data_2BVA
# 
_entry.id   2BVA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2BVA         
PDBE  EBI-24619    
WWPDB D_1290024619 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BVA 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-06-23 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Debreczeni, J.E.'    1  
'Bunkoczi, G.'        2  
'Eswaran, J.'         3  
'Filippakopoulos, P.' 4  
'Das, S.'             5  
'Fedorov, O.'         6  
'Sundstrom, M.'       7  
'Arrowsmith, C.'      8  
'Edwards, A.'         9  
'von Delft, F.'       10 
'Knapp, S.'           11 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structures of the P21-Activated Kinases Pak4, Pak5, and Pak6 Reveal Catalytic Domain Plasticity of Active Group II Paks.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            15 
_citation.page_first                201 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17292838 
_citation.pdbx_database_id_DOI      10.1016/J.STR.2007.01.001 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Eswaran, J.'         1 ? 
primary 'Lee, W.H.'           2 ? 
primary 'Debreczeni, J.E.'    3 ? 
primary 'Filippakopoulos, P.' 4 ? 
primary 'Turnbull, A.'        5 ? 
primary 'Fedorov, O.'         6 ? 
primary 'Deacon, S.W.'        7 ? 
primary 'Peterson, J.R.'      8 ? 
primary 'Knapp, S.'           9 ? 
# 
_cell.entry_id           2BVA 
_cell.length_a           118.110 
_cell.length_b           118.110 
_cell.length_c           55.530 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BVA 
_symmetry.space_group_name_H-M             'P 32' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                145 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'P21-ACTIVATED KINASE 4' 33011.371 2  2.7.1.37 ? 'KINASE DOMAIN, RESIDUES 300-591' 
'PHOSPHORYLATION ON SER 474 A AND SER 474 B' 
2 water   nat water                    18.015    36 ?        ? ?                                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVV
EMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF
GFCAQVSKEVPRRK(SEP)LVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRL
KNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVV
EMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDF
GFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLH
KVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   HIS n 
1 3   GLU n 
1 4   GLN n 
1 5   PHE n 
1 6   ARG n 
1 7   ALA n 
1 8   ALA n 
1 9   LEU n 
1 10  GLN n 
1 11  LEU n 
1 12  VAL n 
1 13  VAL n 
1 14  ASP n 
1 15  PRO n 
1 16  GLY n 
1 17  ASP n 
1 18  PRO n 
1 19  ARG n 
1 20  SER n 
1 21  TYR n 
1 22  LEU n 
1 23  ASP n 
1 24  ASN n 
1 25  PHE n 
1 26  ILE n 
1 27  LYS n 
1 28  ILE n 
1 29  GLY n 
1 30  GLU n 
1 31  GLY n 
1 32  SER n 
1 33  THR n 
1 34  GLY n 
1 35  ILE n 
1 36  VAL n 
1 37  CYS n 
1 38  ILE n 
1 39  ALA n 
1 40  THR n 
1 41  VAL n 
1 42  ARG n 
1 43  SER n 
1 44  SER n 
1 45  GLY n 
1 46  LYS n 
1 47  LEU n 
1 48  VAL n 
1 49  ALA n 
1 50  VAL n 
1 51  LYS n 
1 52  LYS n 
1 53  MET n 
1 54  ASP n 
1 55  LEU n 
1 56  ARG n 
1 57  LYS n 
1 58  GLN n 
1 59  GLN n 
1 60  ARG n 
1 61  ARG n 
1 62  GLU n 
1 63  LEU n 
1 64  LEU n 
1 65  PHE n 
1 66  ASN n 
1 67  GLU n 
1 68  VAL n 
1 69  VAL n 
1 70  ILE n 
1 71  MET n 
1 72  ARG n 
1 73  ASP n 
1 74  TYR n 
1 75  GLN n 
1 76  HIS n 
1 77  GLU n 
1 78  ASN n 
1 79  VAL n 
1 80  VAL n 
1 81  GLU n 
1 82  MET n 
1 83  TYR n 
1 84  ASN n 
1 85  SER n 
1 86  TYR n 
1 87  LEU n 
1 88  VAL n 
1 89  GLY n 
1 90  ASP n 
1 91  GLU n 
1 92  LEU n 
1 93  TRP n 
1 94  VAL n 
1 95  VAL n 
1 96  MET n 
1 97  GLU n 
1 98  PHE n 
1 99  LEU n 
1 100 GLU n 
1 101 GLY n 
1 102 GLY n 
1 103 ALA n 
1 104 LEU n 
1 105 THR n 
1 106 ASP n 
1 107 ILE n 
1 108 VAL n 
1 109 THR n 
1 110 HIS n 
1 111 THR n 
1 112 ARG n 
1 113 MET n 
1 114 ASN n 
1 115 GLU n 
1 116 GLU n 
1 117 GLN n 
1 118 ILE n 
1 119 ALA n 
1 120 ALA n 
1 121 VAL n 
1 122 CYS n 
1 123 LEU n 
1 124 ALA n 
1 125 VAL n 
1 126 LEU n 
1 127 GLN n 
1 128 ALA n 
1 129 LEU n 
1 130 SER n 
1 131 VAL n 
1 132 LEU n 
1 133 HIS n 
1 134 ALA n 
1 135 GLN n 
1 136 GLY n 
1 137 VAL n 
1 138 ILE n 
1 139 HIS n 
1 140 ARG n 
1 141 ASP n 
1 142 ILE n 
1 143 LYS n 
1 144 SER n 
1 145 ASP n 
1 146 SER n 
1 147 ILE n 
1 148 LEU n 
1 149 LEU n 
1 150 THR n 
1 151 HIS n 
1 152 ASP n 
1 153 GLY n 
1 154 ARG n 
1 155 VAL n 
1 156 LYS n 
1 157 LEU n 
1 158 SER n 
1 159 ASP n 
1 160 PHE n 
1 161 GLY n 
1 162 PHE n 
1 163 CYS n 
1 164 ALA n 
1 165 GLN n 
1 166 VAL n 
1 167 SER n 
1 168 LYS n 
1 169 GLU n 
1 170 VAL n 
1 171 PRO n 
1 172 ARG n 
1 173 ARG n 
1 174 LYS n 
1 175 SEP n 
1 176 LEU n 
1 177 VAL n 
1 178 GLY n 
1 179 THR n 
1 180 PRO n 
1 181 TYR n 
1 182 TRP n 
1 183 MET n 
1 184 ALA n 
1 185 PRO n 
1 186 GLU n 
1 187 LEU n 
1 188 ILE n 
1 189 SER n 
1 190 ARG n 
1 191 LEU n 
1 192 PRO n 
1 193 TYR n 
1 194 GLY n 
1 195 PRO n 
1 196 GLU n 
1 197 VAL n 
1 198 ASP n 
1 199 ILE n 
1 200 TRP n 
1 201 SER n 
1 202 LEU n 
1 203 GLY n 
1 204 ILE n 
1 205 MET n 
1 206 VAL n 
1 207 ILE n 
1 208 GLU n 
1 209 MET n 
1 210 VAL n 
1 211 ASP n 
1 212 GLY n 
1 213 GLU n 
1 214 PRO n 
1 215 PRO n 
1 216 TYR n 
1 217 PHE n 
1 218 ASN n 
1 219 GLU n 
1 220 PRO n 
1 221 PRO n 
1 222 LEU n 
1 223 LYS n 
1 224 ALA n 
1 225 MET n 
1 226 LYS n 
1 227 MET n 
1 228 ILE n 
1 229 ARG n 
1 230 ASP n 
1 231 ASN n 
1 232 LEU n 
1 233 PRO n 
1 234 PRO n 
1 235 ARG n 
1 236 LEU n 
1 237 LYS n 
1 238 ASN n 
1 239 LEU n 
1 240 HIS n 
1 241 LYS n 
1 242 VAL n 
1 243 SER n 
1 244 PRO n 
1 245 SER n 
1 246 LEU n 
1 247 LYS n 
1 248 GLY n 
1 249 PHE n 
1 250 LEU n 
1 251 ASP n 
1 252 ARG n 
1 253 LEU n 
1 254 LEU n 
1 255 VAL n 
1 256 ARG n 
1 257 ASP n 
1 258 PRO n 
1 259 ALA n 
1 260 GLN n 
1 261 ARG n 
1 262 ALA n 
1 263 THR n 
1 264 ALA n 
1 265 ALA n 
1 266 GLU n 
1 267 LEU n 
1 268 LEU n 
1 269 LYS n 
1 270 HIS n 
1 271 PRO n 
1 272 PHE n 
1 273 LEU n 
1 274 ALA n 
1 275 LYS n 
1 276 ALA n 
1 277 GLY n 
1 278 PRO n 
1 279 PRO n 
1 280 ALA n 
1 281 SER n 
1 282 ILE n 
1 283 VAL n 
1 284 PRO n 
1 285 LEU n 
1 286 MET n 
1 287 ARG n 
1 288 GLN n 
1 289 ASN n 
1 290 ARG n 
1 291 THR n 
1 292 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'R (PHAGE RESISTANT)' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PGEX6B 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX6B-C001 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8NCH5_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q8NCH5 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2BVA A 1 ? 292 ? Q8NCH5 300 ? 591 ? 300 591 
2 1 2BVA B 1 ? 292 ? Q8NCH5 300 ? 591 ? 300 591 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2BVA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3 
_exptl_crystal.density_percent_sol   59 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'SITTING DROPS, 1.5 M NACL, 10% ETHANOL' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-04-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.968 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.968 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2BVA 
_reflns.observed_criterion_sigma_I   3.500 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.400 
_reflns.d_resolution_high            2.300 
_reflns.number_obs                   38417 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.8600 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.700 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.40 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.28000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.550 
_reflns_shell.pdbx_redundancy        2.70 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2BVA 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     38368 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20 
_refine.ls_d_res_high                            2.3 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_obs                          0.1878 
_refine.ls_R_factor_all                          0.1917 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.2686 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.5 
_refine.ls_number_reflns_R_free                  1721 
_refine.ls_number_parameters                     17176 
_refine.ls_number_restraints                     22479 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  
;1. HYDROGENS WERE ADDED ON RIDING POSITIONS 2. TWIN REFINEMENT: PERFECT MEROHEDRAL TWIN, APPARENT SPACEGROUP P3221, REAL SPACEGROUP P32, TWIN LAW: 010 100 00-1, BASF: 0.5006 3. NCS RESTRAINTS WERE USED
;
_refine.pdbx_starting_model                      'PDB ENTRY 1U5R' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER BASED ON HIC-UP ENTRY' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'THIN SHELLS' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2BVA 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      0 
_refine_analyze.occupancy_sum_hydrogen          13065 
_refine_analyze.occupancy_sum_non_hydrogen      12879 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4251 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             36 
_refine_hist.number_atoms_total               4287 
_refine_hist.d_res_high                       2.3 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.023 ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.078 ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.397 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.036 ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.049 ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.044 ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    2BVA 
_pdbx_refine.R_factor_all_no_cutoff                      0.1917 
_pdbx_refine.R_factor_obs_no_cutoff                      0.1878 
_pdbx_refine.free_R_factor_no_cutoff                     0.2686 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     4.5 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            1721 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.1847 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1807 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.2630 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   4.5 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          1670 
_pdbx_refine.number_reflns_obs_4sig_cutoff               36828 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.499720 
_struct_ncs_oper.matrix[1][2]   -0.866160 
_struct_ncs_oper.matrix[1][3]   -0.006760 
_struct_ncs_oper.matrix[2][1]   -0.866080 
_struct_ncs_oper.matrix[2][2]   0.499770 
_struct_ncs_oper.matrix[2][3]   -0.011460 
_struct_ncs_oper.matrix[3][1]   0.013300 
_struct_ncs_oper.matrix[3][2]   0.000130 
_struct_ncs_oper.matrix[3][3]   -0.999910 
_struct_ncs_oper.vector[1]      -0.37658 
_struct_ncs_oper.vector[2]      -0.01682 
_struct_ncs_oper.vector[3]      -18.42605 
# 
_struct.entry_id                  2BVA 
_struct.title                     'Crystal structure of the human P21-activated kinase 4' 
_struct.pdbx_descriptor           'P21-ACTIVATED KINASE 4 (E.C.2.7.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BVA 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'PROTEIN KINASE, STE20, PAK4, ATP-BINDING, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 6   ? LEU A 11  ? ARG A 305 LEU A 310 1 ? 6  
HELX_P HELX_P2  2  LEU A 64  ? ASP A 73  ? LEU A 363 ASP A 372 1 ? 10 
HELX_P HELX_P3  3  LEU A 104 ? THR A 109 ? LEU A 403 THR A 408 1 ? 6  
HELX_P HELX_P4  4  ASN A 114 ? GLN A 135 ? ASN A 413 GLN A 434 1 ? 22 
HELX_P HELX_P5  5  LYS A 143 ? ASP A 145 ? LYS A 442 ASP A 444 5 ? 3  
HELX_P HELX_P6  6  THR A 179 ? MET A 183 ? THR A 478 MET A 482 5 ? 5  
HELX_P HELX_P7  7  ALA A 184 ? SER A 189 ? ALA A 483 SER A 488 1 ? 6  
HELX_P HELX_P8  8  PRO A 195 ? ASP A 211 ? PRO A 494 ASP A 510 1 ? 17 
HELX_P HELX_P9  9  PRO A 220 ? ASP A 230 ? PRO A 519 ASP A 529 1 ? 11 
HELX_P HELX_P10 10 SER A 243 ? LEU A 254 ? SER A 542 LEU A 553 1 ? 12 
HELX_P HELX_P11 11 ASP A 257 ? ARG A 261 ? ASP A 556 ARG A 560 5 ? 5  
HELX_P HELX_P12 12 THR A 263 ? LEU A 268 ? THR A 562 LEU A 567 1 ? 6  
HELX_P HELX_P13 13 LYS A 269 ? ALA A 276 ? LYS A 568 ALA A 575 5 ? 8  
HELX_P HELX_P14 14 PRO A 278 ? ARG A 287 ? PRO A 577 ARG A 586 1 ? 10 
HELX_P HELX_P15 15 HIS B 2   ? GLN B 10  ? HIS B 301 GLN B 309 1 ? 9  
HELX_P HELX_P16 16 LEU B 63  ? ARG B 72  ? LEU B 362 ARG B 371 1 ? 10 
HELX_P HELX_P17 17 ALA B 103 ? THR B 111 ? ALA B 402 THR B 410 1 ? 9  
HELX_P HELX_P18 18 ASN B 114 ? GLN B 135 ? ASN B 413 GLN B 434 1 ? 22 
HELX_P HELX_P19 19 LYS B 143 ? ASP B 145 ? LYS B 442 ASP B 444 5 ? 3  
HELX_P HELX_P20 20 THR B 179 ? MET B 183 ? THR B 478 MET B 482 5 ? 5  
HELX_P HELX_P21 21 ALA B 184 ? SER B 189 ? ALA B 483 SER B 488 1 ? 6  
HELX_P HELX_P22 22 GLU B 196 ? GLY B 212 ? GLU B 495 GLY B 511 1 ? 17 
HELX_P HELX_P23 23 PRO B 220 ? ASP B 230 ? PRO B 519 ASP B 529 1 ? 11 
HELX_P HELX_P24 24 SER B 243 ? ASP B 251 ? SER B 542 ASP B 550 1 ? 9  
HELX_P HELX_P25 25 THR B 263 ? LYS B 269 ? THR B 562 LYS B 568 1 ? 7  
HELX_P HELX_P26 26 HIS B 270 ? LYS B 275 ? HIS B 569 LYS B 574 5 ? 6  
HELX_P HELX_P27 27 PRO B 278 ? SER B 281 ? PRO B 577 SER B 580 5 ? 4  
HELX_P HELX_P28 28 ILE B 282 ? ARG B 287 ? ILE B 581 ARG B 586 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A LYS 174 C ? ? ? 1_555 A SEP 175 N ? ? A LYS 473 A SEP 474 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale2 covale both ? A SEP 175 C ? ? ? 1_555 A LEU 176 N ? ? A SEP 474 A LEU 475 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale3 covale both ? B LYS 174 C ? ? ? 1_555 B SEP 175 N ? ? B LYS 473 B SEP 474 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale4 covale both ? B SEP 175 C ? ? ? 1_555 B LEU 176 N ? ? B SEP 474 B LEU 475 1_555 ? ? ? ? ? ? ? 1.327 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
AB ? 2 ? 
BA ? 4 ? 
BB ? 2 ? 
BC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 MET A 82  ? LEU A 87  ? MET A 381 LEU A 386 
AA 2 LEU A 92  ? MET A 96  ? LEU A 391 MET A 395 
AB 1 ILE A 147 ? LEU A 149 ? ILE A 446 LEU A 448 
AB 2 VAL A 155 ? LEU A 157 ? VAL A 454 LEU A 456 
BA 1 ALA B 39  ? THR B 40  ? ALA B 338 THR B 339 
BA 2 LEU B 47  ? VAL B 50  ? LEU B 346 VAL B 349 
BA 3 LEU B 92  ? MET B 96  ? LEU B 391 MET B 395 
BA 4 MET B 82  ? LEU B 87  ? MET B 381 LEU B 386 
BB 1 VAL B 137 ? ILE B 138 ? VAL B 436 ILE B 437 
BB 2 ALA B 164 ? GLN B 165 ? ALA B 463 GLN B 464 
BC 1 ILE B 147 ? LEU B 149 ? ILE B 446 LEU B 448 
BC 2 VAL B 155 ? LEU B 157 ? VAL B 454 LEU B 456 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N TYR A 86  ? N TYR A 385 O TRP A 93  ? O TRP A 392 
AB 1 2 N LEU A 148 ? N LEU A 447 O LYS A 156 ? O LYS A 455 
BA 1 2 O ALA B 39  ? O ALA B 338 N VAL B 48  ? N VAL B 347 
BA 2 3 N ALA B 49  ? N ALA B 348 O MET B 96  ? O MET B 395 
BA 3 4 O VAL B 95  ? O VAL B 394 N TYR B 83  ? N TYR B 382 
BB 1 2 N ILE B 138 ? N ILE B 437 O ALA B 164 ? O ALA B 463 
BC 1 2 N LEU B 148 ? N LEU B 447 O LYS B 156 ? O LYS B 455 
# 
_database_PDB_matrix.entry_id          2BVA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BVA 
_atom_sites.fract_transf_matrix[1][1]   0.008467 
_atom_sites.fract_transf_matrix[1][2]   0.004888 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009776 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018008 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? -8.269  57.932 -20.889 1.00 41.49 ? 300  SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? -9.662  58.222 -21.162 1.00 41.15 ? 300  SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? -10.037 58.033 -22.641 1.00 41.16 ? 300  SER A C   1 
ATOM   4    O O   . SER A 1 1   ? -9.194  58.324 -23.482 1.00 44.65 ? 300  SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? -9.976  59.697 -20.909 1.00 41.30 ? 300  SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? -9.963  60.392 -22.154 1.00 41.59 ? 300  SER A OG  1 
ATOM   7    N N   . HIS A 1 2   ? -11.245 57.596 -22.874 1.00 39.94 ? 301  HIS A N   1 
ATOM   8    C CA  . HIS A 1 2   ? -11.826 57.314 -24.152 1.00 38.76 ? 301  HIS A CA  1 
ATOM   9    C C   . HIS A 1 2   ? -13.172 56.597 -23.931 1.00 38.69 ? 301  HIS A C   1 
ATOM   10   O O   . HIS A 1 2   ? -13.303 55.850 -22.967 1.00 41.87 ? 301  HIS A O   1 
ATOM   11   C CB  . HIS A 1 2   ? -10.962 56.457 -25.079 1.00 38.54 ? 301  HIS A CB  1 
ATOM   12   C CG  . HIS A 1 2   ? -10.426 57.228 -26.250 1.00 38.57 ? 301  HIS A CG  1 
ATOM   13   N ND1 . HIS A 1 2   ? -9.690  56.650 -27.258 1.00 39.42 ? 301  HIS A ND1 1 
ATOM   14   C CD2 . HIS A 1 2   ? -10.516 58.535 -26.583 1.00 38.58 ? 301  HIS A CD2 1 
ATOM   15   C CE1 . HIS A 1 2   ? -9.348  57.556 -28.157 1.00 38.90 ? 301  HIS A CE1 1 
ATOM   16   N NE2 . HIS A 1 2   ? -9.844  58.718 -27.768 1.00 38.65 ? 301  HIS A NE2 1 
ATOM   17   N N   . GLU A 1 3   ? -14.107 56.867 -24.819 1.00 37.22 ? 302  GLU A N   1 
ATOM   18   C CA  . GLU A 1 3   ? -15.484 56.423 -24.709 1.00 36.23 ? 302  GLU A CA  1 
ATOM   19   C C   . GLU A 1 3   ? -15.697 55.059 -25.362 1.00 36.93 ? 302  GLU A C   1 
ATOM   20   O O   . GLU A 1 3   ? -16.820 54.567 -25.451 1.00 33.41 ? 302  GLU A O   1 
ATOM   21   C CB  . GLU A 1 3   ? -16.394 57.497 -25.318 1.00 34.80 ? 302  GLU A CB  1 
ATOM   22   C CG  . GLU A 1 3   ? -16.445 58.759 -24.462 1.00 33.70 ? 302  GLU A CG  1 
ATOM   23   C CD  . GLU A 1 3   ? -15.289 59.709 -24.686 1.00 32.79 ? 302  GLU A CD  1 
ATOM   24   O OE1 . GLU A 1 3   ? -15.336 60.481 -25.673 1.00 34.26 ? 302  GLU A OE1 1 
ATOM   25   O OE2 . GLU A 1 3   ? -14.329 59.706 -23.887 1.00 27.54 ? 302  GLU A OE2 1 
ATOM   26   N N   . GLN A 1 4   ? -14.602 54.459 -25.802 1.00 39.10 ? 303  GLN A N   1 
ATOM   27   C CA  . GLN A 1 4   ? -14.574 53.098 -26.303 1.00 40.84 ? 303  GLN A CA  1 
ATOM   28   C C   . GLN A 1 4   ? -14.029 52.186 -25.198 1.00 42.48 ? 303  GLN A C   1 
ATOM   29   O O   . GLN A 1 4   ? -14.486 51.063 -25.019 1.00 43.82 ? 303  GLN A O   1 
ATOM   30   C CB  . GLN A 1 4   ? -13.724 52.989 -27.565 1.00 40.57 ? 303  GLN A CB  1 
ATOM   31   C CG  . GLN A 1 4   ? -12.234 52.808 -27.317 1.00 41.23 ? 303  GLN A CG  1 
ATOM   32   N N   . PHE A 1 5   ? -13.055 52.712 -24.463 1.00 43.08 ? 304  PHE A N   1 
ATOM   33   C CA  . PHE A 1 5   ? -12.490 52.039 -23.304 1.00 42.76 ? 304  PHE A CA  1 
ATOM   34   C C   . PHE A 1 5   ? -13.500 52.131 -22.155 1.00 40.43 ? 304  PHE A C   1 
ATOM   35   O O   . PHE A 1 5   ? -13.386 51.440 -21.145 1.00 43.96 ? 304  PHE A O   1 
ATOM   36   C CB  . PHE A 1 5   ? -11.150 52.648 -22.912 1.00 44.46 ? 304  PHE A CB  1 
ATOM   37   C CG  . PHE A 1 5   ? -11.018 53.073 -21.461 1.00 46.69 ? 304  PHE A CG  1 
ATOM   38   C CD1 . PHE A 1 5   ? -10.579 52.178 -20.498 1.00 47.59 ? 304  PHE A CD1 1 
ATOM   39   C CD2 . PHE A 1 5   ? -11.329 54.366 -21.071 1.00 47.92 ? 304  PHE A CD2 1 
ATOM   40   C CE1 . PHE A 1 5   ? -10.448 52.567 -19.178 1.00 48.41 ? 304  PHE A CE1 1 
ATOM   41   C CE2 . PHE A 1 5   ? -11.198 54.765 -19.755 1.00 48.40 ? 304  PHE A CE2 1 
ATOM   42   C CZ  . PHE A 1 5   ? -10.755 53.863 -18.805 1.00 48.81 ? 304  PHE A CZ  1 
ATOM   43   N N   . ARG A 1 6   ? -14.484 52.993 -22.350 1.00 37.93 ? 305  ARG A N   1 
ATOM   44   C CA  . ARG A 1 6   ? -15.616 53.131 -21.442 1.00 35.76 ? 305  ARG A CA  1 
ATOM   45   C C   . ARG A 1 6   ? -16.787 52.339 -22.016 1.00 33.90 ? 305  ARG A C   1 
ATOM   46   O O   . ARG A 1 6   ? -17.922 52.401 -21.550 1.00 31.18 ? 305  ARG A O   1 
ATOM   47   C CB  . ARG A 1 6   ? -15.924 54.608 -21.254 1.00 35.40 ? 305  ARG A CB  1 
ATOM   48   C CG  . ARG A 1 6   ? -17.285 54.996 -20.714 1.00 35.09 ? 305  ARG A CG  1 
ATOM   49   C CD  . ARG A 1 6   ? -17.724 56.353 -21.249 1.00 33.64 ? 305  ARG A CD  1 
ATOM   50   N NE  . ARG A 1 6   ? -19.150 56.579 -21.066 1.00 33.16 ? 305  ARG A NE  1 
ATOM   51   C CZ  . ARG A 1 6   ? -19.746 57.132 -20.018 1.00 31.84 ? 305  ARG A CZ  1 
ATOM   52   N NH1 . ARG A 1 6   ? -19.049 57.555 -18.975 1.00 27.68 ? 305  ARG A NH1 1 
ATOM   53   N NH2 . ARG A 1 6   ? -21.064 57.260 -20.014 1.00 28.79 ? 305  ARG A NH2 1 
ATOM   54   N N   . ALA A 1 7   ? -16.488 51.571 -23.072 1.00 33.06 ? 306  ALA A N   1 
ATOM   55   C CA  . ALA A 1 7   ? -17.512 50.736 -23.697 1.00 32.26 ? 306  ALA A CA  1 
ATOM   56   C C   . ALA A 1 7   ? -17.600 49.412 -22.935 1.00 32.22 ? 306  ALA A C   1 
ATOM   57   O O   . ALA A 1 7   ? -18.690 48.941 -22.629 1.00 29.84 ? 306  ALA A O   1 
ATOM   58   C CB  . ALA A 1 7   ? -17.226 50.504 -25.165 1.00 30.45 ? 306  ALA A CB  1 
ATOM   59   N N   . ALA A 1 8   ? -16.438 48.854 -22.626 1.00 33.06 ? 307  ALA A N   1 
ATOM   60   C CA  . ALA A 1 8   ? -16.326 47.674 -21.793 1.00 34.29 ? 307  ALA A CA  1 
ATOM   61   C C   . ALA A 1 8   ? -16.406 48.041 -20.310 1.00 34.60 ? 307  ALA A C   1 
ATOM   62   O O   . ALA A 1 8   ? -16.046 47.220 -19.466 1.00 35.05 ? 307  ALA A O   1 
ATOM   63   C CB  . ALA A 1 8   ? -15.023 46.933 -22.055 1.00 36.41 ? 307  ALA A CB  1 
ATOM   64   N N   . LEU A 1 9   ? -16.861 49.249 -20.033 1.00 34.47 ? 308  LEU A N   1 
ATOM   65   C CA  . LEU A 1 9   ? -17.013 49.761 -18.685 1.00 35.42 ? 308  LEU A CA  1 
ATOM   66   C C   . LEU A 1 9   ? -18.470 49.659 -18.220 1.00 37.05 ? 308  LEU A C   1 
ATOM   67   O O   . LEU A 1 9   ? -18.784 48.883 -17.324 1.00 41.56 ? 308  LEU A O   1 
ATOM   68   C CB  . LEU A 1 9   ? -16.562 51.220 -18.589 1.00 35.02 ? 308  LEU A CB  1 
ATOM   69   C CG  . LEU A 1 9   ? -16.327 51.793 -17.191 1.00 34.62 ? 308  LEU A CG  1 
ATOM   70   C CD1 . LEU A 1 9   ? -15.216 52.837 -17.218 1.00 33.38 ? 308  LEU A CD1 1 
ATOM   71   C CD2 . LEU A 1 9   ? -17.596 52.398 -16.609 1.00 34.13 ? 308  LEU A CD2 1 
ATOM   72   N N   . GLN A 1 10  ? -19.316 50.459 -18.841 1.00 36.32 ? 309  GLN A N   1 
ATOM   73   C CA  . GLN A 1 10  ? -20.713 50.596 -18.486 1.00 34.89 ? 309  GLN A CA  1 
ATOM   74   C C   . GLN A 1 10  ? -21.393 49.250 -18.245 1.00 33.07 ? 309  GLN A C   1 
ATOM   75   O O   . GLN A 1 10  ? -22.094 49.067 -17.249 1.00 29.90 ? 309  GLN A O   1 
ATOM   76   C CB  . GLN A 1 10  ? -21.438 51.340 -19.617 1.00 35.06 ? 309  GLN A CB  1 
ATOM   77   C CG  . GLN A 1 10  ? -22.779 50.726 -19.990 1.00 34.70 ? 309  GLN A CG  1 
ATOM   78   C CD  . GLN A 1 10  ? -23.577 51.668 -20.876 1.00 33.77 ? 309  GLN A CD  1 
ATOM   79   O OE1 . GLN A 1 10  ? -23.249 52.858 -20.911 1.00 33.74 ? 309  GLN A OE1 1 
ATOM   80   N NE2 . GLN A 1 10  ? -24.578 51.134 -21.568 1.00 32.13 ? 309  GLN A NE2 1 
ATOM   81   N N   . LEU A 1 11  ? -21.174 48.332 -19.175 1.00 32.14 ? 310  LEU A N   1 
ATOM   82   C CA  . LEU A 1 11  ? -21.766 47.006 -19.142 1.00 31.22 ? 310  LEU A CA  1 
ATOM   83   C C   . LEU A 1 11  ? -21.596 46.360 -17.766 1.00 30.91 ? 310  LEU A C   1 
ATOM   84   O O   . LEU A 1 11  ? -22.554 45.880 -17.161 1.00 31.62 ? 310  LEU A O   1 
ATOM   85   C CB  . LEU A 1 11  ? -21.157 46.100 -20.211 1.00 30.66 ? 310  LEU A CB  1 
ATOM   86   C CG  . LEU A 1 11  ? -20.488 46.707 -21.440 1.00 30.78 ? 310  LEU A CG  1 
ATOM   87   C CD1 . LEU A 1 11  ? -19.971 45.608 -22.363 1.00 29.49 ? 310  LEU A CD1 1 
ATOM   88   C CD2 . LEU A 1 11  ? -21.428 47.625 -22.198 1.00 33.02 ? 310  LEU A CD2 1 
ATOM   89   N N   . VAL A 1 12  ? -20.360 46.347 -17.277 1.00 30.64 ? 311  VAL A N   1 
ATOM   90   C CA  . VAL A 1 12  ? -20.042 45.686 -16.018 1.00 29.53 ? 311  VAL A CA  1 
ATOM   91   C C   . VAL A 1 12  ? -20.438 46.509 -14.797 1.00 28.49 ? 311  VAL A C   1 
ATOM   92   O O   . VAL A 1 12  ? -19.760 46.423 -13.770 1.00 31.51 ? 311  VAL A O   1 
ATOM   93   C CB  . VAL A 1 12  ? -18.530 45.383 -15.938 1.00 29.16 ? 311  VAL A CB  1 
ATOM   94   C CG1 . VAL A 1 12  ? -18.114 44.439 -17.056 1.00 27.28 ? 311  VAL A CG1 1 
ATOM   95   C CG2 . VAL A 1 12  ? -17.711 46.662 -16.004 1.00 28.02 ? 311  VAL A CG2 1 
ATOM   96   N N   . VAL A 1 13  ? -21.503 47.280 -14.913 1.00 26.21 ? 312  VAL A N   1 
ATOM   97   C CA  . VAL A 1 13  ? -21.916 48.229 -13.890 1.00 23.98 ? 312  VAL A CA  1 
ATOM   98   C C   . VAL A 1 13  ? -23.421 48.273 -13.738 1.00 22.73 ? 312  VAL A C   1 
ATOM   99   O O   . VAL A 1 13  ? -24.160 48.239 -14.726 1.00 27.90 ? 312  VAL A O   1 
ATOM   100  C CB  . VAL A 1 13  ? -21.444 49.657 -14.236 1.00 24.46 ? 312  VAL A CB  1 
ATOM   101  C CG1 . VAL A 1 13  ? -22.397 50.680 -13.630 1.00 27.35 ? 312  VAL A CG1 1 
ATOM   102  C CG2 . VAL A 1 13  ? -20.020 49.887 -13.769 1.00 24.91 ? 312  VAL A CG2 1 
ATOM   103  N N   . ASP A 1 14  ? -23.911 48.356 -12.497 1.00 20.85 ? 313  ASP A N   1 
ATOM   104  C CA  . ASP A 1 14  ? -25.364 48.416 -12.315 1.00 20.15 ? 313  ASP A CA  1 
ATOM   105  C C   . ASP A 1 14  ? -25.876 49.696 -12.960 1.00 20.66 ? 313  ASP A C   1 
ATOM   106  O O   . ASP A 1 14  ? -25.127 50.674 -13.009 1.00 17.24 ? 313  ASP A O   1 
ATOM   107  C CB  . ASP A 1 14  ? -25.845 48.379 -10.871 1.00 18.48 ? 313  ASP A CB  1 
ATOM   108  C CG  . ASP A 1 14  ? -24.812 47.764 -9.952  1.00 17.86 ? 313  ASP A CG  1 
ATOM   109  O OD1 . ASP A 1 14  ? -24.733 48.238 -8.805  1.00 18.34 ? 313  ASP A OD1 1 
ATOM   110  O OD2 . ASP A 1 14  ? -24.115 46.838 -10.415 1.00 16.68 ? 313  ASP A OD2 1 
ATOM   111  N N   . PRO A 1 15  ? -27.100 49.679 -13.450 1.00 22.37 ? 314  PRO A N   1 
ATOM   112  C CA  . PRO A 1 15  ? -27.699 50.918 -13.994 1.00 22.91 ? 314  PRO A CA  1 
ATOM   113  C C   . PRO A 1 15  ? -28.579 51.590 -12.951 1.00 22.90 ? 314  PRO A C   1 
ATOM   114  O O   . PRO A 1 15  ? -28.553 51.221 -11.774 1.00 26.57 ? 314  PRO A O   1 
ATOM   115  C CB  . PRO A 1 15  ? -28.521 50.409 -15.170 1.00 22.97 ? 314  PRO A CB  1 
ATOM   116  C CG  . PRO A 1 15  ? -28.598 48.930 -15.015 1.00 22.87 ? 314  PRO A CG  1 
ATOM   117  C CD  . PRO A 1 15  ? -28.087 48.594 -13.636 1.00 22.07 ? 314  PRO A CD  1 
ATOM   118  N N   . GLY A 1 16  ? -29.348 52.571 -13.395 1.00 22.31 ? 315  GLY A N   1 
ATOM   119  C CA  . GLY A 1 16  ? -30.172 53.383 -12.524 1.00 22.38 ? 315  GLY A CA  1 
ATOM   120  C C   . GLY A 1 16  ? -29.286 54.336 -11.733 1.00 22.18 ? 315  GLY A C   1 
ATOM   121  O O   . GLY A 1 16  ? -28.414 54.962 -12.326 1.00 20.82 ? 315  GLY A O   1 
ATOM   122  N N   . ASP A 1 17  ? -29.518 54.414 -10.434 1.00 22.00 ? 316  ASP A N   1 
ATOM   123  C CA  . ASP A 1 17  ? -28.788 55.336 -9.567  1.00 23.21 ? 316  ASP A CA  1 
ATOM   124  C C   . ASP A 1 17  ? -28.898 54.887 -8.117  1.00 21.92 ? 316  ASP A C   1 
ATOM   125  O O   . ASP A 1 17  ? -29.703 53.997 -7.835  1.00 20.72 ? 316  ASP A O   1 
ATOM   126  C CB  . ASP A 1 17  ? -29.327 56.733 -9.830  1.00 25.62 ? 316  ASP A CB  1 
ATOM   127  C CG  . ASP A 1 17  ? -30.510 57.165 -8.999  1.00 26.46 ? 316  ASP A CG  1 
ATOM   128  O OD1 . ASP A 1 17  ? -31.259 56.320 -8.472  1.00 25.38 ? 316  ASP A OD1 1 
ATOM   129  O OD2 . ASP A 1 17  ? -30.704 58.402 -8.887  1.00 28.15 ? 316  ASP A OD2 1 
ATOM   130  N N   . PRO A 1 18  ? -28.112 55.464 -7.226  1.00 20.39 ? 317  PRO A N   1 
ATOM   131  C CA  . PRO A 1 18  ? -28.208 55.139 -5.797  1.00 20.73 ? 317  PRO A CA  1 
ATOM   132  C C   . PRO A 1 18  ? -29.259 55.957 -5.062  1.00 22.61 ? 317  PRO A C   1 
ATOM   133  O O   . PRO A 1 18  ? -29.897 55.491 -4.116  1.00 16.46 ? 317  PRO A O   1 
ATOM   134  C CB  . PRO A 1 18  ? -26.825 55.542 -5.270  1.00 20.09 ? 317  PRO A CB  1 
ATOM   135  C CG  . PRO A 1 18  ? -26.437 56.698 -6.137  1.00 19.79 ? 317  PRO A CG  1 
ATOM   136  C CD  . PRO A 1 18  ? -27.041 56.440 -7.488  1.00 19.21 ? 317  PRO A CD  1 
ATOM   137  N N   . ARG A 1 19  ? -29.435 57.203 -5.492  1.00 27.02 ? 318  ARG A N   1 
ATOM   138  C CA  . ARG A 1 19  ? -30.401 58.093 -4.878  1.00 31.29 ? 318  ARG A CA  1 
ATOM   139  C C   . ARG A 1 19  ? -31.836 57.762 -5.316  1.00 33.93 ? 318  ARG A C   1 
ATOM   140  O O   . ARG A 1 19  ? -32.572 58.656 -5.729  1.00 38.11 ? 318  ARG A O   1 
ATOM   141  C CB  . ARG A 1 19  ? -30.090 59.555 -5.190  1.00 32.72 ? 318  ARG A CB  1 
ATOM   142  C CG  . ARG A 1 19  ? -29.997 59.925 -6.654  1.00 33.17 ? 318  ARG A CG  1 
ATOM   143  C CD  . ARG A 1 19  ? -31.286 60.533 -7.174  1.00 34.24 ? 318  ARG A CD  1 
ATOM   144  N NE  . ARG A 1 19  ? -31.213 61.981 -7.338  1.00 34.76 ? 318  ARG A NE  1 
ATOM   145  C CZ  . ARG A 1 19  ? -32.229 62.827 -7.252  1.00 34.89 ? 318  ARG A CZ  1 
ATOM   146  N NH1 . ARG A 1 19  ? -33.468 62.420 -6.996  1.00 31.96 ? 318  ARG A NH1 1 
ATOM   147  N NH2 . ARG A 1 19  ? -32.000 64.124 -7.429  1.00 36.22 ? 318  ARG A NH2 1 
ATOM   148  N N   . SER A 1 20  ? -32.197 56.502 -5.191  1.00 34.86 ? 319  SER A N   1 
ATOM   149  C CA  . SER A 1 20  ? -33.560 56.015 -5.189  1.00 33.62 ? 319  SER A CA  1 
ATOM   150  C C   . SER A 1 20  ? -33.997 55.502 -3.798  1.00 34.37 ? 319  SER A C   1 
ATOM   151  O O   . SER A 1 20  ? -35.177 55.602 -3.467  1.00 34.72 ? 319  SER A O   1 
ATOM   152  C CB  . SER A 1 20  ? -33.738 54.874 -6.197  1.00 31.81 ? 319  SER A CB  1 
ATOM   153  O OG  . SER A 1 20  ? -32.606 54.012 -6.143  1.00 27.07 ? 319  SER A OG  1 
ATOM   154  N N   . TYR A 1 21  ? -33.062 54.960 -3.069  1.00 33.57 ? 320  TYR A N   1 
ATOM   155  C CA  . TYR A 1 21  ? -33.099 54.522 -1.709  1.00 32.17 ? 320  TYR A CA  1 
ATOM   156  C C   . TYR A 1 21  ? -32.247 55.456 -0.829  1.00 29.21 ? 320  TYR A C   1 
ATOM   157  O O   . TYR A 1 21  ? -32.634 55.804 0.289   1.00 27.56 ? 320  TYR A O   1 
ATOM   158  C CB  . TYR A 1 21  ? -32.578 53.089 -1.618  1.00 33.93 ? 320  TYR A CB  1 
ATOM   159  C CG  . TYR A 1 21  ? -33.498 52.016 -1.102  1.00 36.58 ? 320  TYR A CG  1 
ATOM   160  C CD1 . TYR A 1 21  ? -33.193 51.332 0.077   1.00 37.57 ? 320  TYR A CD1 1 
ATOM   161  C CD2 . TYR A 1 21  ? -34.665 51.643 -1.753  1.00 37.30 ? 320  TYR A CD2 1 
ATOM   162  C CE1 . TYR A 1 21  ? -34.003 50.340 0.588   1.00 37.50 ? 320  TYR A CE1 1 
ATOM   163  C CE2 . TYR A 1 21  ? -35.486 50.648 -1.251  1.00 37.30 ? 320  TYR A CE2 1 
ATOM   164  C CZ  . TYR A 1 21  ? -35.159 49.998 -0.083  1.00 37.62 ? 320  TYR A CZ  1 
ATOM   165  O OH  . TYR A 1 21  ? -35.972 49.006 0.427   1.00 38.73 ? 320  TYR A OH  1 
ATOM   166  N N   . LEU A 1 22  ? -31.099 55.846 -1.358  1.00 26.25 ? 321  LEU A N   1 
ATOM   167  C CA  . LEU A 1 22  ? -30.145 56.715 -0.702  1.00 25.46 ? 321  LEU A CA  1 
ATOM   168  C C   . LEU A 1 22  ? -30.371 58.181 -0.997  1.00 26.62 ? 321  LEU A C   1 
ATOM   169  O O   . LEU A 1 22  ? -30.738 58.558 -2.114  1.00 32.63 ? 321  LEU A O   1 
ATOM   170  C CB  . LEU A 1 22  ? -28.736 56.321 -1.179  1.00 24.14 ? 321  LEU A CB  1 
ATOM   171  C CG  . LEU A 1 22  ? -28.437 54.820 -1.091  1.00 23.58 ? 321  LEU A CG  1 
ATOM   172  C CD1 . LEU A 1 22  ? -27.870 54.301 -2.402  1.00 22.80 ? 321  LEU A CD1 1 
ATOM   173  C CD2 . LEU A 1 22  ? -27.502 54.540 0.079   1.00 21.57 ? 321  LEU A CD2 1 
ATOM   174  N N   . ASP A 1 23  ? -30.164 59.052 0.001   1.00 25.52 ? 322  ASP A N   1 
ATOM   175  C CA  . ASP A 1 23  ? -30.630 60.434 -0.177  1.00 25.64 ? 322  ASP A CA  1 
ATOM   176  C C   . ASP A 1 23  ? -29.841 61.515 0.535   1.00 27.15 ? 322  ASP A C   1 
ATOM   177  O O   . ASP A 1 23  ? -29.410 62.466 -0.132  1.00 28.43 ? 322  ASP A O   1 
ATOM   178  C CB  . ASP A 1 23  ? -32.109 60.524 0.234   1.00 23.87 ? 322  ASP A CB  1 
ATOM   179  C CG  . ASP A 1 23  ? -32.630 59.455 1.161   1.00 21.23 ? 322  ASP A CG  1 
ATOM   180  O OD1 . ASP A 1 23  ? -31.873 58.671 1.763   1.00 11.88 ? 322  ASP A OD1 1 
ATOM   181  O OD2 . ASP A 1 23  ? -33.874 59.380 1.329   1.00 19.72 ? 322  ASP A OD2 1 
ATOM   182  N N   . ASN A 1 24  ? -29.673 61.420 1.841   1.00 28.68 ? 323  ASN A N   1 
ATOM   183  C CA  . ASN A 1 24  ? -29.163 62.532 2.639   1.00 30.32 ? 323  ASN A CA  1 
ATOM   184  C C   . ASN A 1 24  ? -27.664 62.772 2.474   1.00 30.94 ? 323  ASN A C   1 
ATOM   185  O O   . ASN A 1 24  ? -26.904 62.702 3.445   1.00 30.23 ? 323  ASN A O   1 
ATOM   186  C CB  . ASN A 1 24  ? -29.473 62.303 4.122   1.00 31.28 ? 323  ASN A CB  1 
ATOM   187  C CG  . ASN A 1 24  ? -30.734 63.024 4.552   1.00 32.27 ? 323  ASN A CG  1 
ATOM   188  O OD1 . ASN A 1 24  ? -31.571 63.361 3.713   1.00 33.76 ? 323  ASN A OD1 1 
ATOM   189  N ND2 . ASN A 1 24  ? -30.860 63.252 5.855   1.00 34.89 ? 323  ASN A ND2 1 
ATOM   190  N N   . PHE A 1 25  ? -27.253 63.062 1.248   1.00 31.76 ? 324  PHE A N   1 
ATOM   191  C CA  . PHE A 1 25  ? -25.853 63.256 0.912   1.00 31.64 ? 324  PHE A CA  1 
ATOM   192  C C   . PHE A 1 25  ? -25.245 64.451 1.639   1.00 31.61 ? 324  PHE A C   1 
ATOM   193  O O   . PHE A 1 25  ? -25.957 65.311 2.161   1.00 34.76 ? 324  PHE A O   1 
ATOM   194  C CB  . PHE A 1 25  ? -25.703 63.435 -0.604  1.00 31.59 ? 324  PHE A CB  1 
ATOM   195  C CG  . PHE A 1 25  ? -25.752 62.133 -1.391  1.00 31.62 ? 324  PHE A CG  1 
ATOM   196  C CD1 . PHE A 1 25  ? -24.594 61.578 -1.914  1.00 32.31 ? 324  PHE A CD1 1 
ATOM   197  C CD2 . PHE A 1 25  ? -26.945 61.468 -1.605  1.00 30.71 ? 324  PHE A CD2 1 
ATOM   198  C CE1 . PHE A 1 25  ? -24.619 60.390 -2.625  1.00 31.66 ? 324  PHE A CE1 1 
ATOM   199  C CE2 . PHE A 1 25  ? -26.976 60.279 -2.313  1.00 30.63 ? 324  PHE A CE2 1 
ATOM   200  C CZ  . PHE A 1 25  ? -25.817 59.729 -2.827  1.00 30.58 ? 324  PHE A CZ  1 
ATOM   201  N N   . ILE A 1 26  ? -23.918 64.502 1.663   1.00 30.47 ? 325  ILE A N   1 
ATOM   202  C CA  . ILE A 1 26  ? -23.185 65.647 2.170   1.00 29.35 ? 325  ILE A CA  1 
ATOM   203  C C   . ILE A 1 26  ? -21.737 65.519 1.722   1.00 28.81 ? 325  ILE A C   1 
ATOM   204  O O   . ILE A 1 26  ? -21.114 64.478 1.942   1.00 32.92 ? 325  ILE A O   1 
ATOM   205  C CB  . ILE A 1 26  ? -23.199 65.764 3.702   1.00 29.99 ? 325  ILE A CB  1 
ATOM   206  C CG1 . ILE A 1 26  ? -24.537 66.134 4.337   1.00 30.27 ? 325  ILE A CG1 1 
ATOM   207  C CG2 . ILE A 1 26  ? -22.117 66.746 4.150   1.00 32.33 ? 325  ILE A CG2 1 
ATOM   208  C CD1 . ILE A 1 26  ? -24.375 66.872 5.646   1.00 32.14 ? 325  ILE A CD1 1 
ATOM   209  N N   . LYS A 1 27  ? -21.194 66.567 1.098   1.00 26.69 ? 326  LYS A N   1 
ATOM   210  C CA  . LYS A 1 27  ? -19.749 66.517 0.786   1.00 24.31 ? 326  LYS A CA  1 
ATOM   211  C C   . LYS A 1 27  ? -19.020 66.537 2.127   1.00 21.72 ? 326  LYS A C   1 
ATOM   212  O O   . LYS A 1 27  ? -19.280 67.378 2.985   1.00 15.44 ? 326  LYS A O   1 
ATOM   213  C CB  . LYS A 1 27  ? -19.299 67.624 -0.145  1.00 25.65 ? 326  LYS A CB  1 
ATOM   214  N N   . ILE A 1 28  ? -18.117 65.576 2.309   1.00 20.75 ? 327  ILE A N   1 
ATOM   215  C CA  . ILE A 1 28  ? -17.423 65.417 3.578   1.00 19.27 ? 327  ILE A CA  1 
ATOM   216  C C   . ILE A 1 28  ? -15.964 65.862 3.498   1.00 17.49 ? 327  ILE A C   1 
ATOM   217  O O   . ILE A 1 28  ? -15.379 66.237 4.508   1.00 13.62 ? 327  ILE A O   1 
ATOM   218  C CB  . ILE A 1 28  ? -17.425 63.945 4.034   1.00 19.25 ? 327  ILE A CB  1 
ATOM   219  C CG1 . ILE A 1 28  ? -18.796 63.268 3.954   1.00 19.13 ? 327  ILE A CG1 1 
ATOM   220  C CG2 . ILE A 1 28  ? -16.839 63.855 5.427   1.00 20.14 ? 327  ILE A CG2 1 
ATOM   221  C CD1 . ILE A 1 28  ? -19.563 63.401 5.259   1.00 16.71 ? 327  ILE A CD1 1 
ATOM   222  N N   . GLY A 1 29  ? -15.413 65.789 2.300   1.00 16.90 ? 328  GLY A N   1 
ATOM   223  C CA  . GLY A 1 29  ? -14.006 65.965 2.036   1.00 16.16 ? 328  GLY A CA  1 
ATOM   224  C C   . GLY A 1 29  ? -13.740 65.333 0.665   1.00 16.55 ? 328  GLY A C   1 
ATOM   225  O O   . GLY A 1 29  ? -14.735 64.949 0.029   1.00 17.44 ? 328  GLY A O   1 
ATOM   226  N N   . ILE A 1 35  ? -13.355 60.006 -1.615  1.00 33.47 ? 334  ILE A N   1 
ATOM   227  C CA  . ILE A 1 35  ? -13.912 60.455 -0.344  1.00 33.05 ? 334  ILE A CA  1 
ATOM   228  C C   . ILE A 1 35  ? -15.293 61.075 -0.544  1.00 32.81 ? 334  ILE A C   1 
ATOM   229  O O   . ILE A 1 35  ? -16.303 60.491 -0.134  1.00 36.66 ? 334  ILE A O   1 
ATOM   230  C CB  . ILE A 1 35  ? -12.923 61.439 0.312   1.00 32.92 ? 334  ILE A CB  1 
ATOM   231  C CG1 . ILE A 1 35  ? -11.535 60.826 0.523   1.00 32.33 ? 334  ILE A CG1 1 
ATOM   232  C CG2 . ILE A 1 35  ? -13.501 62.009 1.597   1.00 33.57 ? 334  ILE A CG2 1 
ATOM   233  C CD1 . ILE A 1 35  ? -10.921 61.080 1.879   1.00 32.63 ? 334  ILE A CD1 1 
ATOM   234  N N   . VAL A 1 36  ? -15.335 62.233 -1.173  1.00 31.01 ? 335  VAL A N   1 
ATOM   235  C CA  . VAL A 1 36  ? -16.559 62.899 -1.583  1.00 30.05 ? 335  VAL A CA  1 
ATOM   236  C C   . VAL A 1 36  ? -17.705 62.843 -0.597  1.00 30.38 ? 335  VAL A C   1 
ATOM   237  O O   . VAL A 1 36  ? -17.828 63.761 0.227   1.00 32.53 ? 335  VAL A O   1 
ATOM   238  C CB  . VAL A 1 36  ? -16.958 62.329 -2.968  1.00 29.24 ? 335  VAL A CB  1 
ATOM   239  C CG1 . VAL A 1 36  ? -18.035 63.167 -3.627  1.00 26.09 ? 335  VAL A CG1 1 
ATOM   240  C CG2 . VAL A 1 36  ? -15.720 62.254 -3.849  1.00 30.36 ? 335  VAL A CG2 1 
ATOM   241  N N   . CYS A 1 37  ? -18.565 61.832 -0.657  1.00 29.45 ? 336  CYS A N   1 
ATOM   242  C CA  . CYS A 1 37  ? -19.893 61.935 -0.062  1.00 29.13 ? 336  CYS A CA  1 
ATOM   243  C C   . CYS A 1 37  ? -20.277 60.978 1.066   1.00 28.59 ? 336  CYS A C   1 
ATOM   244  O O   . CYS A 1 37  ? -19.504 60.109 1.460   1.00 28.08 ? 336  CYS A O   1 
ATOM   245  C CB  . CYS A 1 37  ? -20.932 61.743 -1.194  1.00 28.98 ? 336  CYS A CB  1 
ATOM   246  S SG  . CYS A 1 37  ? -21.053 63.175 -2.294  1.00 40.95 ? 336  CYS A SG  1 
ATOM   247  N N   . ILE A 1 38  ? -21.493 61.166 1.568   1.00 27.79 ? 337  ILE A N   1 
ATOM   248  C CA  . ILE A 1 38  ? -22.113 60.318 2.562   1.00 26.44 ? 337  ILE A CA  1 
ATOM   249  C C   . ILE A 1 38  ? -23.636 60.482 2.494   1.00 23.98 ? 337  ILE A C   1 
ATOM   250  O O   . ILE A 1 38  ? -24.134 61.607 2.535   1.00 25.24 ? 337  ILE A O   1 
ATOM   251  C CB  . ILE A 1 38  ? -21.662 60.607 4.005   1.00 27.50 ? 337  ILE A CB  1 
ATOM   252  C CG1 . ILE A 1 38  ? -20.676 59.602 4.598   1.00 27.34 ? 337  ILE A CG1 1 
ATOM   253  C CG2 . ILE A 1 38  ? -22.867 60.746 4.936   1.00 26.75 ? 337  ILE A CG2 1 
ATOM   254  C CD1 . ILE A 1 38  ? -19.226 60.031 4.591   1.00 25.63 ? 337  ILE A CD1 1 
ATOM   255  N N   . ALA A 1 39  ? -24.341 59.371 2.387   1.00 20.92 ? 338  ALA A N   1 
ATOM   256  C CA  . ALA A 1 39  ? -25.795 59.367 2.268   1.00 18.28 ? 338  ALA A CA  1 
ATOM   257  C C   . ALA A 1 39  ? -26.430 58.630 3.438   1.00 19.57 ? 338  ALA A C   1 
ATOM   258  O O   . ALA A 1 39  ? -25.754 58.331 4.426   1.00 22.96 ? 338  ALA A O   1 
ATOM   259  C CB  . ALA A 1 39  ? -26.202 58.745 0.935   1.00 6.22  ? 338  ALA A CB  1 
ATOM   260  N N   . THR A 1 40  ? -27.721 58.336 3.339   1.00 20.91 ? 339  THR A N   1 
ATOM   261  C CA  . THR A 1 40  ? -28.407 57.526 4.327   1.00 22.70 ? 339  THR A CA  1 
ATOM   262  C C   . THR A 1 40  ? -29.357 56.517 3.677   1.00 22.62 ? 339  THR A C   1 
ATOM   263  O O   . THR A 1 40  ? -29.929 56.790 2.627   1.00 13.82 ? 339  THR A O   1 
ATOM   264  C CB  . THR A 1 40  ? -29.226 58.365 5.326   1.00 24.59 ? 339  THR A CB  1 
ATOM   265  O OG1 . THR A 1 40  ? -28.923 59.752 5.157   1.00 30.47 ? 339  THR A OG1 1 
ATOM   266  C CG2 . THR A 1 40  ? -28.847 57.974 6.746   1.00 24.57 ? 339  THR A CG2 1 
ATOM   267  N N   . VAL A 1 41  ? -29.508 55.372 4.331   1.00 25.03 ? 340  VAL A N   1 
ATOM   268  C CA  . VAL A 1 41  ? -30.445 54.343 3.907   1.00 26.45 ? 340  VAL A CA  1 
ATOM   269  C C   . VAL A 1 41  ? -31.775 54.575 4.625   1.00 29.43 ? 340  VAL A C   1 
ATOM   270  O O   . VAL A 1 41  ? -31.837 54.496 5.853   1.00 30.97 ? 340  VAL A O   1 
ATOM   271  C CB  . VAL A 1 41  ? -30.017 52.899 4.218   1.00 23.95 ? 340  VAL A CB  1 
ATOM   272  C CG1 . VAL A 1 41  ? -30.484 51.964 3.113   1.00 21.23 ? 340  VAL A CG1 1 
ATOM   273  C CG2 . VAL A 1 41  ? -28.517 52.764 4.412   1.00 21.09 ? 340  VAL A CG2 1 
ATOM   274  N N   . ARG A 1 42  ? -32.820 54.866 3.855   1.00 31.06 ? 341  ARG A N   1 
ATOM   275  C CA  . ARG A 1 42  ? -34.131 55.113 4.460   1.00 33.14 ? 341  ARG A CA  1 
ATOM   276  C C   . ARG A 1 42  ? -34.646 53.822 5.109   1.00 35.71 ? 341  ARG A C   1 
ATOM   277  O O   . ARG A 1 42  ? -35.477 53.880 6.024   1.00 36.76 ? 341  ARG A O   1 
ATOM   278  C CB  . ARG A 1 42  ? -35.123 55.677 3.453   1.00 32.13 ? 341  ARG A CB  1 
ATOM   279  C CG  . ARG A 1 42  ? -35.280 54.938 2.145   1.00 31.29 ? 341  ARG A CG  1 
ATOM   280  C CD  . ARG A 1 42  ? -35.407 55.897 0.955   1.00 30.61 ? 341  ARG A CD  1 
ATOM   281  N NE  . ARG A 1 42  ? -36.786 56.138 0.564   1.00 28.16 ? 341  ARG A NE  1 
ATOM   282  C CZ  . ARG A 1 42  ? -37.207 56.529 -0.625  1.00 26.44 ? 341  ARG A CZ  1 
ATOM   283  N NH1 . ARG A 1 42  ? -36.361 56.752 -1.616  1.00 26.26 ? 341  ARG A NH1 1 
ATOM   284  N NH2 . ARG A 1 42  ? -38.503 56.711 -0.834  1.00 26.64 ? 341  ARG A NH2 1 
ATOM   285  N N   . SER A 1 43  ? -34.148 52.695 4.631   1.00 37.67 ? 342  SER A N   1 
ATOM   286  C CA  . SER A 1 43  ? -34.545 51.379 5.098   1.00 39.26 ? 342  SER A CA  1 
ATOM   287  C C   . SER A 1 43  ? -34.026 51.059 6.495   1.00 40.49 ? 342  SER A C   1 
ATOM   288  O O   . SER A 1 43  ? -34.681 50.376 7.292   1.00 46.13 ? 342  SER A O   1 
ATOM   289  C CB  . SER A 1 43  ? -34.034 50.296 4.138   1.00 42.12 ? 342  SER A CB  1 
ATOM   290  N N   . SER A 1 44  ? -32.825 51.547 6.801   1.00 39.83 ? 343  SER A N   1 
ATOM   291  C CA  . SER A 1 44  ? -32.262 51.336 8.137   1.00 39.50 ? 343  SER A CA  1 
ATOM   292  C C   . SER A 1 44  ? -31.720 52.650 8.688   1.00 39.74 ? 343  SER A C   1 
ATOM   293  O O   . SER A 1 44  ? -32.023 53.029 9.821   1.00 40.62 ? 343  SER A O   1 
ATOM   294  C CB  . SER A 1 44  ? -31.179 50.263 8.084   1.00 38.79 ? 343  SER A CB  1 
ATOM   295  O OG  . SER A 1 44  ? -31.420 49.388 6.995   1.00 37.83 ? 343  SER A OG  1 
ATOM   296  N N   . GLY A 1 45  ? -30.932 53.339 7.869   1.00 38.68 ? 344  GLY A N   1 
ATOM   297  C CA  . GLY A 1 45  ? -30.358 54.620 8.228   1.00 37.50 ? 344  GLY A CA  1 
ATOM   298  C C   . GLY A 1 45  ? -28.853 54.662 8.062   1.00 35.38 ? 344  GLY A C   1 
ATOM   299  O O   . GLY A 1 45  ? -28.218 55.700 8.253   1.00 33.39 ? 344  GLY A O   1 
ATOM   300  N N   . LYS A 1 46  ? -28.262 53.525 7.687   1.00 33.62 ? 345  LYS A N   1 
ATOM   301  C CA  . LYS A 1 46  ? -26.829 53.488 7.410   1.00 31.79 ? 345  LYS A CA  1 
ATOM   302  C C   . LYS A 1 46  ? -26.438 54.616 6.446   1.00 30.52 ? 345  LYS A C   1 
ATOM   303  O O   . LYS A 1 46  ? -27.212 54.957 5.559   1.00 28.30 ? 345  LYS A O   1 
ATOM   304  C CB  . LYS A 1 46  ? -26.378 52.165 6.812   1.00 28.96 ? 345  LYS A CB  1 
ATOM   305  N N   . LEU A 1 47  ? -25.257 55.157 6.655   1.00 29.96 ? 346  LEU A N   1 
ATOM   306  C CA  . LEU A 1 47  ? -24.623 56.128 5.795   1.00 28.99 ? 346  LEU A CA  1 
ATOM   307  C C   . LEU A 1 47  ? -23.517 55.430 5.014   1.00 29.26 ? 346  LEU A C   1 
ATOM   308  O O   . LEU A 1 47  ? -22.947 54.456 5.515   1.00 31.62 ? 346  LEU A O   1 
ATOM   309  C CB  . LEU A 1 47  ? -24.034 57.288 6.614   1.00 28.81 ? 346  LEU A CB  1 
ATOM   310  C CG  . LEU A 1 47  ? -23.696 56.988 8.072   1.00 27.27 ? 346  LEU A CG  1 
ATOM   311  C CD1 . LEU A 1 47  ? -22.482 55.976 8.162   1.00 80.90 ? 346  LEU A CD1 1 
ATOM   312  C CD2 . LEU A 1 47  ? -23.306 58.260 8.847   1.00 21.59 ? 346  LEU A CD2 1 
ATOM   313  N N   . VAL A 1 48  ? -23.217 55.911 3.818   1.00 29.68 ? 347  VAL A N   1 
ATOM   314  C CA  . VAL A 1 48  ? -22.131 55.316 3.018   1.00 28.27 ? 347  VAL A CA  1 
ATOM   315  C C   . VAL A 1 48  ? -21.204 56.419 2.537   1.00 28.35 ? 347  VAL A C   1 
ATOM   316  O O   . VAL A 1 48  ? -21.645 57.563 2.411   1.00 23.45 ? 347  VAL A O   1 
ATOM   317  C CB  . VAL A 1 48  ? -22.746 54.516 1.857   1.00 26.84 ? 347  VAL A CB  1 
ATOM   318  C CG1 . VAL A 1 48  ? -21.767 54.309 0.715   1.00 26.81 ? 347  VAL A CG1 1 
ATOM   319  C CG2 . VAL A 1 48  ? -23.271 53.174 2.358   1.00 20.17 ? 347  VAL A CG2 1 
ATOM   320  N N   . ALA A 1 49  ? -19.944 56.096 2.272   1.00 29.51 ? 348  ALA A N   1 
ATOM   321  C CA  . ALA A 1 49  ? -19.018 57.021 1.659   1.00 31.62 ? 348  ALA A CA  1 
ATOM   322  C C   . ALA A 1 49  ? -18.575 56.577 0.247   1.00 33.05 ? 348  ALA A C   1 
ATOM   323  O O   . ALA A 1 49  ? -17.926 55.539 0.119   1.00 34.70 ? 348  ALA A O   1 
ATOM   324  C CB  . ALA A 1 49  ? -17.758 57.240 2.474   1.00 36.87 ? 348  ALA A CB  1 
ATOM   325  N N   . VAL A 1 50  ? -18.908 57.383 -0.730  1.00 32.95 ? 349  VAL A N   1 
ATOM   326  C CA  . VAL A 1 50  ? -18.589 57.252 -2.123  1.00 31.90 ? 349  VAL A CA  1 
ATOM   327  C C   . VAL A 1 50  ? -17.309 57.979 -2.517  1.00 31.71 ? 349  VAL A C   1 
ATOM   328  O O   . VAL A 1 50  ? -16.850 58.900 -1.834  1.00 33.41 ? 349  VAL A O   1 
ATOM   329  C CB  . VAL A 1 50  ? -19.759 57.849 -2.948  1.00 31.47 ? 349  VAL A CB  1 
ATOM   330  C CG1 . VAL A 1 50  ? -19.611 57.597 -4.435  1.00 34.21 ? 349  VAL A CG1 1 
ATOM   331  C CG2 . VAL A 1 50  ? -21.082 57.286 -2.446  1.00 29.55 ? 349  VAL A CG2 1 
ATOM   332  N N   . LYS A 1 51  ? -16.726 57.575 -3.639  1.00 31.21 ? 350  LYS A N   1 
ATOM   333  C CA  . LYS A 1 51  ? -15.637 58.318 -4.254  1.00 30.98 ? 350  LYS A CA  1 
ATOM   334  C C   . LYS A 1 51  ? -15.926 58.464 -5.752  1.00 33.25 ? 350  LYS A C   1 
ATOM   335  O O   . LYS A 1 51  ? -15.606 57.563 -6.533  1.00 40.17 ? 350  LYS A O   1 
ATOM   336  C CB  . LYS A 1 51  ? -14.290 57.658 -4.030  1.00 29.94 ? 350  LYS A CB  1 
ATOM   337  C CG  . LYS A 1 51  ? -14.114 56.282 -4.640  1.00 28.97 ? 350  LYS A CG  1 
ATOM   338  C CD  . LYS A 1 51  ? -13.369 55.381 -3.667  1.00 28.41 ? 350  LYS A CD  1 
ATOM   339  C CE  . LYS A 1 51  ? -12.529 54.332 -4.389  1.00 28.08 ? 350  LYS A CE  1 
ATOM   340  N NZ  . LYS A 1 51  ? -12.427 53.091 -3.567  1.00 27.64 ? 350  LYS A NZ  1 
ATOM   341  N N   . LYS A 1 52  ? -16.513 59.587 -6.125  1.00 32.60 ? 351  LYS A N   1 
ATOM   342  C CA  . LYS A 1 52  ? -16.920 59.859 -7.488  1.00 32.31 ? 351  LYS A CA  1 
ATOM   343  C C   . LYS A 1 52  ? -15.767 60.098 -8.462  1.00 31.49 ? 351  LYS A C   1 
ATOM   344  O O   . LYS A 1 52  ? -14.595 60.088 -8.090  1.00 32.77 ? 351  LYS A O   1 
ATOM   345  C CB  . LYS A 1 52  ? -17.836 61.085 -7.540  1.00 32.70 ? 351  LYS A CB  1 
ATOM   346  N N   . MET A 1 53  ? -16.133 60.301 -9.720  1.00 29.91 ? 352  MET A N   1 
ATOM   347  C CA  . MET A 1 53  ? -15.179 60.492 -10.804 1.00 29.27 ? 352  MET A CA  1 
ATOM   348  C C   . MET A 1 53  ? -15.935 60.907 -12.056 1.00 27.38 ? 352  MET A C   1 
ATOM   349  O O   . MET A 1 53  ? -17.162 61.006 -12.028 1.00 22.79 ? 352  MET A O   1 
ATOM   350  C CB  . MET A 1 53  ? -14.366 59.216 -11.049 1.00 29.81 ? 352  MET A CB  1 
ATOM   351  N N   . ASP A 1 54  ? -15.228 61.154 -13.156 1.00 27.00 ? 353  ASP A N   1 
ATOM   352  C CA  . ASP A 1 54  ? -15.946 61.614 -14.365 1.00 27.33 ? 353  ASP A CA  1 
ATOM   353  C C   . ASP A 1 54  ? -15.188 61.247 -15.635 1.00 26.95 ? 353  ASP A C   1 
ATOM   354  O O   . ASP A 1 54  ? -15.101 60.040 -15.882 1.00 22.50 ? 353  ASP A O   1 
ATOM   355  C CB  . ASP A 1 54  ? -16.230 63.108 -14.271 1.00 26.34 ? 353  ASP A CB  1 
ATOM   356  N N   . LEU A 1 63  ? -5.267  48.129 -15.099 1.00 33.57 ? 362  LEU A N   1 
ATOM   357  C CA  . LEU A 1 63  ? -5.483  49.585 -15.074 1.00 32.81 ? 362  LEU A CA  1 
ATOM   358  C C   . LEU A 1 63  ? -6.431  49.927 -13.941 1.00 33.09 ? 362  LEU A C   1 
ATOM   359  O O   . LEU A 1 63  ? -6.537  49.148 -12.983 1.00 31.14 ? 362  LEU A O   1 
ATOM   360  C CB  . LEU A 1 63  ? -5.942  49.991 -16.481 1.00 32.09 ? 362  LEU A CB  1 
ATOM   361  C CG  . LEU A 1 63  ? -4.850  50.616 -17.362 1.00 30.85 ? 362  LEU A CG  1 
ATOM   362  C CD1 . LEU A 1 63  ? -4.115  49.536 -18.133 1.00 29.16 ? 362  LEU A CD1 1 
ATOM   363  C CD2 . LEU A 1 63  ? -5.423  51.654 -18.307 1.00 28.57 ? 362  LEU A CD2 1 
ATOM   364  N N   . LEU A 1 64  ? -7.131  51.056 -14.011 1.00 33.58 ? 363  LEU A N   1 
ATOM   365  C CA  . LEU A 1 64  ? -8.245  51.320 -13.109 1.00 33.17 ? 363  LEU A CA  1 
ATOM   366  C C   . LEU A 1 64  ? -9.430  50.405 -13.440 1.00 32.31 ? 363  LEU A C   1 
ATOM   367  O O   . LEU A 1 64  ? -10.392 50.258 -12.687 1.00 31.89 ? 363  LEU A O   1 
ATOM   368  C CB  . LEU A 1 64  ? -8.712  52.770 -13.172 1.00 33.60 ? 363  LEU A CB  1 
ATOM   369  C CG  . LEU A 1 64  ? -9.565  53.236 -11.988 1.00 33.23 ? 363  LEU A CG  1 
ATOM   370  C CD1 . LEU A 1 64  ? -9.114  54.626 -11.565 1.00 34.48 ? 363  LEU A CD1 1 
ATOM   371  C CD2 . LEU A 1 64  ? -11.046 53.207 -12.326 1.00 31.93 ? 363  LEU A CD2 1 
ATOM   372  N N   . PHE A 1 65  ? -9.343  49.775 -14.608 1.00 31.80 ? 364  PHE A N   1 
ATOM   373  C CA  . PHE A 1 65  ? -10.227 48.702 -14.996 1.00 30.93 ? 364  PHE A CA  1 
ATOM   374  C C   . PHE A 1 65  ? -10.329 47.668 -13.879 1.00 28.10 ? 364  PHE A C   1 
ATOM   375  O O   . PHE A 1 65  ? -11.398 47.120 -13.607 1.00 27.03 ? 364  PHE A O   1 
ATOM   376  C CB  . PHE A 1 65  ? -9.663  48.077 -16.274 1.00 32.84 ? 364  PHE A CB  1 
ATOM   377  C CG  . PHE A 1 65  ? -10.087 46.641 -16.509 1.00 34.46 ? 364  PHE A CG  1 
ATOM   378  C CD1 . PHE A 1 65  ? -11.357 46.355 -16.978 1.00 35.12 ? 364  PHE A CD1 1 
ATOM   379  C CD2 . PHE A 1 65  ? -9.212  45.600 -16.263 1.00 35.56 ? 364  PHE A CD2 1 
ATOM   380  C CE1 . PHE A 1 65  ? -11.737 45.047 -17.198 1.00 36.17 ? 364  PHE A CE1 1 
ATOM   381  C CE2 . PHE A 1 65  ? -9.586  44.286 -16.478 1.00 36.43 ? 364  PHE A CE2 1 
ATOM   382  C CZ  . PHE A 1 65  ? -10.857 44.009 -16.944 1.00 36.76 ? 364  PHE A CZ  1 
ATOM   383  N N   . ASN A 1 66  ? -9.200  47.423 -13.227 1.00 26.29 ? 365  ASN A N   1 
ATOM   384  C CA  . ASN A 1 66  ? -9.013  46.295 -12.340 1.00 24.72 ? 365  ASN A CA  1 
ATOM   385  C C   . ASN A 1 66  ? -9.772  46.339 -11.042 1.00 22.89 ? 365  ASN A C   1 
ATOM   386  O O   . ASN A 1 66  ? -10.158 45.295 -10.500 1.00 22.66 ? 365  ASN A O   1 
ATOM   387  C CB  . ASN A 1 66  ? -7.501  46.138 -12.045 1.00 25.66 ? 365  ASN A CB  1 
ATOM   388  C CG  . ASN A 1 66  ? -6.961  44.971 -12.858 1.00 26.69 ? 365  ASN A CG  1 
ATOM   389  O OD1 . ASN A 1 66  ? -7.748  44.259 -13.485 1.00 26.42 ? 365  ASN A OD1 1 
ATOM   390  N ND2 . ASN A 1 66  ? -5.653  44.783 -12.880 1.00 28.72 ? 365  ASN A ND2 1 
ATOM   391  N N   . GLU A 1 67  ? -10.025 47.526 -10.476 1.00 21.67 ? 366  GLU A N   1 
ATOM   392  C CA  . GLU A 1 67  ? -10.865 47.510 -9.255  1.00 21.44 ? 366  GLU A CA  1 
ATOM   393  C C   . GLU A 1 67  ? -12.291 47.122 -9.618  1.00 21.43 ? 366  GLU A C   1 
ATOM   394  O O   . GLU A 1 67  ? -12.862 46.218 -9.003  1.00 22.19 ? 366  GLU A O   1 
ATOM   395  C CB  . GLU A 1 67  ? -10.830 48.824 -8.485  1.00 20.02 ? 366  GLU A CB  1 
ATOM   396  C CG  . GLU A 1 67  ? -11.103 48.647 -7.003  1.00 18.58 ? 366  GLU A CG  1 
ATOM   397  C CD  . GLU A 1 67  ? -10.459 49.682 -6.107  1.00 17.69 ? 366  GLU A CD  1 
ATOM   398  O OE1 . GLU A 1 67  ? -9.656  50.502 -6.586  1.00 16.51 ? 366  GLU A OE1 1 
ATOM   399  O OE2 . GLU A 1 67  ? -10.756 49.682 -4.890  1.00 16.69 ? 366  GLU A OE2 1 
ATOM   400  N N   . VAL A 1 68  ? -12.872 47.797 -10.603 1.00 21.68 ? 367  VAL A N   1 
ATOM   401  C CA  . VAL A 1 68  ? -14.306 47.623 -10.871 1.00 22.73 ? 367  VAL A CA  1 
ATOM   402  C C   . VAL A 1 68  ? -14.663 46.170 -11.144 1.00 23.64 ? 367  VAL A C   1 
ATOM   403  O O   . VAL A 1 68  ? -15.437 45.561 -10.397 1.00 22.18 ? 367  VAL A O   1 
ATOM   404  C CB  . VAL A 1 68  ? -14.780 48.526 -12.026 1.00 22.28 ? 367  VAL A CB  1 
ATOM   405  C CG1 . VAL A 1 68  ? -15.985 47.956 -12.754 1.00 22.26 ? 367  VAL A CG1 1 
ATOM   406  C CG2 . VAL A 1 68  ? -15.101 49.908 -11.460 1.00 18.71 ? 367  VAL A CG2 1 
ATOM   407  N N   . VAL A 1 69  ? -14.112 45.610 -12.214 1.00 24.61 ? 368  VAL A N   1 
ATOM   408  C CA  . VAL A 1 69  ? -14.465 44.245 -12.598 1.00 25.13 ? 368  VAL A CA  1 
ATOM   409  C C   . VAL A 1 69  ? -14.036 43.207 -11.573 1.00 23.87 ? 368  VAL A C   1 
ATOM   410  O O   . VAL A 1 69  ? -14.828 42.388 -11.093 1.00 24.23 ? 368  VAL A O   1 
ATOM   411  C CB  . VAL A 1 69  ? -13.835 43.853 -13.949 1.00 26.41 ? 368  VAL A CB  1 
ATOM   412  C CG1 . VAL A 1 69  ? -14.235 42.417 -14.258 1.00 27.80 ? 368  VAL A CG1 1 
ATOM   413  C CG2 . VAL A 1 69  ? -14.257 44.814 -15.042 1.00 27.13 ? 368  VAL A CG2 1 
ATOM   414  N N   . ILE A 1 70  ? -12.756 43.218 -11.225 1.00 23.47 ? 369  ILE A N   1 
ATOM   415  C CA  . ILE A 1 70  ? -12.163 42.185 -10.392 1.00 23.36 ? 369  ILE A CA  1 
ATOM   416  C C   . ILE A 1 70  ? -12.726 42.057 -8.993  1.00 24.36 ? 369  ILE A C   1 
ATOM   417  O O   . ILE A 1 70  ? -13.009 40.944 -8.537  1.00 27.37 ? 369  ILE A O   1 
ATOM   418  C CB  . ILE A 1 70  ? -10.639 42.484 -10.318 1.00 20.80 ? 369  ILE A CB  1 
ATOM   419  C CG1 . ILE A 1 70  ? -10.086 42.783 -11.709 1.00 21.05 ? 369  ILE A CG1 1 
ATOM   420  C CG2 . ILE A 1 70  ? -9.869  41.388 -9.620  1.00 14.38 ? 369  ILE A CG2 1 
ATOM   421  C CD1 . ILE A 1 70  ? -8.807  42.088 -12.089 1.00 20.48 ? 369  ILE A CD1 1 
ATOM   422  N N   . MET A 1 71  ? -12.881 43.174 -8.286  1.00 24.32 ? 370  MET A N   1 
ATOM   423  C CA  . MET A 1 71  ? -13.303 43.089 -6.882  1.00 26.30 ? 370  MET A CA  1 
ATOM   424  C C   . MET A 1 71  ? -14.795 43.264 -6.716  1.00 27.71 ? 370  MET A C   1 
ATOM   425  O O   . MET A 1 71  ? -15.332 43.123 -5.612  1.00 27.05 ? 370  MET A O   1 
ATOM   426  C CB  . MET A 1 71  ? -12.499 44.103 -6.056  1.00 27.09 ? 370  MET A CB  1 
ATOM   427  C CG  . MET A 1 71  ? -11.121 43.526 -5.696  1.00 26.99 ? 370  MET A CG  1 
ATOM   428  S SD  . MET A 1 71  ? -11.280 42.207 -4.481  1.00 19.37 ? 370  MET A SD  1 
ATOM   429  C CE  . MET A 1 71  ? -10.794 40.777 -5.444  1.00 30.05 ? 370  MET A CE  1 
ATOM   430  N N   . ARG A 1 72  ? -15.508 43.548 -7.806  1.00 29.25 ? 371  ARG A N   1 
ATOM   431  C CA  . ARG A 1 72  ? -16.973 43.542 -7.749  1.00 29.69 ? 371  ARG A CA  1 
ATOM   432  C C   . ARG A 1 72  ? -17.436 42.096 -7.558  1.00 30.01 ? 371  ARG A C   1 
ATOM   433  O O   . ARG A 1 72  ? -18.524 41.818 -7.064  1.00 28.77 ? 371  ARG A O   1 
ATOM   434  C CB  . ARG A 1 72  ? -17.579 44.164 -8.999  1.00 29.40 ? 371  ARG A CB  1 
ATOM   435  C CG  . ARG A 1 72  ? -17.377 43.334 -10.257 1.00 29.44 ? 371  ARG A CG  1 
ATOM   436  C CD  . ARG A 1 72  ? -18.701 43.110 -10.963 1.00 29.58 ? 371  ARG A CD  1 
ATOM   437  N NE  . ARG A 1 72  ? -19.348 44.321 -11.429 1.00 29.36 ? 371  ARG A NE  1 
ATOM   438  C CZ  . ARG A 1 72  ? -20.470 44.887 -11.024 1.00 29.48 ? 371  ARG A CZ  1 
ATOM   439  N NH1 . ARG A 1 72  ? -21.206 44.367 -10.047 1.00 32.35 ? 371  ARG A NH1 1 
ATOM   440  N NH2 . ARG A 1 72  ? -20.897 46.009 -11.586 1.00 28.23 ? 371  ARG A NH2 1 
ATOM   441  N N   . ASP A 1 73  ? -16.554 41.165 -7.935  1.00 30.27 ? 372  ASP A N   1 
ATOM   442  C CA  . ASP A 1 73  ? -16.749 39.760 -7.599  1.00 29.96 ? 372  ASP A CA  1 
ATOM   443  C C   . ASP A 1 73  ? -15.898 39.365 -6.393  1.00 29.54 ? 372  ASP A C   1 
ATOM   444  O O   . ASP A 1 73  ? -14.866 38.722 -6.568  1.00 27.52 ? 372  ASP A O   1 
ATOM   445  C CB  . ASP A 1 73  ? -16.420 38.860 -8.785  1.00 29.99 ? 372  ASP A CB  1 
ATOM   446  C CG  . ASP A 1 73  ? -16.779 39.429 -10.135 1.00 29.51 ? 372  ASP A CG  1 
ATOM   447  O OD1 . ASP A 1 73  ? -17.468 40.468 -10.221 1.00 30.23 ? 372  ASP A OD1 1 
ATOM   448  O OD2 . ASP A 1 73  ? -16.378 38.847 -11.173 1.00 25.88 ? 372  ASP A OD2 1 
ATOM   449  N N   . TYR A 1 74  ? -16.342 39.746 -5.206  1.00 30.14 ? 373  TYR A N   1 
ATOM   450  C CA  . TYR A 1 74  ? -15.694 39.408 -3.951  1.00 29.87 ? 373  TYR A CA  1 
ATOM   451  C C   . TYR A 1 74  ? -16.259 40.171 -2.749  1.00 28.17 ? 373  TYR A C   1 
ATOM   452  O O   . TYR A 1 74  ? -16.758 41.289 -2.883  1.00 31.46 ? 373  TYR A O   1 
ATOM   453  C CB  . TYR A 1 74  ? -14.181 39.675 -4.030  1.00 30.87 ? 373  TYR A CB  1 
ATOM   454  C CG  . TYR A 1 74  ? -13.390 39.028 -2.914  1.00 31.42 ? 373  TYR A CG  1 
ATOM   455  C CD1 . TYR A 1 74  ? -12.885 37.740 -3.030  1.00 32.16 ? 373  TYR A CD1 1 
ATOM   456  C CD2 . TYR A 1 74  ? -13.154 39.715 -1.730  1.00 31.45 ? 373  TYR A CD2 1 
ATOM   457  C CE1 . TYR A 1 74  ? -12.168 37.163 -1.999  1.00 32.47 ? 373  TYR A CE1 1 
ATOM   458  C CE2 . TYR A 1 74  ? -12.436 39.146 -0.695  1.00 31.74 ? 373  TYR A CE2 1 
ATOM   459  C CZ  . TYR A 1 74  ? -11.942 37.865 -0.834  1.00 32.22 ? 373  TYR A CZ  1 
ATOM   460  O OH  . TYR A 1 74  ? -11.222 37.287 0.190   1.00 31.11 ? 373  TYR A OH  1 
ATOM   461  N N   . GLN A 1 75  ? -16.161 39.568 -1.571  1.00 25.19 ? 374  GLN A N   1 
ATOM   462  C CA  . GLN A 1 75  ? -16.544 40.203 -0.322  1.00 23.12 ? 374  GLN A CA  1 
ATOM   463  C C   . GLN A 1 75  ? -15.971 39.451 0.888   1.00 19.88 ? 374  GLN A C   1 
ATOM   464  O O   . GLN A 1 75  ? -16.262 38.268 1.084   1.00 16.89 ? 374  GLN A O   1 
ATOM   465  C CB  . GLN A 1 75  ? -18.071 40.305 -0.189  1.00 25.10 ? 374  GLN A CB  1 
ATOM   466  N N   . HIS A 1 76  ? -15.164 40.139 1.673   1.00 17.45 ? 375  HIS A N   1 
ATOM   467  C CA  . HIS A 1 76  ? -14.585 39.630 2.902   1.00 16.27 ? 375  HIS A CA  1 
ATOM   468  C C   . HIS A 1 76  ? -14.755 40.706 3.994   1.00 14.79 ? 375  HIS A C   1 
ATOM   469  O O   . HIS A 1 76  ? -14.663 41.887 3.662   1.00 11.02 ? 375  HIS A O   1 
ATOM   470  C CB  . HIS A 1 76  ? -13.114 39.297 2.788   1.00 15.82 ? 375  HIS A CB  1 
ATOM   471  C CG  . HIS A 1 76  ? -12.422 38.445 3.795   1.00 14.53 ? 375  HIS A CG  1 
ATOM   472  N ND1 . HIS A 1 76  ? -12.333 38.589 5.152   1.00 13.86 ? 375  HIS A ND1 1 
ATOM   473  C CD2 . HIS A 1 76  ? -11.699 37.317 3.551   1.00 14.81 ? 375  HIS A CD2 1 
ATOM   474  C CE1 . HIS A 1 76  ? -11.626 37.638 5.716   1.00 14.45 ? 375  HIS A CE1 1 
ATOM   475  N NE2 . HIS A 1 76  ? -11.224 36.833 4.748   1.00 14.76 ? 375  HIS A NE2 1 
ATOM   476  N N   . GLU A 1 77  ? -14.964 40.270 5.209   1.00 13.39 ? 376  GLU A N   1 
ATOM   477  C CA  . GLU A 1 77  ? -15.125 41.053 6.401   1.00 14.01 ? 376  GLU A CA  1 
ATOM   478  C C   . GLU A 1 77  ? -13.894 41.868 6.808   1.00 11.75 ? 376  GLU A C   1 
ATOM   479  O O   . GLU A 1 77  ? -13.916 42.564 7.825   1.00 8.00  ? 376  GLU A O   1 
ATOM   480  C CB  . GLU A 1 77  ? -15.497 40.110 7.569   1.00 16.72 ? 376  GLU A CB  1 
ATOM   481  C CG  . GLU A 1 77  ? -14.676 38.838 7.626   1.00 18.09 ? 376  GLU A CG  1 
ATOM   482  C CD  . GLU A 1 77  ? -15.146 37.703 6.746   1.00 18.29 ? 376  GLU A CD  1 
ATOM   483  O OE1 . GLU A 1 77  ? -15.700 36.704 7.260   1.00 15.71 ? 376  GLU A OE1 1 
ATOM   484  O OE2 . GLU A 1 77  ? -14.948 37.799 5.516   1.00 18.54 ? 376  GLU A OE2 1 
ATOM   485  N N   . ASN A 1 78  ? -12.847 41.774 6.029   1.00 13.31 ? 377  ASN A N   1 
ATOM   486  C CA  . ASN A 1 78  ? -11.572 42.403 6.208   1.00 14.59 ? 377  ASN A CA  1 
ATOM   487  C C   . ASN A 1 78  ? -11.209 43.335 5.047   1.00 12.68 ? 377  ASN A C   1 
ATOM   488  O O   . ASN A 1 78  ? -10.123 43.908 5.078   1.00 13.40 ? 377  ASN A O   1 
ATOM   489  C CB  . ASN A 1 78  ? -10.513 41.293 6.342   1.00 17.45 ? 377  ASN A CB  1 
ATOM   490  C CG  . ASN A 1 78  ? -10.447 40.797 7.776   1.00 18.76 ? 377  ASN A CG  1 
ATOM   491  O OD1 . ASN A 1 78  ? -10.685 39.628 8.057   1.00 22.93 ? 377  ASN A OD1 1 
ATOM   492  N ND2 . ASN A 1 78  ? -10.117 41.723 8.675   1.00 18.65 ? 377  ASN A ND2 1 
ATOM   493  N N   . VAL A 1 79  ? -12.096 43.462 4.102   1.00 12.50 ? 378  VAL A N   1 
ATOM   494  C CA  . VAL A 1 79  ? -12.009 44.219 2.888   1.00 12.30 ? 378  VAL A CA  1 
ATOM   495  C C   . VAL A 1 79  ? -13.205 45.168 2.843   1.00 13.58 ? 378  VAL A C   1 
ATOM   496  O O   . VAL A 1 79  ? -14.358 44.730 2.887   1.00 12.42 ? 378  VAL A O   1 
ATOM   497  C CB  . VAL A 1 79  ? -12.025 43.266 1.677   1.00 10.47 ? 378  VAL A CB  1 
ATOM   498  C CG1 . VAL A 1 79  ? -11.741 43.975 0.376   1.00 4.96  ? 378  VAL A CG1 1 
ATOM   499  C CG2 . VAL A 1 79  ? -11.018 42.145 1.896   1.00 10.77 ? 378  VAL A CG2 1 
ATOM   500  N N   . VAL A 1 80  ? -12.917 46.463 2.799   1.00 15.20 ? 379  VAL A N   1 
ATOM   501  C CA  . VAL A 1 80  ? -13.967 47.475 2.681   1.00 14.17 ? 379  VAL A CA  1 
ATOM   502  C C   . VAL A 1 80  ? -14.863 47.109 1.500   1.00 12.77 ? 379  VAL A C   1 
ATOM   503  O O   . VAL A 1 80  ? -14.425 47.070 0.350   1.00 11.22 ? 379  VAL A O   1 
ATOM   504  C CB  . VAL A 1 80  ? -13.388 48.887 2.537   1.00 13.71 ? 379  VAL A CB  1 
ATOM   505  C CG1 . VAL A 1 80  ? -14.392 49.836 1.899   1.00 16.30 ? 379  VAL A CG1 1 
ATOM   506  C CG2 . VAL A 1 80  ? -12.961 49.397 3.911   1.00 13.15 ? 379  VAL A CG2 1 
ATOM   507  N N   . GLU A 1 81  ? -16.119 46.803 1.811   1.00 11.16 ? 380  GLU A N   1 
ATOM   508  C CA  . GLU A 1 81  ? -17.062 46.322 0.820   1.00 9.70  ? 380  GLU A CA  1 
ATOM   509  C C   . GLU A 1 81  ? -17.410 47.394 -0.210  1.00 11.00 ? 380  GLU A C   1 
ATOM   510  O O   . GLU A 1 81  ? -17.780 48.524 0.105   1.00 10.97 ? 380  GLU A O   1 
ATOM   511  C CB  . GLU A 1 81  ? -18.350 45.811 1.475   1.00 7.77  ? 380  GLU A CB  1 
ATOM   512  C CG  . GLU A 1 81  ? -19.397 45.341 0.485   1.00 7.82  ? 380  GLU A CG  1 
ATOM   513  C CD  . GLU A 1 81  ? -20.377 44.326 1.045   1.00 6.86  ? 380  GLU A CD  1 
ATOM   514  O OE1 . GLU A 1 81  ? -21.298 43.927 0.293   1.00 5.82  ? 380  GLU A OE1 1 
ATOM   515  O OE2 . GLU A 1 81  ? -20.259 43.917 2.219   1.00 4.50  ? 380  GLU A OE2 1 
ATOM   516  N N   . MET A 1 82  ? -17.291 47.012 -1.480  1.00 13.62 ? 381  MET A N   1 
ATOM   517  C CA  . MET A 1 82  ? -17.722 47.857 -2.583  1.00 13.50 ? 381  MET A CA  1 
ATOM   518  C C   . MET A 1 82  ? -19.130 47.447 -2.987  1.00 13.63 ? 381  MET A C   1 
ATOM   519  O O   . MET A 1 82  ? -19.305 46.392 -3.603  1.00 13.31 ? 381  MET A O   1 
ATOM   520  C CB  . MET A 1 82  ? -16.760 47.709 -3.758  1.00 12.56 ? 381  MET A CB  1 
ATOM   521  C CG  . MET A 1 82  ? -17.361 48.301 -5.030  1.00 12.65 ? 381  MET A CG  1 
ATOM   522  S SD  . MET A 1 82  ? -16.306 47.994 -6.458  1.00 18.74 ? 381  MET A SD  1 
ATOM   523  C CE  . MET A 1 82  ? -17.561 47.660 -7.704  1.00 26.60 ? 381  MET A CE  1 
ATOM   524  N N   . TYR A 1 83  ? -20.122 48.251 -2.621  1.00 12.80 ? 382  TYR A N   1 
ATOM   525  C CA  . TYR A 1 83  ? -21.521 47.820 -2.721  1.00 10.82 ? 382  TYR A CA  1 
ATOM   526  C C   . TYR A 1 83  ? -22.059 47.777 -4.141  1.00 8.69  ? 382  TYR A C   1 
ATOM   527  O O   . TYR A 1 83  ? -22.440 46.703 -4.619  1.00 8.25  ? 382  TYR A O   1 
ATOM   528  C CB  . TYR A 1 83  ? -22.384 48.731 -1.843  1.00 11.23 ? 382  TYR A CB  1 
ATOM   529  C CG  . TYR A 1 83  ? -22.028 48.692 -0.377  1.00 10.56 ? 382  TYR A CG  1 
ATOM   530  C CD1 . TYR A 1 83  ? -21.698 49.827 0.351   1.00 9.38  ? 382  TYR A CD1 1 
ATOM   531  C CD2 . TYR A 1 83  ? -22.036 47.467 0.280   1.00 10.32 ? 382  TYR A CD2 1 
ATOM   532  C CE1 . TYR A 1 83  ? -21.387 49.731 1.696   1.00 8.15  ? 382  TYR A CE1 1 
ATOM   533  C CE2 . TYR A 1 83  ? -21.722 47.365 1.618   1.00 8.87  ? 382  TYR A CE2 1 
ATOM   534  C CZ  . TYR A 1 83  ? -21.395 48.502 2.318   1.00 8.05  ? 382  TYR A CZ  1 
ATOM   535  O OH  . TYR A 1 83  ? -21.088 48.369 3.652   1.00 10.63 ? 382  TYR A OH  1 
ATOM   536  N N   . ASN A 1 84  ? -22.100 48.912 -4.813  1.00 8.19  ? 383  ASN A N   1 
ATOM   537  C CA  . ASN A 1 84  ? -22.726 49.037 -6.124  1.00 7.24  ? 383  ASN A CA  1 
ATOM   538  C C   . ASN A 1 84  ? -22.039 50.094 -6.982  1.00 6.20  ? 383  ASN A C   1 
ATOM   539  O O   . ASN A 1 84  ? -21.384 50.953 -6.412  1.00 5.62  ? 383  ASN A O   1 
ATOM   540  C CB  . ASN A 1 84  ? -24.209 49.383 -5.933  1.00 6.92  ? 383  ASN A CB  1 
ATOM   541  C CG  . ASN A 1 84  ? -25.104 48.230 -5.545  1.00 5.82  ? 383  ASN A CG  1 
ATOM   542  O OD1 . ASN A 1 84  ? -25.442 47.988 -4.385  1.00 3.00  ? 383  ASN A OD1 1 
ATOM   543  N ND2 . ASN A 1 84  ? -25.560 47.424 -6.495  1.00 8.69  ? 383  ASN A ND2 1 
ATOM   544  N N   . SER A 1 85  ? -22.195 50.022 -8.294  1.00 9.26  ? 384  SER A N   1 
ATOM   545  C CA  . SER A 1 85  ? -21.578 50.968 -9.224  1.00 10.51 ? 384  SER A CA  1 
ATOM   546  C C   . SER A 1 85  ? -22.496 51.446 -10.348 1.00 10.50 ? 384  SER A C   1 
ATOM   547  O O   . SER A 1 85  ? -23.211 50.651 -10.952 1.00 14.36 ? 384  SER A O   1 
ATOM   548  C CB  . SER A 1 85  ? -20.306 50.325 -9.804  1.00 9.85  ? 384  SER A CB  1 
ATOM   549  O OG  . SER A 1 85  ? -20.627 49.444 -10.860 1.00 10.97 ? 384  SER A OG  1 
ATOM   550  N N   . TYR A 1 86  ? -22.503 52.751 -10.605 1.00 11.31 ? 385  TYR A N   1 
ATOM   551  C CA  . TYR A 1 86  ? -23.363 53.369 -11.599 1.00 13.27 ? 385  TYR A CA  1 
ATOM   552  C C   . TYR A 1 86  ? -22.695 54.575 -12.246 1.00 17.92 ? 385  TYR A C   1 
ATOM   553  O O   . TYR A 1 86  ? -21.670 55.047 -11.754 1.00 20.29 ? 385  TYR A O   1 
ATOM   554  C CB  . TYR A 1 86  ? -24.708 53.890 -11.044 1.00 11.46 ? 385  TYR A CB  1 
ATOM   555  C CG  . TYR A 1 86  ? -25.325 53.091 -9.937  1.00 9.54  ? 385  TYR A CG  1 
ATOM   556  C CD1 . TYR A 1 86  ? -26.455 52.300 -10.119 1.00 8.97  ? 385  TYR A CD1 1 
ATOM   557  C CD2 . TYR A 1 86  ? -24.762 53.127 -8.667  1.00 7.95  ? 385  TYR A CD2 1 
ATOM   558  C CE1 . TYR A 1 86  ? -26.999 51.573 -9.079  1.00 7.46  ? 385  TYR A CE1 1 
ATOM   559  C CE2 . TYR A 1 86  ? -25.292 52.397 -7.635  1.00 7.44  ? 385  TYR A CE2 1 
ATOM   560  C CZ  . TYR A 1 86  ? -26.413 51.621 -7.837  1.00 6.67  ? 385  TYR A CZ  1 
ATOM   561  O OH  . TYR A 1 86  ? -26.925 50.907 -6.776  1.00 5.64  ? 385  TYR A OH  1 
ATOM   562  N N   . LEU A 1 87  ? -23.274 55.091 -13.333 1.00 21.75 ? 386  LEU A N   1 
ATOM   563  C CA  . LEU A 1 87  ? -22.855 56.399 -13.845 1.00 24.71 ? 386  LEU A CA  1 
ATOM   564  C C   . LEU A 1 87  ? -23.999 57.180 -14.502 1.00 26.89 ? 386  LEU A C   1 
ATOM   565  O O   . LEU A 1 87  ? -24.804 56.631 -15.249 1.00 30.13 ? 386  LEU A O   1 
ATOM   566  C CB  . LEU A 1 87  ? -21.717 56.359 -14.847 1.00 25.07 ? 386  LEU A CB  1 
ATOM   567  C CG  . LEU A 1 87  ? -21.443 55.281 -15.865 1.00 24.72 ? 386  LEU A CG  1 
ATOM   568  C CD1 . LEU A 1 87  ? -22.498 55.288 -16.957 1.00 25.67 ? 386  LEU A CD1 1 
ATOM   569  C CD2 . LEU A 1 87  ? -20.054 55.513 -16.464 1.00 20.43 ? 386  LEU A CD2 1 
ATOM   570  N N   . VAL A 1 88  ? -24.029 58.484 -14.231 1.00 28.19 ? 387  VAL A N   1 
ATOM   571  C CA  . VAL A 1 88  ? -24.901 59.386 -14.969 1.00 29.51 ? 387  VAL A CA  1 
ATOM   572  C C   . VAL A 1 88  ? -24.031 60.235 -15.900 1.00 31.10 ? 387  VAL A C   1 
ATOM   573  O O   . VAL A 1 88  ? -23.215 61.026 -15.436 1.00 30.60 ? 387  VAL A O   1 
ATOM   574  C CB  . VAL A 1 88  ? -25.763 60.310 -14.107 1.00 29.82 ? 387  VAL A CB  1 
ATOM   575  C CG1 . VAL A 1 88  ? -26.895 60.881 -14.953 1.00 29.58 ? 387  VAL A CG1 1 
ATOM   576  C CG2 . VAL A 1 88  ? -26.341 59.570 -12.910 1.00 29.78 ? 387  VAL A CG2 1 
ATOM   577  N N   . GLY A 1 89  ? -24.232 60.048 -17.196 1.00 32.25 ? 388  GLY A N   1 
ATOM   578  C CA  . GLY A 1 89  ? -23.474 60.744 -18.220 1.00 32.10 ? 388  GLY A CA  1 
ATOM   579  C C   . GLY A 1 89  ? -22.037 60.244 -18.208 1.00 32.10 ? 388  GLY A C   1 
ATOM   580  O O   . GLY A 1 89  ? -21.780 59.065 -18.450 1.00 33.29 ? 388  GLY A O   1 
ATOM   581  N N   . ASP A 1 90  ? -21.103 61.144 -17.918 1.00 31.13 ? 389  ASP A N   1 
ATOM   582  C CA  . ASP A 1 90  ? -19.692 60.795 -17.885 1.00 29.57 ? 389  ASP A CA  1 
ATOM   583  C C   . ASP A 1 90  ? -19.171 60.615 -16.471 1.00 28.98 ? 389  ASP A C   1 
ATOM   584  O O   . ASP A 1 90  ? -18.007 60.916 -16.201 1.00 29.01 ? 389  ASP A O   1 
ATOM   585  C CB  . ASP A 1 90  ? -18.897 61.892 -18.610 1.00 28.46 ? 389  ASP A CB  1 
ATOM   586  C CG  . ASP A 1 90  ? -18.921 61.726 -20.115 1.00 26.99 ? 389  ASP A CG  1 
ATOM   587  O OD1 . ASP A 1 90  ? -18.534 62.667 -20.832 1.00 24.94 ? 389  ASP A OD1 1 
ATOM   588  O OD2 . ASP A 1 90  ? -19.326 60.638 -20.572 1.00 28.31 ? 389  ASP A OD2 1 
ATOM   589  N N   . GLU A 1 91  ? -20.014 60.118 -15.564 1.00 28.28 ? 390  GLU A N   1 
ATOM   590  C CA  . GLU A 1 91  ? -19.644 60.118 -14.148 1.00 28.15 ? 390  GLU A CA  1 
ATOM   591  C C   . GLU A 1 91  ? -19.984 58.874 -13.351 1.00 28.07 ? 390  GLU A C   1 
ATOM   592  O O   . GLU A 1 91  ? -21.149 58.535 -13.186 1.00 27.83 ? 390  GLU A O   1 
ATOM   593  C CB  . GLU A 1 91  ? -20.320 61.345 -13.526 1.00 28.82 ? 390  GLU A CB  1 
ATOM   594  N N   . LEU A 1 92  ? -18.951 58.209 -12.833 1.00 28.64 ? 391  LEU A N   1 
ATOM   595  C CA  . LEU A 1 92  ? -19.138 56.969 -12.093 1.00 29.26 ? 391  LEU A CA  1 
ATOM   596  C C   . LEU A 1 92  ? -19.437 57.187 -10.604 1.00 31.38 ? 391  LEU A C   1 
ATOM   597  O O   . LEU A 1 92  ? -18.726 57.910 -9.902  1.00 32.24 ? 391  LEU A O   1 
ATOM   598  C CB  . LEU A 1 92  ? -17.939 56.018 -12.240 1.00 28.05 ? 391  LEU A CB  1 
ATOM   599  C CG  . LEU A 1 92  ? -18.189 54.633 -11.627 1.00 27.13 ? 391  LEU A CG  1 
ATOM   600  C CD1 . LEU A 1 92  ? -18.459 53.591 -12.703 1.00 24.04 ? 391  LEU A CD1 1 
ATOM   601  C CD2 . LEU A 1 92  ? -17.019 54.213 -10.754 1.00 27.57 ? 391  LEU A CD2 1 
ATOM   602  N N   . TRP A 1 93  ? -20.493 56.537 -10.146 1.00 32.65 ? 392  TRP A N   1 
ATOM   603  C CA  . TRP A 1 93  ? -20.956 56.529 -8.783  1.00 32.99 ? 392  TRP A CA  1 
ATOM   604  C C   . TRP A 1 93  ? -20.647 55.164 -8.168  1.00 31.46 ? 392  TRP A C   1 
ATOM   605  O O   . TRP A 1 93  ? -21.066 54.136 -8.705  1.00 31.37 ? 392  TRP A O   1 
ATOM   606  C CB  . TRP A 1 93  ? -22.455 56.772 -8.740  1.00 34.61 ? 392  TRP A CB  1 
ATOM   607  C CG  . TRP A 1 93  ? -23.028 58.115 -8.471  1.00 36.53 ? 392  TRP A CG  1 
ATOM   608  C CD1 . TRP A 1 93  ? -24.353 58.311 -8.184  1.00 37.60 ? 392  TRP A CD1 1 
ATOM   609  C CD2 . TRP A 1 93  ? -22.448 59.424 -8.441  1.00 37.98 ? 392  TRP A CD2 1 
ATOM   610  N NE1 . TRP A 1 93  ? -24.636 59.635 -7.977  1.00 37.99 ? 392  TRP A NE1 1 
ATOM   611  C CE2 . TRP A 1 93  ? -23.471 60.343 -8.127  1.00 38.46 ? 392  TRP A CE2 1 
ATOM   612  C CE3 . TRP A 1 93  ? -21.154 59.922 -8.645  1.00 38.57 ? 392  TRP A CE3 1 
ATOM   613  C CZ2 . TRP A 1 93  ? -23.259 61.718 -8.012  1.00 38.73 ? 392  TRP A CZ2 1 
ATOM   614  C CZ3 . TRP A 1 93  ? -20.946 61.286 -8.529  1.00 38.88 ? 392  TRP A CZ3 1 
ATOM   615  C CH2 . TRP A 1 93  ? -21.985 62.171 -8.217  1.00 38.91 ? 392  TRP A CH2 1 
ATOM   616  N N   . VAL A 1 94  ? -19.911 55.157 -7.064  1.00 29.33 ? 393  VAL A N   1 
ATOM   617  C CA  . VAL A 1 94  ? -19.624 53.920 -6.353  1.00 27.01 ? 393  VAL A CA  1 
ATOM   618  C C   . VAL A 1 94  ? -20.095 53.998 -4.895  1.00 24.88 ? 393  VAL A C   1 
ATOM   619  O O   . VAL A 1 94  ? -19.605 54.807 -4.114  1.00 25.42 ? 393  VAL A O   1 
ATOM   620  C CB  . VAL A 1 94  ? -18.136 53.527 -6.314  1.00 27.20 ? 393  VAL A CB  1 
ATOM   621  C CG1 . VAL A 1 94  ? -17.921 52.364 -5.353  1.00 25.65 ? 393  VAL A CG1 1 
ATOM   622  C CG2 . VAL A 1 94  ? -17.625 53.155 -7.693  1.00 27.64 ? 393  VAL A CG2 1 
ATOM   623  N N   . VAL A 1 95  ? -21.030 53.118 -4.551  1.00 21.34 ? 394  VAL A N   1 
ATOM   624  C CA  . VAL A 1 95  ? -21.464 52.958 -3.165  1.00 17.15 ? 394  VAL A CA  1 
ATOM   625  C C   . VAL A 1 95  ? -20.420 52.129 -2.435  1.00 15.62 ? 394  VAL A C   1 
ATOM   626  O O   . VAL A 1 95  ? -19.970 51.104 -2.949  1.00 15.85 ? 394  VAL A O   1 
ATOM   627  C CB  . VAL A 1 95  ? -22.848 52.309 -3.091  1.00 16.34 ? 394  VAL A CB  1 
ATOM   628  C CG1 . VAL A 1 95  ? -23.428 52.476 -1.693  1.00 12.66 ? 394  VAL A CG1 1 
ATOM   629  C CG2 . VAL A 1 95  ? -23.823 52.880 -4.119  1.00 17.65 ? 394  VAL A CG2 1 
ATOM   630  N N   . MET A 1 96  ? -19.987 52.584 -1.258  1.00 15.21 ? 395  MET A N   1 
ATOM   631  C CA  . MET A 1 96  ? -18.872 51.902 -0.585  1.00 14.18 ? 395  MET A CA  1 
ATOM   632  C C   . MET A 1 96  ? -18.997 51.870 0.935   1.00 14.38 ? 395  MET A C   1 
ATOM   633  O O   . MET A 1 96  ? -19.593 52.752 1.544   1.00 15.66 ? 395  MET A O   1 
ATOM   634  C CB  . MET A 1 96  ? -17.548 52.550 -0.989  1.00 13.13 ? 395  MET A CB  1 
ATOM   635  C CG  . MET A 1 96  ? -16.348 51.627 -0.934  1.00 14.54 ? 395  MET A CG  1 
ATOM   636  S SD  . MET A 1 96  ? -15.879 50.885 -2.502  1.00 20.00 ? 395  MET A SD  1 
ATOM   637  C CE  . MET A 1 96  ? -14.161 50.492 -2.167  1.00 44.00 ? 395  MET A CE  1 
ATOM   638  N N   . GLU A 1 97  ? -18.432 50.823 1.535   1.00 13.79 ? 396  GLU A N   1 
ATOM   639  C CA  . GLU A 1 97  ? -18.489 50.650 2.985   1.00 14.87 ? 396  GLU A CA  1 
ATOM   640  C C   . GLU A 1 97  ? -17.607 51.658 3.697   1.00 16.61 ? 396  GLU A C   1 
ATOM   641  O O   . GLU A 1 97  ? -16.376 51.615 3.612   1.00 20.95 ? 396  GLU A O   1 
ATOM   642  C CB  . GLU A 1 97  ? -18.081 49.226 3.342   1.00 14.57 ? 396  GLU A CB  1 
ATOM   643  C CG  . GLU A 1 97  ? -18.342 48.773 4.761   1.00 15.13 ? 396  GLU A CG  1 
ATOM   644  C CD  . GLU A 1 97  ? -17.242 47.845 5.253   1.00 15.42 ? 396  GLU A CD  1 
ATOM   645  O OE1 . GLU A 1 97  ? -16.504 47.308 4.398   1.00 14.49 ? 396  GLU A OE1 1 
ATOM   646  O OE2 . GLU A 1 97  ? -17.143 47.674 6.484   1.00 14.99 ? 396  GLU A OE2 1 
ATOM   647  N N   . PHE A 1 98  ? -18.232 52.593 4.417   1.00 16.71 ? 397  PHE A N   1 
ATOM   648  C CA  . PHE A 1 98  ? -17.462 53.660 5.047   1.00 16.98 ? 397  PHE A CA  1 
ATOM   649  C C   . PHE A 1 98  ? -17.155 53.361 6.511   1.00 15.05 ? 397  PHE A C   1 
ATOM   650  O O   . PHE A 1 98  ? -17.950 52.803 7.259   1.00 15.90 ? 397  PHE A O   1 
ATOM   651  C CB  . PHE A 1 98  ? -18.132 55.043 4.970   1.00 19.26 ? 397  PHE A CB  1 
ATOM   652  C CG  . PHE A 1 98  ? -17.171 56.107 5.512   1.00 22.00 ? 397  PHE A CG  1 
ATOM   653  C CD1 . PHE A 1 98  ? -15.893 56.204 4.985   1.00 22.51 ? 397  PHE A CD1 1 
ATOM   654  C CD2 . PHE A 1 98  ? -17.541 56.979 6.521   1.00 23.48 ? 397  PHE A CD2 1 
ATOM   655  C CE1 . PHE A 1 98  ? -14.996 57.142 5.451   1.00 22.40 ? 397  PHE A CE1 1 
ATOM   656  C CE2 . PHE A 1 98  ? -16.645 57.922 6.991   1.00 23.83 ? 397  PHE A CE2 1 
ATOM   657  C CZ  . PHE A 1 98  ? -15.374 58.008 6.453   1.00 23.08 ? 397  PHE A CZ  1 
ATOM   658  N N   . LEU A 1 99  ? -15.950 53.761 6.921   1.00 14.22 ? 398  LEU A N   1 
ATOM   659  C CA  . LEU A 1 99  ? -15.485 53.443 8.271   1.00 13.37 ? 398  LEU A CA  1 
ATOM   660  C C   . LEU A 1 99  ? -14.817 54.649 8.883   1.00 12.26 ? 398  LEU A C   1 
ATOM   661  O O   . LEU A 1 99  ? -14.210 55.491 8.211   1.00 8.81  ? 398  LEU A O   1 
ATOM   662  C CB  . LEU A 1 99  ? -14.554 52.225 8.195   1.00 13.62 ? 398  LEU A CB  1 
ATOM   663  C CG  . LEU A 1 99  ? -15.282 50.920 7.832   1.00 13.50 ? 398  LEU A CG  1 
ATOM   664  C CD1 . LEU A 1 99  ? -14.995 50.569 6.373   1.00 16.19 ? 398  LEU A CD1 1 
ATOM   665  C CD2 . LEU A 1 99  ? -14.917 49.784 8.764   1.00 9.57  ? 398  LEU A CD2 1 
ATOM   666  N N   . GLU A 1 100 ? -14.923 54.795 10.212  1.00 12.13 ? 399  GLU A N   1 
ATOM   667  C CA  . GLU A 1 100 ? -14.195 55.934 10.826  1.00 13.38 ? 399  GLU A CA  1 
ATOM   668  C C   . GLU A 1 100 ? -13.235 55.308 11.823  1.00 13.55 ? 399  GLU A C   1 
ATOM   669  O O   . GLU A 1 100 ? -13.662 54.557 12.702  1.00 14.13 ? 399  GLU A O   1 
ATOM   670  C CB  . GLU A 1 100 ? -15.132 56.966 11.412  1.00 13.42 ? 399  GLU A CB  1 
ATOM   671  C CG  . GLU A 1 100 ? -15.764 57.897 10.376  1.00 13.40 ? 399  GLU A CG  1 
ATOM   672  C CD  . GLU A 1 100 ? -16.745 58.866 10.999  1.00 11.90 ? 399  GLU A CD  1 
ATOM   673  O OE1 . GLU A 1 100 ? -16.440 60.077 11.028  1.00 9.22  ? 399  GLU A OE1 1 
ATOM   674  O OE2 . GLU A 1 100 ? -17.811 58.417 11.467  1.00 9.26  ? 399  GLU A OE2 1 
ATOM   675  N N   . GLY A 1 101 ? -11.946 55.558 11.657  1.00 13.87 ? 400  GLY A N   1 
ATOM   676  C CA  . GLY A 1 101 ? -10.931 54.779 12.343  1.00 15.81 ? 400  GLY A CA  1 
ATOM   677  C C   . GLY A 1 101 ? -9.519  54.860 11.814  1.00 15.25 ? 400  GLY A C   1 
ATOM   678  O O   . GLY A 1 101 ? -8.605  54.429 12.524  1.00 13.25 ? 400  GLY A O   1 
ATOM   679  N N   . GLY A 1 102 ? -9.317  55.386 10.619  1.00 15.18 ? 401  GLY A N   1 
ATOM   680  C CA  . GLY A 1 102 ? -8.038  55.747 10.093  1.00 16.17 ? 401  GLY A CA  1 
ATOM   681  C C   . GLY A 1 102 ? -7.140  54.632 9.607   1.00 17.47 ? 401  GLY A C   1 
ATOM   682  O O   . GLY A 1 102 ? -7.532  53.464 9.563   1.00 17.97 ? 401  GLY A O   1 
ATOM   683  N N   . ALA A 1 103 ? -5.918  55.003 9.215   1.00 17.25 ? 402  ALA A N   1 
ATOM   684  C CA  . ALA A 1 103 ? -4.952  54.057 8.697   1.00 16.41 ? 402  ALA A CA  1 
ATOM   685  C C   . ALA A 1 103 ? -3.810  53.848 9.691   1.00 15.11 ? 402  ALA A C   1 
ATOM   686  O O   . ALA A 1 103 ? -3.501  54.700 10.518  1.00 11.90 ? 402  ALA A O   1 
ATOM   687  C CB  . ALA A 1 103 ? -4.375  54.490 7.354   1.00 18.35 ? 402  ALA A CB  1 
ATOM   688  N N   . LEU A 1 104 ? -3.172  52.682 9.576   1.00 14.08 ? 403  LEU A N   1 
ATOM   689  C CA  . LEU A 1 104 ? -2.120  52.282 10.497  1.00 10.63 ? 403  LEU A CA  1 
ATOM   690  C C   . LEU A 1 104 ? -0.922  53.218 10.461  1.00 7.97  ? 403  LEU A C   1 
ATOM   691  O O   . LEU A 1 104 ? -0.098  53.258 11.380  1.00 6.14  ? 403  LEU A O   1 
ATOM   692  C CB  . LEU A 1 104 ? -1.722  50.839 10.158  1.00 10.87 ? 403  LEU A CB  1 
ATOM   693  C CG  . LEU A 1 104 ? -1.047  50.088 11.317  1.00 10.05 ? 403  LEU A CG  1 
ATOM   694  C CD1 . LEU A 1 104 ? -2.094  49.746 12.364  1.00 8.52  ? 403  LEU A CD1 1 
ATOM   695  C CD2 . LEU A 1 104 ? -0.319  48.856 10.817  1.00 4.63  ? 403  LEU A CD2 1 
ATOM   696  N N   . THR A 1 105 ? -0.827  54.006 9.395   1.00 7.08  ? 404  THR A N   1 
ATOM   697  C CA  . THR A 1 105 ? 0.212   55.014 9.263   1.00 6.56  ? 404  THR A CA  1 
ATOM   698  C C   . THR A 1 105 ? 0.124   56.126 10.285  1.00 7.22  ? 404  THR A C   1 
ATOM   699  O O   . THR A 1 105 ? 1.148   56.670 10.713  1.00 5.95  ? 404  THR A O   1 
ATOM   700  C CB  . THR A 1 105 ? 0.169   55.619 7.844   1.00 4.71  ? 404  THR A CB  1 
ATOM   701  O OG1 . THR A 1 105 ? 0.401   54.576 6.887   1.00 5.24  ? 404  THR A OG1 1 
ATOM   702  C CG2 . THR A 1 105 ? 1.271   56.647 7.654   1.00 4.16  ? 404  THR A CG2 1 
ATOM   703  N N   . ASP A 1 106 ? -1.084  56.502 10.706  1.00 8.90  ? 405  ASP A N   1 
ATOM   704  C CA  . ASP A 1 106 ? -1.186  57.507 11.777  1.00 10.28 ? 405  ASP A CA  1 
ATOM   705  C C   . ASP A 1 106 ? -0.730  56.938 13.117  1.00 10.26 ? 405  ASP A C   1 
ATOM   706  O O   . ASP A 1 106 ? -0.540  57.672 14.091  1.00 8.62  ? 405  ASP A O   1 
ATOM   707  C CB  . ASP A 1 106 ? -2.598  58.053 11.913  1.00 11.46 ? 405  ASP A CB  1 
ATOM   708  C CG  . ASP A 1 106 ? -3.183  58.555 10.622  1.00 13.12 ? 405  ASP A CG  1 
ATOM   709  O OD1 . ASP A 1 106 ? -4.429  58.600 10.528  1.00 17.24 ? 405  ASP A OD1 1 
ATOM   710  O OD2 . ASP A 1 106 ? -2.483  58.928 9.661   1.00 20.27 ? 405  ASP A OD2 1 
ATOM   711  N N   . ILE A 1 107 ? -0.544  55.622 13.176  1.00 11.59 ? 406  ILE A N   1 
ATOM   712  C CA  . ILE A 1 107 ? -0.142  54.986 14.433  1.00 13.56 ? 406  ILE A CA  1 
ATOM   713  C C   . ILE A 1 107 ? 1.366   54.740 14.437  1.00 14.44 ? 406  ILE A C   1 
ATOM   714  O O   . ILE A 1 107 ? 2.100   55.295 15.261  1.00 14.69 ? 406  ILE A O   1 
ATOM   715  C CB  . ILE A 1 107 ? -0.887  53.668 14.699  1.00 14.53 ? 406  ILE A CB  1 
ATOM   716  C CG1 . ILE A 1 107 ? -2.352  53.789 15.111  1.00 14.79 ? 406  ILE A CG1 1 
ATOM   717  C CG2 . ILE A 1 107 ? -0.127  52.860 15.746  1.00 15.01 ? 406  ILE A CG2 1 
ATOM   718  C CD1 . ILE A 1 107 ? -3.084  55.024 14.643  1.00 15.62 ? 406  ILE A CD1 1 
ATOM   719  N N   . VAL A 1 108 ? 1.822   53.907 13.513  1.00 15.60 ? 407  VAL A N   1 
ATOM   720  C CA  . VAL A 1 108 ? 3.217   53.519 13.403  1.00 16.45 ? 407  VAL A CA  1 
ATOM   721  C C   . VAL A 1 108 ? 4.175   54.685 13.489  1.00 16.10 ? 407  VAL A C   1 
ATOM   722  O O   . VAL A 1 108 ? 5.275   54.551 14.023  1.00 13.93 ? 407  VAL A O   1 
ATOM   723  C CB  . VAL A 1 108 ? 3.369   52.762 12.064  1.00 17.03 ? 407  VAL A CB  1 
ATOM   724  C CG1 . VAL A 1 108 ? 4.753   52.745 11.460  1.00 18.24 ? 407  VAL A CG1 1 
ATOM   725  C CG2 . VAL A 1 108 ? 2.891   51.334 12.338  1.00 15.32 ? 407  VAL A CG2 1 
ATOM   726  N N   . THR A 1 109 ? 3.790   55.829 12.936  1.00 17.22 ? 408  THR A N   1 
ATOM   727  C CA  . THR A 1 109 ? 4.749   56.925 12.767  1.00 18.44 ? 408  THR A CA  1 
ATOM   728  C C   . THR A 1 109 ? 5.096   57.665 14.038  1.00 19.91 ? 408  THR A C   1 
ATOM   729  O O   . THR A 1 109 ? 6.133   58.342 14.082  1.00 27.04 ? 408  THR A O   1 
ATOM   730  C CB  . THR A 1 109 ? 4.217   57.913 11.703  1.00 17.33 ? 408  THR A CB  1 
ATOM   731  O OG1 . THR A 1 109 ? 2.856   58.245 11.967  1.00 18.83 ? 408  THR A OG1 1 
ATOM   732  C CG2 . THR A 1 109 ? 4.253   57.233 10.342  1.00 16.11 ? 408  THR A CG2 1 
ATOM   733  N N   . HIS A 1 110 ? 4.278   57.569 15.079  1.00 19.16 ? 409  HIS A N   1 
ATOM   734  C CA  . HIS A 1 110 ? 4.552   58.353 16.294  1.00 19.49 ? 409  HIS A CA  1 
ATOM   735  C C   . HIS A 1 110 ? 4.819   57.507 17.524  1.00 20.75 ? 409  HIS A C   1 
ATOM   736  O O   . HIS A 1 110 ? 5.745   57.798 18.297  1.00 21.95 ? 409  HIS A O   1 
ATOM   737  C CB  . HIS A 1 110 ? 3.402   59.322 16.608  1.00 19.67 ? 409  HIS A CB  1 
ATOM   738  C CG  . HIS A 1 110 ? 3.059   60.197 15.442  1.00 19.54 ? 409  HIS A CG  1 
ATOM   739  N ND1 . HIS A 1 110 ? 3.625   61.427 15.225  1.00 19.60 ? 409  HIS A ND1 1 
ATOM   740  C CD2 . HIS A 1 110 ? 2.197   59.985 14.420  1.00 18.94 ? 409  HIS A CD2 1 
ATOM   741  C CE1 . HIS A 1 110 ? 3.123   61.944 14.116  1.00 19.81 ? 409  HIS A CE1 1 
ATOM   742  N NE2 . HIS A 1 110 ? 2.254   61.086 13.607  1.00 18.97 ? 409  HIS A NE2 1 
ATOM   743  N N   . THR A 1 111 ? 4.027   56.456 17.740  1.00 20.78 ? 410  THR A N   1 
ATOM   744  C CA  . THR A 1 111 ? 4.255   55.608 18.919  1.00 21.62 ? 410  THR A CA  1 
ATOM   745  C C   . THR A 1 111 ? 4.785   54.221 18.543  1.00 22.90 ? 410  THR A C   1 
ATOM   746  O O   . THR A 1 111 ? 4.918   53.878 17.370  1.00 22.85 ? 410  THR A O   1 
ATOM   747  C CB  . THR A 1 111 ? 2.998   55.462 19.797  1.00 20.68 ? 410  THR A CB  1 
ATOM   748  O OG1 . THR A 1 111 ? 1.896   54.956 19.029  1.00 25.38 ? 410  THR A OG1 1 
ATOM   749  C CG2 . THR A 1 111 ? 2.571   56.814 20.353  1.00 17.84 ? 410  THR A CG2 1 
ATOM   750  N N   . ARG A 1 112 ? 5.088   53.432 19.569  1.00 23.72 ? 411  ARG A N   1 
ATOM   751  C CA  . ARG A 1 112 ? 5.654   52.099 19.395  1.00 23.96 ? 411  ARG A CA  1 
ATOM   752  C C   . ARG A 1 112 ? 4.639   51.017 19.755  1.00 23.76 ? 411  ARG A C   1 
ATOM   753  O O   . ARG A 1 112 ? 4.264   50.853 20.914  1.00 24.79 ? 411  ARG A O   1 
ATOM   754  C CB  . ARG A 1 112 ? 6.933   51.996 20.219  1.00 24.52 ? 411  ARG A CB  1 
ATOM   755  C CG  . ARG A 1 112 ? 6.992   51.124 21.453  1.00 24.71 ? 411  ARG A CG  1 
ATOM   756  C CD  . ARG A 1 112 ? 6.428   51.818 22.686  1.00 25.03 ? 411  ARG A CD  1 
ATOM   757  N NE  . ARG A 1 112 ? 6.645   51.049 23.898  1.00 25.08 ? 411  ARG A NE  1 
ATOM   758  C CZ  . ARG A 1 112 ? 5.796   50.269 24.543  1.00 24.18 ? 411  ARG A CZ  1 
ATOM   759  N NH1 . ARG A 1 112 ? 4.550   50.077 24.138  1.00 22.61 ? 411  ARG A NH1 1 
ATOM   760  N NH2 . ARG A 1 112 ? 6.230   49.661 25.642  1.00 24.18 ? 411  ARG A NH2 1 
ATOM   761  N N   . MET A 1 113 ? 4.185   50.285 18.740  1.00 23.30 ? 412  MET A N   1 
ATOM   762  C CA  . MET A 1 113 ? 3.257   49.184 18.915  1.00 22.60 ? 412  MET A CA  1 
ATOM   763  C C   . MET A 1 113 ? 3.864   48.033 19.720  1.00 22.99 ? 412  MET A C   1 
ATOM   764  O O   . MET A 1 113 ? 5.069   47.974 19.962  1.00 24.94 ? 412  MET A O   1 
ATOM   765  C CB  . MET A 1 113 ? 2.798   48.644 17.557  1.00 22.28 ? 412  MET A CB  1 
ATOM   766  C CG  . MET A 1 113 ? 1.488   49.237 17.068  1.00 22.57 ? 412  MET A CG  1 
ATOM   767  S SD  . MET A 1 113 ? 1.121   48.862 15.346  1.00 23.62 ? 412  MET A SD  1 
ATOM   768  C CE  . MET A 1 113 ? 0.301   47.277 15.479  1.00 20.40 ? 412  MET A CE  1 
ATOM   769  N N   . ASN A 1 114 ? 3.001   47.102 20.126  1.00 21.23 ? 413  ASN A N   1 
ATOM   770  C CA  . ASN A 1 114 ? 3.459   45.905 20.839  1.00 18.10 ? 413  ASN A CA  1 
ATOM   771  C C   . ASN A 1 114 ? 3.100   44.691 19.993  1.00 15.71 ? 413  ASN A C   1 
ATOM   772  O O   . ASN A 1 114 ? 2.385   44.843 18.996  1.00 12.77 ? 413  ASN A O   1 
ATOM   773  C CB  . ASN A 1 114 ? 2.859   45.946 22.227  1.00 17.93 ? 413  ASN A CB  1 
ATOM   774  C CG  . ASN A 1 114 ? 1.783   44.985 22.626  1.00 17.10 ? 413  ASN A CG  1 
ATOM   775  O OD1 . ASN A 1 114 ? 2.130   43.861 22.999  1.00 19.47 ? 413  ASN A OD1 1 
ATOM   776  N ND2 . ASN A 1 114 ? 0.507   45.355 22.614  1.00 10.05 ? 413  ASN A ND2 1 
ATOM   777  N N   . GLU A 1 115 ? 3.585   43.524 20.383  1.00 13.03 ? 414  GLU A N   1 
ATOM   778  C CA  . GLU A 1 115 ? 3.342   42.285 19.664  1.00 11.97 ? 414  GLU A CA  1 
ATOM   779  C C   . GLU A 1 115 ? 1.881   41.871 19.604  1.00 9.86  ? 414  GLU A C   1 
ATOM   780  O O   . GLU A 1 115 ? 1.441   41.236 18.640  1.00 7.24  ? 414  GLU A O   1 
ATOM   781  C CB  . GLU A 1 115 ? 4.170   41.150 20.302  1.00 13.13 ? 414  GLU A CB  1 
ATOM   782  C CG  . GLU A 1 115 ? 5.655   41.432 20.408  1.00 13.79 ? 414  GLU A CG  1 
ATOM   783  C CD  . GLU A 1 115 ? 6.530   40.658 19.445  1.00 14.58 ? 414  GLU A CD  1 
ATOM   784  O OE1 . GLU A 1 115 ? 5.988   39.853 18.654  1.00 14.07 ? 414  GLU A OE1 1 
ATOM   785  O OE2 . GLU A 1 115 ? 7.764   40.863 19.455  1.00 17.16 ? 414  GLU A OE2 1 
ATOM   786  N N   . GLU A 1 116 ? 1.106   42.232 20.624  1.00 10.39 ? 415  GLU A N   1 
ATOM   787  C CA  . GLU A 1 116 ? -0.327  41.904 20.612  1.00 10.40 ? 415  GLU A CA  1 
ATOM   788  C C   . GLU A 1 116 ? -1.049  42.681 19.509  1.00 8.15  ? 415  GLU A C   1 
ATOM   789  O O   . GLU A 1 116 ? -1.784  42.073 18.743  1.00 7.13  ? 415  GLU A O   1 
ATOM   790  C CB  . GLU A 1 116 ? -0.973  42.179 21.974  1.00 11.77 ? 415  GLU A CB  1 
ATOM   791  C CG  . GLU A 1 116 ? -2.355  42.812 21.823  1.00 12.64 ? 415  GLU A CG  1 
ATOM   792  C CD  . GLU A 1 116 ? -3.178  42.754 23.086  1.00 14.08 ? 415  GLU A CD  1 
ATOM   793  O OE1 . GLU A 1 116 ? -2.769  43.433 24.052  1.00 16.81 ? 415  GLU A OE1 1 
ATOM   794  O OE2 . GLU A 1 116 ? -4.207  42.043 23.082  1.00 17.27 ? 415  GLU A OE2 1 
ATOM   795  N N   . GLN A 1 117 ? -0.839  43.978 19.471  1.00 8.97  ? 416  GLN A N   1 
ATOM   796  C CA  . GLN A 1 117 ? -1.323  44.862 18.430  1.00 10.87 ? 416  GLN A CA  1 
ATOM   797  C C   . GLN A 1 117 ? -0.728  44.537 17.069  1.00 11.12 ? 416  GLN A C   1 
ATOM   798  O O   . GLN A 1 117 ? -1.428  44.429 16.061  1.00 8.06  ? 416  GLN A O   1 
ATOM   799  C CB  . GLN A 1 117 ? -0.969  46.319 18.787  1.00 12.42 ? 416  GLN A CB  1 
ATOM   800  C CG  . GLN A 1 117 ? -1.898  46.935 19.802  1.00 13.02 ? 416  GLN A CG  1 
ATOM   801  C CD  . GLN A 1 117 ? -1.206  47.674 20.928  1.00 13.99 ? 416  GLN A CD  1 
ATOM   802  O OE1 . GLN A 1 117 ? -0.047  48.089 20.852  1.00 13.60 ? 416  GLN A OE1 1 
ATOM   803  N NE2 . GLN A 1 117 ? -1.978  47.837 22.003  1.00 14.48 ? 416  GLN A NE2 1 
ATOM   804  N N   . ILE A 1 118 ? 0.599   44.388 17.027  1.00 11.56 ? 417  ILE A N   1 
ATOM   805  C CA  . ILE A 1 118 ? 1.259   43.944 15.808  1.00 10.51 ? 417  ILE A CA  1 
ATOM   806  C C   . ILE A 1 118 ? 0.675   42.633 15.284  1.00 11.28 ? 417  ILE A C   1 
ATOM   807  O O   . ILE A 1 118 ? 0.332   42.471 14.113  1.00 6.42  ? 417  ILE A O   1 
ATOM   808  C CB  . ILE A 1 118 ? 2.765   43.690 16.014  1.00 8.50  ? 417  ILE A CB  1 
ATOM   809  C CG1 . ILE A 1 118 ? 3.612   44.915 16.315  1.00 8.27  ? 417  ILE A CG1 1 
ATOM   810  C CG2 . ILE A 1 118 ? 3.270   42.927 14.793  1.00 5.69  ? 417  ILE A CG2 1 
ATOM   811  C CD1 . ILE A 1 118 ? 4.903   44.617 17.044  1.00 10.04 ? 417  ILE A CD1 1 
ATOM   812  N N   . ALA A 1 119 ? 0.583   41.644 16.185  1.00 13.23 ? 418  ALA A N   1 
ATOM   813  C CA  . ALA A 1 119 ? 0.177   40.300 15.750  1.00 14.36 ? 418  ALA A CA  1 
ATOM   814  C C   . ALA A 1 119 ? -1.223  40.334 15.138  1.00 14.67 ? 418  ALA A C   1 
ATOM   815  O O   . ALA A 1 119 ? -1.508  39.586 14.200  1.00 15.22 ? 418  ALA A O   1 
ATOM   816  C CB  . ALA A 1 119 ? 0.290   39.348 16.924  1.00 16.87 ? 418  ALA A CB  1 
ATOM   817  N N   . ALA A 1 120 ? -2.056  41.214 15.664  1.00 14.41 ? 419  ALA A N   1 
ATOM   818  C CA  . ALA A 1 120 ? -3.408  41.451 15.212  1.00 13.93 ? 419  ALA A CA  1 
ATOM   819  C C   . ALA A 1 120 ? -3.525  42.120 13.855  1.00 12.13 ? 419  ALA A C   1 
ATOM   820  O O   . ALA A 1 120 ? -4.457  41.851 13.092  1.00 8.56  ? 419  ALA A O   1 
ATOM   821  C CB  . ALA A 1 120 ? -4.116  42.313 16.264  1.00 16.35 ? 419  ALA A CB  1 
ATOM   822  N N   . VAL A 1 121 ? -2.585  43.011 13.533  1.00 11.14 ? 420  VAL A N   1 
ATOM   823  C CA  . VAL A 1 121 ? -2.589  43.619 12.200  1.00 10.78 ? 420  VAL A CA  1 
ATOM   824  C C   . VAL A 1 121 ? -2.121  42.576 11.184  1.00 9.99  ? 420  VAL A C   1 
ATOM   825  O O   . VAL A 1 121 ? -2.641  42.466 10.066  1.00 9.47  ? 420  VAL A O   1 
ATOM   826  C CB  . VAL A 1 121 ? -1.731  44.889 12.115  1.00 10.35 ? 420  VAL A CB  1 
ATOM   827  C CG1 . VAL A 1 121 ? -1.824  45.496 10.720  1.00 12.45 ? 420  VAL A CG1 1 
ATOM   828  C CG2 . VAL A 1 121 ? -2.176  45.911 13.144  1.00 7.74  ? 420  VAL A CG2 1 
ATOM   829  N N   . CYS A 1 122 ? -1.132  41.788 11.590  1.00 9.51  ? 421  CYS A N   1 
ATOM   830  C CA  . CYS A 1 122 ? -0.570  40.758 10.717  1.00 9.39  ? 421  CYS A CA  1 
ATOM   831  C C   . CYS A 1 122 ? -1.605  39.714 10.341  1.00 8.09  ? 421  CYS A C   1 
ATOM   832  O O   . CYS A 1 122 ? -1.951  39.622 9.157   1.00 12.09 ? 421  CYS A O   1 
ATOM   833  C CB  . CYS A 1 122 ? 0.657   40.091 11.345  1.00 10.00 ? 421  CYS A CB  1 
ATOM   834  S SG  . CYS A 1 122 ? 2.136   41.119 11.522  1.00 16.01 ? 421  CYS A SG  1 
ATOM   835  N N   . LEU A 1 123 ? -2.099  38.933 11.293  1.00 8.12  ? 422  LEU A N   1 
ATOM   836  C CA  . LEU A 1 123 ? -3.061  37.865 10.922  1.00 9.33  ? 422  LEU A CA  1 
ATOM   837  C C   . LEU A 1 123 ? -4.294  38.456 10.248  1.00 9.82  ? 422  LEU A C   1 
ATOM   838  O O   . LEU A 1 123 ? -4.855  37.856 9.324   1.00 11.63 ? 422  LEU A O   1 
ATOM   839  C CB  . LEU A 1 123 ? -3.435  36.966 12.090  1.00 10.36 ? 422  LEU A CB  1 
ATOM   840  C CG  . LEU A 1 123 ? -4.647  36.036 11.930  1.00 10.16 ? 422  LEU A CG  1 
ATOM   841  C CD1 . LEU A 1 123 ? -4.322  34.564 12.122  1.00 7.28  ? 422  LEU A CD1 1 
ATOM   842  C CD2 . LEU A 1 123 ? -5.736  36.467 12.905  1.00 8.71  ? 422  LEU A CD2 1 
ATOM   843  N N   . ALA A 1 124 ? -4.739  39.624 10.700  1.00 10.69 ? 423  ALA A N   1 
ATOM   844  C CA  . ALA A 1 124 ? -5.866  40.290 10.037  1.00 10.40 ? 423  ALA A CA  1 
ATOM   845  C C   . ALA A 1 124 ? -5.617  40.423 8.529   1.00 10.97 ? 423  ALA A C   1 
ATOM   846  O O   . ALA A 1 124 ? -6.457  40.009 7.732   1.00 11.11 ? 423  ALA A O   1 
ATOM   847  C CB  . ALA A 1 124 ? -6.115  41.653 10.645  1.00 11.50 ? 423  ALA A CB  1 
ATOM   848  N N   . VAL A 1 125 ? -4.471  40.978 8.196   1.00 11.61 ? 424  VAL A N   1 
ATOM   849  C CA  . VAL A 1 125 ? -3.972  41.178 6.860   1.00 10.76 ? 424  VAL A CA  1 
ATOM   850  C C   . VAL A 1 125 ? -3.872  39.854 6.101   1.00 10.64 ? 424  VAL A C   1 
ATOM   851  O O   . VAL A 1 125 ? -4.082  39.796 4.888   1.00 12.27 ? 424  VAL A O   1 
ATOM   852  C CB  . VAL A 1 125 ? -2.550  41.792 6.888   1.00 11.58 ? 424  VAL A CB  1 
ATOM   853  C CG1 . VAL A 1 125 ? -1.929  41.686 5.502   1.00 13.64 ? 424  VAL A CG1 1 
ATOM   854  C CG2 . VAL A 1 125 ? -2.529  43.233 7.367   1.00 7.94  ? 424  VAL A CG2 1 
ATOM   855  N N   . LEU A 1 126 ? -3.532  38.807 6.837   1.00 11.21 ? 425  LEU A N   1 
ATOM   856  C CA  . LEU A 1 126 ? -3.354  37.468 6.326   1.00 12.10 ? 425  LEU A CA  1 
ATOM   857  C C   . LEU A 1 126 ? -4.674  36.762 6.059   1.00 12.50 ? 425  LEU A C   1 
ATOM   858  O O   . LEU A 1 126 ? -4.808  35.970 5.125   1.00 15.68 ? 425  LEU A O   1 
ATOM   859  C CB  . LEU A 1 126 ? -2.575  36.614 7.325   1.00 13.03 ? 425  LEU A CB  1 
ATOM   860  C CG  . LEU A 1 126 ? -1.060  36.563 7.280   1.00 13.45 ? 425  LEU A CG  1 
ATOM   861  C CD1 . LEU A 1 126 ? -0.535  35.721 8.433   1.00 5.99  ? 425  LEU A CD1 1 
ATOM   862  C CD2 . LEU A 1 126 ? -0.579  36.005 5.944   1.00 17.35 ? 425  LEU A CD2 1 
ATOM   863  N N   . GLN A 1 127 ? -5.674  37.030 6.903   1.00 13.64 ? 426  GLN A N   1 
ATOM   864  C CA  . GLN A 1 127 ? -6.999  36.452 6.682   1.00 14.23 ? 426  GLN A CA  1 
ATOM   865  C C   . GLN A 1 127 ? -7.519  36.862 5.316   1.00 13.05 ? 426  GLN A C   1 
ATOM   866  O O   . GLN A 1 127 ? -8.076  36.057 4.573   1.00 14.22 ? 426  GLN A O   1 
ATOM   867  C CB  . GLN A 1 127 ? -7.916  36.881 7.826   1.00 16.27 ? 426  GLN A CB  1 
ATOM   868  C CG  . GLN A 1 127 ? -8.211  35.823 8.851   1.00 18.00 ? 426  GLN A CG  1 
ATOM   869  C CD  . GLN A 1 127 ? -7.791  36.022 10.284  1.00 20.16 ? 426  GLN A CD  1 
ATOM   870  O OE1 . GLN A 1 127 ? -7.255  35.055 10.838  1.00 21.83 ? 426  GLN A OE1 1 
ATOM   871  N NE2 . GLN A 1 127 ? -7.986  37.171 10.917  1.00 23.16 ? 426  GLN A NE2 1 
ATOM   872  N N   . ALA A 1 128 ? -7.311  38.132 4.960   1.00 11.56 ? 427  ALA A N   1 
ATOM   873  C CA  . ALA A 1 128 ? -7.642  38.570 3.609   1.00 12.41 ? 427  ALA A CA  1 
ATOM   874  C C   . ALA A 1 128 ? -6.823  37.807 2.566   1.00 12.93 ? 427  ALA A C   1 
ATOM   875  O O   . ALA A 1 128 ? -7.422  37.043 1.814   1.00 12.28 ? 427  ALA A O   1 
ATOM   876  C CB  . ALA A 1 128 ? -7.462  40.071 3.482   1.00 14.59 ? 427  ALA A CB  1 
ATOM   877  N N   . LEU A 1 129 ? -5.524  38.016 2.535   1.00 13.98 ? 428  LEU A N   1 
ATOM   878  C CA  . LEU A 1 129 ? -4.636  37.490 1.516   1.00 13.62 ? 428  LEU A CA  1 
ATOM   879  C C   . LEU A 1 129 ? -4.911  36.015 1.179   1.00 12.62 ? 428  LEU A C   1 
ATOM   880  O O   . LEU A 1 129 ? -4.982  35.627 0.015   1.00 4.65  ? 428  LEU A O   1 
ATOM   881  C CB  . LEU A 1 129 ? -3.179  37.588 1.968   1.00 13.28 ? 428  LEU A CB  1 
ATOM   882  C CG  . LEU A 1 129 ? -2.472  38.933 1.949   1.00 11.59 ? 428  LEU A CG  1 
ATOM   883  C CD1 . LEU A 1 129 ? -0.970  38.729 2.142   1.00 10.48 ? 428  LEU A CD1 1 
ATOM   884  C CD2 . LEU A 1 129 ? -2.715  39.700 0.664   1.00 8.16  ? 428  LEU A CD2 1 
ATOM   885  N N   . SER A 1 130 ? -5.069  35.236 2.232   1.00 13.83 ? 429  SER A N   1 
ATOM   886  C CA  . SER A 1 130 ? -5.361  33.823 2.175   1.00 15.09 ? 429  SER A CA  1 
ATOM   887  C C   . SER A 1 130 ? -6.513  33.455 1.266   1.00 17.05 ? 429  SER A C   1 
ATOM   888  O O   . SER A 1 130 ? -6.490  32.399 0.624   1.00 19.60 ? 429  SER A O   1 
ATOM   889  C CB  . SER A 1 130 ? -5.652  33.313 3.602   1.00 15.51 ? 429  SER A CB  1 
ATOM   890  O OG  . SER A 1 130 ? -4.552  32.505 4.004   1.00 20.15 ? 429  SER A OG  1 
ATOM   891  N N   . VAL A 1 131 ? -7.545  34.298 1.188   1.00 17.94 ? 430  VAL A N   1 
ATOM   892  C CA  . VAL A 1 131 ? -8.632  33.985 0.235   1.00 17.73 ? 430  VAL A CA  1 
ATOM   893  C C   . VAL A 1 131 ? -8.476  34.777 -1.047  1.00 15.11 ? 430  VAL A C   1 
ATOM   894  O O   . VAL A 1 131 ? -8.768  34.313 -2.159  1.00 17.87 ? 430  VAL A O   1 
ATOM   895  C CB  . VAL A 1 131 ? -10.030 34.214 0.829   1.00 19.53 ? 430  VAL A CB  1 
ATOM   896  C CG1 . VAL A 1 131 ? -11.052 34.306 -0.295  1.00 20.31 ? 430  VAL A CG1 1 
ATOM   897  C CG2 . VAL A 1 131 ? -10.395 33.099 1.798   1.00 16.86 ? 430  VAL A CG2 1 
ATOM   898  N N   . LEU A 1 132 ? -7.986  36.015 -0.940  1.00 13.72 ? 431  LEU A N   1 
ATOM   899  C CA  . LEU A 1 132 ? -7.754  36.801 -2.160  1.00 13.16 ? 431  LEU A CA  1 
ATOM   900  C C   . LEU A 1 132 ? -6.817  36.069 -3.132  1.00 12.19 ? 431  LEU A C   1 
ATOM   901  O O   . LEU A 1 132 ? -6.905  36.252 -4.345  1.00 9.47  ? 431  LEU A O   1 
ATOM   902  C CB  . LEU A 1 132 ? -7.187  38.165 -1.807  1.00 13.76 ? 431  LEU A CB  1 
ATOM   903  C CG  . LEU A 1 132 ? -8.047  39.166 -1.047  1.00 14.08 ? 431  LEU A CG  1 
ATOM   904  C CD1 . LEU A 1 132 ? -7.171  40.277 -0.485  1.00 13.81 ? 431  LEU A CD1 1 
ATOM   905  C CD2 . LEU A 1 132 ? -9.134  39.784 -1.915  1.00 18.50 ? 431  LEU A CD2 1 
ATOM   906  N N   . HIS A 1 133 ? -5.934  35.253 -2.574  1.00 11.65 ? 432  HIS A N   1 
ATOM   907  C CA  . HIS A 1 133 ? -4.863  34.617 -3.332  1.00 11.85 ? 432  HIS A CA  1 
ATOM   908  C C   . HIS A 1 133 ? -5.305  33.348 -4.038  1.00 12.82 ? 432  HIS A C   1 
ATOM   909  O O   . HIS A 1 133 ? -5.201  33.253 -5.268  1.00 14.70 ? 432  HIS A O   1 
ATOM   910  C CB  . HIS A 1 133 ? -3.659  34.372 -2.405  1.00 9.06  ? 432  HIS A CB  1 
ATOM   911  C CG  . HIS A 1 133 ? -2.709  35.540 -2.395  1.00 6.93  ? 432  HIS A CG  1 
ATOM   912  N ND1 . HIS A 1 133 ? -1.707  35.704 -1.462  1.00 5.77  ? 432  HIS A ND1 1 
ATOM   913  C CD2 . HIS A 1 133 ? -2.608  36.612 -3.216  1.00 4.78  ? 432  HIS A CD2 1 
ATOM   914  C CE1 . HIS A 1 133 ? -1.035  36.812 -1.699  1.00 4.43  ? 432  HIS A CE1 1 
ATOM   915  N NE2 . HIS A 1 133 ? -1.570  37.381 -2.766  1.00 4.12  ? 432  HIS A NE2 1 
ATOM   916  N N   . ALA A 1 134 ? -5.818  32.371 -3.303  1.00 13.97 ? 433  ALA A N   1 
ATOM   917  C CA  . ALA A 1 134 ? -6.433  31.195 -3.930  1.00 15.92 ? 433  ALA A CA  1 
ATOM   918  C C   . ALA A 1 134 ? -7.454  31.599 -4.990  1.00 18.61 ? 433  ALA A C   1 
ATOM   919  O O   . ALA A 1 134 ? -7.621  30.982 -6.043  1.00 20.08 ? 433  ALA A O   1 
ATOM   920  C CB  . ALA A 1 134 ? -7.096  30.314 -2.891  1.00 10.28 ? 433  ALA A CB  1 
ATOM   921  N N   . GLN A 1 135 ? -8.148  32.708 -4.720  1.00 21.05 ? 434  GLN A N   1 
ATOM   922  C CA  . GLN A 1 135 ? -9.068  33.291 -5.682  1.00 22.49 ? 434  GLN A CA  1 
ATOM   923  C C   . GLN A 1 135 ? -8.342  33.925 -6.863  1.00 21.35 ? 434  GLN A C   1 
ATOM   924  O O   . GLN A 1 135 ? -9.011  34.442 -7.759  1.00 23.77 ? 434  GLN A O   1 
ATOM   925  C CB  . GLN A 1 135 ? -9.976  34.314 -4.972  1.00 24.72 ? 434  GLN A CB  1 
ATOM   926  C CG  . GLN A 1 135 ? -11.172 33.663 -4.297  1.00 26.90 ? 434  GLN A CG  1 
ATOM   927  C CD  . GLN A 1 135 ? -12.367 34.559 -4.067  1.00 28.60 ? 434  GLN A CD  1 
ATOM   928  O OE1 . GLN A 1 135 ? -12.786 35.361 -4.909  1.00 28.74 ? 434  GLN A OE1 1 
ATOM   929  N NE2 . GLN A 1 135 ? -12.933 34.396 -2.869  1.00 29.17 ? 434  GLN A NE2 1 
ATOM   930  N N   . GLY A 1 136 ? -7.023  33.884 -6.861  1.00 19.55 ? 435  GLY A N   1 
ATOM   931  C CA  . GLY A 1 136 ? -6.185  34.244 -7.974  1.00 18.04 ? 435  GLY A CA  1 
ATOM   932  C C   . GLY A 1 136 ? -5.896  35.714 -8.149  1.00 16.47 ? 435  GLY A C   1 
ATOM   933  O O   . GLY A 1 136 ? -5.708  36.198 -9.269  1.00 18.43 ? 435  GLY A O   1 
ATOM   934  N N   . VAL A 1 137 ? -5.867  36.460 -7.051  1.00 15.05 ? 436  VAL A N   1 
ATOM   935  C CA  . VAL A 1 137 ? -5.672  37.911 -7.119  1.00 12.32 ? 436  VAL A CA  1 
ATOM   936  C C   . VAL A 1 137 ? -4.521  38.316 -6.215  1.00 10.75 ? 436  VAL A C   1 
ATOM   937  O O   . VAL A 1 137 ? -4.253  37.602 -5.252  1.00 10.07 ? 436  VAL A O   1 
ATOM   938  C CB  . VAL A 1 137 ? -6.986  38.612 -6.727  1.00 11.41 ? 436  VAL A CB  1 
ATOM   939  C CG1 . VAL A 1 137 ? -6.799  39.990 -6.132  1.00 11.79 ? 436  VAL A CG1 1 
ATOM   940  C CG2 . VAL A 1 137 ? -7.853  38.670 -7.986  1.00 7.59  ? 436  VAL A CG2 1 
ATOM   941  N N   . ILE A 1 138 ? -3.869  39.420 -6.520  1.00 11.85 ? 437  ILE A N   1 
ATOM   942  C CA  . ILE A 1 138 ? -2.699  39.899 -5.801  1.00 12.09 ? 437  ILE A CA  1 
ATOM   943  C C   . ILE A 1 138 ? -2.792  41.403 -5.548  1.00 10.57 ? 437  ILE A C   1 
ATOM   944  O O   . ILE A 1 138 ? -2.972  42.134 -6.523  1.00 11.13 ? 437  ILE A O   1 
ATOM   945  C CB  . ILE A 1 138 ? -1.414  39.602 -6.605  1.00 13.10 ? 437  ILE A CB  1 
ATOM   946  C CG1 . ILE A 1 138 ? -1.406  38.229 -7.291  1.00 14.25 ? 437  ILE A CG1 1 
ATOM   947  C CG2 . ILE A 1 138 ? -0.147  39.740 -5.781  1.00 10.22 ? 437  ILE A CG2 1 
ATOM   948  C CD1 . ILE A 1 138 ? -0.563  38.192 -8.549  1.00 13.62 ? 437  ILE A CD1 1 
ATOM   949  N N   . HIS A 1 139 ? -2.664  41.819 -4.308  1.00 9.26  ? 438  HIS A N   1 
ATOM   950  C CA  . HIS A 1 139 ? -2.753  43.197 -3.876  1.00 9.22  ? 438  HIS A CA  1 
ATOM   951  C C   . HIS A 1 139 ? -1.741  44.104 -4.578  1.00 9.52  ? 438  HIS A C   1 
ATOM   952  O O   . HIS A 1 139 ? -2.146  45.051 -5.255  1.00 6.83  ? 438  HIS A O   1 
ATOM   953  C CB  . HIS A 1 139 ? -2.556  43.350 -2.364  1.00 10.78 ? 438  HIS A CB  1 
ATOM   954  C CG  . HIS A 1 139 ? -3.293  44.506 -1.756  1.00 12.20 ? 438  HIS A CG  1 
ATOM   955  N ND1 . HIS A 1 139 ? -2.768  45.756 -1.551  1.00 11.73 ? 438  HIS A ND1 1 
ATOM   956  C CD2 . HIS A 1 139 ? -4.566  44.592 -1.285  1.00 13.19 ? 438  HIS A CD2 1 
ATOM   957  C CE1 . HIS A 1 139 ? -3.658  46.556 -0.996  1.00 12.27 ? 438  HIS A CE1 1 
ATOM   958  N NE2 . HIS A 1 139 ? -4.770  45.875 -0.823  1.00 11.90 ? 438  HIS A NE2 1 
ATOM   959  N N   . ARG A 1 140 ? -0.465  43.810 -4.416  1.00 10.50 ? 439  ARG A N   1 
ATOM   960  C CA  . ARG A 1 140 ? 0.619   44.548 -5.054  1.00 9.29  ? 439  ARG A CA  1 
ATOM   961  C C   . ARG A 1 140 ? 0.901   45.938 -4.493  1.00 7.38  ? 439  ARG A C   1 
ATOM   962  O O   . ARG A 1 140 ? 1.764   46.626 -5.036  1.00 7.82  ? 439  ARG A O   1 
ATOM   963  C CB  . ARG A 1 140 ? 0.365   44.680 -6.558  1.00 9.50  ? 439  ARG A CB  1 
ATOM   964  C CG  . ARG A 1 140 ? 0.052   43.351 -7.237  1.00 10.29 ? 439  ARG A CG  1 
ATOM   965  C CD  . ARG A 1 140 ? -0.790  43.579 -8.484  1.00 9.73  ? 439  ARG A CD  1 
ATOM   966  N NE  . ARG A 1 140 ? -0.006  43.290 -9.674  1.00 8.27  ? 439  ARG A NE  1 
ATOM   967  C CZ  . ARG A 1 140 ? -0.209  43.718 -10.896 1.00 7.55  ? 439  ARG A CZ  1 
ATOM   968  N NH1 . ARG A 1 140 ? -1.205  44.518 -11.238 1.00 8.93  ? 439  ARG A NH1 1 
ATOM   969  N NH2 . ARG A 1 140 ? 0.650   43.311 -11.825 1.00 6.57  ? 439  ARG A NH2 1 
ATOM   970  N N   . ASP A 1 141 ? 0.233   46.333 -3.428  1.00 5.68  ? 440  ASP A N   1 
ATOM   971  C CA  . ASP A 1 141 ? 0.544   47.562 -2.710  1.00 5.02  ? 440  ASP A CA  1 
ATOM   972  C C   . ASP A 1 141 ? 0.359   47.404 -1.198  1.00 4.67  ? 440  ASP A C   1 
ATOM   973  O O   . ASP A 1 141 ? -0.178  48.291 -0.533  1.00 9.00  ? 440  ASP A O   1 
ATOM   974  C CB  . ASP A 1 141 ? -0.290  48.728 -3.250  1.00 4.74  ? 440  ASP A CB  1 
ATOM   975  C CG  . ASP A 1 141 ? 0.339   50.077 -2.956  1.00 5.41  ? 440  ASP A CG  1 
ATOM   976  O OD1 . ASP A 1 141 ? -0.348  51.102 -2.777  1.00 3.95  ? 440  ASP A OD1 1 
ATOM   977  O OD2 . ASP A 1 141 ? 1.589   50.122 -2.877  1.00 12.39 ? 440  ASP A OD2 1 
ATOM   978  N N   . ILE A 1 142 ? 0.819   46.285 -0.661  1.00 4.79  ? 441  ILE A N   1 
ATOM   979  C CA  . ILE A 1 142 ? 0.741   46.011 0.763   1.00 4.84  ? 441  ILE A CA  1 
ATOM   980  C C   . ILE A 1 142 ? 1.792   46.774 1.594   1.00 4.23  ? 441  ILE A C   1 
ATOM   981  O O   . ILE A 1 142 ? 2.987   46.599 1.373   1.00 4.11  ? 441  ILE A O   1 
ATOM   982  C CB  . ILE A 1 142 ? 0.898   44.505 1.062   1.00 4.95  ? 441  ILE A CB  1 
ATOM   983  C CG1 . ILE A 1 142 ? -0.062  43.622 0.263   1.00 4.76  ? 441  ILE A CG1 1 
ATOM   984  C CG2 . ILE A 1 142 ? 0.804   44.258 2.560   1.00 4.31  ? 441  ILE A CG2 1 
ATOM   985  C CD1 . ILE A 1 142 ? -1.377  43.369 0.956   1.00 4.49  ? 441  ILE A CD1 1 
ATOM   986  N N   . LYS A 1 143 ? 1.315   47.555 2.528   1.00 2.78  ? 442  LYS A N   1 
ATOM   987  C CA  . LYS A 1 143 ? 2.028   48.501 3.345   1.00 2.15  ? 442  LYS A CA  1 
ATOM   988  C C   . LYS A 1 143 ? 1.048   49.046 4.371   1.00 2.28  ? 442  LYS A C   1 
ATOM   989  O O   . LYS A 1 143 ? -0.169  48.892 4.204   1.00 7.23  ? 442  LYS A O   1 
ATOM   990  C CB  . LYS A 1 143 ? 2.610   49.638 2.518   1.00 2.24  ? 442  LYS A CB  1 
ATOM   991  C CG  . LYS A 1 143 ? 1.658   50.293 1.530   1.00 2.71  ? 442  LYS A CG  1 
ATOM   992  C CD  . LYS A 1 143 ? 2.256   51.569 0.966   1.00 2.03  ? 442  LYS A CD  1 
ATOM   993  C CE  . LYS A 1 143 ? 1.231   52.492 0.366   1.00 2.30  ? 442  LYS A CE  1 
ATOM   994  N NZ  . LYS A 1 143 ? 1.279   52.622 -1.105  1.00 3.52  ? 442  LYS A NZ  1 
ATOM   995  N N   . SER A 1 144 ? 1.530   49.663 5.445   1.00 2.03  ? 443  SER A N   1 
ATOM   996  C CA  . SER A 1 144 ? 0.573   50.176 6.448   1.00 3.72  ? 443  SER A CA  1 
ATOM   997  C C   . SER A 1 144 ? -0.439  51.147 5.840   1.00 5.76  ? 443  SER A C   1 
ATOM   998  O O   . SER A 1 144 ? -1.565  51.252 6.328   1.00 5.21  ? 443  SER A O   1 
ATOM   999  C CB  . SER A 1 144 ? 1.311   50.808 7.626   1.00 5.01  ? 443  SER A CB  1 
ATOM   1000 O OG  . SER A 1 144 ? 1.941   52.006 7.227   1.00 0.21  ? 443  SER A OG  1 
ATOM   1001 N N   . ASP A 1 145 ? -0.047  51.846 4.781   1.00 7.55  ? 444  ASP A N   1 
ATOM   1002 C CA  . ASP A 1 145 ? -0.871  52.911 4.218   1.00 9.54  ? 444  ASP A CA  1 
ATOM   1003 C C   . ASP A 1 145 ? -2.162  52.394 3.582   1.00 11.74 ? 444  ASP A C   1 
ATOM   1004 O O   . ASP A 1 145 ? -3.092  53.176 3.367   1.00 13.64 ? 444  ASP A O   1 
ATOM   1005 C CB  . ASP A 1 145 ? -0.081  53.716 3.195   1.00 9.31  ? 444  ASP A CB  1 
ATOM   1006 C CG  . ASP A 1 145 ? 1.154   54.437 3.667   1.00 10.18 ? 444  ASP A CG  1 
ATOM   1007 O OD1 . ASP A 1 145 ? 1.196   55.694 3.563   1.00 12.40 ? 444  ASP A OD1 1 
ATOM   1008 O OD2 . ASP A 1 145 ? 2.139   53.822 4.126   1.00 3.80  ? 444  ASP A OD2 1 
ATOM   1009 N N   . SER A 1 146 ? -2.207  51.106 3.285   1.00 11.92 ? 445  SER A N   1 
ATOM   1010 C CA  . SER A 1 146 ? -3.338  50.488 2.600   1.00 10.10 ? 445  SER A CA  1 
ATOM   1011 C C   . SER A 1 146 ? -4.216  49.692 3.563   1.00 9.32  ? 445  SER A C   1 
ATOM   1012 O O   . SER A 1 146 ? -5.039  48.861 3.175   1.00 4.31  ? 445  SER A O   1 
ATOM   1013 C CB  . SER A 1 146 ? -2.830  49.572 1.487   1.00 10.05 ? 445  SER A CB  1 
ATOM   1014 O OG  . SER A 1 146 ? -2.220  50.362 0.474   1.00 12.57 ? 445  SER A OG  1 
ATOM   1015 N N   . ILE A 1 147 ? -4.024  49.974 4.848   1.00 10.89 ? 446  ILE A N   1 
ATOM   1016 C CA  . ILE A 1 147 ? -4.785  49.347 5.913   1.00 10.52 ? 446  ILE A CA  1 
ATOM   1017 C C   . ILE A 1 147 ? -5.657  50.369 6.638   1.00 10.29 ? 446  ILE A C   1 
ATOM   1018 O O   . ILE A 1 147 ? -5.194  51.419 7.080   1.00 7.20  ? 446  ILE A O   1 
ATOM   1019 C CB  . ILE A 1 147 ? -3.882  48.659 6.951   1.00 9.68  ? 446  ILE A CB  1 
ATOM   1020 C CG1 . ILE A 1 147 ? -2.792  47.776 6.348   1.00 9.54  ? 446  ILE A CG1 1 
ATOM   1021 C CG2 . ILE A 1 147 ? -4.746  47.886 7.938   1.00 12.25 ? 446  ILE A CG2 1 
ATOM   1022 C CD1 . ILE A 1 147 ? -3.254  46.972 5.161   1.00 9.48  ? 446  ILE A CD1 1 
ATOM   1023 N N   . LEU A 1 148 ? -6.946  50.051 6.767   1.00 11.64 ? 447  LEU A N   1 
ATOM   1024 C CA  . LEU A 1 148 ? -7.870  50.942 7.460   1.00 12.24 ? 447  LEU A CA  1 
ATOM   1025 C C   . LEU A 1 148 ? -8.483  50.280 8.684   1.00 12.38 ? 447  LEU A C   1 
ATOM   1026 O O   . LEU A 1 148 ? -8.592  49.054 8.764   1.00 10.59 ? 447  LEU A O   1 
ATOM   1027 C CB  . LEU A 1 148 ? -8.943  51.388 6.461   1.00 13.02 ? 447  LEU A CB  1 
ATOM   1028 C CG  . LEU A 1 148 ? -8.401  52.286 5.339   1.00 13.25 ? 447  LEU A CG  1 
ATOM   1029 C CD1 . LEU A 1 148 ? -9.396  52.409 4.201   1.00 10.47 ? 447  LEU A CD1 1 
ATOM   1030 C CD2 . LEU A 1 148 ? -8.035  53.666 5.873   1.00 13.62 ? 447  LEU A CD2 1 
ATOM   1031 N N   . LEU A 1 149 ? -8.891  51.104 9.649   1.00 13.68 ? 448  LEU A N   1 
ATOM   1032 C CA  . LEU A 1 149 ? -9.499  50.593 10.873  1.00 14.85 ? 448  LEU A CA  1 
ATOM   1033 C C   . LEU A 1 149 ? -10.883 51.202 11.112  1.00 16.09 ? 448  LEU A C   1 
ATOM   1034 O O   . LEU A 1 149 ? -11.105 52.369 10.798  1.00 15.76 ? 448  LEU A O   1 
ATOM   1035 C CB  . LEU A 1 149 ? -8.578  50.840 12.073  1.00 14.53 ? 448  LEU A CB  1 
ATOM   1036 C CG  . LEU A 1 149 ? -7.130  51.214 11.722  1.00 14.51 ? 448  LEU A CG  1 
ATOM   1037 C CD1 . LEU A 1 149 ? -6.447  51.858 12.919  1.00 12.59 ? 448  LEU A CD1 1 
ATOM   1038 C CD2 . LEU A 1 149 ? -6.304  50.021 11.241  1.00 11.70 ? 448  LEU A CD2 1 
ATOM   1039 N N   . THR A 1 150 ? -11.774 50.397 11.651  1.00 17.41 ? 449  THR A N   1 
ATOM   1040 C CA  . THR A 1 150 ? -13.067 50.779 12.176  1.00 17.25 ? 449  THR A CA  1 
ATOM   1041 C C   . THR A 1 150 ? -12.853 51.619 13.435  1.00 17.82 ? 449  THR A C   1 
ATOM   1042 O O   . THR A 1 150 ? -11.735 51.645 13.958  1.00 16.04 ? 449  THR A O   1 
ATOM   1043 C CB  . THR A 1 150 ? -13.989 49.591 12.517  1.00 16.32 ? 449  THR A CB  1 
ATOM   1044 O OG1 . THR A 1 150 ? -13.595 48.950 13.740  1.00 11.44 ? 449  THR A OG1 1 
ATOM   1045 C CG2 . THR A 1 150 ? -13.976 48.408 11.542  1.00 13.05 ? 449  THR A CG2 1 
ATOM   1046 N N   . HIS A 1 151 ? -13.881 52.317 13.903  1.00 18.62 ? 450  HIS A N   1 
ATOM   1047 C CA  . HIS A 1 151 ? -13.699 53.142 15.114  1.00 18.23 ? 450  HIS A CA  1 
ATOM   1048 C C   . HIS A 1 151 ? -13.493 52.209 16.318  1.00 17.14 ? 450  HIS A C   1 
ATOM   1049 O O   . HIS A 1 151 ? -12.784 52.530 17.268  1.00 14.07 ? 450  HIS A O   1 
ATOM   1050 C CB  . HIS A 1 151 ? -14.861 54.096 15.340  1.00 18.77 ? 450  HIS A CB  1 
ATOM   1051 C CG  . HIS A 1 151 ? -14.629 55.047 16.483  1.00 19.68 ? 450  HIS A CG  1 
ATOM   1052 N ND1 . HIS A 1 151 ? -15.453 55.065 17.587  1.00 19.44 ? 450  HIS A ND1 1 
ATOM   1053 C CD2 . HIS A 1 151 ? -13.691 55.997 16.716  1.00 19.42 ? 450  HIS A CD2 1 
ATOM   1054 C CE1 . HIS A 1 151 ? -15.027 55.985 18.437  1.00 19.42 ? 450  HIS A CE1 1 
ATOM   1055 N NE2 . HIS A 1 151 ? -13.953 56.572 17.934  1.00 18.60 ? 450  HIS A NE2 1 
ATOM   1056 N N   . ASP A 1 152 ? -14.129 51.055 16.236  1.00 17.83 ? 451  ASP A N   1 
ATOM   1057 C CA  . ASP A 1 152 ? -14.102 50.015 17.228  1.00 18.35 ? 451  ASP A CA  1 
ATOM   1058 C C   . ASP A 1 152 ? -12.776 49.286 17.375  1.00 17.41 ? 451  ASP A C   1 
ATOM   1059 O O   . ASP A 1 152 ? -12.545 48.629 18.389  1.00 18.61 ? 451  ASP A O   1 
ATOM   1060 C CB  . ASP A 1 152 ? -15.191 48.986 16.845  1.00 19.77 ? 451  ASP A CB  1 
ATOM   1061 C CG  . ASP A 1 152 ? -15.429 47.956 17.927  1.00 20.59 ? 451  ASP A CG  1 
ATOM   1062 O OD1 . ASP A 1 152 ? -16.518 47.980 18.553  1.00 18.32 ? 451  ASP A OD1 1 
ATOM   1063 O OD2 . ASP A 1 152 ? -14.523 47.116 18.143  1.00 21.98 ? 451  ASP A OD2 1 
ATOM   1064 N N   . GLY A 1 153 ? -11.907 49.383 16.378  1.00 16.73 ? 452  GLY A N   1 
ATOM   1065 C CA  . GLY A 1 153 ? -10.655 48.685 16.334  1.00 15.48 ? 452  GLY A CA  1 
ATOM   1066 C C   . GLY A 1 153 ? -10.599 47.437 15.487  1.00 14.28 ? 452  GLY A C   1 
ATOM   1067 O O   . GLY A 1 153 ? -9.816  46.526 15.785  1.00 11.33 ? 452  GLY A O   1 
ATOM   1068 N N   . ARG A 1 154 ? -11.422 47.368 14.442  1.00 13.41 ? 453  ARG A N   1 
ATOM   1069 C CA  . ARG A 1 154 ? -11.391 46.193 13.561  1.00 11.91 ? 453  ARG A CA  1 
ATOM   1070 C C   . ARG A 1 154 ? -10.656 46.544 12.264  1.00 9.04  ? 453  ARG A C   1 
ATOM   1071 O O   . ARG A 1 154 ? -10.783 47.658 11.750  1.00 3.19  ? 453  ARG A O   1 
ATOM   1072 C CB  . ARG A 1 154 ? -12.765 45.614 13.247  1.00 14.43 ? 453  ARG A CB  1 
ATOM   1073 C CG  . ARG A 1 154 ? -13.812 45.812 14.322  1.00 16.81 ? 453  ARG A CG  1 
ATOM   1074 C CD  . ARG A 1 154 ? -15.216 45.492 13.846  1.00 18.87 ? 453  ARG A CD  1 
ATOM   1075 N NE  . ARG A 1 154 ? -16.247 46.485 14.103  1.00 20.24 ? 453  ARG A NE  1 
ATOM   1076 C CZ  . ARG A 1 154 ? -17.101 46.557 15.122  1.00 20.24 ? 453  ARG A CZ  1 
ATOM   1077 N NH1 . ARG A 1 154 ? -17.085 45.656 16.090  1.00 19.97 ? 453  ARG A NH1 1 
ATOM   1078 N NH2 . ARG A 1 154 ? -17.985 47.543 15.192  1.00 19.89 ? 453  ARG A NH2 1 
ATOM   1079 N N   . VAL A 1 155 ? -9.930  45.575 11.746  1.00 8.78  ? 454  VAL A N   1 
ATOM   1080 C CA  . VAL A 1 155 ? -8.859  45.737 10.790  1.00 8.20  ? 454  VAL A CA  1 
ATOM   1081 C C   . VAL A 1 155 ? -9.192  45.244 9.389   1.00 7.52  ? 454  VAL A C   1 
ATOM   1082 O O   . VAL A 1 155 ? -9.612  44.100 9.251   1.00 6.10  ? 454  VAL A O   1 
ATOM   1083 C CB  . VAL A 1 155 ? -7.638  44.951 11.330  1.00 9.06  ? 454  VAL A CB  1 
ATOM   1084 C CG1 . VAL A 1 155 ? -6.475  44.915 10.347  1.00 9.13  ? 454  VAL A CG1 1 
ATOM   1085 C CG2 . VAL A 1 155 ? -7.184  45.523 12.669  1.00 8.67  ? 454  VAL A CG2 1 
ATOM   1086 N N   . LYS A 1 156 ? -8.999  46.097 8.388   1.00 7.98  ? 455  LYS A N   1 
ATOM   1087 C CA  . LYS A 1 156 ? -9.312  45.759 7.008   1.00 8.24  ? 455  LYS A CA  1 
ATOM   1088 C C   . LYS A 1 156 ? -8.293  46.267 5.966   1.00 7.15  ? 455  LYS A C   1 
ATOM   1089 O O   . LYS A 1 156 ? -7.541  47.212 6.178   1.00 2.71  ? 455  LYS A O   1 
ATOM   1090 C CB  . LYS A 1 156 ? -10.681 46.280 6.555   1.00 8.13  ? 455  LYS A CB  1 
ATOM   1091 C CG  . LYS A 1 156 ? -11.638 46.777 7.608   1.00 8.12  ? 455  LYS A CG  1 
ATOM   1092 C CD  . LYS A 1 156 ? -13.088 46.501 7.266   1.00 7.95  ? 455  LYS A CD  1 
ATOM   1093 C CE  . LYS A 1 156 ? -13.748 45.717 8.396   1.00 7.71  ? 455  LYS A CE  1 
ATOM   1094 N NZ  . LYS A 1 156 ? -15.093 45.258 7.964   1.00 10.01 ? 455  LYS A NZ  1 
ATOM   1095 N N   . LEU A 1 157 ? -8.318  45.607 4.816   1.00 7.75  ? 456  LEU A N   1 
ATOM   1096 C CA  . LEU A 1 157 ? -7.439  45.857 3.707   1.00 8.97  ? 456  LEU A CA  1 
ATOM   1097 C C   . LEU A 1 157 ? -8.051  46.732 2.624   1.00 10.38 ? 456  LEU A C   1 
ATOM   1098 O O   . LEU A 1 157 ? -9.135  46.440 2.119   1.00 10.85 ? 456  LEU A O   1 
ATOM   1099 C CB  . LEU A 1 157 ? -7.041  44.505 3.088   1.00 8.26  ? 456  LEU A CB  1 
ATOM   1100 C CG  . LEU A 1 157 ? -5.910  44.518 2.072   1.00 7.83  ? 456  LEU A CG  1 
ATOM   1101 C CD1 . LEU A 1 157 ? -4.649  45.161 2.649   1.00 9.83  ? 456  LEU A CD1 1 
ATOM   1102 C CD2 . LEU A 1 157 ? -5.576  43.101 1.599   1.00 8.95  ? 456  LEU A CD2 1 
ATOM   1103 N N   . SER A 1 158 ? -7.353  47.806 2.256   1.00 11.30 ? 457  SER A N   1 
ATOM   1104 C CA  . SER A 1 158 ? -7.894  48.781 1.326   1.00 12.77 ? 457  SER A CA  1 
ATOM   1105 C C   . SER A 1 158 ? -7.083  48.881 0.028   1.00 11.71 ? 457  SER A C   1 
ATOM   1106 O O   . SER A 1 158 ? -6.138  48.120 -0.150  1.00 15.17 ? 457  SER A O   1 
ATOM   1107 C CB  . SER A 1 158 ? -7.949  50.172 1.968   1.00 15.18 ? 457  SER A CB  1 
ATOM   1108 O OG  . SER A 1 158 ? -9.174  50.865 1.690   1.00 19.60 ? 457  SER A OG  1 
ATOM   1109 N N   . ASP A 1 159 ? -7.490  49.793 -0.815  1.00 12.08 ? 458  ASP A N   1 
ATOM   1110 C CA  . ASP A 1 159 ? -6.780  50.351 -1.926  1.00 12.97 ? 458  ASP A CA  1 
ATOM   1111 C C   . ASP A 1 159 ? -6.279  49.352 -2.967  1.00 12.93 ? 458  ASP A C   1 
ATOM   1112 O O   . ASP A 1 159 ? -5.069  49.120 -3.063  1.00 12.09 ? 458  ASP A O   1 
ATOM   1113 C CB  . ASP A 1 159 ? -5.598  51.167 -1.347  1.00 14.21 ? 458  ASP A CB  1 
ATOM   1114 C CG  . ASP A 1 159 ? -6.063  52.584 -1.050  1.00 17.02 ? 458  ASP A CG  1 
ATOM   1115 O OD1 . ASP A 1 159 ? -6.055  53.005 0.125   1.00 20.43 ? 458  ASP A OD1 1 
ATOM   1116 O OD2 . ASP A 1 159 ? -6.448  53.278 -2.018  1.00 22.11 ? 458  ASP A OD2 1 
ATOM   1117 N N   . PHE A 1 160 ? -7.206  48.792 -3.729  1.00 11.50 ? 459  PHE A N   1 
ATOM   1118 C CA  . PHE A 1 160 ? -6.892  47.878 -4.819  1.00 9.19  ? 459  PHE A CA  1 
ATOM   1119 C C   . PHE A 1 160 ? -6.717  48.572 -6.162  1.00 8.52  ? 459  PHE A C   1 
ATOM   1120 O O   . PHE A 1 160 ? -7.060  48.021 -7.206  1.00 5.92  ? 459  PHE A O   1 
ATOM   1121 C CB  . PHE A 1 160 ? -7.968  46.793 -4.982  1.00 7.75  ? 459  PHE A CB  1 
ATOM   1122 C CG  . PHE A 1 160 ? -7.970  45.774 -3.858  1.00 6.49  ? 459  PHE A CG  1 
ATOM   1123 C CD1 . PHE A 1 160 ? -8.597  46.082 -2.655  1.00 6.14  ? 459  PHE A CD1 1 
ATOM   1124 C CD2 . PHE A 1 160 ? -7.359  44.539 -3.979  1.00 5.64  ? 459  PHE A CD2 1 
ATOM   1125 C CE1 . PHE A 1 160 ? -8.602  45.174 -1.615  1.00 4.62  ? 459  PHE A CE1 1 
ATOM   1126 C CE2 . PHE A 1 160 ? -7.373  43.637 -2.933  1.00 4.50  ? 459  PHE A CE2 1 
ATOM   1127 C CZ  . PHE A 1 160 ? -7.993  43.941 -1.744  1.00 2.83  ? 459  PHE A CZ  1 
ATOM   1128 N N   . GLY A 1 161 ? -6.162  49.779 -6.143  1.00 10.90 ? 460  GLY A N   1 
ATOM   1129 C CA  . GLY A 1 161 ? -5.893  50.518 -7.363  1.00 12.09 ? 460  GLY A CA  1 
ATOM   1130 C C   . GLY A 1 161 ? -4.784  49.920 -8.198  1.00 14.69 ? 460  GLY A C   1 
ATOM   1131 O O   . GLY A 1 161 ? -4.447  50.402 -9.292  1.00 9.61  ? 460  GLY A O   1 
ATOM   1132 N N   . PHE A 1 162 ? -4.161  48.850 -7.697  1.00 16.51 ? 461  PHE A N   1 
ATOM   1133 C CA  . PHE A 1 162 ? -3.017  48.268 -8.401  1.00 17.64 ? 461  PHE A CA  1 
ATOM   1134 C C   . PHE A 1 162 ? -3.181  46.788 -8.723  1.00 14.89 ? 461  PHE A C   1 
ATOM   1135 O O   . PHE A 1 162 ? -2.319  46.239 -9.412  1.00 13.54 ? 461  PHE A O   1 
ATOM   1136 C CB  . PHE A 1 162 ? -1.765  48.513 -7.554  1.00 20.05 ? 461  PHE A CB  1 
ATOM   1137 C CG  . PHE A 1 162 ? -1.187  49.920 -7.587  1.00 21.70 ? 461  PHE A CG  1 
ATOM   1138 C CD1 . PHE A 1 162 ? -1.655  50.925 -8.417  1.00 22.14 ? 461  PHE A CD1 1 
ATOM   1139 C CD2 . PHE A 1 162 ? -0.125  50.217 -6.743  1.00 22.07 ? 461  PHE A CD2 1 
ATOM   1140 C CE1 . PHE A 1 162 ? -1.086  52.179 -8.424  1.00 22.46 ? 461  PHE A CE1 1 
ATOM   1141 C CE2 . PHE A 1 162 ? 0.454   51.468 -6.741  1.00 22.72 ? 461  PHE A CE2 1 
ATOM   1142 C CZ  . PHE A 1 162 ? -0.025  52.456 -7.582  1.00 22.64 ? 461  PHE A CZ  1 
ATOM   1143 N N   . CYS A 1 163 ? -4.243  46.174 -8.246  1.00 13.17 ? 462  CYS A N   1 
ATOM   1144 C CA  . CYS A 1 163 ? -4.467  44.738 -8.377  1.00 12.64 ? 462  CYS A CA  1 
ATOM   1145 C C   . CYS A 1 163 ? -4.523  44.252 -9.822  1.00 11.20 ? 462  CYS A C   1 
ATOM   1146 O O   . CYS A 1 163 ? -4.386  45.041 -10.752 1.00 8.49  ? 462  CYS A O   1 
ATOM   1147 C CB  . CYS A 1 163 ? -5.757  44.359 -7.643  1.00 12.27 ? 462  CYS A CB  1 
ATOM   1148 S SG  . CYS A 1 163 ? -7.312  44.703 -8.491  1.00 3.30  ? 462  CYS A SG  1 
ATOM   1149 N N   . ALA A 1 164 ? -4.721  42.953 -10.001 1.00 10.85 ? 463  ALA A N   1 
ATOM   1150 C CA  . ALA A 1 164 ? -4.921  42.343 -11.303 1.00 11.14 ? 463  ALA A CA  1 
ATOM   1151 C C   . ALA A 1 164 ? -5.158  40.838 -11.191 1.00 11.32 ? 463  ALA A C   1 
ATOM   1152 O O   . ALA A 1 164 ? -4.731  40.230 -10.212 1.00 5.32  ? 463  ALA A O   1 
ATOM   1153 C CB  . ALA A 1 164 ? -3.744  42.575 -12.238 1.00 16.43 ? 463  ALA A CB  1 
ATOM   1154 N N   . GLN A 1 165 ? -5.808  40.261 -12.195 1.00 12.60 ? 464  GLN A N   1 
ATOM   1155 C CA  . GLN A 1 165 ? -6.203  38.858 -12.160 1.00 12.66 ? 464  GLN A CA  1 
ATOM   1156 C C   . GLN A 1 165 ? -5.314  37.949 -13.020 1.00 11.62 ? 464  GLN A C   1 
ATOM   1157 O O   . GLN A 1 165 ? -5.225  38.145 -14.227 1.00 14.59 ? 464  GLN A O   1 
ATOM   1158 C CB  . GLN A 1 165 ? -7.647  38.702 -12.632 1.00 13.30 ? 464  GLN A CB  1 
ATOM   1159 C CG  . GLN A 1 165 ? -8.176  37.286 -12.667 1.00 12.72 ? 464  GLN A CG  1 
ATOM   1160 C CD  . GLN A 1 165 ? -8.569  36.818 -11.279 1.00 11.32 ? 464  GLN A CD  1 
ATOM   1161 O OE1 . GLN A 1 165 ? -9.333  37.511 -10.612 1.00 10.80 ? 464  GLN A OE1 1 
ATOM   1162 N NE2 . GLN A 1 165 ? -8.058  35.665 -10.872 1.00 6.79  ? 464  GLN A NE2 1 
ATOM   1163 N N   . VAL A 1 166 ? -4.716  36.970 -12.380 1.00 9.92  ? 465  VAL A N   1 
ATOM   1164 C CA  . VAL A 1 166 ? -3.712  36.090 -12.930 1.00 7.33  ? 465  VAL A CA  1 
ATOM   1165 C C   . VAL A 1 166 ? -4.198  34.668 -13.183 1.00 8.13  ? 465  VAL A C   1 
ATOM   1166 O O   . VAL A 1 166 ? -5.396  34.430 -13.363 1.00 9.49  ? 465  VAL A O   1 
ATOM   1167 C CB  . VAL A 1 166 ? -2.538  36.031 -11.927 1.00 3.76  ? 465  VAL A CB  1 
ATOM   1168 C CG1 . VAL A 1 166 ? -2.352  34.610 -11.425 1.00 8.23  ? 465  VAL A CG1 1 
ATOM   1169 C CG2 . VAL A 1 166 ? -1.267  36.563 -12.547 1.00 3.16  ? 465  VAL A CG2 1 
ATOM   1170 N N   . GLU A 1 169 ? -0.969  28.621 -17.070 1.00 26.00 ? 468  GLU A N   1 
ATOM   1171 C CA  . GLU A 1 169 ? -1.814  29.478 -17.888 1.00 29.40 ? 468  GLU A CA  1 
ATOM   1172 C C   . GLU A 1 169 ? -1.284  30.926 -17.841 1.00 29.41 ? 468  GLU A C   1 
ATOM   1173 O O   . GLU A 1 169 ? -0.459  31.305 -18.674 1.00 29.78 ? 468  GLU A O   1 
ATOM   1174 C CB  . GLU A 1 169 ? -3.284  29.436 -17.519 1.00 30.63 ? 468  GLU A CB  1 
ATOM   1175 C CG  . GLU A 1 169 ? -3.769  29.271 -16.105 1.00 31.89 ? 468  GLU A CG  1 
ATOM   1176 C CD  . GLU A 1 169 ? -4.059  30.529 -15.327 1.00 32.80 ? 468  GLU A CD  1 
ATOM   1177 O OE1 . GLU A 1 169 ? -4.033  31.682 -15.819 1.00 36.60 ? 468  GLU A OE1 1 
ATOM   1178 O OE2 . GLU A 1 169 ? -4.374  30.388 -14.116 1.00 32.55 ? 468  GLU A OE2 1 
ATOM   1179 N N   . VAL A 1 170 ? -1.781  31.678 -16.888 1.00 28.54 ? 469  VAL A N   1 
ATOM   1180 C CA  . VAL A 1 170 ? -1.384  33.021 -16.556 1.00 27.79 ? 469  VAL A CA  1 
ATOM   1181 C C   . VAL A 1 170 ? -1.086  33.139 -15.071 1.00 26.89 ? 469  VAL A C   1 
ATOM   1182 O O   . VAL A 1 170 ? -1.609  34.052 -14.426 1.00 22.29 ? 469  VAL A O   1 
ATOM   1183 C CB  . VAL A 1 170 ? -2.525  34.004 -16.909 1.00 27.33 ? 469  VAL A CB  1 
ATOM   1184 C CG1 . VAL A 1 170 ? -2.058  35.448 -16.805 1.00 24.06 ? 469  VAL A CG1 1 
ATOM   1185 C CG2 . VAL A 1 170 ? -3.066  33.707 -18.300 1.00 25.90 ? 469  VAL A CG2 1 
ATOM   1186 N N   . PRO A 1 171 ? -0.272  32.251 -14.528 1.00 27.15 ? 470  PRO A N   1 
ATOM   1187 C CA  . PRO A 1 171 ? -0.091  32.193 -13.063 1.00 26.68 ? 470  PRO A CA  1 
ATOM   1188 C C   . PRO A 1 171 ? 1.021   33.140 -12.601 1.00 25.85 ? 470  PRO A C   1 
ATOM   1189 O O   . PRO A 1 171 ? 1.209   33.373 -11.412 1.00 21.33 ? 470  PRO A O   1 
ATOM   1190 C CB  . PRO A 1 171 ? 0.307   30.742 -12.814 1.00 26.93 ? 470  PRO A CB  1 
ATOM   1191 C CG  . PRO A 1 171 ? 0.547   30.122 -14.148 1.00 26.69 ? 470  PRO A CG  1 
ATOM   1192 C CD  . PRO A 1 171 ? 0.603   31.237 -15.154 1.00 27.03 ? 470  PRO A CD  1 
ATOM   1193 N N   . ARG A 1 172 ? 1.750   33.661 -13.581 1.00 26.51 ? 471  ARG A N   1 
ATOM   1194 C CA  . ARG A 1 172 ? 2.897   34.515 -13.346 1.00 26.35 ? 471  ARG A CA  1 
ATOM   1195 C C   . ARG A 1 172 ? 2.567   35.915 -13.871 1.00 26.01 ? 471  ARG A C   1 
ATOM   1196 O O   . ARG A 1 172 ? 1.662   36.042 -14.693 1.00 22.14 ? 471  ARG A O   1 
ATOM   1197 C CB  . ARG A 1 172 ? 4.147   33.949 -14.008 1.00 26.12 ? 471  ARG A CB  1 
ATOM   1198 C CG  . ARG A 1 172 ? 4.141   32.448 -14.238 1.00 26.19 ? 471  ARG A CG  1 
ATOM   1199 C CD  . ARG A 1 172 ? 5.184   31.958 -15.218 1.00 26.65 ? 471  ARG A CD  1 
ATOM   1200 N NE  . ARG A 1 172 ? 6.547   32.246 -14.808 1.00 27.61 ? 471  ARG A NE  1 
ATOM   1201 C CZ  . ARG A 1 172 ? 7.540   31.410 -14.551 1.00 27.89 ? 471  ARG A CZ  1 
ATOM   1202 N NH1 . ARG A 1 172 ? 7.380   30.098 -14.654 1.00 25.36 ? 471  ARG A NH1 1 
ATOM   1203 N NH2 . ARG A 1 172 ? 8.721   31.904 -14.186 1.00 28.60 ? 471  ARG A NH2 1 
ATOM   1204 N N   . ARG A 1 173 ? 3.277   36.907 -13.375 1.00 26.25 ? 472  ARG A N   1 
ATOM   1205 C CA  . ARG A 1 173 ? 3.069   38.304 -13.728 1.00 25.39 ? 472  ARG A CA  1 
ATOM   1206 C C   . ARG A 1 173 ? 4.411   39.018 -13.775 1.00 25.75 ? 472  ARG A C   1 
ATOM   1207 O O   . ARG A 1 173 ? 5.406   38.514 -13.255 1.00 24.81 ? 472  ARG A O   1 
ATOM   1208 C CB  . ARG A 1 173 ? 2.165   38.981 -12.708 1.00 24.62 ? 472  ARG A CB  1 
ATOM   1209 C CG  . ARG A 1 173 ? 0.856   39.584 -13.131 1.00 24.67 ? 472  ARG A CG  1 
ATOM   1210 C CD  . ARG A 1 173 ? 0.188   38.936 -14.316 1.00 24.36 ? 472  ARG A CD  1 
ATOM   1211 N NE  . ARG A 1 173 ? -1.256  38.977 -14.358 1.00 23.77 ? 472  ARG A NE  1 
ATOM   1212 C CZ  . ARG A 1 173 ? -2.073  40.014 -14.285 1.00 23.87 ? 472  ARG A CZ  1 
ATOM   1213 N NH1 . ARG A 1 173 ? -1.595  41.243 -14.132 1.00 26.21 ? 472  ARG A NH1 1 
ATOM   1214 N NH2 . ARG A 1 173 ? -3.384  39.817 -14.352 1.00 22.54 ? 472  ARG A NH2 1 
ATOM   1215 N N   . LYS A 1 174 ? 4.437   40.216 -14.374 1.00 25.55 ? 473  LYS A N   1 
ATOM   1216 C CA  . LYS A 1 174 ? 5.664   41.010 -14.336 1.00 25.46 ? 473  LYS A CA  1 
ATOM   1217 C C   . LYS A 1 174 ? 5.519   42.509 -14.434 1.00 24.29 ? 473  LYS A C   1 
ATOM   1218 O O   . LYS A 1 174 ? 6.497   43.205 -14.755 1.00 24.98 ? 473  LYS A O   1 
ATOM   1219 C CB  . LYS A 1 174 ? 6.607   40.503 -15.449 1.00 27.52 ? 473  LYS A CB  1 
ATOM   1220 C CG  . LYS A 1 174 ? 8.048   40.956 -15.236 1.00 28.54 ? 473  LYS A CG  1 
ATOM   1221 C CD  . LYS A 1 174 ? 8.797   40.291 -14.118 1.00 28.04 ? 473  LYS A CD  1 
ATOM   1222 C CE  . LYS A 1 174 ? 8.888   40.979 -12.799 1.00 28.30 ? 473  LYS A CE  1 
ATOM   1223 N NZ  . LYS A 1 174 ? 8.801   42.452 -12.712 1.00 29.44 ? 473  LYS A NZ  1 
HETATM 1224 N N   . SEP A 1 175 ? 4.345   43.062 -14.137 1.00 23.02 ? 474  SEP A N   1 
HETATM 1225 C CA  . SEP A 1 175 ? 4.157   44.510 -14.291 1.00 21.87 ? 474  SEP A CA  1 
HETATM 1226 C CB  . SEP A 1 175 ? 2.674   44.876 -14.266 1.00 22.93 ? 474  SEP A CB  1 
HETATM 1227 O OG  . SEP A 1 175 ? 2.065   44.515 -15.503 1.00 23.21 ? 474  SEP A OG  1 
HETATM 1228 C C   . SEP A 1 175 ? 4.857   45.295 -13.205 1.00 20.19 ? 474  SEP A C   1 
HETATM 1229 O O   . SEP A 1 175 ? 4.702   44.931 -12.067 1.00 17.40 ? 474  SEP A O   1 
HETATM 1230 P P   . SEP A 1 175 ? 0.964   43.408 -15.109 1.00 23.35 ? 474  SEP A P   1 
HETATM 1231 O O1P . SEP A 1 175 ? -0.226  44.109 -14.589 1.00 26.85 ? 474  SEP A O1P 1 
HETATM 1232 O O2P . SEP A 1 175 ? 0.596   42.557 -16.430 1.00 24.79 ? 474  SEP A O2P 1 
HETATM 1233 O O3P . SEP A 1 175 ? 1.529   42.422 -13.980 1.00 23.05 ? 474  SEP A O3P 1 
ATOM   1234 N N   . LEU A 1 176 ? 5.568   46.348 -13.591 1.00 19.00 ? 475  LEU A N   1 
ATOM   1235 C CA  . LEU A 1 176 ? 6.232   47.242 -12.659 1.00 18.54 ? 475  LEU A CA  1 
ATOM   1236 C C   . LEU A 1 176 ? 5.222   48.171 -11.984 1.00 18.15 ? 475  LEU A C   1 
ATOM   1237 O O   . LEU A 1 176 ? 4.724   49.148 -12.555 1.00 17.17 ? 475  LEU A O   1 
ATOM   1238 C CB  . LEU A 1 176 ? 7.330   48.033 -13.377 1.00 18.38 ? 475  LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 176 ? 7.889   49.266 -12.656 1.00 18.81 ? 475  LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 176 ? 9.031   48.873 -11.732 1.00 18.07 ? 475  LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 176 ? 8.311   50.335 -13.655 1.00 16.84 ? 475  LEU A CD2 1 
ATOM   1242 N N   . VAL A 1 177 ? 4.914   47.856 -10.724 1.00 16.74 ? 476  VAL A N   1 
ATOM   1243 C CA  . VAL A 1 177 ? 3.915   48.581 -9.972  1.00 15.30 ? 476  VAL A CA  1 
ATOM   1244 C C   . VAL A 1 177 ? 4.058   48.371 -8.462  1.00 13.49 ? 476  VAL A C   1 
ATOM   1245 O O   . VAL A 1 177 ? 4.546   47.345 -8.005  1.00 14.37 ? 476  VAL A O   1 
ATOM   1246 C CB  . VAL A 1 177 ? 2.474   48.173 -10.358 1.00 15.88 ? 476  VAL A CB  1 
ATOM   1247 C CG1 . VAL A 1 177 ? 1.971   47.078 -9.430  1.00 15.41 ? 476  VAL A CG1 1 
ATOM   1248 C CG2 . VAL A 1 177 ? 1.544   49.373 -10.317 1.00 17.13 ? 476  VAL A CG2 1 
ATOM   1249 N N   . GLY A 1 178 ? 3.600   49.364 -7.712  1.00 12.54 ? 477  GLY A N   1 
ATOM   1250 C CA  . GLY A 1 178 ? 3.547   49.334 -6.276  1.00 11.49 ? 477  GLY A CA  1 
ATOM   1251 C C   . GLY A 1 178 ? 4.218   50.555 -5.677  1.00 10.27 ? 477  GLY A C   1 
ATOM   1252 O O   . GLY A 1 178 ? 4.077   51.645 -6.221  1.00 9.49  ? 477  GLY A O   1 
ATOM   1253 N N   . THR A 1 179 ? 4.930   50.362 -4.571  1.00 9.07  ? 478  THR A N   1 
ATOM   1254 C CA  . THR A 1 179 ? 5.656   51.435 -3.912  1.00 8.41  ? 478  THR A CA  1 
ATOM   1255 C C   . THR A 1 179 ? 7.049   50.931 -3.512  1.00 7.96  ? 478  THR A C   1 
ATOM   1256 O O   . THR A 1 179 ? 7.161   50.098 -2.621  1.00 5.61  ? 478  THR A O   1 
ATOM   1257 C CB  . THR A 1 179 ? 4.945   51.974 -2.660  1.00 8.63  ? 478  THR A CB  1 
ATOM   1258 O OG1 . THR A 1 179 ? 3.538   51.773 -2.747  1.00 8.64  ? 478  THR A OG1 1 
ATOM   1259 C CG2 . THR A 1 179 ? 5.183   53.477 -2.531  1.00 10.54 ? 478  THR A CG2 1 
ATOM   1260 N N   . PRO A 1 180 ? 8.065   51.455 -4.171  1.00 8.09  ? 479  PRO A N   1 
ATOM   1261 C CA  . PRO A 1 180 ? 9.396   50.873 -4.228  1.00 7.90  ? 479  PRO A CA  1 
ATOM   1262 C C   . PRO A 1 180 ? 9.925   50.272 -2.925  1.00 7.08  ? 479  PRO A C   1 
ATOM   1263 O O   . PRO A 1 180 ? 10.367  49.119 -2.914  1.00 6.27  ? 479  PRO A O   1 
ATOM   1264 C CB  . PRO A 1 180 ? 10.291  52.064 -4.611  1.00 6.63  ? 479  PRO A CB  1 
ATOM   1265 C CG  . PRO A 1 180 ? 9.404   53.086 -5.204  1.00 6.44  ? 479  PRO A CG  1 
ATOM   1266 C CD  . PRO A 1 180 ? 7.980   52.724 -4.918  1.00 7.78  ? 479  PRO A CD  1 
ATOM   1267 N N   . TYR A 1 181 ? 9.859   51.028 -1.845  1.00 6.33  ? 480  TYR A N   1 
ATOM   1268 C CA  . TYR A 1 181 ? 10.392  50.638 -0.556  1.00 5.89  ? 480  TYR A CA  1 
ATOM   1269 C C   . TYR A 1 181 ? 9.753   49.379 0.012   1.00 5.75  ? 480  TYR A C   1 
ATOM   1270 O O   . TYR A 1 181 ? 10.265  48.809 0.971   1.00 4.11  ? 480  TYR A O   1 
ATOM   1271 C CB  . TYR A 1 181 ? 10.190  51.755 0.486   1.00 6.29  ? 480  TYR A CB  1 
ATOM   1272 C CG  . TYR A 1 181 ? 10.878  53.050 0.136   1.00 6.16  ? 480  TYR A CG  1 
ATOM   1273 C CD1 . TYR A 1 181 ? 10.276  53.938 -0.744  1.00 5.35  ? 480  TYR A CD1 1 
ATOM   1274 C CD2 . TYR A 1 181 ? 12.116  53.381 0.675   1.00 6.23  ? 480  TYR A CD2 1 
ATOM   1275 C CE1 . TYR A 1 181 ? 10.889  55.123 -1.077  1.00 6.03  ? 480  TYR A CE1 1 
ATOM   1276 C CE2 . TYR A 1 181 ? 12.738  54.572 0.343   1.00 5.65  ? 480  TYR A CE2 1 
ATOM   1277 C CZ  . TYR A 1 181 ? 12.115  55.433 -0.530  1.00 6.79  ? 480  TYR A CZ  1 
ATOM   1278 O OH  . TYR A 1 181 ? 12.689  56.628 -0.891  1.00 13.12 ? 480  TYR A OH  1 
ATOM   1279 N N   . TRP A 1 182 ? 8.626   48.970 -0.565  1.00 6.16  ? 481  TRP A N   1 
ATOM   1280 C CA  . TRP A 1 182 ? 7.936   47.768 -0.116  1.00 6.03  ? 481  TRP A CA  1 
ATOM   1281 C C   . TRP A 1 182 ? 8.031   46.633 -1.140  1.00 5.99  ? 481  TRP A C   1 
ATOM   1282 O O   . TRP A 1 182 ? 7.769   45.472 -0.801  1.00 7.84  ? 481  TRP A O   1 
ATOM   1283 C CB  . TRP A 1 182 ? 6.485   48.103 0.197   1.00 5.67  ? 481  TRP A CB  1 
ATOM   1284 C CG  . TRP A 1 182 ? 6.211   48.763 1.510   1.00 4.45  ? 481  TRP A CG  1 
ATOM   1285 C CD1 . TRP A 1 182 ? 6.099   48.156 2.732   1.00 3.36  ? 481  TRP A CD1 1 
ATOM   1286 C CD2 . TRP A 1 182 ? 6.004   50.159 1.750   1.00 2.84  ? 481  TRP A CD2 1 
ATOM   1287 N NE1 . TRP A 1 182 ? 5.843   49.090 3.708   1.00 2.42  ? 481  TRP A NE1 1 
ATOM   1288 C CE2 . TRP A 1 182 ? 5.776   50.325 3.134   1.00 2.96  ? 481  TRP A CE2 1 
ATOM   1289 C CE3 . TRP A 1 182 ? 5.983   51.296 0.942   1.00 2.38  ? 481  TRP A CE3 1 
ATOM   1290 C CZ2 . TRP A 1 182 ? 5.535   51.572 3.727   1.00 3.75  ? 481  TRP A CZ2 1 
ATOM   1291 C CZ3 . TRP A 1 182 ? 5.747   52.535 1.509   1.00 1.91  ? 481  TRP A CZ3 1 
ATOM   1292 C CH2 . TRP A 1 182 ? 5.527   52.663 2.886   1.00 2.71  ? 481  TRP A CH2 1 
ATOM   1293 N N   . MET A 1 183 ? 8.409   46.950 -2.359  1.00 5.78  ? 482  MET A N   1 
ATOM   1294 C CA  . MET A 1 183 ? 8.424   46.025 -3.474  1.00 8.26  ? 482  MET A CA  1 
ATOM   1295 C C   . MET A 1 183 ? 9.252   44.754 -3.284  1.00 10.60 ? 482  MET A C   1 
ATOM   1296 O O   . MET A 1 183 ? 10.161  44.673 -2.458  1.00 15.33 ? 482  MET A O   1 
ATOM   1297 C CB  . MET A 1 183 ? 8.941   46.768 -4.727  1.00 6.85  ? 482  MET A CB  1 
ATOM   1298 C CG  . MET A 1 183 ? 7.812   47.151 -5.659  1.00 5.26  ? 482  MET A CG  1 
ATOM   1299 S SD  . MET A 1 183 ? 8.290   48.284 -6.967  1.00 10.12 ? 482  MET A SD  1 
ATOM   1300 C CE  . MET A 1 183 ? 7.269   49.689 -6.558  1.00 31.94 ? 482  MET A CE  1 
ATOM   1301 N N   . ALA A 1 184 ? 8.925   43.738 -4.088  1.00 10.72 ? 483  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 184 ? 9.635   42.468 -4.045  1.00 11.25 ? 483  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 184 ? 10.875  42.502 -4.928  1.00 12.78 ? 483  ALA A C   1 
ATOM   1304 O O   . ALA A 1 184 ? 10.838  43.074 -6.024  1.00 13.15 ? 483  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 184 ? 8.692   41.346 -4.442  1.00 11.74 ? 483  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 185 ? 11.980  41.920 -4.469  1.00 13.33 ? 484  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 185 ? 13.205  41.918 -5.303  1.00 12.15 ? 484  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 185 ? 12.977  41.297 -6.672  1.00 10.21 ? 484  PRO A C   1 
ATOM   1309 O O   . PRO A 1 185 ? 13.397  41.843 -7.697  1.00 11.68 ? 484  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 185 ? 14.188  41.083 -4.484  1.00 13.62 ? 484  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 185 ? 13.735  41.299 -3.074  1.00 13.78 ? 484  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 185 ? 12.229  41.258 -3.176  1.00 13.28 ? 484  PRO A CD  1 
ATOM   1313 N N   . GLU A 1 186 ? 12.301  40.158 -6.705  1.00 9.31  ? 485  GLU A N   1 
ATOM   1314 C CA  . GLU A 1 186 ? 11.932  39.515 -7.963  1.00 8.07  ? 485  GLU A CA  1 
ATOM   1315 C C   . GLU A 1 186 ? 11.086  40.444 -8.822  1.00 7.00  ? 485  GLU A C   1 
ATOM   1316 O O   . GLU A 1 186 ? 11.153  40.421 -10.054 1.00 7.80  ? 485  GLU A O   1 
ATOM   1317 C CB  . GLU A 1 186 ? 11.189  38.208 -7.681  1.00 8.70  ? 485  GLU A CB  1 
ATOM   1318 C CG  . GLU A 1 186 ? 9.993   38.286 -6.747  1.00 8.74  ? 485  GLU A CG  1 
ATOM   1319 C CD  . GLU A 1 186 ? 10.393  38.099 -5.295  1.00 9.33  ? 485  GLU A CD  1 
ATOM   1320 O OE1 . GLU A 1 186 ? 9.691   37.424 -4.521  1.00 6.46  ? 485  GLU A OE1 1 
ATOM   1321 O OE2 . GLU A 1 186 ? 11.455  38.637 -4.913  1.00 14.04 ? 485  GLU A OE2 1 
ATOM   1322 N N   . LEU A 1 187 ? 10.278  41.280 -8.168  1.00 6.01  ? 486  LEU A N   1 
ATOM   1323 C CA  . LEU A 1 187 ? 9.485   42.266 -8.870  1.00 7.10  ? 486  LEU A CA  1 
ATOM   1324 C C   . LEU A 1 187 ? 10.334  43.428 -9.358  1.00 7.83  ? 486  LEU A C   1 
ATOM   1325 O O   . LEU A 1 187 ? 10.194  43.931 -10.477 1.00 10.44 ? 486  LEU A O   1 
ATOM   1326 C CB  . LEU A 1 187 ? 8.376   42.836 -7.973  1.00 7.44  ? 486  LEU A CB  1 
ATOM   1327 C CG  . LEU A 1 187 ? 7.201   43.454 -8.722  1.00 7.21  ? 486  LEU A CG  1 
ATOM   1328 C CD1 . LEU A 1 187 ? 5.919   42.956 -8.064  1.00 8.30  ? 486  LEU A CD1 1 
ATOM   1329 C CD2 . LEU A 1 187 ? 7.165   44.974 -8.742  1.00 10.30 ? 486  LEU A CD2 1 
ATOM   1330 N N   . ILE A 1 188 ? 11.237  43.911 -8.494  1.00 8.67  ? 487  ILE A N   1 
ATOM   1331 C CA  . ILE A 1 188 ? 12.116  45.008 -8.929  1.00 10.24 ? 487  ILE A CA  1 
ATOM   1332 C C   . ILE A 1 188 ? 13.088  44.471 -9.984  1.00 11.93 ? 487  ILE A C   1 
ATOM   1333 O O   . ILE A 1 188 ? 13.418  45.150 -10.961 1.00 6.90  ? 487  ILE A O   1 
ATOM   1334 C CB  . ILE A 1 188 ? 12.845  45.636 -7.734  1.00 9.60  ? 487  ILE A CB  1 
ATOM   1335 C CG1 . ILE A 1 188 ? 12.028  46.785 -7.136  1.00 9.11  ? 487  ILE A CG1 1 
ATOM   1336 C CG2 . ILE A 1 188 ? 14.266  46.045 -8.087  1.00 5.40  ? 487  ILE A CG2 1 
ATOM   1337 C CD1 . ILE A 1 188 ? 12.365  47.176 -5.715  1.00 5.53  ? 487  ILE A CD1 1 
ATOM   1338 N N   . SER A 1 189 ? 13.534  43.238 -9.766  1.00 13.07 ? 488  SER A N   1 
ATOM   1339 C CA  . SER A 1 189 ? 14.529  42.600 -10.609 1.00 13.02 ? 488  SER A CA  1 
ATOM   1340 C C   . SER A 1 189 ? 13.927  42.128 -11.922 1.00 15.53 ? 488  SER A C   1 
ATOM   1341 O O   . SER A 1 189 ? 14.607  41.516 -12.747 1.00 18.01 ? 488  SER A O   1 
ATOM   1342 C CB  . SER A 1 189 ? 15.151  41.431 -9.839  1.00 12.65 ? 488  SER A CB  1 
ATOM   1343 O OG  . SER A 1 189 ? 16.220  41.894 -9.032  1.00 11.02 ? 488  SER A OG  1 
ATOM   1344 N N   . ARG A 1 190 ? 12.648  42.413 -12.112 1.00 17.10 ? 489  ARG A N   1 
ATOM   1345 C CA  . ARG A 1 190 ? 11.947  42.058 -13.337 1.00 17.01 ? 489  ARG A CA  1 
ATOM   1346 C C   . ARG A 1 190 ? 12.016  40.556 -13.581 1.00 15.04 ? 489  ARG A C   1 
ATOM   1347 O O   . ARG A 1 190 ? 11.935  40.103 -14.714 1.00 11.78 ? 489  ARG A O   1 
ATOM   1348 C CB  . ARG A 1 190 ? 12.482  42.860 -14.521 1.00 20.18 ? 489  ARG A CB  1 
ATOM   1349 C CG  . ARG A 1 190 ? 12.827  44.303 -14.214 1.00 22.25 ? 489  ARG A CG  1 
ATOM   1350 C CD  . ARG A 1 190 ? 11.590  45.087 -13.777 1.00 24.20 ? 489  ARG A CD  1 
ATOM   1351 N NE  . ARG A 1 190 ? 11.249  46.090 -14.763 1.00 26.60 ? 489  ARG A NE  1 
ATOM   1352 C CZ  . ARG A 1 190 ? 10.111  46.303 -15.399 1.00 28.42 ? 489  ARG A CZ  1 
ATOM   1353 N NH1 . ARG A 1 190 ? 9.028   45.562 -15.199 1.00 31.05 ? 489  ARG A NH1 1 
ATOM   1354 N NH2 . ARG A 1 190 ? 10.070  47.310 -16.269 1.00 28.83 ? 489  ARG A NH2 1 
ATOM   1355 N N   . LEU A 1 191 ? 12.126  39.789 -12.496 1.00 13.73 ? 490  LEU A N   1 
ATOM   1356 C CA  . LEU A 1 191 ? 11.919  38.346 -12.568 1.00 11.51 ? 490  LEU A CA  1 
ATOM   1357 C C   . LEU A 1 191 ? 10.450  38.036 -12.306 1.00 10.78 ? 490  LEU A C   1 
ATOM   1358 O O   . LEU A 1 191 ? 9.864   38.626 -11.397 1.00 8.47  ? 490  LEU A O   1 
ATOM   1359 C CB  . LEU A 1 191 ? 12.814  37.612 -11.571 1.00 9.81  ? 490  LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 191 ? 14.303  37.902 -11.726 1.00 8.25  ? 490  LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 191 ? 15.022  37.913 -10.390 1.00 9.01  ? 490  LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 191 ? 14.925  36.873 -12.667 1.00 7.14  ? 490  LEU A CD2 1 
ATOM   1363 N N   . PRO A 1 192 ? 9.858   37.166 -13.109 1.00 11.13 ? 491  PRO A N   1 
ATOM   1364 C CA  . PRO A 1 192 ? 8.447   36.806 -12.914 1.00 10.78 ? 491  PRO A CA  1 
ATOM   1365 C C   . PRO A 1 192 ? 8.159   36.411 -11.474 1.00 11.42 ? 491  PRO A C   1 
ATOM   1366 O O   . PRO A 1 192 ? 8.870   35.637 -10.845 1.00 8.04  ? 491  PRO A O   1 
ATOM   1367 C CB  . PRO A 1 192 ? 8.249   35.627 -13.868 1.00 10.53 ? 491  PRO A CB  1 
ATOM   1368 C CG  . PRO A 1 192 ? 9.147   36.008 -15.004 1.00 9.79  ? 491  PRO A CG  1 
ATOM   1369 C CD  . PRO A 1 192 ? 10.393  36.482 -14.301 1.00 10.76 ? 491  PRO A CD  1 
ATOM   1370 N N   . TYR A 1 193 ? 7.064   36.973 -10.951 1.00 13.68 ? 492  TYR A N   1 
ATOM   1371 C CA  . TYR A 1 193 ? 6.619   36.675 -9.608  1.00 14.11 ? 492  TYR A CA  1 
ATOM   1372 C C   . TYR A 1 193 ? 5.174   36.174 -9.615  1.00 12.50 ? 492  TYR A C   1 
ATOM   1373 O O   . TYR A 1 193 ? 4.496   36.236 -10.632 1.00 6.94  ? 492  TYR A O   1 
ATOM   1374 C CB  . TYR A 1 193 ? 6.735   37.936 -8.727  1.00 15.58 ? 492  TYR A CB  1 
ATOM   1375 C CG  . TYR A 1 193 ? 5.974   39.090 -9.353  1.00 16.54 ? 492  TYR A CG  1 
ATOM   1376 C CD1 . TYR A 1 193 ? 6.614   39.891 -10.294 1.00 16.19 ? 492  TYR A CD1 1 
ATOM   1377 C CD2 . TYR A 1 193 ? 4.651   39.378 -9.037  1.00 17.74 ? 492  TYR A CD2 1 
ATOM   1378 C CE1 . TYR A 1 193 ? 5.964   40.948 -10.893 1.00 17.20 ? 492  TYR A CE1 1 
ATOM   1379 C CE2 . TYR A 1 193 ? 3.992   40.439 -9.632  1.00 18.36 ? 492  TYR A CE2 1 
ATOM   1380 C CZ  . TYR A 1 193 ? 4.654   41.219 -10.563 1.00 19.00 ? 492  TYR A CZ  1 
ATOM   1381 O OH  . TYR A 1 193 ? 4.027   42.282 -11.174 1.00 22.93 ? 492  TYR A OH  1 
ATOM   1382 N N   . GLY A 1 194 ? 4.732   35.707 -8.459  1.00 13.17 ? 493  GLY A N   1 
ATOM   1383 C CA  . GLY A 1 194 ? 3.349   35.454 -8.156  1.00 13.43 ? 493  GLY A CA  1 
ATOM   1384 C C   . GLY A 1 194 ? 2.899   36.259 -6.937  1.00 13.40 ? 493  GLY A C   1 
ATOM   1385 O O   . GLY A 1 194 ? 3.491   37.295 -6.635  1.00 14.50 ? 493  GLY A O   1 
ATOM   1386 N N   . PRO A 1 195 ? 1.863   35.784 -6.268  1.00 12.80 ? 494  PRO A N   1 
ATOM   1387 C CA  . PRO A 1 195 ? 1.379   36.411 -5.038  1.00 12.89 ? 494  PRO A CA  1 
ATOM   1388 C C   . PRO A 1 195 ? 2.399   36.531 -3.915  1.00 13.67 ? 494  PRO A C   1 
ATOM   1389 O O   . PRO A 1 195 ? 2.204   37.260 -2.931  1.00 13.60 ? 494  PRO A O   1 
ATOM   1390 C CB  . PRO A 1 195 ? 0.267   35.429 -4.614  1.00 13.26 ? 494  PRO A CB  1 
ATOM   1391 C CG  . PRO A 1 195 ? -0.228  34.870 -5.910  1.00 12.92 ? 494  PRO A CG  1 
ATOM   1392 C CD  . PRO A 1 195 ? 1.047   34.622 -6.692  1.00 12.69 ? 494  PRO A CD  1 
ATOM   1393 N N   . GLU A 1 196 ? 3.509   35.817 -4.037  1.00 14.34 ? 495  GLU A N   1 
ATOM   1394 C CA  . GLU A 1 196 ? 4.548   35.792 -3.015  1.00 13.08 ? 495  GLU A CA  1 
ATOM   1395 C C   . GLU A 1 196 ? 5.127   37.179 -2.729  1.00 11.81 ? 495  GLU A C   1 
ATOM   1396 O O   . GLU A 1 196 ? 5.728   37.405 -1.677  1.00 9.26  ? 495  GLU A O   1 
ATOM   1397 C CB  . GLU A 1 196 ? 5.660   34.828 -3.430  1.00 13.77 ? 495  GLU A CB  1 
ATOM   1398 C CG  . GLU A 1 196 ? 5.098   33.512 -3.963  1.00 14.80 ? 495  GLU A CG  1 
ATOM   1399 C CD  . GLU A 1 196 ? 5.448   33.281 -5.410  1.00 14.47 ? 495  GLU A CD  1 
ATOM   1400 O OE1 . GLU A 1 196 ? 4.555   33.093 -6.263  1.00 19.29 ? 495  GLU A OE1 1 
ATOM   1401 O OE2 . GLU A 1 196 ? 6.659   33.271 -5.712  1.00 12.74 ? 495  GLU A OE2 1 
ATOM   1402 N N   . VAL A 1 197 ? 4.944   38.089 -3.671  1.00 11.21 ? 496  VAL A N   1 
ATOM   1403 C CA  . VAL A 1 197 ? 5.276   39.488 -3.513  1.00 10.92 ? 496  VAL A CA  1 
ATOM   1404 C C   . VAL A 1 197 ? 4.514   40.121 -2.344  1.00 12.77 ? 496  VAL A C   1 
ATOM   1405 O O   . VAL A 1 197 ? 5.063   40.914 -1.578  1.00 14.26 ? 496  VAL A O   1 
ATOM   1406 C CB  . VAL A 1 197 ? 4.953   40.276 -4.798  1.00 8.07  ? 496  VAL A CB  1 
ATOM   1407 C CG1 . VAL A 1 197 ? 5.864   39.850 -5.927  1.00 5.05  ? 496  VAL A CG1 1 
ATOM   1408 C CG2 . VAL A 1 197 ? 3.507   40.078 -5.220  1.00 9.29  ? 496  VAL A CG2 1 
ATOM   1409 N N   . ASP A 1 198 ? 3.249   39.748 -2.217  1.00 13.04 ? 497  ASP A N   1 
ATOM   1410 C CA  . ASP A 1 198 ? 2.365   40.234 -1.182  1.00 12.32 ? 497  ASP A CA  1 
ATOM   1411 C C   . ASP A 1 198 ? 2.874   39.782 0.190   1.00 9.19  ? 497  ASP A C   1 
ATOM   1412 O O   . ASP A 1 198 ? 2.536   40.357 1.213   1.00 3.18  ? 497  ASP A O   1 
ATOM   1413 C CB  . ASP A 1 198 ? 0.953   39.670 -1.321  1.00 15.16 ? 497  ASP A CB  1 
ATOM   1414 C CG  . ASP A 1 198 ? 0.107   40.349 -2.370  1.00 16.34 ? 497  ASP A CG  1 
ATOM   1415 O OD1 . ASP A 1 198 ? 0.546   41.408 -2.872  1.00 20.65 ? 497  ASP A OD1 1 
ATOM   1416 O OD2 . ASP A 1 198 ? -0.973  39.805 -2.673  1.00 16.14 ? 497  ASP A OD2 1 
ATOM   1417 N N   . ILE A 1 199 ? 3.660   38.720 0.163   1.00 9.28  ? 498  ILE A N   1 
ATOM   1418 C CA  . ILE A 1 199 ? 4.213   38.086 1.337   1.00 7.34  ? 498  ILE A CA  1 
ATOM   1419 C C   . ILE A 1 199 ? 5.478   38.792 1.791   1.00 6.24  ? 498  ILE A C   1 
ATOM   1420 O O   . ILE A 1 199 ? 5.731   38.924 2.986   1.00 5.74  ? 498  ILE A O   1 
ATOM   1421 C CB  . ILE A 1 199 ? 4.503   36.605 1.009   1.00 6.22  ? 498  ILE A CB  1 
ATOM   1422 C CG1 . ILE A 1 199 ? 3.319   35.915 0.336   1.00 5.16  ? 498  ILE A CG1 1 
ATOM   1423 C CG2 . ILE A 1 199 ? 4.958   35.868 2.259   1.00 3.90  ? 498  ILE A CG2 1 
ATOM   1424 C CD1 . ILE A 1 199 ? 2.275   35.417 1.302   1.00 4.87  ? 498  ILE A CD1 1 
ATOM   1425 N N   . TRP A 1 200 ? 6.271   39.244 0.826   1.00 7.54  ? 499  TRP A N   1 
ATOM   1426 C CA  . TRP A 1 200 ? 7.443   40.062 1.125   1.00 9.97  ? 499  TRP A CA  1 
ATOM   1427 C C   . TRP A 1 200 ? 7.016   41.421 1.674   1.00 8.08  ? 499  TRP A C   1 
ATOM   1428 O O   . TRP A 1 200 ? 7.639   41.947 2.601   1.00 8.73  ? 499  TRP A O   1 
ATOM   1429 C CB  . TRP A 1 200 ? 8.297   40.214 -0.138  1.00 11.93 ? 499  TRP A CB  1 
ATOM   1430 C CG  . TRP A 1 200 ? 9.511   41.073 0.004   1.00 12.62 ? 499  TRP A CG  1 
ATOM   1431 C CD1 . TRP A 1 200 ? 9.606   42.432 -0.094  1.00 13.05 ? 499  TRP A CD1 1 
ATOM   1432 C CD2 . TRP A 1 200 ? 10.839  40.606 0.271   1.00 13.32 ? 499  TRP A CD2 1 
ATOM   1433 N NE1 . TRP A 1 200 ? 10.901  42.840 0.101   1.00 13.14 ? 499  TRP A NE1 1 
ATOM   1434 C CE2 . TRP A 1 200 ? 11.682  41.740 0.326   1.00 13.39 ? 499  TRP A CE2 1 
ATOM   1435 C CE3 . TRP A 1 200 ? 11.398  39.339 0.472   1.00 12.47 ? 499  TRP A CE3 1 
ATOM   1436 C CZ2 . TRP A 1 200 ? 13.051  41.653 0.572   1.00 12.51 ? 499  TRP A CZ2 1 
ATOM   1437 C CZ3 . TRP A 1 200 ? 12.757  39.259 0.716   1.00 11.99 ? 499  TRP A CZ3 1 
ATOM   1438 C CH2 . TRP A 1 200 ? 13.569  40.399 0.764   1.00 12.01 ? 499  TRP A CH2 1 
ATOM   1439 N N   . SER A 1 201 ? 5.965   41.995 1.096   1.00 5.20  ? 500  SER A N   1 
ATOM   1440 C CA  . SER A 1 201 ? 5.454   43.289 1.527   1.00 3.82  ? 500  SER A CA  1 
ATOM   1441 C C   . SER A 1 201 ? 5.037   43.303 2.997   1.00 3.70  ? 500  SER A C   1 
ATOM   1442 O O   . SER A 1 201 ? 5.155   44.316 3.689   1.00 2.92  ? 500  SER A O   1 
ATOM   1443 C CB  . SER A 1 201 ? 4.253   43.692 0.668   1.00 2.54  ? 500  SER A CB  1 
ATOM   1444 O OG  . SER A 1 201 ? 4.613   43.888 -0.676  1.00 2.28  ? 500  SER A OG  1 
ATOM   1445 N N   . LEU A 1 202 ? 4.540   42.163 3.466   1.00 3.11  ? 501  LEU A N   1 
ATOM   1446 C CA  . LEU A 1 202 ? 4.060   42.051 4.838   1.00 2.69  ? 501  LEU A CA  1 
ATOM   1447 C C   . LEU A 1 202 ? 5.229   42.228 5.791   1.00 4.60  ? 501  LEU A C   1 
ATOM   1448 O O   . LEU A 1 202 ? 5.141   42.852 6.850   1.00 6.40  ? 501  LEU A O   1 
ATOM   1449 C CB  . LEU A 1 202 ? 3.390   40.698 5.041   1.00 2.85  ? 501  LEU A CB  1 
ATOM   1450 C CG  . LEU A 1 202 ? 3.064   40.310 6.489   1.00 2.72  ? 501  LEU A CG  1 
ATOM   1451 C CD1 . LEU A 1 202 ? 2.058   41.278 7.091   1.00 2.88  ? 501  LEU A CD1 1 
ATOM   1452 C CD2 . LEU A 1 202 ? 2.556   38.884 6.531   1.00 2.04  ? 501  LEU A CD2 1 
ATOM   1453 N N   . GLY A 1 203 ? 6.370   41.643 5.395   1.00 5.40  ? 502  GLY A N   1 
ATOM   1454 C CA  . GLY A 1 203 ? 7.562   41.724 6.235   1.00 4.32  ? 502  GLY A CA  1 
ATOM   1455 C C   . GLY A 1 203 ? 8.074   43.151 6.320   1.00 2.41  ? 502  GLY A C   1 
ATOM   1456 O O   . GLY A 1 203 ? 8.625   43.567 7.333   1.00 2.99  ? 502  GLY A O   1 
ATOM   1457 N N   . ILE A 1 204 ? 7.896   43.906 5.234   1.00 2.14  ? 503  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 204 ? 8.360   45.301 5.234   1.00 2.16  ? 503  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 204 ? 7.434   46.154 6.080   1.00 3.05  ? 503  ILE A C   1 
ATOM   1460 O O   . ILE A 1 204 ? 7.876   47.049 6.809   1.00 4.56  ? 503  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 204 ? 8.533   45.772 3.791   1.00 2.12  ? 503  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 204 ? 9.362   44.750 2.987   1.00 2.12  ? 503  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 204 ? 9.156   47.152 3.721   1.00 3.16  ? 503  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 204 ? 10.664  44.416 3.719   1.00 2.67  ? 503  ILE A CD1 1 
ATOM   1465 N N   . MET A 1 205 ? 6.142   45.844 6.034   1.00 3.98  ? 504  MET A N   1 
ATOM   1466 C CA  . MET A 1 205 ? 5.185   46.388 6.988   1.00 4.50  ? 504  MET A CA  1 
ATOM   1467 C C   . MET A 1 205 ? 5.491   45.960 8.414   1.00 3.08  ? 504  MET A C   1 
ATOM   1468 O O   . MET A 1 205 ? 5.182   46.659 9.387   1.00 2.65  ? 504  MET A O   1 
ATOM   1469 C CB  . MET A 1 205 ? 3.762   45.973 6.548   1.00 6.37  ? 504  MET A CB  1 
ATOM   1470 C CG  . MET A 1 205 ? 2.739   47.072 6.749   1.00 7.92  ? 504  MET A CG  1 
ATOM   1471 S SD  . MET A 1 205 ? 1.017   46.633 6.959   1.00 7.99  ? 504  MET A SD  1 
ATOM   1472 C CE  . MET A 1 205 ? 1.050   45.255 8.091   1.00 3.01  ? 504  MET A CE  1 
ATOM   1473 N N   . VAL A 1 206 ? 6.095   44.784 8.585   1.00 4.00  ? 505  VAL A N   1 
ATOM   1474 C CA  . VAL A 1 206 ? 6.540   44.355 9.909   1.00 3.75  ? 505  VAL A CA  1 
ATOM   1475 C C   . VAL A 1 206 ? 7.699   45.205 10.415  1.00 3.88  ? 505  VAL A C   1 
ATOM   1476 O O   . VAL A 1 206 ? 7.730   45.571 11.589  1.00 5.66  ? 505  VAL A O   1 
ATOM   1477 C CB  . VAL A 1 206 ? 6.966   42.875 9.935   1.00 6.26  ? 505  VAL A CB  1 
ATOM   1478 C CG1 . VAL A 1 206 ? 7.557   42.488 11.277  1.00 8.52  ? 505  VAL A CG1 1 
ATOM   1479 C CG2 . VAL A 1 206 ? 5.761   42.001 9.613   1.00 10.77 ? 505  VAL A CG2 1 
ATOM   1480 N N   . ILE A 1 207 ? 8.649   45.503 9.545   1.00 4.63  ? 506  ILE A N   1 
ATOM   1481 C CA  . ILE A 1 207 ? 9.762   46.388 9.892   1.00 5.65  ? 506  ILE A CA  1 
ATOM   1482 C C   . ILE A 1 207 ? 9.209   47.752 10.313  1.00 5.44  ? 506  ILE A C   1 
ATOM   1483 O O   . ILE A 1 207 ? 9.705   48.427 11.221  1.00 2.04  ? 506  ILE A O   1 
ATOM   1484 C CB  . ILE A 1 207 ? 10.745  46.514 8.713   1.00 7.01  ? 506  ILE A CB  1 
ATOM   1485 C CG1 . ILE A 1 207 ? 11.183  45.175 8.109   1.00 8.53  ? 506  ILE A CG1 1 
ATOM   1486 C CG2 . ILE A 1 207 ? 11.959  47.354 9.098   1.00 3.71  ? 506  ILE A CG2 1 
ATOM   1487 C CD1 . ILE A 1 207 ? 12.681  45.023 7.959   1.00 14.08 ? 506  ILE A CD1 1 
ATOM   1488 N N   . GLU A 1 208 ? 8.138   48.155 9.636   1.00 6.30  ? 507  GLU A N   1 
ATOM   1489 C CA  . GLU A 1 208 ? 7.411   49.369 9.946   1.00 5.85  ? 507  GLU A CA  1 
ATOM   1490 C C   . GLU A 1 208 ? 6.816   49.356 11.350  1.00 6.08  ? 507  GLU A C   1 
ATOM   1491 O O   . GLU A 1 208 ? 6.840   50.356 12.062  1.00 3.13  ? 507  GLU A O   1 
ATOM   1492 C CB  . GLU A 1 208 ? 6.240   49.559 8.990   1.00 5.09  ? 507  GLU A CB  1 
ATOM   1493 C CG  . GLU A 1 208 ? 6.435   50.435 7.778   1.00 4.04  ? 507  GLU A CG  1 
ATOM   1494 C CD  . GLU A 1 208 ? 5.113   50.737 7.097   1.00 4.41  ? 507  GLU A CD  1 
ATOM   1495 O OE1 . GLU A 1 208 ? 4.433   49.788 6.648   1.00 5.23  ? 507  GLU A OE1 1 
ATOM   1496 O OE2 . GLU A 1 208 ? 4.756   51.927 7.021   1.00 5.05  ? 507  GLU A OE2 1 
ATOM   1497 N N   . MET A 1 209 ? 6.249   48.215 11.741  1.00 7.05  ? 508  MET A N   1 
ATOM   1498 C CA  . MET A 1 209 ? 5.590   48.120 13.044  1.00 6.73  ? 508  MET A CA  1 
ATOM   1499 C C   . MET A 1 209 ? 6.621   48.059 14.158  1.00 6.92  ? 508  MET A C   1 
ATOM   1500 O O   . MET A 1 209 ? 6.387   48.498 15.294  1.00 3.90  ? 508  MET A O   1 
ATOM   1501 C CB  . MET A 1 209 ? 4.656   46.919 13.105  1.00 8.02  ? 508  MET A CB  1 
ATOM   1502 C CG  . MET A 1 209 ? 3.364   47.074 12.309  1.00 9.42  ? 508  MET A CG  1 
ATOM   1503 S SD  . MET A 1 209 ? 2.284   45.629 12.429  1.00 4.16  ? 508  MET A SD  1 
ATOM   1504 C CE  . MET A 1 209 ? 2.963   44.604 11.137  1.00 3.78  ? 508  MET A CE  1 
ATOM   1505 N N   . VAL A 1 210 ? 7.810   47.532 13.846  1.00 6.80  ? 509  VAL A N   1 
ATOM   1506 C CA  . VAL A 1 210 ? 8.835   47.410 14.892  1.00 6.57  ? 509  VAL A CA  1 
ATOM   1507 C C   . VAL A 1 210 ? 9.695   48.663 14.983  1.00 5.34  ? 509  VAL A C   1 
ATOM   1508 O O   . VAL A 1 210 ? 9.816   49.245 16.059  1.00 2.82  ? 509  VAL A O   1 
ATOM   1509 C CB  . VAL A 1 210 ? 9.710   46.164 14.688  1.00 6.79  ? 509  VAL A CB  1 
ATOM   1510 C CG1 . VAL A 1 210 ? 10.892  46.220 15.642  1.00 12.28 ? 509  VAL A CG1 1 
ATOM   1511 C CG2 . VAL A 1 210 ? 8.938   44.880 14.932  1.00 8.46  ? 509  VAL A CG2 1 
ATOM   1512 N N   . ASP A 1 211 ? 10.265  49.083 13.862  1.00 6.71  ? 510  ASP A N   1 
ATOM   1513 C CA  . ASP A 1 211 ? 11.131  50.270 13.859  1.00 7.61  ? 510  ASP A CA  1 
ATOM   1514 C C   . ASP A 1 211 ? 10.373  51.557 13.547  1.00 9.00  ? 510  ASP A C   1 
ATOM   1515 O O   . ASP A 1 211 ? 10.797  52.611 14.011  1.00 13.08 ? 510  ASP A O   1 
ATOM   1516 C CB  . ASP A 1 211 ? 12.273  50.135 12.851  1.00 5.92  ? 510  ASP A CB  1 
ATOM   1517 C CG  . ASP A 1 211 ? 13.142  48.922 13.098  1.00 4.60  ? 510  ASP A CG  1 
ATOM   1518 O OD1 . ASP A 1 211 ? 13.917  48.530 12.205  1.00 5.63  ? 510  ASP A OD1 1 
ATOM   1519 O OD2 . ASP A 1 211 ? 13.024  48.364 14.207  1.00 3.59  ? 510  ASP A OD2 1 
ATOM   1520 N N   . GLY A 1 212 ? 9.290   51.452 12.794  1.00 8.38  ? 511  GLY A N   1 
ATOM   1521 C CA  . GLY A 1 212 ? 8.473   52.594 12.452  1.00 9.37  ? 511  GLY A CA  1 
ATOM   1522 C C   . GLY A 1 212 ? 8.567   52.949 10.983  1.00 10.95 ? 511  GLY A C   1 
ATOM   1523 O O   . GLY A 1 212 ? 7.643   53.566 10.440  1.00 15.74 ? 511  GLY A O   1 
ATOM   1524 N N   . GLU A 1 213 ? 9.658   52.570 10.336  1.00 10.67 ? 512  GLU A N   1 
ATOM   1525 C CA  . GLU A 1 213 ? 9.892   52.880 8.939   1.00 11.26 ? 512  GLU A CA  1 
ATOM   1526 C C   . GLU A 1 213 ? 10.250  51.635 8.133   1.00 10.52 ? 512  GLU A C   1 
ATOM   1527 O O   . GLU A 1 213 ? 10.749  50.642 8.673   1.00 10.58 ? 512  GLU A O   1 
ATOM   1528 C CB  . GLU A 1 213 ? 11.036  53.901 8.853   1.00 13.65 ? 512  GLU A CB  1 
ATOM   1529 C CG  . GLU A 1 213 ? 10.604  55.349 8.723   1.00 15.66 ? 512  GLU A CG  1 
ATOM   1530 C CD  . GLU A 1 213 ? 11.756  56.310 8.508   1.00 17.41 ? 512  GLU A CD  1 
ATOM   1531 O OE1 . GLU A 1 213 ? 11.502  57.464 8.086   1.00 17.69 ? 512  GLU A OE1 1 
ATOM   1532 O OE2 . GLU A 1 213 ? 12.926  55.928 8.754   1.00 19.80 ? 512  GLU A OE2 1 
ATOM   1533 N N   . PRO A 1 214 ? 10.004  51.693 6.829   1.00 8.68  ? 513  PRO A N   1 
ATOM   1534 C CA  . PRO A 1 214 ? 10.544  50.691 5.910   1.00 7.07  ? 513  PRO A CA  1 
ATOM   1535 C C   . PRO A 1 214 ? 12.015  50.956 5.612   1.00 3.82  ? 513  PRO A C   1 
ATOM   1536 O O   . PRO A 1 214 ? 12.430  52.115 5.615   1.00 2.04  ? 513  PRO A O   1 
ATOM   1537 C CB  . PRO A 1 214 ? 9.711   50.881 4.646   1.00 8.36  ? 513  PRO A CB  1 
ATOM   1538 C CG  . PRO A 1 214 ? 9.214   52.287 4.705   1.00 8.31  ? 513  PRO A CG  1 
ATOM   1539 C CD  . PRO A 1 214 ? 9.167   52.695 6.148   1.00 8.79  ? 513  PRO A CD  1 
ATOM   1540 N N   . PRO A 1 215 ? 12.796  49.911 5.376   1.00 2.53  ? 514  PRO A N   1 
ATOM   1541 C CA  . PRO A 1 215 ? 14.237  50.081 5.123   1.00 2.39  ? 514  PRO A CA  1 
ATOM   1542 C C   . PRO A 1 215 ? 14.576  51.023 3.976   1.00 2.02  ? 514  PRO A C   1 
ATOM   1543 O O   . PRO A 1 215 ? 13.806  51.142 3.019   1.00 2.50  ? 514  PRO A O   1 
ATOM   1544 C CB  . PRO A 1 215 ? 14.689  48.658 4.735   1.00 2.34  ? 514  PRO A CB  1 
ATOM   1545 C CG  . PRO A 1 215 ? 13.736  47.779 5.465   1.00 2.10  ? 514  PRO A CG  1 
ATOM   1546 C CD  . PRO A 1 215 ? 12.421  48.484 5.335   1.00 2.44  ? 514  PRO A CD  1 
ATOM   1547 N N   . TYR A 1 216 ? 15.722  51.690 4.063   1.00 2.92  ? 515  TYR A N   1 
ATOM   1548 C CA  . TYR A 1 216 ? 16.201  52.586 3.030   1.00 5.63  ? 515  TYR A CA  1 
ATOM   1549 C C   . TYR A 1 216 ? 15.366  53.852 2.846   1.00 7.63  ? 515  TYR A C   1 
ATOM   1550 O O   . TYR A 1 216 ? 15.604  54.638 1.917   1.00 4.03  ? 515  TYR A O   1 
ATOM   1551 C CB  . TYR A 1 216 ? 16.254  51.838 1.676   1.00 8.05  ? 515  TYR A CB  1 
ATOM   1552 C CG  . TYR A 1 216 ? 17.324  50.770 1.645   1.00 8.83  ? 515  TYR A CG  1 
ATOM   1553 C CD1 . TYR A 1 216 ? 17.044  49.452 1.297   1.00 8.70  ? 515  TYR A CD1 1 
ATOM   1554 C CD2 . TYR A 1 216 ? 18.637  51.089 1.969   1.00 9.46  ? 515  TYR A CD2 1 
ATOM   1555 C CE1 . TYR A 1 216 ? 18.045  48.497 1.277   1.00 8.68  ? 515  TYR A CE1 1 
ATOM   1556 C CE2 . TYR A 1 216 ? 19.640  50.138 1.953   1.00 8.09  ? 515  TYR A CE2 1 
ATOM   1557 C CZ  . TYR A 1 216 ? 19.341  48.844 1.606   1.00 7.17  ? 515  TYR A CZ  1 
ATOM   1558 O OH  . TYR A 1 216 ? 20.354  47.913 1.593   1.00 2.61  ? 515  TYR A OH  1 
ATOM   1559 N N   . PHE A 1 217 ? 14.399  54.064 3.725   1.00 9.32  ? 516  PHE A N   1 
ATOM   1560 C CA  . PHE A 1 217 ? 13.434  55.145 3.605   1.00 11.02 ? 516  PHE A CA  1 
ATOM   1561 C C   . PHE A 1 217 ? 14.042  56.546 3.692   1.00 11.64 ? 516  PHE A C   1 
ATOM   1562 O O   . PHE A 1 217 ? 13.364  57.535 3.434   1.00 11.17 ? 516  PHE A O   1 
ATOM   1563 C CB  . PHE A 1 217 ? 12.384  55.011 4.711   1.00 10.28 ? 516  PHE A CB  1 
ATOM   1564 C CG  . PHE A 1 217 ? 10.968  55.381 4.340   1.00 8.74  ? 516  PHE A CG  1 
ATOM   1565 C CD1 . PHE A 1 217 ? 10.422  55.104 3.096   1.00 7.84  ? 516  PHE A CD1 1 
ATOM   1566 C CD2 . PHE A 1 217 ? 10.182  56.015 5.288   1.00 8.74  ? 516  PHE A CD2 1 
ATOM   1567 C CE1 . PHE A 1 217 ? 9.116   55.429 2.802   1.00 6.60  ? 516  PHE A CE1 1 
ATOM   1568 C CE2 . PHE A 1 217 ? 8.865   56.330 5.011   1.00 8.62  ? 516  PHE A CE2 1 
ATOM   1569 C CZ  . PHE A 1 217 ? 8.336   56.039 3.765   1.00 8.18  ? 516  PHE A CZ  1 
ATOM   1570 N N   . ASN A 1 218 ? 15.306  56.594 4.048   1.00 12.97 ? 517  ASN A N   1 
ATOM   1571 C CA  . ASN A 1 218 ? 16.174  57.741 3.980   1.00 12.38 ? 517  ASN A CA  1 
ATOM   1572 C C   . ASN A 1 218 ? 16.661  58.011 2.565   1.00 11.02 ? 517  ASN A C   1 
ATOM   1573 O O   . ASN A 1 218 ? 17.173  59.081 2.266   1.00 10.44 ? 517  ASN A O   1 
ATOM   1574 C CB  . ASN A 1 218 ? 17.371  57.405 4.902   1.00 11.74 ? 517  ASN A CB  1 
ATOM   1575 C CG  . ASN A 1 218 ? 17.220  55.923 5.271   1.00 10.98 ? 517  ASN A CG  1 
ATOM   1576 O OD1 . ASN A 1 218 ? 17.638  55.061 4.506   1.00 10.98 ? 517  ASN A OD1 1 
ATOM   1577 N ND2 . ASN A 1 218 ? 16.600  55.618 6.403   1.00 8.45  ? 517  ASN A ND2 1 
ATOM   1578 N N   . GLU A 1 219 ? 16.505  57.011 1.699   1.00 10.73 ? 518  GLU A N   1 
ATOM   1579 C CA  . GLU A 1 219 ? 17.028  57.052 0.352   1.00 9.22  ? 518  GLU A CA  1 
ATOM   1580 C C   . GLU A 1 219 ? 16.000  57.529 -0.650  1.00 8.85  ? 518  GLU A C   1 
ATOM   1581 O O   . GLU A 1 219 ? 14.812  57.345 -0.410  1.00 9.18  ? 518  GLU A O   1 
ATOM   1582 C CB  . GLU A 1 219 ? 17.483  55.636 -0.038  1.00 9.28  ? 518  GLU A CB  1 
ATOM   1583 C CG  . GLU A 1 219 ? 18.574  55.083 0.869   1.00 10.35 ? 518  GLU A CG  1 
ATOM   1584 C CD  . GLU A 1 219 ? 19.878  55.842 0.666   1.00 9.18  ? 518  GLU A CD  1 
ATOM   1585 O OE1 . GLU A 1 219 ? 20.858  55.500 1.336   1.00 5.16  ? 518  GLU A OE1 1 
ATOM   1586 O OE2 . GLU A 1 219 ? 19.849  56.772 -0.170  1.00 9.70  ? 518  GLU A OE2 1 
ATOM   1587 N N   . PRO A 1 220 ? 16.444  58.121 -1.755  1.00 7.76  ? 519  PRO A N   1 
ATOM   1588 C CA  . PRO A 1 220 ? 15.520  58.334 -2.881  1.00 6.79  ? 519  PRO A CA  1 
ATOM   1589 C C   . PRO A 1 220 ? 15.096  56.961 -3.409  1.00 6.85  ? 519  PRO A C   1 
ATOM   1590 O O   . PRO A 1 220 ? 15.918  56.037 -3.424  1.00 6.57  ? 519  PRO A O   1 
ATOM   1591 C CB  . PRO A 1 220 ? 16.321  59.159 -3.869  1.00 6.07  ? 519  PRO A CB  1 
ATOM   1592 C CG  . PRO A 1 220 ? 17.746  59.061 -3.469  1.00 6.45  ? 519  PRO A CG  1 
ATOM   1593 C CD  . PRO A 1 220 ? 17.794  58.643 -2.030  1.00 7.22  ? 519  PRO A CD  1 
ATOM   1594 N N   . PRO A 1 221 ? 13.846  56.824 -3.811  1.00 6.78  ? 520  PRO A N   1 
ATOM   1595 C CA  . PRO A 1 221 ? 13.303  55.499 -4.154  1.00 6.09  ? 520  PRO A CA  1 
ATOM   1596 C C   . PRO A 1 221 ? 14.105  54.640 -5.109  1.00 6.95  ? 520  PRO A C   1 
ATOM   1597 O O   . PRO A 1 221 ? 14.186  53.417 -4.930  1.00 5.97  ? 520  PRO A O   1 
ATOM   1598 C CB  . PRO A 1 221 ? 11.964  55.850 -4.836  1.00 5.12  ? 520  PRO A CB  1 
ATOM   1599 C CG  . PRO A 1 221 ? 11.548  57.092 -4.121  1.00 5.12  ? 520  PRO A CG  1 
ATOM   1600 C CD  . PRO A 1 221 ? 12.823  57.877 -3.969  1.00 6.21  ? 520  PRO A CD  1 
ATOM   1601 N N   . LEU A 1 222 ? 14.688  55.228 -6.151  1.00 8.39  ? 521  LEU A N   1 
ATOM   1602 C CA  . LEU A 1 222 ? 15.267  54.421 -7.224  1.00 10.17 ? 521  LEU A CA  1 
ATOM   1603 C C   . LEU A 1 222 ? 16.535  53.702 -6.782  1.00 10.52 ? 521  LEU A C   1 
ATOM   1604 O O   . LEU A 1 222 ? 16.643  52.492 -6.973  1.00 7.22  ? 521  LEU A O   1 
ATOM   1605 C CB  . LEU A 1 222 ? 15.519  55.299 -8.442  1.00 11.80 ? 521  LEU A CB  1 
ATOM   1606 C CG  . LEU A 1 222 ? 14.642  55.233 -9.676  1.00 12.67 ? 521  LEU A CG  1 
ATOM   1607 C CD1 . LEU A 1 222 ? 13.260  54.618 -9.511  1.00 15.76 ? 521  LEU A CD1 1 
ATOM   1608 C CD2 . LEU A 1 222 ? 14.465  56.656 -10.220 1.00 14.69 ? 521  LEU A CD2 1 
ATOM   1609 N N   . LYS A 1 223 ? 17.469  54.448 -6.205  1.00 11.24 ? 522  LYS A N   1 
ATOM   1610 C CA  . LYS A 1 223 ? 18.728  53.858 -5.741  1.00 11.66 ? 522  LYS A CA  1 
ATOM   1611 C C   . LYS A 1 223 ? 18.402  52.772 -4.711  1.00 11.05 ? 522  LYS A C   1 
ATOM   1612 O O   . LYS A 1 223 ? 18.984  51.692 -4.718  1.00 7.19  ? 522  LYS A O   1 
ATOM   1613 C CB  . LYS A 1 223 ? 19.647  54.931 -5.175  1.00 13.01 ? 522  LYS A CB  1 
ATOM   1614 C CG  . LYS A 1 223 ? 20.687  54.447 -4.171  1.00 14.94 ? 522  LYS A CG  1 
ATOM   1615 C CD  . LYS A 1 223 ? 21.225  55.583 -3.330  1.00 16.10 ? 522  LYS A CD  1 
ATOM   1616 C CE  . LYS A 1 223 ? 22.741  55.671 -3.393  1.00 17.15 ? 522  LYS A CE  1 
ATOM   1617 N NZ  . LYS A 1 223 ? 23.233  56.957 -2.816  1.00 20.40 ? 522  LYS A NZ  1 
ATOM   1618 N N   . ALA A 1 224 ? 17.459  53.093 -3.833  1.00 11.05 ? 523  ALA A N   1 
ATOM   1619 C CA  . ALA A 1 224 ? 16.904  52.169 -2.872  1.00 9.66  ? 523  ALA A CA  1 
ATOM   1620 C C   . ALA A 1 224 ? 16.512  50.858 -3.555  1.00 7.49  ? 523  ALA A C   1 
ATOM   1621 O O   . ALA A 1 224 ? 16.809  49.777 -3.066  1.00 3.58  ? 523  ALA A O   1 
ATOM   1622 C CB  . ALA A 1 224 ? 15.693  52.801 -2.197  1.00 9.97  ? 523  ALA A CB  1 
ATOM   1623 N N   . MET A 1 225 ? 15.852  50.993 -4.696  1.00 8.89  ? 524  MET A N   1 
ATOM   1624 C CA  . MET A 1 225 ? 15.434  49.851 -5.500  1.00 9.50  ? 524  MET A CA  1 
ATOM   1625 C C   . MET A 1 225 ? 16.621  49.021 -5.977  1.00 9.14  ? 524  MET A C   1 
ATOM   1626 O O   . MET A 1 225 ? 16.451  47.820 -6.175  1.00 7.63  ? 524  MET A O   1 
ATOM   1627 C CB  . MET A 1 225 ? 14.554  50.388 -6.633  1.00 10.10 ? 524  MET A CB  1 
ATOM   1628 C CG  . MET A 1 225 ? 13.115  50.528 -6.111  1.00 11.33 ? 524  MET A CG  1 
ATOM   1629 S SD  . MET A 1 225 ? 11.902  50.886 -7.374  1.00 13.59 ? 524  MET A SD  1 
ATOM   1630 C CE  . MET A 1 225 ? 12.591  50.100 -8.828  1.00 16.33 ? 524  MET A CE  1 
ATOM   1631 N N   . LYS A 1 226 ? 17.767  49.648 -6.120  1.00 8.40  ? 525  LYS A N   1 
ATOM   1632 C CA  . LYS A 1 226 ? 19.048  49.007 -6.326  1.00 6.76  ? 525  LYS A CA  1 
ATOM   1633 C C   . LYS A 1 226 ? 19.542  48.310 -5.056  1.00 4.49  ? 525  LYS A C   1 
ATOM   1634 O O   . LYS A 1 226 ? 20.034  47.195 -5.149  1.00 0.00  ? 525  LYS A O   1 
ATOM   1635 C CB  . LYS A 1 226 ? 20.082  50.057 -6.749  1.00 7.61  ? 525  LYS A CB  1 
ATOM   1636 C CG  . LYS A 1 226 ? 21.258  49.576 -7.573  1.00 5.40  ? 525  LYS A CG  1 
ATOM   1637 N N   . MET A 1 227 ? 19.415  48.993 -3.932  1.00 5.31  ? 526  MET A N   1 
ATOM   1638 C CA  . MET A 1 227 ? 19.867  48.500 -2.641  1.00 7.26  ? 526  MET A CA  1 
ATOM   1639 C C   . MET A 1 227 ? 18.931  47.415 -2.124  1.00 9.13  ? 526  MET A C   1 
ATOM   1640 O O   . MET A 1 227 ? 19.334  46.518 -1.380  1.00 16.51 ? 526  MET A O   1 
ATOM   1641 C CB  . MET A 1 227 ? 19.957  49.618 -1.608  1.00 5.90  ? 526  MET A CB  1 
ATOM   1642 C CG  . MET A 1 227 ? 21.244  50.408 -1.615  1.00 5.88  ? 526  MET A CG  1 
ATOM   1643 S SD  . MET A 1 227 ? 21.188  51.787 -0.445  1.00 13.50 ? 526  MET A SD  1 
ATOM   1644 C CE  . MET A 1 227 ? 22.683  51.520 0.480   1.00 0.00  ? 526  MET A CE  1 
ATOM   1645 N N   . ILE A 1 228 ? 17.666  47.483 -2.531  1.00 7.40  ? 527  ILE A N   1 
ATOM   1646 C CA  . ILE A 1 228 ? 16.765  46.358 -2.318  1.00 8.15  ? 527  ILE A CA  1 
ATOM   1647 C C   . ILE A 1 228 ? 17.243  45.185 -3.199  1.00 7.62  ? 527  ILE A C   1 
ATOM   1648 O O   . ILE A 1 228 ? 17.168  44.030 -2.809  1.00 5.03  ? 527  ILE A O   1 
ATOM   1649 C CB  . ILE A 1 228 ? 15.284  46.544 -2.692  1.00 6.41  ? 527  ILE A CB  1 
ATOM   1650 C CG1 . ILE A 1 228 ? 14.649  47.912 -2.500  1.00 4.11  ? 527  ILE A CG1 1 
ATOM   1651 C CG2 . ILE A 1 228 ? 14.524  45.466 -1.914  1.00 1.23  ? 527  ILE A CG2 1 
ATOM   1652 C CD1 . ILE A 1 228 ? 14.545  48.413 -1.094  1.00 0.00  ? 527  ILE A CD1 1 
ATOM   1653 N N   . ARG A 1 229 ? 17.725  45.553 -4.376  1.00 7.45  ? 528  ARG A N   1 
ATOM   1654 C CA  . ARG A 1 229 ? 18.109  44.636 -5.425  1.00 7.77  ? 528  ARG A CA  1 
ATOM   1655 C C   . ARG A 1 229 ? 19.331  43.798 -5.124  1.00 8.16  ? 528  ARG A C   1 
ATOM   1656 O O   . ARG A 1 229 ? 19.429  42.630 -5.510  1.00 6.12  ? 528  ARG A O   1 
ATOM   1657 C CB  . ARG A 1 229 ? 18.340  45.463 -6.701  1.00 8.14  ? 528  ARG A CB  1 
ATOM   1658 C CG  . ARG A 1 229 ? 18.326  44.649 -7.983  1.00 7.44  ? 528  ARG A CG  1 
ATOM   1659 C CD  . ARG A 1 229 ? 19.702  44.717 -8.650  1.00 8.10  ? 528  ARG A CD  1 
ATOM   1660 N NE  . ARG A 1 229 ? 19.694  45.811 -9.609  1.00 8.64  ? 528  ARG A NE  1 
ATOM   1661 C CZ  . ARG A 1 229 ? 20.546  46.806 -9.753  1.00 8.17  ? 528  ARG A CZ  1 
ATOM   1662 N NH1 . ARG A 1 229 ? 21.616  46.955 -8.992  1.00 8.89  ? 528  ARG A NH1 1 
ATOM   1663 N NH2 . ARG A 1 229 ? 20.325  47.696 -10.708 1.00 8.12  ? 528  ARG A NH2 1 
ATOM   1664 N N   . ASP A 1 230 ? 20.318  44.371 -4.423  1.00 10.67 ? 529  ASP A N   1 
ATOM   1665 C CA  . ASP A 1 230 ? 21.577  43.634 -4.263  1.00 11.89 ? 529  ASP A CA  1 
ATOM   1666 C C   . ASP A 1 230 ? 22.147  43.736 -2.867  1.00 11.63 ? 529  ASP A C   1 
ATOM   1667 O O   . ASP A 1 230 ? 23.359  43.865 -2.726  1.00 11.52 ? 529  ASP A O   1 
ATOM   1668 C CB  . ASP A 1 230 ? 22.647  44.097 -5.257  1.00 13.00 ? 529  ASP A CB  1 
ATOM   1669 C CG  . ASP A 1 230 ? 22.339  45.446 -5.860  1.00 13.51 ? 529  ASP A CG  1 
ATOM   1670 O OD1 . ASP A 1 230 ? 21.848  45.454 -7.013  1.00 14.76 ? 529  ASP A OD1 1 
ATOM   1671 O OD2 . ASP A 1 230 ? 22.594  46.435 -5.151  1.00 14.41 ? 529  ASP A OD2 1 
ATOM   1672 N N   . ASN A 1 231 ? 21.294  43.636 -1.857  1.00 12.57 ? 530  ASN A N   1 
ATOM   1673 C CA  . ASN A 1 231 ? 21.771  43.454 -0.485  1.00 13.60 ? 530  ASN A CA  1 
ATOM   1674 C C   . ASN A 1 231 ? 20.989  42.302 0.142   1.00 13.60 ? 530  ASN A C   1 
ATOM   1675 O O   . ASN A 1 231 ? 19.925  41.951 -0.367  1.00 11.73 ? 530  ASN A O   1 
ATOM   1676 C CB  . ASN A 1 231 ? 21.671  44.757 0.298   1.00 14.91 ? 530  ASN A CB  1 
ATOM   1677 C CG  . ASN A 1 231 ? 22.530  45.861 -0.299  1.00 16.87 ? 530  ASN A CG  1 
ATOM   1678 O OD1 . ASN A 1 231 ? 23.653  46.102 0.147   1.00 22.13 ? 530  ASN A OD1 1 
ATOM   1679 N ND2 . ASN A 1 231 ? 22.023  46.544 -1.319  1.00 16.97 ? 530  ASN A ND2 1 
ATOM   1680 N N   . LEU A 1 232 ? 21.520  41.734 1.208   1.00 14.68 ? 531  LEU A N   1 
ATOM   1681 C CA  . LEU A 1 232 ? 20.852  40.644 1.929   1.00 15.02 ? 531  LEU A CA  1 
ATOM   1682 C C   . LEU A 1 232 ? 19.537  41.115 2.514   1.00 15.58 ? 531  LEU A C   1 
ATOM   1683 O O   . LEU A 1 232 ? 19.251  42.326 2.499   1.00 17.70 ? 531  LEU A O   1 
ATOM   1684 C CB  . LEU A 1 232 ? 21.814  40.130 2.996   1.00 15.71 ? 531  LEU A CB  1 
ATOM   1685 C CG  . LEU A 1 232 ? 23.026  39.321 2.528   1.00 16.20 ? 531  LEU A CG  1 
ATOM   1686 C CD1 . LEU A 1 232 ? 23.924  38.986 3.712   1.00 13.66 ? 531  LEU A CD1 1 
ATOM   1687 C CD2 . LEU A 1 232 ? 22.622  38.050 1.796   1.00 18.27 ? 531  LEU A CD2 1 
ATOM   1688 N N   . PRO A 1 233 ? 18.698  40.216 3.008   1.00 15.52 ? 532  PRO A N   1 
ATOM   1689 C CA  . PRO A 1 233 ? 17.394  40.675 3.555   1.00 15.67 ? 532  PRO A CA  1 
ATOM   1690 C C   . PRO A 1 233 ? 17.601  41.691 4.668   1.00 16.46 ? 532  PRO A C   1 
ATOM   1691 O O   . PRO A 1 233 ? 18.599  41.629 5.384   1.00 19.79 ? 532  PRO A O   1 
ATOM   1692 C CB  . PRO A 1 233 ? 16.757  39.393 4.065   1.00 15.11 ? 532  PRO A CB  1 
ATOM   1693 C CG  . PRO A 1 233 ? 17.393  38.302 3.261   1.00 14.11 ? 532  PRO A CG  1 
ATOM   1694 C CD  . PRO A 1 233 ? 18.824  38.752 3.098   1.00 15.12 ? 532  PRO A CD  1 
ATOM   1695 N N   . PRO A 1 234 ? 16.664  42.621 4.806   1.00 16.83 ? 533  PRO A N   1 
ATOM   1696 C CA  . PRO A 1 234 ? 16.815  43.724 5.758   1.00 17.20 ? 533  PRO A CA  1 
ATOM   1697 C C   . PRO A 1 234 ? 16.641  43.270 7.210   1.00 18.58 ? 533  PRO A C   1 
ATOM   1698 O O   . PRO A 1 234 ? 15.796  42.414 7.474   1.00 16.20 ? 533  PRO A O   1 
ATOM   1699 C CB  . PRO A 1 234 ? 15.686  44.679 5.372   1.00 16.48 ? 533  PRO A CB  1 
ATOM   1700 C CG  . PRO A 1 234 ? 14.658  43.796 4.753   1.00 16.02 ? 533  PRO A CG  1 
ATOM   1701 C CD  . PRO A 1 234 ? 15.391  42.682 4.072   1.00 15.84 ? 533  PRO A CD  1 
ATOM   1702 N N   . ARG A 1 235 ? 17.440  43.842 8.085   1.00 20.10 ? 534  ARG A N   1 
ATOM   1703 C CA  . ARG A 1 235 ? 17.515  43.531 9.491   1.00 22.75 ? 534  ARG A CA  1 
ATOM   1704 C C   . ARG A 1 235 ? 16.940  44.622 10.391  1.00 24.56 ? 534  ARG A C   1 
ATOM   1705 O O   . ARG A 1 235 ? 16.879  45.797 10.025  1.00 26.02 ? 534  ARG A O   1 
ATOM   1706 C CB  . ARG A 1 235 ? 18.982  43.310 9.901   1.00 23.35 ? 534  ARG A CB  1 
ATOM   1707 C CG  . ARG A 1 235 ? 19.736  42.374 8.975   1.00 24.49 ? 534  ARG A CG  1 
ATOM   1708 C CD  . ARG A 1 235 ? 20.891  43.028 8.232   1.00 26.02 ? 534  ARG A CD  1 
ATOM   1709 N NE  . ARG A 1 235 ? 20.750  42.915 6.786   1.00 26.94 ? 534  ARG A NE  1 
ATOM   1710 C CZ  . ARG A 1 235 ? 20.310  43.819 5.922   1.00 26.45 ? 534  ARG A CZ  1 
ATOM   1711 N NH1 . ARG A 1 235 ? 19.917  45.027 6.317   1.00 27.06 ? 534  ARG A NH1 1 
ATOM   1712 N NH2 . ARG A 1 235 ? 20.260  43.496 4.632   1.00 20.60 ? 534  ARG A NH2 1 
ATOM   1713 N N   . LEU A 1 236 ? 16.529  44.229 11.600  1.00 25.51 ? 535  LEU A N   1 
ATOM   1714 C CA  . LEU A 1 236 ? 15.917  45.173 12.527  1.00 26.30 ? 535  LEU A CA  1 
ATOM   1715 C C   . LEU A 1 236 ? 16.941  46.047 13.246  1.00 27.75 ? 535  LEU A C   1 
ATOM   1716 O O   . LEU A 1 236 ? 17.963  45.556 13.717  1.00 29.29 ? 535  LEU A O   1 
ATOM   1717 C CB  . LEU A 1 236 ? 15.065  44.484 13.596  1.00 24.84 ? 535  LEU A CB  1 
ATOM   1718 C CG  . LEU A 1 236 ? 13.582  44.307 13.269  1.00 24.87 ? 535  LEU A CG  1 
ATOM   1719 C CD1 . LEU A 1 236 ? 12.888  43.495 14.356  1.00 25.13 ? 535  LEU A CD1 1 
ATOM   1720 C CD2 . LEU A 1 236 ? 12.868  45.635 13.068  1.00 23.42 ? 535  LEU A CD2 1 
ATOM   1721 N N   . LYS A 1 237 ? 16.640  47.340 13.330  1.00 28.69 ? 536  LYS A N   1 
ATOM   1722 C CA  . LYS A 1 237 ? 17.478  48.265 14.092  1.00 30.33 ? 536  LYS A CA  1 
ATOM   1723 C C   . LYS A 1 237 ? 17.071  48.250 15.558  1.00 30.71 ? 536  LYS A C   1 
ATOM   1724 O O   . LYS A 1 237 ? 17.833  48.736 16.422  1.00 28.10 ? 536  LYS A O   1 
ATOM   1725 C CB  . LYS A 1 237 ? 17.293  49.704 13.646  1.00 31.79 ? 536  LYS A CB  1 
ATOM   1726 C CG  . LYS A 1 237 ? 17.467  50.821 14.650  1.00 33.09 ? 536  LYS A CG  1 
ATOM   1727 C CD  . LYS A 1 237 ? 16.185  51.241 15.332  1.00 34.12 ? 536  LYS A CD  1 
ATOM   1728 C CE  . LYS A 1 237 ? 15.439  52.394 14.704  1.00 35.03 ? 536  LYS A CE  1 
ATOM   1729 N NZ  . LYS A 1 237 ? 16.244  53.633 14.530  1.00 37.20 ? 536  LYS A NZ  1 
ATOM   1730 N N   . ASN A 1 238 ? 15.886  47.684 15.831  1.00 31.54 ? 537  ASN A N   1 
ATOM   1731 C CA  . ASN A 1 238 ? 15.419  47.677 17.225  1.00 32.46 ? 537  ASN A CA  1 
ATOM   1732 C C   . ASN A 1 238 ? 15.966  46.398 17.815  1.00 31.98 ? 537  ASN A C   1 
ATOM   1733 O O   . ASN A 1 238 ? 17.207  46.383 18.129  1.00 34.70 ? 537  ASN A O   1 
ATOM   1734 C CB  . ASN A 1 238 ? 13.895  47.798 17.250  1.00 33.29 ? 537  ASN A CB  1 
ATOM   1735 C CG  . ASN A 1 238 ? 13.497  49.265 17.329  1.00 33.46 ? 537  ASN A CG  1 
ATOM   1736 O OD1 . ASN A 1 238 ? 13.129  49.903 16.343  1.00 36.60 ? 537  ASN A OD1 1 
ATOM   1737 N ND2 . ASN A 1 238 ? 13.576  49.834 18.528  1.00 30.02 ? 537  ASN A ND2 1 
ATOM   1738 N N   . LEU A 1 239 ? 15.227  45.304 17.773  1.00 30.48 ? 538  LEU A N   1 
ATOM   1739 C CA  . LEU A 1 239 ? 15.729  44.017 18.261  1.00 28.60 ? 538  LEU A CA  1 
ATOM   1740 C C   . LEU A 1 239 ? 15.918  43.940 19.777  1.00 28.59 ? 538  LEU A C   1 
ATOM   1741 O O   . LEU A 1 239 ? 15.565  42.909 20.363  1.00 29.67 ? 538  LEU A O   1 
ATOM   1742 C CB  . LEU A 1 239 ? 17.048  43.664 17.558  1.00 26.20 ? 538  LEU A CB  1 
ATOM   1743 C CG  . LEU A 1 239 ? 17.754  42.407 18.072  1.00 24.31 ? 538  LEU A CG  1 
ATOM   1744 C CD1 . LEU A 1 239 ? 16.828  41.199 18.092  1.00 20.82 ? 538  LEU A CD1 1 
ATOM   1745 C CD2 . LEU A 1 239 ? 18.986  42.120 17.228  1.00 22.78 ? 538  LEU A CD2 1 
ATOM   1746 N N   . HIS A 1 240 ? 16.439  44.977 20.378  1.00 28.64 ? 539  HIS A N   1 
ATOM   1747 C CA  . HIS A 1 240 ? 16.588  45.219 21.779  1.00 28.62 ? 539  HIS A CA  1 
ATOM   1748 C C   . HIS A 1 240 ? 15.326  45.015 22.610  1.00 27.41 ? 539  HIS A C   1 
ATOM   1749 O O   . HIS A 1 240 ? 15.410  44.872 23.833  1.00 25.92 ? 539  HIS A O   1 
ATOM   1750 C CB  . HIS A 1 240 ? 17.069  46.678 21.964  1.00 29.38 ? 539  HIS A CB  1 
ATOM   1751 N N   . LYS A 1 241 ? 14.171  45.002 21.964  1.00 27.23 ? 540  LYS A N   1 
ATOM   1752 C CA  . LYS A 1 241 ? 12.914  44.691 22.640  1.00 27.74 ? 540  LYS A CA  1 
ATOM   1753 C C   . LYS A 1 241 ? 12.104  43.711 21.798  1.00 27.28 ? 540  LYS A C   1 
ATOM   1754 O O   . LYS A 1 241 ? 10.890  43.824 21.634  1.00 27.72 ? 540  LYS A O   1 
ATOM   1755 C CB  . LYS A 1 241 ? 12.079  45.938 22.920  1.00 28.06 ? 540  LYS A CB  1 
ATOM   1756 C CG  . LYS A 1 241 ? 12.776  47.166 23.454  1.00 28.12 ? 540  LYS A CG  1 
ATOM   1757 C CD  . LYS A 1 241 ? 12.698  47.298 24.970  1.00 27.12 ? 540  LYS A CD  1 
ATOM   1758 C CE  . LYS A 1 241 ? 14.019  47.749 25.567  1.00 26.87 ? 540  LYS A CE  1 
ATOM   1759 N NZ  . LYS A 1 241 ? 14.788  46.668 26.237  1.00 26.67 ? 540  LYS A NZ  1 
ATOM   1760 N N   . VAL A 1 242 ? 12.797  42.722 21.231  1.00 27.88 ? 541  VAL A N   1 
ATOM   1761 C CA  . VAL A 1 242 ? 12.154  41.834 20.267  1.00 29.71 ? 541  VAL A CA  1 
ATOM   1762 C C   . VAL A 1 242 ? 12.157  40.378 20.699  1.00 31.02 ? 541  VAL A C   1 
ATOM   1763 O O   . VAL A 1 242 ? 13.190  39.710 20.647  1.00 33.39 ? 541  VAL A O   1 
ATOM   1764 C CB  . VAL A 1 242 ? 12.849  41.964 18.897  1.00 30.13 ? 541  VAL A CB  1 
ATOM   1765 C CG1 . VAL A 1 242 ? 12.443  40.841 17.964  1.00 31.34 ? 541  VAL A CG1 1 
ATOM   1766 C CG2 . VAL A 1 242 ? 12.506  43.331 18.324  1.00 30.87 ? 541  VAL A CG2 1 
ATOM   1767 N N   . SER A 1 243 ? 10.992  39.887 21.109  1.00 30.95 ? 542  SER A N   1 
ATOM   1768 C CA  . SER A 1 243 ? 10.825  38.470 21.409  1.00 30.73 ? 542  SER A CA  1 
ATOM   1769 C C   . SER A 1 243 ? 11.362  37.628 20.257  1.00 29.85 ? 542  SER A C   1 
ATOM   1770 O O   . SER A 1 243 ? 11.061  37.905 19.093  1.00 32.06 ? 542  SER A O   1 
ATOM   1771 C CB  . SER A 1 243 ? 9.363   38.115 21.669  1.00 31.75 ? 542  SER A CB  1 
ATOM   1772 O OG  . SER A 1 243 ? 8.571   38.267 20.504  1.00 32.87 ? 542  SER A OG  1 
ATOM   1773 N N   . PRO A 1 244 ? 12.158  36.617 20.579  1.00 28.22 ? 543  PRO A N   1 
ATOM   1774 C CA  . PRO A 1 244 ? 12.663  35.670 19.589  1.00 27.00 ? 543  PRO A CA  1 
ATOM   1775 C C   . PRO A 1 244 ? 11.639  35.060 18.644  1.00 26.80 ? 543  PRO A C   1 
ATOM   1776 O O   . PRO A 1 244 ? 12.039  34.519 17.607  1.00 27.58 ? 543  PRO A O   1 
ATOM   1777 C CB  . PRO A 1 244 ? 13.213  34.534 20.472  1.00 27.40 ? 543  PRO A CB  1 
ATOM   1778 C CG  . PRO A 1 244 ? 13.683  35.251 21.698  1.00 28.12 ? 543  PRO A CG  1 
ATOM   1779 C CD  . PRO A 1 244 ? 12.671  36.333 21.935  1.00 28.04 ? 543  PRO A CD  1 
ATOM   1780 N N   . SER A 1 245 ? 10.366  35.124 18.979  1.00 26.06 ? 544  SER A N   1 
ATOM   1781 C CA  . SER A 1 245 ? 9.290   34.623 18.129  1.00 24.47 ? 544  SER A CA  1 
ATOM   1782 C C   . SER A 1 245 ? 8.971   35.557 16.970  1.00 23.13 ? 544  SER A C   1 
ATOM   1783 O O   . SER A 1 245 ? 8.654   35.093 15.871  1.00 22.59 ? 544  SER A O   1 
ATOM   1784 C CB  . SER A 1 245 ? 8.023   34.387 18.951  1.00 25.08 ? 544  SER A CB  1 
ATOM   1785 O OG  . SER A 1 245 ? 7.606   35.554 19.638  1.00 26.11 ? 544  SER A OG  1 
ATOM   1786 N N   . LEU A 1 246 ? 9.070   36.860 17.205  1.00 21.54 ? 545  LEU A N   1 
ATOM   1787 C CA  . LEU A 1 246 ? 8.886   37.853 16.150  1.00 19.11 ? 545  LEU A CA  1 
ATOM   1788 C C   . LEU A 1 246 ? 10.029  37.709 15.156  1.00 18.20 ? 545  LEU A C   1 
ATOM   1789 O O   . LEU A 1 246 ? 9.819   37.777 13.943  1.00 20.70 ? 545  LEU A O   1 
ATOM   1790 C CB  . LEU A 1 246 ? 8.765   39.260 16.721  1.00 18.40 ? 545  LEU A CB  1 
ATOM   1791 C CG  . LEU A 1 246 ? 8.217   40.325 15.761  1.00 18.86 ? 545  LEU A CG  1 
ATOM   1792 C CD1 . LEU A 1 246 ? 6.894   40.934 16.184  1.00 21.42 ? 545  LEU A CD1 1 
ATOM   1793 C CD2 . LEU A 1 246 ? 9.260   41.416 15.618  1.00 18.21 ? 545  LEU A CD2 1 
ATOM   1794 N N   . LYS A 1 247 ? 11.240  37.478 15.670  1.00 17.23 ? 546  LYS A N   1 
ATOM   1795 C CA  . LYS A 1 247 ? 12.352  37.142 14.784  1.00 17.49 ? 546  LYS A CA  1 
ATOM   1796 C C   . LYS A 1 247 ? 11.964  35.942 13.920  1.00 16.55 ? 546  LYS A C   1 
ATOM   1797 O O   . LYS A 1 247 ? 12.102  35.979 12.705  1.00 16.88 ? 546  LYS A O   1 
ATOM   1798 C CB  . LYS A 1 247 ? 13.634  36.771 15.510  1.00 19.19 ? 546  LYS A CB  1 
ATOM   1799 C CG  . LYS A 1 247 ? 14.256  37.831 16.401  1.00 19.39 ? 546  LYS A CG  1 
ATOM   1800 C CD  . LYS A 1 247 ? 15.582  37.328 16.946  1.00 20.00 ? 546  LYS A CD  1 
ATOM   1801 C CE  . LYS A 1 247 ? 15.709  37.454 18.462  1.00 19.94 ? 546  LYS A CE  1 
ATOM   1802 N NZ  . LYS A 1 247 ? 16.527  36.321 19.009  1.00 16.85 ? 546  LYS A NZ  1 
ATOM   1803 N N   . GLY A 1 248 ? 11.494  34.883 14.576  1.00 15.49 ? 547  GLY A N   1 
ATOM   1804 C CA  . GLY A 1 248 ? 11.246  33.621 13.899  1.00 15.55 ? 547  GLY A CA  1 
ATOM   1805 C C   . GLY A 1 248 ? 10.275  33.809 12.744  1.00 15.30 ? 547  GLY A C   1 
ATOM   1806 O O   . GLY A 1 248 ? 10.542  33.415 11.611  1.00 18.30 ? 547  GLY A O   1 
ATOM   1807 N N   . PHE A 1 249 ? 9.138   34.427 13.043  1.00 15.14 ? 548  PHE A N   1 
ATOM   1808 C CA  . PHE A 1 249 ? 8.169   34.785 12.003  1.00 13.99 ? 548  PHE A CA  1 
ATOM   1809 C C   . PHE A 1 249 ? 8.815   35.693 10.970  1.00 11.03 ? 548  PHE A C   1 
ATOM   1810 O O   . PHE A 1 249 ? 8.780   35.410 9.771   1.00 2.77  ? 548  PHE A O   1 
ATOM   1811 C CB  . PHE A 1 249 ? 6.964   35.444 12.661  1.00 14.74 ? 548  PHE A CB  1 
ATOM   1812 C CG  . PHE A 1 249 ? 5.772   35.763 11.791  1.00 15.35 ? 548  PHE A CG  1 
ATOM   1813 C CD1 . PHE A 1 249 ? 4.718   34.868 11.737  1.00 17.16 ? 548  PHE A CD1 1 
ATOM   1814 C CD2 . PHE A 1 249 ? 5.684   36.927 11.053  1.00 15.44 ? 548  PHE A CD2 1 
ATOM   1815 C CE1 . PHE A 1 249 ? 3.597   35.138 10.972  1.00 18.00 ? 548  PHE A CE1 1 
ATOM   1816 C CE2 . PHE A 1 249 ? 4.578   37.204 10.275  1.00 16.75 ? 548  PHE A CE2 1 
ATOM   1817 C CZ  . PHE A 1 249 ? 3.531   36.301 10.225  1.00 17.80 ? 548  PHE A CZ  1 
ATOM   1818 N N   . LEU A 1 250 ? 9.430   36.778 11.442  1.00 11.22 ? 549  LEU A N   1 
ATOM   1819 C CA  . LEU A 1 250 ? 10.125  37.697 10.536  1.00 13.13 ? 549  LEU A CA  1 
ATOM   1820 C C   . LEU A 1 250 ? 11.116  36.942 9.636   1.00 12.22 ? 549  LEU A C   1 
ATOM   1821 O O   . LEU A 1 250 ? 11.182  37.195 8.436   1.00 14.16 ? 549  LEU A O   1 
ATOM   1822 C CB  . LEU A 1 250 ? 10.875  38.806 11.278  1.00 13.73 ? 549  LEU A CB  1 
ATOM   1823 C CG  . LEU A 1 250 ? 10.369  40.231 11.104  1.00 14.40 ? 549  LEU A CG  1 
ATOM   1824 C CD1 . LEU A 1 250 ? 10.123  40.817 12.495  1.00 17.79 ? 549  LEU A CD1 1 
ATOM   1825 C CD2 . LEU A 1 250 ? 11.294  41.156 10.339  1.00 15.90 ? 549  LEU A CD2 1 
ATOM   1826 N N   . ASP A 1 251 ? 11.835  36.014 10.229  1.00 12.73 ? 550  ASP A N   1 
ATOM   1827 C CA  . ASP A 1 251 ? 12.859  35.210 9.621   1.00 14.07 ? 550  ASP A CA  1 
ATOM   1828 C C   . ASP A 1 251 ? 12.364  34.266 8.542   1.00 12.82 ? 550  ASP A C   1 
ATOM   1829 O O   . ASP A 1 251 ? 13.149  33.575 7.877   1.00 12.82 ? 550  ASP A O   1 
ATOM   1830 C CB  . ASP A 1 251 ? 13.536  34.349 10.713  1.00 14.80 ? 550  ASP A CB  1 
ATOM   1831 C CG  . ASP A 1 251 ? 14.508  35.102 11.591  1.00 15.37 ? 550  ASP A CG  1 
ATOM   1832 O OD1 . ASP A 1 251 ? 14.476  36.353 11.585  1.00 15.43 ? 550  ASP A OD1 1 
ATOM   1833 O OD2 . ASP A 1 251 ? 15.299  34.445 12.313  1.00 15.90 ? 550  ASP A OD2 1 
ATOM   1834 N N   . ARG A 1 252 ? 11.046  34.189 8.354   1.00 12.32 ? 551  ARG A N   1 
ATOM   1835 C CA  . ARG A 1 252 ? 10.536  33.252 7.335   1.00 12.09 ? 551  ARG A CA  1 
ATOM   1836 C C   . ARG A 1 252 ? 9.980   33.996 6.130   1.00 12.41 ? 551  ARG A C   1 
ATOM   1837 O O   . ARG A 1 252 ? 9.931   33.424 5.038   1.00 13.82 ? 551  ARG A O   1 
ATOM   1838 C CB  . ARG A 1 252 ? 9.482   32.323 7.928   1.00 12.79 ? 551  ARG A CB  1 
ATOM   1839 C CG  . ARG A 1 252 ? 10.012  31.347 8.966   1.00 12.20 ? 551  ARG A CG  1 
ATOM   1840 C CD  . ARG A 1 252 ? 10.685  30.159 8.320   1.00 12.00 ? 551  ARG A CD  1 
ATOM   1841 N NE  . ARG A 1 252 ? 9.935   29.493 7.271   1.00 11.01 ? 551  ARG A NE  1 
ATOM   1842 C CZ  . ARG A 1 252 ? 10.157  29.433 5.971   1.00 10.46 ? 551  ARG A CZ  1 
ATOM   1843 N NH1 . ARG A 1 252 ? 9.322   28.751 5.178   1.00 10.41 ? 551  ARG A NH1 1 
ATOM   1844 N NH2 . ARG A 1 252 ? 11.193  30.030 5.387   1.00 6.96  ? 551  ARG A NH2 1 
ATOM   1845 N N   . LEU A 1 253 ? 9.568   35.235 6.327   1.00 13.44 ? 552  LEU A N   1 
ATOM   1846 C CA  . LEU A 1 253 ? 8.954   36.070 5.320   1.00 13.32 ? 552  LEU A CA  1 
ATOM   1847 C C   . LEU A 1 253 ? 9.930   36.894 4.488   1.00 13.87 ? 552  LEU A C   1 
ATOM   1848 O O   . LEU A 1 253 ? 9.672   37.285 3.344   1.00 9.36  ? 552  LEU A O   1 
ATOM   1849 C CB  . LEU A 1 253 ? 7.989   37.030 6.032   1.00 13.30 ? 552  LEU A CB  1 
ATOM   1850 C CG  . LEU A 1 253 ? 6.684   36.427 6.547   1.00 13.98 ? 552  LEU A CG  1 
ATOM   1851 C CD1 . LEU A 1 253 ? 5.827   37.481 7.235   1.00 13.85 ? 552  LEU A CD1 1 
ATOM   1852 C CD2 . LEU A 1 253 ? 5.868   35.780 5.427   1.00 14.62 ? 552  LEU A CD2 1 
ATOM   1853 N N   . LEU A 1 254 ? 11.091  37.176 5.079   1.00 14.45 ? 553  LEU A N   1 
ATOM   1854 C CA  . LEU A 1 254 ? 12.134  37.913 4.361   1.00 13.32 ? 553  LEU A CA  1 
ATOM   1855 C C   . LEU A 1 254 ? 13.079  36.906 3.710   1.00 13.90 ? 553  LEU A C   1 
ATOM   1856 O O   . LEU A 1 254 ? 14.243  36.807 4.074   1.00 12.71 ? 553  LEU A O   1 
ATOM   1857 C CB  . LEU A 1 254 ? 12.878  38.876 5.285   1.00 11.83 ? 553  LEU A CB  1 
ATOM   1858 C CG  . LEU A 1 254 ? 12.017  40.017 5.847   1.00 10.15 ? 553  LEU A CG  1 
ATOM   1859 C CD1 . LEU A 1 254 ? 12.738  40.799 6.919   1.00 12.46 ? 553  LEU A CD1 1 
ATOM   1860 C CD2 . LEU A 1 254 ? 11.585  40.931 4.710   1.00 9.48  ? 553  LEU A CD2 1 
ATOM   1861 N N   . VAL A 1 255 ? 12.541  36.169 2.741   1.00 14.36 ? 554  VAL A N   1 
ATOM   1862 C CA  . VAL A 1 255 ? 13.321  35.290 1.898   1.00 13.85 ? 554  VAL A CA  1 
ATOM   1863 C C   . VAL A 1 255 ? 13.495  35.862 0.488   1.00 13.25 ? 554  VAL A C   1 
ATOM   1864 O O   . VAL A 1 255 ? 12.527  36.190 -0.201  1.00 4.91  ? 554  VAL A O   1 
ATOM   1865 C CB  . VAL A 1 255 ? 12.658  33.904 1.843   1.00 15.67 ? 554  VAL A CB  1 
ATOM   1866 C CG1 . VAL A 1 255 ? 13.455  32.954 0.962   1.00 21.98 ? 554  VAL A CG1 1 
ATOM   1867 C CG2 . VAL A 1 255 ? 12.500  33.365 3.259   1.00 9.71  ? 554  VAL A CG2 1 
ATOM   1868 N N   . ARG A 1 256 ? 14.756  35.982 0.085   1.00 14.15 ? 555  ARG A N   1 
ATOM   1869 C CA  . ARG A 1 256 ? 15.149  36.495 -1.205  1.00 16.16 ? 555  ARG A CA  1 
ATOM   1870 C C   . ARG A 1 256 ? 14.840  35.509 -2.331  1.00 16.29 ? 555  ARG A C   1 
ATOM   1871 O O   . ARG A 1 256 ? 14.418  35.877 -3.429  1.00 16.78 ? 555  ARG A O   1 
ATOM   1872 C CB  . ARG A 1 256 ? 16.652  36.796 -1.228  1.00 17.83 ? 555  ARG A CB  1 
ATOM   1873 C CG  . ARG A 1 256 ? 17.043  38.226 -0.933  1.00 18.44 ? 555  ARG A CG  1 
ATOM   1874 C CD  . ARG A 1 256 ? 18.443  38.558 -1.403  1.00 18.39 ? 555  ARG A CD  1 
ATOM   1875 N NE  . ARG A 1 256 ? 18.598  38.545 -2.852  1.00 18.47 ? 555  ARG A NE  1 
ATOM   1876 C CZ  . ARG A 1 256 ? 18.141  39.403 -3.747  1.00 15.73 ? 555  ARG A CZ  1 
ATOM   1877 N NH1 . ARG A 1 256 ? 17.427  40.446 -3.362  1.00 12.17 ? 555  ARG A NH1 1 
ATOM   1878 N NH2 . ARG A 1 256 ? 18.394  39.215 -5.034  1.00 12.19 ? 555  ARG A NH2 1 
ATOM   1879 N N   . ASP A 1 257 ? 15.058  34.220 -2.043  1.00 14.75 ? 556  ASP A N   1 
ATOM   1880 C CA  . ASP A 1 257 ? 14.593  33.190 -2.979  1.00 14.52 ? 556  ASP A CA  1 
ATOM   1881 C C   . ASP A 1 257 ? 13.083  33.087 -2.758  1.00 13.43 ? 556  ASP A C   1 
ATOM   1882 O O   . ASP A 1 257 ? 12.634  32.657 -1.695  1.00 12.17 ? 556  ASP A O   1 
ATOM   1883 C CB  . ASP A 1 257 ? 15.279  31.855 -2.795  1.00 14.61 ? 556  ASP A CB  1 
ATOM   1884 C CG  . ASP A 1 257 ? 15.184  30.929 -3.986  1.00 14.54 ? 556  ASP A CG  1 
ATOM   1885 O OD1 . ASP A 1 257 ? 16.020  29.987 -4.028  1.00 21.82 ? 556  ASP A OD1 1 
ATOM   1886 O OD2 . ASP A 1 257 ? 14.321  31.091 -4.868  1.00 5.56  ? 556  ASP A OD2 1 
ATOM   1887 N N   . PRO A 1 258 ? 12.320  33.519 -3.751  1.00 12.90 ? 557  PRO A N   1 
ATOM   1888 C CA  . PRO A 1 258 ? 10.863  33.487 -3.680  1.00 13.72 ? 557  PRO A CA  1 
ATOM   1889 C C   . PRO A 1 258 ? 10.304  32.134 -3.235  1.00 15.29 ? 557  PRO A C   1 
ATOM   1890 O O   . PRO A 1 258 ? 9.228   32.104 -2.629  1.00 17.41 ? 557  PRO A O   1 
ATOM   1891 C CB  . PRO A 1 258 ? 10.456  33.760 -5.131  1.00 12.63 ? 557  PRO A CB  1 
ATOM   1892 C CG  . PRO A 1 258 ? 11.565  34.604 -5.665  1.00 11.38 ? 557  PRO A CG  1 
ATOM   1893 C CD  . PRO A 1 258 ? 12.817  34.096 -5.018  1.00 11.52 ? 557  PRO A CD  1 
ATOM   1894 N N   . ALA A 1 259 ? 11.019  31.071 -3.535  1.00 15.20 ? 558  ALA A N   1 
ATOM   1895 C CA  . ALA A 1 259 ? 10.632  29.704 -3.273  1.00 14.37 ? 558  ALA A CA  1 
ATOM   1896 C C   . ALA A 1 259 ? 10.884  29.221 -1.856  1.00 14.18 ? 558  ALA A C   1 
ATOM   1897 O O   . ALA A 1 259 ? 10.211  28.299 -1.390  1.00 13.88 ? 558  ALA A O   1 
ATOM   1898 C CB  . ALA A 1 259 ? 11.399  28.775 -4.218  1.00 13.49 ? 558  ALA A CB  1 
ATOM   1899 N N   . GLN A 1 260 ? 11.852  29.824 -1.173  1.00 14.38 ? 559  GLN A N   1 
ATOM   1900 C CA  . GLN A 1 260 ? 12.116  29.497 0.226   1.00 14.27 ? 559  GLN A CA  1 
ATOM   1901 C C   . GLN A 1 260 ? 11.341  30.432 1.159   1.00 15.58 ? 559  GLN A C   1 
ATOM   1902 O O   . GLN A 1 260 ? 11.605  30.492 2.358   1.00 15.17 ? 559  GLN A O   1 
ATOM   1903 C CB  . GLN A 1 260 ? 13.616  29.568 0.517   1.00 14.40 ? 559  GLN A CB  1 
ATOM   1904 C CG  . GLN A 1 260 ? 14.197  28.195 0.898   1.00 12.50 ? 559  GLN A CG  1 
ATOM   1905 C CD  . GLN A 1 260 ? 14.052  27.235 -0.271  1.00 9.71  ? 559  GLN A CD  1 
ATOM   1906 O OE1 . GLN A 1 260 ? 14.606  27.508 -1.333  1.00 8.39  ? 559  GLN A OE1 1 
ATOM   1907 N NE2 . GLN A 1 260 ? 13.301  26.165 -0.086  1.00 10.49 ? 559  GLN A NE2 1 
ATOM   1908 N N   . ARG A 1 261 ? 10.391  31.146 0.565   1.00 16.69 ? 560  ARG A N   1 
ATOM   1909 C CA  . ARG A 1 261 ? 9.566   32.117 1.256   1.00 16.85 ? 560  ARG A CA  1 
ATOM   1910 C C   . ARG A 1 261 ? 8.272   31.460 1.728   1.00 13.78 ? 560  ARG A C   1 
ATOM   1911 O O   . ARG A 1 261 ? 7.609   30.752 0.971   1.00 14.04 ? 560  ARG A O   1 
ATOM   1912 C CB  . ARG A 1 261 ? 9.251   33.321 0.356   1.00 19.76 ? 560  ARG A CB  1 
ATOM   1913 C CG  . ARG A 1 261 ? 9.094   34.647 1.092   1.00 21.10 ? 560  ARG A CG  1 
ATOM   1914 C CD  . ARG A 1 261 ? 9.815   35.770 0.347   1.00 21.49 ? 560  ARG A CD  1 
ATOM   1915 N NE  . ARG A 1 261 ? 8.918   36.412 -0.593  1.00 21.31 ? 560  ARG A NE  1 
ATOM   1916 C CZ  . ARG A 1 261 ? 9.231   36.984 -1.744  1.00 20.31 ? 560  ARG A CZ  1 
ATOM   1917 N NH1 . ARG A 1 261 ? 8.271   37.534 -2.478  1.00 14.26 ? 560  ARG A NH1 1 
ATOM   1918 N NH2 . ARG A 1 261 ? 10.482  37.021 -2.186  1.00 21.63 ? 560  ARG A NH2 1 
ATOM   1919 N N   . ALA A 1 262 ? 7.931   31.690 2.988   1.00 12.27 ? 561  ALA A N   1 
ATOM   1920 C CA  . ALA A 1 262 ? 6.811   31.004 3.617   1.00 11.95 ? 561  ALA A CA  1 
ATOM   1921 C C   . ALA A 1 262 ? 5.476   31.483 3.061   1.00 11.97 ? 561  ALA A C   1 
ATOM   1922 O O   . ALA A 1 262 ? 5.363   32.547 2.454   1.00 10.62 ? 561  ALA A O   1 
ATOM   1923 C CB  . ALA A 1 262 ? 6.894   31.170 5.124   1.00 8.68  ? 561  ALA A CB  1 
ATOM   1924 N N   . THR A 1 263 ? 4.441   30.664 3.259   1.00 12.08 ? 562  THR A N   1 
ATOM   1925 C CA  . THR A 1 263 ? 3.151   30.927 2.631   1.00 12.15 ? 562  THR A CA  1 
ATOM   1926 C C   . THR A 1 263 ? 2.132   31.342 3.689   1.00 12.79 ? 562  THR A C   1 
ATOM   1927 O O   . THR A 1 263 ? 2.306   31.022 4.859   1.00 14.89 ? 562  THR A O   1 
ATOM   1928 C CB  . THR A 1 263 ? 2.659   29.719 1.821   1.00 12.61 ? 562  THR A CB  1 
ATOM   1929 O OG1 . THR A 1 263 ? 2.573   28.552 2.637   1.00 15.26 ? 562  THR A OG1 1 
ATOM   1930 C CG2 . THR A 1 263 ? 3.669   29.361 0.733   1.00 13.44 ? 562  THR A CG2 1 
ATOM   1931 N N   . ALA A 1 264 ? 1.109   32.066 3.258   1.00 13.10 ? 563  ALA A N   1 
ATOM   1932 C CA  . ALA A 1 264 ? 0.087   32.602 4.147   1.00 12.91 ? 563  ALA A CA  1 
ATOM   1933 C C   . ALA A 1 264 ? -0.588  31.467 4.908   1.00 13.82 ? 563  ALA A C   1 
ATOM   1934 O O   . ALA A 1 264 ? -0.835  31.558 6.116   1.00 13.69 ? 563  ALA A O   1 
ATOM   1935 C CB  . ALA A 1 264 ? -0.898  33.435 3.351   1.00 12.54 ? 563  ALA A CB  1 
ATOM   1936 N N   . ALA A 1 265 ? -0.881  30.386 4.195   1.00 14.75 ? 564  ALA A N   1 
ATOM   1937 C CA  . ALA A 1 265 ? -1.436  29.186 4.801   1.00 17.42 ? 564  ALA A CA  1 
ATOM   1938 C C   . ALA A 1 265 ? -0.547  28.674 5.935   1.00 20.33 ? 564  ALA A C   1 
ATOM   1939 O O   . ALA A 1 265 ? -1.032  28.174 6.953   1.00 24.34 ? 564  ALA A O   1 
ATOM   1940 C CB  . ALA A 1 265 ? -1.619  28.110 3.747   1.00 17.33 ? 564  ALA A CB  1 
ATOM   1941 N N   . GLU A 1 266 ? 0.759   28.817 5.754   1.00 21.05 ? 565  GLU A N   1 
ATOM   1942 C CA  . GLU A 1 266 ? 1.739   28.410 6.747   1.00 20.38 ? 565  GLU A CA  1 
ATOM   1943 C C   . GLU A 1 266 ? 1.691   29.353 7.951   1.00 19.89 ? 565  GLU A C   1 
ATOM   1944 O O   . GLU A 1 266 ? 1.691   28.936 9.108   1.00 18.32 ? 565  GLU A O   1 
ATOM   1945 C CB  . GLU A 1 266 ? 3.150   28.414 6.163   1.00 19.98 ? 565  GLU A CB  1 
ATOM   1946 C CG  . GLU A 1 266 ? 3.578   27.279 5.275   1.00 19.41 ? 565  GLU A CG  1 
ATOM   1947 C CD  . GLU A 1 266 ? 4.649   27.598 4.254   1.00 18.90 ? 565  GLU A CD  1 
ATOM   1948 O OE1 . GLU A 1 266 ? 5.691   28.221 4.546   1.00 18.64 ? 565  GLU A OE1 1 
ATOM   1949 O OE2 . GLU A 1 266 ? 4.487   27.218 3.071   1.00 16.84 ? 565  GLU A OE2 1 
ATOM   1950 N N   . LEU A 1 267 ? 1.645   30.647 7.657   1.00 20.20 ? 566  LEU A N   1 
ATOM   1951 C CA  . LEU A 1 267 ? 1.858   31.686 8.650   1.00 21.00 ? 566  LEU A CA  1 
ATOM   1952 C C   . LEU A 1 267 ? 0.774   31.751 9.703   1.00 21.56 ? 566  LEU A C   1 
ATOM   1953 O O   . LEU A 1 267 ? 1.009   32.177 10.839  1.00 22.88 ? 566  LEU A O   1 
ATOM   1954 C CB  . LEU A 1 267 ? 2.018   33.027 7.899   1.00 20.70 ? 566  LEU A CB  1 
ATOM   1955 C CG  . LEU A 1 267 ? 3.359   33.150 7.155   1.00 19.64 ? 566  LEU A CG  1 
ATOM   1956 C CD1 . LEU A 1 267 ? 3.205   33.713 5.756   1.00 12.18 ? 566  LEU A CD1 1 
ATOM   1957 C CD2 . LEU A 1 267 ? 4.333   33.991 7.973   1.00 19.94 ? 566  LEU A CD2 1 
ATOM   1958 N N   . LEU A 1 268 ? -0.442  31.319 9.365   1.00 22.51 ? 567  LEU A N   1 
ATOM   1959 C CA  . LEU A 1 268 ? -1.514  31.356 10.381  1.00 22.73 ? 567  LEU A CA  1 
ATOM   1960 C C   . LEU A 1 268 ? -1.149  30.383 11.505  1.00 21.64 ? 567  LEU A C   1 
ATOM   1961 O O   . LEU A 1 268 ? -1.468  30.596 12.668  1.00 19.66 ? 567  LEU A O   1 
ATOM   1962 C CB  . LEU A 1 268 ? -2.885  31.039 9.804   1.00 22.43 ? 567  LEU A CB  1 
ATOM   1963 C CG  . LEU A 1 268 ? -3.418  31.880 8.646   1.00 21.67 ? 567  LEU A CG  1 
ATOM   1964 C CD1 . LEU A 1 268 ? -4.474  31.105 7.859   1.00 16.87 ? 567  LEU A CD1 1 
ATOM   1965 C CD2 . LEU A 1 268 ? -3.986  33.223 9.098   1.00 22.86 ? 567  LEU A CD2 1 
ATOM   1966 N N   . LYS A 1 269 ? -0.462  29.307 11.128  1.00 22.01 ? 568  LYS A N   1 
ATOM   1967 C CA  . LYS A 1 269 ? -0.077  28.264 12.067  1.00 20.70 ? 568  LYS A CA  1 
ATOM   1968 C C   . LYS A 1 269 ? 1.179   28.638 12.842  1.00 21.82 ? 568  LYS A C   1 
ATOM   1969 O O   . LYS A 1 269 ? 1.833   27.805 13.476  1.00 18.83 ? 568  LYS A O   1 
ATOM   1970 C CB  . LYS A 1 269 ? 0.153   26.965 11.299  1.00 18.43 ? 568  LYS A CB  1 
ATOM   1971 C CG  . LYS A 1 269 ? -1.086  26.129 11.070  1.00 17.11 ? 568  LYS A CG  1 
ATOM   1972 C CD  . LYS A 1 269 ? -0.794  24.961 10.140  1.00 16.46 ? 568  LYS A CD  1 
ATOM   1973 N N   . HIS A 1 270 ? 1.529   29.927 12.775  1.00 22.81 ? 569  HIS A N   1 
ATOM   1974 C CA  . HIS A 1 270 ? 2.785   30.379 13.367  1.00 22.74 ? 569  HIS A CA  1 
ATOM   1975 C C   . HIS A 1 270 ? 2.609   30.772 14.817  1.00 20.76 ? 569  HIS A C   1 
ATOM   1976 O O   . HIS A 1 270 ? 1.641   31.486 15.111  1.00 22.44 ? 569  HIS A O   1 
ATOM   1977 C CB  . HIS A 1 270 ? 3.385   31.527 12.547  1.00 25.78 ? 569  HIS A CB  1 
ATOM   1978 C CG  . HIS A 1 270 ? 4.879   31.537 12.694  1.00 27.51 ? 569  HIS A CG  1 
ATOM   1979 N ND1 . HIS A 1 270 ? 5.528   32.382 13.558  1.00 28.78 ? 569  HIS A ND1 1 
ATOM   1980 C CD2 . HIS A 1 270 ? 5.844   30.801 12.097  1.00 27.77 ? 569  HIS A CD2 1 
ATOM   1981 C CE1 . HIS A 1 270 ? 6.831   32.176 13.497  1.00 28.87 ? 569  HIS A CE1 1 
ATOM   1982 N NE2 . HIS A 1 270 ? 7.046   31.221 12.610  1.00 28.43 ? 569  HIS A NE2 1 
ATOM   1983 N N   . PRO A 1 271 ? 3.468   30.325 15.726  1.00 18.31 ? 570  PRO A N   1 
ATOM   1984 C CA  . PRO A 1 271 ? 3.284   30.679 17.150  1.00 18.60 ? 570  PRO A CA  1 
ATOM   1985 C C   . PRO A 1 271 ? 3.407   32.146 17.515  1.00 19.44 ? 570  PRO A C   1 
ATOM   1986 O O   . PRO A 1 271 ? 2.900   32.575 18.564  1.00 22.14 ? 570  PRO A O   1 
ATOM   1987 C CB  . PRO A 1 271 ? 4.414   29.925 17.874  1.00 18.69 ? 570  PRO A CB  1 
ATOM   1988 C CG  . PRO A 1 271 ? 4.785   28.834 16.933  1.00 18.19 ? 570  PRO A CG  1 
ATOM   1989 C CD  . PRO A 1 271 ? 4.650   29.455 15.575  1.00 17.12 ? 570  PRO A CD  1 
ATOM   1990 N N   . PHE A 1 272 ? 4.062   32.951 16.683  1.00 19.24 ? 571  PHE A N   1 
ATOM   1991 C CA  . PHE A 1 272 ? 4.057   34.396 16.900  1.00 19.94 ? 571  PHE A CA  1 
ATOM   1992 C C   . PHE A 1 272 ? 2.617   34.908 17.044  1.00 21.44 ? 571  PHE A C   1 
ATOM   1993 O O   . PHE A 1 272 ? 2.345   35.831 17.804  1.00 21.06 ? 571  PHE A O   1 
ATOM   1994 C CB  . PHE A 1 272 ? 4.705   35.173 15.760  1.00 19.05 ? 571  PHE A CB  1 
ATOM   1995 C CG  . PHE A 1 272 ? 4.294   36.635 15.710  1.00 18.46 ? 571  PHE A CG  1 
ATOM   1996 C CD1 . PHE A 1 272 ? 4.675   37.512 16.711  1.00 18.79 ? 571  PHE A CD1 1 
ATOM   1997 C CD2 . PHE A 1 272 ? 3.530   37.113 14.661  1.00 18.30 ? 571  PHE A CD2 1 
ATOM   1998 C CE1 . PHE A 1 272 ? 4.300   38.844 16.662  1.00 18.88 ? 571  PHE A CE1 1 
ATOM   1999 C CE2 . PHE A 1 272 ? 3.149   38.439 14.596  1.00 17.37 ? 571  PHE A CE2 1 
ATOM   2000 C CZ  . PHE A 1 272 ? 3.540   39.303 15.596  1.00 18.27 ? 571  PHE A CZ  1 
ATOM   2001 N N   . LEU A 1 273 ? 1.726   34.294 16.280  1.00 22.91 ? 572  LEU A N   1 
ATOM   2002 C CA  . LEU A 1 273 ? 0.335   34.690 16.199  1.00 23.80 ? 572  LEU A CA  1 
ATOM   2003 C C   . LEU A 1 273 ? -0.498  34.226 17.382  1.00 23.97 ? 572  LEU A C   1 
ATOM   2004 O O   . LEU A 1 273 ? -1.716  34.430 17.421  1.00 26.11 ? 572  LEU A O   1 
ATOM   2005 C CB  . LEU A 1 273 ? -0.269  34.167 14.890  1.00 23.09 ? 572  LEU A CB  1 
ATOM   2006 C CG  . LEU A 1 273 ? 0.171   34.797 13.573  1.00 21.80 ? 572  LEU A CG  1 
ATOM   2007 C CD1 . LEU A 1 273 ? -0.600  34.136 12.434  1.00 22.97 ? 572  LEU A CD1 1 
ATOM   2008 C CD2 . LEU A 1 273 ? -0.019  36.303 13.530  1.00 19.59 ? 572  LEU A CD2 1 
ATOM   2009 N N   . ALA A 1 274 ? 0.145   33.621 18.380  1.00 24.20 ? 573  ALA A N   1 
ATOM   2010 C CA  . ALA A 1 274 ? -0.575  33.262 19.607  1.00 24.65 ? 573  ALA A CA  1 
ATOM   2011 C C   . ALA A 1 274 ? -0.921  34.523 20.400  1.00 24.16 ? 573  ALA A C   1 
ATOM   2012 O O   . ALA A 1 274 ? -1.728  34.503 21.326  1.00 22.03 ? 573  ALA A O   1 
ATOM   2013 C CB  . ALA A 1 274 ? 0.236   32.317 20.477  1.00 24.27 ? 573  ALA A CB  1 
ATOM   2014 N N   . LYS A 1 275 ? -0.281  35.627 20.022  1.00 24.72 ? 574  LYS A N   1 
ATOM   2015 C CA  . LYS A 1 275 ? -0.326  36.853 20.793  1.00 24.39 ? 574  LYS A CA  1 
ATOM   2016 C C   . LYS A 1 275 ? -1.204  37.951 20.243  1.00 24.62 ? 574  LYS A C   1 
ATOM   2017 O O   . LYS A 1 275 ? -1.276  39.024 20.845  1.00 20.78 ? 574  LYS A O   1 
ATOM   2018 C CB  . LYS A 1 275 ? 1.122   37.370 20.917  1.00 23.47 ? 574  LYS A CB  1 
ATOM   2019 C CG  . LYS A 1 275 ? 1.791   36.598 22.042  1.00 23.61 ? 574  LYS A CG  1 
ATOM   2020 C CD  . LYS A 1 275 ? 3.307   36.650 21.956  1.00 24.40 ? 574  LYS A CD  1 
ATOM   2021 C CE  . LYS A 1 275 ? 3.895   37.457 23.106  1.00 24.07 ? 574  LYS A CE  1 
ATOM   2022 N NZ  . LYS A 1 275 ? 5.355   37.687 22.889  1.00 25.35 ? 574  LYS A NZ  1 
ATOM   2023 N N   . ALA A 1 276 ? -1.880  37.693 19.130  1.00 25.73 ? 575  ALA A N   1 
ATOM   2024 C CA  . ALA A 1 276 ? -2.821  38.657 18.564  1.00 26.63 ? 575  ALA A CA  1 
ATOM   2025 C C   . ALA A 1 276 ? -3.851  39.093 19.597  1.00 27.44 ? 575  ALA A C   1 
ATOM   2026 O O   . ALA A 1 276 ? -4.287  38.292 20.427  1.00 27.77 ? 575  ALA A O   1 
ATOM   2027 C CB  . ALA A 1 276 ? -3.475  38.055 17.332  1.00 27.43 ? 575  ALA A CB  1 
ATOM   2028 N N   . GLY A 1 277 ? -4.229  40.369 19.560  1.00 28.15 ? 576  GLY A N   1 
ATOM   2029 C CA  . GLY A 1 277 ? -5.186  40.900 20.517  1.00 29.43 ? 576  GLY A CA  1 
ATOM   2030 C C   . GLY A 1 277 ? -6.544  41.154 19.893  1.00 31.09 ? 576  GLY A C   1 
ATOM   2031 O O   . GLY A 1 277 ? -6.667  41.211 18.666  1.00 32.39 ? 576  GLY A O   1 
ATOM   2032 N N   . PRO A 1 278 ? -7.570  41.314 20.726  1.00 31.86 ? 577  PRO A N   1 
ATOM   2033 C CA  . PRO A 1 278 ? -8.910  41.635 20.226  1.00 31.85 ? 577  PRO A CA  1 
ATOM   2034 C C   . PRO A 1 278 ? -8.965  43.059 19.687  1.00 31.39 ? 577  PRO A C   1 
ATOM   2035 O O   . PRO A 1 278 ? -8.026  43.833 19.881  1.00 36.50 ? 577  PRO A O   1 
ATOM   2036 C CB  . PRO A 1 278 ? -9.791  41.534 21.474  1.00 32.07 ? 577  PRO A CB  1 
ATOM   2037 C CG  . PRO A 1 278 ? -8.850  41.822 22.600  1.00 32.21 ? 577  PRO A CG  1 
ATOM   2038 C CD  . PRO A 1 278 ? -7.540  41.203 22.192  1.00 31.85 ? 577  PRO A CD  1 
ATOM   2039 N N   . PRO A 1 279 ? -10.059 43.404 19.019  1.00 29.73 ? 578  PRO A N   1 
ATOM   2040 C CA  . PRO A 1 279 ? -10.251 44.785 18.559  1.00 27.67 ? 578  PRO A CA  1 
ATOM   2041 C C   . PRO A 1 279 ? -10.029 45.778 19.701  1.00 24.45 ? 578  PRO A C   1 
ATOM   2042 O O   . PRO A 1 279 ? -9.248  46.722 19.589  1.00 21.77 ? 578  PRO A O   1 
ATOM   2043 C CB  . PRO A 1 279 ? -11.706 44.815 18.111  1.00 28.84 ? 578  PRO A CB  1 
ATOM   2044 C CG  . PRO A 1 279 ? -12.129 43.404 17.916  1.00 29.16 ? 578  PRO A CG  1 
ATOM   2045 C CD  . PRO A 1 279 ? -11.170 42.517 18.644  1.00 29.49 ? 578  PRO A CD  1 
ATOM   2046 N N   . ALA A 1 280 ? -10.728 45.542 20.804  1.00 22.56 ? 579  ALA A N   1 
ATOM   2047 C CA  . ALA A 1 280 ? -10.589 46.357 22.000  1.00 20.58 ? 579  ALA A CA  1 
ATOM   2048 C C   . ALA A 1 280 ? -9.133  46.563 22.380  1.00 18.36 ? 579  ALA A C   1 
ATOM   2049 O O   . ALA A 1 280 ? -8.729  47.664 22.737  1.00 12.44 ? 579  ALA A O   1 
ATOM   2050 C CB  . ALA A 1 280 ? -11.349 45.706 23.147  1.00 19.69 ? 579  ALA A CB  1 
ATOM   2051 N N   . SER A 1 281 ? -8.325  45.506 22.291  1.00 18.41 ? 580  SER A N   1 
ATOM   2052 C CA  . SER A 1 281 ? -6.914  45.624 22.673  1.00 19.31 ? 580  SER A CA  1 
ATOM   2053 C C   . SER A 1 281 ? -6.173  46.605 21.762  1.00 20.45 ? 580  SER A C   1 
ATOM   2054 O O   . SER A 1 281 ? -5.109  47.117 22.115  1.00 22.49 ? 580  SER A O   1 
ATOM   2055 C CB  . SER A 1 281 ? -6.226  44.260 22.686  1.00 19.21 ? 580  SER A CB  1 
ATOM   2056 O OG  . SER A 1 281 ? -6.263  43.581 21.452  1.00 20.01 ? 580  SER A OG  1 
ATOM   2057 N N   . ILE A 1 282 ? -6.747  46.853 20.596  1.00 20.91 ? 581  ILE A N   1 
ATOM   2058 C CA  . ILE A 1 282 ? -6.198  47.773 19.615  1.00 20.82 ? 581  ILE A CA  1 
ATOM   2059 C C   . ILE A 1 282 ? -6.722  49.183 19.771  1.00 21.91 ? 581  ILE A C   1 
ATOM   2060 O O   . ILE A 1 282 ? -6.060  50.152 19.373  1.00 22.06 ? 581  ILE A O   1 
ATOM   2061 C CB  . ILE A 1 282 ? -6.507  47.209 18.209  1.00 20.36 ? 581  ILE A CB  1 
ATOM   2062 C CG1 . ILE A 1 282 ? -6.032  45.758 18.072  1.00 20.55 ? 581  ILE A CG1 1 
ATOM   2063 C CG2 . ILE A 1 282 ? -5.945  48.071 17.104  1.00 18.62 ? 581  ILE A CG2 1 
ATOM   2064 C CD1 . ILE A 1 282 ? -5.939  45.275 16.647  1.00 20.62 ? 581  ILE A CD1 1 
ATOM   2065 N N   . VAL A 1 283 ? -7.912  49.343 20.360  1.00 23.23 ? 582  VAL A N   1 
ATOM   2066 C CA  . VAL A 1 283 ? -8.544  50.668 20.387  1.00 24.62 ? 582  VAL A CA  1 
ATOM   2067 C C   . VAL A 1 283 ? -7.714  51.794 20.971  1.00 23.92 ? 582  VAL A C   1 
ATOM   2068 O O   . VAL A 1 283 ? -7.779  52.906 20.415  1.00 18.74 ? 582  VAL A O   1 
ATOM   2069 C CB  . VAL A 1 283 ? -9.925  50.693 21.095  1.00 25.93 ? 582  VAL A CB  1 
ATOM   2070 C CG1 . VAL A 1 283 ? -10.955 49.882 20.320  1.00 25.22 ? 582  VAL A CG1 1 
ATOM   2071 C CG2 . VAL A 1 283 ? -9.890  50.195 22.528  1.00 30.38 ? 582  VAL A CG2 1 
ATOM   2072 N N   . PRO A 1 284 ? -6.980  51.605 22.052  1.00 24.31 ? 583  PRO A N   1 
ATOM   2073 C CA  . PRO A 1 284 ? -6.348  52.784 22.694  1.00 23.60 ? 583  PRO A CA  1 
ATOM   2074 C C   . PRO A 1 284 ? -5.177  53.353 21.922  1.00 22.32 ? 583  PRO A C   1 
ATOM   2075 O O   . PRO A 1 284 ? -4.564  54.331 22.364  1.00 22.69 ? 583  PRO A O   1 
ATOM   2076 C CB  . PRO A 1 284 ? -5.843  52.290 24.051  1.00 23.67 ? 583  PRO A CB  1 
ATOM   2077 C CG  . PRO A 1 284 ? -6.461  50.944 24.218  1.00 24.26 ? 583  PRO A CG  1 
ATOM   2078 C CD  . PRO A 1 284 ? -6.616  50.407 22.829  1.00 24.81 ? 583  PRO A CD  1 
ATOM   2079 N N   . LEU A 1 285 ? -4.846  52.775 20.772  1.00 21.60 ? 584  LEU A N   1 
ATOM   2080 C CA  . LEU A 1 285 ? -3.716  53.317 19.992  1.00 21.54 ? 584  LEU A CA  1 
ATOM   2081 C C   . LEU A 1 285 ? -4.198  54.494 19.153  1.00 21.50 ? 584  LEU A C   1 
ATOM   2082 O O   . LEU A 1 285 ? -3.474  55.465 18.966  1.00 19.14 ? 584  LEU A O   1 
ATOM   2083 C CB  . LEU A 1 285 ? -3.105  52.209 19.162  1.00 21.43 ? 584  LEU A CB  1 
ATOM   2084 C CG  . LEU A 1 285 ? -1.721  51.667 19.499  1.00 20.25 ? 584  LEU A CG  1 
ATOM   2085 C CD1 . LEU A 1 285 ? -1.557  50.952 20.825  1.00 20.12 ? 584  LEU A CD1 1 
ATOM   2086 C CD2 . LEU A 1 285 ? -1.352  50.688 18.386  1.00 21.14 ? 584  LEU A CD2 1 
ATOM   2087 N N   . MET A 1 286 ? -5.436  54.395 18.680  1.00 23.37 ? 585  MET A N   1 
ATOM   2088 C CA  . MET A 1 286 ? -6.049  55.479 17.923  1.00 25.60 ? 585  MET A CA  1 
ATOM   2089 C C   . MET A 1 286 ? -6.555  56.556 18.887  1.00 27.94 ? 585  MET A C   1 
ATOM   2090 O O   . MET A 1 286 ? -6.630  57.731 18.535  1.00 32.47 ? 585  MET A O   1 
ATOM   2091 C CB  . MET A 1 286 ? -7.205  55.033 17.051  1.00 24.46 ? 585  MET A CB  1 
ATOM   2092 C CG  . MET A 1 286 ? -7.090  53.757 16.264  1.00 23.83 ? 585  MET A CG  1 
ATOM   2093 S SD  . MET A 1 286 ? -8.401  52.601 16.726  1.00 17.39 ? 585  MET A SD  1 
ATOM   2094 C CE  . MET A 1 286 ? -7.623  51.056 16.317  1.00 22.37 ? 585  MET A CE  1 
ATOM   2095 N N   . ARG A 1 287 ? -6.888  56.142 20.103  1.00 28.95 ? 586  ARG A N   1 
ATOM   2096 C CA  . ARG A 1 287 ? -7.426  57.072 21.094  1.00 31.34 ? 586  ARG A CA  1 
ATOM   2097 C C   . ARG A 1 287 ? -6.430  58.178 21.402  1.00 32.98 ? 586  ARG A C   1 
ATOM   2098 O O   . ARG A 1 287 ? -6.805  59.261 21.858  1.00 34.89 ? 586  ARG A O   1 
ATOM   2099 C CB  . ARG A 1 287 ? -7.838  56.347 22.378  1.00 31.57 ? 586  ARG A CB  1 
ATOM   2100 C CG  . ARG A 1 287 ? -9.321  56.038 22.507  1.00 31.55 ? 586  ARG A CG  1 
ATOM   2101 C CD  . ARG A 1 287 ? -9.744  54.956 21.518  1.00 31.63 ? 586  ARG A CD  1 
ATOM   2102 N NE  . ARG A 1 287 ? -10.128 55.504 20.228  1.00 32.17 ? 586  ARG A NE  1 
ATOM   2103 C CZ  . ARG A 1 287 ? -10.870 54.977 19.272  1.00 32.53 ? 586  ARG A CZ  1 
ATOM   2104 N NH1 . ARG A 1 287 ? -11.405 53.769 19.379  1.00 32.94 ? 586  ARG A NH1 1 
ATOM   2105 N NH2 . ARG A 1 287 ? -11.082 55.680 18.165  1.00 33.27 ? 586  ARG A NH2 1 
ATOM   2106 N N   . GLN A 1 288 ? -5.147  57.920 21.147  1.00 33.92 ? 587  GLN A N   1 
ATOM   2107 C CA  . GLN A 1 288 ? -4.130  58.956 21.334  1.00 34.57 ? 587  GLN A CA  1 
ATOM   2108 C C   . GLN A 1 288 ? -3.704  59.515 19.972  1.00 35.34 ? 587  GLN A C   1 
ATOM   2109 O O   . GLN A 1 288 ? -4.095  60.636 19.621  1.00 36.15 ? 587  GLN A O   1 
ATOM   2110 C CB  . GLN A 1 288 ? -2.906  58.487 22.099  1.00 34.55 ? 587  GLN A CB  1 
ATOM   2111 C CG  . GLN A 1 288 ? -2.415  57.069 21.916  1.00 34.57 ? 587  GLN A CG  1 
ATOM   2112 C CD  . GLN A 1 288 ? -1.571  56.619 23.098  1.00 34.90 ? 587  GLN A CD  1 
ATOM   2113 O OE1 . GLN A 1 288 ? -1.962  55.756 23.885  1.00 33.22 ? 587  GLN A OE1 1 
ATOM   2114 N NE2 . GLN A 1 288 ? -0.387  57.218 23.236  1.00 34.59 ? 587  GLN A NE2 1 
ATOM   2115 N N   . HIS B 1 2   ? -42.568 35.769 4.351   1.00 28.75 ? 301  HIS B N   1 
ATOM   2116 C CA  . HIS B 1 2   ? -42.372 36.246 5.722   1.00 27.80 ? 301  HIS B CA  1 
ATOM   2117 C C   . HIS B 1 2   ? -41.617 37.574 5.722   1.00 27.79 ? 301  HIS B C   1 
ATOM   2118 O O   . HIS B 1 2   ? -41.036 37.940 4.702   1.00 25.44 ? 301  HIS B O   1 
ATOM   2119 C CB  . HIS B 1 2   ? -41.640 35.177 6.508   1.00 26.69 ? 301  HIS B CB  1 
ATOM   2120 C CG  . HIS B 1 2   ? -41.839 35.194 7.983   1.00 26.33 ? 301  HIS B CG  1 
ATOM   2121 N ND1 . HIS B 1 2   ? -42.796 35.927 8.590   1.00 26.78 ? 301  HIS B ND1 1 
ATOM   2122 C CD2 . HIS B 1 2   ? -41.184 34.555 8.982   1.00 26.70 ? 301  HIS B CD2 1 
ATOM   2123 C CE1 . HIS B 1 2   ? -42.746 35.740 9.898   1.00 27.24 ? 301  HIS B CE1 1 
ATOM   2124 N NE2 . HIS B 1 2   ? -41.794 34.936 10.167  1.00 27.89 ? 301  HIS B NE2 1 
ATOM   2125 N N   . GLU B 1 3   ? -41.632 38.273 6.845   1.00 28.05 ? 302  GLU B N   1 
ATOM   2126 C CA  . GLU B 1 3   ? -40.851 39.484 7.044   1.00 28.65 ? 302  GLU B CA  1 
ATOM   2127 C C   . GLU B 1 3   ? -39.404 39.085 7.339   1.00 28.75 ? 302  GLU B C   1 
ATOM   2128 O O   . GLU B 1 3   ? -38.458 39.755 6.941   1.00 22.66 ? 302  GLU B O   1 
ATOM   2129 C CB  . GLU B 1 3   ? -41.424 40.337 8.172   1.00 28.91 ? 302  GLU B CB  1 
ATOM   2130 C CG  . GLU B 1 3   ? -41.853 41.742 7.771   1.00 28.41 ? 302  GLU B CG  1 
ATOM   2131 C CD  . GLU B 1 3   ? -43.199 41.816 7.079   1.00 26.77 ? 302  GLU B CD  1 
ATOM   2132 O OE1 . GLU B 1 3   ? -44.238 41.907 7.775   1.00 27.20 ? 302  GLU B OE1 1 
ATOM   2133 O OE2 . GLU B 1 3   ? -43.232 41.798 5.828   1.00 19.56 ? 302  GLU B OE2 1 
ATOM   2134 N N   . GLN B 1 4   ? -39.260 37.960 8.036   1.00 30.15 ? 303  GLN B N   1 
ATOM   2135 C CA  . GLN B 1 4   ? -37.979 37.315 8.235   1.00 30.27 ? 303  GLN B CA  1 
ATOM   2136 C C   . GLN B 1 4   ? -37.468 36.646 6.959   1.00 30.04 ? 303  GLN B C   1 
ATOM   2137 O O   . GLN B 1 4   ? -36.341 36.139 6.909   1.00 31.18 ? 303  GLN B O   1 
ATOM   2138 C CB  . GLN B 1 4   ? -38.086 36.265 9.347   1.00 30.70 ? 303  GLN B CB  1 
ATOM   2139 C CG  . GLN B 1 4   ? -37.879 34.842 8.823   1.00 33.10 ? 303  GLN B CG  1 
ATOM   2140 N N   . PHE B 1 5   ? -38.305 36.631 5.925   1.00 29.59 ? 304  PHE B N   1 
ATOM   2141 C CA  . PHE B 1 5   ? -37.918 36.058 4.639   1.00 30.31 ? 304  PHE B CA  1 
ATOM   2142 C C   . PHE B 1 5   ? -37.894 37.120 3.533   1.00 31.35 ? 304  PHE B C   1 
ATOM   2143 O O   . PHE B 1 5   ? -37.049 37.057 2.636   1.00 28.89 ? 304  PHE B O   1 
ATOM   2144 C CB  . PHE B 1 5   ? -38.852 34.911 4.259   1.00 29.55 ? 304  PHE B CB  1 
ATOM   2145 N N   . ARG B 1 6   ? -38.805 38.071 3.614   1.00 32.25 ? 305  ARG B N   1 
ATOM   2146 C CA  . ARG B 1 6   ? -38.841 39.252 2.780   1.00 31.38 ? 305  ARG B CA  1 
ATOM   2147 C C   . ARG B 1 6   ? -37.506 39.989 2.908   1.00 32.59 ? 305  ARG B C   1 
ATOM   2148 O O   . ARG B 1 6   ? -36.944 40.438 1.918   1.00 29.52 ? 305  ARG B O   1 
ATOM   2149 C CB  . ARG B 1 6   ? -39.983 40.187 3.173   1.00 29.89 ? 305  ARG B CB  1 
ATOM   2150 C CG  . ARG B 1 6   ? -39.686 41.665 2.937   1.00 28.47 ? 305  ARG B CG  1 
ATOM   2151 C CD  . ARG B 1 6   ? -40.766 42.559 3.500   1.00 26.23 ? 305  ARG B CD  1 
ATOM   2152 N NE  . ARG B 1 6   ? -41.071 43.729 2.695   1.00 24.68 ? 305  ARG B NE  1 
ATOM   2153 C CZ  . ARG B 1 6   ? -41.682 44.836 3.112   1.00 22.41 ? 305  ARG B CZ  1 
ATOM   2154 N NH1 . ARG B 1 6   ? -42.084 44.957 4.372   1.00 15.71 ? 305  ARG B NH1 1 
ATOM   2155 N NH2 . ARG B 1 6   ? -41.898 45.837 2.261   1.00 18.33 ? 305  ARG B NH2 1 
ATOM   2156 N N   . ALA B 1 7   ? -37.019 40.082 4.143   1.00 34.64 ? 306  ALA B N   1 
ATOM   2157 C CA  . ALA B 1 7   ? -35.730 40.706 4.420   1.00 35.95 ? 306  ALA B CA  1 
ATOM   2158 C C   . ALA B 1 7   ? -34.591 39.782 4.000   1.00 35.78 ? 306  ALA B C   1 
ATOM   2159 O O   . ALA B 1 7   ? -33.424 40.160 4.050   1.00 34.38 ? 306  ALA B O   1 
ATOM   2160 C CB  . ALA B 1 7   ? -35.591 41.082 5.884   1.00 40.92 ? 306  ALA B CB  1 
ATOM   2161 N N   . ALA B 1 8   ? -34.952 38.572 3.585   1.00 35.71 ? 307  ALA B N   1 
ATOM   2162 C CA  . ALA B 1 8   ? -34.030 37.705 2.860   1.00 34.98 ? 307  ALA B CA  1 
ATOM   2163 C C   . ALA B 1 8   ? -34.153 38.129 1.391   1.00 33.93 ? 307  ALA B C   1 
ATOM   2164 O O   . ALA B 1 8   ? -33.167 38.264 0.682   1.00 33.32 ? 307  ALA B O   1 
ATOM   2165 C CB  . ALA B 1 8   ? -34.313 36.233 3.043   1.00 34.26 ? 307  ALA B CB  1 
ATOM   2166 N N   . LEU B 1 9   ? -35.401 38.352 0.976   1.00 33.52 ? 308  LEU B N   1 
ATOM   2167 C CA  . LEU B 1 9   ? -35.671 38.869 -0.360  1.00 33.54 ? 308  LEU B CA  1 
ATOM   2168 C C   . LEU B 1 9   ? -34.837 40.151 -0.508  1.00 32.24 ? 308  LEU B C   1 
ATOM   2169 O O   . LEU B 1 9   ? -34.054 40.278 -1.443  1.00 33.85 ? 308  LEU B O   1 
ATOM   2170 C CB  . LEU B 1 9   ? -37.142 39.162 -0.580  1.00 34.70 ? 308  LEU B CB  1 
ATOM   2171 C CG  . LEU B 1 9   ? -37.995 38.165 -1.360  1.00 35.23 ? 308  LEU B CG  1 
ATOM   2172 C CD1 . LEU B 1 9   ? -39.448 38.223 -0.897  1.00 34.79 ? 308  LEU B CD1 1 
ATOM   2173 C CD2 . LEU B 1 9   ? -37.916 38.422 -2.858  1.00 36.61 ? 308  LEU B CD2 1 
ATOM   2174 N N   . GLN B 1 10  ? -35.020 41.045 0.445   1.00 31.08 ? 309  GLN B N   1 
ATOM   2175 C CA  . GLN B 1 10  ? -34.231 42.231 0.637   1.00 30.50 ? 309  GLN B CA  1 
ATOM   2176 C C   . GLN B 1 10  ? -32.745 42.004 0.384   1.00 30.81 ? 309  GLN B C   1 
ATOM   2177 O O   . GLN B 1 10  ? -32.073 42.857 -0.194  1.00 31.34 ? 309  GLN B O   1 
ATOM   2178 C CB  . GLN B 1 10  ? -34.416 42.716 2.085   1.00 32.36 ? 309  GLN B CB  1 
ATOM   2179 N N   . LEU B 1 11  ? -32.243 40.857 0.822   1.00 30.94 ? 310  LEU B N   1 
ATOM   2180 C CA  . LEU B 1 11  ? -30.820 40.564 0.801   1.00 30.82 ? 310  LEU B CA  1 
ATOM   2181 C C   . LEU B 1 11  ? -30.262 40.034 -0.506  1.00 31.38 ? 310  LEU B C   1 
ATOM   2182 O O   . LEU B 1 11  ? -29.104 40.340 -0.828  1.00 37.37 ? 310  LEU B O   1 
ATOM   2183 C CB  . LEU B 1 11  ? -30.516 39.553 1.930   1.00 30.38 ? 310  LEU B CB  1 
ATOM   2184 C CG  . LEU B 1 11  ? -30.639 40.114 3.350   1.00 29.09 ? 310  LEU B CG  1 
ATOM   2185 C CD1 . LEU B 1 11  ? -30.627 38.985 4.373   1.00 28.62 ? 310  LEU B CD1 1 
ATOM   2186 C CD2 . LEU B 1 11  ? -29.543 41.131 3.634   1.00 23.50 ? 310  LEU B CD2 1 
ATOM   2187 N N   . VAL B 1 12  ? -31.027 39.251 -1.255  1.00 30.19 ? 311  VAL B N   1 
ATOM   2188 C CA  . VAL B 1 12  ? -30.494 38.626 -2.476  1.00 28.07 ? 311  VAL B CA  1 
ATOM   2189 C C   . VAL B 1 12  ? -31.113 39.244 -3.732  1.00 27.36 ? 311  VAL B C   1 
ATOM   2190 O O   . VAL B 1 12  ? -31.426 38.581 -4.727  1.00 25.36 ? 311  VAL B O   1 
ATOM   2191 C CB  . VAL B 1 12  ? -30.690 37.102 -2.458  1.00 27.21 ? 311  VAL B CB  1 
ATOM   2192 C CG1 . VAL B 1 12  ? -29.547 36.397 -3.175  1.00 28.02 ? 311  VAL B CG1 1 
ATOM   2193 C CG2 . VAL B 1 12  ? -30.793 36.599 -1.026  1.00 28.69 ? 311  VAL B CG2 1 
ATOM   2194 N N   . VAL B 1 13  ? -31.275 40.562 -3.685  1.00 26.31 ? 312  VAL B N   1 
ATOM   2195 C CA  . VAL B 1 13  ? -31.911 41.319 -4.751  1.00 24.85 ? 312  VAL B CA  1 
ATOM   2196 C C   . VAL B 1 13  ? -31.221 42.667 -4.895  1.00 22.31 ? 312  VAL B C   1 
ATOM   2197 O O   . VAL B 1 13  ? -30.607 43.162 -3.944  1.00 16.18 ? 312  VAL B O   1 
ATOM   2198 C CB  . VAL B 1 13  ? -33.404 41.472 -4.399  1.00 26.96 ? 312  VAL B CB  1 
ATOM   2199 C CG1 . VAL B 1 13  ? -34.080 42.573 -5.195  1.00 29.11 ? 312  VAL B CG1 1 
ATOM   2200 C CG2 . VAL B 1 13  ? -34.159 40.160 -4.603  1.00 29.88 ? 312  VAL B CG2 1 
ATOM   2201 N N   . ASP B 1 14  ? -31.308 43.273 -6.075  1.00 20.59 ? 313  ASP B N   1 
ATOM   2202 C CA  . ASP B 1 14  ? -30.804 44.626 -6.273  1.00 19.53 ? 313  ASP B CA  1 
ATOM   2203 C C   . ASP B 1 14  ? -31.730 45.637 -5.605  1.00 21.06 ? 313  ASP B C   1 
ATOM   2204 O O   . ASP B 1 14  ? -32.909 45.358 -5.375  1.00 21.00 ? 313  ASP B O   1 
ATOM   2205 C CB  . ASP B 1 14  ? -30.652 44.959 -7.762  1.00 17.33 ? 313  ASP B CB  1 
ATOM   2206 C CG  . ASP B 1 14  ? -29.864 43.888 -8.493  1.00 15.49 ? 313  ASP B CG  1 
ATOM   2207 O OD1 . ASP B 1 14  ? -30.155 43.658 -9.685  1.00 11.71 ? 313  ASP B OD1 1 
ATOM   2208 O OD2 . ASP B 1 14  ? -28.970 43.288 -7.850  1.00 12.76 ? 313  ASP B OD2 1 
ATOM   2209 N N   . PRO B 1 15  ? -31.200 46.814 -5.303  1.00 22.34 ? 314  PRO B N   1 
ATOM   2210 C CA  . PRO B 1 15  ? -31.959 47.825 -4.563  1.00 23.15 ? 314  PRO B CA  1 
ATOM   2211 C C   . PRO B 1 15  ? -32.610 48.884 -5.448  1.00 23.64 ? 314  PRO B C   1 
ATOM   2212 O O   . PRO B 1 15  ? -32.354 48.934 -6.651  1.00 24.37 ? 314  PRO B O   1 
ATOM   2213 C CB  . PRO B 1 15  ? -30.835 48.455 -3.724  1.00 23.36 ? 314  PRO B CB  1 
ATOM   2214 C CG  . PRO B 1 15  ? -29.606 48.344 -4.559  1.00 23.52 ? 314  PRO B CG  1 
ATOM   2215 C CD  . PRO B 1 15  ? -29.855 47.313 -5.618  1.00 22.92 ? 314  PRO B CD  1 
ATOM   2216 N N   . GLY B 1 16  ? -33.438 49.717 -4.843  1.00 25.26 ? 315  GLY B N   1 
ATOM   2217 C CA  . GLY B 1 16  ? -33.978 50.912 -5.402  1.00 29.08 ? 315  GLY B CA  1 
ATOM   2218 C C   . GLY B 1 16  ? -34.972 50.825 -6.531  1.00 32.17 ? 315  GLY B C   1 
ATOM   2219 O O   . GLY B 1 16  ? -35.683 49.829 -6.669  1.00 34.32 ? 315  GLY B O   1 
ATOM   2220 N N   . ASP B 1 17  ? -35.043 51.874 -7.360  1.00 34.20 ? 316  ASP B N   1 
ATOM   2221 C CA  . ASP B 1 17  ? -36.000 51.876 -8.467  1.00 36.77 ? 316  ASP B CA  1 
ATOM   2222 C C   . ASP B 1 17  ? -35.361 52.019 -9.840  1.00 38.32 ? 316  ASP B C   1 
ATOM   2223 O O   . ASP B 1 17  ? -34.707 53.013 -10.162 1.00 39.68 ? 316  ASP B O   1 
ATOM   2224 C CB  . ASP B 1 17  ? -37.043 52.962 -8.251  1.00 38.26 ? 316  ASP B CB  1 
ATOM   2225 C CG  . ASP B 1 17  ? -37.005 54.200 -9.098  1.00 40.88 ? 316  ASP B CG  1 
ATOM   2226 O OD1 . ASP B 1 17  ? -35.930 54.818 -9.255  1.00 43.60 ? 316  ASP B OD1 1 
ATOM   2227 O OD2 . ASP B 1 17  ? -38.079 54.594 -9.618  1.00 45.80 ? 316  ASP B OD2 1 
ATOM   2228 N N   . PRO B 1 18  ? -35.559 51.010 -10.691 1.00 40.09 ? 317  PRO B N   1 
ATOM   2229 C CA  . PRO B 1 18  ? -35.070 51.134 -12.075 1.00 40.62 ? 317  PRO B CA  1 
ATOM   2230 C C   . PRO B 1 18  ? -35.923 52.175 -12.806 1.00 40.79 ? 317  PRO B C   1 
ATOM   2231 O O   . PRO B 1 18  ? -36.804 51.823 -13.583 1.00 35.00 ? 317  PRO B O   1 
ATOM   2232 C CB  . PRO B 1 18  ? -35.262 49.743 -12.655 1.00 40.38 ? 317  PRO B CB  1 
ATOM   2233 C CG  . PRO B 1 18  ? -36.359 49.138 -11.848 1.00 40.48 ? 317  PRO B CG  1 
ATOM   2234 C CD  . PRO B 1 18  ? -36.228 49.717 -10.468 1.00 40.71 ? 317  PRO B CD  1 
ATOM   2235 N N   . ARG B 1 19  ? -35.648 53.441 -12.523 1.00 41.80 ? 318  ARG B N   1 
ATOM   2236 C CA  . ARG B 1 19  ? -36.332 54.557 -13.161 1.00 41.72 ? 318  ARG B CA  1 
ATOM   2237 C C   . ARG B 1 19  ? -35.318 55.675 -13.419 1.00 40.07 ? 318  ARG B C   1 
ATOM   2238 O O   . ARG B 1 19  ? -35.639 56.848 -13.255 1.00 36.20 ? 318  ARG B O   1 
ATOM   2239 C CB  . ARG B 1 19  ? -37.488 55.067 -12.313 1.00 42.91 ? 318  ARG B CB  1 
ATOM   2240 C CG  . ARG B 1 19  ? -38.700 55.582 -13.066 1.00 43.91 ? 318  ARG B CG  1 
ATOM   2241 C CD  . ARG B 1 19  ? -39.699 56.230 -12.122 1.00 45.46 ? 318  ARG B CD  1 
ATOM   2242 N NE  . ARG B 1 19  ? -40.241 57.485 -12.630 1.00 47.15 ? 318  ARG B NE  1 
ATOM   2243 C CZ  . ARG B 1 19  ? -40.714 58.503 -11.925 1.00 48.45 ? 318  ARG B CZ  1 
ATOM   2244 N NH1 . ARG B 1 19  ? -40.733 58.477 -10.596 1.00 49.31 ? 318  ARG B NH1 1 
ATOM   2245 N NH2 . ARG B 1 19  ? -41.181 59.583 -12.546 1.00 49.72 ? 318  ARG B NH2 1 
ATOM   2246 N N   . SER B 1 20  ? -34.113 55.275 -13.810 1.00 40.21 ? 319  SER B N   1 
ATOM   2247 C CA  . SER B 1 20  ? -33.036 56.214 -14.120 1.00 40.43 ? 319  SER B CA  1 
ATOM   2248 C C   . SER B 1 20  ? -32.094 55.921 -15.271 1.00 40.44 ? 319  SER B C   1 
ATOM   2249 O O   . SER B 1 20  ? -31.360 56.826 -15.744 1.00 40.18 ? 319  SER B O   1 
ATOM   2250 C CB  . SER B 1 20  ? -32.189 56.373 -12.830 1.00 40.06 ? 319  SER B CB  1 
ATOM   2251 O OG  . SER B 1 20  ? -32.011 57.757 -12.545 1.00 39.34 ? 319  SER B OG  1 
ATOM   2252 N N   . TYR B 1 21  ? -32.044 54.687 -15.780 1.00 39.43 ? 320  TYR B N   1 
ATOM   2253 C CA  . TYR B 1 21  ? -31.245 54.376 -16.962 1.00 37.24 ? 320  TYR B CA  1 
ATOM   2254 C C   . TYR B 1 21  ? -32.158 54.249 -18.182 1.00 35.48 ? 320  TYR B C   1 
ATOM   2255 O O   . TYR B 1 21  ? -31.679 54.128 -19.311 1.00 33.87 ? 320  TYR B O   1 
ATOM   2256 C CB  . TYR B 1 21  ? -30.409 53.113 -16.762 1.00 36.44 ? 320  TYR B CB  1 
ATOM   2257 C CG  . TYR B 1 21  ? -28.932 53.280 -17.045 1.00 36.42 ? 320  TYR B CG  1 
ATOM   2258 C CD1 . TYR B 1 21  ? -28.054 53.872 -16.160 1.00 37.38 ? 320  TYR B CD1 1 
ATOM   2259 C CD2 . TYR B 1 21  ? -28.382 52.836 -18.238 1.00 35.82 ? 320  TYR B CD2 1 
ATOM   2260 C CE1 . TYR B 1 21  ? -26.702 54.011 -16.461 1.00 37.36 ? 320  TYR B CE1 1 
ATOM   2261 C CE2 . TYR B 1 21  ? -27.050 52.962 -18.559 1.00 35.92 ? 320  TYR B CE2 1 
ATOM   2262 C CZ  . TYR B 1 21  ? -26.201 53.557 -17.662 1.00 36.34 ? 320  TYR B CZ  1 
ATOM   2263 O OH  . TYR B 1 21  ? -24.865 53.689 -17.951 1.00 34.53 ? 320  TYR B OH  1 
ATOM   2264 N N   . LEU B 1 22  ? -33.462 54.296 -17.943 1.00 34.53 ? 321  LEU B N   1 
ATOM   2265 C CA  . LEU B 1 22  ? -34.448 54.167 -19.015 1.00 34.33 ? 321  LEU B CA  1 
ATOM   2266 C C   . LEU B 1 22  ? -35.074 55.507 -19.356 1.00 33.47 ? 321  LEU B C   1 
ATOM   2267 O O   . LEU B 1 22  ? -34.797 56.520 -18.711 1.00 33.14 ? 321  LEU B O   1 
ATOM   2268 C CB  . LEU B 1 22  ? -35.511 53.133 -18.635 1.00 34.45 ? 321  LEU B CB  1 
ATOM   2269 C CG  . LEU B 1 22  ? -34.988 51.702 -18.445 1.00 34.10 ? 321  LEU B CG  1 
ATOM   2270 C CD1 . LEU B 1 22  ? -35.928 50.891 -17.563 1.00 30.32 ? 321  LEU B CD1 1 
ATOM   2271 C CD2 . LEU B 1 22  ? -34.785 51.023 -19.795 1.00 34.44 ? 321  LEU B CD2 1 
ATOM   2272 N N   . ASP B 1 23  ? -35.916 55.530 -20.388 1.00 33.65 ? 322  ASP B N   1 
ATOM   2273 C CA  . ASP B 1 23  ? -36.408 56.811 -20.904 1.00 35.26 ? 322  ASP B CA  1 
ATOM   2274 C C   . ASP B 1 23  ? -37.919 56.943 -20.828 1.00 36.07 ? 322  ASP B C   1 
ATOM   2275 O O   . ASP B 1 23  ? -38.416 57.906 -20.233 1.00 36.58 ? 322  ASP B O   1 
ATOM   2276 C CB  . ASP B 1 23  ? -35.904 57.001 -22.345 1.00 36.01 ? 322  ASP B CB  1 
ATOM   2277 C CG  . ASP B 1 23  ? -34.384 57.044 -22.397 1.00 36.30 ? 322  ASP B CG  1 
ATOM   2278 O OD1 . ASP B 1 23  ? -33.780 56.031 -22.799 1.00 36.91 ? 322  ASP B OD1 1 
ATOM   2279 O OD2 . ASP B 1 23  ? -33.779 58.073 -22.028 1.00 34.26 ? 322  ASP B OD2 1 
ATOM   2280 N N   . ASN B 1 24  ? -38.638 55.997 -21.419 1.00 35.34 ? 323  ASN B N   1 
ATOM   2281 C CA  . ASN B 1 24  ? -40.097 55.976 -21.342 1.00 33.98 ? 323  ASN B CA  1 
ATOM   2282 C C   . ASN B 1 24  ? -40.575 54.654 -20.746 1.00 34.76 ? 323  ASN B C   1 
ATOM   2283 O O   . ASN B 1 24  ? -39.981 53.614 -21.022 1.00 36.09 ? 323  ASN B O   1 
ATOM   2284 C CB  . ASN B 1 24  ? -40.748 56.167 -22.707 1.00 32.14 ? 323  ASN B CB  1 
ATOM   2285 C CG  . ASN B 1 24  ? -40.583 57.546 -23.302 1.00 31.30 ? 323  ASN B CG  1 
ATOM   2286 O OD1 . ASN B 1 24  ? -39.481 58.090 -23.363 1.00 29.82 ? 323  ASN B OD1 1 
ATOM   2287 N ND2 . ASN B 1 24  ? -41.685 58.129 -23.763 1.00 29.93 ? 323  ASN B ND2 1 
ATOM   2288 N N   . PHE B 1 25  ? -41.640 54.699 -19.956 1.00 35.53 ? 324  PHE B N   1 
ATOM   2289 C CA  . PHE B 1 25  ? -42.247 53.478 -19.428 1.00 36.98 ? 324  PHE B CA  1 
ATOM   2290 C C   . PHE B 1 25  ? -43.519 53.149 -20.209 1.00 38.02 ? 324  PHE B C   1 
ATOM   2291 O O   . PHE B 1 25  ? -44.026 53.981 -20.964 1.00 40.65 ? 324  PHE B O   1 
ATOM   2292 C CB  . PHE B 1 25  ? -42.579 53.589 -17.943 1.00 36.78 ? 324  PHE B CB  1 
ATOM   2293 C CG  . PHE B 1 25  ? -41.395 53.512 -16.996 1.00 36.51 ? 324  PHE B CG  1 
ATOM   2294 C CD1 . PHE B 1 25  ? -41.475 52.761 -15.835 1.00 36.16 ? 324  PHE B CD1 1 
ATOM   2295 C CD2 . PHE B 1 25  ? -40.215 54.181 -17.273 1.00 36.54 ? 324  PHE B CD2 1 
ATOM   2296 C CE1 . PHE B 1 25  ? -40.401 52.677 -14.968 1.00 36.12 ? 324  PHE B CE1 1 
ATOM   2297 C CE2 . PHE B 1 25  ? -39.135 54.109 -16.408 1.00 36.60 ? 324  PHE B CE2 1 
ATOM   2298 C CZ  . PHE B 1 25  ? -39.230 53.355 -15.255 1.00 36.25 ? 324  PHE B CZ  1 
ATOM   2299 N N   . ILE B 1 26  ? -44.027 51.934 -20.021 1.00 37.29 ? 325  ILE B N   1 
ATOM   2300 C CA  . ILE B 1 26  ? -45.245 51.511 -20.698 1.00 36.80 ? 325  ILE B CA  1 
ATOM   2301 C C   . ILE B 1 26  ? -45.768 50.177 -20.178 1.00 36.07 ? 325  ILE B C   1 
ATOM   2302 O O   . ILE B 1 26  ? -45.027 49.202 -20.068 1.00 34.22 ? 325  ILE B O   1 
ATOM   2303 C CB  . ILE B 1 26  ? -45.024 51.387 -22.219 1.00 37.76 ? 325  ILE B CB  1 
ATOM   2304 C CG1 . ILE B 1 26  ? -45.379 52.651 -23.016 1.00 38.63 ? 325  ILE B CG1 1 
ATOM   2305 C CG2 . ILE B 1 26  ? -45.785 50.183 -22.755 1.00 37.50 ? 325  ILE B CG2 1 
ATOM   2306 C CD1 . ILE B 1 26  ? -44.707 52.740 -24.373 1.00 39.69 ? 325  ILE B CD1 1 
ATOM   2307 N N   . LYS B 1 27  ? -47.060 50.139 -19.869 1.00 34.76 ? 326  LYS B N   1 
ATOM   2308 C CA  . LYS B 1 27  ? -47.730 48.897 -19.500 1.00 33.36 ? 326  LYS B CA  1 
ATOM   2309 C C   . LYS B 1 27  ? -47.984 48.083 -20.765 1.00 30.24 ? 326  LYS B C   1 
ATOM   2310 O O   . LYS B 1 27  ? -48.486 48.647 -21.737 1.00 26.71 ? 326  LYS B O   1 
ATOM   2311 C CB  . LYS B 1 27  ? -49.040 49.165 -18.764 1.00 37.42 ? 326  LYS B CB  1 
ATOM   2312 N N   . ILE B 1 28  ? -47.628 46.810 -20.738 1.00 28.62 ? 327  ILE B N   1 
ATOM   2313 C CA  . ILE B 1 28  ? -47.661 45.969 -21.934 1.00 28.08 ? 327  ILE B CA  1 
ATOM   2314 C C   . ILE B 1 28  ? -48.698 44.867 -21.856 1.00 28.70 ? 327  ILE B C   1 
ATOM   2315 O O   . ILE B 1 28  ? -49.255 44.427 -22.865 1.00 25.08 ? 327  ILE B O   1 
ATOM   2316 C CB  . ILE B 1 28  ? -46.260 45.370 -22.193 1.00 26.96 ? 327  ILE B CB  1 
ATOM   2317 C CG1 . ILE B 1 28  ? -45.212 46.407 -22.609 1.00 26.09 ? 327  ILE B CG1 1 
ATOM   2318 C CG2 . ILE B 1 28  ? -46.306 44.241 -23.209 1.00 25.10 ? 327  ILE B CG2 1 
ATOM   2319 C CD1 . ILE B 1 28  ? -44.300 45.925 -23.723 1.00 25.45 ? 327  ILE B CD1 1 
ATOM   2320 N N   . GLY B 1 29  ? -48.987 44.392 -20.639 1.00 30.19 ? 328  GLY B N   1 
ATOM   2321 C CA  . GLY B 1 29  ? -49.950 43.308 -20.495 1.00 32.19 ? 328  GLY B CA  1 
ATOM   2322 C C   . GLY B 1 29  ? -50.120 42.783 -19.089 1.00 34.01 ? 328  GLY B C   1 
ATOM   2323 O O   . GLY B 1 29  ? -50.313 43.563 -18.150 1.00 36.16 ? 328  GLY B O   1 
ATOM   2324 N N   . GLU B 1 30  ? -50.064 41.456 -18.934 1.00 35.56 ? 329  GLU B N   1 
ATOM   2325 C CA  . GLU B 1 30  ? -50.316 40.834 -17.636 1.00 36.35 ? 329  GLU B CA  1 
ATOM   2326 C C   . GLU B 1 30  ? -50.318 39.315 -17.715 1.00 37.86 ? 329  GLU B C   1 
ATOM   2327 O O   . GLU B 1 30  ? -50.434 38.728 -18.793 1.00 39.91 ? 329  GLU B O   1 
ATOM   2328 C CB  . GLU B 1 30  ? -51.662 41.328 -17.087 1.00 35.36 ? 329  GLU B CB  1 
ATOM   2329 C CG  . GLU B 1 30  ? -52.794 40.327 -17.266 1.00 34.74 ? 329  GLU B CG  1 
ATOM   2330 C CD  . GLU B 1 30  ? -54.002 40.925 -17.958 1.00 33.10 ? 329  GLU B CD  1 
ATOM   2331 O OE1 . GLU B 1 30  ? -53.955 42.126 -18.299 1.00 32.57 ? 329  GLU B OE1 1 
ATOM   2332 O OE2 . GLU B 1 30  ? -54.991 40.193 -18.155 1.00 28.65 ? 329  GLU B OE2 1 
ATOM   2333 N N   . GLY B 1 31  ? -50.192 38.663 -16.557 1.00 38.85 ? 330  GLY B N   1 
ATOM   2334 C CA  . GLY B 1 31  ? -50.191 37.207 -16.517 1.00 39.81 ? 330  GLY B CA  1 
ATOM   2335 C C   . GLY B 1 31  ? -49.984 36.638 -15.128 1.00 39.63 ? 330  GLY B C   1 
ATOM   2336 O O   . GLY B 1 31  ? -50.036 35.417 -14.951 1.00 38.77 ? 330  GLY B O   1 
ATOM   2337 N N   . ILE B 1 35  ? -45.543 39.357 -17.193 1.00 44.53 ? 334  ILE B N   1 
ATOM   2338 C CA  . ILE B 1 35  ? -44.711 40.559 -17.263 1.00 46.13 ? 334  ILE B CA  1 
ATOM   2339 C C   . ILE B 1 35  ? -45.613 41.783 -17.275 1.00 47.31 ? 334  ILE B C   1 
ATOM   2340 O O   . ILE B 1 35  ? -46.842 41.655 -17.229 1.00 47.10 ? 334  ILE B O   1 
ATOM   2341 C CB  . ILE B 1 35  ? -43.764 40.544 -18.501 1.00 45.75 ? 334  ILE B CB  1 
ATOM   2342 C CG1 . ILE B 1 35  ? -44.206 39.624 -19.675 1.00 45.57 ? 334  ILE B CG1 1 
ATOM   2343 C CG2 . ILE B 1 35  ? -42.340 40.249 -18.074 1.00 44.84 ? 334  ILE B CG2 1 
ATOM   2344 C CD1 . ILE B 1 35  ? -44.047 38.121 -19.472 1.00 45.17 ? 334  ILE B CD1 1 
ATOM   2345 N N   . VAL B 1 36  ? -45.009 42.971 -17.336 1.00 48.09 ? 335  VAL B N   1 
ATOM   2346 C CA  . VAL B 1 36  ? -45.819 44.195 -17.395 1.00 48.25 ? 335  VAL B CA  1 
ATOM   2347 C C   . VAL B 1 36  ? -45.194 45.256 -18.295 1.00 48.89 ? 335  VAL B C   1 
ATOM   2348 O O   . VAL B 1 36  ? -45.533 45.322 -19.499 1.00 50.29 ? 335  VAL B O   1 
ATOM   2349 C CB  . VAL B 1 36  ? -46.085 44.783 -15.995 1.00 47.83 ? 335  VAL B CB  1 
ATOM   2350 C CG1 . VAL B 1 36  ? -47.478 44.349 -15.505 1.00 47.82 ? 335  VAL B CG1 1 
ATOM   2351 C CG2 . VAL B 1 36  ? -45.023 44.387 -14.985 1.00 47.22 ? 335  VAL B CG2 1 
ATOM   2352 N N   . CYS B 1 37  ? -44.310 46.076 -17.747 1.00 49.11 ? 336  CYS B N   1 
ATOM   2353 C CA  . CYS B 1 37  ? -43.853 47.283 -18.412 1.00 49.36 ? 336  CYS B CA  1 
ATOM   2354 C C   . CYS B 1 37  ? -42.866 47.024 -19.556 1.00 48.15 ? 336  CYS B C   1 
ATOM   2355 O O   . CYS B 1 37  ? -42.774 45.904 -20.051 1.00 49.64 ? 336  CYS B O   1 
ATOM   2356 C CB  . CYS B 1 37  ? -43.238 48.259 -17.393 1.00 50.33 ? 336  CYS B CB  1 
ATOM   2357 S SG  . CYS B 1 37  ? -43.727 47.989 -15.672 1.00 48.80 ? 336  CYS B SG  1 
ATOM   2358 N N   . ILE B 1 38  ? -42.167 48.076 -19.944 1.00 46.37 ? 337  ILE B N   1 
ATOM   2359 C CA  . ILE B 1 38  ? -41.191 48.066 -21.023 1.00 44.27 ? 337  ILE B CA  1 
ATOM   2360 C C   . ILE B 1 38  ? -40.559 49.443 -21.147 1.00 42.34 ? 337  ILE B C   1 
ATOM   2361 O O   . ILE B 1 38  ? -41.109 50.448 -20.679 1.00 44.47 ? 337  ILE B O   1 
ATOM   2362 C CB  . ILE B 1 38  ? -41.843 47.660 -22.360 1.00 44.72 ? 337  ILE B CB  1 
ATOM   2363 C CG1 . ILE B 1 38  ? -41.116 46.520 -23.082 1.00 44.62 ? 337  ILE B CG1 1 
ATOM   2364 C CG2 . ILE B 1 38  ? -42.011 48.875 -23.263 1.00 46.19 ? 337  ILE B CG2 1 
ATOM   2365 C CD1 . ILE B 1 38  ? -40.453 46.918 -24.375 1.00 43.86 ? 337  ILE B CD1 1 
ATOM   2366 N N   . ALA B 1 39  ? -39.378 49.525 -21.771 1.00 39.58 ? 338  ALA B N   1 
ATOM   2367 C CA  . ALA B 1 39  ? -38.706 50.828 -21.838 1.00 37.70 ? 338  ALA B CA  1 
ATOM   2368 C C   . ALA B 1 39  ? -37.388 50.823 -22.609 1.00 36.49 ? 338  ALA B C   1 
ATOM   2369 O O   . ALA B 1 39  ? -36.915 49.777 -23.047 1.00 36.01 ? 338  ALA B O   1 
ATOM   2370 C CB  . ALA B 1 39  ? -38.465 51.343 -20.421 1.00 38.28 ? 338  ALA B CB  1 
ATOM   2371 N N   . THR B 1 40  ? -36.819 52.013 -22.760 1.00 35.12 ? 339  THR B N   1 
ATOM   2372 C CA  . THR B 1 40  ? -35.610 52.252 -23.520 1.00 32.64 ? 339  THR B CA  1 
ATOM   2373 C C   . THR B 1 40  ? -34.440 52.657 -22.638 1.00 29.76 ? 339  THR B C   1 
ATOM   2374 O O   . THR B 1 40  ? -34.574 53.476 -21.724 1.00 25.95 ? 339  THR B O   1 
ATOM   2375 C CB  . THR B 1 40  ? -35.856 53.380 -24.554 1.00 32.71 ? 339  THR B CB  1 
ATOM   2376 O OG1 . THR B 1 40  ? -36.831 52.933 -25.509 1.00 33.62 ? 339  THR B OG1 1 
ATOM   2377 C CG2 . THR B 1 40  ? -34.590 53.724 -25.322 1.00 28.17 ? 339  THR B CG2 1 
ATOM   2378 N N   . VAL B 1 41  ? -33.263 52.094 -22.906 1.00 28.29 ? 340  VAL B N   1 
ATOM   2379 C CA  . VAL B 1 41  ? -32.058 52.558 -22.207 1.00 27.24 ? 340  VAL B CA  1 
ATOM   2380 C C   . VAL B 1 41  ? -31.743 53.934 -22.774 1.00 26.88 ? 340  VAL B C   1 
ATOM   2381 O O   . VAL B 1 41  ? -31.766 54.118 -23.991 1.00 25.12 ? 340  VAL B O   1 
ATOM   2382 C CB  . VAL B 1 41  ? -30.804 51.694 -22.379 1.00 27.54 ? 340  VAL B CB  1 
ATOM   2383 C CG1 . VAL B 1 41  ? -29.740 51.936 -21.319 1.00 23.99 ? 340  VAL B CG1 1 
ATOM   2384 C CG2 . VAL B 1 41  ? -31.125 50.192 -22.383 1.00 29.31 ? 340  VAL B CG2 1 
ATOM   2385 N N   . ARG B 1 42  ? -31.407 54.884 -21.906 1.00 27.55 ? 341  ARG B N   1 
ATOM   2386 C CA  . ARG B 1 42  ? -31.014 56.216 -22.370 1.00 29.01 ? 341  ARG B CA  1 
ATOM   2387 C C   . ARG B 1 42  ? -29.573 56.215 -22.881 1.00 29.18 ? 341  ARG B C   1 
ATOM   2388 O O   . ARG B 1 42  ? -29.071 57.295 -23.200 1.00 24.02 ? 341  ARG B O   1 
ATOM   2389 C CB  . ARG B 1 42  ? -31.197 57.268 -21.287 1.00 30.57 ? 341  ARG B CB  1 
ATOM   2390 C CG  . ARG B 1 42  ? -30.518 56.993 -19.964 1.00 31.61 ? 341  ARG B CG  1 
ATOM   2391 C CD  . ARG B 1 42  ? -31.375 57.392 -18.777 1.00 32.51 ? 341  ARG B CD  1 
ATOM   2392 N NE  . ARG B 1 42  ? -31.490 58.822 -18.522 1.00 33.19 ? 341  ARG B NE  1 
ATOM   2393 C CZ  . ARG B 1 42  ? -32.215 59.340 -17.534 1.00 33.18 ? 341  ARG B CZ  1 
ATOM   2394 N NH1 . ARG B 1 42  ? -32.883 58.556 -16.706 1.00 31.46 ? 341  ARG B NH1 1 
ATOM   2395 N NH2 . ARG B 1 42  ? -32.258 60.655 -17.380 1.00 35.36 ? 341  ARG B NH2 1 
ATOM   2396 N N   . SER B 1 43  ? -28.984 55.053 -22.951 1.00 30.92 ? 342  SER B N   1 
ATOM   2397 C CA  . SER B 1 43  ? -27.662 54.779 -23.476 1.00 31.93 ? 342  SER B CA  1 
ATOM   2398 C C   . SER B 1 43  ? -27.570 53.518 -24.337 1.00 32.75 ? 342  SER B C   1 
ATOM   2399 O O   . SER B 1 43  ? -26.455 53.066 -24.624 1.00 36.31 ? 342  SER B O   1 
ATOM   2400 C CB  . SER B 1 43  ? -26.674 54.626 -22.314 1.00 32.01 ? 342  SER B CB  1 
ATOM   2401 O OG  . SER B 1 43  ? -26.580 53.271 -21.913 1.00 31.14 ? 342  SER B OG  1 
ATOM   2402 N N   . SER B 1 44  ? -28.701 52.968 -24.746 1.00 32.60 ? 343  SER B N   1 
ATOM   2403 C CA  . SER B 1 44  ? -28.740 51.816 -25.659 1.00 31.79 ? 343  SER B CA  1 
ATOM   2404 C C   . SER B 1 44  ? -29.684 52.112 -26.831 1.00 29.87 ? 343  SER B C   1 
ATOM   2405 O O   . SER B 1 44  ? -29.270 52.075 -27.987 1.00 30.58 ? 343  SER B O   1 
ATOM   2406 C CB  . SER B 1 44  ? -29.186 50.484 -25.025 1.00 31.58 ? 343  SER B CB  1 
ATOM   2407 O OG  . SER B 1 44  ? -28.348 50.219 -23.891 1.00 30.44 ? 343  SER B OG  1 
ATOM   2408 N N   . GLY B 1 45  ? -30.915 52.346 -26.493 1.00 27.96 ? 344  GLY B N   1 
ATOM   2409 C CA  . GLY B 1 45  ? -31.972 52.473 -27.448 1.00 27.27 ? 344  GLY B CA  1 
ATOM   2410 C C   . GLY B 1 45  ? -32.914 51.306 -27.411 1.00 27.66 ? 344  GLY B C   1 
ATOM   2411 O O   . GLY B 1 45  ? -34.085 51.462 -27.063 1.00 32.60 ? 344  GLY B O   1 
ATOM   2412 N N   . LYS B 1 46  ? -32.412 50.127 -27.664 1.00 27.57 ? 345  LYS B N   1 
ATOM   2413 C CA  . LYS B 1 46  ? -33.031 48.832 -27.498 1.00 27.80 ? 345  LYS B CA  1 
ATOM   2414 C C   . LYS B 1 46  ? -33.965 48.729 -26.299 1.00 26.66 ? 345  LYS B C   1 
ATOM   2415 O O   . LYS B 1 46  ? -33.710 49.319 -25.244 1.00 23.42 ? 345  LYS B O   1 
ATOM   2416 C CB  . LYS B 1 46  ? -31.914 47.779 -27.351 1.00 28.21 ? 345  LYS B CB  1 
ATOM   2417 C CG  . LYS B 1 46  ? -32.391 46.434 -26.830 1.00 27.27 ? 345  LYS B CG  1 
ATOM   2418 C CD  . LYS B 1 46  ? -31.379 45.343 -27.125 1.00 26.30 ? 345  LYS B CD  1 
ATOM   2419 C CE  . LYS B 1 46  ? -31.297 45.002 -28.599 1.00 25.18 ? 345  LYS B CE  1 
ATOM   2420 N NZ  . LYS B 1 46  ? -32.584 44.495 -29.146 1.00 24.81 ? 345  LYS B NZ  1 
ATOM   2421 N N   . LEU B 1 47  ? -35.060 47.992 -26.469 1.00 26.23 ? 346  LEU B N   1 
ATOM   2422 C CA  . LEU B 1 47  ? -36.078 47.887 -25.430 1.00 25.54 ? 346  LEU B CA  1 
ATOM   2423 C C   . LEU B 1 47  ? -35.766 46.771 -24.437 1.00 24.05 ? 346  LEU B C   1 
ATOM   2424 O O   . LEU B 1 47  ? -34.821 46.026 -24.666 1.00 20.09 ? 346  LEU B O   1 
ATOM   2425 C CB  . LEU B 1 47  ? -37.459 47.623 -26.026 1.00 24.87 ? 346  LEU B CB  1 
ATOM   2426 C CG  . LEU B 1 47  ? -37.973 48.610 -27.069 1.00 24.75 ? 346  LEU B CG  1 
ATOM   2427 C CD1 . LEU B 1 47  ? -37.630 48.144 -28.470 1.00 27.12 ? 346  LEU B CD1 1 
ATOM   2428 C CD2 . LEU B 1 47  ? -39.478 48.800 -26.920 1.00 26.59 ? 346  LEU B CD2 1 
ATOM   2429 N N   . VAL B 1 48  ? -36.560 46.675 -23.386 1.00 24.78 ? 347  VAL B N   1 
ATOM   2430 C CA  . VAL B 1 48  ? -36.382 45.689 -22.338 1.00 27.00 ? 347  VAL B CA  1 
ATOM   2431 C C   . VAL B 1 48  ? -37.614 45.564 -21.439 1.00 28.87 ? 347  VAL B C   1 
ATOM   2432 O O   . VAL B 1 48  ? -38.191 46.563 -21.006 1.00 32.62 ? 347  VAL B O   1 
ATOM   2433 C CB  . VAL B 1 48  ? -35.195 46.013 -21.408 1.00 27.38 ? 347  VAL B CB  1 
ATOM   2434 C CG1 . VAL B 1 48  ? -35.576 45.649 -19.974 1.00 28.52 ? 347  VAL B CG1 1 
ATOM   2435 C CG2 . VAL B 1 48  ? -33.921 45.289 -21.803 1.00 29.11 ? 347  VAL B CG2 1 
ATOM   2436 N N   . ALA B 1 49  ? -37.997 44.327 -21.142 1.00 29.56 ? 348  ALA B N   1 
ATOM   2437 C CA  . ALA B 1 49  ? -39.090 44.046 -20.230 1.00 31.08 ? 348  ALA B CA  1 
ATOM   2438 C C   . ALA B 1 49  ? -38.778 44.440 -18.783 1.00 31.92 ? 348  ALA B C   1 
ATOM   2439 O O   . ALA B 1 49  ? -38.110 43.694 -18.061 1.00 32.13 ? 348  ALA B O   1 
ATOM   2440 C CB  . ALA B 1 49  ? -39.445 42.564 -20.302 1.00 30.80 ? 348  ALA B CB  1 
ATOM   2441 N N   . VAL B 1 50  ? -39.277 45.593 -18.375 1.00 30.65 ? 349  VAL B N   1 
ATOM   2442 C CA  . VAL B 1 50  ? -39.220 46.063 -17.003 1.00 29.14 ? 349  VAL B CA  1 
ATOM   2443 C C   . VAL B 1 50  ? -40.489 45.645 -16.271 1.00 27.88 ? 349  VAL B C   1 
ATOM   2444 O O   . VAL B 1 50  ? -41.561 46.134 -16.617 1.00 30.17 ? 349  VAL B O   1 
ATOM   2445 C CB  . VAL B 1 50  ? -39.108 47.595 -16.891 1.00 30.47 ? 349  VAL B CB  1 
ATOM   2446 C CG1 . VAL B 1 50  ? -37.684 48.024 -16.569 1.00 30.11 ? 349  VAL B CG1 1 
ATOM   2447 C CG2 . VAL B 1 50  ? -39.573 48.309 -18.160 1.00 33.80 ? 349  VAL B CG2 1 
ATOM   2448 N N   . LYS B 1 51  ? -40.378 44.766 -15.289 1.00 27.53 ? 350  LYS B N   1 
ATOM   2449 C CA  . LYS B 1 51  ? -41.555 44.132 -14.703 1.00 27.73 ? 350  LYS B CA  1 
ATOM   2450 C C   . LYS B 1 51  ? -41.782 44.413 -13.217 1.00 29.43 ? 350  LYS B C   1 
ATOM   2451 O O   . LYS B 1 51  ? -40.916 44.962 -12.534 1.00 30.81 ? 350  LYS B O   1 
ATOM   2452 C CB  . LYS B 1 51  ? -41.455 42.624 -14.962 1.00 27.56 ? 350  LYS B CB  1 
ATOM   2453 C CG  . LYS B 1 51  ? -41.083 41.777 -13.760 1.00 27.18 ? 350  LYS B CG  1 
ATOM   2454 C CD  . LYS B 1 51  ? -41.938 40.516 -13.689 1.00 25.32 ? 350  LYS B CD  1 
ATOM   2455 C CE  . LYS B 1 51  ? -41.553 39.544 -14.804 1.00 24.67 ? 350  LYS B CE  1 
ATOM   2456 N NZ  . LYS B 1 51  ? -42.657 38.571 -15.113 1.00 23.07 ? 350  LYS B NZ  1 
ATOM   2457 N N   . LYS B 1 52  ? -42.956 44.035 -12.731 1.00 30.99 ? 351  LYS B N   1 
ATOM   2458 C CA  . LYS B 1 52  ? -43.418 44.258 -11.382 1.00 31.31 ? 351  LYS B CA  1 
ATOM   2459 C C   . LYS B 1 52  ? -43.305 43.017 -10.483 1.00 31.07 ? 351  LYS B C   1 
ATOM   2460 O O   . LYS B 1 52  ? -42.840 41.972 -10.928 1.00 30.89 ? 351  LYS B O   1 
ATOM   2461 C CB  . LYS B 1 52  ? -44.939 44.534 -11.405 1.00 30.90 ? 351  LYS B CB  1 
ATOM   2462 C CG  . LYS B 1 52  ? -45.337 45.956 -10.973 1.00 29.57 ? 351  LYS B CG  1 
ATOM   2463 C CD  . LYS B 1 52  ? -46.745 45.952 -10.360 1.00 27.95 ? 351  LYS B CD  1 
ATOM   2464 C CE  . LYS B 1 52  ? -46.774 45.345 -8.968  1.00 26.05 ? 351  LYS B CE  1 
ATOM   2465 N NZ  . LYS B 1 52  ? -48.040 44.596 -8.686  1.00 21.18 ? 351  LYS B NZ  1 
ATOM   2466 N N   . MET B 1 53  ? -43.794 43.144 -9.260  1.00 30.07 ? 352  MET B N   1 
ATOM   2467 C CA  . MET B 1 53  ? -43.817 42.115 -8.258  1.00 29.12 ? 352  MET B CA  1 
ATOM   2468 C C   . MET B 1 53  ? -44.142 42.701 -6.883  1.00 27.65 ? 352  MET B C   1 
ATOM   2469 O O   . MET B 1 53  ? -43.982 43.896 -6.644  1.00 22.04 ? 352  MET B O   1 
ATOM   2470 C CB  . MET B 1 53  ? -42.546 41.281 -8.134  1.00 29.64 ? 352  MET B CB  1 
ATOM   2471 N N   . ASP B 1 54  ? -44.618 41.843 -5.982  1.00 27.90 ? 353  ASP B N   1 
ATOM   2472 C CA  . ASP B 1 54  ? -45.074 42.341 -4.673  1.00 28.09 ? 353  ASP B CA  1 
ATOM   2473 C C   . ASP B 1 54  ? -45.083 41.284 -3.581  1.00 28.40 ? 353  ASP B C   1 
ATOM   2474 O O   . ASP B 1 54  ? -44.527 40.182 -3.669  1.00 22.71 ? 353  ASP B O   1 
ATOM   2475 C CB  . ASP B 1 54  ? -46.454 42.984 -4.877  1.00 25.80 ? 353  ASP B CB  1 
ATOM   2476 N N   . LEU B 1 55  ? -45.725 41.620 -2.448  1.00 30.10 ? 354  LEU B N   1 
ATOM   2477 C CA  . LEU B 1 55  ? -45.844 40.650 -1.364  1.00 31.35 ? 354  LEU B CA  1 
ATOM   2478 C C   . LEU B 1 55  ? -47.218 39.974 -1.452  1.00 31.92 ? 354  LEU B C   1 
ATOM   2479 O O   . LEU B 1 55  ? -47.794 39.934 -2.544  1.00 32.85 ? 354  LEU B O   1 
ATOM   2480 C CB  . LEU B 1 55  ? -45.647 41.280 0.003   1.00 31.64 ? 354  LEU B CB  1 
ATOM   2481 C CG  . LEU B 1 55  ? -44.689 42.451 0.181   1.00 32.09 ? 354  LEU B CG  1 
ATOM   2482 C CD1 . LEU B 1 55  ? -44.323 42.590 1.660   1.00 31.35 ? 354  LEU B CD1 1 
ATOM   2483 C CD2 . LEU B 1 55  ? -43.425 42.324 -0.662  1.00 31.30 ? 354  LEU B CD2 1 
ATOM   2484 N N   . LEU B 1 63  ? -39.867 29.744 -3.406  1.00 33.86 ? 362  LEU B N   1 
ATOM   2485 C CA  . LEU B 1 63  ? -40.741 30.780 -3.984  1.00 33.07 ? 362  LEU B CA  1 
ATOM   2486 C C   . LEU B 1 63  ? -39.917 31.650 -4.916  1.00 33.92 ? 362  LEU B C   1 
ATOM   2487 O O   . LEU B 1 63  ? -38.795 31.275 -5.291  1.00 33.62 ? 362  LEU B O   1 
ATOM   2488 C CB  . LEU B 1 63  ? -41.427 31.505 -2.830  1.00 31.69 ? 362  LEU B CB  1 
ATOM   2489 C CG  . LEU B 1 63  ? -42.841 31.052 -2.469  1.00 30.96 ? 362  LEU B CG  1 
ATOM   2490 C CD1 . LEU B 1 63  ? -42.855 29.751 -1.672  1.00 28.71 ? 362  LEU B CD1 1 
ATOM   2491 C CD2 . LEU B 1 63  ? -43.550 32.147 -1.679  1.00 29.20 ? 362  LEU B CD2 1 
ATOM   2492 N N   . LEU B 1 64  ? -40.436 32.803 -5.323  1.00 34.40 ? 363  LEU B N   1 
ATOM   2493 C CA  . LEU B 1 64  ? -39.716 33.673 -6.251  1.00 33.52 ? 363  LEU B CA  1 
ATOM   2494 C C   . LEU B 1 64  ? -38.488 34.305 -5.616  1.00 32.85 ? 363  LEU B C   1 
ATOM   2495 O O   . LEU B 1 64  ? -37.675 34.961 -6.278  1.00 31.73 ? 363  LEU B O   1 
ATOM   2496 C CB  . LEU B 1 64  ? -40.648 34.768 -6.788  1.00 33.42 ? 363  LEU B CB  1 
ATOM   2497 C CG  . LEU B 1 64  ? -40.064 35.594 -7.944  1.00 33.71 ? 363  LEU B CG  1 
ATOM   2498 C CD1 . LEU B 1 64  ? -41.011 35.648 -9.134  1.00 34.91 ? 363  LEU B CD1 1 
ATOM   2499 C CD2 . LEU B 1 64  ? -39.705 36.991 -7.449  1.00 32.50 ? 363  LEU B CD2 1 
ATOM   2500 N N   . PHE B 1 65  ? -38.334 34.120 -4.303  1.00 32.43 ? 364  PHE B N   1 
ATOM   2501 C CA  . PHE B 1 65  ? -37.116 34.621 -3.649  1.00 31.27 ? 364  PHE B CA  1 
ATOM   2502 C C   . PHE B 1 65  ? -35.903 33.992 -4.342  1.00 28.38 ? 364  PHE B C   1 
ATOM   2503 O O   . PHE B 1 65  ? -34.951 34.680 -4.700  1.00 26.85 ? 364  PHE B O   1 
ATOM   2504 C CB  . PHE B 1 65  ? -37.121 34.326 -2.154  1.00 32.71 ? 364  PHE B CB  1 
ATOM   2505 C CG  . PHE B 1 65  ? -35.734 34.065 -1.589  1.00 34.26 ? 364  PHE B CG  1 
ATOM   2506 C CD1 . PHE B 1 65  ? -34.888 35.124 -1.316  1.00 35.46 ? 364  PHE B CD1 1 
ATOM   2507 C CD2 . PHE B 1 65  ? -35.290 32.778 -1.341  1.00 35.66 ? 364  PHE B CD2 1 
ATOM   2508 C CE1 . PHE B 1 65  ? -33.620 34.908 -0.811  1.00 36.03 ? 364  PHE B CE1 1 
ATOM   2509 C CE2 . PHE B 1 65  ? -34.023 32.545 -0.840  1.00 36.59 ? 364  PHE B CE2 1 
ATOM   2510 C CZ  . PHE B 1 65  ? -33.184 33.618 -0.576  1.00 36.83 ? 364  PHE B CZ  1 
ATOM   2511 N N   . ASN B 1 66  ? -35.971 32.679 -4.519  1.00 26.57 ? 365  ASN B N   1 
ATOM   2512 C CA  . ASN B 1 66  ? -34.917 31.902 -5.138  1.00 24.92 ? 365  ASN B CA  1 
ATOM   2513 C C   . ASN B 1 66  ? -34.734 32.194 -6.618  1.00 22.90 ? 365  ASN B C   1 
ATOM   2514 O O   . ASN B 1 66  ? -33.631 32.035 -7.142  1.00 23.44 ? 365  ASN B O   1 
ATOM   2515 C CB  . ASN B 1 66  ? -35.198 30.399 -4.953  1.00 25.44 ? 365  ASN B CB  1 
ATOM   2516 C CG  . ASN B 1 66  ? -34.116 29.747 -4.114  1.00 25.76 ? 365  ASN B CG  1 
ATOM   2517 O OD1 . ASN B 1 66  ? -33.158 30.397 -3.703  1.00 24.54 ? 365  ASN B OD1 1 
ATOM   2518 N ND2 . ASN B 1 66  ? -34.264 28.452 -3.855  1.00 28.85 ? 365  ASN B ND2 1 
ATOM   2519 N N   . GLU B 1 67  ? -35.796 32.617 -7.296  1.00 21.74 ? 366  GLU B N   1 
ATOM   2520 C CA  . GLU B 1 67  ? -35.705 32.894 -8.726  1.00 20.76 ? 366  GLU B CA  1 
ATOM   2521 C C   . GLU B 1 67  ? -34.581 33.886 -9.012  1.00 20.72 ? 366  GLU B C   1 
ATOM   2522 O O   . GLU B 1 67  ? -33.709 33.637 -9.846  1.00 20.20 ? 366  GLU B O   1 
ATOM   2523 C CB  . GLU B 1 67  ? -37.021 33.423 -9.307  1.00 19.65 ? 366  GLU B CB  1 
ATOM   2524 C CG  . GLU B 1 67  ? -37.227 32.938 -10.740 1.00 18.74 ? 366  GLU B CG  1 
ATOM   2525 C CD  . GLU B 1 67  ? -38.570 33.309 -11.320 1.00 18.33 ? 366  GLU B CD  1 
ATOM   2526 O OE1 . GLU B 1 67  ? -39.461 33.764 -10.569 1.00 19.49 ? 366  GLU B OE1 1 
ATOM   2527 O OE2 . GLU B 1 67  ? -38.758 33.157 -12.547 1.00 17.08 ? 366  GLU B OE2 1 
ATOM   2528 N N   . VAL B 1 68  ? -34.599 35.005 -8.297  1.00 21.09 ? 367  VAL B N   1 
ATOM   2529 C CA  . VAL B 1 68  ? -33.525 35.987 -8.386  1.00 21.90 ? 367  VAL B CA  1 
ATOM   2530 C C   . VAL B 1 68  ? -32.173 35.314 -8.116  1.00 22.98 ? 367  VAL B C   1 
ATOM   2531 O O   . VAL B 1 68  ? -31.228 35.389 -8.904  1.00 19.83 ? 367  VAL B O   1 
ATOM   2532 C CB  . VAL B 1 68  ? -33.735 37.137 -7.391  1.00 21.36 ? 367  VAL B CB  1 
ATOM   2533 C CG1 . VAL B 1 68  ? -32.481 38.002 -7.338  1.00 23.52 ? 367  VAL B CG1 1 
ATOM   2534 C CG2 . VAL B 1 68  ? -34.950 37.973 -7.749  1.00 17.58 ? 367  VAL B CG2 1 
ATOM   2535 N N   . VAL B 1 69  ? -32.104 34.631 -6.987  1.00 24.42 ? 368  VAL B N   1 
ATOM   2536 C CA  . VAL B 1 69  ? -30.976 33.855 -6.545  1.00 24.56 ? 368  VAL B CA  1 
ATOM   2537 C C   . VAL B 1 69  ? -30.216 33.080 -7.599  1.00 23.46 ? 368  VAL B C   1 
ATOM   2538 O O   . VAL B 1 69  ? -28.981 33.069 -7.595  1.00 22.26 ? 368  VAL B O   1 
ATOM   2539 C CB  . VAL B 1 69  ? -31.522 32.845 -5.492  1.00 26.01 ? 368  VAL B CB  1 
ATOM   2540 C CG1 . VAL B 1 69  ? -30.572 31.693 -5.245  1.00 27.12 ? 368  VAL B CG1 1 
ATOM   2541 C CG2 . VAL B 1 69  ? -31.834 33.606 -4.204  1.00 27.41 ? 368  VAL B CG2 1 
ATOM   2542 N N   . ILE B 1 70  ? -30.926 32.389 -8.489  1.00 23.64 ? 369  ILE B N   1 
ATOM   2543 C CA  . ILE B 1 70  ? -30.232 31.438 -9.371  1.00 23.06 ? 369  ILE B CA  1 
ATOM   2544 C C   . ILE B 1 70  ? -29.927 31.961 -10.755 1.00 24.57 ? 369  ILE B C   1 
ATOM   2545 O O   . ILE B 1 70  ? -28.821 31.776 -11.282 1.00 27.35 ? 369  ILE B O   1 
ATOM   2546 C CB  . ILE B 1 70  ? -31.043 30.130 -9.528  1.00 20.81 ? 369  ILE B CB  1 
ATOM   2547 C CG1 . ILE B 1 70  ? -31.784 29.717 -8.266  1.00 20.49 ? 369  ILE B CG1 1 
ATOM   2548 C CG2 . ILE B 1 70  ? -30.111 29.042 -10.058 1.00 16.88 ? 369  ILE B CG2 1 
ATOM   2549 C CD1 . ILE B 1 70  ? -31.774 28.230 -7.975  1.00 20.04 ? 369  ILE B CD1 1 
ATOM   2550 N N   . MET B 1 71  ? -30.908 32.594 -11.398 1.00 25.42 ? 370  MET B N   1 
ATOM   2551 C CA  . MET B 1 71  ? -30.740 32.951 -12.814 1.00 26.43 ? 370  MET B CA  1 
ATOM   2552 C C   . MET B 1 71  ? -29.975 34.254 -12.980 1.00 28.01 ? 370  MET B C   1 
ATOM   2553 O O   . MET B 1 71  ? -29.858 34.842 -14.057 1.00 25.90 ? 370  MET B O   1 
ATOM   2554 C CB  . MET B 1 71  ? -32.111 33.000 -13.481 1.00 26.79 ? 370  MET B CB  1 
ATOM   2555 C CG  . MET B 1 71  ? -32.817 31.659 -13.575 1.00 27.18 ? 370  MET B CG  1 
ATOM   2556 S SD  . MET B 1 71  ? -31.817 30.362 -14.332 1.00 18.84 ? 370  MET B SD  1 
ATOM   2557 C CE  . MET B 1 71  ? -31.653 29.224 -12.966 1.00 36.35 ? 370  MET B CE  1 
ATOM   2558 N N   . ARG B 1 72  ? -29.410 34.731 -11.860 1.00 29.81 ? 371  ARG B N   1 
ATOM   2559 C CA  . ARG B 1 72  ? -28.552 35.914 -11.929 1.00 30.06 ? 371  ARG B CA  1 
ATOM   2560 C C   . ARG B 1 72  ? -27.149 35.476 -12.344 1.00 29.75 ? 371  ARG B C   1 
ATOM   2561 O O   . ARG B 1 72  ? -26.392 36.251 -12.921 1.00 27.58 ? 371  ARG B O   1 
ATOM   2562 C CB  . ARG B 1 72  ? -28.547 36.639 -10.590 1.00 29.31 ? 371  ARG B CB  1 
ATOM   2563 C CG  . ARG B 1 72  ? -27.780 35.904 -9.507  1.00 29.37 ? 371  ARG B CG  1 
ATOM   2564 C CD  . ARG B 1 72  ? -26.942 36.876 -8.691  1.00 29.73 ? 371  ARG B CD  1 
ATOM   2565 N NE  . ARG B 1 72  ? -27.765 37.966 -8.179  1.00 29.78 ? 371  ARG B NE  1 
ATOM   2566 C CZ  . ARG B 1 72  ? -27.504 39.258 -8.170  1.00 29.95 ? 371  ARG B CZ  1 
ATOM   2567 N NH1 . ARG B 1 72  ? -26.380 39.778 -8.651  1.00 31.80 ? 371  ARG B NH1 1 
ATOM   2568 N NH2 . ARG B 1 72  ? -28.420 40.071 -7.645  1.00 29.07 ? 371  ARG B NH2 1 
ATOM   2569 N N   . ASP B 1 73  ? -26.821 34.228 -12.029 1.00 30.08 ? 372  ASP B N   1 
ATOM   2570 C CA  . ASP B 1 73  ? -25.515 33.663 -12.332 1.00 30.09 ? 372  ASP B CA  1 
ATOM   2571 C C   . ASP B 1 73  ? -25.531 32.762 -13.571 1.00 29.75 ? 372  ASP B C   1 
ATOM   2572 O O   . ASP B 1 73  ? -25.561 31.541 -13.435 1.00 27.87 ? 372  ASP B O   1 
ATOM   2573 C CB  . ASP B 1 73  ? -24.927 32.870 -11.174 1.00 30.45 ? 372  ASP B CB  1 
ATOM   2574 C CG  . ASP B 1 73  ? -25.822 32.575 -9.987  1.00 29.84 ? 372  ASP B CG  1 
ATOM   2575 O OD1 . ASP B 1 73  ? -27.059 32.617 -10.138 1.00 28.55 ? 372  ASP B OD1 1 
ATOM   2576 O OD2 . ASP B 1 73  ? -25.276 32.284 -8.895  1.00 26.14 ? 372  ASP B OD2 1 
ATOM   2577 N N   . TYR B 1 74  ? -25.585 33.345 -14.755 1.00 30.32 ? 373  TYR B N   1 
ATOM   2578 C CA  . TYR B 1 74  ? -25.756 32.676 -16.001 1.00 30.05 ? 373  TYR B CA  1 
ATOM   2579 C C   . TYR B 1 74  ? -25.837 33.597 -17.207 1.00 27.63 ? 373  TYR B C   1 
ATOM   2580 O O   . TYR B 1 74  ? -26.405 34.694 -17.163 1.00 29.69 ? 373  TYR B O   1 
ATOM   2581 C CB  . TYR B 1 74  ? -27.089 31.924 -15.893 1.00 30.91 ? 373  TYR B CB  1 
ATOM   2582 C CG  . TYR B 1 74  ? -27.343 30.815 -16.877 1.00 31.21 ? 373  TYR B CG  1 
ATOM   2583 C CD1 . TYR B 1 74  ? -27.172 29.493 -16.474 1.00 31.86 ? 373  TYR B CD1 1 
ATOM   2584 C CD2 . TYR B 1 74  ? -27.754 31.050 -18.180 1.00 31.04 ? 373  TYR B CD2 1 
ATOM   2585 C CE1 . TYR B 1 74  ? -27.397 28.446 -17.349 1.00 32.57 ? 373  TYR B CE1 1 
ATOM   2586 C CE2 . TYR B 1 74  ? -27.982 30.011 -19.058 1.00 31.92 ? 373  TYR B CE2 1 
ATOM   2587 C CZ  . TYR B 1 74  ? -27.806 28.707 -18.643 1.00 32.29 ? 373  TYR B CZ  1 
ATOM   2588 O OH  . TYR B 1 74  ? -28.035 27.677 -19.529 1.00 30.51 ? 373  TYR B OH  1 
ATOM   2589 N N   . GLN B 1 75  ? -25.298 33.139 -18.334 1.00 25.73 ? 374  GLN B N   1 
ATOM   2590 C CA  . GLN B 1 75  ? -25.661 33.751 -19.620 1.00 24.58 ? 374  GLN B CA  1 
ATOM   2591 C C   . GLN B 1 75  ? -25.467 32.728 -20.749 1.00 21.12 ? 374  GLN B C   1 
ATOM   2592 O O   . GLN B 1 75  ? -24.372 32.205 -20.941 1.00 17.17 ? 374  GLN B O   1 
ATOM   2593 C CB  . GLN B 1 75  ? -24.916 35.046 -19.885 1.00 25.45 ? 374  GLN B CB  1 
ATOM   2594 C CG  . GLN B 1 75  ? -23.742 34.929 -20.835 1.00 26.41 ? 374  GLN B CG  1 
ATOM   2595 C CD  . GLN B 1 75  ? -22.469 34.500 -20.126 1.00 26.59 ? 374  GLN B CD  1 
ATOM   2596 O OE1 . GLN B 1 75  ? -22.043 35.148 -19.169 1.00 25.82 ? 374  GLN B OE1 1 
ATOM   2597 N NE2 . GLN B 1 75  ? -21.876 33.415 -20.605 1.00 27.88 ? 374  GLN B NE2 1 
ATOM   2598 N N   . HIS B 1 76  ? -26.556 32.456 -21.452 1.00 19.15 ? 375  HIS B N   1 
ATOM   2599 C CA  . HIS B 1 76  ? -26.590 31.581 -22.595 1.00 16.73 ? 375  HIS B CA  1 
ATOM   2600 C C   . HIS B 1 76  ? -27.469 32.203 -23.709 1.00 15.29 ? 375  HIS B C   1 
ATOM   2601 O O   . HIS B 1 76  ? -28.445 32.895 -23.420 1.00 9.68  ? 375  HIS B O   1 
ATOM   2602 C CB  . HIS B 1 76  ? -27.141 30.179 -22.327 1.00 16.16 ? 375  HIS B CB  1 
ATOM   2603 C CG  . HIS B 1 76  ? -26.752 29.120 -23.319 1.00 15.12 ? 375  HIS B CG  1 
ATOM   2604 N ND1 . HIS B 1 76  ? -25.574 28.412 -23.211 1.00 15.26 ? 375  HIS B ND1 1 
ATOM   2605 C CD2 . HIS B 1 76  ? -27.332 28.598 -24.418 1.00 14.68 ? 375  HIS B CD2 1 
ATOM   2606 C CE1 . HIS B 1 76  ? -25.454 27.530 -24.193 1.00 14.81 ? 375  HIS B CE1 1 
ATOM   2607 N NE2 . HIS B 1 76  ? -26.527 27.630 -24.954 1.00 14.82 ? 375  HIS B NE2 1 
ATOM   2608 N N   . GLU B 1 77  ? -27.084 31.900 -24.921 1.00 14.46 ? 376  GLU B N   1 
ATOM   2609 C CA  . GLU B 1 77  ? -27.698 32.185 -26.169 1.00 13.92 ? 376  GLU B CA  1 
ATOM   2610 C C   . GLU B 1 77  ? -29.069 31.561 -26.369 1.00 12.60 ? 376  GLU B C   1 
ATOM   2611 O O   . GLU B 1 77  ? -29.677 31.781 -27.421 1.00 9.97  ? 376  GLU B O   1 
ATOM   2612 C CB  . GLU B 1 77  ? -26.751 31.645 -27.271 1.00 17.35 ? 376  GLU B CB  1 
ATOM   2613 C CG  . GLU B 1 77  ? -26.125 30.287 -26.977 1.00 18.55 ? 376  GLU B CG  1 
ATOM   2614 C CD  . GLU B 1 77  ? -24.859 30.316 -26.140 1.00 18.57 ? 376  GLU B CD  1 
ATOM   2615 O OE1 . GLU B 1 77  ? -23.732 30.084 -26.637 1.00 16.70 ? 376  GLU B OE1 1 
ATOM   2616 O OE2 . GLU B 1 77  ? -24.966 30.576 -24.921 1.00 18.61 ? 376  GLU B OE2 1 
ATOM   2617 N N   . ASN B 1 78  ? -29.540 30.790 -25.401 1.00 13.55 ? 377  ASN B N   1 
ATOM   2618 C CA  . ASN B 1 78  ? -30.796 30.053 -25.536 1.00 14.69 ? 377  ASN B CA  1 
ATOM   2619 C C   . ASN B 1 78  ? -31.725 30.227 -24.332 1.00 13.30 ? 377  ASN B C   1 
ATOM   2620 O O   . ASN B 1 78  ? -32.764 29.560 -24.254 1.00 13.00 ? 377  ASN B O   1 
ATOM   2621 C CB  . ASN B 1 78  ? -30.570 28.552 -25.792 1.00 16.30 ? 377  ASN B CB  1 
ATOM   2622 C CG  . ASN B 1 78  ? -29.755 28.350 -27.060 1.00 17.47 ? 377  ASN B CG  1 
ATOM   2623 O OD1 . ASN B 1 78  ? -28.624 27.865 -27.054 1.00 22.50 ? 377  ASN B OD1 1 
ATOM   2624 N ND2 . ASN B 1 78  ? -30.339 28.760 -28.178 1.00 17.29 ? 377  ASN B ND2 1 
ATOM   2625 N N   . VAL B 1 79  ? -31.361 31.118 -23.434 1.00 12.08 ? 378  VAL B N   1 
ATOM   2626 C CA  . VAL B 1 79  ? -32.054 31.375 -22.189 1.00 12.17 ? 378  VAL B CA  1 
ATOM   2627 C C   . VAL B 1 79  ? -32.342 32.868 -22.054 1.00 12.81 ? 378  VAL B C   1 
ATOM   2628 O O   . VAL B 1 79  ? -31.409 33.665 -22.044 1.00 12.22 ? 378  VAL B O   1 
ATOM   2629 C CB  . VAL B 1 79  ? -31.198 30.867 -21.010 1.00 10.76 ? 378  VAL B CB  1 
ATOM   2630 C CG1 . VAL B 1 79  ? -31.836 31.077 -19.655 1.00 5.17  ? 378  VAL B CG1 1 
ATOM   2631 C CG2 . VAL B 1 79  ? -30.906 29.386 -21.230 1.00 10.05 ? 378  VAL B CG2 1 
ATOM   2632 N N   . VAL B 1 80  ? -33.615 33.216 -21.970 1.00 13.51 ? 379  VAL B N   1 
ATOM   2633 C CA  . VAL B 1 80  ? -34.043 34.602 -21.827 1.00 13.15 ? 379  VAL B CA  1 
ATOM   2634 C C   . VAL B 1 80  ? -33.271 35.254 -20.691 1.00 12.23 ? 379  VAL B C   1 
ATOM   2635 O O   . VAL B 1 80  ? -33.314 34.848 -19.536 1.00 9.75  ? 379  VAL B O   1 
ATOM   2636 C CB  . VAL B 1 80  ? -35.560 34.713 -21.597 1.00 12.49 ? 379  VAL B CB  1 
ATOM   2637 C CG1 . VAL B 1 80  ? -35.909 36.058 -20.978 1.00 17.01 ? 379  VAL B CG1 1 
ATOM   2638 C CG2 . VAL B 1 80  ? -36.303 34.519 -22.911 1.00 10.66 ? 379  VAL B CG2 1 
ATOM   2639 N N   . GLU B 1 81  ? -32.496 36.296 -21.038 1.00 11.79 ? 380  GLU B N   1 
ATOM   2640 C CA  . GLU B 1 81  ? -31.544 36.821 -20.060 1.00 10.11 ? 380  GLU B CA  1 
ATOM   2641 C C   . GLU B 1 81  ? -32.254 37.636 -18.977 1.00 10.08 ? 380  GLU B C   1 
ATOM   2642 O O   . GLU B 1 81  ? -33.048 38.523 -19.261 1.00 8.64  ? 380  GLU B O   1 
ATOM   2643 C CB  . GLU B 1 81  ? -30.430 37.640 -20.715 1.00 7.18  ? 380  GLU B CB  1 
ATOM   2644 C CG  . GLU B 1 81  ? -29.486 38.236 -19.689 1.00 5.67  ? 380  GLU B CG  1 
ATOM   2645 C CD  . GLU B 1 81  ? -28.088 38.538 -20.153 1.00 4.77  ? 380  GLU B CD  1 
ATOM   2646 O OE1 . GLU B 1 81  ? -27.239 38.794 -19.272 1.00 4.92  ? 380  GLU B OE1 1 
ATOM   2647 O OE2 . GLU B 1 81  ? -27.828 38.513 -21.372 1.00 6.03  ? 380  GLU B OE2 1 
ATOM   2648 N N   . MET B 1 82  ? -31.937 37.306 -17.730 1.00 11.16 ? 381  MET B N   1 
ATOM   2649 C CA  . MET B 1 82  ? -32.402 38.061 -16.577 1.00 12.30 ? 381  MET B CA  1 
ATOM   2650 C C   . MET B 1 82  ? -31.329 39.095 -16.226 1.00 12.52 ? 381  MET B C   1 
ATOM   2651 O O   . MET B 1 82  ? -30.249 38.696 -15.798 1.00 13.46 ? 381  MET B O   1 
ATOM   2652 C CB  . MET B 1 82  ? -32.709 37.119 -15.424 1.00 11.66 ? 381  MET B CB  1 
ATOM   2653 C CG  . MET B 1 82  ? -32.382 37.615 -14.033 1.00 11.89 ? 381  MET B CG  1 
ATOM   2654 S SD  . MET B 1 82  ? -32.994 36.514 -12.740 1.00 16.71 ? 381  MET B SD  1 
ATOM   2655 C CE  . MET B 1 82  ? -31.714 36.736 -11.504 1.00 28.58 ? 381  MET B CE  1 
ATOM   2656 N N   . TYR B 1 83  ? -31.637 40.361 -16.431 1.00 11.68 ? 382  TYR B N   1 
ATOM   2657 C CA  . TYR B 1 83  ? -30.709 41.457 -16.208 1.00 10.84 ? 382  TYR B CA  1 
ATOM   2658 C C   . TYR B 1 83  ? -30.592 41.880 -14.754 1.00 9.10  ? 382  TYR B C   1 
ATOM   2659 O O   . TYR B 1 83  ? -29.485 41.894 -14.199 1.00 8.93  ? 382  TYR B O   1 
ATOM   2660 C CB  . TYR B 1 83  ? -31.109 42.662 -17.096 1.00 11.49 ? 382  TYR B CB  1 
ATOM   2661 C CG  . TYR B 1 83  ? -30.961 42.350 -18.572 1.00 11.52 ? 382  TYR B CG  1 
ATOM   2662 C CD1 . TYR B 1 83  ? -31.959 42.609 -19.504 1.00 10.35 ? 382  TYR B CD1 1 
ATOM   2663 C CD2 . TYR B 1 83  ? -29.780 41.770 -19.031 1.00 12.07 ? 382  TYR B CD2 1 
ATOM   2664 C CE1 . TYR B 1 83  ? -31.774 42.303 -20.843 1.00 10.04 ? 382  TYR B CE1 1 
ATOM   2665 C CE2 . TYR B 1 83  ? -29.598 41.463 -20.363 1.00 10.99 ? 382  TYR B CE2 1 
ATOM   2666 C CZ  . TYR B 1 83  ? -30.594 41.728 -21.275 1.00 9.98  ? 382  TYR B CZ  1 
ATOM   2667 O OH  . TYR B 1 83  ? -30.371 41.402 -22.599 1.00 9.13  ? 382  TYR B OH  1 
ATOM   2668 N N   . ASN B 1 84  ? -31.697 42.244 -14.119 1.00 8.25  ? 383  ASN B N   1 
ATOM   2669 C CA  . ASN B 1 84  ? -31.681 42.670 -12.724 1.00 7.78  ? 383  ASN B CA  1 
ATOM   2670 C C   . ASN B 1 84  ? -33.020 42.404 -12.035 1.00 7.89  ? 383  ASN B C   1 
ATOM   2671 O O   . ASN B 1 84  ? -34.030 42.375 -12.732 1.00 6.73  ? 383  ASN B O   1 
ATOM   2672 C CB  . ASN B 1 84  ? -31.416 44.168 -12.579 1.00 8.29  ? 383  ASN B CB  1 
ATOM   2673 C CG  . ASN B 1 84  ? -30.066 44.653 -13.057 1.00 6.76  ? 383  ASN B CG  1 
ATOM   2674 O OD1 . ASN B 1 84  ? -29.840 44.896 -14.244 1.00 1.33  ? 383  ASN B OD1 1 
ATOM   2675 N ND2 . ASN B 1 84  ? -29.173 44.778 -12.091 1.00 9.50  ? 383  ASN B ND2 1 
ATOM   2676 N N   . SER B 1 85  ? -32.998 42.260 -10.726 1.00 10.15 ? 384  SER B N   1 
ATOM   2677 C CA  . SER B 1 85  ? -34.189 42.188 -9.891  1.00 10.38 ? 384  SER B CA  1 
ATOM   2678 C C   . SER B 1 85  ? -34.075 43.063 -8.646  1.00 11.24 ? 384  SER B C   1 
ATOM   2679 O O   . SER B 1 85  ? -33.118 42.960 -7.874  1.00 17.21 ? 384  SER B O   1 
ATOM   2680 C CB  . SER B 1 85  ? -34.444 40.730 -9.488  1.00 9.77  ? 384  SER B CB  1 
ATOM   2681 O OG  . SER B 1 85  ? -33.478 40.320 -8.547  1.00 8.23  ? 384  SER B OG  1 
ATOM   2682 N N   . TYR B 1 86  ? -35.042 43.950 -8.441  1.00 13.22 ? 385  TYR B N   1 
ATOM   2683 C CA  . TYR B 1 86  ? -34.971 44.921 -7.344  1.00 14.83 ? 385  TYR B CA  1 
ATOM   2684 C C   . TYR B 1 86  ? -36.379 45.258 -6.849  1.00 18.06 ? 385  TYR B C   1 
ATOM   2685 O O   . TYR B 1 86  ? -37.348 44.703 -7.350  1.00 19.47 ? 385  TYR B O   1 
ATOM   2686 C CB  . TYR B 1 86  ? -34.253 46.219 -7.669  1.00 12.16 ? 385  TYR B CB  1 
ATOM   2687 C CG  . TYR B 1 86  ? -33.835 46.610 -9.047  1.00 10.10 ? 385  TYR B CG  1 
ATOM   2688 C CD1 . TYR B 1 86  ? -32.632 47.295 -9.215  1.00 9.27  ? 385  TYR B CD1 1 
ATOM   2689 C CD2 . TYR B 1 86  ? -34.580 46.338 -10.184 1.00 8.37  ? 385  TYR B CD2 1 
ATOM   2690 C CE1 . TYR B 1 86  ? -32.192 47.685 -10.467 1.00 7.33  ? 385  TYR B CE1 1 
ATOM   2691 C CE2 . TYR B 1 86  ? -34.143 46.727 -11.426 1.00 7.89  ? 385  TYR B CE2 1 
ATOM   2692 C CZ  . TYR B 1 86  ? -32.950 47.400 -11.572 1.00 6.57  ? 385  TYR B CZ  1 
ATOM   2693 O OH  . TYR B 1 86  ? -32.547 47.776 -12.834 1.00 9.26  ? 385  TYR B OH  1 
ATOM   2694 N N   . LEU B 1 87  ? -36.476 46.168 -5.876  1.00 21.79 ? 386  LEU B N   1 
ATOM   2695 C CA  . LEU B 1 87  ? -37.799 46.499 -5.330  1.00 24.89 ? 386  LEU B CA  1 
ATOM   2696 C C   . LEU B 1 87  ? -37.987 47.982 -5.015  1.00 27.59 ? 386  LEU B C   1 
ATOM   2697 O O   . LEU B 1 87  ? -37.236 48.581 -4.253  1.00 30.18 ? 386  LEU B O   1 
ATOM   2698 C CB  . LEU B 1 87  ? -38.156 45.711 -4.075  1.00 24.60 ? 386  LEU B CB  1 
ATOM   2699 C CG  . LEU B 1 87  ? -37.270 44.580 -3.576  1.00 24.74 ? 386  LEU B CG  1 
ATOM   2700 C CD1 . LEU B 1 87  ? -35.855 45.046 -3.158  1.00 27.62 ? 386  LEU B CD1 1 
ATOM   2701 C CD2 . LEU B 1 87  ? -37.923 43.876 -2.374  1.00 19.28 ? 386  LEU B CD2 1 
ATOM   2702 N N   . VAL B 1 88  ? -39.029 48.553 -5.626  1.00 28.71 ? 387  VAL B N   1 
ATOM   2703 C CA  . VAL B 1 88  ? -39.361 49.952 -5.461  1.00 30.20 ? 387  VAL B CA  1 
ATOM   2704 C C   . VAL B 1 88  ? -40.384 50.109 -4.335  1.00 31.00 ? 387  VAL B C   1 
ATOM   2705 O O   . VAL B 1 88  ? -41.550 49.759 -4.497  1.00 29.36 ? 387  VAL B O   1 
ATOM   2706 C CB  . VAL B 1 88  ? -39.971 50.615 -6.712  1.00 30.47 ? 387  VAL B CB  1 
ATOM   2707 C CG1 . VAL B 1 88  ? -39.835 52.132 -6.588  1.00 29.18 ? 387  VAL B CG1 1 
ATOM   2708 C CG2 . VAL B 1 88  ? -39.354 50.099 -7.995  1.00 29.93 ? 387  VAL B CG2 1 
ATOM   2709 N N   . GLY B 1 89  ? -39.911 50.626 -3.207  1.00 32.06 ? 388  GLY B N   1 
ATOM   2710 C CA  . GLY B 1 89  ? -40.731 50.743 -2.014  1.00 31.97 ? 388  GLY B CA  1 
ATOM   2711 C C   . GLY B 1 89  ? -41.262 49.371 -1.632  1.00 31.52 ? 388  GLY B C   1 
ATOM   2712 O O   . GLY B 1 89  ? -40.471 48.504 -1.266  1.00 33.70 ? 388  GLY B O   1 
ATOM   2713 N N   . ASP B 1 90  ? -42.569 49.183 -1.737  1.00 30.16 ? 389  ASP B N   1 
ATOM   2714 C CA  . ASP B 1 90  ? -43.211 47.963 -1.262  1.00 29.08 ? 389  ASP B CA  1 
ATOM   2715 C C   . ASP B 1 90  ? -43.412 46.914 -2.334  1.00 28.88 ? 389  ASP B C   1 
ATOM   2716 O O   . ASP B 1 90  ? -44.431 46.213 -2.356  1.00 28.00 ? 389  ASP B O   1 
ATOM   2717 C CB  . ASP B 1 90  ? -44.559 48.353 -0.633  1.00 28.28 ? 389  ASP B CB  1 
ATOM   2718 C CG  . ASP B 1 90  ? -44.413 48.788 0.814   1.00 27.25 ? 389  ASP B CG  1 
ATOM   2719 O OD1 . ASP B 1 90  ? -45.422 49.139 1.459   1.00 24.53 ? 389  ASP B OD1 1 
ATOM   2720 O OD2 . ASP B 1 90  ? -43.274 48.785 1.325   1.00 27.62 ? 389  ASP B OD2 1 
ATOM   2721 N N   . GLU B 1 91  ? -42.446 46.774 -3.241  1.00 28.57 ? 390  GLU B N   1 
ATOM   2722 C CA  . GLU B 1 91  ? -42.591 45.794 -4.323  1.00 28.75 ? 390  GLU B CA  1 
ATOM   2723 C C   . GLU B 1 91  ? -41.346 45.530 -5.170  1.00 28.12 ? 390  GLU B C   1 
ATOM   2724 O O   . GLU B 1 91  ? -40.647 46.465 -5.560  1.00 27.75 ? 390  GLU B O   1 
ATOM   2725 C CB  . GLU B 1 91  ? -43.728 46.254 -5.267  1.00 30.53 ? 390  GLU B CB  1 
ATOM   2726 N N   . LEU B 1 92  ? -41.091 44.262 -5.484  1.00 28.21 ? 391  LEU B N   1 
ATOM   2727 C CA  . LEU B 1 92  ? -40.046 43.844 -6.407  1.00 29.46 ? 391  LEU B CA  1 
ATOM   2728 C C   . LEU B 1 92  ? -40.403 44.095 -7.875  1.00 31.36 ? 391  LEU B C   1 
ATOM   2729 O O   . LEU B 1 92  ? -41.491 43.728 -8.319  1.00 32.11 ? 391  LEU B O   1 
ATOM   2730 C CB  . LEU B 1 92  ? -39.709 42.366 -6.192  1.00 28.86 ? 391  LEU B CB  1 
ATOM   2731 C CG  . LEU B 1 92  ? -38.802 41.706 -7.238  1.00 28.28 ? 391  LEU B CG  1 
ATOM   2732 C CD1 . LEU B 1 92  ? -37.380 41.556 -6.722  1.00 26.06 ? 391  LEU B CD1 1 
ATOM   2733 C CD2 . LEU B 1 92  ? -39.346 40.352 -7.666  1.00 27.98 ? 391  LEU B CD2 1 
ATOM   2734 N N   . TRP B 1 93  ? -39.498 44.722 -8.604  1.00 32.03 ? 392  TRP B N   1 
ATOM   2735 C CA  . TRP B 1 93  ? -39.604 44.940 -10.037 1.00 33.08 ? 392  TRP B CA  1 
ATOM   2736 C C   . TRP B 1 93  ? -38.412 44.257 -10.710 1.00 32.15 ? 392  TRP B C   1 
ATOM   2737 O O   . TRP B 1 93  ? -37.266 44.544 -10.353 1.00 32.32 ? 392  TRP B O   1 
ATOM   2738 C CB  . TRP B 1 93  ? -39.567 46.409 -10.407 1.00 34.94 ? 392  TRP B CB  1 
ATOM   2739 C CG  . TRP B 1 93  ? -40.793 47.200 -10.685 1.00 36.85 ? 392  TRP B CG  1 
ATOM   2740 C CD1 . TRP B 1 93  ? -40.933 48.050 -11.757 1.00 37.70 ? 392  TRP B CD1 1 
ATOM   2741 C CD2 . TRP B 1 93  ? -42.018 47.275 -9.957  1.00 37.89 ? 392  TRP B CD2 1 
ATOM   2742 N NE1 . TRP B 1 93  ? -42.173 48.636 -11.740 1.00 38.01 ? 392  TRP B NE1 1 
ATOM   2743 C CE2 . TRP B 1 93  ? -42.860 48.173 -10.640 1.00 38.46 ? 392  TRP B CE2 1 
ATOM   2744 C CE3 . TRP B 1 93  ? -42.522 46.676 -8.797  1.00 38.48 ? 392  TRP B CE3 1 
ATOM   2745 C CZ2 . TRP B 1 93  ? -44.152 48.487 -10.214 1.00 39.26 ? 392  TRP B CZ2 1 
ATOM   2746 C CZ3 . TRP B 1 93  ? -43.783 46.987 -8.377  1.00 38.97 ? 392  TRP B CZ3 1 
ATOM   2747 C CH2 . TRP B 1 93  ? -44.595 47.882 -9.073  1.00 39.36 ? 392  TRP B CH2 1 
ATOM   2748 N N   . VAL B 1 94  ? -38.671 43.370 -11.664 1.00 29.99 ? 393  VAL B N   1 
ATOM   2749 C CA  . VAL B 1 94  ? -37.615 42.559 -12.252 1.00 26.88 ? 393  VAL B CA  1 
ATOM   2750 C C   . VAL B 1 94  ? -37.426 42.777 -13.756 1.00 25.84 ? 393  VAL B C   1 
ATOM   2751 O O   . VAL B 1 94  ? -38.327 42.469 -14.539 1.00 28.36 ? 393  VAL B O   1 
ATOM   2752 C CB  . VAL B 1 94  ? -37.852 41.044 -12.085 1.00 26.54 ? 393  VAL B CB  1 
ATOM   2753 C CG1 . VAL B 1 94  ? -36.721 40.308 -12.805 1.00 25.75 ? 393  VAL B CG1 1 
ATOM   2754 C CG2 . VAL B 1 94  ? -37.939 40.625 -10.634 1.00 26.55 ? 393  VAL B CG2 1 
ATOM   2755 N N   . VAL B 1 95  ? -36.256 43.267 -14.122 1.00 21.91 ? 394  VAL B N   1 
ATOM   2756 C CA  . VAL B 1 95  ? -35.876 43.509 -15.496 1.00 17.93 ? 394  VAL B CA  1 
ATOM   2757 C C   . VAL B 1 95  ? -35.361 42.249 -16.186 1.00 15.28 ? 394  VAL B C   1 
ATOM   2758 O O   . VAL B 1 95  ? -34.516 41.535 -15.650 1.00 15.72 ? 394  VAL B O   1 
ATOM   2759 C CB  . VAL B 1 95  ? -34.790 44.611 -15.531 1.00 17.35 ? 394  VAL B CB  1 
ATOM   2760 C CG1 . VAL B 1 95  ? -34.432 45.034 -16.945 1.00 12.38 ? 394  VAL B CG1 1 
ATOM   2761 C CG2 . VAL B 1 95  ? -35.270 45.804 -14.717 1.00 17.17 ? 394  VAL B CG2 1 
ATOM   2762 N N   . MET B 1 96  ? -35.857 41.990 -17.385 1.00 13.98 ? 395  MET B N   1 
ATOM   2763 C CA  . MET B 1 96  ? -35.419 40.879 -18.206 1.00 13.15 ? 395  MET B CA  1 
ATOM   2764 C C   . MET B 1 96  ? -35.365 41.249 -19.691 1.00 13.41 ? 395  MET B C   1 
ATOM   2765 O O   . MET B 1 96  ? -35.887 42.282 -20.112 1.00 14.93 ? 395  MET B O   1 
ATOM   2766 C CB  . MET B 1 96  ? -36.376 39.701 -18.011 1.00 13.31 ? 395  MET B CB  1 
ATOM   2767 C CG  . MET B 1 96  ? -35.748 38.338 -18.268 1.00 13.40 ? 395  MET B CG  1 
ATOM   2768 S SD  . MET B 1 96  ? -35.773 37.341 -16.775 1.00 22.48 ? 395  MET B SD  1 
ATOM   2769 C CE  . MET B 1 96  ? -35.401 35.709 -17.400 1.00 43.24 ? 395  MET B CE  1 
ATOM   2770 N N   . GLU B 1 97  ? -34.746 40.397 -20.486 1.00 14.01 ? 396  GLU B N   1 
ATOM   2771 C CA  . GLU B 1 97  ? -34.802 40.434 -21.931 1.00 15.16 ? 396  GLU B CA  1 
ATOM   2772 C C   . GLU B 1 97  ? -36.236 40.519 -22.437 1.00 16.29 ? 396  GLU B C   1 
ATOM   2773 O O   . GLU B 1 97  ? -37.091 39.744 -22.011 1.00 20.38 ? 396  GLU B O   1 
ATOM   2774 C CB  . GLU B 1 97  ? -34.147 39.159 -22.488 1.00 15.20 ? 396  GLU B CB  1 
ATOM   2775 C CG  . GLU B 1 97  ? -33.733 39.185 -23.944 1.00 15.77 ? 396  GLU B CG  1 
ATOM   2776 C CD  . GLU B 1 97  ? -32.609 38.214 -24.253 1.00 16.29 ? 396  GLU B CD  1 
ATOM   2777 O OE1 . GLU B 1 97  ? -32.140 37.475 -23.357 1.00 16.26 ? 396  GLU B OE1 1 
ATOM   2778 O OE2 . GLU B 1 97  ? -32.163 38.166 -25.421 1.00 16.27 ? 396  GLU B OE2 1 
ATOM   2779 N N   . PHE B 1 98  ? -36.501 41.440 -23.356 1.00 16.44 ? 397  PHE B N   1 
ATOM   2780 C CA  . PHE B 1 98  ? -37.797 41.501 -24.023 1.00 16.74 ? 397  PHE B CA  1 
ATOM   2781 C C   . PHE B 1 98  ? -37.804 40.675 -25.310 1.00 15.34 ? 397  PHE B C   1 
ATOM   2782 O O   . PHE B 1 98  ? -36.924 40.785 -26.164 1.00 16.37 ? 397  PHE B O   1 
ATOM   2783 C CB  . PHE B 1 98  ? -38.166 42.945 -24.331 1.00 19.70 ? 397  PHE B CB  1 
ATOM   2784 C CG  . PHE B 1 98  ? -39.456 43.176 -25.095 1.00 21.74 ? 397  PHE B CG  1 
ATOM   2785 C CD1 . PHE B 1 98  ? -40.585 42.397 -24.920 1.00 22.94 ? 397  PHE B CD1 1 
ATOM   2786 C CD2 . PHE B 1 98  ? -39.520 44.211 -26.008 1.00 22.31 ? 397  PHE B CD2 1 
ATOM   2787 C CE1 . PHE B 1 98  ? -41.744 42.645 -25.634 1.00 22.82 ? 397  PHE B CE1 1 
ATOM   2788 C CE2 . PHE B 1 98  ? -40.668 44.481 -26.729 1.00 22.93 ? 397  PHE B CE2 1 
ATOM   2789 C CZ  . PHE B 1 98  ? -41.786 43.689 -26.538 1.00 23.27 ? 397  PHE B CZ  1 
ATOM   2790 N N   . LEU B 1 99  ? -38.832 39.846 -25.446 1.00 14.59 ? 398  LEU B N   1 
ATOM   2791 C CA  . LEU B 1 99  ? -39.068 39.083 -26.655 1.00 12.98 ? 398  LEU B CA  1 
ATOM   2792 C C   . LEU B 1 99  ? -40.438 39.384 -27.258 1.00 12.41 ? 398  LEU B C   1 
ATOM   2793 O O   . LEU B 1 99  ? -41.449 39.539 -26.572 1.00 8.27  ? 398  LEU B O   1 
ATOM   2794 C CB  . LEU B 1 99  ? -38.915 37.607 -26.291 1.00 12.57 ? 398  LEU B CB  1 
ATOM   2795 C CG  . LEU B 1 99  ? -37.703 36.894 -26.892 1.00 12.59 ? 398  LEU B CG  1 
ATOM   2796 C CD1 . LEU B 1 99  ? -36.467 36.982 -26.016 1.00 16.14 ? 398  LEU B CD1 1 
ATOM   2797 C CD2 . LEU B 1 99  ? -38.067 35.437 -27.160 1.00 8.95  ? 398  LEU B CD2 1 
ATOM   2798 N N   . GLU B 1 100 ? -40.473 39.475 -28.585 1.00 12.44 ? 399  GLU B N   1 
ATOM   2799 C CA  . GLU B 1 100 ? -41.743 39.482 -29.305 1.00 13.64 ? 399  GLU B CA  1 
ATOM   2800 C C   . GLU B 1 100 ? -41.701 38.287 -30.252 1.00 13.41 ? 399  GLU B C   1 
ATOM   2801 O O   . GLU B 1 100 ? -40.621 37.910 -30.691 1.00 10.35 ? 399  GLU B O   1 
ATOM   2802 C CB  . GLU B 1 100 ? -41.966 40.819 -30.003 1.00 13.83 ? 399  GLU B CB  1 
ATOM   2803 C CG  . GLU B 1 100 ? -42.971 41.707 -29.272 1.00 14.07 ? 399  GLU B CG  1 
ATOM   2804 C CD  . GLU B 1 100 ? -43.774 42.588 -30.220 1.00 13.22 ? 399  GLU B CD  1 
ATOM   2805 O OE1 . GLU B 1 100 ? -44.977 42.307 -30.425 1.00 9.05  ? 399  GLU B OE1 1 
ATOM   2806 O OE2 . GLU B 1 100 ? -43.175 43.557 -30.737 1.00 9.26  ? 399  GLU B OE2 1 
ATOM   2807 N N   . GLY B 1 101 ? -42.852 37.687 -30.523 1.00 15.45 ? 400  GLY B N   1 
ATOM   2808 C CA  . GLY B 1 101 ? -42.925 36.512 -31.371 1.00 15.84 ? 400  GLY B CA  1 
ATOM   2809 C C   . GLY B 1 101 ? -43.831 35.400 -30.887 1.00 15.53 ? 400  GLY B C   1 
ATOM   2810 O O   . GLY B 1 101 ? -44.145 34.475 -31.644 1.00 15.01 ? 400  GLY B O   1 
ATOM   2811 N N   . GLY B 1 102 ? -44.260 35.461 -29.631 1.00 16.49 ? 401  GLY B N   1 
ATOM   2812 C CA  . GLY B 1 102 ? -45.143 34.452 -29.064 1.00 17.49 ? 401  GLY B CA  1 
ATOM   2813 C C   . GLY B 1 102 ? -44.479 33.131 -28.734 1.00 17.46 ? 401  GLY B C   1 
ATOM   2814 O O   . GLY B 1 102 ? -43.479 32.755 -29.351 1.00 18.08 ? 401  GLY B O   1 
ATOM   2815 N N   . ALA B 1 103 ? -45.035 32.401 -27.770 1.00 16.95 ? 402  ALA B N   1 
ATOM   2816 C CA  . ALA B 1 103 ? -44.453 31.148 -27.310 1.00 16.35 ? 402  ALA B CA  1 
ATOM   2817 C C   . ALA B 1 103 ? -44.760 29.986 -28.241 1.00 15.26 ? 402  ALA B C   1 
ATOM   2818 O O   . ALA B 1 103 ? -45.721 30.039 -29.008 1.00 14.80 ? 402  ALA B O   1 
ATOM   2819 C CB  . ALA B 1 103 ? -44.946 30.813 -25.911 1.00 17.54 ? 402  ALA B CB  1 
ATOM   2820 N N   . LEU B 1 104 ? -43.954 28.932 -28.165 1.00 14.18 ? 403  LEU B N   1 
ATOM   2821 C CA  . LEU B 1 104 ? -44.062 27.811 -29.097 1.00 10.37 ? 403  LEU B CA  1 
ATOM   2822 C C   . LEU B 1 104 ? -45.475 27.244 -29.161 1.00 8.75  ? 403  LEU B C   1 
ATOM   2823 O O   . LEU B 1 104 ? -45.837 26.684 -30.197 1.00 6.62  ? 403  LEU B O   1 
ATOM   2824 C CB  . LEU B 1 104 ? -43.021 26.749 -28.732 1.00 9.32  ? 403  LEU B CB  1 
ATOM   2825 C CG  . LEU B 1 104 ? -42.977 25.497 -29.617 1.00 10.27 ? 403  LEU B CG  1 
ATOM   2826 C CD1 . LEU B 1 104 ? -42.612 25.824 -31.057 1.00 9.37  ? 403  LEU B CD1 1 
ATOM   2827 C CD2 . LEU B 1 104 ? -42.021 24.462 -29.028 1.00 7.57  ? 403  LEU B CD2 1 
ATOM   2828 N N   . THR B 1 105 ? -46.247 27.400 -28.098 1.00 7.53  ? 404  THR B N   1 
ATOM   2829 C CA  . THR B 1 105 ? -47.615 26.944 -28.027 1.00 6.57  ? 404  THR B CA  1 
ATOM   2830 C C   . THR B 1 105 ? -48.469 27.377 -29.214 1.00 7.89  ? 404  THR B C   1 
ATOM   2831 O O   . THR B 1 105 ? -49.253 26.593 -29.750 1.00 6.07  ? 404  THR B O   1 
ATOM   2832 C CB  . THR B 1 105 ? -48.350 27.448 -26.758 1.00 6.24  ? 404  THR B CB  1 
ATOM   2833 O OG1 . THR B 1 105 ? -47.573 27.279 -25.577 1.00 3.18  ? 404  THR B OG1 1 
ATOM   2834 C CG2 . THR B 1 105 ? -49.636 26.639 -26.586 1.00 2.81  ? 404  THR B CG2 1 
ATOM   2835 N N   . ASP B 1 106 ? -48.328 28.638 -29.625 1.00 10.19 ? 405  ASP B N   1 
ATOM   2836 C CA  . ASP B 1 106 ? -49.204 29.185 -30.663 1.00 11.01 ? 405  ASP B CA  1 
ATOM   2837 C C   . ASP B 1 106 ? -48.933 28.560 -32.021 1.00 10.92 ? 405  ASP B C   1 
ATOM   2838 O O   . ASP B 1 106 ? -49.851 28.401 -32.824 1.00 11.13 ? 405  ASP B O   1 
ATOM   2839 C CB  . ASP B 1 106 ? -49.102 30.705 -30.804 1.00 12.42 ? 405  ASP B CB  1 
ATOM   2840 C CG  . ASP B 1 106 ? -48.174 31.375 -29.814 1.00 14.36 ? 405  ASP B CG  1 
ATOM   2841 O OD1 . ASP B 1 106 ? -47.389 32.254 -30.219 1.00 18.47 ? 405  ASP B OD1 1 
ATOM   2842 O OD2 . ASP B 1 106 ? -48.229 31.004 -28.624 1.00 21.09 ? 405  ASP B OD2 1 
ATOM   2843 N N   . ILE B 1 107 ? -47.673 28.216 -32.296 1.00 12.69 ? 406  ILE B N   1 
ATOM   2844 C CA  . ILE B 1 107 ? -47.365 27.611 -33.604 1.00 14.29 ? 406  ILE B CA  1 
ATOM   2845 C C   . ILE B 1 107 ? -47.903 26.174 -33.633 1.00 14.19 ? 406  ILE B C   1 
ATOM   2846 O O   . ILE B 1 107 ? -48.676 25.828 -34.520 1.00 14.75 ? 406  ILE B O   1 
ATOM   2847 C CB  . ILE B 1 107 ? -45.866 27.628 -33.913 1.00 14.98 ? 406  ILE B CB  1 
ATOM   2848 C CG1 . ILE B 1 107 ? -45.285 28.969 -34.371 1.00 14.72 ? 406  ILE B CG1 1 
ATOM   2849 C CG2 . ILE B 1 107 ? -45.537 26.554 -34.948 1.00 14.88 ? 406  ILE B CG2 1 
ATOM   2850 C CD1 . ILE B 1 107 ? -45.923 30.180 -33.738 1.00 15.56 ? 406  ILE B CD1 1 
ATOM   2851 N N   . VAL B 1 108 ? -47.507 25.395 -32.644 1.00 15.02 ? 407  VAL B N   1 
ATOM   2852 C CA  . VAL B 1 108 ? -47.919 24.017 -32.488 1.00 16.65 ? 407  VAL B CA  1 
ATOM   2853 C C   . VAL B 1 108 ? -49.407 23.795 -32.762 1.00 16.48 ? 407  VAL B C   1 
ATOM   2854 O O   . VAL B 1 108 ? -49.791 22.906 -33.512 1.00 15.01 ? 407  VAL B O   1 
ATOM   2855 C CB  . VAL B 1 108 ? -47.703 23.395 -31.087 1.00 17.51 ? 407  VAL B CB  1 
ATOM   2856 C CG1 . VAL B 1 108 ? -46.653 22.318 -31.296 1.00 18.72 ? 407  VAL B CG1 1 
ATOM   2857 C CG2 . VAL B 1 108 ? -47.269 24.303 -29.966 1.00 17.16 ? 407  VAL B CG2 1 
ATOM   2858 N N   . THR B 1 109 ? -50.233 24.649 -32.153 1.00 17.57 ? 408  THR B N   1 
ATOM   2859 C CA  . THR B 1 109 ? -51.677 24.524 -32.267 1.00 18.40 ? 408  THR B CA  1 
ATOM   2860 C C   . THR B 1 109 ? -52.207 24.837 -33.651 1.00 19.40 ? 408  THR B C   1 
ATOM   2861 O O   . THR B 1 109 ? -53.280 24.359 -34.027 1.00 25.86 ? 408  THR B O   1 
ATOM   2862 C CB  . THR B 1 109 ? -52.387 25.422 -31.229 1.00 18.19 ? 408  THR B CB  1 
ATOM   2863 O OG1 . THR B 1 109 ? -51.883 26.754 -31.262 1.00 18.71 ? 408  THR B OG1 1 
ATOM   2864 C CG2 . THR B 1 109 ? -52.106 24.908 -29.823 1.00 17.84 ? 408  THR B CG2 1 
ATOM   2865 N N   . HIS B 1 110 ? -51.479 25.632 -34.434 1.00 19.64 ? 409  HIS B N   1 
ATOM   2866 C CA  . HIS B 1 110 ? -51.999 26.015 -35.754 1.00 19.90 ? 409  HIS B CA  1 
ATOM   2867 C C   . HIS B 1 110 ? -51.375 25.292 -36.926 1.00 20.36 ? 409  HIS B C   1 
ATOM   2868 O O   . HIS B 1 110 ? -52.111 24.865 -37.823 1.00 22.77 ? 409  HIS B O   1 
ATOM   2869 C CB  . HIS B 1 110 ? -51.857 27.539 -35.894 1.00 20.04 ? 409  HIS B CB  1 
ATOM   2870 C CG  . HIS B 1 110 ? -52.976 28.270 -35.213 1.00 20.67 ? 409  HIS B CG  1 
ATOM   2871 N ND1 . HIS B 1 110 ? -52.917 28.741 -33.920 1.00 20.70 ? 409  HIS B ND1 1 
ATOM   2872 C CD2 . HIS B 1 110 ? -54.209 28.617 -35.665 1.00 20.60 ? 409  HIS B CD2 1 
ATOM   2873 C CE1 . HIS B 1 110 ? -54.056 29.338 -33.610 1.00 20.16 ? 409  HIS B CE1 1 
ATOM   2874 N NE2 . HIS B 1 110 ? -54.866 29.282 -34.654 1.00 19.95 ? 409  HIS B NE2 1 
ATOM   2875 N N   . THR B 1 111 ? -50.056 25.144 -36.961 1.00 20.54 ? 410  THR B N   1 
ATOM   2876 C CA  . THR B 1 111 ? -49.419 24.572 -38.160 1.00 21.21 ? 410  THR B CA  1 
ATOM   2877 C C   . THR B 1 111 ? -48.665 23.278 -37.879 1.00 22.82 ? 410  THR B C   1 
ATOM   2878 O O   . THR B 1 111 ? -48.654 22.808 -36.739 1.00 24.71 ? 410  THR B O   1 
ATOM   2879 C CB  . THR B 1 111 ? -48.475 25.587 -38.835 1.00 20.73 ? 410  THR B CB  1 
ATOM   2880 O OG1 . THR B 1 111 ? -47.478 26.031 -37.911 1.00 24.61 ? 410  THR B OG1 1 
ATOM   2881 C CG2 . THR B 1 111 ? -49.250 26.827 -39.267 1.00 18.15 ? 410  THR B CG2 1 
ATOM   2882 N N   . ARG B 1 112 ? -48.059 22.703 -38.915 1.00 23.43 ? 411  ARG B N   1 
ATOM   2883 C CA  . ARG B 1 112 ? -47.311 21.459 -38.806 1.00 23.47 ? 411  ARG B CA  1 
ATOM   2884 C C   . ARG B 1 112 ? -45.865 21.657 -39.253 1.00 23.53 ? 411  ARG B C   1 
ATOM   2885 O O   . ARG B 1 112 ? -45.574 21.779 -40.444 1.00 24.43 ? 411  ARG B O   1 
ATOM   2886 C CB  . ARG B 1 112 ? -47.999 20.358 -39.615 1.00 24.20 ? 411  ARG B CB  1 
ATOM   2887 C CG  . ARG B 1 112 ? -47.087 19.279 -40.162 1.00 24.39 ? 411  ARG B CG  1 
ATOM   2888 C CD  . ARG B 1 112 ? -46.906 19.416 -41.655 1.00 24.48 ? 411  ARG B CD  1 
ATOM   2889 N NE  . ARG B 1 112 ? -46.131 18.386 -42.321 1.00 24.40 ? 411  ARG B NE  1 
ATOM   2890 C CZ  . ARG B 1 112 ? -44.813 18.329 -42.441 1.00 23.98 ? 411  ARG B CZ  1 
ATOM   2891 N NH1 . ARG B 1 112 ? -44.040 19.271 -41.922 1.00 22.86 ? 411  ARG B NH1 1 
ATOM   2892 N NH2 . ARG B 1 112 ? -44.220 17.331 -43.080 1.00 24.02 ? 411  ARG B NH2 1 
ATOM   2893 N N   . MET B 1 113 ? -44.952 21.676 -38.290 1.00 23.00 ? 412  MET B N   1 
ATOM   2894 C CA  . MET B 1 113 ? -43.542 21.900 -38.545 1.00 22.46 ? 412  MET B CA  1 
ATOM   2895 C C   . MET B 1 113 ? -42.911 20.779 -39.371 1.00 22.84 ? 412  MET B C   1 
ATOM   2896 O O   . MET B 1 113 ? -43.477 19.697 -39.527 1.00 24.39 ? 412  MET B O   1 
ATOM   2897 C CB  . MET B 1 113 ? -42.746 22.040 -37.235 1.00 21.99 ? 412  MET B CB  1 
ATOM   2898 C CG  . MET B 1 113 ? -42.824 23.419 -36.605 1.00 22.34 ? 412  MET B CG  1 
ATOM   2899 S SD  . MET B 1 113 ? -42.726 23.412 -34.803 1.00 24.56 ? 412  MET B SD  1 
ATOM   2900 C CE  . MET B 1 113 ? -40.956 23.664 -34.626 1.00 21.47 ? 412  MET B CE  1 
ATOM   2901 N N   . ASN B 1 114 ? -41.713 21.053 -39.879 1.00 21.17 ? 413  ASN B N   1 
ATOM   2902 C CA  . ASN B 1 114 ? -40.933 20.040 -40.590 1.00 18.02 ? 413  ASN B CA  1 
ATOM   2903 C C   . ASN B 1 114 ? -39.748 19.639 -39.707 1.00 14.91 ? 413  ASN B C   1 
ATOM   2904 O O   . ASN B 1 114 ? -39.524 20.285 -38.684 1.00 11.04 ? 413  ASN B O   1 
ATOM   2905 C CB  . ASN B 1 114 ? -40.493 20.495 -41.963 1.00 17.41 ? 413  ASN B CB  1 
ATOM   2906 C CG  . ASN B 1 114 ? -39.503 21.621 -42.096 1.00 17.10 ? 413  ASN B CG  1 
ATOM   2907 O OD1 . ASN B 1 114 ? -38.605 21.905 -41.301 1.00 19.96 ? 413  ASN B OD1 1 
ATOM   2908 N ND2 . ASN B 1 114 ? -39.696 22.323 -43.212 1.00 10.34 ? 413  ASN B ND2 1 
ATOM   2909 N N   . GLU B 1 115 ? -39.050 18.582 -40.092 1.00 13.22 ? 414  GLU B N   1 
ATOM   2910 C CA  . GLU B 1 115 ? -37.992 18.002 -39.262 1.00 11.62 ? 414  GLU B CA  1 
ATOM   2911 C C   . GLU B 1 115 ? -36.773 18.912 -39.191 1.00 10.03 ? 414  GLU B C   1 
ATOM   2912 O O   . GLU B 1 115 ? -36.030 18.969 -38.200 1.00 7.43  ? 414  GLU B O   1 
ATOM   2913 C CB  . GLU B 1 115 ? -37.622 16.595 -39.727 1.00 11.86 ? 414  GLU B CB  1 
ATOM   2914 C CG  . GLU B 1 115 ? -38.795 15.787 -40.249 1.00 12.97 ? 414  GLU B CG  1 
ATOM   2915 C CD  . GLU B 1 115 ? -38.867 14.366 -39.753 1.00 14.18 ? 414  GLU B CD  1 
ATOM   2916 O OE1 . GLU B 1 115 ? -37.843 13.833 -39.267 1.00 11.72 ? 414  GLU B OE1 1 
ATOM   2917 O OE2 . GLU B 1 115 ? -39.974 13.775 -39.857 1.00 15.79 ? 414  GLU B OE2 1 
ATOM   2918 N N   . GLU B 1 116 ? -36.539 19.683 -40.261 1.00 9.81  ? 415  GLU B N   1 
ATOM   2919 C CA  . GLU B 1 116 ? -35.454 20.673 -40.195 1.00 9.52  ? 415  GLU B CA  1 
ATOM   2920 C C   . GLU B 1 116 ? -35.810 21.684 -39.106 1.00 8.38  ? 415  GLU B C   1 
ATOM   2921 O O   . GLU B 1 116 ? -35.041 21.874 -38.169 1.00 6.38  ? 415  GLU B O   1 
ATOM   2922 C CB  . GLU B 1 116 ? -35.223 21.338 -41.538 1.00 10.85 ? 415  GLU B CB  1 
ATOM   2923 C CG  . GLU B 1 116 ? -34.388 22.598 -41.432 1.00 11.26 ? 415  GLU B CG  1 
ATOM   2924 C CD  . GLU B 1 116 ? -34.372 23.379 -42.729 1.00 12.41 ? 415  GLU B CD  1 
ATOM   2925 O OE1 . GLU B 1 116 ? -35.459 23.765 -43.201 1.00 14.12 ? 415  GLU B OE1 1 
ATOM   2926 O OE2 . GLU B 1 116 ? -33.273 23.610 -43.274 1.00 15.78 ? 415  GLU B OE2 1 
ATOM   2927 N N   . GLN B 1 117 ? -36.996 22.267 -39.220 1.00 9.00  ? 416  GLN B N   1 
ATOM   2928 C CA  . GLN B 1 117 ? -37.578 23.113 -38.194 1.00 11.04 ? 416  GLN B CA  1 
ATOM   2929 C C   . GLN B 1 117 ? -37.583 22.447 -36.820 1.00 10.67 ? 416  GLN B C   1 
ATOM   2930 O O   . GLN B 1 117 ? -36.941 22.899 -35.874 1.00 5.49  ? 416  GLN B O   1 
ATOM   2931 C CB  . GLN B 1 117 ? -39.006 23.488 -38.605 1.00 12.93 ? 416  GLN B CB  1 
ATOM   2932 C CG  . GLN B 1 117 ? -39.078 24.386 -39.832 1.00 12.93 ? 416  GLN B CG  1 
ATOM   2933 C CD  . GLN B 1 117 ? -40.496 24.627 -40.298 1.00 12.71 ? 416  GLN B CD  1 
ATOM   2934 O OE1 . GLN B 1 117 ? -41.267 23.690 -40.498 1.00 11.53 ? 416  GLN B OE1 1 
ATOM   2935 N NE2 . GLN B 1 117 ? -40.886 25.886 -40.486 1.00 12.65 ? 416  GLN B NE2 1 
ATOM   2936 N N   . ILE B 1 118 ? -38.316 21.340 -36.711 1.00 12.28 ? 417  ILE B N   1 
ATOM   2937 C CA  . ILE B 1 118 ? -38.364 20.565 -35.470 1.00 10.51 ? 417  ILE B CA  1 
ATOM   2938 C C   . ILE B 1 118 ? -37.002 20.238 -34.889 1.00 10.58 ? 417  ILE B C   1 
ATOM   2939 O O   . ILE B 1 118 ? -36.781 20.296 -33.673 1.00 7.70  ? 417  ILE B O   1 
ATOM   2940 C CB  . ILE B 1 118 ? -39.133 19.261 -35.762 1.00 9.08  ? 417  ILE B CB  1 
ATOM   2941 C CG1 . ILE B 1 118 ? -40.650 19.393 -35.576 1.00 9.28  ? 417  ILE B CG1 1 
ATOM   2942 C CG2 . ILE B 1 118 ? -38.600 18.087 -34.966 1.00 7.37  ? 417  ILE B CG2 1 
ATOM   2943 C CD1 . ILE B 1 118 ? -41.443 18.560 -36.557 1.00 10.62 ? 417  ILE B CD1 1 
ATOM   2944 N N   . ALA B 1 119 ? -36.048 19.888 -35.749 1.00 11.68 ? 418  ALA B N   1 
ATOM   2945 C CA  . ALA B 1 119 ? -34.678 19.659 -35.287 1.00 13.85 ? 418  ALA B CA  1 
ATOM   2946 C C   . ALA B 1 119 ? -34.045 20.919 -34.706 1.00 13.49 ? 418  ALA B C   1 
ATOM   2947 O O   . ALA B 1 119 ? -33.169 20.859 -33.838 1.00 13.56 ? 418  ALA B O   1 
ATOM   2948 C CB  . ALA B 1 119 ? -33.848 19.109 -36.448 1.00 17.51 ? 418  ALA B CB  1 
ATOM   2949 N N   . ALA B 1 120 ? -34.484 22.081 -35.184 1.00 13.88 ? 419  ALA B N   1 
ATOM   2950 C CA  . ALA B 1 120 ? -33.882 23.350 -34.772 1.00 13.67 ? 419  ALA B CA  1 
ATOM   2951 C C   . ALA B 1 120 ? -34.213 23.736 -33.340 1.00 11.40 ? 419  ALA B C   1 
ATOM   2952 O O   . ALA B 1 120 ? -33.364 24.221 -32.589 1.00 7.18  ? 419  ALA B O   1 
ATOM   2953 C CB  . ALA B 1 120 ? -34.304 24.446 -35.745 1.00 15.87 ? 419  ALA B CB  1 
ATOM   2954 N N   . VAL B 1 121 ? -35.463 23.515 -32.940 1.00 11.22 ? 420  VAL B N   1 
ATOM   2955 C CA  . VAL B 1 121 ? -35.864 23.808 -31.557 1.00 10.23 ? 420  VAL B CA  1 
ATOM   2956 C C   . VAL B 1 121 ? -35.076 22.924 -30.604 1.00 9.03  ? 420  VAL B C   1 
ATOM   2957 O O   . VAL B 1 121 ? -34.633 23.374 -29.549 1.00 8.11  ? 420  VAL B O   1 
ATOM   2958 C CB  . VAL B 1 121 ? -37.384 23.625 -31.400 1.00 11.19 ? 420  VAL B CB  1 
ATOM   2959 C CG1 . VAL B 1 121 ? -37.860 23.793 -29.967 1.00 11.59 ? 420  VAL B CG1 1 
ATOM   2960 C CG2 . VAL B 1 121 ? -38.110 24.618 -32.319 1.00 7.08  ? 420  VAL B CG2 1 
ATOM   2961 N N   . CYS B 1 122 ? -34.885 21.668 -30.999 1.00 8.55  ? 421  CYS B N   1 
ATOM   2962 C CA  . CYS B 1 122 ? -34.198 20.683 -30.185 1.00 7.96  ? 421  CYS B CA  1 
ATOM   2963 C C   . CYS B 1 122 ? -32.760 21.060 -29.856 1.00 7.88  ? 421  CYS B C   1 
ATOM   2964 O O   . CYS B 1 122 ? -32.379 21.089 -28.685 1.00 10.58 ? 421  CYS B O   1 
ATOM   2965 C CB  . CYS B 1 122 ? -34.245 19.333 -30.910 1.00 8.15  ? 421  CYS B CB  1 
ATOM   2966 S SG  . CYS B 1 122 ? -35.667 18.332 -30.419 1.00 18.54 ? 421  CYS B SG  1 
ATOM   2967 N N   . LEU B 1 123 ? -31.969 21.341 -30.875 1.00 9.01  ? 422  LEU B N   1 
ATOM   2968 C CA  . LEU B 1 123 ? -30.618 21.848 -30.703 1.00 9.37  ? 422  LEU B CA  1 
ATOM   2969 C C   . LEU B 1 123 ? -30.515 22.931 -29.637 1.00 10.13 ? 422  LEU B C   1 
ATOM   2970 O O   . LEU B 1 123 ? -29.703 22.826 -28.724 1.00 13.11 ? 422  LEU B O   1 
ATOM   2971 C CB  . LEU B 1 123 ? -30.075 22.440 -32.005 1.00 9.20  ? 422  LEU B CB  1 
ATOM   2972 C CG  . LEU B 1 123 ? -28.617 22.182 -32.361 1.00 8.43  ? 422  LEU B CG  1 
ATOM   2973 C CD1 . LEU B 1 123 ? -28.418 22.665 -33.797 1.00 4.48  ? 422  LEU B CD1 1 
ATOM   2974 C CD2 . LEU B 1 123 ? -27.577 22.837 -31.465 1.00 9.67  ? 422  LEU B CD2 1 
ATOM   2975 N N   . ALA B 1 124 ? -31.374 23.938 -29.723 1.00 11.67 ? 423  ALA B N   1 
ATOM   2976 C CA  . ALA B 1 124 ? -31.366 25.074 -28.829 1.00 10.10 ? 423  ALA B CA  1 
ATOM   2977 C C   . ALA B 1 124 ? -31.517 24.687 -27.362 1.00 10.10 ? 423  ALA B C   1 
ATOM   2978 O O   . ALA B 1 124 ? -30.678 25.035 -26.533 1.00 11.65 ? 423  ALA B O   1 
ATOM   2979 C CB  . ALA B 1 124 ? -32.505 26.027 -29.182 1.00 9.98  ? 423  ALA B CB  1 
ATOM   2980 N N   . VAL B 1 125 ? -32.612 24.005 -27.058 1.00 10.27 ? 424  VAL B N   1 
ATOM   2981 C CA  . VAL B 1 125 ? -32.966 23.634 -25.701 1.00 10.05 ? 424  VAL B CA  1 
ATOM   2982 C C   . VAL B 1 125 ? -31.894 22.699 -25.142 1.00 10.28 ? 424  VAL B C   1 
ATOM   2983 O O   . VAL B 1 125 ? -31.489 22.829 -23.989 1.00 9.68  ? 424  VAL B O   1 
ATOM   2984 C CB  . VAL B 1 125 ? -34.349 22.968 -25.647 1.00 10.25 ? 424  VAL B CB  1 
ATOM   2985 C CG1 . VAL B 1 125 ? -34.398 21.743 -24.754 1.00 15.35 ? 424  VAL B CG1 1 
ATOM   2986 C CG2 . VAL B 1 125 ? -35.387 23.975 -25.167 1.00 11.21 ? 424  VAL B CG2 1 
ATOM   2987 N N   . LEU B 1 126 ? -31.460 21.771 -25.988 1.00 10.16 ? 425  LEU B N   1 
ATOM   2988 C CA  . LEU B 1 126 ? -30.519 20.740 -25.574 1.00 11.86 ? 425  LEU B CA  1 
ATOM   2989 C C   . LEU B 1 126 ? -29.137 21.306 -25.281 1.00 12.84 ? 425  LEU B C   1 
ATOM   2990 O O   . LEU B 1 126 ? -28.369 20.684 -24.549 1.00 17.42 ? 425  LEU B O   1 
ATOM   2991 C CB  . LEU B 1 126 ? -30.470 19.630 -26.633 1.00 13.25 ? 425  LEU B CB  1 
ATOM   2992 C CG  . LEU B 1 126 ? -31.411 18.447 -26.355 1.00 12.44 ? 425  LEU B CG  1 
ATOM   2993 C CD1 . LEU B 1 126 ? -31.506 17.511 -27.552 1.00 6.27  ? 425  LEU B CD1 1 
ATOM   2994 C CD2 . LEU B 1 126 ? -30.965 17.691 -25.108 1.00 16.74 ? 425  LEU B CD2 1 
ATOM   2995 N N   . GLN B 1 127 ? -28.838 22.473 -25.830 1.00 13.40 ? 426  GLN B N   1 
ATOM   2996 C CA  . GLN B 1 127 ? -27.587 23.162 -25.523 1.00 14.08 ? 426  GLN B CA  1 
ATOM   2997 C C   . GLN B 1 127 ? -27.721 23.875 -24.176 1.00 13.35 ? 426  GLN B C   1 
ATOM   2998 O O   . GLN B 1 127 ? -26.794 23.872 -23.359 1.00 11.98 ? 426  GLN B O   1 
ATOM   2999 C CB  . GLN B 1 127 ? -27.139 24.180 -26.550 1.00 16.12 ? 426  GLN B CB  1 
ATOM   3000 C CG  . GLN B 1 127 ? -27.218 23.890 -28.017 1.00 17.08 ? 426  GLN B CG  1 
ATOM   3001 C CD  . GLN B 1 127 ? -27.026 25.100 -28.902 1.00 18.90 ? 426  GLN B CD  1 
ATOM   3002 O OE1 . GLN B 1 127 ? -27.804 26.052 -29.012 1.00 20.06 ? 426  GLN B OE1 1 
ATOM   3003 N NE2 . GLN B 1 127 ? -25.897 25.059 -29.608 1.00 21.25 ? 426  GLN B NE2 1 
ATOM   3004 N N   . ALA B 1 128 ? -28.874 24.498 -23.944 1.00 12.43 ? 427  ALA B N   1 
ATOM   3005 C CA  . ALA B 1 128 ? -29.105 25.190 -22.676 1.00 13.55 ? 427  ALA B CA  1 
ATOM   3006 C C   . ALA B 1 128 ? -29.151 24.204 -21.507 1.00 14.38 ? 427  ALA B C   1 
ATOM   3007 O O   . ALA B 1 128 ? -28.439 24.357 -20.512 1.00 12.99 ? 427  ALA B O   1 
ATOM   3008 C CB  . ALA B 1 128 ? -30.394 25.994 -22.698 1.00 14.44 ? 427  ALA B CB  1 
ATOM   3009 N N   . LEU B 1 129 ? -30.011 23.202 -21.643 1.00 14.97 ? 428  LEU B N   1 
ATOM   3010 C CA  . LEU B 1 129 ? -30.108 22.113 -20.682 1.00 14.18 ? 428  LEU B CA  1 
ATOM   3011 C C   . LEU B 1 129 ? -28.708 21.585 -20.348 1.00 12.19 ? 428  LEU B C   1 
ATOM   3012 O O   . LEU B 1 129 ? -28.361 21.489 -19.179 1.00 6.48  ? 428  LEU B O   1 
ATOM   3013 C CB  . LEU B 1 129 ? -30.976 20.979 -21.234 1.00 13.35 ? 428  LEU B CB  1 
ATOM   3014 C CG  . LEU B 1 129 ? -32.433 21.366 -21.531 1.00 11.48 ? 428  LEU B CG  1 
ATOM   3015 C CD1 . LEU B 1 129 ? -33.199 20.193 -22.115 1.00 10.93 ? 428  LEU B CD1 1 
ATOM   3016 C CD2 . LEU B 1 129 ? -33.087 21.907 -20.270 1.00 8.37  ? 428  LEU B CD2 1 
ATOM   3017 N N   . SER B 1 130 ? -27.958 21.294 -21.393 1.00 13.32 ? 429  SER B N   1 
ATOM   3018 C CA  . SER B 1 130 ? -26.558 20.965 -21.348 1.00 14.60 ? 429  SER B CA  1 
ATOM   3019 C C   . SER B 1 130 ? -25.771 21.893 -20.431 1.00 16.68 ? 429  SER B C   1 
ATOM   3020 O O   . SER B 1 130 ? -24.888 21.450 -19.703 1.00 19.22 ? 429  SER B O   1 
ATOM   3021 C CB  . SER B 1 130 ? -25.980 21.060 -22.762 1.00 16.04 ? 429  SER B CB  1 
ATOM   3022 O OG  . SER B 1 130 ? -25.712 19.774 -23.282 1.00 21.41 ? 429  SER B OG  1 
ATOM   3023 N N   . VAL B 1 131 ? -26.106 23.179 -20.466 1.00 17.83 ? 430  VAL B N   1 
ATOM   3024 C CA  . VAL B 1 131 ? -25.401 24.186 -19.690 1.00 17.67 ? 430  VAL B CA  1 
ATOM   3025 C C   . VAL B 1 131 ? -25.892 24.263 -18.256 1.00 16.00 ? 430  VAL B C   1 
ATOM   3026 O O   . VAL B 1 131 ? -25.107 24.381 -17.309 1.00 18.88 ? 430  VAL B O   1 
ATOM   3027 C CB  . VAL B 1 131 ? -25.537 25.574 -20.357 1.00 19.70 ? 430  VAL B CB  1 
ATOM   3028 C CG1 . VAL B 1 131 ? -25.308 26.688 -19.339 1.00 21.35 ? 430  VAL B CG1 1 
ATOM   3029 C CG2 . VAL B 1 131 ? -24.578 25.703 -21.534 1.00 17.18 ? 430  VAL B CG2 1 
ATOM   3030 N N   . LEU B 1 132 ? -27.212 24.199 -18.068 1.00 14.73 ? 431  LEU B N   1 
ATOM   3031 C CA  . LEU B 1 132 ? -27.736 24.229 -16.696 1.00 13.41 ? 431  LEU B CA  1 
ATOM   3032 C C   . LEU B 1 132 ? -27.477 22.888 -16.021 1.00 13.23 ? 431  LEU B C   1 
ATOM   3033 O O   . LEU B 1 132 ? -27.288 22.827 -14.803 1.00 9.68  ? 431  LEU B O   1 
ATOM   3034 C CB  . LEU B 1 132 ? -29.217 24.563 -16.695 1.00 14.12 ? 431  LEU B CB  1 
ATOM   3035 C CG  . LEU B 1 132 ? -29.644 26.017 -16.875 1.00 14.57 ? 431  LEU B CG  1 
ATOM   3036 C CD1 . LEU B 1 132 ? -31.041 26.085 -17.474 1.00 15.04 ? 431  LEU B CD1 1 
ATOM   3037 C CD2 . LEU B 1 132 ? -29.609 26.768 -15.555 1.00 17.35 ? 431  LEU B CD2 1 
ATOM   3038 N N   . HIS B 1 133 ? -27.476 21.818 -16.813 1.00 12.97 ? 432  HIS B N   1 
ATOM   3039 C CA  . HIS B 1 133 ? -27.349 20.463 -16.282 1.00 12.12 ? 432  HIS B CA  1 
ATOM   3040 C C   . HIS B 1 133 ? -26.060 20.254 -15.491 1.00 13.70 ? 432  HIS B C   1 
ATOM   3041 O O   . HIS B 1 133 ? -26.105 20.027 -14.278 1.00 16.51 ? 432  HIS B O   1 
ATOM   3042 C CB  . HIS B 1 133 ? -27.446 19.433 -17.415 1.00 9.31  ? 432  HIS B CB  1 
ATOM   3043 C CG  . HIS B 1 133 ? -28.837 18.977 -17.739 1.00 8.12  ? 432  HIS B CG  1 
ATOM   3044 N ND1 . HIS B 1 133 ? -29.154 17.729 -18.239 1.00 6.78  ? 432  HIS B ND1 1 
ATOM   3045 C CD2 . HIS B 1 133 ? -30.023 19.627 -17.635 1.00 6.73  ? 432  HIS B CD2 1 
ATOM   3046 C CE1 . HIS B 1 133 ? -30.459 17.643 -18.425 1.00 5.41  ? 432  HIS B CE1 1 
ATOM   3047 N NE2 . HIS B 1 133 ? -31.013 18.783 -18.064 1.00 4.92  ? 432  HIS B NE2 1 
ATOM   3048 N N   . ALA B 1 134 ? -24.923 20.331 -16.165 1.00 14.77 ? 433  ALA B N   1 
ATOM   3049 C CA  . ALA B 1 134 ? -23.629 20.090 -15.540 1.00 15.74 ? 433  ALA B CA  1 
ATOM   3050 C C   . ALA B 1 134 ? -23.416 20.889 -14.269 1.00 18.65 ? 433  ALA B C   1 
ATOM   3051 O O   . ALA B 1 134 ? -22.871 20.386 -13.281 1.00 22.75 ? 433  ALA B O   1 
ATOM   3052 C CB  . ALA B 1 134 ? -22.505 20.409 -16.518 1.00 10.69 ? 433  ALA B CB  1 
ATOM   3053 N N   . GLN B 1 135 ? -23.838 22.154 -14.269 1.00 20.45 ? 434  GLN B N   1 
ATOM   3054 C CA  . GLN B 1 135 ? -23.721 22.968 -13.060 1.00 22.21 ? 434  GLN B CA  1 
ATOM   3055 C C   . GLN B 1 135 ? -24.845 22.634 -12.081 1.00 21.57 ? 434  GLN B C   1 
ATOM   3056 O O   . GLN B 1 135 ? -24.972 23.276 -11.039 1.00 22.57 ? 434  GLN B O   1 
ATOM   3057 C CB  . GLN B 1 135 ? -23.727 24.461 -13.383 1.00 24.88 ? 434  GLN B CB  1 
ATOM   3058 C CG  . GLN B 1 135 ? -22.354 25.048 -13.657 1.00 26.99 ? 434  GLN B CG  1 
ATOM   3059 C CD  . GLN B 1 135 ? -22.366 26.561 -13.769 1.00 27.69 ? 434  GLN B CD  1 
ATOM   3060 O OE1 . GLN B 1 135 ? -22.785 27.257 -12.841 1.00 29.93 ? 434  GLN B OE1 1 
ATOM   3061 N NE2 . GLN B 1 135 ? -21.905 27.098 -14.893 1.00 27.66 ? 434  GLN B NE2 1 
ATOM   3062 N N   . GLY B 1 136 ? -25.652 21.642 -12.426 1.00 20.31 ? 435  GLY B N   1 
ATOM   3063 C CA  . GLY B 1 136 ? -26.669 21.092 -11.574 1.00 17.95 ? 435  GLY B CA  1 
ATOM   3064 C C   . GLY B 1 136 ? -27.957 21.855 -11.489 1.00 15.97 ? 435  GLY B C   1 
ATOM   3065 O O   . GLY B 1 136 ? -28.629 21.827 -10.455 1.00 18.17 ? 435  GLY B O   1 
ATOM   3066 N N   . VAL B 1 137 ? -28.356 22.544 -12.564 1.00 13.78 ? 436  VAL B N   1 
ATOM   3067 C CA  . VAL B 1 137 ? -29.577 23.350 -12.481 1.00 11.39 ? 436  VAL B CA  1 
ATOM   3068 C C   . VAL B 1 137 ? -30.673 22.717 -13.336 1.00 10.08 ? 436  VAL B C   1 
ATOM   3069 O O   . VAL B 1 137 ? -30.366 22.288 -14.443 1.00 9.88  ? 436  VAL B O   1 
ATOM   3070 C CB  . VAL B 1 137 ? -29.418 24.811 -12.920 1.00 10.36 ? 436  VAL B CB  1 
ATOM   3071 C CG1 . VAL B 1 137 ? -30.723 25.539 -12.602 1.00 11.67 ? 436  VAL B CG1 1 
ATOM   3072 C CG2 . VAL B 1 137 ? -28.251 25.502 -12.254 1.00 6.41  ? 436  VAL B CG2 1 
ATOM   3073 N N   . ILE B 1 138 ? -31.879 22.670 -12.802 1.00 10.20 ? 437  ILE B N   1 
ATOM   3074 C CA  . ILE B 1 138 ? -33.003 22.013 -13.437 1.00 11.67 ? 437  ILE B CA  1 
ATOM   3075 C C   . ILE B 1 138 ? -34.220 22.952 -13.502 1.00 11.70 ? 437  ILE B C   1 
ATOM   3076 O O   . ILE B 1 138 ? -34.706 23.384 -12.463 1.00 10.91 ? 437  ILE B O   1 
ATOM   3077 C CB  . ILE B 1 138 ? -33.434 20.720 -12.726 1.00 12.62 ? 437  ILE B CB  1 
ATOM   3078 C CG1 . ILE B 1 138 ? -32.298 19.907 -12.097 1.00 13.54 ? 437  ILE B CG1 1 
ATOM   3079 C CG2 . ILE B 1 138 ? -34.239 19.830 -13.664 1.00 10.49 ? 437  ILE B CG2 1 
ATOM   3080 C CD1 . ILE B 1 138 ? -32.824 18.841 -11.150 1.00 14.27 ? 437  ILE B CD1 1 
ATOM   3081 N N   . HIS B 1 139 ? -34.654 23.221 -14.719 1.00 10.76 ? 438  HIS B N   1 
ATOM   3082 C CA  . HIS B 1 139 ? -35.790 24.054 -15.024 1.00 9.82  ? 438  HIS B CA  1 
ATOM   3083 C C   . HIS B 1 139 ? -37.068 23.487 -14.405 1.00 9.03  ? 438  HIS B C   1 
ATOM   3084 O O   . HIS B 1 139 ? -37.701 24.176 -13.604 1.00 6.25  ? 438  HIS B O   1 
ATOM   3085 C CB  . HIS B 1 139 ? -35.944 24.201 -16.545 1.00 10.25 ? 438  HIS B CB  1 
ATOM   3086 C CG  . HIS B 1 139 ? -36.798 25.354 -16.979 1.00 12.11 ? 438  HIS B CG  1 
ATOM   3087 N ND1 . HIS B 1 139 ? -38.144 25.248 -17.243 1.00 12.97 ? 438  HIS B ND1 1 
ATOM   3088 C CD2 . HIS B 1 139 ? -36.508 26.654 -17.197 1.00 13.45 ? 438  HIS B CD2 1 
ATOM   3089 C CE1 . HIS B 1 139 ? -38.643 26.420 -17.605 1.00 13.43 ? 438  HIS B CE1 1 
ATOM   3090 N NE2 . HIS B 1 139 ? -37.661 27.301 -17.585 1.00 13.19 ? 438  HIS B NE2 1 
ATOM   3091 N N   . ARG B 1 140 ? -37.424 22.273 -14.785 1.00 8.67  ? 439  ARG B N   1 
ATOM   3092 C CA  . ARG B 1 140 ? -38.551 21.556 -14.213 1.00 9.57  ? 439  ARG B CA  1 
ATOM   3093 C C   . ARG B 1 140 ? -39.927 22.028 -14.663 1.00 7.83  ? 439  ARG B C   1 
ATOM   3094 O O   . ARG B 1 140 ? -40.928 21.819 -13.967 1.00 7.44  ? 439  ARG B O   1 
ATOM   3095 C CB  . ARG B 1 140 ? -38.501 21.632 -12.670 1.00 9.77  ? 439  ARG B CB  1 
ATOM   3096 C CG  . ARG B 1 140 ? -37.215 20.977 -12.162 1.00 10.08 ? 439  ARG B CG  1 
ATOM   3097 C CD  . ARG B 1 140 ? -36.700 21.631 -10.909 1.00 8.66  ? 439  ARG B CD  1 
ATOM   3098 N NE  . ARG B 1 140 ? -36.919 20.912 -9.679  1.00 8.59  ? 439  ARG B NE  1 
ATOM   3099 C CZ  . ARG B 1 140 ? -37.814 21.087 -8.722  1.00 8.60  ? 439  ARG B CZ  1 
ATOM   3100 N NH1 . ARG B 1 140 ? -38.719 22.049 -8.812  1.00 10.42 ? 439  ARG B NH1 1 
ATOM   3101 N NH2 . ARG B 1 140 ? -37.825 20.296 -7.655  1.00 5.55  ? 439  ARG B NH2 1 
ATOM   3102 N N   . ASP B 1 141 ? -39.985 22.645 -15.836 1.00 6.30  ? 440  ASP B N   1 
ATOM   3103 C CA  . ASP B 1 141 ? -41.247 23.168 -16.357 1.00 5.55  ? 440  ASP B CA  1 
ATOM   3104 C C   . ASP B 1 141 ? -41.186 23.415 -17.863 1.00 4.57  ? 440  ASP B C   1 
ATOM   3105 O O   . ASP B 1 141 ? -41.689 24.411 -18.384 1.00 10.11 ? 440  ASP B O   1 
ATOM   3106 C CB  . ASP B 1 141 ? -41.654 24.451 -15.623 1.00 5.84  ? 440  ASP B CB  1 
ATOM   3107 C CG  . ASP B 1 141 ? -43.143 24.499 -15.357 1.00 5.89  ? 440  ASP B CG  1 
ATOM   3108 O OD1 . ASP B 1 141 ? -43.629 25.544 -14.871 1.00 0.07  ? 440  ASP B OD1 1 
ATOM   3109 O OD2 . ASP B 1 141 ? -43.798 23.473 -15.641 1.00 12.44 ? 440  ASP B OD2 1 
ATOM   3110 N N   . ILE B 1 142 ? -40.581 22.481 -18.577 1.00 4.00  ? 441  ILE B N   1 
ATOM   3111 C CA  . ILE B 1 142 ? -40.615 22.406 -20.018 1.00 4.19  ? 441  ILE B CA  1 
ATOM   3112 C C   . ILE B 1 142 ? -42.016 22.035 -20.547 1.00 5.18  ? 441  ILE B C   1 
ATOM   3113 O O   . ILE B 1 142 ? -42.623 21.100 -20.031 1.00 2.98  ? 441  ILE B O   1 
ATOM   3114 C CB  . ILE B 1 142 ? -39.603 21.359 -20.526 1.00 3.77  ? 441  ILE B CB  1 
ATOM   3115 C CG1 . ILE B 1 142 ? -38.174 21.600 -20.026 1.00 3.60  ? 441  ILE B CG1 1 
ATOM   3116 C CG2 . ILE B 1 142 ? -39.639 21.234 -22.041 1.00 5.04  ? 441  ILE B CG2 1 
ATOM   3117 C CD1 . ILE B 1 142 ? -37.402 22.668 -20.773 1.00 3.73  ? 441  ILE B CD1 1 
ATOM   3118 N N   . LYS B 1 143 ? -42.461 22.783 -21.529 1.00 3.39  ? 442  LYS B N   1 
ATOM   3119 C CA  . LYS B 1 143 ? -43.674 22.633 -22.276 1.00 2.32  ? 442  LYS B CA  1 
ATOM   3120 C C   . LYS B 1 143 ? -43.697 23.759 -23.302 1.00 3.67  ? 442  LYS B C   1 
ATOM   3121 O O   . LYS B 1 143 ? -43.079 24.801 -23.073 1.00 8.33  ? 442  LYS B O   1 
ATOM   3122 C CB  . LYS B 1 143 ? -44.923 22.669 -21.400 1.00 1.47  ? 442  LYS B CB  1 
ATOM   3123 C CG  . LYS B 1 143 ? -45.221 23.977 -20.715 1.00 2.36  ? 442  LYS B CG  1 
ATOM   3124 C CD  . LYS B 1 143 ? -45.854 23.812 -19.358 1.00 2.00  ? 442  LYS B CD  1 
ATOM   3125 C CE  . LYS B 1 143 ? -46.223 25.153 -18.757 1.00 2.00  ? 442  LYS B CE  1 
ATOM   3126 N NZ  . LYS B 1 143 ? -47.596 25.076 -18.187 1.00 2.06  ? 442  LYS B NZ  1 
ATOM   3127 N N   . SER B 1 144 ? -44.402 23.582 -24.410 1.00 3.33  ? 443  SER B N   1 
ATOM   3128 C CA  . SER B 1 144 ? -44.331 24.554 -25.506 1.00 3.05  ? 443  SER B CA  1 
ATOM   3129 C C   . SER B 1 144 ? -44.679 25.974 -25.094 1.00 4.78  ? 443  SER B C   1 
ATOM   3130 O O   . SER B 1 144 ? -44.330 26.943 -25.796 1.00 9.53  ? 443  SER B O   1 
ATOM   3131 C CB  . SER B 1 144 ? -45.214 24.073 -26.666 1.00 2.91  ? 443  SER B CB  1 
ATOM   3132 O OG  . SER B 1 144 ? -46.588 24.155 -26.343 1.00 2.98  ? 443  SER B OG  1 
ATOM   3133 N N   . ASP B 1 145 ? -45.348 26.145 -23.979 1.00 6.65  ? 444  ASP B N   1 
ATOM   3134 C CA  . ASP B 1 145 ? -45.711 27.444 -23.438 1.00 8.75  ? 444  ASP B CA  1 
ATOM   3135 C C   . ASP B 1 145 ? -44.489 28.231 -22.963 1.00 11.28 ? 444  ASP B C   1 
ATOM   3136 O O   . ASP B 1 145 ? -44.520 29.464 -22.913 1.00 13.08 ? 444  ASP B O   1 
ATOM   3137 C CB  . ASP B 1 145 ? -46.707 27.265 -22.291 1.00 9.43  ? 444  ASP B CB  1 
ATOM   3138 C CG  . ASP B 1 145 ? -47.775 26.201 -22.485 1.00 10.19 ? 444  ASP B CG  1 
ATOM   3139 O OD1 . ASP B 1 145 ? -48.981 26.567 -22.476 1.00 13.16 ? 444  ASP B OD1 1 
ATOM   3140 O OD2 . ASP B 1 145 ? -47.449 24.998 -22.645 1.00 2.59  ? 444  ASP B OD2 1 
ATOM   3141 N N   . SER B 1 146 ? -43.425 27.520 -22.623 1.00 11.46 ? 445  SER B N   1 
ATOM   3142 C CA  . SER B 1 146 ? -42.279 28.074 -21.924 1.00 9.79  ? 445  SER B CA  1 
ATOM   3143 C C   . SER B 1 146 ? -41.088 28.318 -22.842 1.00 9.53  ? 445  SER B C   1 
ATOM   3144 O O   . SER B 1 146 ? -40.055 28.831 -22.404 1.00 3.64  ? 445  SER B O   1 
ATOM   3145 C CB  . SER B 1 146 ? -41.841 27.136 -20.790 1.00 9.85  ? 445  SER B CB  1 
ATOM   3146 O OG  . SER B 1 146 ? -42.922 26.771 -19.948 1.00 11.17 ? 445  SER B OG  1 
ATOM   3147 N N   . ILE B 1 147 ? -41.242 27.955 -24.109 1.00 10.53 ? 446  ILE B N   1 
ATOM   3148 C CA  . ILE B 1 147 ? -40.232 28.214 -25.127 1.00 9.95  ? 446  ILE B CA  1 
ATOM   3149 C C   . ILE B 1 147 ? -40.645 29.366 -26.034 1.00 10.79 ? 446  ILE B C   1 
ATOM   3150 O O   . ILE B 1 147 ? -41.774 29.467 -26.513 1.00 7.51  ? 446  ILE B O   1 
ATOM   3151 C CB  . ILE B 1 147 ? -39.982 26.926 -25.919 1.00 10.75 ? 446  ILE B CB  1 
ATOM   3152 C CG1 . ILE B 1 147 ? -39.185 25.895 -25.103 1.00 10.08 ? 446  ILE B CG1 1 
ATOM   3153 C CG2 . ILE B 1 147 ? -39.311 27.144 -27.261 1.00 14.31 ? 446  ILE B CG2 1 
ATOM   3154 C CD1 . ILE B 1 147 ? -38.114 26.473 -24.217 1.00 6.85  ? 446  ILE B CD1 1 
ATOM   3155 N N   . LEU B 1 148 ? -39.695 30.278 -26.263 1.00 12.38 ? 447  LEU B N   1 
ATOM   3156 C CA  . LEU B 1 148 ? -39.976 31.471 -27.050 1.00 12.70 ? 447  LEU B CA  1 
ATOM   3157 C C   . LEU B 1 148 ? -39.168 31.462 -28.349 1.00 12.25 ? 447  LEU B C   1 
ATOM   3158 O O   . LEU B 1 148 ? -38.100 30.849 -28.424 1.00 11.45 ? 447  LEU B O   1 
ATOM   3159 C CB  . LEU B 1 148 ? -39.681 32.723 -26.225 1.00 13.06 ? 447  LEU B CB  1 
ATOM   3160 C CG  . LEU B 1 148 ? -40.330 32.816 -24.849 1.00 13.54 ? 447  LEU B CG  1 
ATOM   3161 C CD1 . LEU B 1 148 ? -39.853 34.049 -24.093 1.00 10.59 ? 447  LEU B CD1 1 
ATOM   3162 C CD2 . LEU B 1 148 ? -41.852 32.809 -24.968 1.00 16.10 ? 447  LEU B CD2 1 
ATOM   3163 N N   . LEU B 1 149 ? -39.694 32.136 -29.354 1.00 12.91 ? 448  LEU B N   1 
ATOM   3164 C CA  . LEU B 1 149 ? -39.058 32.257 -30.655 1.00 15.52 ? 448  LEU B CA  1 
ATOM   3165 C C   . LEU B 1 149 ? -39.107 33.719 -31.106 1.00 16.40 ? 448  LEU B C   1 
ATOM   3166 O O   . LEU B 1 149 ? -40.099 34.408 -30.842 1.00 15.52 ? 448  LEU B O   1 
ATOM   3167 C CB  . LEU B 1 149 ? -39.718 31.332 -31.691 1.00 15.33 ? 448  LEU B CB  1 
ATOM   3168 C CG  . LEU B 1 149 ? -40.753 30.376 -31.070 1.00 14.35 ? 448  LEU B CG  1 
ATOM   3169 C CD1 . LEU B 1 149 ? -42.068 30.393 -31.826 1.00 13.43 ? 448  LEU B CD1 1 
ATOM   3170 C CD2 . LEU B 1 149 ? -40.169 28.977 -31.005 1.00 11.04 ? 448  LEU B CD2 1 
ATOM   3171 N N   . THR B 1 150 ? -38.043 34.175 -31.740 1.00 17.19 ? 449  THR B N   1 
ATOM   3172 C CA  . THR B 1 150 ? -37.868 35.593 -32.045 1.00 17.27 ? 449  THR B CA  1 
ATOM   3173 C C   . THR B 1 150 ? -38.245 35.886 -33.491 1.00 17.73 ? 449  THR B C   1 
ATOM   3174 O O   . THR B 1 150 ? -38.245 34.998 -34.340 1.00 15.70 ? 449  THR B O   1 
ATOM   3175 C CB  . THR B 1 150 ? -36.429 36.102 -31.805 1.00 16.92 ? 449  THR B CB  1 
ATOM   3176 O OG1 . THR B 1 150 ? -35.567 35.545 -32.808 1.00 13.66 ? 449  THR B OG1 1 
ATOM   3177 C CG2 . THR B 1 150 ? -35.897 35.672 -30.444 1.00 12.64 ? 449  THR B CG2 1 
ATOM   3178 N N   . HIS B 1 151 ? -38.556 37.148 -33.767 1.00 19.26 ? 450  HIS B N   1 
ATOM   3179 C CA  . HIS B 1 151 ? -38.878 37.607 -35.111 1.00 18.30 ? 450  HIS B CA  1 
ATOM   3180 C C   . HIS B 1 151 ? -37.806 37.162 -36.107 1.00 17.36 ? 450  HIS B C   1 
ATOM   3181 O O   . HIS B 1 151 ? -38.123 36.849 -37.254 1.00 18.42 ? 450  HIS B O   1 
ATOM   3182 C CB  . HIS B 1 151 ? -39.041 39.132 -35.123 1.00 18.82 ? 450  HIS B CB  1 
ATOM   3183 C CG  . HIS B 1 151 ? -39.391 39.696 -36.465 1.00 19.43 ? 450  HIS B CG  1 
ATOM   3184 N ND1 . HIS B 1 151 ? -40.668 39.854 -36.944 1.00 19.07 ? 450  HIS B ND1 1 
ATOM   3185 C CD2 . HIS B 1 151 ? -38.575 40.141 -37.452 1.00 19.85 ? 450  HIS B CD2 1 
ATOM   3186 C CE1 . HIS B 1 151 ? -40.636 40.370 -38.159 1.00 18.71 ? 450  HIS B CE1 1 
ATOM   3187 N NE2 . HIS B 1 151 ? -39.369 40.555 -38.494 1.00 18.97 ? 450  HIS B NE2 1 
ATOM   3188 N N   . ASP B 1 152 ? -36.576 37.130 -35.648 1.00 18.50 ? 451  ASP B N   1 
ATOM   3189 C CA  . ASP B 1 152 ? -35.424 36.622 -36.387 1.00 18.10 ? 451  ASP B CA  1 
ATOM   3190 C C   . ASP B 1 152 ? -35.522 35.121 -36.617 1.00 16.93 ? 451  ASP B C   1 
ATOM   3191 O O   . ASP B 1 152 ? -34.876 34.568 -37.514 1.00 20.06 ? 451  ASP B O   1 
ATOM   3192 C CB  . ASP B 1 152 ? -34.140 36.982 -35.636 1.00 19.62 ? 451  ASP B CB  1 
ATOM   3193 C CG  . ASP B 1 152 ? -32.939 36.092 -35.651 1.00 19.93 ? 451  ASP B CG  1 
ATOM   3194 O OD1 . ASP B 1 152 ? -31.833 36.658 -35.819 1.00 18.53 ? 451  ASP B OD1 1 
ATOM   3195 O OD2 . ASP B 1 152 ? -32.993 34.858 -35.485 1.00 21.16 ? 451  ASP B OD2 1 
ATOM   3196 N N   . GLY B 1 153 ? -36.289 34.433 -35.784 1.00 15.83 ? 452  GLY B N   1 
ATOM   3197 C CA  . GLY B 1 153 ? -36.373 32.987 -35.832 1.00 14.59 ? 452  GLY B CA  1 
ATOM   3198 C C   . GLY B 1 153 ? -35.683 32.295 -34.682 1.00 13.13 ? 452  GLY B C   1 
ATOM   3199 O O   . GLY B 1 153 ? -35.768 31.068 -34.557 1.00 12.23 ? 452  GLY B O   1 
ATOM   3200 N N   . ARG B 1 154 ? -35.008 33.041 -33.816 1.00 12.11 ? 453  ARG B N   1 
ATOM   3201 C CA  . ARG B 1 154 ? -34.355 32.459 -32.646 1.00 11.89 ? 453  ARG B CA  1 
ATOM   3202 C C   . ARG B 1 154 ? -35.374 31.797 -31.725 1.00 10.32 ? 453  ARG B C   1 
ATOM   3203 O O   . ARG B 1 154 ? -36.566 32.042 -31.893 1.00 5.36  ? 453  ARG B O   1 
ATOM   3204 C CB  . ARG B 1 154 ? -33.577 33.515 -31.872 1.00 14.85 ? 453  ARG B CB  1 
ATOM   3205 C CG  . ARG B 1 154 ? -32.934 34.613 -32.702 1.00 17.21 ? 453  ARG B CG  1 
ATOM   3206 C CD  . ARG B 1 154 ? -31.772 35.261 -31.969 1.00 18.52 ? 453  ARG B CD  1 
ATOM   3207 N NE  . ARG B 1 154 ? -31.619 36.647 -32.398 1.00 19.85 ? 453  ARG B NE  1 
ATOM   3208 C CZ  . ARG B 1 154 ? -30.583 37.416 -32.113 1.00 20.75 ? 453  ARG B CZ  1 
ATOM   3209 N NH1 . ARG B 1 154 ? -29.551 36.987 -31.388 1.00 19.39 ? 453  ARG B NH1 1 
ATOM   3210 N NH2 . ARG B 1 154 ? -30.574 38.667 -32.573 1.00 21.56 ? 453  ARG B NH2 1 
ATOM   3211 N N   . VAL B 1 155 ? -34.911 30.946 -30.830 1.00 10.13 ? 454  VAL B N   1 
ATOM   3212 C CA  . VAL B 1 155 ? -35.763 30.244 -29.878 1.00 9.08  ? 454  VAL B CA  1 
ATOM   3213 C C   . VAL B 1 155 ? -35.093 30.195 -28.514 1.00 7.98  ? 454  VAL B C   1 
ATOM   3214 O O   . VAL B 1 155 ? -33.975 29.683 -28.390 1.00 5.52  ? 454  VAL B O   1 
ATOM   3215 C CB  . VAL B 1 155 ? -36.059 28.801 -30.341 1.00 8.78  ? 454  VAL B CB  1 
ATOM   3216 C CG1 . VAL B 1 155 ? -36.903 28.058 -29.315 1.00 7.68  ? 454  VAL B CG1 1 
ATOM   3217 C CG2 . VAL B 1 155 ? -36.717 28.794 -31.716 1.00 8.66  ? 454  VAL B CG2 1 
ATOM   3218 N N   . LYS B 1 156 ? -35.756 30.723 -27.485 1.00 8.36  ? 455  LYS B N   1 
ATOM   3219 C CA  . LYS B 1 156 ? -35.190 30.704 -26.138 1.00 8.82  ? 455  LYS B CA  1 
ATOM   3220 C C   . LYS B 1 156 ? -36.172 30.408 -25.001 1.00 8.20  ? 455  LYS B C   1 
ATOM   3221 O O   . LYS B 1 156 ? -37.352 30.741 -25.068 1.00 6.77  ? 455  LYS B O   1 
ATOM   3222 C CB  . LYS B 1 156 ? -34.502 32.045 -25.815 1.00 8.91  ? 455  LYS B CB  1 
ATOM   3223 C CG  . LYS B 1 156 ? -33.299 32.282 -26.708 1.00 7.99  ? 455  LYS B CG  1 
ATOM   3224 C CD  . LYS B 1 156 ? -32.194 33.039 -25.983 1.00 7.83  ? 455  LYS B CD  1 
ATOM   3225 C CE  . LYS B 1 156 ? -31.657 34.187 -26.818 1.00 8.27  ? 455  LYS B CE  1 
ATOM   3226 N NZ  . LYS B 1 156 ? -30.180 34.321 -26.755 1.00 8.61  ? 455  LYS B NZ  1 
ATOM   3227 N N   . LEU B 1 157 ? -35.643 29.786 -23.956 1.00 8.66  ? 456  LEU B N   1 
ATOM   3228 C CA  . LEU B 1 157 ? -36.399 29.252 -22.843 1.00 8.98  ? 456  LEU B CA  1 
ATOM   3229 C C   . LEU B 1 157 ? -36.549 30.231 -21.688 1.00 11.24 ? 456  LEU B C   1 
ATOM   3230 O O   . LEU B 1 157 ? -35.566 30.818 -21.234 1.00 12.92 ? 456  LEU B O   1 
ATOM   3231 C CB  . LEU B 1 157 ? -35.663 27.989 -22.367 1.00 8.61  ? 456  LEU B CB  1 
ATOM   3232 C CG  . LEU B 1 157 ? -35.949 27.453 -20.968 1.00 8.62  ? 456  LEU B CG  1 
ATOM   3233 C CD1 . LEU B 1 157 ? -37.285 26.716 -20.984 1.00 10.76 ? 456  LEU B CD1 1 
ATOM   3234 C CD2 . LEU B 1 157 ? -34.850 26.546 -20.450 1.00 8.38  ? 456  LEU B CD2 1 
ATOM   3235 N N   . SER B 1 158 ? -37.771 30.390 -21.192 1.00 13.28 ? 457  SER B N   1 
ATOM   3236 C CA  . SER B 1 158 ? -38.008 31.207 -19.999 1.00 14.29 ? 457  SER B CA  1 
ATOM   3237 C C   . SER B 1 158 ? -38.896 30.434 -19.016 1.00 13.24 ? 457  SER B C   1 
ATOM   3238 O O   . SER B 1 158 ? -38.934 29.211 -19.113 1.00 16.09 ? 457  SER B O   1 
ATOM   3239 C CB  . SER B 1 158 ? -38.619 32.561 -20.346 1.00 15.92 ? 457  SER B CB  1 
ATOM   3240 O OG  . SER B 1 158 ? -38.041 33.616 -19.577 1.00 18.02 ? 457  SER B OG  1 
ATOM   3241 N N   . ASP B 1 159 ? -39.558 31.136 -18.129 1.00 13.19 ? 458  ASP B N   1 
ATOM   3242 C CA  . ASP B 1 159 ? -40.459 30.627 -17.128 1.00 13.85 ? 458  ASP B CA  1 
ATOM   3243 C C   . ASP B 1 159 ? -39.799 29.753 -16.062 1.00 12.74 ? 458  ASP B C   1 
ATOM   3244 O O   . ASP B 1 159 ? -40.373 28.718 -15.734 1.00 9.10  ? 458  ASP B O   1 
ATOM   3245 C CB  . ASP B 1 159 ? -41.577 29.814 -17.819 1.00 14.64 ? 458  ASP B CB  1 
ATOM   3246 C CG  . ASP B 1 159 ? -42.681 30.729 -18.301 1.00 16.56 ? 458  ASP B CG  1 
ATOM   3247 O OD1 . ASP B 1 159 ? -42.896 30.822 -19.525 1.00 20.86 ? 458  ASP B OD1 1 
ATOM   3248 O OD2 . ASP B 1 159 ? -43.330 31.356 -17.438 1.00 22.19 ? 458  ASP B OD2 1 
ATOM   3249 N N   . PHE B 1 160 ? -38.660 30.174 -15.554 1.00 12.53 ? 459  PHE B N   1 
ATOM   3250 C CA  . PHE B 1 160 ? -37.835 29.437 -14.620 1.00 9.83  ? 459  PHE B CA  1 
ATOM   3251 C C   . PHE B 1 160 ? -38.242 29.588 -13.157 1.00 9.49  ? 459  PHE B C   1 
ATOM   3252 O O   . PHE B 1 160 ? -37.394 29.453 -12.271 1.00 9.78  ? 459  PHE B O   1 
ATOM   3253 C CB  . PHE B 1 160 ? -36.383 29.902 -14.728 1.00 7.89  ? 459  PHE B CB  1 
ATOM   3254 C CG  . PHE B 1 160 ? -35.644 29.607 -16.016 1.00 7.16  ? 459  PHE B CG  1 
ATOM   3255 C CD1 . PHE B 1 160 ? -36.071 30.002 -17.269 1.00 6.21  ? 459  PHE B CD1 1 
ATOM   3256 C CD2 . PHE B 1 160 ? -34.454 28.902 -15.934 1.00 6.23  ? 459  PHE B CD2 1 
ATOM   3257 C CE1 . PHE B 1 160 ? -35.320 29.698 -18.396 1.00 6.22  ? 459  PHE B CE1 1 
ATOM   3258 C CE2 . PHE B 1 160 ? -33.713 28.600 -17.056 1.00 5.09  ? 459  PHE B CE2 1 
ATOM   3259 C CZ  . PHE B 1 160 ? -34.137 28.994 -18.304 1.00 4.69  ? 459  PHE B CZ  1 
ATOM   3260 N N   . GLY B 1 161 ? -39.510 29.860 -12.904 1.00 11.41 ? 460  GLY B N   1 
ATOM   3261 C CA  . GLY B 1 161 ? -40.039 30.032 -11.570 1.00 12.68 ? 460  GLY B CA  1 
ATOM   3262 C C   . GLY B 1 161 ? -39.898 28.811 -10.679 1.00 14.43 ? 460  GLY B C   1 
ATOM   3263 O O   . GLY B 1 161 ? -39.924 28.919 -9.451  1.00 6.94  ? 460  GLY B O   1 
ATOM   3264 N N   . PHE B 1 162 ? -39.744 27.645 -11.300 1.00 16.83 ? 461  PHE B N   1 
ATOM   3265 C CA  . PHE B 1 162 ? -39.664 26.385 -10.580 1.00 17.57 ? 461  PHE B CA  1 
ATOM   3266 C C   . PHE B 1 162 ? -38.283 25.746 -10.605 1.00 15.35 ? 461  PHE B C   1 
ATOM   3267 O O   . PHE B 1 162 ? -38.082 24.722 -9.946  1.00 14.25 ? 461  PHE B O   1 
ATOM   3268 C CB  . PHE B 1 162 ? -40.670 25.410 -11.198 1.00 19.71 ? 461  PHE B CB  1 
ATOM   3269 C CG  . PHE B 1 162 ? -42.122 25.531 -10.798 1.00 22.07 ? 461  PHE B CG  1 
ATOM   3270 C CD1 . PHE B 1 162 ? -42.566 26.422 -9.838  1.00 22.16 ? 461  PHE B CD1 1 
ATOM   3271 C CD2 . PHE B 1 162 ? -43.057 24.711 -11.421 1.00 23.19 ? 461  PHE B CD2 1 
ATOM   3272 C CE1 . PHE B 1 162 ? -43.898 26.495 -9.492  1.00 22.81 ? 461  PHE B CE1 1 
ATOM   3273 C CE2 . PHE B 1 162 ? -44.399 24.774 -11.086 1.00 23.62 ? 461  PHE B CE2 1 
ATOM   3274 C CZ  . PHE B 1 162 ? -44.821 25.673 -10.121 1.00 23.78 ? 461  PHE B CZ  1 
ATOM   3275 N N   . CYS B 1 163 ? -37.350 26.328 -11.345 1.00 13.81 ? 462  CYS B N   1 
ATOM   3276 C CA  . CYS B 1 163 ? -36.030 25.718 -11.528 1.00 13.57 ? 462  CYS B CA  1 
ATOM   3277 C C   . CYS B 1 163 ? -35.361 25.328 -10.211 1.00 12.81 ? 462  CYS B C   1 
ATOM   3278 O O   . CYS B 1 163 ? -35.816 25.656 -9.113  1.00 8.74  ? 462  CYS B O   1 
ATOM   3279 C CB  . CYS B 1 163 ? -35.115 26.625 -12.345 1.00 12.26 ? 462  CYS B CB  1 
ATOM   3280 S SG  . CYS B 1 163 ? -34.388 28.056 -11.547 1.00 7.45  ? 462  CYS B SG  1 
ATOM   3281 N N   . ALA B 1 164 ? -34.250 24.593 -10.324 1.00 12.55 ? 463  ALA B N   1 
ATOM   3282 C CA  . ALA B 1 164 ? -33.553 24.134 -9.129  1.00 11.90 ? 463  ALA B CA  1 
ATOM   3283 C C   . ALA B 1 164 ? -32.043 23.942 -9.348  1.00 11.44 ? 463  ALA B C   1 
ATOM   3284 O O   . ALA B 1 164 ? -31.582 23.863 -10.479 1.00 4.79  ? 463  ALA B O   1 
ATOM   3285 C CB  . ALA B 1 164 ? -34.142 22.828 -8.619  1.00 13.75 ? 463  ALA B CB  1 
ATOM   3286 N N   . GLN B 1 165 ? -31.333 23.871 -8.239  1.00 12.65 ? 464  GLN B N   1 
ATOM   3287 C CA  . GLN B 1 165 ? -29.917 23.690 -8.139  1.00 12.38 ? 464  GLN B CA  1 
ATOM   3288 C C   . GLN B 1 165 ? -29.564 22.409 -7.387  1.00 12.06 ? 464  GLN B C   1 
ATOM   3289 O O   . GLN B 1 165 ? -30.063 22.211 -6.273  1.00 17.03 ? 464  GLN B O   1 
ATOM   3290 C CB  . GLN B 1 165 ? -29.302 24.879 -7.379  1.00 13.08 ? 464  GLN B CB  1 
ATOM   3291 C CG  . GLN B 1 165 ? -27.782 24.803 -7.313  1.00 13.27 ? 464  GLN B CG  1 
ATOM   3292 C CD  . GLN B 1 165 ? -27.164 25.104 -8.671  1.00 12.31 ? 464  GLN B CD  1 
ATOM   3293 O OE1 . GLN B 1 165 ? -27.398 26.190 -9.202  1.00 13.52 ? 464  GLN B OE1 1 
ATOM   3294 N NE2 . GLN B 1 165 ? -26.405 24.164 -9.210  1.00 7.20  ? 464  GLN B NE2 1 
ATOM   3295 N N   . VAL B 1 166 ? -28.730 21.578 -7.980  1.00 9.21  ? 465  VAL B N   1 
ATOM   3296 C CA  . VAL B 1 166 ? -28.356 20.284 -7.456  1.00 7.46  ? 465  VAL B CA  1 
ATOM   3297 C C   . VAL B 1 166 ? -26.848 20.084 -7.473  1.00 7.32  ? 465  VAL B C   1 
ATOM   3298 O O   . VAL B 1 166 ? -26.022 20.913 -7.817  1.00 6.70  ? 465  VAL B O   1 
ATOM   3299 C CB  . VAL B 1 166 ? -29.011 19.138 -8.264  1.00 6.01  ? 465  VAL B CB  1 
ATOM   3300 C CG1 . VAL B 1 166 ? -27.920 18.242 -8.847  1.00 8.36  ? 465  VAL B CG1 1 
ATOM   3301 C CG2 . VAL B 1 166 ? -29.988 18.350 -7.417  1.00 1.34  ? 465  VAL B CG2 1 
ATOM   3302 N N   . GLU B 1 169 ? -23.936 17.182 -2.149  1.00 24.96 ? 468  GLU B N   1 
ATOM   3303 C CA  . GLU B 1 169 ? -24.362 17.857 -0.915  1.00 29.23 ? 468  GLU B CA  1 
ATOM   3304 C C   . GLU B 1 169 ? -25.719 17.314 -0.432  1.00 29.04 ? 468  GLU B C   1 
ATOM   3305 O O   . GLU B 1 169 ? -25.720 16.460 0.469   1.00 29.18 ? 468  GLU B O   1 
ATOM   3306 C CB  . GLU B 1 169 ? -24.346 19.356 -1.143  1.00 30.75 ? 468  GLU B CB  1 
ATOM   3307 C CG  . GLU B 1 169 ? -24.891 20.088 -2.371  1.00 32.32 ? 468  GLU B CG  1 
ATOM   3308 C CD  . GLU B 1 169 ? -24.484 19.572 -3.740  1.00 33.87 ? 468  GLU B CD  1 
ATOM   3309 O OE1 . GLU B 1 169 ? -23.242 19.332 -3.967  1.00 37.09 ? 468  GLU B OE1 1 
ATOM   3310 O OE2 . GLU B 1 169 ? -25.362 19.353 -4.600  1.00 34.46 ? 468  GLU B OE2 1 
ATOM   3311 N N   . VAL B 1 170 ? -26.782 17.776 -1.012  1.00 28.43 ? 469  VAL B N   1 
ATOM   3312 C CA  . VAL B 1 170 ? -28.162 17.411 -0.834  1.00 27.24 ? 469  VAL B CA  1 
ATOM   3313 C C   . VAL B 1 170 ? -28.746 17.139 -2.224  1.00 26.14 ? 469  VAL B C   1 
ATOM   3314 O O   . VAL B 1 170 ? -29.568 17.919 -2.701  1.00 22.33 ? 469  VAL B O   1 
ATOM   3315 C CB  . VAL B 1 170 ? -28.954 18.532 -0.140  1.00 26.73 ? 469  VAL B CB  1 
ATOM   3316 C CG1 . VAL B 1 170 ? -30.420 18.187 0.054   1.00 22.82 ? 469  VAL B CG1 1 
ATOM   3317 C CG2 . VAL B 1 170 ? -28.291 18.844 1.200   1.00 25.30 ? 469  VAL B CG2 1 
ATOM   3318 N N   . PRO B 1 171 ? -28.299 16.071 -2.857  1.00 26.22 ? 470  PRO B N   1 
ATOM   3319 C CA  . PRO B 1 171 ? -28.115 16.003 -4.296  1.00 25.60 ? 470  PRO B CA  1 
ATOM   3320 C C   . PRO B 1 171 ? -29.336 15.752 -5.152  1.00 24.97 ? 470  PRO B C   1 
ATOM   3321 O O   . PRO B 1 171 ? -29.253 15.854 -6.386  1.00 19.49 ? 470  PRO B O   1 
ATOM   3322 C CB  . PRO B 1 171 ? -27.161 14.806 -4.480  1.00 26.66 ? 470  PRO B CB  1 
ATOM   3323 C CG  . PRO B 1 171 ? -26.772 14.371 -3.112  1.00 26.61 ? 470  PRO B CG  1 
ATOM   3324 C CD  . PRO B 1 171 ? -27.938 14.760 -2.260  1.00 26.96 ? 470  PRO B CD  1 
ATOM   3325 N N   . ARG B 1 172 ? -30.484 15.445 -4.559  1.00 26.24 ? 471  ARG B N   1 
ATOM   3326 C CA  . ARG B 1 172 ? -31.715 15.359 -5.362  1.00 26.15 ? 471  ARG B CA  1 
ATOM   3327 C C   . ARG B 1 172 ? -32.774 16.299 -4.806  1.00 25.02 ? 471  ARG B C   1 
ATOM   3328 O O   . ARG B 1 172 ? -32.577 16.812 -3.709  1.00 20.90 ? 471  ARG B O   1 
ATOM   3329 C CB  . ARG B 1 172 ? -32.245 13.926 -5.420  1.00 26.60 ? 471  ARG B CB  1 
ATOM   3330 C CG  . ARG B 1 172 ? -31.230 12.958 -6.006  1.00 26.33 ? 471  ARG B CG  1 
ATOM   3331 C CD  . ARG B 1 172 ? -31.618 11.528 -5.680  1.00 27.18 ? 471  ARG B CD  1 
ATOM   3332 N NE  . ARG B 1 172 ? -32.651 11.023 -6.575  1.00 27.70 ? 471  ARG B NE  1 
ATOM   3333 C CZ  . ARG B 1 172 ? -32.835 9.757  -6.916  1.00 27.72 ? 471  ARG B CZ  1 
ATOM   3334 N NH1 . ARG B 1 172 ? -32.064 8.779  -6.455  1.00 25.31 ? 471  ARG B NH1 1 
ATOM   3335 N NH2 . ARG B 1 172 ? -33.820 9.416  -7.747  1.00 27.72 ? 471  ARG B NH2 1 
ATOM   3336 N N   . ARG B 1 173 ? -33.856 16.490 -5.537  1.00 24.85 ? 472  ARG B N   1 
ATOM   3337 C CA  . ARG B 1 173 ? -34.990 17.276 -5.059  1.00 24.46 ? 472  ARG B CA  1 
ATOM   3338 C C   . ARG B 1 173 ? -36.235 16.403 -4.935  1.00 25.44 ? 472  ARG B C   1 
ATOM   3339 O O   . ARG B 1 173 ? -36.291 15.302 -5.489  1.00 26.17 ? 472  ARG B O   1 
ATOM   3340 C CB  . ARG B 1 173 ? -35.301 18.438 -5.975  1.00 24.26 ? 472  ARG B CB  1 
ATOM   3341 C CG  . ARG B 1 173 ? -35.044 19.861 -5.598  1.00 24.27 ? 472  ARG B CG  1 
ATOM   3342 C CD  . ARG B 1 173 ? -35.358 20.313 -4.186  1.00 24.16 ? 472  ARG B CD  1 
ATOM   3343 N NE  . ARG B 1 173 ? -34.453 21.404 -3.828  1.00 24.05 ? 472  ARG B NE  1 
ATOM   3344 C CZ  . ARG B 1 173 ? -34.712 22.694 -3.837  1.00 23.30 ? 472  ARG B CZ  1 
ATOM   3345 N NH1 . ARG B 1 173 ? -35.896 23.172 -4.188  1.00 25.95 ? 472  ARG B NH1 1 
ATOM   3346 N NH2 . ARG B 1 173 ? -33.757 23.543 -3.479  1.00 21.30 ? 472  ARG B NH2 1 
ATOM   3347 N N   . LYS B 1 174 ? -37.233 16.890 -4.199  1.00 25.44 ? 473  LYS B N   1 
ATOM   3348 C CA  . LYS B 1 174 ? -38.461 16.106 -4.027  1.00 25.48 ? 473  LYS B CA  1 
ATOM   3349 C C   . LYS B 1 174 ? -39.701 16.955 -3.849  1.00 24.25 ? 473  LYS B C   1 
ATOM   3350 O O   . LYS B 1 174 ? -40.711 16.535 -3.275  1.00 25.80 ? 473  LYS B O   1 
ATOM   3351 C CB  . LYS B 1 174 ? -38.273 15.140 -2.853  1.00 27.22 ? 473  LYS B CB  1 
ATOM   3352 C CG  . LYS B 1 174 ? -39.212 13.948 -2.951  1.00 28.12 ? 473  LYS B CG  1 
ATOM   3353 C CD  . LYS B 1 174 ? -40.287 14.076 -1.883  1.00 28.06 ? 473  LYS B CD  1 
ATOM   3354 C CE  . LYS B 1 174 ? -40.873 12.713 -1.578  1.00 28.75 ? 473  LYS B CE  1 
ATOM   3355 N NZ  . LYS B 1 174 ? -39.932 11.828 -0.838  1.00 31.06 ? 473  LYS B NZ  1 
HETATM 3356 N N   . SEP B 1 175 ? -39.671 18.188 -4.371  1.00 23.06 ? 474  SEP B N   1 
HETATM 3357 C CA  . SEP B 1 175 ? -40.918 18.968 -4.413  1.00 22.55 ? 474  SEP B CA  1 
HETATM 3358 C CB  . SEP B 1 175 ? -40.692 20.464 -4.445  1.00 23.62 ? 474  SEP B CB  1 
HETATM 3359 O OG  . SEP B 1 175 ? -40.050 20.901 -3.245  1.00 24.47 ? 474  SEP B OG  1 
HETATM 3360 C C   . SEP B 1 175 ? -41.703 18.580 -5.650  1.00 20.56 ? 474  SEP B C   1 
HETATM 3361 O O   . SEP B 1 175 ? -41.120 18.474 -6.704  1.00 17.86 ? 474  SEP B O   1 
HETATM 3362 P P   . SEP B 1 175 ? -38.633 21.494 -3.763  1.00 23.46 ? 474  SEP B P   1 
HETATM 3363 O O1P . SEP B 1 175 ? -38.883 22.752 -4.501  1.00 24.84 ? 474  SEP B O1P 1 
HETATM 3364 O O2P . SEP B 1 175 ? -37.691 21.758 -2.491  1.00 24.45 ? 474  SEP B O2P 1 
HETATM 3365 O O3P . SEP B 1 175 ? -37.992 20.409 -4.756  1.00 22.52 ? 474  SEP B O3P 1 
ATOM   3366 N N   . LEU B 1 176 ? -43.007 18.393 -5.491  1.00 19.65 ? 475  LEU B N   1 
ATOM   3367 C CA  . LEU B 1 176 ? -43.891 18.065 -6.603  1.00 18.94 ? 475  LEU B CA  1 
ATOM   3368 C C   . LEU B 1 176 ? -44.105 19.283 -7.488  1.00 18.19 ? 475  LEU B C   1 
ATOM   3369 O O   . LEU B 1 176 ? -44.756 20.265 -7.117  1.00 18.34 ? 475  LEU B O   1 
ATOM   3370 C CB  . LEU B 1 176 ? -45.200 17.519 -6.031  1.00 18.16 ? 475  LEU B CB  1 
ATOM   3371 C CG  . LEU B 1 176 ? -46.265 17.068 -7.022  1.00 18.05 ? 475  LEU B CG  1 
ATOM   3372 C CD1 . LEU B 1 176 ? -45.968 15.675 -7.556  1.00 18.65 ? 475  LEU B CD1 1 
ATOM   3373 C CD2 . LEU B 1 176 ? -47.646 17.090 -6.377  1.00 16.37 ? 475  LEU B CD2 1 
ATOM   3374 N N   . VAL B 1 177 ? -43.526 19.247 -8.698  1.00 16.94 ? 476  VAL B N   1 
ATOM   3375 C CA  . VAL B 1 177 ? -43.470 20.473 -9.499  1.00 16.31 ? 476  VAL B CA  1 
ATOM   3376 C C   . VAL B 1 177 ? -43.607 20.293 -11.000 1.00 14.78 ? 476  VAL B C   1 
ATOM   3377 O O   . VAL B 1 177 ? -43.458 19.187 -11.514 1.00 15.40 ? 476  VAL B O   1 
ATOM   3378 C CB  . VAL B 1 177 ? -42.124 21.188 -9.218  1.00 16.28 ? 476  VAL B CB  1 
ATOM   3379 C CG1 . VAL B 1 177 ? -41.162 21.008 -10.376 1.00 15.75 ? 476  VAL B CG1 1 
ATOM   3380 C CG2 . VAL B 1 177 ? -42.395 22.653 -8.931  1.00 18.34 ? 476  VAL B CG2 1 
ATOM   3381 N N   . GLY B 1 178 ? -43.893 21.390 -11.696 1.00 13.82 ? 477  GLY B N   1 
ATOM   3382 C CA  . GLY B 1 178 ? -43.990 21.438 -13.132 1.00 12.71 ? 477  GLY B CA  1 
ATOM   3383 C C   . GLY B 1 178 ? -45.413 21.513 -13.652 1.00 11.02 ? 477  GLY B C   1 
ATOM   3384 O O   . GLY B 1 178 ? -46.319 21.957 -12.944 1.00 11.74 ? 477  GLY B O   1 
ATOM   3385 N N   . THR B 1 179 ? -45.628 21.061 -14.885 1.00 9.01  ? 478  THR B N   1 
ATOM   3386 C CA  . THR B 1 179 ? -46.975 21.025 -15.447 1.00 8.86  ? 478  THR B CA  1 
ATOM   3387 C C   . THR B 1 179 ? -47.452 19.582 -15.644 1.00 8.17  ? 478  THR B C   1 
ATOM   3388 O O   . THR B 1 179 ? -46.772 18.820 -16.322 1.00 8.01  ? 478  THR B O   1 
ATOM   3389 C CB  . THR B 1 179 ? -47.051 21.803 -16.772 1.00 8.80  ? 478  THR B CB  1 
ATOM   3390 O OG1 . THR B 1 179 ? -46.291 23.012 -16.664 1.00 7.09  ? 478  THR B OG1 1 
ATOM   3391 C CG2 . THR B 1 179 ? -48.496 22.201 -17.055 1.00 9.25  ? 478  THR B CG2 1 
ATOM   3392 N N   . PRO B 1 180 ? -48.589 19.261 -15.060 1.00 7.48  ? 479  PRO B N   1 
ATOM   3393 C CA  . PRO B 1 180 ? -49.067 17.891 -14.917 1.00 7.54  ? 479  PRO B CA  1 
ATOM   3394 C C   . PRO B 1 180 ? -48.874 16.987 -16.122 1.00 6.86  ? 479  PRO B C   1 
ATOM   3395 O O   . PRO B 1 180 ? -48.452 15.839 -15.957 1.00 7.28  ? 479  PRO B O   1 
ATOM   3396 C CB  . PRO B 1 180 ? -50.584 18.065 -14.686 1.00 7.28  ? 479  PRO B CB  1 
ATOM   3397 C CG  . PRO B 1 180 ? -50.730 19.408 -14.084 1.00 7.32  ? 479  PRO B CG  1 
ATOM   3398 C CD  . PRO B 1 180 ? -49.532 20.223 -14.463 1.00 7.95  ? 479  PRO B CD  1 
ATOM   3399 N N   . TYR B 1 181 ? -49.200 17.474 -17.313 1.00 6.50  ? 480  TYR B N   1 
ATOM   3400 C CA  . TYR B 1 181 ? -49.169 16.609 -18.498 1.00 6.39  ? 480  TYR B CA  1 
ATOM   3401 C C   . TYR B 1 181 ? -47.744 16.317 -18.947 1.00 5.83  ? 480  TYR B C   1 
ATOM   3402 O O   . TYR B 1 181 ? -47.534 15.408 -19.755 1.00 4.36  ? 480  TYR B O   1 
ATOM   3403 C CB  . TYR B 1 181 ? -49.946 17.198 -19.675 1.00 6.68  ? 480  TYR B CB  1 
ATOM   3404 C CG  . TYR B 1 181 ? -51.405 17.460 -19.404 1.00 5.56  ? 480  TYR B CG  1 
ATOM   3405 C CD1 . TYR B 1 181 ? -51.814 18.687 -18.914 1.00 5.53  ? 480  TYR B CD1 1 
ATOM   3406 C CD2 . TYR B 1 181 ? -52.380 16.499 -19.631 1.00 6.17  ? 480  TYR B CD2 1 
ATOM   3407 C CE1 . TYR B 1 181 ? -53.143 18.966 -18.656 1.00 5.55  ? 480  TYR B CE1 1 
ATOM   3408 C CE2 . TYR B 1 181 ? -53.715 16.764 -19.374 1.00 6.42  ? 480  TYR B CE2 1 
ATOM   3409 C CZ  . TYR B 1 181 ? -54.090 17.998 -18.886 1.00 6.43  ? 480  TYR B CZ  1 
ATOM   3410 O OH  . TYR B 1 181 ? -55.417 18.265 -18.629 1.00 12.44 ? 480  TYR B OH  1 
ATOM   3411 N N   . TRP B 1 182 ? -46.789 17.081 -18.438 1.00 5.50  ? 481  TRP B N   1 
ATOM   3412 C CA  . TRP B 1 182 ? -45.405 16.982 -18.890 1.00 5.86  ? 481  TRP B CA  1 
ATOM   3413 C C   . TRP B 1 182 ? -44.493 16.438 -17.791 1.00 6.00  ? 481  TRP B C   1 
ATOM   3414 O O   . TRP B 1 182 ? -43.270 16.348 -17.929 1.00 4.24  ? 481  TRP B O   1 
ATOM   3415 C CB  . TRP B 1 182 ? -44.889 18.350 -19.302 1.00 4.92  ? 481  TRP B CB  1 
ATOM   3416 C CG  . TRP B 1 182 ? -45.427 18.979 -20.531 1.00 3.50  ? 481  TRP B CG  1 
ATOM   3417 C CD1 . TRP B 1 182 ? -44.783 19.127 -21.726 1.00 2.31  ? 481  TRP B CD1 1 
ATOM   3418 C CD2 . TRP B 1 182 ? -46.729 19.561 -20.692 1.00 2.03  ? 481  TRP B CD2 1 
ATOM   3419 N NE1 . TRP B 1 182 ? -45.613 19.763 -22.618 1.00 2.27  ? 481  TRP B NE1 1 
ATOM   3420 C CE2 . TRP B 1 182 ? -46.810 20.040 -22.013 1.00 2.93  ? 481  TRP B CE2 1 
ATOM   3421 C CE3 . TRP B 1 182 ? -47.817 19.708 -19.830 1.00 2.89  ? 481  TRP B CE3 1 
ATOM   3422 C CZ2 . TRP B 1 182 ? -47.959 20.664 -22.490 1.00 2.94  ? 481  TRP B CZ2 1 
ATOM   3423 C CZ3 . TRP B 1 182 ? -48.952 20.327 -20.306 1.00 2.92  ? 481  TRP B CZ3 1 
ATOM   3424 C CH2 . TRP B 1 182 ? -49.017 20.798 -21.625 1.00 2.59  ? 481  TRP B CH2 1 
ATOM   3425 N N   . MET B 1 183 ? -45.105 16.078 -16.665 1.00 7.17  ? 482  MET B N   1 
ATOM   3426 C CA  . MET B 1 183 ? -44.339 15.568 -15.530 1.00 9.14  ? 482  MET B CA  1 
ATOM   3427 C C   . MET B 1 183 ? -43.729 14.198 -15.843 1.00 10.82 ? 482  MET B C   1 
ATOM   3428 O O   . MET B 1 183 ? -44.330 13.339 -16.504 1.00 14.04 ? 482  MET B O   1 
ATOM   3429 C CB  . MET B 1 183 ? -45.198 15.446 -14.278 1.00 8.22  ? 482  MET B CB  1 
ATOM   3430 C CG  . MET B 1 183 ? -45.341 16.684 -13.420 1.00 6.18  ? 482  MET B CG  1 
ATOM   3431 S SD  . MET B 1 183 ? -46.832 16.661 -12.408 1.00 8.60  ? 482  MET B SD  1 
ATOM   3432 C CE  . MET B 1 183 ? -46.180 16.414 -10.762 1.00 32.42 ? 482  MET B CE  1 
ATOM   3433 N N   . ALA B 1 184 ? -42.514 14.003 -15.353 1.00 10.66 ? 483  ALA B N   1 
ATOM   3434 C CA  . ALA B 1 184 ? -41.800 12.749 -15.442 1.00 11.01 ? 483  ALA B CA  1 
ATOM   3435 C C   . ALA B 1 184 ? -42.357 11.688 -14.501 1.00 12.89 ? 483  ALA B C   1 
ATOM   3436 O O   . ALA B 1 184 ? -42.765 12.010 -13.380 1.00 13.65 ? 483  ALA B O   1 
ATOM   3437 C CB  . ALA B 1 184 ? -40.329 13.025 -15.156 1.00 12.37 ? 483  ALA B CB  1 
ATOM   3438 N N   . PRO B 1 185 ? -42.371 10.438 -14.950 1.00 13.31 ? 484  PRO B N   1 
ATOM   3439 C CA  . PRO B 1 185 ? -42.941 9.346  -14.159 1.00 11.47 ? 484  PRO B CA  1 
ATOM   3440 C C   . PRO B 1 185 ? -42.383 9.316  -12.743 1.00 10.27 ? 484  PRO B C   1 
ATOM   3441 O O   . PRO B 1 185 ? -43.130 9.151  -11.780 1.00 13.40 ? 484  PRO B O   1 
ATOM   3442 C CB  . PRO B 1 185 ? -42.487 8.081  -14.897 1.00 12.53 ? 484  PRO B CB  1 
ATOM   3443 C CG  . PRO B 1 185 ? -42.207 8.508  -16.292 1.00 13.57 ? 484  PRO B CG  1 
ATOM   3444 C CD  . PRO B 1 185 ? -41.827 9.958  -16.235 1.00 14.27 ? 484  PRO B CD  1 
ATOM   3445 N N   . GLU B 1 186 ? -41.068 9.485  -12.626 1.00 9.06  ? 485  GLU B N   1 
ATOM   3446 C CA  . GLU B 1 186 ? -40.391 9.313  -11.352 1.00 8.39  ? 485  GLU B CA  1 
ATOM   3447 C C   . GLU B 1 186 ? -40.872 10.338 -10.337 1.00 6.98  ? 485  GLU B C   1 
ATOM   3448 O O   . GLU B 1 186 ? -41.099 9.984  -9.182  1.00 9.86  ? 485  GLU B O   1 
ATOM   3449 C CB  . GLU B 1 186 ? -38.872 9.368  -11.522 1.00 9.55  ? 485  GLU B CB  1 
ATOM   3450 C CG  . GLU B 1 186 ? -38.259 10.680 -11.950 1.00 8.95  ? 485  GLU B CG  1 
ATOM   3451 C CD  . GLU B 1 186 ? -37.926 10.727 -13.424 1.00 9.18  ? 485  GLU B CD  1 
ATOM   3452 O OE1 . GLU B 1 186 ? -36.897 11.351 -13.799 1.00 5.57  ? 485  GLU B OE1 1 
ATOM   3453 O OE2 . GLU B 1 186 ? -38.697 10.130 -14.208 1.00 11.30 ? 485  GLU B OE2 1 
ATOM   3454 N N   . LEU B 1 187 ? -41.004 11.586 -10.760 1.00 7.22  ? 486  LEU B N   1 
ATOM   3455 C CA  . LEU B 1 187 ? -41.267 12.681 -9.811  1.00 7.66  ? 486  LEU B CA  1 
ATOM   3456 C C   . LEU B 1 187 ? -42.707 12.537 -9.309  1.00 7.77  ? 486  LEU B C   1 
ATOM   3457 O O   . LEU B 1 187 ? -43.057 12.826 -8.172  1.00 10.32 ? 486  LEU B O   1 
ATOM   3458 C CB  . LEU B 1 187 ? -41.005 14.065 -10.377 1.00 7.95  ? 486  LEU B CB  1 
ATOM   3459 C CG  . LEU B 1 187 ? -42.003 15.049 -10.958 1.00 7.45  ? 486  LEU B CG  1 
ATOM   3460 C CD1 . LEU B 1 187 ? -42.924 15.751 -9.966  1.00 8.40  ? 486  LEU B CD1 1 
ATOM   3461 C CD2 . LEU B 1 187 ? -41.218 16.118 -11.711 1.00 9.31  ? 486  LEU B CD2 1 
ATOM   3462 N N   . ILE B 1 188 ? -43.564 12.090 -10.224 1.00 9.42  ? 487  ILE B N   1 
ATOM   3463 C CA  . ILE B 1 188 ? -44.941 11.777 -9.895  1.00 10.61 ? 487  ILE B CA  1 
ATOM   3464 C C   . ILE B 1 188 ? -44.946 10.650 -8.864  1.00 10.98 ? 487  ILE B C   1 
ATOM   3465 O O   . ILE B 1 188 ? -45.825 10.562 -8.015  1.00 7.16  ? 487  ILE B O   1 
ATOM   3466 C CB  . ILE B 1 188 ? -45.728 11.325 -11.140 1.00 9.72  ? 487  ILE B CB  1 
ATOM   3467 C CG1 . ILE B 1 188 ? -45.786 12.337 -12.281 1.00 8.49  ? 487  ILE B CG1 1 
ATOM   3468 C CG2 . ILE B 1 188 ? -47.124 10.921 -10.695 1.00 7.88  ? 487  ILE B CG2 1 
ATOM   3469 C CD1 . ILE B 1 188 ? -45.548 11.741 -13.651 1.00 5.14  ? 487  ILE B CD1 1 
ATOM   3470 N N   . SER B 1 189 ? -43.916 9.807  -8.952  1.00 12.18 ? 488  SER B N   1 
ATOM   3471 C CA  . SER B 1 189 ? -43.702 8.717  -8.020  1.00 13.13 ? 488  SER B CA  1 
ATOM   3472 C C   . SER B 1 189 ? -43.266 9.270  -6.664  1.00 16.45 ? 488  SER B C   1 
ATOM   3473 O O   . SER B 1 189 ? -43.226 8.556  -5.662  1.00 19.21 ? 488  SER B O   1 
ATOM   3474 C CB  . SER B 1 189 ? -42.651 7.742  -8.551  1.00 12.59 ? 488  SER B CB  1 
ATOM   3475 O OG  . SER B 1 189 ? -43.144 6.918  -9.596  1.00 12.61 ? 488  SER B OG  1 
ATOM   3476 N N   . ARG B 1 190 ? -42.939 10.562 -6.644  1.00 17.38 ? 489  ARG B N   1 
ATOM   3477 C CA  . ARG B 1 190 ? -42.484 11.222 -5.432  1.00 17.36 ? 489  ARG B CA  1 
ATOM   3478 C C   . ARG B 1 190 ? -41.206 10.559 -4.922  1.00 15.46 ? 489  ARG B C   1 
ATOM   3479 O O   . ARG B 1 190 ? -41.016 10.348 -3.727  1.00 13.06 ? 489  ARG B O   1 
ATOM   3480 C CB  . ARG B 1 190 ? -43.597 11.229 -4.391  1.00 19.86 ? 489  ARG B CB  1 
ATOM   3481 C CG  . ARG B 1 190 ? -44.816 11.970 -4.957  1.00 22.66 ? 489  ARG B CG  1 
ATOM   3482 C CD  . ARG B 1 190 ? -44.591 13.476 -4.849  1.00 25.00 ? 489  ARG B CD  1 
ATOM   3483 N NE  . ARG B 1 190 ? -45.429 14.045 -3.794  1.00 27.03 ? 489  ARG B NE  1 
ATOM   3484 C CZ  . ARG B 1 190 ? -45.135 15.037 -2.980  1.00 28.58 ? 489  ARG B CZ  1 
ATOM   3485 N NH1 . ARG B 1 190 ? -43.972 15.678 -3.030  1.00 31.31 ? 489  ARG B NH1 1 
ATOM   3486 N NH2 . ARG B 1 190 ? -46.041 15.402 -2.072  1.00 29.88 ? 489  ARG B NH2 1 
ATOM   3487 N N   . LEU B 1 191 ? -40.318 10.253 -5.868  1.00 13.76 ? 490  LEU B N   1 
ATOM   3488 C CA  . LEU B 1 191 ? -38.958 9.852  -5.550  1.00 11.83 ? 490  LEU B CA  1 
ATOM   3489 C C   . LEU B 1 191 ? -38.062 11.091 -5.656  1.00 12.12 ? 490  LEU B C   1 
ATOM   3490 O O   . LEU B 1 191 ? -38.281 11.935 -6.531  1.00 9.85  ? 490  LEU B O   1 
ATOM   3491 C CB  . LEU B 1 191 ? -38.461 8.742  -6.463  1.00 9.53  ? 490  LEU B CB  1 
ATOM   3492 C CG  . LEU B 1 191 ? -39.456 7.855  -7.204  1.00 8.58  ? 490  LEU B CG  1 
ATOM   3493 C CD1 . LEU B 1 191 ? -38.779 7.154  -8.378  1.00 7.82  ? 490  LEU B CD1 1 
ATOM   3494 C CD2 . LEU B 1 191 ? -40.091 6.819  -6.293  1.00 6.54  ? 490  LEU B CD2 1 
ATOM   3495 N N   . PRO B 1 192 ? -37.063 11.186 -4.790  1.00 11.78 ? 491  PRO B N   1 
ATOM   3496 C CA  . PRO B 1 192 ? -36.059 12.257 -4.915  1.00 10.91 ? 491  PRO B CA  1 
ATOM   3497 C C   . PRO B 1 192 ? -35.510 12.261 -6.326  1.00 11.58 ? 491  PRO B C   1 
ATOM   3498 O O   . PRO B 1 192 ? -35.368 11.188 -6.921  1.00 9.03  ? 491  PRO B O   1 
ATOM   3499 C CB  . PRO B 1 192 ? -34.990 11.826 -3.916  1.00 10.88 ? 491  PRO B CB  1 
ATOM   3500 C CG  . PRO B 1 192 ? -35.669 10.962 -2.916  1.00 10.09 ? 491  PRO B CG  1 
ATOM   3501 C CD  . PRO B 1 192 ? -36.789 10.285 -3.655  1.00 11.99 ? 491  PRO B CD  1 
ATOM   3502 N N   . TYR B 1 193 ? -35.233 13.431 -6.902  1.00 13.20 ? 492  TYR B N   1 
ATOM   3503 C CA  . TYR B 1 193 ? -34.858 13.446 -8.328  1.00 13.80 ? 492  TYR B CA  1 
ATOM   3504 C C   . TYR B 1 193 ? -33.882 14.548 -8.723  1.00 13.13 ? 492  TYR B C   1 
ATOM   3505 O O   . TYR B 1 193 ? -33.465 15.336 -7.878  1.00 7.64  ? 492  TYR B O   1 
ATOM   3506 C CB  . TYR B 1 193 ? -36.129 13.577 -9.181  1.00 15.12 ? 492  TYR B CB  1 
ATOM   3507 C CG  . TYR B 1 193 ? -36.930 14.815 -8.859  1.00 16.40 ? 492  TYR B CG  1 
ATOM   3508 C CD1 . TYR B 1 193 ? -37.895 14.789 -7.866  1.00 17.09 ? 492  TYR B CD1 1 
ATOM   3509 C CD2 . TYR B 1 193 ? -36.724 16.004 -9.548  1.00 17.31 ? 492  TYR B CD2 1 
ATOM   3510 C CE1 . TYR B 1 193 ? -38.644 15.915 -7.557  1.00 18.08 ? 492  TYR B CE1 1 
ATOM   3511 C CE2 . TYR B 1 193 ? -37.466 17.132 -9.245  1.00 17.84 ? 492  TYR B CE2 1 
ATOM   3512 C CZ  . TYR B 1 193 ? -38.420 17.082 -8.254  1.00 18.56 ? 492  TYR B CZ  1 
ATOM   3513 O OH  . TYR B 1 193 ? -39.157 18.206 -7.954  1.00 22.58 ? 492  TYR B OH  1 
ATOM   3514 N N   . GLY B 1 194 ? -33.548 14.562 -10.025 1.00 13.49 ? 493  GLY B N   1 
ATOM   3515 C CA  . GLY B 1 194 ? -32.634 15.504 -10.586 1.00 13.80 ? 493  GLY B CA  1 
ATOM   3516 C C   . GLY B 1 194 ? -32.604 15.654 -12.093 1.00 13.39 ? 493  GLY B C   1 
ATOM   3517 O O   . GLY B 1 194 ? -33.547 15.281 -12.773 1.00 14.00 ? 493  GLY B O   1 
ATOM   3518 N N   . PRO B 1 195 ? -31.555 16.184 -12.645 1.00 13.18 ? 494  PRO B N   1 
ATOM   3519 C CA  . PRO B 1 195 ? -31.441 16.623 -14.020 1.00 13.06 ? 494  PRO B CA  1 
ATOM   3520 C C   . PRO B 1 195 ? -32.155 15.841 -15.112 1.00 14.47 ? 494  PRO B C   1 
ATOM   3521 O O   . PRO B 1 195 ? -32.523 16.426 -16.143 1.00 14.22 ? 494  PRO B O   1 
ATOM   3522 C CB  . PRO B 1 195 ? -29.923 16.471 -14.294 1.00 12.92 ? 494  PRO B CB  1 
ATOM   3523 C CG  . PRO B 1 195 ? -29.275 16.687 -12.974 1.00 12.97 ? 494  PRO B CG  1 
ATOM   3524 C CD  . PRO B 1 195 ? -30.303 16.498 -11.913 1.00 12.86 ? 494  PRO B CD  1 
ATOM   3525 N N   . GLU B 1 196 ? -32.327 14.544 -14.923 1.00 14.05 ? 495  GLU B N   1 
ATOM   3526 C CA  . GLU B 1 196 ? -32.820 13.669 -15.985 1.00 13.04 ? 495  GLU B CA  1 
ATOM   3527 C C   . GLU B 1 196 ? -34.279 13.911 -16.299 1.00 11.83 ? 495  GLU B C   1 
ATOM   3528 O O   . GLU B 1 196 ? -34.817 13.462 -17.312 1.00 10.89 ? 495  GLU B O   1 
ATOM   3529 C CB  . GLU B 1 196 ? -32.602 12.215 -15.540 1.00 14.19 ? 495  GLU B CB  1 
ATOM   3530 C CG  . GLU B 1 196 ? -31.163 11.852 -15.240 1.00 14.34 ? 495  GLU B CG  1 
ATOM   3531 C CD  . GLU B 1 196 ? -30.646 12.286 -13.887 1.00 15.68 ? 495  GLU B CD  1 
ATOM   3532 O OE1 . GLU B 1 196 ? -29.453 12.670 -13.853 1.00 20.92 ? 495  GLU B OE1 1 
ATOM   3533 O OE2 . GLU B 1 196 ? -31.411 12.261 -12.894 1.00 12.39 ? 495  GLU B OE2 1 
ATOM   3534 N N   . VAL B 1 197 ? -34.954 14.631 -15.403 1.00 12.51 ? 496  VAL B N   1 
ATOM   3535 C CA  . VAL B 1 197 ? -36.385 14.883 -15.585 1.00 12.12 ? 496  VAL B CA  1 
ATOM   3536 C C   . VAL B 1 197 ? -36.661 15.764 -16.789 1.00 13.23 ? 496  VAL B C   1 
ATOM   3537 O O   . VAL B 1 197 ? -37.570 15.492 -17.574 1.00 14.32 ? 496  VAL B O   1 
ATOM   3538 C CB  . VAL B 1 197 ? -36.969 15.510 -14.304 1.00 8.86  ? 496  VAL B CB  1 
ATOM   3539 C CG1 . VAL B 1 197 ? -36.842 14.511 -13.166 1.00 4.91  ? 496  VAL B CG1 1 
ATOM   3540 C CG2 . VAL B 1 197 ? -36.275 16.809 -13.953 1.00 8.31  ? 496  VAL B CG2 1 
ATOM   3541 N N   . ASP B 1 198 ? -35.871 16.829 -16.943 1.00 13.43 ? 497  ASP B N   1 
ATOM   3542 C CA  . ASP B 1 198 ? -36.124 17.808 -17.986 1.00 13.00 ? 497  ASP B CA  1 
ATOM   3543 C C   . ASP B 1 198 ? -36.171 17.174 -19.371 1.00 9.18  ? 497  ASP B C   1 
ATOM   3544 O O   . ASP B 1 198 ? -36.853 17.706 -20.229 1.00 1.47  ? 497  ASP B O   1 
ATOM   3545 C CB  . ASP B 1 198 ? -35.037 18.888 -17.996 1.00 15.71 ? 497  ASP B CB  1 
ATOM   3546 C CG  . ASP B 1 198 ? -35.451 20.103 -17.190 1.00 16.52 ? 497  ASP B CG  1 
ATOM   3547 O OD1 . ASP B 1 198 ? -36.565 20.106 -16.627 1.00 18.40 ? 497  ASP B OD1 1 
ATOM   3548 O OD2 . ASP B 1 198 ? -34.627 21.044 -17.148 1.00 19.82 ? 497  ASP B OD2 1 
ATOM   3549 N N   . ILE B 1 199 ? -35.438 16.088 -19.541 1.00 8.82  ? 498  ILE B N   1 
ATOM   3550 C CA  . ILE B 1 199 ? -35.334 15.393 -20.813 1.00 7.23  ? 498  ILE B CA  1 
ATOM   3551 C C   . ILE B 1 199 ? -36.636 14.677 -21.144 1.00 6.21  ? 498  ILE B C   1 
ATOM   3552 O O   . ILE B 1 199 ? -37.071 14.626 -22.294 1.00 5.68  ? 498  ILE B O   1 
ATOM   3553 C CB  . ILE B 1 199 ? -34.165 14.388 -20.777 1.00 6.66  ? 498  ILE B CB  1 
ATOM   3554 C CG1 . ILE B 1 199 ? -32.826 15.053 -20.441 1.00 6.64  ? 498  ILE B CG1 1 
ATOM   3555 C CG2 . ILE B 1 199 ? -34.061 13.577 -22.060 1.00 0.99  ? 498  ILE B CG2 1 
ATOM   3556 C CD1 . ILE B 1 199 ? -32.107 15.624 -21.649 1.00 5.82  ? 498  ILE B CD1 1 
ATOM   3557 N N   . TRP B 1 200 ? -37.278 14.126 -20.110 1.00 7.02  ? 499  TRP B N   1 
ATOM   3558 C CA  . TRP B 1 200 ? -38.566 13.466 -20.316 1.00 8.60  ? 499  TRP B CA  1 
ATOM   3559 C C   . TRP B 1 200 ? -39.587 14.489 -20.813 1.00 7.37  ? 499  TRP B C   1 
ATOM   3560 O O   . TRP B 1 200 ? -40.326 14.219 -21.753 1.00 7.23  ? 499  TRP B O   1 
ATOM   3561 C CB  . TRP B 1 200 ? -39.032 12.766 -19.037 1.00 11.15 ? 499  TRP B CB  1 
ATOM   3562 C CG  . TRP B 1 200 ? -40.452 12.280 -19.093 1.00 12.42 ? 499  TRP B CG  1 
ATOM   3563 C CD1 . TRP B 1 200 ? -41.582 12.947 -18.718 1.00 12.46 ? 499  TRP B CD1 1 
ATOM   3564 C CD2 . TRP B 1 200 ? -40.897 11.000 -19.563 1.00 12.96 ? 499  TRP B CD2 1 
ATOM   3565 N NE1 . TRP B 1 200 ? -42.690 12.170 -18.923 1.00 12.69 ? 499  TRP B NE1 1 
ATOM   3566 C CE2 . TRP B 1 200 ? -42.296 10.968 -19.441 1.00 12.94 ? 499  TRP B CE2 1 
ATOM   3567 C CE3 . TRP B 1 200 ? -40.239 9.878  -20.075 1.00 13.35 ? 499  TRP B CE3 1 
ATOM   3568 C CZ2 . TRP B 1 200 ? -43.066 9.865  -19.809 1.00 13.61 ? 499  TRP B CZ2 1 
ATOM   3569 C CZ3 . TRP B 1 200 ? -41.005 8.787  -20.438 1.00 13.00 ? 499  TRP B CZ3 1 
ATOM   3570 C CH2 . TRP B 1 200 ? -42.391 8.784  -20.305 1.00 13.01 ? 499  TRP B CH2 1 
ATOM   3571 N N   . SER B 1 201 ? -39.634 15.632 -20.139 1.00 6.81  ? 500  SER B N   1 
ATOM   3572 C CA  . SER B 1 201 ? -40.655 16.643 -20.374 1.00 4.51  ? 500  SER B CA  1 
ATOM   3573 C C   . SER B 1 201 ? -40.459 17.276 -21.754 1.00 4.08  ? 500  SER B C   1 
ATOM   3574 O O   . SER B 1 201 ? -41.424 17.581 -22.463 1.00 4.44  ? 500  SER B O   1 
ATOM   3575 C CB  . SER B 1 201 ? -40.627 17.726 -19.299 1.00 3.61  ? 500  SER B CB  1 
ATOM   3576 O OG  . SER B 1 201 ? -40.378 17.191 -18.013 1.00 4.31  ? 500  SER B OG  1 
ATOM   3577 N N   . LEU B 1 202 ? -39.202 17.461 -22.104 1.00 3.17  ? 501  LEU B N   1 
ATOM   3578 C CA  . LEU B 1 202 ? -38.751 17.881 -23.413 1.00 1.79  ? 501  LEU B CA  1 
ATOM   3579 C C   . LEU B 1 202 ? -39.295 16.920 -24.447 1.00 4.44  ? 501  LEU B C   1 
ATOM   3580 O O   . LEU B 1 202 ? -39.747 17.287 -25.532 1.00 8.96  ? 501  LEU B O   1 
ATOM   3581 C CB  . LEU B 1 202 ? -37.231 17.905 -23.381 1.00 1.77  ? 501  LEU B CB  1 
ATOM   3582 C CG  . LEU B 1 202 ? -36.394 17.785 -24.640 1.00 2.41  ? 501  LEU B CG  1 
ATOM   3583 C CD1 . LEU B 1 202 ? -36.687 18.911 -25.617 1.00 2.97  ? 501  LEU B CD1 1 
ATOM   3584 C CD2 . LEU B 1 202 ? -34.920 17.769 -24.241 1.00 2.21  ? 501  LEU B CD2 1 
ATOM   3585 N N   . GLY B 1 203 ? -39.278 15.623 -24.091 1.00 5.44  ? 502  GLY B N   1 
ATOM   3586 C CA  . GLY B 1 203 ? -39.808 14.610 -24.998 1.00 4.39  ? 502  GLY B CA  1 
ATOM   3587 C C   . GLY B 1 203 ? -41.280 14.803 -25.273 1.00 2.32  ? 502  GLY B C   1 
ATOM   3588 O O   . GLY B 1 203 ? -41.755 14.605 -26.400 1.00 5.53  ? 502  GLY B O   1 
ATOM   3589 N N   . ILE B 1 204 ? -42.039 15.198 -24.255 1.00 2.62  ? 503  ILE B N   1 
ATOM   3590 C CA  . ILE B 1 204 ? -43.474 15.472 -24.478 1.00 2.20  ? 503  ILE B CA  1 
ATOM   3591 C C   . ILE B 1 204 ? -43.646 16.573 -25.510 1.00 3.51  ? 503  ILE B C   1 
ATOM   3592 O O   . ILE B 1 204 ? -44.420 16.410 -26.451 1.00 5.32  ? 503  ILE B O   1 
ATOM   3593 C CB  . ILE B 1 204 ? -44.134 15.794 -23.130 1.00 2.76  ? 503  ILE B CB  1 
ATOM   3594 C CG1 . ILE B 1 204 ? -44.001 14.635 -22.127 1.00 2.10  ? 503  ILE B CG1 1 
ATOM   3595 C CG2 . ILE B 1 204 ? -45.584 16.200 -23.252 1.00 2.12  ? 503  ILE B CG2 1 
ATOM   3596 C CD1 . ILE B 1 204 ? -44.525 13.328 -22.676 1.00 2.02  ? 503  ILE B CD1 1 
ATOM   3597 N N   . MET B 1 205 ? -42.904 17.664 -25.354 1.00 3.87  ? 504  MET B N   1 
ATOM   3598 C CA  . MET B 1 205 ? -43.027 18.810 -26.251 1.00 4.79  ? 504  MET B CA  1 
ATOM   3599 C C   . MET B 1 205 ? -42.880 18.431 -27.718 1.00 3.65  ? 504  MET B C   1 
ATOM   3600 O O   . MET B 1 205 ? -43.603 18.934 -28.582 1.00 2.91  ? 504  MET B O   1 
ATOM   3601 C CB  . MET B 1 205 ? -41.997 19.884 -25.876 1.00 7.35  ? 504  MET B CB  1 
ATOM   3602 C CG  . MET B 1 205 ? -42.527 21.303 -25.794 1.00 8.50  ? 504  MET B CG  1 
ATOM   3603 S SD  . MET B 1 205 ? -41.286 22.450 -25.125 1.00 6.82  ? 504  MET B SD  1 
ATOM   3604 C CE  . MET B 1 205 ? -40.281 22.650 -26.591 1.00 4.73  ? 504  MET B CE  1 
ATOM   3605 N N   . VAL B 1 206 ? -41.938 17.536 -28.021 1.00 3.87  ? 505  VAL B N   1 
ATOM   3606 C CA  . VAL B 1 206 ? -41.714 17.126 -29.401 1.00 4.38  ? 505  VAL B CA  1 
ATOM   3607 C C   . VAL B 1 206 ? -42.988 16.511 -29.995 1.00 4.46  ? 505  VAL B C   1 
ATOM   3608 O O   . VAL B 1 206 ? -43.317 16.784 -31.147 1.00 6.10  ? 505  VAL B O   1 
ATOM   3609 C CB  . VAL B 1 206 ? -40.581 16.113 -29.614 1.00 5.98  ? 505  VAL B CB  1 
ATOM   3610 C CG1 . VAL B 1 206 ? -40.313 16.036 -31.123 1.00 10.64 ? 505  VAL B CG1 1 
ATOM   3611 C CG2 . VAL B 1 206 ? -39.309 16.462 -28.879 1.00 10.34 ? 505  VAL B CG2 1 
ATOM   3612 N N   . ILE B 1 207 ? -43.679 15.711 -29.197 1.00 4.99  ? 506  ILE B N   1 
ATOM   3613 C CA  . ILE B 1 207 ? -44.981 15.170 -29.595 1.00 5.92  ? 506  ILE B CA  1 
ATOM   3614 C C   . ILE B 1 207 ? -45.933 16.328 -29.849 1.00 5.30  ? 506  ILE B C   1 
ATOM   3615 O O   . ILE B 1 207 ? -46.672 16.356 -30.828 1.00 2.04  ? 506  ILE B O   1 
ATOM   3616 C CB  . ILE B 1 207 ? -45.499 14.191 -28.525 1.00 8.14  ? 506  ILE B CB  1 
ATOM   3617 C CG1 . ILE B 1 207 ? -44.626 12.919 -28.459 1.00 9.97  ? 506  ILE B CG1 1 
ATOM   3618 C CG2 . ILE B 1 207 ? -46.967 13.821 -28.670 1.00 4.23  ? 506  ILE B CG2 1 
ATOM   3619 C CD1 . ILE B 1 207 ? -45.410 11.622 -28.550 1.00 14.47 ? 506  ILE B CD1 1 
ATOM   3620 N N   . GLU B 1 208 ? -45.888 17.324 -28.962 1.00 6.20  ? 507  GLU B N   1 
ATOM   3621 C CA  . GLU B 1 208 ? -46.652 18.542 -29.146 1.00 6.56  ? 507  GLU B CA  1 
ATOM   3622 C C   . GLU B 1 208 ? -46.415 19.127 -30.539 1.00 6.98  ? 507  GLU B C   1 
ATOM   3623 O O   . GLU B 1 208 ? -47.390 19.504 -31.173 1.00 4.79  ? 507  GLU B O   1 
ATOM   3624 C CB  . GLU B 1 208 ? -46.280 19.621 -28.129 1.00 6.01  ? 507  GLU B CB  1 
ATOM   3625 C CG  . GLU B 1 208 ? -47.377 19.959 -27.139 1.00 5.15  ? 507  GLU B CG  1 
ATOM   3626 C CD  . GLU B 1 208 ? -47.023 21.184 -26.305 1.00 5.27  ? 507  GLU B CD  1 
ATOM   3627 O OE1 . GLU B 1 208 ? -46.019 21.121 -25.562 1.00 3.43  ? 507  GLU B OE1 1 
ATOM   3628 O OE2 . GLU B 1 208 ? -47.767 22.188 -26.398 1.00 3.96  ? 507  GLU B OE2 1 
ATOM   3629 N N   . MET B 1 209 ? -45.159 19.202 -30.932 1.00 8.78  ? 508  MET B N   1 
ATOM   3630 C CA  . MET B 1 209 ? -44.719 19.804 -32.176 1.00 7.36  ? 508  MET B CA  1 
ATOM   3631 C C   . MET B 1 209 ? -45.195 18.983 -33.377 1.00 6.59  ? 508  MET B C   1 
ATOM   3632 O O   . MET B 1 209 ? -45.134 19.451 -34.512 1.00 4.21  ? 508  MET B O   1 
ATOM   3633 C CB  . MET B 1 209 ? -43.201 19.959 -32.191 1.00 8.36  ? 508  MET B CB  1 
ATOM   3634 C CG  . MET B 1 209 ? -42.577 20.985 -31.271 1.00 8.63  ? 508  MET B CG  1 
ATOM   3635 S SD  . MET B 1 209 ? -41.106 21.825 -31.895 1.00 2.65  ? 508  MET B SD  1 
ATOM   3636 C CE  . MET B 1 209 ? -39.849 20.566 -31.827 1.00 4.82  ? 508  MET B CE  1 
ATOM   3637 N N   . VAL B 1 210 ? -45.664 17.778 -33.105 1.00 7.42  ? 509  VAL B N   1 
ATOM   3638 C CA  . VAL B 1 210 ? -46.090 16.826 -34.113 1.00 6.35  ? 509  VAL B CA  1 
ATOM   3639 C C   . VAL B 1 210 ? -47.593 16.560 -34.065 1.00 4.97  ? 509  VAL B C   1 
ATOM   3640 O O   . VAL B 1 210 ? -48.233 16.528 -35.120 1.00 2.76  ? 509  VAL B O   1 
ATOM   3641 C CB  . VAL B 1 210 ? -45.348 15.484 -33.930 1.00 7.44  ? 509  VAL B CB  1 
ATOM   3642 C CG1 . VAL B 1 210 ? -46.064 14.347 -34.636 1.00 10.96 ? 509  VAL B CG1 1 
ATOM   3643 C CG2 . VAL B 1 210 ? -43.908 15.624 -34.417 1.00 9.88  ? 509  VAL B CG2 1 
ATOM   3644 N N   . ASP B 1 211 ? -48.128 16.348 -32.882 1.00 5.24  ? 510  ASP B N   1 
ATOM   3645 C CA  . ASP B 1 211 ? -49.498 15.966 -32.643 1.00 5.90  ? 510  ASP B CA  1 
ATOM   3646 C C   . ASP B 1 211 ? -50.381 17.116 -32.193 1.00 9.03  ? 510  ASP B C   1 
ATOM   3647 O O   . ASP B 1 211 ? -51.570 16.939 -31.880 1.00 14.23 ? 510  ASP B O   1 
ATOM   3648 C CB  . ASP B 1 211 ? -49.534 14.905 -31.531 1.00 5.00  ? 510  ASP B CB  1 
ATOM   3649 C CG  . ASP B 1 211 ? -49.322 13.495 -32.027 1.00 4.85  ? 510  ASP B CG  1 
ATOM   3650 O OD1 . ASP B 1 211 ? -48.895 12.652 -31.208 1.00 3.79  ? 510  ASP B OD1 1 
ATOM   3651 O OD2 . ASP B 1 211 ? -49.581 13.207 -33.218 1.00 5.61  ? 510  ASP B OD2 1 
ATOM   3652 N N   . GLY B 1 212 ? -49.813 18.313 -32.106 1.00 9.40  ? 511  GLY B N   1 
ATOM   3653 C CA  . GLY B 1 212 ? -50.559 19.514 -31.775 1.00 9.43  ? 511  GLY B CA  1 
ATOM   3654 C C   . GLY B 1 212 ? -50.967 19.618 -30.317 1.00 10.68 ? 511  GLY B C   1 
ATOM   3655 O O   . GLY B 1 212 ? -51.393 20.690 -29.880 1.00 16.42 ? 511  GLY B O   1 
ATOM   3656 N N   . GLU B 1 213 ? -50.852 18.522 -29.590 1.00 9.85  ? 512  GLU B N   1 
ATOM   3657 C CA  . GLU B 1 213 ? -51.242 18.407 -28.206 1.00 9.61  ? 512  GLU B CA  1 
ATOM   3658 C C   . GLU B 1 213 ? -50.447 17.304 -27.510 1.00 8.99  ? 512  GLU B C   1 
ATOM   3659 O O   . GLU B 1 213 ? -49.905 16.390 -28.139 1.00 8.20  ? 512  GLU B O   1 
ATOM   3660 C CB  . GLU B 1 213 ? -52.738 18.084 -28.065 1.00 12.19 ? 512  GLU B CB  1 
ATOM   3661 C CG  . GLU B 1 213 ? -53.622 19.317 -28.117 1.00 15.02 ? 512  GLU B CG  1 
ATOM   3662 C CD  . GLU B 1 213 ? -55.083 19.018 -28.400 1.00 16.95 ? 512  GLU B CD  1 
ATOM   3663 O OE1 . GLU B 1 213 ? -55.913 19.922 -28.144 1.00 17.53 ? 512  GLU B OE1 1 
ATOM   3664 O OE2 . GLU B 1 213 ? -55.390 17.903 -28.880 1.00 19.05 ? 512  GLU B OE2 1 
ATOM   3665 N N   . PRO B 1 214 ? -50.381 17.388 -26.184 1.00 8.31  ? 513  PRO B N   1 
ATOM   3666 C CA  . PRO B 1 214 ? -49.729 16.338 -25.394 1.00 7.29  ? 513  PRO B CA  1 
ATOM   3667 C C   . PRO B 1 214 ? -50.653 15.145 -25.214 1.00 3.76  ? 513  PRO B C   1 
ATOM   3668 O O   . PRO B 1 214 ? -51.841 15.234 -25.526 1.00 2.05  ? 513  PRO B O   1 
ATOM   3669 C CB  . PRO B 1 214 ? -49.472 17.065 -24.069 1.00 8.34  ? 513  PRO B CB  1 
ATOM   3670 C CG  . PRO B 1 214 ? -50.573 18.070 -23.952 1.00 8.30  ? 513  PRO B CG  1 
ATOM   3671 C CD  . PRO B 1 214 ? -50.910 18.487 -25.352 1.00 8.75  ? 513  PRO B CD  1 
ATOM   3672 N N   . PRO B 1 215 ? -50.136 14.026 -24.719 1.00 2.24  ? 514  PRO B N   1 
ATOM   3673 C CA  . PRO B 1 215 ? -51.022 12.881 -24.433 1.00 2.70  ? 514  PRO B CA  1 
ATOM   3674 C C   . PRO B 1 215 ? -51.865 13.092 -23.175 1.00 2.21  ? 514  PRO B C   1 
ATOM   3675 O O   . PRO B 1 215 ? -51.366 13.631 -22.191 1.00 2.42  ? 514  PRO B O   1 
ATOM   3676 C CB  . PRO B 1 215 ? -50.053 11.715 -24.235 1.00 2.95  ? 514  PRO B CB  1 
ATOM   3677 C CG  . PRO B 1 215 ? -48.691 12.226 -24.585 1.00 2.98  ? 514  PRO B CG  1 
ATOM   3678 C CD  . PRO B 1 215 ? -48.738 13.711 -24.403 1.00 2.93  ? 514  PRO B CD  1 
ATOM   3679 N N   . TYR B 1 216 ? -53.106 12.645 -23.225 1.00 3.43  ? 515  TYR B N   1 
ATOM   3680 C CA  . TYR B 1 216 ? -54.012 12.640 -22.086 1.00 6.36  ? 515  TYR B CA  1 
ATOM   3681 C C   . TYR B 1 216 ? -54.459 14.068 -21.741 1.00 7.85  ? 515  TYR B C   1 
ATOM   3682 O O   . TYR B 1 216 ? -54.675 14.430 -20.583 1.00 7.16  ? 515  TYR B O   1 
ATOM   3683 C CB  . TYR B 1 216 ? -53.407 11.978 -20.849 1.00 7.00  ? 515  TYR B CB  1 
ATOM   3684 C CG  . TYR B 1 216 ? -52.723 10.664 -21.114 1.00 7.94  ? 515  TYR B CG  1 
ATOM   3685 C CD1 . TYR B 1 216 ? -51.412 10.422 -20.744 1.00 7.55  ? 515  TYR B CD1 1 
ATOM   3686 C CD2 . TYR B 1 216 ? -53.405 9.646  -21.765 1.00 10.04 ? 515  TYR B CD2 1 
ATOM   3687 C CE1 . TYR B 1 216 ? -50.811 9.208  -21.005 1.00 7.65  ? 515  TYR B CE1 1 
ATOM   3688 C CE2 . TYR B 1 216 ? -52.819 8.421  -22.033 1.00 8.52  ? 515  TYR B CE2 1 
ATOM   3689 C CZ  . TYR B 1 216 ? -51.517 8.214  -21.648 1.00 7.28  ? 515  TYR B CZ  1 
ATOM   3690 O OH  . TYR B 1 216 ? -50.939 6.998  -21.915 1.00 5.47  ? 515  TYR B OH  1 
ATOM   3691 N N   . PHE B 1 217 ? -54.602 14.877 -22.789 1.00 8.65  ? 516  PHE B N   1 
ATOM   3692 C CA  . PHE B 1 217 ? -54.899 16.292 -22.622 1.00 10.25 ? 516  PHE B CA  1 
ATOM   3693 C C   . PHE B 1 217 ? -56.388 16.574 -22.491 1.00 10.74 ? 516  PHE B C   1 
ATOM   3694 O O   . PHE B 1 217 ? -56.732 17.631 -21.962 1.00 11.26 ? 516  PHE B O   1 
ATOM   3695 C CB  . PHE B 1 217 ? -54.315 17.081 -23.802 1.00 10.27 ? 516  PHE B CB  1 
ATOM   3696 C CG  . PHE B 1 217 ? -54.184 18.572 -23.592 1.00 8.24  ? 516  PHE B CG  1 
ATOM   3697 C CD1 . PHE B 1 217 ? -53.910 19.134 -22.361 1.00 7.11  ? 516  PHE B CD1 1 
ATOM   3698 C CD2 . PHE B 1 217 ? -54.352 19.408 -24.686 1.00 8.21  ? 516  PHE B CD2 1 
ATOM   3699 C CE1 . PHE B 1 217 ? -53.805 20.503 -22.217 1.00 7.11  ? 516  PHE B CE1 1 
ATOM   3700 C CE2 . PHE B 1 217 ? -54.241 20.777 -24.564 1.00 7.53  ? 516  PHE B CE2 1 
ATOM   3701 C CZ  . PHE B 1 217 ? -53.962 21.324 -23.325 1.00 7.53  ? 516  PHE B CZ  1 
ATOM   3702 N N   . ASN B 1 218 ? -57.223 15.669 -22.964 1.00 11.52 ? 517  ASN B N   1 
ATOM   3703 C CA  . ASN B 1 218 ? -58.671 15.825 -22.881 1.00 11.75 ? 517  ASN B CA  1 
ATOM   3704 C C   . ASN B 1 218 ? -59.222 15.265 -21.578 1.00 10.61 ? 517  ASN B C   1 
ATOM   3705 O O   . ASN B 1 218 ? -60.419 15.356 -21.314 1.00 8.91  ? 517  ASN B O   1 
ATOM   3706 C CB  . ASN B 1 218 ? -59.306 15.131 -24.086 1.00 11.58 ? 517  ASN B CB  1 
ATOM   3707 C CG  . ASN B 1 218 ? -58.222 14.408 -24.868 1.00 11.07 ? 517  ASN B CG  1 
ATOM   3708 O OD1 . ASN B 1 218 ? -57.768 13.343 -24.449 1.00 11.96 ? 517  ASN B OD1 1 
ATOM   3709 N ND2 . ASN B 1 218 ? -57.828 14.995 -25.993 1.00 8.48  ? 517  ASN B ND2 1 
ATOM   3710 N N   . GLU B 1 219 ? -58.342 14.693 -20.766 1.00 10.41 ? 518  GLU B N   1 
ATOM   3711 C CA  . GLU B 1 219 ? -58.684 14.273 -19.414 1.00 9.19  ? 518  GLU B CA  1 
ATOM   3712 C C   . GLU B 1 219 ? -58.201 15.324 -18.413 1.00 8.88  ? 518  GLU B C   1 
ATOM   3713 O O   . GLU B 1 219 ? -57.147 15.913 -18.660 1.00 9.56  ? 518  GLU B O   1 
ATOM   3714 C CB  . GLU B 1 219 ? -58.075 12.928 -19.047 1.00 9.22  ? 518  GLU B CB  1 
ATOM   3715 C CG  . GLU B 1 219 ? -58.020 11.928 -20.190 1.00 10.13 ? 518  GLU B CG  1 
ATOM   3716 C CD  . GLU B 1 219 ? -59.257 11.051 -20.184 1.00 9.53  ? 518  GLU B CD  1 
ATOM   3717 O OE1 . GLU B 1 219 ? -59.544 10.478 -21.253 1.00 6.11  ? 518  GLU B OE1 1 
ATOM   3718 O OE2 . GLU B 1 219 ? -59.907 10.949 -19.121 1.00 10.70 ? 518  GLU B OE2 1 
ATOM   3719 N N   . PRO B 1 220 ? -58.940 15.544 -17.341 1.00 8.55  ? 519  PRO B N   1 
ATOM   3720 C CA  . PRO B 1 220 ? -58.517 16.474 -16.286 1.00 7.54  ? 519  PRO B CA  1 
ATOM   3721 C C   . PRO B 1 220 ? -57.152 16.144 -15.688 1.00 6.89  ? 519  PRO B C   1 
ATOM   3722 O O   . PRO B 1 220 ? -56.690 15.014 -15.791 1.00 7.00  ? 519  PRO B O   1 
ATOM   3723 C CB  . PRO B 1 220 ? -59.595 16.322 -15.199 1.00 7.08  ? 519  PRO B CB  1 
ATOM   3724 C CG  . PRO B 1 220 ? -60.796 16.010 -16.018 1.00 6.61  ? 519  PRO B CG  1 
ATOM   3725 C CD  . PRO B 1 220 ? -60.269 14.985 -16.996 1.00 7.86  ? 519  PRO B CD  1 
ATOM   3726 N N   . PRO B 1 221 ? -56.521 17.160 -15.111 1.00 6.24  ? 520  PRO B N   1 
ATOM   3727 C CA  . PRO B 1 221 ? -55.162 17.100 -14.611 1.00 5.93  ? 520  PRO B CA  1 
ATOM   3728 C C   . PRO B 1 221 ? -54.767 16.005 -13.639 1.00 5.94  ? 520  PRO B C   1 
ATOM   3729 O O   . PRO B 1 221 ? -53.644 15.477 -13.688 1.00 2.54  ? 520  PRO B O   1 
ATOM   3730 C CB  . PRO B 1 221 ? -54.997 18.439 -13.842 1.00 5.49  ? 520  PRO B CB  1 
ATOM   3731 C CG  . PRO B 1 221 ? -56.230 19.242 -14.043 1.00 4.86  ? 520  PRO B CG  1 
ATOM   3732 C CD  . PRO B 1 221 ? -57.130 18.499 -14.961 1.00 5.46  ? 520  PRO B CD  1 
ATOM   3733 N N   . LEU B 1 222 ? -55.636 15.663 -12.684 1.00 7.63  ? 521  LEU B N   1 
ATOM   3734 C CA  . LEU B 1 222 ? -55.164 14.722 -11.643 1.00 10.09 ? 521  LEU B CA  1 
ATOM   3735 C C   . LEU B 1 222 ? -55.279 13.299 -12.184 1.00 9.41  ? 521  LEU B C   1 
ATOM   3736 O O   . LEU B 1 222 ? -54.338 12.510 -12.078 1.00 6.14  ? 521  LEU B O   1 
ATOM   3737 C CB  . LEU B 1 222 ? -55.829 14.860 -10.285 1.00 12.59 ? 521  LEU B CB  1 
ATOM   3738 C CG  . LEU B 1 222 ? -55.565 16.202 -9.577  1.00 13.82 ? 521  LEU B CG  1 
ATOM   3739 C CD1 . LEU B 1 222 ? -56.934 16.777 -9.240  1.00 16.38 ? 521  LEU B CD1 1 
ATOM   3740 C CD2 . LEU B 1 222 ? -54.689 16.113 -8.343  1.00 16.78 ? 521  LEU B CD2 1 
ATOM   3741 N N   . LYS B 1 223 ? -56.415 12.992 -12.792 1.00 10.75 ? 522  LYS B N   1 
ATOM   3742 C CA  . LYS B 1 223 ? -56.596 11.747 -13.524 1.00 11.08 ? 522  LYS B CA  1 
ATOM   3743 C C   . LYS B 1 223 ? -55.433 11.519 -14.495 1.00 10.31 ? 522  LYS B C   1 
ATOM   3744 O O   . LYS B 1 223 ? -54.984 10.386 -14.675 1.00 8.03  ? 522  LYS B O   1 
ATOM   3745 C CB  . LYS B 1 223 ? -57.925 11.774 -14.276 1.00 12.31 ? 522  LYS B CB  1 
ATOM   3746 C CG  . LYS B 1 223 ? -58.206 10.522 -15.088 1.00 14.99 ? 522  LYS B CG  1 
ATOM   3747 C CD  . LYS B 1 223 ? -59.699 10.219 -15.147 1.00 16.63 ? 522  LYS B CD  1 
ATOM   3748 C CE  . LYS B 1 223 ? -60.189 9.864  -16.536 1.00 17.40 ? 522  LYS B CE  1 
ATOM   3749 N NZ  . LYS B 1 223 ? -61.468 10.545 -16.914 1.00 20.24 ? 522  LYS B NZ  1 
ATOM   3750 N N   . ALA B 1 224 ? -54.962 12.604 -15.082 1.00 8.92  ? 523  ALA B N   1 
ATOM   3751 C CA  . ALA B 1 224 ? -53.907 12.621 -16.062 1.00 7.83  ? 523  ALA B CA  1 
ATOM   3752 C C   . ALA B 1 224 ? -52.569 12.217 -15.472 1.00 6.59  ? 523  ALA B C   1 
ATOM   3753 O O   . ALA B 1 224 ? -51.855 11.401 -16.056 1.00 2.53  ? 523  ALA B O   1 
ATOM   3754 C CB  . ALA B 1 224 ? -53.785 14.014 -16.684 1.00 11.05 ? 523  ALA B CB  1 
ATOM   3755 N N   . MET B 1 225 ? -52.223 12.791 -14.325 1.00 7.52  ? 524  MET B N   1 
ATOM   3756 C CA  . MET B 1 225 ? -50.958 12.457 -13.668 1.00 9.19  ? 524  MET B CA  1 
ATOM   3757 C C   . MET B 1 225 ? -50.865 10.942 -13.415 1.00 9.58  ? 524  MET B C   1 
ATOM   3758 O O   . MET B 1 225 ? -49.812 10.340 -13.665 1.00 9.85  ? 524  MET B O   1 
ATOM   3759 C CB  . MET B 1 225 ? -50.795 13.261 -12.379 1.00 9.78  ? 524  MET B CB  1 
ATOM   3760 C CG  . MET B 1 225 ? -50.663 14.755 -12.577 1.00 10.39 ? 524  MET B CG  1 
ATOM   3761 S SD  . MET B 1 225 ? -50.819 15.729 -11.071 1.00 12.82 ? 524  MET B SD  1 
ATOM   3762 C CE  . MET B 1 225 ? -49.597 14.921 -10.033 1.00 17.50 ? 524  MET B CE  1 
ATOM   3763 N N   . LYS B 1 226 ? -51.953 10.363 -12.958 1.00 7.29  ? 525  LYS B N   1 
ATOM   3764 C CA  . LYS B 1 226 ? -52.124 8.975  -12.635 1.00 6.80  ? 525  LYS B CA  1 
ATOM   3765 C C   . LYS B 1 226 ? -51.884 8.041  -13.822 1.00 5.99  ? 525  LYS B C   1 
ATOM   3766 O O   . LYS B 1 226 ? -51.333 6.946  -13.676 1.00 4.78  ? 525  LYS B O   1 
ATOM   3767 C CB  . LYS B 1 226 ? -53.563 8.694  -12.142 1.00 7.34  ? 525  LYS B CB  1 
ATOM   3768 C CG  . LYS B 1 226 ? -53.619 7.869  -10.867 1.00 2.77  ? 525  LYS B CG  1 
ATOM   3769 N N   . MET B 1 227 ? -52.316 8.481  -14.991 1.00 5.57  ? 526  MET B N   1 
ATOM   3770 C CA  . MET B 1 227 ? -52.140 7.758  -16.234 1.00 7.17  ? 526  MET B CA  1 
ATOM   3771 C C   . MET B 1 227 ? -50.671 7.626  -16.602 1.00 9.46  ? 526  MET B C   1 
ATOM   3772 O O   . MET B 1 227 ? -50.212 6.588  -17.086 1.00 15.83 ? 526  MET B O   1 
ATOM   3773 C CB  . MET B 1 227 ? -52.906 8.463  -17.373 1.00 6.21  ? 526  MET B CB  1 
ATOM   3774 C CG  . MET B 1 227 ? -54.384 8.138  -17.357 1.00 7.57  ? 526  MET B CG  1 
ATOM   3775 S SD  . MET B 1 227 ? -55.517 9.118  -18.336 1.00 9.55  ? 526  MET B SD  1 
ATOM   3776 C CE  . MET B 1 227 ? -55.618 8.144  -19.839 1.00 4.06  ? 526  MET B CE  1 
ATOM   3777 N N   . ILE B 1 228 ? -49.904 8.702  -16.381 1.00 8.57  ? 527  ILE B N   1 
ATOM   3778 C CA  . ILE B 1 228 ? -48.497 8.678  -16.791 1.00 8.01  ? 527  ILE B CA  1 
ATOM   3779 C C   . ILE B 1 228 ? -47.748 7.663  -15.929 1.00 7.22  ? 527  ILE B C   1 
ATOM   3780 O O   . ILE B 1 228 ? -47.035 6.836  -16.479 1.00 8.85  ? 527  ILE B O   1 
ATOM   3781 C CB  . ILE B 1 228 ? -47.791 10.043 -16.668 1.00 6.34  ? 527  ILE B CB  1 
ATOM   3782 C CG1 . ILE B 1 228 ? -48.245 11.062 -17.715 1.00 4.39  ? 527  ILE B CG1 1 
ATOM   3783 C CG2 . ILE B 1 228 ? -46.277 9.910  -16.657 1.00 2.10  ? 527  ILE B CG2 1 
ATOM   3784 C CD1 . ILE B 1 228 ? -47.644 10.877 -19.086 1.00 2.51  ? 527  ILE B CD1 1 
ATOM   3785 N N   . ARG B 1 229 ? -47.908 7.783  -14.627 1.00 6.73  ? 528  ARG B N   1 
ATOM   3786 C CA  . ARG B 1 229 ? -47.105 7.085  -13.645 1.00 7.58  ? 528  ARG B CA  1 
ATOM   3787 C C   . ARG B 1 229 ? -47.406 5.606  -13.515 1.00 8.97  ? 528  ARG B C   1 
ATOM   3788 O O   . ARG B 1 229 ? -46.682 4.830  -12.876 1.00 6.83  ? 528  ARG B O   1 
ATOM   3789 C CB  . ARG B 1 229 ? -47.327 7.781  -12.298 1.00 7.47  ? 528  ARG B CB  1 
ATOM   3790 C CG  . ARG B 1 229 ? -46.295 7.488  -11.234 1.00 7.40  ? 528  ARG B CG  1 
ATOM   3791 C CD  . ARG B 1 229 ? -46.735 6.458  -10.221 1.00 7.39  ? 528  ARG B CD  1 
ATOM   3792 N NE  . ARG B 1 229 ? -47.848 6.811  -9.376  1.00 6.93  ? 528  ARG B NE  1 
ATOM   3793 C CZ  . ARG B 1 229 ? -49.095 6.369  -9.406  1.00 8.02  ? 528  ARG B CZ  1 
ATOM   3794 N NH1 . ARG B 1 229 ? -49.531 5.478  -10.291 1.00 10.95 ? 528  ARG B NH1 1 
ATOM   3795 N NH2 . ARG B 1 229 ? -49.968 6.837  -8.516  1.00 10.31 ? 528  ARG B NH2 1 
ATOM   3796 N N   . ASP B 1 230 ? -48.513 5.160  -14.131 1.00 10.62 ? 529  ASP B N   1 
ATOM   3797 C CA  . ASP B 1 230 ? -48.767 3.716  -14.136 1.00 12.10 ? 529  ASP B CA  1 
ATOM   3798 C C   . ASP B 1 230 ? -49.058 3.201  -15.543 1.00 12.26 ? 529  ASP B C   1 
ATOM   3799 O O   . ASP B 1 230 ? -50.059 2.513  -15.739 1.00 13.40 ? 529  ASP B O   1 
ATOM   3800 C CB  . ASP B 1 230 ? -49.866 3.340  -13.158 1.00 13.87 ? 529  ASP B CB  1 
ATOM   3801 C CG  . ASP B 1 230 ? -51.091 4.211  -13.173 1.00 15.11 ? 529  ASP B CG  1 
ATOM   3802 O OD1 . ASP B 1 230 ? -51.331 4.920  -12.179 1.00 15.53 ? 529  ASP B OD1 1 
ATOM   3803 O OD2 . ASP B 1 230 ? -51.824 4.184  -14.187 1.00 18.01 ? 529  ASP B OD2 1 
ATOM   3804 N N   . ASN B 1 231 ? -48.191 3.517  -16.481 1.00 13.00 ? 530  ASN B N   1 
ATOM   3805 C CA  . ASN B 1 231 ? -48.129 2.881  -17.783 1.00 14.24 ? 530  ASN B CA  1 
ATOM   3806 C C   . ASN B 1 231 ? -46.694 3.046  -18.319 1.00 14.46 ? 530  ASN B C   1 
ATOM   3807 O O   . ASN B 1 231 ? -45.867 3.642  -17.632 1.00 11.84 ? 530  ASN B O   1 
ATOM   3808 C CB  . ASN B 1 231 ? -49.126 3.418  -18.801 1.00 15.47 ? 530  ASN B CB  1 
ATOM   3809 C CG  . ASN B 1 231 ? -50.581 3.192  -18.462 1.00 17.15 ? 530  ASN B CG  1 
ATOM   3810 O OD1 . ASN B 1 231 ? -51.188 2.177  -18.809 1.00 20.98 ? 530  ASN B OD1 1 
ATOM   3811 N ND2 . ASN B 1 231 ? -51.155 4.172  -17.768 1.00 16.75 ? 530  ASN B ND2 1 
ATOM   3812 N N   . LEU B 1 232 ? -46.448 2.527  -19.502 1.00 14.93 ? 531  LEU B N   1 
ATOM   3813 C CA  . LEU B 1 232 ? -45.198 2.689  -20.222 1.00 15.54 ? 531  LEU B CA  1 
ATOM   3814 C C   . LEU B 1 232 ? -45.110 4.031  -20.930 1.00 15.43 ? 531  LEU B C   1 
ATOM   3815 O O   . LEU B 1 232 ? -46.113 4.744  -21.022 1.00 16.97 ? 531  LEU B O   1 
ATOM   3816 C CB  . LEU B 1 232 ? -45.071 1.518  -21.220 1.00 16.73 ? 531  LEU B CB  1 
ATOM   3817 C CG  . LEU B 1 232 ? -44.477 0.244  -20.598 1.00 17.77 ? 531  LEU B CG  1 
ATOM   3818 C CD1 . LEU B 1 232 ? -44.683 -0.943 -21.524 1.00 15.67 ? 531  LEU B CD1 1 
ATOM   3819 C CD2 . LEU B 1 232 ? -43.005 0.467  -20.264 1.00 19.15 ? 531  LEU B CD2 1 
ATOM   3820 N N   . PRO B 1 233 ? -43.927 4.396  -21.407 1.00 15.88 ? 532  PRO B N   1 
ATOM   3821 C CA  . PRO B 1 233 ? -43.754 5.629  -22.177 1.00 15.94 ? 532  PRO B CA  1 
ATOM   3822 C C   . PRO B 1 233 ? -44.826 5.865  -23.236 1.00 16.48 ? 532  PRO B C   1 
ATOM   3823 O O   . PRO B 1 233 ? -45.251 4.933  -23.908 1.00 18.47 ? 532  PRO B O   1 
ATOM   3824 C CB  . PRO B 1 233 ? -42.408 5.416  -22.877 1.00 15.91 ? 532  PRO B CB  1 
ATOM   3825 C CG  . PRO B 1 233 ? -41.626 4.568  -21.936 1.00 14.57 ? 532  PRO B CG  1 
ATOM   3826 C CD  . PRO B 1 233 ? -42.626 3.718  -21.219 1.00 15.61 ? 532  PRO B CD  1 
ATOM   3827 N N   . PRO B 1 234 ? -45.253 7.119  -23.343 1.00 16.60 ? 533  PRO B N   1 
ATOM   3828 C CA  . PRO B 1 234 ? -46.360 7.504  -24.207 1.00 17.30 ? 533  PRO B CA  1 
ATOM   3829 C C   . PRO B 1 234 ? -45.990 7.558  -25.691 1.00 18.35 ? 533  PRO B C   1 
ATOM   3830 O O   . PRO B 1 234 ? -44.836 7.815  -26.022 1.00 15.38 ? 533  PRO B O   1 
ATOM   3831 C CB  . PRO B 1 234 ? -46.725 8.903  -23.700 1.00 16.86 ? 533  PRO B CB  1 
ATOM   3832 C CG  . PRO B 1 234 ? -45.445 9.438  -23.151 1.00 16.75 ? 533  PRO B CG  1 
ATOM   3833 C CD  . PRO B 1 234 ? -44.694 8.262  -22.602 1.00 16.23 ? 533  PRO B CD  1 
ATOM   3834 N N   . ARG B 1 235 ? -46.981 7.323  -26.530 1.00 20.36 ? 534  ARG B N   1 
ATOM   3835 C CA  . ARG B 1 235 ? -46.875 7.096  -27.939 1.00 22.54 ? 534  ARG B CA  1 
ATOM   3836 C C   . ARG B 1 235 ? -47.122 8.300  -28.844 1.00 24.53 ? 534  ARG B C   1 
ATOM   3837 O O   . ARG B 1 235 ? -47.776 9.260  -28.449 1.00 27.77 ? 534  ARG B O   1 
ATOM   3838 C CB  . ARG B 1 235 ? -47.937 6.049  -28.351 1.00 23.86 ? 534  ARG B CB  1 
ATOM   3839 C CG  . ARG B 1 235 ? -48.009 4.819  -27.480 1.00 25.71 ? 534  ARG B CG  1 
ATOM   3840 C CD  . ARG B 1 235 ? -49.232 4.789  -26.570 1.00 26.43 ? 534  ARG B CD  1 
ATOM   3841 N NE  . ARG B 1 235 ? -48.772 4.683  -25.183 1.00 26.68 ? 534  ARG B NE  1 
ATOM   3842 C CZ  . ARG B 1 235 ? -48.999 5.535  -24.194 1.00 26.61 ? 534  ARG B CZ  1 
ATOM   3843 N NH1 . ARG B 1 235 ? -49.720 6.637  -24.394 1.00 27.77 ? 534  ARG B NH1 1 
ATOM   3844 N NH2 . ARG B 1 235 ? -48.481 5.252  -23.000 1.00 23.20 ? 534  ARG B NH2 1 
ATOM   3845 N N   . LEU B 1 236 ? -46.616 8.213  -30.068 1.00 25.71 ? 535  LEU B N   1 
ATOM   3846 C CA  . LEU B 1 236 ? -46.907 9.158  -31.123 1.00 26.05 ? 535  LEU B CA  1 
ATOM   3847 C C   . LEU B 1 236 ? -48.254 8.867  -31.772 1.00 27.38 ? 535  LEU B C   1 
ATOM   3848 O O   . LEU B 1 236 ? -48.530 7.719  -32.118 1.00 30.42 ? 535  LEU B O   1 
ATOM   3849 C CB  . LEU B 1 236 ? -45.848 9.085  -32.225 1.00 25.02 ? 535  LEU B CB  1 
ATOM   3850 C CG  . LEU B 1 236 ? -44.796 10.188 -32.248 1.00 24.88 ? 535  LEU B CG  1 
ATOM   3851 C CD1 . LEU B 1 236 ? -43.603 9.761  -33.088 1.00 25.15 ? 535  LEU B CD1 1 
ATOM   3852 C CD2 . LEU B 1 236 ? -45.428 11.473 -32.761 1.00 24.48 ? 535  LEU B CD2 1 
ATOM   3853 N N   . LYS B 1 237 ? -49.066 9.897  -31.950 1.00 28.86 ? 536  LYS B N   1 
ATOM   3854 C CA  . LYS B 1 237 ? -50.360 9.741  -32.607 1.00 30.81 ? 536  LYS B CA  1 
ATOM   3855 C C   . LYS B 1 237 ? -50.188 9.725  -34.119 1.00 31.09 ? 536  LYS B C   1 
ATOM   3856 O O   . LYS B 1 237 ? -51.092 9.437  -34.905 1.00 28.83 ? 536  LYS B O   1 
ATOM   3857 C CB  . LYS B 1 237 ? -51.315 10.865 -32.196 1.00 32.53 ? 536  LYS B CB  1 
ATOM   3858 C CG  . LYS B 1 237 ? -52.755 10.509 -32.537 1.00 33.83 ? 536  LYS B CG  1 
ATOM   3859 C CD  . LYS B 1 237 ? -53.468 9.902  -31.329 1.00 34.58 ? 536  LYS B CD  1 
ATOM   3860 C CE  . LYS B 1 237 ? -54.693 10.726 -30.976 1.00 35.63 ? 536  LYS B CE  1 
ATOM   3861 N NZ  . LYS B 1 237 ? -55.731 10.655 -32.048 1.00 37.31 ? 536  LYS B NZ  1 
ATOM   3862 N N   . ASN B 1 238 ? -48.965 10.062 -34.550 1.00 31.88 ? 537  ASN B N   1 
ATOM   3863 C CA  . ASN B 1 238 ? -48.663 10.012 -35.985 1.00 32.21 ? 537  ASN B CA  1 
ATOM   3864 C C   . ASN B 1 238 ? -47.660 8.903  -36.243 1.00 31.83 ? 537  ASN B C   1 
ATOM   3865 O O   . ASN B 1 238 ? -48.048 7.755  -36.486 1.00 34.58 ? 537  ASN B O   1 
ATOM   3866 C CB  . ASN B 1 238 ? -48.198 11.380 -36.497 1.00 32.83 ? 537  ASN B CB  1 
ATOM   3867 C CG  . ASN B 1 238 ? -49.349 12.376 -36.403 1.00 33.27 ? 537  ASN B CG  1 
ATOM   3868 O OD1 . ASN B 1 238 ? -49.345 13.220 -35.504 1.00 36.75 ? 537  ASN B OD1 1 
ATOM   3869 N ND2 . ASN B 1 238 ? -50.325 12.268 -37.296 1.00 29.11 ? 537  ASN B ND2 1 
ATOM   3870 N N   . LEU B 1 239 ? -46.375 9.223  -36.204 1.00 30.92 ? 538  LEU B N   1 
ATOM   3871 C CA  . LEU B 1 239 ? -45.314 8.233  -36.351 1.00 28.57 ? 538  LEU B CA  1 
ATOM   3872 C C   . LEU B 1 239 ? -45.124 7.763  -37.788 1.00 28.12 ? 538  LEU B C   1 
ATOM   3873 O O   . LEU B 1 239 ? -43.980 7.522  -38.187 1.00 30.21 ? 538  LEU B O   1 
ATOM   3874 C CB  . LEU B 1 239 ? -45.565 7.028  -35.432 1.00 26.53 ? 538  LEU B CB  1 
ATOM   3875 C CG  . LEU B 1 239 ? -44.632 5.832  -35.672 1.00 25.08 ? 538  LEU B CG  1 
ATOM   3876 C CD1 . LEU B 1 239 ? -43.183 6.218  -35.410 1.00 20.59 ? 538  LEU B CD1 1 
ATOM   3877 C CD2 . LEU B 1 239 ? -45.060 4.653  -34.813 1.00 22.84 ? 538  LEU B CD2 1 
ATOM   3878 N N   . HIS B 1 240 ? -46.200 7.645  -38.537 1.00 28.32 ? 539  HIS B N   1 
ATOM   3879 C CA  . HIS B 1 240 ? -46.177 7.259  -39.939 1.00 28.84 ? 539  HIS B CA  1 
ATOM   3880 C C   . HIS B 1 240 ? -45.564 8.325  -40.845 1.00 28.02 ? 539  HIS B C   1 
ATOM   3881 O O   . HIS B 1 240 ? -45.419 8.138  -42.060 1.00 25.45 ? 539  HIS B O   1 
ATOM   3882 C CB  . HIS B 1 240 ? -47.602 6.924  -40.408 1.00 30.23 ? 539  HIS B CB  1 
ATOM   3883 C CG  . HIS B 1 240 ? -47.660 6.486  -41.842 1.00 33.27 ? 539  HIS B CG  1 
ATOM   3884 N ND1 . HIS B 1 240 ? -46.609 5.834  -42.458 1.00 34.47 ? 539  HIS B ND1 1 
ATOM   3885 C CD2 . HIS B 1 240 ? -48.614 6.611  -42.792 1.00 34.37 ? 539  HIS B CD2 1 
ATOM   3886 C CE1 . HIS B 1 240 ? -46.918 5.569  -43.714 1.00 35.01 ? 539  HIS B CE1 1 
ATOM   3887 N NE2 . HIS B 1 240 ? -48.135 6.031  -43.944 1.00 35.21 ? 539  HIS B NE2 1 
ATOM   3888 N N   . LYS B 1 241 ? -45.189 9.452  -40.257 1.00 28.09 ? 540  LYS B N   1 
ATOM   3889 C CA  . LYS B 1 241 ? -44.513 10.527 -40.959 1.00 28.23 ? 540  LYS B CA  1 
ATOM   3890 C C   . LYS B 1 241 ? -43.223 10.940 -40.269 1.00 28.26 ? 540  LYS B C   1 
ATOM   3891 O O   . LYS B 1 241 ? -42.783 12.077 -40.444 1.00 29.84 ? 540  LYS B O   1 
ATOM   3892 C CB  . LYS B 1 241 ? -45.441 11.740 -41.033 1.00 28.37 ? 540  LYS B CB  1 
ATOM   3893 C CG  . LYS B 1 241 ? -46.623 11.553 -41.974 1.00 28.06 ? 540  LYS B CG  1 
ATOM   3894 C CD  . LYS B 1 241 ? -46.831 12.775 -42.855 1.00 26.90 ? 540  LYS B CD  1 
ATOM   3895 C CE  . LYS B 1 241 ? -48.296 13.173 -42.979 1.00 26.57 ? 540  LYS B CE  1 
ATOM   3896 N NZ  . LYS B 1 241 ? -48.712 13.192 -44.410 1.00 27.60 ? 540  LYS B NZ  1 
ATOM   3897 N N   . VAL B 1 242 ? -42.626 10.048 -39.486 1.00 28.27 ? 541  VAL B N   1 
ATOM   3898 C CA  . VAL B 1 242 ? -41.491 10.428 -38.651 1.00 30.10 ? 541  VAL B CA  1 
ATOM   3899 C C   . VAL B 1 242 ? -40.206 9.668  -38.954 1.00 31.16 ? 541  VAL B C   1 
ATOM   3900 O O   . VAL B 1 242 ? -40.124 8.486  -38.634 1.00 31.62 ? 541  VAL B O   1 
ATOM   3901 C CB  . VAL B 1 242 ? -41.818 10.196 -37.157 1.00 30.77 ? 541  VAL B CB  1 
ATOM   3902 C CG1 . VAL B 1 242 ? -40.594 10.574 -36.335 1.00 32.38 ? 541  VAL B CG1 1 
ATOM   3903 C CG2 . VAL B 1 242 ? -43.052 10.974 -36.742 1.00 31.30 ? 541  VAL B CG2 1 
ATOM   3904 N N   . SER B 1 243 ? -39.236 10.348 -39.545 1.00 32.04 ? 542  SER B N   1 
ATOM   3905 C CA  . SER B 1 243 ? -37.986 9.744  -39.977 1.00 31.30 ? 542  SER B CA  1 
ATOM   3906 C C   . SER B 1 243 ? -37.369 8.839  -38.916 1.00 29.67 ? 542  SER B C   1 
ATOM   3907 O O   . SER B 1 243 ? -37.421 9.177  -37.736 1.00 31.65 ? 542  SER B O   1 
ATOM   3908 C CB  . SER B 1 243 ? -36.978 10.833 -40.363 1.00 31.29 ? 542  SER B CB  1 
ATOM   3909 O OG  . SER B 1 243 ? -36.331 11.340 -39.210 1.00 32.67 ? 542  SER B OG  1 
ATOM   3910 N N   . PRO B 1 244 ? -36.809 7.715  -39.331 1.00 27.97 ? 543  PRO B N   1 
ATOM   3911 C CA  . PRO B 1 244 ? -36.203 6.767  -38.393 1.00 27.12 ? 543  PRO B CA  1 
ATOM   3912 C C   . PRO B 1 244 ? -35.273 7.354  -37.352 1.00 27.05 ? 543  PRO B C   1 
ATOM   3913 O O   . PRO B 1 244 ? -35.188 6.800  -36.252 1.00 28.15 ? 543  PRO B O   1 
ATOM   3914 C CB  . PRO B 1 244 ? -35.370 5.864  -39.323 1.00 27.64 ? 543  PRO B CB  1 
ATOM   3915 C CG  . PRO B 1 244 ? -36.195 5.830  -40.573 1.00 28.16 ? 543  PRO B CG  1 
ATOM   3916 C CD  . PRO B 1 244 ? -36.720 7.228  -40.725 1.00 27.95 ? 543  PRO B CD  1 
ATOM   3917 N N   . SER B 1 245 ? -34.572 8.437  -37.669 1.00 26.17 ? 544  SER B N   1 
ATOM   3918 C CA  . SER B 1 245 ? -33.614 9.007  -36.712 1.00 24.39 ? 544  SER B CA  1 
ATOM   3919 C C   . SER B 1 245 ? -34.299 9.875  -35.666 1.00 22.42 ? 544  SER B C   1 
ATOM   3920 O O   . SER B 1 245 ? -33.784 10.048 -34.560 1.00 21.84 ? 544  SER B O   1 
ATOM   3921 C CB  . SER B 1 245 ? -32.523 9.775  -37.456 1.00 24.79 ? 544  SER B CB  1 
ATOM   3922 O OG  . SER B 1 245 ? -32.992 10.981 -38.031 1.00 25.57 ? 544  SER B OG  1 
ATOM   3923 N N   . LEU B 1 246 ? -35.461 10.429 -36.007 1.00 21.04 ? 545  LEU B N   1 
ATOM   3924 C CA  . LEU B 1 246 ? -36.251 11.170 -35.026 1.00 19.39 ? 545  LEU B CA  1 
ATOM   3925 C C   . LEU B 1 246 ? -36.855 10.144 -34.052 1.00 18.79 ? 545  LEU B C   1 
ATOM   3926 O O   . LEU B 1 246 ? -36.811 10.293 -32.834 1.00 19.86 ? 545  LEU B O   1 
ATOM   3927 C CB  . LEU B 1 246 ? -37.369 12.027 -35.590 1.00 19.22 ? 545  LEU B CB  1 
ATOM   3928 C CG  . LEU B 1 246 ? -37.720 13.318 -34.850 1.00 19.14 ? 545  LEU B CG  1 
ATOM   3929 C CD1 . LEU B 1 246 ? -38.689 14.134 -35.711 1.00 21.35 ? 545  LEU B CD1 1 
ATOM   3930 C CD2 . LEU B 1 246 ? -38.338 13.134 -33.477 1.00 18.21 ? 545  LEU B CD2 1 
ATOM   3931 N N   . LYS B 1 247 ? -37.399 9.079  -34.631 1.00 18.27 ? 546  LYS B N   1 
ATOM   3932 C CA  . LYS B 1 247 ? -37.927 7.958  -33.879 1.00 17.67 ? 546  LYS B CA  1 
ATOM   3933 C C   . LYS B 1 247 ? -36.912 7.490  -32.838 1.00 16.42 ? 546  LYS B C   1 
ATOM   3934 O O   . LYS B 1 247 ? -37.187 7.442  -31.641 1.00 18.39 ? 546  LYS B O   1 
ATOM   3935 C CB  . LYS B 1 247 ? -38.264 6.760  -34.756 1.00 18.95 ? 546  LYS B CB  1 
ATOM   3936 C CG  . LYS B 1 247 ? -38.785 6.980  -36.157 1.00 19.61 ? 546  LYS B CG  1 
ATOM   3937 C CD  . LYS B 1 247 ? -39.090 5.624  -36.793 1.00 19.76 ? 546  LYS B CD  1 
ATOM   3938 C CE  . LYS B 1 247 ? -39.636 5.769  -38.194 1.00 19.26 ? 546  LYS B CE  1 
ATOM   3939 N NZ  . LYS B 1 247 ? -40.804 4.894  -38.480 1.00 16.49 ? 546  LYS B NZ  1 
ATOM   3940 N N   . GLY B 1 248 ? -35.724 7.128  -33.317 1.00 16.45 ? 547  GLY B N   1 
ATOM   3941 C CA  . GLY B 1 248 ? -34.646 6.715  -32.422 1.00 15.47 ? 547  GLY B CA  1 
ATOM   3942 C C   . GLY B 1 248 ? -34.367 7.849  -31.438 1.00 15.49 ? 547  GLY B C   1 
ATOM   3943 O O   . GLY B 1 248 ? -34.003 7.592  -30.294 1.00 20.44 ? 547  GLY B O   1 
ATOM   3944 N N   . PHE B 1 249 ? -34.546 9.076  -31.894 1.00 15.18 ? 548  PHE B N   1 
ATOM   3945 C CA  . PHE B 1 249 ? -34.262 10.269 -31.103 1.00 13.97 ? 548  PHE B CA  1 
ATOM   3946 C C   . PHE B 1 249 ? -35.157 10.357 -29.881 1.00 11.76 ? 548  PHE B C   1 
ATOM   3947 O O   . PHE B 1 249 ? -34.688 10.554 -28.756 1.00 3.97  ? 548  PHE B O   1 
ATOM   3948 C CB  . PHE B 1 249 ? -34.397 11.468 -32.039 1.00 14.64 ? 548  PHE B CB  1 
ATOM   3949 C CG  . PHE B 1 249 ? -34.337 12.867 -31.487 1.00 15.60 ? 548  PHE B CG  1 
ATOM   3950 C CD1 . PHE B 1 249 ? -33.137 13.470 -31.150 1.00 17.01 ? 548  PHE B CD1 1 
ATOM   3951 C CD2 . PHE B 1 249 ? -35.504 13.583 -31.296 1.00 15.69 ? 548  PHE B CD2 1 
ATOM   3952 C CE1 . PHE B 1 249 ? -33.117 14.748 -30.631 1.00 17.01 ? 548  PHE B CE1 1 
ATOM   3953 C CE2 . PHE B 1 249 ? -35.499 14.863 -30.783 1.00 15.96 ? 548  PHE B CE2 1 
ATOM   3954 C CZ  . PHE B 1 249 ? -34.292 15.447 -30.449 1.00 16.65 ? 548  PHE B CZ  1 
ATOM   3955 N N   . LEU B 1 250 ? -36.471 10.219 -30.084 1.00 11.99 ? 549  LEU B N   1 
ATOM   3956 C CA  . LEU B 1 250 ? -37.394 10.342 -28.946 1.00 12.99 ? 549  LEU B CA  1 
ATOM   3957 C C   . LEU B 1 250 ? -37.293 9.161  -27.995 1.00 12.45 ? 549  LEU B C   1 
ATOM   3958 O O   . LEU B 1 250 ? -37.473 9.368  -26.789 1.00 12.49 ? 549  LEU B O   1 
ATOM   3959 C CB  . LEU B 1 250 ? -38.805 10.565 -29.481 1.00 13.81 ? 549  LEU B CB  1 
ATOM   3960 C CG  . LEU B 1 250 ? -39.803 11.303 -28.587 1.00 13.96 ? 549  LEU B CG  1 
ATOM   3961 C CD1 . LEU B 1 250 ? -39.934 12.779 -28.903 1.00 16.74 ? 549  LEU B CD1 1 
ATOM   3962 C CD2 . LEU B 1 250 ? -41.155 10.605 -28.719 1.00 16.60 ? 549  LEU B CD2 1 
ATOM   3963 N N   . ASP B 1 251 ? -37.017 7.974  -28.504 1.00 12.97 ? 550  ASP B N   1 
ATOM   3964 C CA  . ASP B 1 251 ? -36.794 6.794  -27.671 1.00 13.54 ? 550  ASP B CA  1 
ATOM   3965 C C   . ASP B 1 251 ? -35.607 6.951  -26.722 1.00 11.94 ? 550  ASP B C   1 
ATOM   3966 O O   . ASP B 1 251 ? -35.468 6.199  -25.750 1.00 12.05 ? 550  ASP B O   1 
ATOM   3967 C CB  . ASP B 1 251 ? -36.560 5.519  -28.483 1.00 14.32 ? 550  ASP B CB  1 
ATOM   3968 C CG  . ASP B 1 251 ? -37.758 5.014  -29.247 1.00 13.71 ? 550  ASP B CG  1 
ATOM   3969 O OD1 . ASP B 1 251 ? -38.861 5.579  -29.121 1.00 14.54 ? 550  ASP B OD1 1 
ATOM   3970 O OD2 . ASP B 1 251 ? -37.592 4.034  -30.000 1.00 14.22 ? 550  ASP B OD2 1 
ATOM   3971 N N   . ARG B 1 252 ? -34.760 7.937  -26.974 1.00 10.84 ? 551  ARG B N   1 
ATOM   3972 C CA  . ARG B 1 252 ? -33.677 8.257  -26.047 1.00 11.70 ? 551  ARG B CA  1 
ATOM   3973 C C   . ARG B 1 252 ? -34.083 9.186  -24.905 1.00 12.81 ? 551  ARG B C   1 
ATOM   3974 O O   . ARG B 1 252 ? -33.346 9.291  -23.918 1.00 14.23 ? 551  ARG B O   1 
ATOM   3975 C CB  . ARG B 1 252 ? -32.512 8.846  -26.847 1.00 12.51 ? 551  ARG B CB  1 
ATOM   3976 C CG  . ARG B 1 252 ? -31.744 7.860  -27.710 1.00 12.38 ? 551  ARG B CG  1 
ATOM   3977 C CD  . ARG B 1 252 ? -31.188 6.671  -26.929 1.00 11.75 ? 551  ARG B CD  1 
ATOM   3978 N NE  . ARG B 1 252 ? -30.274 7.020  -25.882 1.00 11.40 ? 551  ARG B NE  1 
ATOM   3979 C CZ  . ARG B 1 252 ? -30.264 7.144  -24.579 1.00 9.22  ? 551  ARG B CZ  1 
ATOM   3980 N NH1 . ARG B 1 252 ? -29.140 7.501  -23.955 1.00 11.21 ? 551  ARG B NH1 1 
ATOM   3981 N NH2 . ARG B 1 252 ? -31.315 6.942  -23.817 1.00 4.14  ? 551  ARG B NH2 1 
ATOM   3982 N N   . LEU B 1 253 ? -35.238 9.813  -25.034 1.00 13.51 ? 552  LEU B N   1 
ATOM   3983 C CA  . LEU B 1 253 ? -35.758 10.740 -24.041 1.00 14.08 ? 552  LEU B CA  1 
ATOM   3984 C C   . LEU B 1 253 ? -36.934 10.161 -23.243 1.00 13.95 ? 552  LEU B C   1 
ATOM   3985 O O   . LEU B 1 253 ? -37.088 10.424 -22.042 1.00 9.67  ? 552  LEU B O   1 
ATOM   3986 C CB  . LEU B 1 253 ? -36.202 12.069 -24.647 1.00 14.26 ? 552  LEU B CB  1 
ATOM   3987 C CG  . LEU B 1 253 ? -35.880 12.532 -26.056 1.00 13.72 ? 552  LEU B CG  1 
ATOM   3988 C CD1 . LEU B 1 253 ? -36.213 14.017 -26.192 1.00 14.86 ? 552  LEU B CD1 1 
ATOM   3989 C CD2 . LEU B 1 253 ? -34.432 12.324 -26.450 1.00 14.59 ? 552  LEU B CD2 1 
ATOM   3990 N N   . LEU B 1 254 ? -37.782 9.387  -23.912 1.00 14.30 ? 553  LEU B N   1 
ATOM   3991 C CA  . LEU B 1 254 ? -39.021 8.909  -23.306 1.00 13.32 ? 553  LEU B CA  1 
ATOM   3992 C C   . LEU B 1 254 ? -38.893 7.548  -22.634 1.00 13.53 ? 553  LEU B C   1 
ATOM   3993 O O   . LEU B 1 254 ? -39.676 6.652  -22.952 1.00 11.39 ? 553  LEU B O   1 
ATOM   3994 C CB  . LEU B 1 254 ? -40.120 8.838  -24.378 1.00 11.65 ? 553  LEU B CB  1 
ATOM   3995 C CG  . LEU B 1 254 ? -40.611 10.148 -24.982 1.00 10.91 ? 553  LEU B CG  1 
ATOM   3996 C CD1 . LEU B 1 254 ? -42.000 9.974  -25.596 1.00 12.31 ? 553  LEU B CD1 1 
ATOM   3997 C CD2 . LEU B 1 254 ? -40.636 11.272 -23.952 1.00 9.03  ? 553  LEU B CD2 1 
ATOM   3998 N N   . VAL B 1 255 ? -37.955 7.418  -21.715 1.00 13.85 ? 554  VAL B N   1 
ATOM   3999 C CA  . VAL B 1 255 ? -37.767 6.208  -20.933 1.00 13.93 ? 554  VAL B CA  1 
ATOM   4000 C C   . VAL B 1 255 ? -37.990 6.410  -19.443 1.00 13.03 ? 554  VAL B C   1 
ATOM   4001 O O   . VAL B 1 255 ? -37.728 7.487  -18.905 1.00 6.32  ? 554  VAL B O   1 
ATOM   4002 C CB  . VAL B 1 255 ? -36.345 5.659  -21.191 1.00 15.78 ? 554  VAL B CB  1 
ATOM   4003 C CG1 . VAL B 1 255 ? -36.229 4.257  -20.611 1.00 22.08 ? 554  VAL B CG1 1 
ATOM   4004 C CG2 . VAL B 1 255 ? -36.056 5.662  -22.681 1.00 10.37 ? 554  VAL B CG2 1 
ATOM   4005 N N   . ARG B 1 256 ? -38.488 5.374  -18.768 1.00 13.91 ? 555  ARG B N   1 
ATOM   4006 C CA  . ARG B 1 256 ? -38.988 5.518  -17.404 1.00 15.52 ? 555  ARG B CA  1 
ATOM   4007 C C   . ARG B 1 256 ? -37.926 5.360  -16.327 1.00 15.05 ? 555  ARG B C   1 
ATOM   4008 O O   . ARG B 1 256 ? -38.080 5.874  -15.211 1.00 15.95 ? 555  ARG B O   1 
ATOM   4009 C CB  . ARG B 1 256 ? -40.143 4.526  -17.143 1.00 16.97 ? 555  ARG B CB  1 
ATOM   4010 C CG  . ARG B 1 256 ? -41.496 5.134  -17.510 1.00 18.55 ? 555  ARG B CG  1 
ATOM   4011 C CD  . ARG B 1 256 ? -42.597 4.102  -17.351 1.00 19.51 ? 555  ARG B CD  1 
ATOM   4012 N NE  . ARG B 1 256 ? -43.175 4.106  -16.003 1.00 18.40 ? 555  ARG B NE  1 
ATOM   4013 C CZ  . ARG B 1 256 ? -44.168 4.879  -15.591 1.00 16.38 ? 555  ARG B CZ  1 
ATOM   4014 N NH1 . ARG B 1 256 ? -44.740 5.757  -16.406 1.00 12.83 ? 555  ARG B NH1 1 
ATOM   4015 N NH2 . ARG B 1 256 ? -44.621 4.795  -14.343 1.00 13.41 ? 555  ARG B NH2 1 
ATOM   4016 N N   . ASP B 1 257 ? -36.848 4.657  -16.637 1.00 14.31 ? 556  ASP B N   1 
ATOM   4017 C CA  . ASP B 1 257 ? -35.723 4.550  -15.691 1.00 13.82 ? 556  ASP B CA  1 
ATOM   4018 C C   . ASP B 1 257 ? -34.911 5.834  -15.816 1.00 12.13 ? 556  ASP B C   1 
ATOM   4019 O O   . ASP B 1 257 ? -34.318 6.089  -16.858 1.00 11.06 ? 556  ASP B O   1 
ATOM   4020 C CB  . ASP B 1 257 ? -34.907 3.303  -15.964 1.00 14.30 ? 556  ASP B CB  1 
ATOM   4021 C CG  . ASP B 1 257 ? -33.554 3.135  -15.336 1.00 14.13 ? 556  ASP B CG  1 
ATOM   4022 O OD1 . ASP B 1 257 ? -32.788 2.259  -15.810 1.00 20.57 ? 556  ASP B OD1 1 
ATOM   4023 O OD2 . ASP B 1 257 ? -33.215 3.846  -14.373 1.00 6.67  ? 556  ASP B OD2 1 
ATOM   4024 N N   . PRO B 1 258 ? -34.921 6.635  -14.760 1.00 12.51 ? 557  PRO B N   1 
ATOM   4025 C CA  . PRO B 1 258 ? -34.082 7.827  -14.691 1.00 13.40 ? 557  PRO B CA  1 
ATOM   4026 C C   . PRO B 1 258 ? -32.607 7.528  -14.956 1.00 15.51 ? 557  PRO B C   1 
ATOM   4027 O O   . PRO B 1 258 ? -31.891 8.410  -15.436 1.00 18.03 ? 557  PRO B O   1 
ATOM   4028 C CB  . PRO B 1 258 ? -34.257 8.277  -13.239 1.00 12.60 ? 557  PRO B CB  1 
ATOM   4029 C CG  . PRO B 1 258 ? -35.591 7.751  -12.834 1.00 12.04 ? 557  PRO B CG  1 
ATOM   4030 C CD  . PRO B 1 258 ? -35.770 6.458  -13.569 1.00 11.75 ? 557  PRO B CD  1 
ATOM   4031 N N   . ALA B 1 259 ? -32.188 6.313  -14.654 1.00 16.48 ? 558  ALA B N   1 
ATOM   4032 C CA  . ALA B 1 259 ? -30.812 5.874  -14.756 1.00 15.81 ? 558  ALA B CA  1 
ATOM   4033 C C   . ALA B 1 259 ? -30.313 5.509  -16.143 1.00 14.04 ? 558  ALA B C   1 
ATOM   4034 O O   . ALA B 1 259 ? -29.098 5.591  -16.377 1.00 15.04 ? 558  ALA B O   1 
ATOM   4035 C CB  . ALA B 1 259 ? -30.597 4.658  -13.843 1.00 13.74 ? 558  ALA B CB  1 
ATOM   4036 N N   . GLN B 1 260 ? -31.188 5.096  -17.043 1.00 12.89 ? 559  GLN B N   1 
ATOM   4037 C CA  . GLN B 1 260 ? -30.742 4.667  -18.375 1.00 13.63 ? 559  GLN B CA  1 
ATOM   4038 C C   . GLN B 1 260 ? -31.210 5.655  -19.437 1.00 14.64 ? 559  GLN B C   1 
ATOM   4039 O O   . GLN B 1 260 ? -31.216 5.330  -20.628 1.00 17.28 ? 559  GLN B O   1 
ATOM   4040 C CB  . GLN B 1 260 ? -31.235 3.266  -18.740 1.00 14.04 ? 559  GLN B CB  1 
ATOM   4041 C CG  . GLN B 1 260 ? -30.125 2.277  -19.029 1.00 12.47 ? 559  GLN B CG  1 
ATOM   4042 C CD  . GLN B 1 260 ? -29.536 1.715  -17.758 1.00 10.14 ? 559  GLN B CD  1 
ATOM   4043 O OE1 . GLN B 1 260 ? -30.095 1.765  -16.667 1.00 6.68  ? 559  GLN B OE1 1 
ATOM   4044 N NE2 . GLN B 1 260 ? -28.354 1.133  -17.925 1.00 11.85 ? 559  GLN B NE2 1 
ATOM   4045 N N   . ARG B 1 261 ? -31.599 6.842  -19.010 1.00 15.81 ? 560  ARG B N   1 
ATOM   4046 C CA  . ARG B 1 261 ? -32.021 7.903  -19.919 1.00 16.29 ? 560  ARG B CA  1 
ATOM   4047 C C   . ARG B 1 261 ? -30.881 8.884  -20.154 1.00 13.11 ? 560  ARG B C   1 
ATOM   4048 O O   . ARG B 1 261 ? -29.996 9.021  -19.316 1.00 12.50 ? 560  ARG B O   1 
ATOM   4049 C CB  . ARG B 1 261 ? -33.243 8.624  -19.355 1.00 19.35 ? 560  ARG B CB  1 
ATOM   4050 C CG  . ARG B 1 261 ? -34.142 9.274  -20.387 1.00 20.59 ? 560  ARG B CG  1 
ATOM   4051 C CD  . ARG B 1 261 ? -35.186 10.203 -19.829 1.00 21.26 ? 560  ARG B CD  1 
ATOM   4052 N NE  . ARG B 1 261 ? -35.128 10.644 -18.450 1.00 21.69 ? 560  ARG B NE  1 
ATOM   4053 C CZ  . ARG B 1 261 ? -35.850 10.259 -17.405 1.00 20.82 ? 560  ARG B CZ  1 
ATOM   4054 N NH1 . ARG B 1 261 ? -35.624 10.808 -16.214 1.00 15.75 ? 560  ARG B NH1 1 
ATOM   4055 N NH2 . ARG B 1 261 ? -36.801 9.338  -17.499 1.00 20.41 ? 560  ARG B NH2 1 
ATOM   4056 N N   . ALA B 1 262 ? -30.914 9.567  -21.291 1.00 12.86 ? 561  ALA B N   1 
ATOM   4057 C CA  . ALA B 1 262 ? -29.823 10.438 -21.700 1.00 12.43 ? 561  ALA B CA  1 
ATOM   4058 C C   . ALA B 1 262 ? -29.690 11.688 -20.833 1.00 11.89 ? 561  ALA B C   1 
ATOM   4059 O O   . ALA B 1 262 ? -30.615 12.108 -20.138 1.00 10.19 ? 561  ALA B O   1 
ATOM   4060 C CB  . ALA B 1 262 ? -29.997 10.829 -23.163 1.00 8.60  ? 561  ALA B CB  1 
ATOM   4061 N N   . THR B 1 263 ? -28.498 12.278 -20.881 1.00 11.21 ? 562  THR B N   1 
ATOM   4062 C CA  . THR B 1 263 ? -28.251 13.585 -20.313 1.00 11.63 ? 562  THR B CA  1 
ATOM   4063 C C   . THR B 1 263 ? -28.178 14.585 -21.467 1.00 12.50 ? 562  THR B C   1 
ATOM   4064 O O   . THR B 1 263 ? -27.885 14.164 -22.589 1.00 16.66 ? 562  THR B O   1 
ATOM   4065 C CB  . THR B 1 263 ? -26.965 13.679 -19.481 1.00 12.49 ? 562  THR B CB  1 
ATOM   4066 O OG1 . THR B 1 263 ? -25.862 13.129 -20.212 1.00 16.30 ? 562  THR B OG1 1 
ATOM   4067 C CG2 . THR B 1 263 ? -27.098 12.862 -18.207 1.00 13.22 ? 562  THR B CG2 1 
ATOM   4068 N N   . ALA B 1 264 ? -28.449 15.842 -21.177 1.00 12.35 ? 563  ALA B N   1 
ATOM   4069 C CA  . ALA B 1 264 ? -28.454 16.900 -22.175 1.00 13.23 ? 563  ALA B CA  1 
ATOM   4070 C C   . ALA B 1 264 ? -27.231 16.835 -23.084 1.00 14.63 ? 563  ALA B C   1 
ATOM   4071 O O   . ALA B 1 264 ? -27.361 16.855 -24.308 1.00 16.44 ? 563  ALA B O   1 
ATOM   4072 C CB  . ALA B 1 264 ? -28.531 18.256 -21.486 1.00 13.17 ? 563  ALA B CB  1 
ATOM   4073 N N   . ALA B 1 265 ? -26.053 16.742 -22.481 1.00 16.19 ? 564  ALA B N   1 
ATOM   4074 C CA  . ALA B 1 265 ? -24.804 16.751 -23.233 1.00 18.39 ? 564  ALA B CA  1 
ATOM   4075 C C   . ALA B 1 265 ? -24.707 15.576 -24.202 1.00 20.14 ? 564  ALA B C   1 
ATOM   4076 O O   . ALA B 1 265 ? -24.242 15.775 -25.325 1.00 21.16 ? 564  ALA B O   1 
ATOM   4077 C CB  . ALA B 1 265 ? -23.622 16.783 -22.270 1.00 15.87 ? 564  ALA B CB  1 
ATOM   4078 N N   . GLU B 1 266 ? -25.133 14.404 -23.765 1.00 21.59 ? 565  GLU B N   1 
ATOM   4079 C CA  . GLU B 1 266 ? -25.046 13.177 -24.544 1.00 20.95 ? 565  GLU B CA  1 
ATOM   4080 C C   . GLU B 1 266 ? -25.915 13.243 -25.799 1.00 19.89 ? 565  GLU B C   1 
ATOM   4081 O O   . GLU B 1 266 ? -25.574 12.672 -26.830 1.00 17.08 ? 565  GLU B O   1 
ATOM   4082 C CB  . GLU B 1 266 ? -25.480 11.956 -23.728 1.00 20.80 ? 565  GLU B CB  1 
ATOM   4083 C CG  . GLU B 1 266 ? -24.410 11.294 -22.885 1.00 20.45 ? 565  GLU B CG  1 
ATOM   4084 C CD  . GLU B 1 266 ? -24.721 9.899  -22.381 1.00 19.34 ? 565  GLU B CD  1 
ATOM   4085 O OE1 . GLU B 1 266 ? -24.674 8.935  -23.175 1.00 17.58 ? 565  GLU B OE1 1 
ATOM   4086 O OE2 . GLU B 1 266 ? -25.001 9.722  -21.173 1.00 16.57 ? 565  GLU B OE2 1 
ATOM   4087 N N   . LEU B 1 267 ? -27.044 13.934 -25.680 1.00 20.58 ? 566  LEU B N   1 
ATOM   4088 C CA  . LEU B 1 267 ? -28.004 14.007 -26.781 1.00 21.13 ? 566  LEU B CA  1 
ATOM   4089 C C   . LEU B 1 267 ? -27.569 14.954 -27.876 1.00 22.04 ? 566  LEU B C   1 
ATOM   4090 O O   . LEU B 1 267 ? -27.937 14.794 -29.048 1.00 24.55 ? 566  LEU B O   1 
ATOM   4091 C CB  . LEU B 1 267 ? -29.399 14.386 -26.256 1.00 20.21 ? 566  LEU B CB  1 
ATOM   4092 C CG  . LEU B 1 267 ? -30.067 13.346 -25.352 1.00 18.86 ? 566  LEU B CG  1 
ATOM   4093 C CD1 . LEU B 1 267 ? -31.122 14.005 -24.482 1.00 12.87 ? 566  LEU B CD1 1 
ATOM   4094 C CD2 . LEU B 1 267 ? -30.685 12.201 -26.147 1.00 19.56 ? 566  LEU B CD2 1 
ATOM   4095 N N   . LEU B 1 268 ? -26.743 15.950 -27.542 1.00 22.28 ? 567  LEU B N   1 
ATOM   4096 C CA  . LEU B 1 268 ? -26.182 16.804 -28.603 1.00 22.35 ? 567  LEU B CA  1 
ATOM   4097 C C   . LEU B 1 268 ? -25.313 15.938 -29.522 1.00 22.03 ? 567  LEU B C   1 
ATOM   4098 O O   . LEU B 1 268 ? -25.148 16.262 -30.701 1.00 21.48 ? 567  LEU B O   1 
ATOM   4099 C CB  . LEU B 1 268 ? -25.397 17.971 -28.030 1.00 22.57 ? 567  LEU B CB  1 
ATOM   4100 C CG  . LEU B 1 268 ? -26.183 19.056 -27.284 1.00 22.20 ? 567  LEU B CG  1 
ATOM   4101 C CD1 . LEU B 1 268 ? -25.399 19.597 -26.091 1.00 18.33 ? 567  LEU B CD1 1 
ATOM   4102 C CD2 . LEU B 1 268 ? -26.567 20.197 -28.219 1.00 22.16 ? 567  LEU B CD2 1 
ATOM   4103 N N   . LYS B 1 269 ? -24.796 14.855 -28.974 1.00 21.08 ? 568  LYS B N   1 
ATOM   4104 C CA  . LYS B 1 269 ? -24.026 13.853 -29.664 1.00 20.58 ? 568  LYS B CA  1 
ATOM   4105 C C   . LYS B 1 269 ? -24.829 12.949 -30.587 1.00 22.15 ? 568  LYS B C   1 
ATOM   4106 O O   . LYS B 1 269 ? -24.250 12.094 -31.268 1.00 21.78 ? 568  LYS B O   1 
ATOM   4107 C CB  . LYS B 1 269 ? -23.314 12.951 -28.633 1.00 18.22 ? 568  LYS B CB  1 
ATOM   4108 C CG  . LYS B 1 269 ? -22.127 13.562 -27.924 1.00 17.04 ? 568  LYS B CG  1 
ATOM   4109 C CD  . LYS B 1 269 ? -21.099 12.509 -27.544 1.00 17.07 ? 568  LYS B CD  1 
ATOM   4110 N N   . HIS B 1 270 ? -26.148 13.110 -30.620 1.00 23.09 ? 569  HIS B N   1 
ATOM   4111 C CA  . HIS B 1 270 ? -26.986 12.255 -31.469 1.00 23.09 ? 569  HIS B CA  1 
ATOM   4112 C C   . HIS B 1 270 ? -27.088 12.764 -32.898 1.00 19.86 ? 569  HIS B C   1 
ATOM   4113 O O   . HIS B 1 270 ? -27.149 13.988 -33.069 1.00 20.67 ? 569  HIS B O   1 
ATOM   4114 C CB  . HIS B 1 270 ? -28.373 12.129 -30.817 1.00 25.79 ? 569  HIS B CB  1 
ATOM   4115 C CG  . HIS B 1 270 ? -29.248 11.171 -31.570 1.00 27.80 ? 569  HIS B CG  1 
ATOM   4116 N ND1 . HIS B 1 270 ? -30.066 11.600 -32.589 1.00 28.37 ? 569  HIS B ND1 1 
ATOM   4117 C CD2 . HIS B 1 270 ? -29.417 9.831  -31.493 1.00 28.60 ? 569  HIS B CD2 1 
ATOM   4118 C CE1 . HIS B 1 270 ? -30.717 10.566 -33.102 1.00 28.97 ? 569  HIS B CE1 1 
ATOM   4119 N NE2 . HIS B 1 270 ? -30.344 9.477  -32.447 1.00 29.30 ? 569  HIS B NE2 1 
ATOM   4120 N N   . PRO B 1 271 ? -27.099 11.901 -33.900 1.00 17.74 ? 570  PRO B N   1 
ATOM   4121 C CA  . PRO B 1 271 ? -27.097 12.387 -35.299 1.00 18.16 ? 570  PRO B CA  1 
ATOM   4122 C C   . PRO B 1 271 ? -28.349 13.025 -35.865 1.00 18.83 ? 570  PRO B C   1 
ATOM   4123 O O   . PRO B 1 271 ? -28.233 13.870 -36.771 1.00 21.42 ? 570  PRO B O   1 
ATOM   4124 C CB  . PRO B 1 271 ? -26.802 11.118 -36.133 1.00 18.55 ? 570  PRO B CB  1 
ATOM   4125 C CG  . PRO B 1 271 ? -26.228 10.148 -35.147 1.00 18.40 ? 570  PRO B CG  1 
ATOM   4126 C CD  . PRO B 1 271 ? -27.057 10.418 -33.913 1.00 18.14 ? 570  PRO B CD  1 
ATOM   4127 N N   . PHE B 1 272 ? -29.535 12.674 -35.404 1.00 19.56 ? 571  PHE B N   1 
ATOM   4128 C CA  . PHE B 1 272 ? -30.755 13.350 -35.843 1.00 19.84 ? 571  PHE B CA  1 
ATOM   4129 C C   . PHE B 1 272 ? -30.627 14.876 -35.741 1.00 21.46 ? 571  PHE B C   1 
ATOM   4130 O O   . PHE B 1 272 ? -31.174 15.599 -36.574 1.00 22.35 ? 571  PHE B O   1 
ATOM   4131 C CB  . PHE B 1 272 ? -31.983 12.926 -35.028 1.00 19.01 ? 571  PHE B CB  1 
ATOM   4132 C CG  . PHE B 1 272 ? -33.187 13.829 -35.269 1.00 18.07 ? 571  PHE B CG  1 
ATOM   4133 C CD1 . PHE B 1 272 ? -33.888 13.735 -36.456 1.00 17.28 ? 571  PHE B CD1 1 
ATOM   4134 C CD2 . PHE B 1 272 ? -33.601 14.753 -34.325 1.00 18.63 ? 571  PHE B CD2 1 
ATOM   4135 C CE1 . PHE B 1 272 ? -34.975 14.550 -36.694 1.00 17.89 ? 571  PHE B CE1 1 
ATOM   4136 C CE2 . PHE B 1 272 ? -34.686 15.579 -34.548 1.00 17.48 ? 571  PHE B CE2 1 
ATOM   4137 C CZ  . PHE B 1 272 ? -35.368 15.474 -35.745 1.00 18.02 ? 571  PHE B CZ  1 
ATOM   4138 N N   . LEU B 1 273 ? -29.903 15.324 -34.736 1.00 22.37 ? 572  LEU B N   1 
ATOM   4139 C CA  . LEU B 1 273 ? -29.582 16.703 -34.472 1.00 22.97 ? 572  LEU B CA  1 
ATOM   4140 C C   . LEU B 1 273 ? -28.544 17.263 -35.442 1.00 23.90 ? 572  LEU B C   1 
ATOM   4141 O O   . LEU B 1 273 ? -28.070 18.396 -35.305 1.00 25.60 ? 572  LEU B O   1 
ATOM   4142 C CB  . LEU B 1 273 ? -29.079 16.827 -33.017 1.00 22.52 ? 572  LEU B CB  1 
ATOM   4143 C CG  . LEU B 1 273 ? -30.190 17.034 -31.979 1.00 22.41 ? 572  LEU B CG  1 
ATOM   4144 C CD1 . LEU B 1 273 ? -29.859 16.419 -30.628 1.00 24.31 ? 572  LEU B CD1 1 
ATOM   4145 C CD2 . LEU B 1 273 ? -30.473 18.523 -31.826 1.00 20.50 ? 572  LEU B CD2 1 
ATOM   4146 N N   . ALA B 1 274 ? -28.190 16.462 -36.442 1.00 24.05 ? 573  ALA B N   1 
ATOM   4147 C CA  . ALA B 1 274 ? -27.310 16.902 -37.508 1.00 24.60 ? 573  ALA B CA  1 
ATOM   4148 C C   . ALA B 1 274 ? -28.046 17.819 -38.482 1.00 23.91 ? 573  ALA B C   1 
ATOM   4149 O O   . ALA B 1 274 ? -27.408 18.617 -39.157 1.00 20.06 ? 573  ALA B O   1 
ATOM   4150 C CB  . ALA B 1 274 ? -26.731 15.702 -38.253 1.00 23.91 ? 573  ALA B CB  1 
ATOM   4151 N N   . LYS B 1 275 ? -29.365 17.686 -38.539 1.00 24.41 ? 574  LYS B N   1 
ATOM   4152 C CA  . LYS B 1 275 ? -30.156 18.234 -39.629 1.00 24.63 ? 574  LYS B CA  1 
ATOM   4153 C C   . LYS B 1 275 ? -30.917 19.520 -39.308 1.00 25.09 ? 574  LYS B C   1 
ATOM   4154 O O   . LYS B 1 275 ? -31.739 19.989 -40.112 1.00 21.75 ? 574  LYS B O   1 
ATOM   4155 C CB  . LYS B 1 275 ? -31.126 17.178 -40.142 1.00 24.03 ? 574  LYS B CB  1 
ATOM   4156 C CG  . LYS B 1 275 ? -31.806 16.178 -39.238 1.00 23.90 ? 574  LYS B CG  1 
ATOM   4157 C CD  . LYS B 1 275 ? -33.105 15.678 -39.880 1.00 24.20 ? 574  LYS B CD  1 
ATOM   4158 C CE  . LYS B 1 275 ? -33.076 14.166 -40.059 1.00 24.11 ? 574  LYS B CE  1 
ATOM   4159 N NZ  . LYS B 1 275 ? -34.372 13.666 -40.600 1.00 23.82 ? 574  LYS B NZ  1 
ATOM   4160 N N   . ALA B 1 276 ? -30.653 20.095 -38.144 1.00 25.24 ? 575  ALA B N   1 
ATOM   4161 C CA  . ALA B 1 276 ? -31.317 21.342 -37.758 1.00 26.27 ? 575  ALA B CA  1 
ATOM   4162 C C   . ALA B 1 276 ? -30.992 22.453 -38.748 1.00 27.35 ? 575  ALA B C   1 
ATOM   4163 O O   . ALA B 1 276 ? -29.845 22.600 -39.182 1.00 28.22 ? 575  ALA B O   1 
ATOM   4164 C CB  . ALA B 1 276 ? -30.918 21.710 -36.339 1.00 27.13 ? 575  ALA B CB  1 
ATOM   4165 N N   . GLY B 1 277 ? -31.998 23.243 -39.107 1.00 28.08 ? 576  GLY B N   1 
ATOM   4166 C CA  . GLY B 1 277 ? -31.822 24.382 -39.986 1.00 29.38 ? 576  GLY B CA  1 
ATOM   4167 C C   . GLY B 1 277 ? -31.628 25.680 -39.222 1.00 31.29 ? 576  GLY B C   1 
ATOM   4168 O O   . GLY B 1 277 ? -31.800 25.726 -38.000 1.00 32.80 ? 576  GLY B O   1 
ATOM   4169 N N   . PRO B 1 278 ? -31.272 26.751 -39.927 1.00 32.33 ? 577  PRO B N   1 
ATOM   4170 C CA  . PRO B 1 278 ? -31.036 28.042 -39.265 1.00 31.64 ? 577  PRO B CA  1 
ATOM   4171 C C   . PRO B 1 278 ? -32.348 28.633 -38.775 1.00 31.39 ? 577  PRO B C   1 
ATOM   4172 O O   . PRO B 1 278 ? -33.415 28.110 -39.107 1.00 36.90 ? 577  PRO B O   1 
ATOM   4173 C CB  . PRO B 1 278 ? -30.457 28.906 -40.387 1.00 31.59 ? 577  PRO B CB  1 
ATOM   4174 C CG  . PRO B 1 278 ? -31.035 28.319 -41.630 1.00 32.01 ? 577  PRO B CG  1 
ATOM   4175 C CD  . PRO B 1 278 ? -31.094 26.832 -41.387 1.00 32.43 ? 577  PRO B CD  1 
ATOM   4176 N N   . PRO B 1 279 ? -32.280 29.712 -38.010 1.00 29.37 ? 578  PRO B N   1 
ATOM   4177 C CA  . PRO B 1 279 ? -33.488 30.433 -37.594 1.00 27.56 ? 578  PRO B CA  1 
ATOM   4178 C C   . PRO B 1 279 ? -34.432 30.689 -38.768 1.00 24.97 ? 578  PRO B C   1 
ATOM   4179 O O   . PRO B 1 279 ? -35.653 30.630 -38.618 1.00 21.51 ? 578  PRO B O   1 
ATOM   4180 C CB  . PRO B 1 279 ? -32.907 31.758 -37.097 1.00 28.62 ? 578  PRO B CB  1 
ATOM   4181 C CG  . PRO B 1 279 ? -31.598 31.348 -36.503 1.00 28.95 ? 578  PRO B CG  1 
ATOM   4182 C CD  . PRO B 1 279 ? -31.058 30.330 -37.474 1.00 29.28 ? 578  PRO B CD  1 
ATOM   4183 N N   . ALA B 1 280 ? -33.846 30.959 -39.922 1.00 23.12 ? 579  ALA B N   1 
ATOM   4184 C CA  . ALA B 1 280 ? -34.548 31.212 -41.161 1.00 21.37 ? 579  ALA B CA  1 
ATOM   4185 C C   . ALA B 1 280 ? -35.732 30.287 -41.388 1.00 18.99 ? 579  ALA B C   1 
ATOM   4186 O O   . ALA B 1 280 ? -36.771 30.686 -41.912 1.00 12.49 ? 579  ALA B O   1 
ATOM   4187 C CB  . ALA B 1 280 ? -33.562 31.101 -42.326 1.00 19.23 ? 579  ALA B CB  1 
ATOM   4188 N N   . SER B 1 281 ? -35.594 29.023 -40.971 1.00 18.92 ? 580  SER B N   1 
ATOM   4189 C CA  . SER B 1 281 ? -36.721 28.091 -41.158 1.00 18.78 ? 580  SER B CA  1 
ATOM   4190 C C   . SER B 1 281 ? -37.882 28.496 -40.257 1.00 19.54 ? 580  SER B C   1 
ATOM   4191 O O   . SER B 1 281 ? -39.043 28.262 -40.609 1.00 20.64 ? 580  SER B O   1 
ATOM   4192 C CB  . SER B 1 281 ? -36.306 26.643 -40.958 1.00 18.15 ? 580  SER B CB  1 
ATOM   4193 O OG  . SER B 1 281 ? -35.675 26.380 -39.731 1.00 17.88 ? 580  SER B OG  1 
ATOM   4194 N N   . ILE B 1 282 ? -37.589 29.141 -39.141 1.00 20.30 ? 581  ILE B N   1 
ATOM   4195 C CA  . ILE B 1 282 ? -38.608 29.556 -38.185 1.00 20.92 ? 581  ILE B CA  1 
ATOM   4196 C C   . ILE B 1 282 ? -39.464 30.729 -38.622 1.00 22.10 ? 581  ILE B C   1 
ATOM   4197 O O   . ILE B 1 282 ? -40.672 30.748 -38.365 1.00 22.52 ? 581  ILE B O   1 
ATOM   4198 C CB  . ILE B 1 282 ? -37.926 29.896 -36.834 1.00 20.12 ? 581  ILE B CB  1 
ATOM   4199 C CG1 . ILE B 1 282 ? -36.877 28.869 -36.429 1.00 19.74 ? 581  ILE B CG1 1 
ATOM   4200 C CG2 . ILE B 1 282 ? -38.968 30.117 -35.751 1.00 18.92 ? 581  ILE B CG2 1 
ATOM   4201 C CD1 . ILE B 1 282 ? -37.050 28.194 -35.096 1.00 20.19 ? 581  ILE B CD1 1 
ATOM   4202 N N   . VAL B 1 283 ? -38.868 31.714 -39.293 1.00 23.21 ? 582  VAL B N   1 
ATOM   4203 C CA  . VAL B 1 283 ? -39.641 32.879 -39.730 1.00 24.63 ? 582  VAL B CA  1 
ATOM   4204 C C   . VAL B 1 283 ? -40.839 32.566 -40.597 1.00 24.69 ? 582  VAL B C   1 
ATOM   4205 O O   . VAL B 1 283 ? -41.824 33.336 -40.495 1.00 19.33 ? 582  VAL B O   1 
ATOM   4206 C CB  . VAL B 1 283 ? -38.798 33.976 -40.429 1.00 25.48 ? 582  VAL B CB  1 
ATOM   4207 C CG1 . VAL B 1 283 ? -38.136 34.839 -39.353 1.00 25.03 ? 582  VAL B CG1 1 
ATOM   4208 C CG2 . VAL B 1 283 ? -37.759 33.457 -41.402 1.00 30.35 ? 582  VAL B CG2 1 
ATOM   4209 N N   . PRO B 1 284 ? -40.843 31.544 -41.425 1.00 25.42 ? 583  PRO B N   1 
ATOM   4210 C CA  . PRO B 1 284 ? -42.107 31.195 -42.129 1.00 23.98 ? 583  PRO B CA  1 
ATOM   4211 C C   . PRO B 1 284 ? -43.090 30.418 -41.282 1.00 21.76 ? 583  PRO B C   1 
ATOM   4212 O O   . PRO B 1 284 ? -44.086 29.905 -41.806 1.00 21.94 ? 583  PRO B O   1 
ATOM   4213 C CB  . PRO B 1 284 ? -41.670 30.322 -43.312 1.00 24.11 ? 583  PRO B CB  1 
ATOM   4214 C CG  . PRO B 1 284 ? -40.186 30.347 -43.319 1.00 24.91 ? 583  PRO B CG  1 
ATOM   4215 C CD  . PRO B 1 284 ? -39.799 30.615 -41.897 1.00 25.63 ? 583  PRO B CD  1 
ATOM   4216 N N   . LEU B 1 285 ? -42.846 30.306 -39.980 1.00 21.25 ? 584  LEU B N   1 
ATOM   4217 C CA  . LEU B 1 285 ? -43.867 29.671 -39.124 1.00 21.42 ? 584  LEU B CA  1 
ATOM   4218 C C   . LEU B 1 285 ? -44.645 30.781 -38.413 1.00 21.23 ? 584  LEU B C   1 
ATOM   4219 O O   . LEU B 1 285 ? -45.866 30.732 -38.322 1.00 18.25 ? 584  LEU B O   1 
ATOM   4220 C CB  . LEU B 1 285 ? -43.371 28.702 -38.075 1.00 21.53 ? 584  LEU B CB  1 
ATOM   4221 C CG  . LEU B 1 285 ? -42.973 27.285 -38.470 1.00 20.88 ? 584  LEU B CG  1 
ATOM   4222 C CD1 . LEU B 1 285 ? -41.626 27.032 -37.819 1.00 19.63 ? 584  LEU B CD1 1 
ATOM   4223 C CD2 . LEU B 1 285 ? -44.000 26.246 -38.065 1.00 22.67 ? 584  LEU B CD2 1 
ATOM   4224 N N   . MET B 1 286 ? -43.907 31.768 -37.911 1.00 23.16 ? 585  MET B N   1 
ATOM   4225 C CA  . MET B 1 286 ? -44.508 32.951 -37.321 1.00 25.45 ? 585  MET B CA  1 
ATOM   4226 C C   . MET B 1 286 ? -44.979 33.918 -38.395 1.00 28.36 ? 585  MET B C   1 
ATOM   4227 O O   . MET B 1 286 ? -45.759 34.839 -38.154 1.00 32.28 ? 585  MET B O   1 
ATOM   4228 C CB  . MET B 1 286 ? -43.496 33.643 -36.419 1.00 24.46 ? 585  MET B CB  1 
ATOM   4229 C CG  . MET B 1 286 ? -43.649 33.182 -34.977 1.00 24.11 ? 585  MET B CG  1 
ATOM   4230 S SD  . MET B 1 286 ? -42.120 32.636 -34.239 1.00 22.34 ? 585  MET B SD  1 
ATOM   4231 C CE  . MET B 1 286 ? -41.781 33.901 -33.019 1.00 21.18 ? 585  MET B CE  1 
ATOM   4232 N N   . ARG B 1 287 ? -44.491 33.697 -39.623 1.00 29.31 ? 586  ARG B N   1 
ATOM   4233 C CA  . ARG B 1 287 ? -45.036 34.460 -40.748 1.00 31.66 ? 586  ARG B CA  1 
ATOM   4234 C C   . ARG B 1 287 ? -46.474 34.033 -40.980 1.00 33.02 ? 586  ARG B C   1 
ATOM   4235 O O   . ARG B 1 287 ? -47.255 34.779 -41.572 1.00 35.30 ? 586  ARG B O   1 
ATOM   4236 C CB  . ARG B 1 287 ? -44.140 34.340 -41.977 1.00 31.91 ? 586  ARG B CB  1 
ATOM   4237 C CG  . ARG B 1 287 ? -43.732 35.671 -42.577 1.00 31.72 ? 586  ARG B CG  1 
ATOM   4238 C CD  . ARG B 1 287 ? -42.861 36.567 -41.730 1.00 31.88 ? 586  ARG B CD  1 
ATOM   4239 N NE  . ARG B 1 287 ? -43.579 37.303 -40.700 1.00 32.51 ? 586  ARG B NE  1 
ATOM   4240 C CZ  . ARG B 1 287 ? -43.095 37.884 -39.612 1.00 32.93 ? 586  ARG B CZ  1 
ATOM   4241 N NH1 . ARG B 1 287 ? -41.798 37.870 -39.327 1.00 32.15 ? 586  ARG B NH1 1 
ATOM   4242 N NH2 . ARG B 1 287 ? -43.919 38.506 -38.777 1.00 34.82 ? 586  ARG B NH2 1 
ATOM   4243 N N   . GLN B 1 288 ? -46.849 32.854 -40.485 1.00 33.61 ? 587  GLN B N   1 
ATOM   4244 C CA  . GLN B 1 288 ? -48.267 32.483 -40.463 1.00 34.85 ? 587  GLN B CA  1 
ATOM   4245 C C   . GLN B 1 288 ? -48.825 32.703 -39.048 1.00 35.38 ? 587  GLN B C   1 
ATOM   4246 O O   . GLN B 1 288 ? -49.509 33.694 -38.789 1.00 35.56 ? 587  GLN B O   1 
ATOM   4247 C CB  . GLN B 1 288 ? -48.531 31.063 -40.944 1.00 34.89 ? 587  GLN B CB  1 
ATOM   4248 C CG  . GLN B 1 288 ? -47.664 29.946 -40.409 1.00 34.73 ? 587  GLN B CG  1 
ATOM   4249 C CD  . GLN B 1 288 ? -47.411 28.864 -41.441 1.00 34.22 ? 587  GLN B CD  1 
ATOM   4250 O OE1 . GLN B 1 288 ? -46.276 28.674 -41.875 1.00 32.41 ? 587  GLN B OE1 1 
ATOM   4251 N NE2 . GLN B 1 288 ? -48.470 28.167 -41.838 1.00 34.13 ? 587  GLN B NE2 1 
HETATM 4252 O O   . HOH C 2 .   ? -32.078 61.376 -2.540  1.00 2.33  ? 2001 HOH A O   1 
HETATM 4253 O O   . HOH C 2 .   ? -12.434 62.575 4.126   1.00 28.64 ? 2002 HOH A O   1 
HETATM 4254 O O   . HOH C 2 .   ? -12.834 54.079 3.642   1.00 20.94 ? 2003 HOH A O   1 
HETATM 4255 O O   . HOH C 2 .   ? -15.691 52.936 11.829  1.00 8.19  ? 2004 HOH A O   1 
HETATM 4256 O O   . HOH C 2 .   ? 3.459   48.716 -1.333  1.00 3.11  ? 2005 HOH A O   1 
HETATM 4257 O O   . HOH C 2 .   ? 3.769   54.527 5.582   1.00 7.91  ? 2006 HOH A O   1 
HETATM 4258 O O   . HOH C 2 .   ? 4.144   56.839 4.648   1.00 4.89  ? 2007 HOH A O   1 
HETATM 4259 O O   . HOH C 2 .   ? -15.435 54.066 21.403  1.00 3.74  ? 2008 HOH A O   1 
HETATM 4260 O O   . HOH C 2 .   ? -12.403 52.950 0.706   1.00 4.85  ? 2009 HOH A O   1 
HETATM 4261 O O   . HOH C 2 .   ? -12.244 34.891 -12.746 1.00 11.75 ? 2010 HOH A O   1 
HETATM 4262 O O   . HOH C 2 .   ? 11.556  46.290 -0.059  1.00 5.24  ? 2011 HOH A O   1 
HETATM 4263 O O   . HOH C 2 .   ? 5.472   46.993 -3.319  1.00 2.52  ? 2012 HOH A O   1 
HETATM 4264 O O   . HOH C 2 .   ? 6.284   43.525 -3.417  1.00 2.76  ? 2013 HOH A O   1 
HETATM 4265 O O   . HOH C 2 .   ? 13.285  46.077 1.435   1.00 2.04  ? 2014 HOH A O   1 
HETATM 4266 O O   . HOH C 2 .   ? 14.473  58.091 8.344   1.00 15.28 ? 2015 HOH A O   1 
HETATM 4267 O O   . HOH C 2 .   ? 20.146  53.728 4.671   1.00 7.74  ? 2016 HOH A O   1 
HETATM 4268 O O   . HOH C 2 .   ? 20.377  36.169 0.879   1.00 7.01  ? 2017 HOH A O   1 
HETATM 4269 O O   . HOH C 2 .   ? 13.817  48.331 29.987  1.00 11.49 ? 2018 HOH A O   1 
HETATM 4270 O O   . HOH C 2 .   ? 10.190  32.600 21.328  1.00 7.45  ? 2019 HOH A O   1 
HETATM 4271 O O   . HOH C 2 .   ? 6.153   30.331 -1.338  1.00 8.77  ? 2020 HOH A O   1 
HETATM 4272 O O   . HOH C 2 .   ? -4.626  28.371 10.826  1.00 12.36 ? 2021 HOH A O   1 
HETATM 4273 O O   . HOH D 2 .   ? -35.153 52.442 -30.072 1.00 12.72 ? 2001 HOH B O   1 
HETATM 4274 O O   . HOH D 2 .   ? -25.802 40.965 -22.068 1.00 14.09 ? 2002 HOH B O   1 
HETATM 4275 O O   . HOH D 2 .   ? -31.059 25.678 -33.588 1.00 8.84  ? 2003 HOH B O   1 
HETATM 4276 O O   . HOH D 2 .   ? -24.844 22.705 -30.529 1.00 15.74 ? 2004 HOH B O   1 
HETATM 4277 O O   . HOH D 2 .   ? -21.921 21.807 -9.706  1.00 28.30 ? 2005 HOH B O   1 
HETATM 4278 O O   . HOH D 2 .   ? -22.088 30.667 -16.143 1.00 22.96 ? 2006 HOH B O   1 
HETATM 4279 O O   . HOH D 2 .   ? -49.913 24.754 -19.820 1.00 7.30  ? 2007 HOH B O   1 
HETATM 4280 O O   . HOH D 2 .   ? -51.946 25.408 -24.263 1.00 32.91 ? 2008 HOH B O   1 
HETATM 4281 O O   . HOH D 2 .   ? -45.552 13.125 -18.438 1.00 17.34 ? 2009 HOH B O   1 
HETATM 4282 O O   . HOH D 2 .   ? -50.151 23.495 -24.277 1.00 3.74  ? 2010 HOH B O   1 
HETATM 4283 O O   . HOH D 2 .   ? -50.479 13.169 -29.499 1.00 25.50 ? 2011 HOH B O   1 
HETATM 4284 O O   . HOH D 2 .   ? -51.607 12.136 -8.455  1.00 10.31 ? 2012 HOH B O   1 
HETATM 4285 O O   . HOH D 2 .   ? -45.683 7.280  -19.762 1.00 13.89 ? 2013 HOH B O   1 
HETATM 4286 O O   . HOH D 2 .   ? -43.598 6.507  -30.759 1.00 2.15  ? 2014 HOH B O   1 
HETATM 4287 O O   . HOH D 2 .   ? -36.191 -0.906 -13.961 1.00 14.03 ? 2015 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   300 300 SER SER A . n 
A 1 2   HIS 2   301 301 HIS HIS A . n 
A 1 3   GLU 3   302 302 GLU GLU A . n 
A 1 4   GLN 4   303 303 GLN GLN A . n 
A 1 5   PHE 5   304 304 PHE PHE A . n 
A 1 6   ARG 6   305 305 ARG ARG A . n 
A 1 7   ALA 7   306 306 ALA ALA A . n 
A 1 8   ALA 8   307 307 ALA ALA A . n 
A 1 9   LEU 9   308 308 LEU LEU A . n 
A 1 10  GLN 10  309 309 GLN GLN A . n 
A 1 11  LEU 11  310 310 LEU LEU A . n 
A 1 12  VAL 12  311 311 VAL VAL A . n 
A 1 13  VAL 13  312 312 VAL VAL A . n 
A 1 14  ASP 14  313 313 ASP ASP A . n 
A 1 15  PRO 15  314 314 PRO PRO A . n 
A 1 16  GLY 16  315 315 GLY GLY A . n 
A 1 17  ASP 17  316 316 ASP ASP A . n 
A 1 18  PRO 18  317 317 PRO PRO A . n 
A 1 19  ARG 19  318 318 ARG ARG A . n 
A 1 20  SER 20  319 319 SER SER A . n 
A 1 21  TYR 21  320 320 TYR TYR A . n 
A 1 22  LEU 22  321 321 LEU LEU A . n 
A 1 23  ASP 23  322 322 ASP ASP A . n 
A 1 24  ASN 24  323 323 ASN ASN A . n 
A 1 25  PHE 25  324 324 PHE PHE A . n 
A 1 26  ILE 26  325 325 ILE ILE A . n 
A 1 27  LYS 27  326 326 LYS LYS A . n 
A 1 28  ILE 28  327 327 ILE ILE A . n 
A 1 29  GLY 29  328 328 GLY GLY A . n 
A 1 30  GLU 30  329 ?   ?   ?   A . n 
A 1 31  GLY 31  330 ?   ?   ?   A . n 
A 1 32  SER 32  331 ?   ?   ?   A . n 
A 1 33  THR 33  332 ?   ?   ?   A . n 
A 1 34  GLY 34  333 ?   ?   ?   A . n 
A 1 35  ILE 35  334 334 ILE ILE A . n 
A 1 36  VAL 36  335 335 VAL VAL A . n 
A 1 37  CYS 37  336 336 CYS CYS A . n 
A 1 38  ILE 38  337 337 ILE ILE A . n 
A 1 39  ALA 39  338 338 ALA ALA A . n 
A 1 40  THR 40  339 339 THR THR A . n 
A 1 41  VAL 41  340 340 VAL VAL A . n 
A 1 42  ARG 42  341 341 ARG ARG A . n 
A 1 43  SER 43  342 342 SER SER A . n 
A 1 44  SER 44  343 343 SER SER A . n 
A 1 45  GLY 45  344 344 GLY GLY A . n 
A 1 46  LYS 46  345 345 LYS LYS A . n 
A 1 47  LEU 47  346 346 LEU LEU A . n 
A 1 48  VAL 48  347 347 VAL VAL A . n 
A 1 49  ALA 49  348 348 ALA ALA A . n 
A 1 50  VAL 50  349 349 VAL VAL A . n 
A 1 51  LYS 51  350 350 LYS LYS A . n 
A 1 52  LYS 52  351 351 LYS LYS A . n 
A 1 53  MET 53  352 352 MET MET A . n 
A 1 54  ASP 54  353 353 ASP ASP A . n 
A 1 55  LEU 55  354 ?   ?   ?   A . n 
A 1 56  ARG 56  355 ?   ?   ?   A . n 
A 1 57  LYS 57  356 ?   ?   ?   A . n 
A 1 58  GLN 58  357 ?   ?   ?   A . n 
A 1 59  GLN 59  358 ?   ?   ?   A . n 
A 1 60  ARG 60  359 ?   ?   ?   A . n 
A 1 61  ARG 61  360 ?   ?   ?   A . n 
A 1 62  GLU 62  361 ?   ?   ?   A . n 
A 1 63  LEU 63  362 362 LEU LEU A . n 
A 1 64  LEU 64  363 363 LEU LEU A . n 
A 1 65  PHE 65  364 364 PHE PHE A . n 
A 1 66  ASN 66  365 365 ASN ASN A . n 
A 1 67  GLU 67  366 366 GLU GLU A . n 
A 1 68  VAL 68  367 367 VAL VAL A . n 
A 1 69  VAL 69  368 368 VAL VAL A . n 
A 1 70  ILE 70  369 369 ILE ILE A . n 
A 1 71  MET 71  370 370 MET MET A . n 
A 1 72  ARG 72  371 371 ARG ARG A . n 
A 1 73  ASP 73  372 372 ASP ASP A . n 
A 1 74  TYR 74  373 373 TYR TYR A . n 
A 1 75  GLN 75  374 374 GLN GLN A . n 
A 1 76  HIS 76  375 375 HIS HIS A . n 
A 1 77  GLU 77  376 376 GLU GLU A . n 
A 1 78  ASN 78  377 377 ASN ASN A . n 
A 1 79  VAL 79  378 378 VAL VAL A . n 
A 1 80  VAL 80  379 379 VAL VAL A . n 
A 1 81  GLU 81  380 380 GLU GLU A . n 
A 1 82  MET 82  381 381 MET MET A . n 
A 1 83  TYR 83  382 382 TYR TYR A . n 
A 1 84  ASN 84  383 383 ASN ASN A . n 
A 1 85  SER 85  384 384 SER SER A . n 
A 1 86  TYR 86  385 385 TYR TYR A . n 
A 1 87  LEU 87  386 386 LEU LEU A . n 
A 1 88  VAL 88  387 387 VAL VAL A . n 
A 1 89  GLY 89  388 388 GLY GLY A . n 
A 1 90  ASP 90  389 389 ASP ASP A . n 
A 1 91  GLU 91  390 390 GLU GLU A . n 
A 1 92  LEU 92  391 391 LEU LEU A . n 
A 1 93  TRP 93  392 392 TRP TRP A . n 
A 1 94  VAL 94  393 393 VAL VAL A . n 
A 1 95  VAL 95  394 394 VAL VAL A . n 
A 1 96  MET 96  395 395 MET MET A . n 
A 1 97  GLU 97  396 396 GLU GLU A . n 
A 1 98  PHE 98  397 397 PHE PHE A . n 
A 1 99  LEU 99  398 398 LEU LEU A . n 
A 1 100 GLU 100 399 399 GLU GLU A . n 
A 1 101 GLY 101 400 400 GLY GLY A . n 
A 1 102 GLY 102 401 401 GLY GLY A . n 
A 1 103 ALA 103 402 402 ALA ALA A . n 
A 1 104 LEU 104 403 403 LEU LEU A . n 
A 1 105 THR 105 404 404 THR THR A . n 
A 1 106 ASP 106 405 405 ASP ASP A . n 
A 1 107 ILE 107 406 406 ILE ILE A . n 
A 1 108 VAL 108 407 407 VAL VAL A . n 
A 1 109 THR 109 408 408 THR THR A . n 
A 1 110 HIS 110 409 409 HIS HIS A . n 
A 1 111 THR 111 410 410 THR THR A . n 
A 1 112 ARG 112 411 411 ARG ARG A . n 
A 1 113 MET 113 412 412 MET MET A . n 
A 1 114 ASN 114 413 413 ASN ASN A . n 
A 1 115 GLU 115 414 414 GLU GLU A . n 
A 1 116 GLU 116 415 415 GLU GLU A . n 
A 1 117 GLN 117 416 416 GLN GLN A . n 
A 1 118 ILE 118 417 417 ILE ILE A . n 
A 1 119 ALA 119 418 418 ALA ALA A . n 
A 1 120 ALA 120 419 419 ALA ALA A . n 
A 1 121 VAL 121 420 420 VAL VAL A . n 
A 1 122 CYS 122 421 421 CYS CYS A . n 
A 1 123 LEU 123 422 422 LEU LEU A . n 
A 1 124 ALA 124 423 423 ALA ALA A . n 
A 1 125 VAL 125 424 424 VAL VAL A . n 
A 1 126 LEU 126 425 425 LEU LEU A . n 
A 1 127 GLN 127 426 426 GLN GLN A . n 
A 1 128 ALA 128 427 427 ALA ALA A . n 
A 1 129 LEU 129 428 428 LEU LEU A . n 
A 1 130 SER 130 429 429 SER SER A . n 
A 1 131 VAL 131 430 430 VAL VAL A . n 
A 1 132 LEU 132 431 431 LEU LEU A . n 
A 1 133 HIS 133 432 432 HIS HIS A . n 
A 1 134 ALA 134 433 433 ALA ALA A . n 
A 1 135 GLN 135 434 434 GLN GLN A . n 
A 1 136 GLY 136 435 435 GLY GLY A . n 
A 1 137 VAL 137 436 436 VAL VAL A . n 
A 1 138 ILE 138 437 437 ILE ILE A . n 
A 1 139 HIS 139 438 438 HIS HIS A . n 
A 1 140 ARG 140 439 439 ARG ARG A . n 
A 1 141 ASP 141 440 440 ASP ASP A . n 
A 1 142 ILE 142 441 441 ILE ILE A . n 
A 1 143 LYS 143 442 442 LYS LYS A . n 
A 1 144 SER 144 443 443 SER SER A . n 
A 1 145 ASP 145 444 444 ASP ASP A . n 
A 1 146 SER 146 445 445 SER SER A . n 
A 1 147 ILE 147 446 446 ILE ILE A . n 
A 1 148 LEU 148 447 447 LEU LEU A . n 
A 1 149 LEU 149 448 448 LEU LEU A . n 
A 1 150 THR 150 449 449 THR THR A . n 
A 1 151 HIS 151 450 450 HIS HIS A . n 
A 1 152 ASP 152 451 451 ASP ASP A . n 
A 1 153 GLY 153 452 452 GLY GLY A . n 
A 1 154 ARG 154 453 453 ARG ARG A . n 
A 1 155 VAL 155 454 454 VAL VAL A . n 
A 1 156 LYS 156 455 455 LYS LYS A . n 
A 1 157 LEU 157 456 456 LEU LEU A . n 
A 1 158 SER 158 457 457 SER SER A . n 
A 1 159 ASP 159 458 458 ASP ASP A . n 
A 1 160 PHE 160 459 459 PHE PHE A . n 
A 1 161 GLY 161 460 460 GLY GLY A . n 
A 1 162 PHE 162 461 461 PHE PHE A . n 
A 1 163 CYS 163 462 462 CYS CYS A . n 
A 1 164 ALA 164 463 463 ALA ALA A . n 
A 1 165 GLN 165 464 464 GLN GLN A . n 
A 1 166 VAL 166 465 465 VAL VAL A . n 
A 1 167 SER 167 466 ?   ?   ?   A . n 
A 1 168 LYS 168 467 ?   ?   ?   A . n 
A 1 169 GLU 169 468 468 GLU GLU A . n 
A 1 170 VAL 170 469 469 VAL VAL A . n 
A 1 171 PRO 171 470 470 PRO PRO A . n 
A 1 172 ARG 172 471 471 ARG ARG A . n 
A 1 173 ARG 173 472 472 ARG ARG A . n 
A 1 174 LYS 174 473 473 LYS LYS A . n 
A 1 175 SEP 175 474 474 SEP SEP A . n 
A 1 176 LEU 176 475 475 LEU LEU A . n 
A 1 177 VAL 177 476 476 VAL VAL A . n 
A 1 178 GLY 178 477 477 GLY GLY A . n 
A 1 179 THR 179 478 478 THR THR A . n 
A 1 180 PRO 180 479 479 PRO PRO A . n 
A 1 181 TYR 181 480 480 TYR TYR A . n 
A 1 182 TRP 182 481 481 TRP TRP A . n 
A 1 183 MET 183 482 482 MET MET A . n 
A 1 184 ALA 184 483 483 ALA ALA A . n 
A 1 185 PRO 185 484 484 PRO PRO A . n 
A 1 186 GLU 186 485 485 GLU GLU A . n 
A 1 187 LEU 187 486 486 LEU LEU A . n 
A 1 188 ILE 188 487 487 ILE ILE A . n 
A 1 189 SER 189 488 488 SER SER A . n 
A 1 190 ARG 190 489 489 ARG ARG A . n 
A 1 191 LEU 191 490 490 LEU LEU A . n 
A 1 192 PRO 192 491 491 PRO PRO A . n 
A 1 193 TYR 193 492 492 TYR TYR A . n 
A 1 194 GLY 194 493 493 GLY GLY A . n 
A 1 195 PRO 195 494 494 PRO PRO A . n 
A 1 196 GLU 196 495 495 GLU GLU A . n 
A 1 197 VAL 197 496 496 VAL VAL A . n 
A 1 198 ASP 198 497 497 ASP ASP A . n 
A 1 199 ILE 199 498 498 ILE ILE A . n 
A 1 200 TRP 200 499 499 TRP TRP A . n 
A 1 201 SER 201 500 500 SER SER A . n 
A 1 202 LEU 202 501 501 LEU LEU A . n 
A 1 203 GLY 203 502 502 GLY GLY A . n 
A 1 204 ILE 204 503 503 ILE ILE A . n 
A 1 205 MET 205 504 504 MET MET A . n 
A 1 206 VAL 206 505 505 VAL VAL A . n 
A 1 207 ILE 207 506 506 ILE ILE A . n 
A 1 208 GLU 208 507 507 GLU GLU A . n 
A 1 209 MET 209 508 508 MET MET A . n 
A 1 210 VAL 210 509 509 VAL VAL A . n 
A 1 211 ASP 211 510 510 ASP ASP A . n 
A 1 212 GLY 212 511 511 GLY GLY A . n 
A 1 213 GLU 213 512 512 GLU GLU A . n 
A 1 214 PRO 214 513 513 PRO PRO A . n 
A 1 215 PRO 215 514 514 PRO PRO A . n 
A 1 216 TYR 216 515 515 TYR TYR A . n 
A 1 217 PHE 217 516 516 PHE PHE A . n 
A 1 218 ASN 218 517 517 ASN ASN A . n 
A 1 219 GLU 219 518 518 GLU GLU A . n 
A 1 220 PRO 220 519 519 PRO PRO A . n 
A 1 221 PRO 221 520 520 PRO PRO A . n 
A 1 222 LEU 222 521 521 LEU LEU A . n 
A 1 223 LYS 223 522 522 LYS LYS A . n 
A 1 224 ALA 224 523 523 ALA ALA A . n 
A 1 225 MET 225 524 524 MET MET A . n 
A 1 226 LYS 226 525 525 LYS LYS A . n 
A 1 227 MET 227 526 526 MET MET A . n 
A 1 228 ILE 228 527 527 ILE ILE A . n 
A 1 229 ARG 229 528 528 ARG ARG A . n 
A 1 230 ASP 230 529 529 ASP ASP A . n 
A 1 231 ASN 231 530 530 ASN ASN A . n 
A 1 232 LEU 232 531 531 LEU LEU A . n 
A 1 233 PRO 233 532 532 PRO PRO A . n 
A 1 234 PRO 234 533 533 PRO PRO A . n 
A 1 235 ARG 235 534 534 ARG ARG A . n 
A 1 236 LEU 236 535 535 LEU LEU A . n 
A 1 237 LYS 237 536 536 LYS LYS A . n 
A 1 238 ASN 238 537 537 ASN ASN A . n 
A 1 239 LEU 239 538 538 LEU LEU A . n 
A 1 240 HIS 240 539 539 HIS HIS A . n 
A 1 241 LYS 241 540 540 LYS LYS A . n 
A 1 242 VAL 242 541 541 VAL VAL A . n 
A 1 243 SER 243 542 542 SER SER A . n 
A 1 244 PRO 244 543 543 PRO PRO A . n 
A 1 245 SER 245 544 544 SER SER A . n 
A 1 246 LEU 246 545 545 LEU LEU A . n 
A 1 247 LYS 247 546 546 LYS LYS A . n 
A 1 248 GLY 248 547 547 GLY GLY A . n 
A 1 249 PHE 249 548 548 PHE PHE A . n 
A 1 250 LEU 250 549 549 LEU LEU A . n 
A 1 251 ASP 251 550 550 ASP ASP A . n 
A 1 252 ARG 252 551 551 ARG ARG A . n 
A 1 253 LEU 253 552 552 LEU LEU A . n 
A 1 254 LEU 254 553 553 LEU LEU A . n 
A 1 255 VAL 255 554 554 VAL VAL A . n 
A 1 256 ARG 256 555 555 ARG ARG A . n 
A 1 257 ASP 257 556 556 ASP ASP A . n 
A 1 258 PRO 258 557 557 PRO PRO A . n 
A 1 259 ALA 259 558 558 ALA ALA A . n 
A 1 260 GLN 260 559 559 GLN GLN A . n 
A 1 261 ARG 261 560 560 ARG ARG A . n 
A 1 262 ALA 262 561 561 ALA ALA A . n 
A 1 263 THR 263 562 562 THR THR A . n 
A 1 264 ALA 264 563 563 ALA ALA A . n 
A 1 265 ALA 265 564 564 ALA ALA A . n 
A 1 266 GLU 266 565 565 GLU GLU A . n 
A 1 267 LEU 267 566 566 LEU LEU A . n 
A 1 268 LEU 268 567 567 LEU LEU A . n 
A 1 269 LYS 269 568 568 LYS LYS A . n 
A 1 270 HIS 270 569 569 HIS HIS A . n 
A 1 271 PRO 271 570 570 PRO PRO A . n 
A 1 272 PHE 272 571 571 PHE PHE A . n 
A 1 273 LEU 273 572 572 LEU LEU A . n 
A 1 274 ALA 274 573 573 ALA ALA A . n 
A 1 275 LYS 275 574 574 LYS LYS A . n 
A 1 276 ALA 276 575 575 ALA ALA A . n 
A 1 277 GLY 277 576 576 GLY GLY A . n 
A 1 278 PRO 278 577 577 PRO PRO A . n 
A 1 279 PRO 279 578 578 PRO PRO A . n 
A 1 280 ALA 280 579 579 ALA ALA A . n 
A 1 281 SER 281 580 580 SER SER A . n 
A 1 282 ILE 282 581 581 ILE ILE A . n 
A 1 283 VAL 283 582 582 VAL VAL A . n 
A 1 284 PRO 284 583 583 PRO PRO A . n 
A 1 285 LEU 285 584 584 LEU LEU A . n 
A 1 286 MET 286 585 585 MET MET A . n 
A 1 287 ARG 287 586 586 ARG ARG A . n 
A 1 288 GLN 288 587 587 GLN GLN A . n 
A 1 289 ASN 289 588 ?   ?   ?   A . n 
A 1 290 ARG 290 589 ?   ?   ?   A . n 
A 1 291 THR 291 590 ?   ?   ?   A . n 
A 1 292 ARG 292 591 ?   ?   ?   A . n 
B 1 1   SER 1   300 ?   ?   ?   B . n 
B 1 2   HIS 2   301 301 HIS HIS B . n 
B 1 3   GLU 3   302 302 GLU GLU B . n 
B 1 4   GLN 4   303 303 GLN GLN B . n 
B 1 5   PHE 5   304 304 PHE PHE B . n 
B 1 6   ARG 6   305 305 ARG ARG B . n 
B 1 7   ALA 7   306 306 ALA ALA B . n 
B 1 8   ALA 8   307 307 ALA ALA B . n 
B 1 9   LEU 9   308 308 LEU LEU B . n 
B 1 10  GLN 10  309 309 GLN GLN B . n 
B 1 11  LEU 11  310 310 LEU LEU B . n 
B 1 12  VAL 12  311 311 VAL VAL B . n 
B 1 13  VAL 13  312 312 VAL VAL B . n 
B 1 14  ASP 14  313 313 ASP ASP B . n 
B 1 15  PRO 15  314 314 PRO PRO B . n 
B 1 16  GLY 16  315 315 GLY GLY B . n 
B 1 17  ASP 17  316 316 ASP ASP B . n 
B 1 18  PRO 18  317 317 PRO PRO B . n 
B 1 19  ARG 19  318 318 ARG ARG B . n 
B 1 20  SER 20  319 319 SER SER B . n 
B 1 21  TYR 21  320 320 TYR TYR B . n 
B 1 22  LEU 22  321 321 LEU LEU B . n 
B 1 23  ASP 23  322 322 ASP ASP B . n 
B 1 24  ASN 24  323 323 ASN ASN B . n 
B 1 25  PHE 25  324 324 PHE PHE B . n 
B 1 26  ILE 26  325 325 ILE ILE B . n 
B 1 27  LYS 27  326 326 LYS LYS B . n 
B 1 28  ILE 28  327 327 ILE ILE B . n 
B 1 29  GLY 29  328 328 GLY GLY B . n 
B 1 30  GLU 30  329 329 GLU GLU B . n 
B 1 31  GLY 31  330 330 GLY GLY B . n 
B 1 32  SER 32  331 ?   ?   ?   B . n 
B 1 33  THR 33  332 ?   ?   ?   B . n 
B 1 34  GLY 34  333 ?   ?   ?   B . n 
B 1 35  ILE 35  334 334 ILE ILE B . n 
B 1 36  VAL 36  335 335 VAL VAL B . n 
B 1 37  CYS 37  336 336 CYS CYS B . n 
B 1 38  ILE 38  337 337 ILE ILE B . n 
B 1 39  ALA 39  338 338 ALA ALA B . n 
B 1 40  THR 40  339 339 THR THR B . n 
B 1 41  VAL 41  340 340 VAL VAL B . n 
B 1 42  ARG 42  341 341 ARG ARG B . n 
B 1 43  SER 43  342 342 SER SER B . n 
B 1 44  SER 44  343 343 SER SER B . n 
B 1 45  GLY 45  344 344 GLY GLY B . n 
B 1 46  LYS 46  345 345 LYS LYS B . n 
B 1 47  LEU 47  346 346 LEU LEU B . n 
B 1 48  VAL 48  347 347 VAL VAL B . n 
B 1 49  ALA 49  348 348 ALA ALA B . n 
B 1 50  VAL 50  349 349 VAL VAL B . n 
B 1 51  LYS 51  350 350 LYS LYS B . n 
B 1 52  LYS 52  351 351 LYS LYS B . n 
B 1 53  MET 53  352 352 MET MET B . n 
B 1 54  ASP 54  353 353 ASP ASP B . n 
B 1 55  LEU 55  354 354 LEU LEU B . n 
B 1 56  ARG 56  355 ?   ?   ?   B . n 
B 1 57  LYS 57  356 ?   ?   ?   B . n 
B 1 58  GLN 58  357 ?   ?   ?   B . n 
B 1 59  GLN 59  358 ?   ?   ?   B . n 
B 1 60  ARG 60  359 ?   ?   ?   B . n 
B 1 61  ARG 61  360 ?   ?   ?   B . n 
B 1 62  GLU 62  361 ?   ?   ?   B . n 
B 1 63  LEU 63  362 362 LEU LEU B . n 
B 1 64  LEU 64  363 363 LEU LEU B . n 
B 1 65  PHE 65  364 364 PHE PHE B . n 
B 1 66  ASN 66  365 365 ASN ASN B . n 
B 1 67  GLU 67  366 366 GLU GLU B . n 
B 1 68  VAL 68  367 367 VAL VAL B . n 
B 1 69  VAL 69  368 368 VAL VAL B . n 
B 1 70  ILE 70  369 369 ILE ILE B . n 
B 1 71  MET 71  370 370 MET MET B . n 
B 1 72  ARG 72  371 371 ARG ARG B . n 
B 1 73  ASP 73  372 372 ASP ASP B . n 
B 1 74  TYR 74  373 373 TYR TYR B . n 
B 1 75  GLN 75  374 374 GLN GLN B . n 
B 1 76  HIS 76  375 375 HIS HIS B . n 
B 1 77  GLU 77  376 376 GLU GLU B . n 
B 1 78  ASN 78  377 377 ASN ASN B . n 
B 1 79  VAL 79  378 378 VAL VAL B . n 
B 1 80  VAL 80  379 379 VAL VAL B . n 
B 1 81  GLU 81  380 380 GLU GLU B . n 
B 1 82  MET 82  381 381 MET MET B . n 
B 1 83  TYR 83  382 382 TYR TYR B . n 
B 1 84  ASN 84  383 383 ASN ASN B . n 
B 1 85  SER 85  384 384 SER SER B . n 
B 1 86  TYR 86  385 385 TYR TYR B . n 
B 1 87  LEU 87  386 386 LEU LEU B . n 
B 1 88  VAL 88  387 387 VAL VAL B . n 
B 1 89  GLY 89  388 388 GLY GLY B . n 
B 1 90  ASP 90  389 389 ASP ASP B . n 
B 1 91  GLU 91  390 390 GLU GLU B . n 
B 1 92  LEU 92  391 391 LEU LEU B . n 
B 1 93  TRP 93  392 392 TRP TRP B . n 
B 1 94  VAL 94  393 393 VAL VAL B . n 
B 1 95  VAL 95  394 394 VAL VAL B . n 
B 1 96  MET 96  395 395 MET MET B . n 
B 1 97  GLU 97  396 396 GLU GLU B . n 
B 1 98  PHE 98  397 397 PHE PHE B . n 
B 1 99  LEU 99  398 398 LEU LEU B . n 
B 1 100 GLU 100 399 399 GLU GLU B . n 
B 1 101 GLY 101 400 400 GLY GLY B . n 
B 1 102 GLY 102 401 401 GLY GLY B . n 
B 1 103 ALA 103 402 402 ALA ALA B . n 
B 1 104 LEU 104 403 403 LEU LEU B . n 
B 1 105 THR 105 404 404 THR THR B . n 
B 1 106 ASP 106 405 405 ASP ASP B . n 
B 1 107 ILE 107 406 406 ILE ILE B . n 
B 1 108 VAL 108 407 407 VAL VAL B . n 
B 1 109 THR 109 408 408 THR THR B . n 
B 1 110 HIS 110 409 409 HIS HIS B . n 
B 1 111 THR 111 410 410 THR THR B . n 
B 1 112 ARG 112 411 411 ARG ARG B . n 
B 1 113 MET 113 412 412 MET MET B . n 
B 1 114 ASN 114 413 413 ASN ASN B . n 
B 1 115 GLU 115 414 414 GLU GLU B . n 
B 1 116 GLU 116 415 415 GLU GLU B . n 
B 1 117 GLN 117 416 416 GLN GLN B . n 
B 1 118 ILE 118 417 417 ILE ILE B . n 
B 1 119 ALA 119 418 418 ALA ALA B . n 
B 1 120 ALA 120 419 419 ALA ALA B . n 
B 1 121 VAL 121 420 420 VAL VAL B . n 
B 1 122 CYS 122 421 421 CYS CYS B . n 
B 1 123 LEU 123 422 422 LEU LEU B . n 
B 1 124 ALA 124 423 423 ALA ALA B . n 
B 1 125 VAL 125 424 424 VAL VAL B . n 
B 1 126 LEU 126 425 425 LEU LEU B . n 
B 1 127 GLN 127 426 426 GLN GLN B . n 
B 1 128 ALA 128 427 427 ALA ALA B . n 
B 1 129 LEU 129 428 428 LEU LEU B . n 
B 1 130 SER 130 429 429 SER SER B . n 
B 1 131 VAL 131 430 430 VAL VAL B . n 
B 1 132 LEU 132 431 431 LEU LEU B . n 
B 1 133 HIS 133 432 432 HIS HIS B . n 
B 1 134 ALA 134 433 433 ALA ALA B . n 
B 1 135 GLN 135 434 434 GLN GLN B . n 
B 1 136 GLY 136 435 435 GLY GLY B . n 
B 1 137 VAL 137 436 436 VAL VAL B . n 
B 1 138 ILE 138 437 437 ILE ILE B . n 
B 1 139 HIS 139 438 438 HIS HIS B . n 
B 1 140 ARG 140 439 439 ARG ARG B . n 
B 1 141 ASP 141 440 440 ASP ASP B . n 
B 1 142 ILE 142 441 441 ILE ILE B . n 
B 1 143 LYS 143 442 442 LYS LYS B . n 
B 1 144 SER 144 443 443 SER SER B . n 
B 1 145 ASP 145 444 444 ASP ASP B . n 
B 1 146 SER 146 445 445 SER SER B . n 
B 1 147 ILE 147 446 446 ILE ILE B . n 
B 1 148 LEU 148 447 447 LEU LEU B . n 
B 1 149 LEU 149 448 448 LEU LEU B . n 
B 1 150 THR 150 449 449 THR THR B . n 
B 1 151 HIS 151 450 450 HIS HIS B . n 
B 1 152 ASP 152 451 451 ASP ASP B . n 
B 1 153 GLY 153 452 452 GLY GLY B . n 
B 1 154 ARG 154 453 453 ARG ARG B . n 
B 1 155 VAL 155 454 454 VAL VAL B . n 
B 1 156 LYS 156 455 455 LYS LYS B . n 
B 1 157 LEU 157 456 456 LEU LEU B . n 
B 1 158 SER 158 457 457 SER SER B . n 
B 1 159 ASP 159 458 458 ASP ASP B . n 
B 1 160 PHE 160 459 459 PHE PHE B . n 
B 1 161 GLY 161 460 460 GLY GLY B . n 
B 1 162 PHE 162 461 461 PHE PHE B . n 
B 1 163 CYS 163 462 462 CYS CYS B . n 
B 1 164 ALA 164 463 463 ALA ALA B . n 
B 1 165 GLN 165 464 464 GLN GLN B . n 
B 1 166 VAL 166 465 465 VAL VAL B . n 
B 1 167 SER 167 466 ?   ?   ?   B . n 
B 1 168 LYS 168 467 ?   ?   ?   B . n 
B 1 169 GLU 169 468 468 GLU GLU B . n 
B 1 170 VAL 170 469 469 VAL VAL B . n 
B 1 171 PRO 171 470 470 PRO PRO B . n 
B 1 172 ARG 172 471 471 ARG ARG B . n 
B 1 173 ARG 173 472 472 ARG ARG B . n 
B 1 174 LYS 174 473 473 LYS LYS B . n 
B 1 175 SEP 175 474 474 SEP SEP B . n 
B 1 176 LEU 176 475 475 LEU LEU B . n 
B 1 177 VAL 177 476 476 VAL VAL B . n 
B 1 178 GLY 178 477 477 GLY GLY B . n 
B 1 179 THR 179 478 478 THR THR B . n 
B 1 180 PRO 180 479 479 PRO PRO B . n 
B 1 181 TYR 181 480 480 TYR TYR B . n 
B 1 182 TRP 182 481 481 TRP TRP B . n 
B 1 183 MET 183 482 482 MET MET B . n 
B 1 184 ALA 184 483 483 ALA ALA B . n 
B 1 185 PRO 185 484 484 PRO PRO B . n 
B 1 186 GLU 186 485 485 GLU GLU B . n 
B 1 187 LEU 187 486 486 LEU LEU B . n 
B 1 188 ILE 188 487 487 ILE ILE B . n 
B 1 189 SER 189 488 488 SER SER B . n 
B 1 190 ARG 190 489 489 ARG ARG B . n 
B 1 191 LEU 191 490 490 LEU LEU B . n 
B 1 192 PRO 192 491 491 PRO PRO B . n 
B 1 193 TYR 193 492 492 TYR TYR B . n 
B 1 194 GLY 194 493 493 GLY GLY B . n 
B 1 195 PRO 195 494 494 PRO PRO B . n 
B 1 196 GLU 196 495 495 GLU GLU B . n 
B 1 197 VAL 197 496 496 VAL VAL B . n 
B 1 198 ASP 198 497 497 ASP ASP B . n 
B 1 199 ILE 199 498 498 ILE ILE B . n 
B 1 200 TRP 200 499 499 TRP TRP B . n 
B 1 201 SER 201 500 500 SER SER B . n 
B 1 202 LEU 202 501 501 LEU LEU B . n 
B 1 203 GLY 203 502 502 GLY GLY B . n 
B 1 204 ILE 204 503 503 ILE ILE B . n 
B 1 205 MET 205 504 504 MET MET B . n 
B 1 206 VAL 206 505 505 VAL VAL B . n 
B 1 207 ILE 207 506 506 ILE ILE B . n 
B 1 208 GLU 208 507 507 GLU GLU B . n 
B 1 209 MET 209 508 508 MET MET B . n 
B 1 210 VAL 210 509 509 VAL VAL B . n 
B 1 211 ASP 211 510 510 ASP ASP B . n 
B 1 212 GLY 212 511 511 GLY GLY B . n 
B 1 213 GLU 213 512 512 GLU GLU B . n 
B 1 214 PRO 214 513 513 PRO PRO B . n 
B 1 215 PRO 215 514 514 PRO PRO B . n 
B 1 216 TYR 216 515 515 TYR TYR B . n 
B 1 217 PHE 217 516 516 PHE PHE B . n 
B 1 218 ASN 218 517 517 ASN ASN B . n 
B 1 219 GLU 219 518 518 GLU GLU B . n 
B 1 220 PRO 220 519 519 PRO PRO B . n 
B 1 221 PRO 221 520 520 PRO PRO B . n 
B 1 222 LEU 222 521 521 LEU LEU B . n 
B 1 223 LYS 223 522 522 LYS LYS B . n 
B 1 224 ALA 224 523 523 ALA ALA B . n 
B 1 225 MET 225 524 524 MET MET B . n 
B 1 226 LYS 226 525 525 LYS LYS B . n 
B 1 227 MET 227 526 526 MET MET B . n 
B 1 228 ILE 228 527 527 ILE ILE B . n 
B 1 229 ARG 229 528 528 ARG ARG B . n 
B 1 230 ASP 230 529 529 ASP ASP B . n 
B 1 231 ASN 231 530 530 ASN ASN B . n 
B 1 232 LEU 232 531 531 LEU LEU B . n 
B 1 233 PRO 233 532 532 PRO PRO B . n 
B 1 234 PRO 234 533 533 PRO PRO B . n 
B 1 235 ARG 235 534 534 ARG ARG B . n 
B 1 236 LEU 236 535 535 LEU LEU B . n 
B 1 237 LYS 237 536 536 LYS LYS B . n 
B 1 238 ASN 238 537 537 ASN ASN B . n 
B 1 239 LEU 239 538 538 LEU LEU B . n 
B 1 240 HIS 240 539 539 HIS HIS B . n 
B 1 241 LYS 241 540 540 LYS LYS B . n 
B 1 242 VAL 242 541 541 VAL VAL B . n 
B 1 243 SER 243 542 542 SER SER B . n 
B 1 244 PRO 244 543 543 PRO PRO B . n 
B 1 245 SER 245 544 544 SER SER B . n 
B 1 246 LEU 246 545 545 LEU LEU B . n 
B 1 247 LYS 247 546 546 LYS LYS B . n 
B 1 248 GLY 248 547 547 GLY GLY B . n 
B 1 249 PHE 249 548 548 PHE PHE B . n 
B 1 250 LEU 250 549 549 LEU LEU B . n 
B 1 251 ASP 251 550 550 ASP ASP B . n 
B 1 252 ARG 252 551 551 ARG ARG B . n 
B 1 253 LEU 253 552 552 LEU LEU B . n 
B 1 254 LEU 254 553 553 LEU LEU B . n 
B 1 255 VAL 255 554 554 VAL VAL B . n 
B 1 256 ARG 256 555 555 ARG ARG B . n 
B 1 257 ASP 257 556 556 ASP ASP B . n 
B 1 258 PRO 258 557 557 PRO PRO B . n 
B 1 259 ALA 259 558 558 ALA ALA B . n 
B 1 260 GLN 260 559 559 GLN GLN B . n 
B 1 261 ARG 261 560 560 ARG ARG B . n 
B 1 262 ALA 262 561 561 ALA ALA B . n 
B 1 263 THR 263 562 562 THR THR B . n 
B 1 264 ALA 264 563 563 ALA ALA B . n 
B 1 265 ALA 265 564 564 ALA ALA B . n 
B 1 266 GLU 266 565 565 GLU GLU B . n 
B 1 267 LEU 267 566 566 LEU LEU B . n 
B 1 268 LEU 268 567 567 LEU LEU B . n 
B 1 269 LYS 269 568 568 LYS LYS B . n 
B 1 270 HIS 270 569 569 HIS HIS B . n 
B 1 271 PRO 271 570 570 PRO PRO B . n 
B 1 272 PHE 272 571 571 PHE PHE B . n 
B 1 273 LEU 273 572 572 LEU LEU B . n 
B 1 274 ALA 274 573 573 ALA ALA B . n 
B 1 275 LYS 275 574 574 LYS LYS B . n 
B 1 276 ALA 276 575 575 ALA ALA B . n 
B 1 277 GLY 277 576 576 GLY GLY B . n 
B 1 278 PRO 278 577 577 PRO PRO B . n 
B 1 279 PRO 279 578 578 PRO PRO B . n 
B 1 280 ALA 280 579 579 ALA ALA B . n 
B 1 281 SER 281 580 580 SER SER B . n 
B 1 282 ILE 282 581 581 ILE ILE B . n 
B 1 283 VAL 283 582 582 VAL VAL B . n 
B 1 284 PRO 284 583 583 PRO PRO B . n 
B 1 285 LEU 285 584 584 LEU LEU B . n 
B 1 286 MET 286 585 585 MET MET B . n 
B 1 287 ARG 287 586 586 ARG ARG B . n 
B 1 288 GLN 288 587 587 GLN GLN B . n 
B 1 289 ASN 289 588 ?   ?   ?   B . n 
B 1 290 ARG 290 589 ?   ?   ?   B . n 
B 1 291 THR 291 590 ?   ?   ?   B . n 
B 1 292 ARG 292 591 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  2001 2001 HOH HOH A . 
C 2 HOH 2  2002 2002 HOH HOH A . 
C 2 HOH 3  2003 2003 HOH HOH A . 
C 2 HOH 4  2004 2004 HOH HOH A . 
C 2 HOH 5  2005 2005 HOH HOH A . 
C 2 HOH 6  2006 2006 HOH HOH A . 
C 2 HOH 7  2007 2007 HOH HOH A . 
C 2 HOH 8  2008 2008 HOH HOH A . 
C 2 HOH 9  2009 2009 HOH HOH A . 
C 2 HOH 10 2010 2010 HOH HOH A . 
C 2 HOH 11 2011 2011 HOH HOH A . 
C 2 HOH 12 2012 2012 HOH HOH A . 
C 2 HOH 13 2013 2013 HOH HOH A . 
C 2 HOH 14 2014 2014 HOH HOH A . 
C 2 HOH 15 2015 2015 HOH HOH A . 
C 2 HOH 16 2016 2016 HOH HOH A . 
C 2 HOH 17 2017 2017 HOH HOH A . 
C 2 HOH 18 2018 2018 HOH HOH A . 
C 2 HOH 19 2019 2019 HOH HOH A . 
C 2 HOH 20 2020 2020 HOH HOH A . 
C 2 HOH 21 2021 2021 HOH HOH A . 
D 2 HOH 1  2001 2001 HOH HOH B . 
D 2 HOH 2  2002 2002 HOH HOH B . 
D 2 HOH 3  2003 2003 HOH HOH B . 
D 2 HOH 4  2004 2004 HOH HOH B . 
D 2 HOH 5  2005 2005 HOH HOH B . 
D 2 HOH 6  2006 2006 HOH HOH B . 
D 2 HOH 7  2007 2007 HOH HOH B . 
D 2 HOH 8  2008 2008 HOH HOH B . 
D 2 HOH 9  2009 2009 HOH HOH B . 
D 2 HOH 10 2010 2010 HOH HOH B . 
D 2 HOH 11 2011 2011 HOH HOH B . 
D 2 HOH 12 2012 2012 HOH HOH B . 
D 2 HOH 13 2013 2013 HOH HOH B . 
D 2 HOH 14 2014 2014 HOH HOH B . 
D 2 HOH 15 2015 2015 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A SEP 175 A SEP 474 ? SER PHOSPHOSERINE 
2 B SEP 175 B SEP 474 ? SER PHOSPHOSERINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS monomeric 1 
2 author_and_software_defined_assembly PQS monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-14 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-24 
5 'Structure model' 1 4 2019-05-08 
6 'Structure model' 1 5 2019-05-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Structure summary'         
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Experimental preparation'  
7 6 'Structure model' 'Data collection'           
8 6 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' audit_author                
2 5 'Structure model' exptl_crystal_grow          
3 5 'Structure model' pdbx_seq_map_depositor_info 
4 5 'Structure model' struct_conn                 
5 6 'Structure model' pdbx_seq_map_depositor_info 
6 6 'Structure model' refine                      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_audit_author.name'                               
2 5 'Structure model' '_exptl_crystal_grow.method'                       
3 5 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
4 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'              
5 6 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
6 6 'Structure model' '_refine.pdbx_ls_cross_valid_method'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-97 refinement       . ? 1 
XDS       'data reduction' . ? 2 
XDS       'data scaling'   . ? 3 
PHASER    phasing          . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 439 ? ? CZ A ARG 439 ? ? NH1 A ARG 439 ? ? 123.73 120.30 3.43  0.50 N 
2 1 NE A ARG 439 ? ? CZ A ARG 439 ? ? NH2 A ARG 439 ? ? 116.85 120.30 -3.45 0.50 N 
3 1 CD B ARG 551 ? ? NE B ARG 551 ? ? CZ  B ARG 551 ? ? 139.05 123.60 15.45 1.40 N 
4 1 NE B ARG 551 ? ? CZ B ARG 551 ? ? NH2 B ARG 551 ? ? 123.83 120.30 3.53  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 301 ? ? 170.36  146.32  
2  1 LEU A 308 ? ? -99.77  -68.55  
3  1 VAL A 311 ? ? -78.42  32.14   
4  1 ASP A 322 ? ? -149.88 -55.59  
5  1 VAL A 335 ? ? 40.32   -89.66  
6  1 ALA A 338 ? ? -118.59 -168.03 
7  1 SER A 343 ? ? -132.37 -48.78  
8  1 ASP A 372 ? ? -100.11 77.20   
9  1 TYR A 373 ? ? 169.75  152.50  
10 1 GLN A 374 ? ? -164.10 119.95  
11 1 GLU A 376 ? ? -64.09  0.63    
12 1 ILE A 406 ? ? -98.79  -63.12  
13 1 ASP A 440 ? ? -143.40 43.16   
14 1 ASP A 458 ? ? 56.65   71.44   
15 1 PHE A 459 ? ? -91.27  35.10   
16 1 CYS A 462 ? ? -59.51  179.82  
17 1 LYS A 473 ? ? -153.10 20.52   
18 1 ASN A 537 ? ? -89.56  -91.73  
19 1 LEU A 538 ? ? 68.95   -41.68  
20 1 PRO A 543 ? ? -49.44  -17.76  
21 1 GLN B 309 ? ? -39.15  -39.78  
22 1 VAL B 311 ? ? -109.92 40.01   
23 1 ARG B 318 ? ? -141.61 38.73   
24 1 SER B 319 ? ? -142.25 -15.98  
25 1 ILE B 325 ? ? -170.99 131.08  
26 1 GLU B 329 ? ? 175.07  163.21  
27 1 VAL B 335 ? ? -143.29 -87.05  
28 1 CYS B 336 ? ? -75.01  -162.85 
29 1 SER B 343 ? ? -129.08 -60.51  
30 1 LYS B 345 ? ? -34.93  142.90  
31 1 ALA B 348 ? ? -67.49  99.61   
32 1 MET B 352 ? ? 166.49  158.74  
33 1 ASP B 372 ? ? -101.13 75.67   
34 1 TYR B 373 ? ? 177.73  145.22  
35 1 ASP B 389 ? ? -95.22  37.92   
36 1 ASP B 440 ? ? -161.34 42.11   
37 1 SER B 457 ? ? -131.91 -158.23 
38 1 CYS B 462 ? ? -51.39  170.54  
39 1 LYS B 473 ? ? -149.48 25.59   
40 1 PRO B 494 ? ? -35.50  -29.98  
41 1 TYR B 515 ? ? 71.48   34.52   
42 1 ASN B 537 ? ? -112.36 -90.83  
43 1 LEU B 538 ? ? 75.47   -35.99  
44 1 LEU B 553 ? ? -92.43  55.10   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   VAL 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    469 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   PRO 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    470 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -145.11 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 303 ? CD  ? A GLN 4   CD  
2  1 Y 1 A GLN 303 ? OE1 ? A GLN 4   OE1 
3  1 Y 1 A GLN 303 ? NE2 ? A GLN 4   NE2 
4  1 Y 1 A LYS 326 ? CG  ? A LYS 27  CG  
5  1 Y 1 A LYS 326 ? CD  ? A LYS 27  CD  
6  1 Y 1 A LYS 326 ? CE  ? A LYS 27  CE  
7  1 Y 1 A LYS 326 ? NZ  ? A LYS 27  NZ  
8  1 Y 1 A SER 342 ? OG  ? A SER 43  OG  
9  1 Y 1 A LYS 345 ? CG  ? A LYS 46  CG  
10 1 Y 1 A LYS 345 ? CD  ? A LYS 46  CD  
11 1 Y 1 A LYS 345 ? CE  ? A LYS 46  CE  
12 1 Y 1 A LYS 345 ? NZ  ? A LYS 46  NZ  
13 1 Y 1 A LYS 351 ? CG  ? A LYS 52  CG  
14 1 Y 1 A LYS 351 ? CD  ? A LYS 52  CD  
15 1 Y 1 A LYS 351 ? CE  ? A LYS 52  CE  
16 1 Y 1 A LYS 351 ? NZ  ? A LYS 52  NZ  
17 1 Y 1 A MET 352 ? CG  ? A MET 53  CG  
18 1 Y 1 A MET 352 ? SD  ? A MET 53  SD  
19 1 Y 1 A MET 352 ? CE  ? A MET 53  CE  
20 1 Y 1 A ASP 353 ? CG  ? A ASP 54  CG  
21 1 Y 1 A ASP 353 ? OD1 ? A ASP 54  OD1 
22 1 Y 1 A ASP 353 ? OD2 ? A ASP 54  OD2 
23 1 Y 1 A GLN 374 ? CG  ? A GLN 75  CG  
24 1 Y 1 A GLN 374 ? CD  ? A GLN 75  CD  
25 1 Y 1 A GLN 374 ? OE1 ? A GLN 75  OE1 
26 1 Y 1 A GLN 374 ? NE2 ? A GLN 75  NE2 
27 1 Y 1 A GLU 390 ? CG  ? A GLU 91  CG  
28 1 Y 1 A GLU 390 ? CD  ? A GLU 91  CD  
29 1 Y 1 A GLU 390 ? OE1 ? A GLU 91  OE1 
30 1 Y 1 A GLU 390 ? OE2 ? A GLU 91  OE2 
31 1 Y 1 A LYS 525 ? CD  ? A LYS 226 CD  
32 1 Y 1 A LYS 525 ? CE  ? A LYS 226 CE  
33 1 Y 1 A LYS 525 ? NZ  ? A LYS 226 NZ  
34 1 Y 1 A HIS 539 ? CG  ? A HIS 240 CG  
35 1 Y 1 A HIS 539 ? ND1 ? A HIS 240 ND1 
36 1 Y 1 A HIS 539 ? CD2 ? A HIS 240 CD2 
37 1 Y 1 A HIS 539 ? CE1 ? A HIS 240 CE1 
38 1 Y 1 A HIS 539 ? NE2 ? A HIS 240 NE2 
39 1 Y 1 A LYS 568 ? CE  ? A LYS 269 CE  
40 1 Y 1 A LYS 568 ? NZ  ? A LYS 269 NZ  
41 1 Y 1 B GLN 303 ? CD  ? B GLN 4   CD  
42 1 Y 1 B GLN 303 ? OE1 ? B GLN 4   OE1 
43 1 Y 1 B GLN 303 ? NE2 ? B GLN 4   NE2 
44 1 Y 1 B PHE 304 ? CG  ? B PHE 5   CG  
45 1 Y 1 B PHE 304 ? CD1 ? B PHE 5   CD1 
46 1 Y 1 B PHE 304 ? CD2 ? B PHE 5   CD2 
47 1 Y 1 B PHE 304 ? CE1 ? B PHE 5   CE1 
48 1 Y 1 B PHE 304 ? CE2 ? B PHE 5   CE2 
49 1 Y 1 B PHE 304 ? CZ  ? B PHE 5   CZ  
50 1 Y 1 B GLN 309 ? CG  ? B GLN 10  CG  
51 1 Y 1 B GLN 309 ? CD  ? B GLN 10  CD  
52 1 Y 1 B GLN 309 ? OE1 ? B GLN 10  OE1 
53 1 Y 1 B GLN 309 ? NE2 ? B GLN 10  NE2 
54 1 Y 1 B LYS 326 ? CG  ? B LYS 27  CG  
55 1 Y 1 B LYS 326 ? CD  ? B LYS 27  CD  
56 1 Y 1 B LYS 326 ? CE  ? B LYS 27  CE  
57 1 Y 1 B LYS 326 ? NZ  ? B LYS 27  NZ  
58 1 Y 1 B MET 352 ? CG  ? B MET 53  CG  
59 1 Y 1 B MET 352 ? SD  ? B MET 53  SD  
60 1 Y 1 B MET 352 ? CE  ? B MET 53  CE  
61 1 Y 1 B ASP 353 ? CG  ? B ASP 54  CG  
62 1 Y 1 B ASP 353 ? OD1 ? B ASP 54  OD1 
63 1 Y 1 B ASP 353 ? OD2 ? B ASP 54  OD2 
64 1 Y 1 B GLU 390 ? CG  ? B GLU 91  CG  
65 1 Y 1 B GLU 390 ? CD  ? B GLU 91  CD  
66 1 Y 1 B GLU 390 ? OE1 ? B GLU 91  OE1 
67 1 Y 1 B GLU 390 ? OE2 ? B GLU 91  OE2 
68 1 Y 1 B LYS 525 ? CD  ? B LYS 226 CD  
69 1 Y 1 B LYS 525 ? CE  ? B LYS 226 CE  
70 1 Y 1 B LYS 525 ? NZ  ? B LYS 226 NZ  
71 1 Y 1 B LYS 568 ? CE  ? B LYS 269 CE  
72 1 Y 1 B LYS 568 ? NZ  ? B LYS 269 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLU 329 ? A GLU 30  
2  1 Y 1 A GLY 330 ? A GLY 31  
3  1 Y 1 A SER 331 ? A SER 32  
4  1 Y 1 A THR 332 ? A THR 33  
5  1 Y 1 A GLY 333 ? A GLY 34  
6  1 Y 1 A LEU 354 ? A LEU 55  
7  1 Y 1 A ARG 355 ? A ARG 56  
8  1 Y 1 A LYS 356 ? A LYS 57  
9  1 Y 1 A GLN 357 ? A GLN 58  
10 1 Y 1 A GLN 358 ? A GLN 59  
11 1 Y 1 A ARG 359 ? A ARG 60  
12 1 Y 1 A ARG 360 ? A ARG 61  
13 1 Y 1 A GLU 361 ? A GLU 62  
14 1 Y 1 A SER 466 ? A SER 167 
15 1 Y 1 A LYS 467 ? A LYS 168 
16 1 Y 1 A ASN 588 ? A ASN 289 
17 1 Y 1 A ARG 589 ? A ARG 290 
18 1 Y 1 A THR 590 ? A THR 291 
19 1 Y 1 A ARG 591 ? A ARG 292 
20 1 Y 1 B SER 300 ? B SER 1   
21 1 Y 1 B SER 331 ? B SER 32  
22 1 Y 1 B THR 332 ? B THR 33  
23 1 Y 1 B GLY 333 ? B GLY 34  
24 1 Y 1 B ARG 355 ? B ARG 56  
25 1 Y 1 B LYS 356 ? B LYS 57  
26 1 Y 1 B GLN 357 ? B GLN 58  
27 1 Y 1 B GLN 358 ? B GLN 59  
28 1 Y 1 B ARG 359 ? B ARG 60  
29 1 Y 1 B ARG 360 ? B ARG 61  
30 1 Y 1 B GLU 361 ? B GLU 62  
31 1 Y 1 B SER 466 ? B SER 167 
32 1 Y 1 B LYS 467 ? B LYS 168 
33 1 Y 1 B ASN 588 ? B ASN 289 
34 1 Y 1 B ARG 589 ? B ARG 290 
35 1 Y 1 B THR 590 ? B THR 291 
36 1 Y 1 B ARG 591 ? B ARG 292 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#