data_2BWJ
# 
_entry.id   2BWJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2BWJ         
PDBE  EBI-24904    
WWPDB D_1290024904 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BWJ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bunkoczi, G.'        1  ? 
'Filippakopoulos, P.' 2  ? 
'Fedorov, O.'         3  ? 
'Jansson, A.'         4  ? 
'Longman, E.'         5  ? 
'Ugochukwu, E.'       6  ? 
'Knapp, S.'           7  ? 
'von Delft, F.'       8  ? 
'Arrowsmith, C.'      9  ? 
'Edwards, A.'         10 ? 
'Sundstrom, M.'       11 ? 
'Weigelt, J.'         12 ? 
# 
_citation.id                        primary 
_citation.title                     'Structure of Adenylate Kinase 5' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Filippakopoulos, P.' 1 
primary 'Bunkoczi, G.'        2 
primary 'Jansson, A.'         3 
primary 'Longman, E.'         4 
primary 'Knapp, S.'           5 
# 
_cell.entry_id           2BWJ 
_cell.length_a           180.375 
_cell.length_b           180.375 
_cell.length_c           121.701 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BWJ 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ADENYLATE KINASE 5'      22176.564 6   2.7.4.3 YES ? ? 
2 non-polymer syn 'SULFATE ION'             96.063    7   ?       ?   ? ? 
3 non-polymer syn 'CHLORIDE ION'            35.453    5   ?       ?   ? ? 
4 non-polymer syn 'ADENOSINE MONOPHOSPHATE' 347.221   3   ?       ?   ? ? 
5 water       nat water                     18.015    460 ?       ?   ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ATP-AMP, TRANSPHOSPHORYLASE5' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELL
KEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRA
SIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIFL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELL
KEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQMSRSSLPVDDTTKTIAKRLEAYYRA
SIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIFL
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLY n 
1 4   GLY n 
1 5   PHE n 
1 6   MET n 
1 7   GLU n 
1 8   ASP n 
1 9   LEU n 
1 10  ARG n 
1 11  LYS n 
1 12  CYS n 
1 13  LYS n 
1 14  ILE n 
1 15  ILE n 
1 16  PHE n 
1 17  ILE n 
1 18  ILE n 
1 19  GLY n 
1 20  GLY n 
1 21  PRO n 
1 22  GLY n 
1 23  SER n 
1 24  GLY n 
1 25  LYS n 
1 26  GLY n 
1 27  THR n 
1 28  GLN n 
1 29  CYS n 
1 30  GLU n 
1 31  LYS n 
1 32  LEU n 
1 33  VAL n 
1 34  GLU n 
1 35  LYS n 
1 36  TYR n 
1 37  GLY n 
1 38  PHE n 
1 39  THR n 
1 40  HIS n 
1 41  LEU n 
1 42  SER n 
1 43  THR n 
1 44  GLY n 
1 45  GLU n 
1 46  LEU n 
1 47  LEU n 
1 48  ARG n 
1 49  GLU n 
1 50  GLU n 
1 51  LEU n 
1 52  ALA n 
1 53  SER n 
1 54  GLU n 
1 55  SER n 
1 56  GLU n 
1 57  ARG n 
1 58  SER n 
1 59  LYS n 
1 60  LEU n 
1 61  ILE n 
1 62  ARG n 
1 63  ASP n 
1 64  ILE n 
1 65  MET n 
1 66  GLU n 
1 67  ARG n 
1 68  GLY n 
1 69  ASP n 
1 70  LEU n 
1 71  VAL n 
1 72  PRO n 
1 73  SER n 
1 74  GLY n 
1 75  ILE n 
1 76  VAL n 
1 77  LEU n 
1 78  GLU n 
1 79  LEU n 
1 80  LEU n 
1 81  LYS n 
1 82  GLU n 
1 83  ALA n 
1 84  MET n 
1 85  VAL n 
1 86  ALA n 
1 87  SER n 
1 88  LEU n 
1 89  GLY n 
1 90  ASP n 
1 91  THR n 
1 92  ARG n 
1 93  GLY n 
1 94  PHE n 
1 95  LEU n 
1 96  ILE n 
1 97  ASP n 
1 98  GLY n 
1 99  TYR n 
1 100 PRO n 
1 101 ARG n 
1 102 GLU n 
1 103 VAL n 
1 104 LYS n 
1 105 GLN n 
1 106 GLY n 
1 107 GLU n 
1 108 GLU n 
1 109 PHE n 
1 110 GLY n 
1 111 ARG n 
1 112 ARG n 
1 113 ILE n 
1 114 GLY n 
1 115 ASP n 
1 116 PRO n 
1 117 GLN n 
1 118 LEU n 
1 119 VAL n 
1 120 ILE n 
1 121 CYS n 
1 122 MET n 
1 123 ASP n 
1 124 CYS n 
1 125 SER n 
1 126 ALA n 
1 127 ASP n 
1 128 THR n 
1 129 MET n 
1 130 THR n 
1 131 ASN n 
1 132 ARG n 
1 133 LEU n 
1 134 LEU n 
1 135 GLN n 
1 136 MET n 
1 137 SER n 
1 138 ARG n 
1 139 SER n 
1 140 SER n 
1 141 LEU n 
1 142 PRO n 
1 143 VAL n 
1 144 ASP n 
1 145 ASP n 
1 146 THR n 
1 147 THR n 
1 148 LYS n 
1 149 THR n 
1 150 ILE n 
1 151 ALA n 
1 152 LYS n 
1 153 ARG n 
1 154 LEU n 
1 155 GLU n 
1 156 ALA n 
1 157 TYR n 
1 158 TYR n 
1 159 ARG n 
1 160 ALA n 
1 161 SER n 
1 162 ILE n 
1 163 PRO n 
1 164 VAL n 
1 165 ILE n 
1 166 ALA n 
1 167 TYR n 
1 168 TYR n 
1 169 GLU n 
1 170 THR n 
1 171 LYS n 
1 172 THR n 
1 173 GLN n 
1 174 LEU n 
1 175 HIS n 
1 176 LYS n 
1 177 ILE n 
1 178 ASN n 
1 179 ALA n 
1 180 GLU n 
1 181 GLY n 
1 182 THR n 
1 183 PRO n 
1 184 GLU n 
1 185 ASP n 
1 186 VAL n 
1 187 PHE n 
1 188 LEU n 
1 189 GLN n 
1 190 LEU n 
1 191 CYS n 
1 192 THR n 
1 193 ALA n 
1 194 ILE n 
1 195 ASP n 
1 196 SER n 
1 197 ILE n 
1 198 PHE n 
1 199 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PLIC-SGC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2BWJ       1 ? ? 2BWJ   ? 
2 UNP KAD5_HUMAN 1 ? ? Q9Y6K8 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2BWJ A 1   ? 1   ? 2BWJ   0   ? 0   ? 0   0   
2  2 2BWJ A 2   ? 198 ? Q9Y6K8 340 ? 536 ? 1   197 
3  1 2BWJ A 199 ? 199 ? 2BWJ   198 ? 198 ? 198 198 
4  1 2BWJ B 1   ? 1   ? 2BWJ   0   ? 0   ? 0   0   
5  2 2BWJ B 2   ? 198 ? Q9Y6K8 340 ? 536 ? 1   197 
6  1 2BWJ B 199 ? 199 ? 2BWJ   198 ? 198 ? 198 198 
7  1 2BWJ C 1   ? 1   ? 2BWJ   0   ? 0   ? 0   0   
8  2 2BWJ C 2   ? 198 ? Q9Y6K8 340 ? 536 ? 1   197 
9  1 2BWJ C 199 ? 199 ? 2BWJ   198 ? 198 ? 198 198 
10 1 2BWJ D 1   ? 1   ? 2BWJ   0   ? 0   ? 0   0   
11 2 2BWJ D 2   ? 198 ? Q9Y6K8 340 ? 536 ? 1   197 
12 1 2BWJ D 199 ? 199 ? 2BWJ   198 ? 198 ? 198 198 
13 1 2BWJ E 1   ? 1   ? 2BWJ   0   ? 0   ? 0   0   
14 2 2BWJ E 2   ? 198 ? Q9Y6K8 340 ? 536 ? 1   197 
15 1 2BWJ E 199 ? 199 ? 2BWJ   198 ? 198 ? 198 198 
16 1 2BWJ F 1   ? 1   ? 2BWJ   0   ? 0   ? 0   0   
17 2 2BWJ F 2   ? 198 ? Q9Y6K8 340 ? 536 ? 1   197 
18 1 2BWJ F 199 ? 199 ? 2BWJ   198 ? 198 ? 198 198 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  2BWJ MET A 136 ? UNP Q9Y6K8 ARG 474 'engineered mutation' 135 1 
4  2BWJ MET B 136 ? UNP Q9Y6K8 ARG 474 'engineered mutation' 135 2 
7  2BWJ MET C 136 ? UNP Q9Y6K8 ARG 474 'engineered mutation' 135 3 
10 2BWJ MET D 136 ? UNP Q9Y6K8 ARG 474 'engineered mutation' 135 4 
13 2BWJ MET E 136 ? UNP Q9Y6K8 ARG 474 'engineered mutation' 135 5 
16 2BWJ MET F 136 ? UNP Q9Y6K8 ARG 474 'engineered mutation' 135 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                   ? 'C3 H7 N O2'      89.093  
AMP non-polymer         . 'ADENOSINE MONOPHOSPHATE' ? 'C10 H14 N5 O7 P' 347.221 
ARG 'L-peptide linking' y ARGININE                  ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'           ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'            ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                  ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                 ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'           ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                   ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                 ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                     ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                   ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                    ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE             ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                   ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                    ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'             ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                 ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                  ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                    ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2BWJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.2 
_exptl_crystal.density_percent_sol   70.7 
_exptl_crystal.description           'NCS AVERAGING DONE WITH DM.' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M HEPES PH7.5, 0.1M NACL, 1.6M (NH4)2SO4, pH 7.50' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-03-13 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SI111 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9184 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             0.9184 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2BWJ 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.150 
_reflns.d_resolution_high            2.300 
_reflns.number_obs                   7913 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.0 
_reflns.pdbx_Rmerge_I_obs            0.09000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.5300 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.600 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.38 
_reflns_shell.percent_possible_all   63.1 
_reflns_shell.Rmerge_I_obs           0.37000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.350 
_reflns_shell.pdbx_redundancy        3.00 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2BWJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     84202 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    88.9 
_refine.ls_R_factor_obs                          0.174 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.172 
_refine.ls_R_factor_R_free                       0.213 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  4454 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.964 
_refine.correlation_coeff_Fo_to_Fc_free          0.948 
_refine.B_iso_mean                               56.12 
_refine.aniso_B[1][1]                            1.58000 
_refine.aniso_B[2][2]                            1.58000 
_refine.aniso_B[3][3]                            -2.37000 
_refine.aniso_B[1][2]                            0.79000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.186 
_refine.pdbx_overall_ESU_R_Free                  0.172 
_refine.overall_SU_ML                            0.127 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             9.839 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8699 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         101 
_refine_hist.number_atoms_solvent             460 
_refine_hist.number_atoms_total               9260 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 8947  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 8349  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.348  2.006  ? 12118 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.776  3.000  ? 19333 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.207  5.000  ? 1166  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.900 24.344 ? 343   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.562 15.000 ? 1571  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.986 15.000 ? 56    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.070  0.200  ? 1428  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 9912  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1701  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.195  0.200  ? 1981  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.167  0.200  ? 8151  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.173  0.200  ? 4437  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.086  0.200  ? 5364  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.160  0.200  ? 465   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.214  0.200  ? 10    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.221  0.200  ? 71    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.134  0.200  ? 9     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.947  3.000  ? 5918  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 4.156  5.000  ? 9260  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  8.456  8.000  ? 3376  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 11.690 11.000 ? 2851  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 41   0.32 0.50  'medium positional' 1 1  'X-RAY DIFFRACTION' ? ? ? 
2 B 41   0.26 0.50  'medium positional' 1 2  'X-RAY DIFFRACTION' ? ? ? 
3 C 41   0.19 0.50  'medium positional' 1 3  'X-RAY DIFFRACTION' ? ? ? 
4 D 41   0.22 0.50  'medium positional' 1 4  'X-RAY DIFFRACTION' ? ? ? 
5 F 41   0.31 0.50  'medium positional' 1 5  'X-RAY DIFFRACTION' ? ? ? 
1 A 1083 0.38 0.50  'medium positional' 2 6  'X-RAY DIFFRACTION' ? ? ? 
2 B 1083 0.67 0.50  'medium positional' 2 7  'X-RAY DIFFRACTION' ? ? ? 
3 C 1083 0.33 0.50  'medium positional' 2 8  'X-RAY DIFFRACTION' ? ? ? 
4 D 1083 0.30 0.50  'medium positional' 2 9  'X-RAY DIFFRACTION' ? ? ? 
5 E 1083 0.42 0.50  'medium positional' 2 10 'X-RAY DIFFRACTION' ? ? ? 
6 F 1083 0.41 0.50  'medium positional' 2 11 'X-RAY DIFFRACTION' ? ? ? 
1 A 22   0.61 5.00  'loose positional'  1 12 'X-RAY DIFFRACTION' ? ? ? 
2 B 22   0.54 5.00  'loose positional'  1 13 'X-RAY DIFFRACTION' ? ? ? 
3 C 22   0.68 5.00  'loose positional'  1 14 'X-RAY DIFFRACTION' ? ? ? 
4 D 22   0.70 5.00  'loose positional'  1 15 'X-RAY DIFFRACTION' ? ? ? 
5 F 22   0.76 5.00  'loose positional'  1 16 'X-RAY DIFFRACTION' ? ? ? 
1 A 1390 0.78 5.00  'loose positional'  2 17 'X-RAY DIFFRACTION' ? ? ? 
2 B 1390 1.09 5.00  'loose positional'  2 18 'X-RAY DIFFRACTION' ? ? ? 
3 C 1390 0.69 5.00  'loose positional'  2 19 'X-RAY DIFFRACTION' ? ? ? 
4 D 1390 0.89 5.00  'loose positional'  2 20 'X-RAY DIFFRACTION' ? ? ? 
5 E 1390 0.94 5.00  'loose positional'  2 21 'X-RAY DIFFRACTION' ? ? ? 
6 F 1390 0.74 5.00  'loose positional'  2 22 'X-RAY DIFFRACTION' ? ? ? 
1 A 41   1.40 2.00  'medium thermal'    1 23 'X-RAY DIFFRACTION' ? ? ? 
2 B 41   0.76 2.00  'medium thermal'    1 24 'X-RAY DIFFRACTION' ? ? ? 
3 C 41   0.77 2.00  'medium thermal'    1 25 'X-RAY DIFFRACTION' ? ? ? 
4 D 41   0.36 2.00  'medium thermal'    1 26 'X-RAY DIFFRACTION' ? ? ? 
5 F 41   0.80 2.00  'medium thermal'    1 27 'X-RAY DIFFRACTION' ? ? ? 
1 A 1083 1.16 2.00  'medium thermal'    2 28 'X-RAY DIFFRACTION' ? ? ? 
2 B 1083 1.15 2.00  'medium thermal'    2 29 'X-RAY DIFFRACTION' ? ? ? 
3 C 1083 0.92 2.00  'medium thermal'    2 30 'X-RAY DIFFRACTION' ? ? ? 
4 D 1083 0.64 2.00  'medium thermal'    2 31 'X-RAY DIFFRACTION' ? ? ? 
5 E 1083 0.85 2.00  'medium thermal'    2 32 'X-RAY DIFFRACTION' ? ? ? 
6 F 1083 0.97 2.00  'medium thermal'    2 33 'X-RAY DIFFRACTION' ? ? ? 
1 A 22   3.12 10.00 'loose thermal'     1 34 'X-RAY DIFFRACTION' ? ? ? 
2 B 22   1.29 10.00 'loose thermal'     1 35 'X-RAY DIFFRACTION' ? ? ? 
3 C 22   1.70 10.00 'loose thermal'     1 36 'X-RAY DIFFRACTION' ? ? ? 
4 D 22   1.51 10.00 'loose thermal'     1 37 'X-RAY DIFFRACTION' ? ? ? 
5 F 22   1.78 10.00 'loose thermal'     1 38 'X-RAY DIFFRACTION' ? ? ? 
1 A 1390 3.19 10.00 'loose thermal'     2 39 'X-RAY DIFFRACTION' ? ? ? 
2 B 1390 3.37 10.00 'loose thermal'     2 40 'X-RAY DIFFRACTION' ? ? ? 
3 C 1390 2.75 10.00 'loose thermal'     2 41 'X-RAY DIFFRACTION' ? ? ? 
4 D 1390 3.16 10.00 'loose thermal'     2 42 'X-RAY DIFFRACTION' ? ? ? 
5 E 1390 2.75 10.00 'loose thermal'     2 43 'X-RAY DIFFRACTION' ? ? ? 
6 F 1390 2.86 10.00 'loose thermal'     2 44 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.36 
_refine_ls_shell.number_reflns_R_work             3381 
_refine_ls_shell.R_factor_R_work                  0.2120 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2870 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             191 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.419840 -0.905190 0.066030  -0.905630 0.413030  -0.096090 0.059710  -0.100140 -0.993180 147.22264 93.15382  -2.42559  
2 given ? -0.571130 -0.246430 0.782990  0.231570  0.866760  0.441710  -0.787520 0.433590  -0.437970 148.41650 17.35153  81.46748  
3 given ? 0.364420  -0.914280 0.176900  -0.164260 -0.250100 -0.954180 0.916630  0.318660  -0.241320 106.49550 17.93164  -74.65356 
4 given ? 0.607950  -0.793530 -0.026530 0.218030  0.134720  0.966600  -0.763460 -0.593430 0.254910  81.50393  -25.39286 97.05065  
5 given ? 0.560540  0.277030  -0.780410 -0.826520 0.128500  -0.548040 -0.051540 0.952230  0.301000  34.93513  128.80684 4.32571   
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
3 C 1 
4 D 1 
5 F 1 
1 A 2 
2 B 2 
3 C 2 
4 D 2 
5 E 2 
6 F 2 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 3  A 11  1 5 ? ? ? ? ? ? ? ? 1 ? 
2 B 3  B 11  1 5 ? ? ? ? ? ? ? ? 1 ? 
3 C 3  C 11  1 5 ? ? ? ? ? ? ? ? 1 ? 
4 D 3  D 11  1 5 ? ? ? ? ? ? ? ? 1 ? 
5 F 3  F 11  1 5 ? ? ? ? ? ? ? ? 1 ? 
1 A 11 A 198 1 5 ? ? ? ? ? ? ? ? 2 ? 
2 B 11 B 198 1 5 ? ? ? ? ? ? ? ? 2 ? 
3 C 11 C 198 1 5 ? ? ? ? ? ? ? ? 2 ? 
4 D 11 D 198 1 5 ? ? ? ? ? ? ? ? 2 ? 
5 E 11 E 198 1 5 ? ? ? ? ? ? ? ? 2 ? 
6 F 11 F 198 1 5 ? ? ? ? ? ? ? ? 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  2BWJ 
_struct.title                     'Structure of adenylate kinase 5' 
_struct.pdbx_descriptor           'ADENYLATE KINASE 5 (E.C.2.7.4.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BWJ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'ADENYLATE KINASE, PHOSPHORYL TRANSFER REACTION, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 2 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 2 ? 
N  N N 4 ? 
O  N N 2 ? 
P  N N 2 ? 
Q  N N 3 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 4 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 4   ? CYS A 12  ? GLY A 3   CYS A 11  1 ? 9  
HELX_P HELX_P2  2  GLY A 24  ? GLY A 37  ? GLY A 23  GLY A 36  1 ? 14 
HELX_P HELX_P3  3  THR A 43  ? GLU A 54  ? THR A 42  GLU A 53  1 ? 12 
HELX_P HELX_P4  4  SER A 55  ? ARG A 67  ? SER A 54  ARG A 66  1 ? 13 
HELX_P HELX_P5  5  PRO A 72  ? LEU A 88  ? PRO A 71  LEU A 87  1 ? 17 
HELX_P HELX_P6  6  GLU A 102 ? ILE A 113 ? GLU A 101 ILE A 112 1 ? 12 
HELX_P HELX_P7  7  SER A 125 ? MET A 136 ? SER A 124 MET A 135 1 ? 12 
HELX_P HELX_P8  8  PRO A 142 ? THR A 172 ? PRO A 141 THR A 171 1 ? 31 
HELX_P HELX_P9  9  THR A 182 ? PHE A 198 ? THR A 181 PHE A 197 1 ? 17 
HELX_P HELX_P10 10 PHE B 5   ? LYS B 11  ? PHE B 4   LYS B 10  1 ? 7  
HELX_P HELX_P11 11 GLY B 24  ? GLY B 37  ? GLY B 23  GLY B 36  1 ? 14 
HELX_P HELX_P12 12 SER B 42  ? ALA B 52  ? SER B 41  ALA B 51  1 ? 11 
HELX_P HELX_P13 13 SER B 55  ? GLU B 66  ? SER B 54  GLU B 65  1 ? 12 
HELX_P HELX_P14 14 PRO B 72  ? LEU B 88  ? PRO B 71  LEU B 87  1 ? 17 
HELX_P HELX_P15 15 GLU B 102 ? ILE B 113 ? GLU B 101 ILE B 112 1 ? 12 
HELX_P HELX_P16 16 SER B 125 ? SER B 137 ? SER B 124 SER B 136 1 ? 13 
HELX_P HELX_P17 17 PRO B 142 ? LYS B 171 ? PRO B 141 LYS B 170 1 ? 30 
HELX_P HELX_P18 18 THR B 182 ? PHE B 198 ? THR B 181 PHE B 197 1 ? 17 
HELX_P HELX_P19 19 MET C 6   ? LYS C 11  ? MET C 5   LYS C 10  1 ? 6  
HELX_P HELX_P20 20 GLY C 24  ? GLY C 37  ? GLY C 23  GLY C 36  1 ? 14 
HELX_P HELX_P21 21 THR C 43  ? SER C 53  ? THR C 42  SER C 52  1 ? 11 
HELX_P HELX_P22 22 SER C 55  ? ARG C 67  ? SER C 54  ARG C 66  1 ? 13 
HELX_P HELX_P23 23 PRO C 72  ? LEU C 88  ? PRO C 71  LEU C 87  1 ? 17 
HELX_P HELX_P24 24 GLU C 102 ? ILE C 113 ? GLU C 101 ILE C 112 1 ? 12 
HELX_P HELX_P25 25 SER C 125 ? MET C 136 ? SER C 124 MET C 135 1 ? 12 
HELX_P HELX_P26 26 PRO C 142 ? THR C 170 ? PRO C 141 THR C 169 1 ? 29 
HELX_P HELX_P27 27 THR C 182 ? PHE C 198 ? THR C 181 PHE C 197 1 ? 17 
HELX_P HELX_P28 28 MET D 6   ? LYS D 11  ? MET D 5   LYS D 10  1 ? 6  
HELX_P HELX_P29 29 GLY D 24  ? GLY D 37  ? GLY D 23  GLY D 36  1 ? 14 
HELX_P HELX_P30 30 THR D 43  ? ALA D 52  ? THR D 42  ALA D 51  1 ? 10 
HELX_P HELX_P31 31 SER D 55  ? ARG D 67  ? SER D 54  ARG D 66  1 ? 13 
HELX_P HELX_P32 32 PRO D 72  ? LEU D 88  ? PRO D 71  LEU D 87  1 ? 17 
HELX_P HELX_P33 33 GLU D 102 ? ILE D 113 ? GLU D 101 ILE D 112 1 ? 12 
HELX_P HELX_P34 34 SER D 125 ? SER D 137 ? SER D 124 SER D 136 1 ? 13 
HELX_P HELX_P35 35 PRO D 142 ? THR D 172 ? PRO D 141 THR D 171 1 ? 31 
HELX_P HELX_P36 36 THR D 182 ? ILE D 197 ? THR D 181 ILE D 196 1 ? 16 
HELX_P HELX_P37 37 GLY E 24  ? GLY E 37  ? GLY E 23  GLY E 36  1 ? 14 
HELX_P HELX_P38 38 THR E 43  ? SER E 53  ? THR E 42  SER E 52  1 ? 11 
HELX_P HELX_P39 39 SER E 55  ? GLU E 66  ? SER E 54  GLU E 65  1 ? 12 
HELX_P HELX_P40 40 PRO E 72  ? LEU E 88  ? PRO E 71  LEU E 87  1 ? 17 
HELX_P HELX_P41 41 GLU E 102 ? ILE E 113 ? GLU E 101 ILE E 112 1 ? 12 
HELX_P HELX_P42 42 SER E 125 ? SER E 137 ? SER E 124 SER E 136 1 ? 13 
HELX_P HELX_P43 43 PRO E 142 ? THR E 172 ? PRO E 141 THR E 171 1 ? 31 
HELX_P HELX_P44 44 THR E 182 ? ILE E 197 ? THR E 181 ILE E 196 1 ? 16 
HELX_P HELX_P45 45 GLY F 24  ? GLY F 37  ? GLY F 23  GLY F 36  1 ? 14 
HELX_P HELX_P46 46 SER F 42  ? ALA F 52  ? SER F 41  ALA F 51  1 ? 11 
HELX_P HELX_P47 47 SER F 55  ? GLU F 66  ? SER F 54  GLU F 65  1 ? 12 
HELX_P HELX_P48 48 PRO F 72  ? LEU F 88  ? PRO F 71  LEU F 87  1 ? 17 
HELX_P HELX_P49 49 GLU F 102 ? ILE F 113 ? GLU F 101 ILE F 112 1 ? 12 
HELX_P HELX_P50 50 SER F 125 ? MET F 136 ? SER F 124 MET F 135 1 ? 12 
HELX_P HELX_P51 51 PRO F 142 ? THR F 172 ? PRO F 141 THR F 171 1 ? 31 
HELX_P HELX_P52 52 THR F 182 ? LEU F 199 ? THR F 181 LEU F 198 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 99 A . ? TYR 98 A PRO 100 A ? PRO 99 A 1 -5.33 
2 TYR 99 B . ? TYR 98 B PRO 100 B ? PRO 99 B 1 -3.98 
3 TYR 99 C . ? TYR 98 C PRO 100 C ? PRO 99 C 1 -7.88 
4 TYR 99 D . ? TYR 98 D PRO 100 D ? PRO 99 D 1 -7.17 
5 TYR 99 E . ? TYR 98 E PRO 100 E ? PRO 99 E 1 -2.68 
6 TYR 99 F . ? TYR 98 F PRO 100 F ? PRO 99 F 1 -1.15 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
BA ? 5 ? 
CA ? 5 ? 
DA ? 5 ? 
EA ? 5 ? 
FA ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel 
AA 2 3 ? parallel 
AA 3 4 ? parallel 
AA 4 5 ? parallel 
BA 1 2 ? parallel 
BA 2 3 ? parallel 
BA 3 4 ? parallel 
BA 4 5 ? parallel 
CA 1 2 ? parallel 
CA 2 3 ? parallel 
CA 3 4 ? parallel 
CA 4 5 ? parallel 
DA 1 2 ? parallel 
DA 2 3 ? parallel 
DA 3 4 ? parallel 
DA 4 5 ? parallel 
EA 1 2 ? parallel 
EA 2 3 ? parallel 
EA 3 4 ? parallel 
EA 4 5 ? parallel 
FA 1 2 ? parallel 
FA 2 3 ? parallel 
FA 3 4 ? parallel 
FA 4 5 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 39  ? SER A 42  ? THR A 38  SER A 41  
AA 2 PHE A 94  ? ASP A 97  ? PHE A 93  ASP A 96  
AA 3 ILE A 14  ? GLY A 19  ? ILE A 13  GLY A 18  
AA 4 LEU A 118 ? ASP A 123 ? LEU A 117 ASP A 122 
AA 5 GLN A 173 ? ASN A 178 ? GLN A 172 ASN A 177 
BA 1 THR B 39  ? LEU B 41  ? THR B 38  LEU B 40  
BA 2 PHE B 94  ? ASP B 97  ? PHE B 93  ASP B 96  
BA 3 ILE B 14  ? GLY B 19  ? ILE B 13  GLY B 18  
BA 4 LEU B 118 ? ASP B 123 ? LEU B 117 ASP B 122 
BA 5 LEU B 174 ? ASN B 178 ? LEU B 173 ASN B 177 
CA 1 THR C 39  ? SER C 42  ? THR C 38  SER C 41  
CA 2 PHE C 94  ? ASP C 97  ? PHE C 93  ASP C 96  
CA 3 ILE C 14  ? GLY C 19  ? ILE C 13  GLY C 18  
CA 4 LEU C 118 ? ASP C 123 ? LEU C 117 ASP C 122 
CA 5 GLN C 173 ? ASN C 178 ? GLN C 172 ASN C 177 
DA 1 THR D 39  ? SER D 42  ? THR D 38  SER D 41  
DA 2 PHE D 94  ? ASP D 97  ? PHE D 93  ASP D 96  
DA 3 ILE D 14  ? GLY D 19  ? ILE D 13  GLY D 18  
DA 4 LEU D 118 ? ASP D 123 ? LEU D 117 ASP D 122 
DA 5 LEU D 174 ? ASN D 178 ? LEU D 173 ASN D 177 
EA 1 THR E 39  ? SER E 42  ? THR E 38  SER E 41  
EA 2 PHE E 94  ? ASP E 97  ? PHE E 93  ASP E 96  
EA 3 ILE E 14  ? GLY E 19  ? ILE E 13  GLY E 18  
EA 4 LEU E 118 ? ASP E 123 ? LEU E 117 ASP E 122 
EA 5 GLN E 173 ? ASN E 178 ? GLN E 172 ASN E 177 
FA 1 THR F 39  ? LEU F 41  ? THR F 38  LEU F 40  
FA 2 PHE F 94  ? ASP F 97  ? PHE F 93  ASP F 96  
FA 3 ILE F 14  ? GLY F 19  ? ILE F 13  GLY F 18  
FA 4 LEU F 118 ? ASP F 123 ? LEU F 117 ASP F 122 
FA 5 GLN F 173 ? ASN F 178 ? GLN F 172 ASN F 177 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 41  ? N LEU A 40  O LEU A 95  ? O LEU A 94  
AA 2 3 N ILE A 96  ? N ILE A 95  O ILE A 15  ? O ILE A 14  
AA 3 4 N PHE A 16  ? N PHE A 15  O LEU A 118 ? O LEU A 117 
AA 4 5 N VAL A 119 ? N VAL A 118 O GLN A 173 ? O GLN A 172 
BA 1 2 N LEU B 41  ? N LEU B 40  O LEU B 95  ? O LEU B 94  
BA 2 3 N ILE B 96  ? N ILE B 95  O ILE B 15  ? O ILE B 14  
BA 3 4 N PHE B 16  ? N PHE B 15  O LEU B 118 ? O LEU B 117 
BA 4 5 N CYS B 121 ? N CYS B 120 O HIS B 175 ? O HIS B 174 
CA 1 2 N LEU C 41  ? N LEU C 40  O LEU C 95  ? O LEU C 94  
CA 2 3 N ILE C 96  ? N ILE C 95  O ILE C 15  ? O ILE C 14  
CA 3 4 N PHE C 16  ? N PHE C 15  O LEU C 118 ? O LEU C 117 
CA 4 5 N VAL C 119 ? N VAL C 118 O GLN C 173 ? O GLN C 172 
DA 1 2 N LEU D 41  ? N LEU D 40  O LEU D 95  ? O LEU D 94  
DA 2 3 N ILE D 96  ? N ILE D 95  O ILE D 15  ? O ILE D 14  
DA 3 4 N PHE D 16  ? N PHE D 15  O LEU D 118 ? O LEU D 117 
DA 4 5 N CYS D 121 ? N CYS D 120 O HIS D 175 ? O HIS D 174 
EA 1 2 N LEU E 41  ? N LEU E 40  O LEU E 95  ? O LEU E 94  
EA 2 3 N ILE E 96  ? N ILE E 95  O ILE E 15  ? O ILE E 14  
EA 3 4 N PHE E 16  ? N PHE E 15  O LEU E 118 ? O LEU E 117 
EA 4 5 N VAL E 119 ? N VAL E 118 O GLN E 173 ? O GLN E 172 
FA 1 2 N LEU F 41  ? N LEU F 40  O LEU F 95  ? O LEU F 94  
FA 2 3 N ILE F 96  ? N ILE F 95  O ILE F 15  ? O ILE F 14  
FA 3 4 N PHE F 16  ? N PHE F 15  O LEU F 118 ? O LEU F 117 
FA 4 5 N VAL F 119 ? N VAL F 118 O GLN F 173 ? O GLN F 172 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SO4 A1199' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 A1200' 
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A1201'  
AC4 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SO4 B1199' 
AC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CL B1200'  
AC6 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE SO4 C1198' 
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 D1197' 
AC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 E1198' 
AC9 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL E1199'  
BC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 F1199' 
BC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CL F1200'  
BC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL F1201'  
BC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE AMP B1201' 
BC5 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE AMP C1199' 
BC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE AMP F1202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 GLY A  20  ? GLY A 19   . ? 1_555 ? 
2  AC1 11 GLY A  22  ? GLY A 21   . ? 1_555 ? 
3  AC1 11 SER A  23  ? SER A 22   . ? 1_555 ? 
4  AC1 11 GLY A  24  ? GLY A 23   . ? 1_555 ? 
5  AC1 11 LYS A  25  ? LYS A 24   . ? 1_555 ? 
6  AC1 11 GLY A  26  ? GLY A 25   . ? 1_555 ? 
7  AC1 11 HOH V  .   ? HOH A 2120 . ? 1_555 ? 
8  AC1 11 HOH V  .   ? HOH A 2121 . ? 1_555 ? 
9  AC1 11 HOH V  .   ? HOH A 2122 . ? 1_555 ? 
10 AC1 11 HOH V  .   ? HOH A 2123 . ? 1_555 ? 
11 AC1 11 HOH V  .   ? HOH A 2124 . ? 1_555 ? 
12 AC2 6  SER A  55  ? SER A 54   . ? 1_555 ? 
13 AC2 6  GLU A  56  ? GLU A 55   . ? 1_555 ? 
14 AC2 6  HOH V  .   ? HOH A 2125 . ? 1_555 ? 
15 AC2 6  SER B  139 ? SER B 138  . ? 1_555 ? 
16 AC2 6  LEU B  141 ? LEU B 140  . ? 1_555 ? 
17 AC2 6  HOH W  .   ? HOH B 2080 . ? 1_555 ? 
18 AC3 1  ALA A  126 ? ALA A 125  . ? 1_555 ? 
19 AC4 11 GLY B  20  ? GLY B 19   . ? 1_555 ? 
20 AC4 11 PRO B  21  ? PRO B 20   . ? 1_555 ? 
21 AC4 11 GLY B  22  ? GLY B 21   . ? 1_555 ? 
22 AC4 11 SER B  23  ? SER B 22   . ? 1_555 ? 
23 AC4 11 GLY B  24  ? GLY B 23   . ? 1_555 ? 
24 AC4 11 LYS B  25  ? LYS B 24   . ? 1_555 ? 
25 AC4 11 GLY B  26  ? GLY B 25   . ? 1_555 ? 
26 AC4 11 HOH W  .   ? HOH B 2009 . ? 1_555 ? 
27 AC4 11 HOH W  .   ? HOH B 2099 . ? 1_555 ? 
28 AC4 11 HOH W  .   ? HOH B 2100 . ? 1_555 ? 
29 AC4 11 HOH W  .   ? HOH B 2101 . ? 1_555 ? 
30 AC5 2  HOH V  .   ? HOH A 2042 . ? 1_555 ? 
31 AC5 2  ARG B  153 ? ARG B 152  . ? 1_555 ? 
32 AC6 9  GLY C  20  ? GLY C 19   . ? 1_555 ? 
33 AC6 9  GLY C  22  ? GLY C 21   . ? 1_555 ? 
34 AC6 9  SER C  23  ? SER C 22   . ? 1_555 ? 
35 AC6 9  GLY C  24  ? GLY C 23   . ? 1_555 ? 
36 AC6 9  LYS C  25  ? LYS C 24   . ? 1_555 ? 
37 AC6 9  GLY C  26  ? GLY C 25   . ? 1_555 ? 
38 AC6 9  HOH X  .   ? HOH C 2003 . ? 1_555 ? 
39 AC6 9  HOH X  .   ? HOH C 2005 . ? 1_555 ? 
40 AC6 9  HOH X  .   ? HOH C 2084 . ? 1_555 ? 
41 AC7 6  GLY D  20  ? GLY D 19   . ? 1_555 ? 
42 AC7 6  GLY D  22  ? GLY D 21   . ? 1_555 ? 
43 AC7 6  SER D  23  ? SER D 22   . ? 1_555 ? 
44 AC7 6  GLY D  24  ? GLY D 23   . ? 1_555 ? 
45 AC7 6  LYS D  25  ? LYS D 24   . ? 1_555 ? 
46 AC7 6  GLY D  26  ? GLY D 25   . ? 1_555 ? 
47 AC8 8  GLY E  20  ? GLY E 19   . ? 1_555 ? 
48 AC8 8  GLY E  22  ? GLY E 21   . ? 1_555 ? 
49 AC8 8  SER E  23  ? SER E 22   . ? 1_555 ? 
50 AC8 8  GLY E  24  ? GLY E 23   . ? 1_555 ? 
51 AC8 8  LYS E  25  ? LYS E 24   . ? 1_555 ? 
52 AC8 8  GLY E  26  ? GLY E 25   . ? 1_555 ? 
53 AC8 8  HOH Z  .   ? HOH E 2039 . ? 1_555 ? 
54 AC8 8  HOH Z  .   ? HOH E 2040 . ? 1_555 ? 
55 AC9 1  ALA E  126 ? ALA E 125  . ? 1_555 ? 
56 BC1 10 GLY F  20  ? GLY F 19   . ? 1_555 ? 
57 BC1 10 GLY F  22  ? GLY F 21   . ? 1_555 ? 
58 BC1 10 SER F  23  ? SER F 22   . ? 1_555 ? 
59 BC1 10 GLY F  24  ? GLY F 23   . ? 1_555 ? 
60 BC1 10 LYS F  25  ? LYS F 24   . ? 1_555 ? 
61 BC1 10 GLY F  26  ? GLY F 25   . ? 1_555 ? 
62 BC1 10 HOH AA .   ? HOH F 2006 . ? 1_555 ? 
63 BC1 10 HOH AA .   ? HOH F 2010 . ? 1_555 ? 
64 BC1 10 HOH AA .   ? HOH F 2096 . ? 1_555 ? 
65 BC1 10 HOH AA .   ? HOH F 2097 . ? 1_555 ? 
66 BC2 3  ARG C  67  ? ARG C 66   . ? 1_555 ? 
67 BC2 3  ARG F  101 ? ARG F 100  . ? 1_555 ? 
68 BC2 3  TYR F  157 ? TYR F 156  . ? 1_555 ? 
69 BC3 1  ARG F  159 ? ARG F 158  . ? 1_555 ? 
70 BC4 3  GLU B  30  ? GLU B 29   . ? 1_555 ? 
71 BC4 3  HIS B  40  ? HIS B 39   . ? 1_555 ? 
72 BC4 3  HOH W  .   ? HOH B 2102 . ? 1_555 ? 
73 BC5 2  HIS C  40  ? HIS C 39   . ? 1_555 ? 
74 BC5 2  HOH X  .   ? HOH C 2086 . ? 1_555 ? 
75 BC6 4  GLU F  30  ? GLU F 29   . ? 1_555 ? 
76 BC6 4  HIS F  40  ? HIS F 39   . ? 1_555 ? 
77 BC6 4  HOH AA .   ? HOH F 2098 . ? 1_555 ? 
78 BC6 4  HOH AA .   ? HOH F 2099 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2BWJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BWJ 
_atom_sites.fract_transf_matrix[1][1]   0.005544 
_atom_sites.fract_transf_matrix[1][2]   0.003201 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006402 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008217 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A  1 4   ? 67.253  -2.871  9.028   1.00 97.64  ? 3    GLY A N     1 
ATOM   2    C  CA    . GLY A  1 4   ? 67.955  -4.117  9.470   1.00 96.98  ? 3    GLY A CA    1 
ATOM   3    C  C     . GLY A  1 4   ? 69.330  -3.767  10.000  1.00 95.89  ? 3    GLY A C     1 
ATOM   4    O  O     . GLY A  1 4   ? 69.517  -3.648  11.206  1.00 89.74  ? 3    GLY A O     1 
ATOM   5    N  N     . PHE A  1 5   ? 70.287  -3.593  9.085   1.00 98.03  ? 4    PHE A N     1 
ATOM   6    C  CA    . PHE A  1 5   ? 71.585  -2.970  9.408   1.00 95.03  ? 4    PHE A CA    1 
ATOM   7    C  C     . PHE A  1 5   ? 71.376  -1.509  9.818   1.00 86.78  ? 4    PHE A C     1 
ATOM   8    O  O     . PHE A  1 5   ? 71.992  -1.041  10.771  1.00 88.35  ? 4    PHE A O     1 
ATOM   9    C  CB    . PHE A  1 5   ? 72.570  -3.031  8.220   1.00 96.84  ? 4    PHE A CB    1 
ATOM   10   C  CG    . PHE A  1 5   ? 73.123  -4.416  7.932   1.00 103.44 ? 4    PHE A CG    1 
ATOM   11   C  CD1   . PHE A  1 5   ? 73.100  -4.934  6.633   1.00 103.98 ? 4    PHE A CD1   1 
ATOM   12   C  CD2   . PHE A  1 5   ? 73.683  -5.194  8.952   1.00 100.63 ? 4    PHE A CD2   1 
ATOM   13   C  CE1   . PHE A  1 5   ? 73.616  -6.207  6.357   1.00 100.09 ? 4    PHE A CE1   1 
ATOM   14   C  CE2   . PHE A  1 5   ? 74.200  -6.464  8.687   1.00 98.39  ? 4    PHE A CE2   1 
ATOM   15   C  CZ    . PHE A  1 5   ? 74.163  -6.974  7.385   1.00 96.10  ? 4    PHE A CZ    1 
ATOM   16   N  N     . MET A  1 6   ? 70.498  -0.807  9.093   1.00 76.57  ? 5    MET A N     1 
ATOM   17   C  CA    . MET A  1 6   ? 70.172  0.610   9.351   1.00 74.23  ? 5    MET A CA    1 
ATOM   18   C  C     . MET A  1 6   ? 69.820  0.834   10.839  1.00 72.76  ? 5    MET A C     1 
ATOM   19   O  O     . MET A  1 6   ? 70.523  1.551   11.553  1.00 66.85  ? 5    MET A O     1 
ATOM   20   C  CB    . MET A  1 6   ? 69.021  1.064   8.422   1.00 75.52  ? 5    MET A CB    1 
ATOM   21   C  CG    . MET A  1 6   ? 69.022  2.544   8.061   1.00 78.97  ? 5    MET A CG    1 
ATOM   22   N  N     . GLU A  1 7   ? 68.758  0.185   11.308  1.00 72.09  ? 6    GLU A N     1 
ATOM   23   C  CA    . GLU A  1 7   ? 68.350  0.296   12.701  1.00 69.63  ? 6    GLU A CA    1 
ATOM   24   C  C     . GLU A  1 7   ? 69.381  -0.347  13.636  1.00 67.22  ? 6    GLU A C     1 
ATOM   25   O  O     . GLU A  1 7   ? 69.501  0.074   14.782  1.00 63.36  ? 6    GLU A O     1 
ATOM   26   C  CB    . GLU A  1 7   ? 66.969  -0.338  12.905  1.00 74.54  ? 6    GLU A CB    1 
ATOM   27   C  CG    . GLU A  1 7   ? 66.477  -0.367  14.366  1.00 85.60  ? 6    GLU A CG    1 
ATOM   28   N  N     . ASP A  1 8   ? 70.108  -1.366  13.162  1.00 66.04  ? 7    ASP A N     1 
ATOM   29   C  CA    . ASP A  1 8   ? 71.181  -1.997  13.964  1.00 67.12  ? 7    ASP A CA    1 
ATOM   30   C  C     . ASP A  1 8   ? 72.322  -1.014  14.197  1.00 64.53  ? 7    ASP A C     1 
ATOM   31   O  O     . ASP A  1 8   ? 72.776  -0.847  15.326  1.00 61.15  ? 7    ASP A O     1 
ATOM   32   C  CB    . ASP A  1 8   ? 71.757  -3.254  13.280  1.00 71.40  ? 7    ASP A CB    1 
ATOM   33   C  CG    . ASP A  1 8   ? 70.996  -4.545  13.625  1.00 81.91  ? 7    ASP A CG    1 
ATOM   34   O  OD1   . ASP A  1 8   ? 70.362  -4.640  14.702  1.00 83.01  ? 7    ASP A OD1   1 
ATOM   35   O  OD2   . ASP A  1 8   ? 71.067  -5.483  12.803  1.00 75.32  ? 7    ASP A OD2   1 
ATOM   36   N  N     . LEU A  1 9   ? 72.778  -0.392  13.110  1.00 65.07  ? 8    LEU A N     1 
ATOM   37   C  CA    . LEU A  1 9   ? 73.844  0.607   13.160  1.00 67.39  ? 8    LEU A CA    1 
ATOM   38   C  C     . LEU A  1 9   ? 73.470  1.802   14.008  1.00 63.43  ? 8    LEU A C     1 
ATOM   39   O  O     . LEU A  1 9   ? 74.321  2.341   14.690  1.00 62.28  ? 8    LEU A O     1 
ATOM   40   C  CB    . LEU A  1 9   ? 74.213  1.102   11.760  1.00 65.61  ? 8    LEU A CB    1 
ATOM   41   C  CG    . LEU A  1 9   ? 75.182  0.260   10.939  1.00 74.29  ? 8    LEU A CG    1 
ATOM   42   C  CD1   . LEU A  1 9   ? 75.310  0.865   9.530   1.00 74.44  ? 8    LEU A CD1   1 
ATOM   43   C  CD2   . LEU A  1 9   ? 76.529  0.159   11.633  1.00 70.68  ? 8    LEU A CD2   1 
ATOM   44   N  N     . ARG A  1 10  ? 72.202  2.206   13.958  1.00 62.73  ? 9    ARG A N     1 
ATOM   45   C  CA    . ARG A  1 10  ? 71.729  3.360   14.714  1.00 66.57  ? 9    ARG A CA    1 
ATOM   46   C  C     . ARG A  1 10  ? 71.670  3.092   16.227  1.00 68.15  ? 9    ARG A C     1 
ATOM   47   O  O     . ARG A  1 10  ? 71.737  4.036   17.010  1.00 69.06  ? 9    ARG A O     1 
ATOM   48   C  CB    . ARG A  1 10  ? 70.338  3.810   14.254  1.00 64.07  ? 9    ARG A CB    1 
ATOM   49   C  CG    . ARG A  1 10  ? 70.277  4.482   12.898  1.00 72.73  ? 9    ARG A CG    1 
ATOM   50   C  CD    . ARG A  1 10  ? 69.242  5.594   12.888  1.00 71.97  ? 9    ARG A CD    1 
ATOM   51   N  NE    . ARG A  1 10  ? 69.677  6.707   13.735  1.00 77.69  ? 9    ARG A NE    1 
ATOM   52   C  CZ    . ARG A  1 10  ? 70.466  7.706   13.345  1.00 78.22  ? 9    ARG A CZ    1 
ATOM   53   N  NH1   . ARG A  1 10  ? 70.925  7.772   12.100  1.00 60.00  ? 9    ARG A NH1   1 
ATOM   54   N  NH2   . ARG A  1 10  ? 70.791  8.656   14.214  1.00 83.29  ? 9    ARG A NH2   1 
ATOM   55   N  N     . LYS A  1 11  ? 71.544  1.826   16.621  1.00 63.95  ? 10   LYS A N     1 
ATOM   56   C  CA    . LYS A  1 11  ? 71.389  1.470   18.019  1.00 66.17  ? 10   LYS A CA    1 
ATOM   57   C  C     . LYS A  1 11  ? 72.648  0.836   18.645  1.00 68.80  ? 10   LYS A C     1 
ATOM   58   O  O     . LYS A  1 11  ? 72.631  0.473   19.816  1.00 71.20  ? 10   LYS A O     1 
ATOM   59   C  CB    . LYS A  1 11  ? 70.171  0.554   18.193  1.00 65.58  ? 10   LYS A CB    1 
ATOM   60   C  CG    . LYS A  1 11  ? 70.365  -0.892  17.724  1.00 71.83  ? 10   LYS A CG    1 
ATOM   61   N  N     . CYS A  1 12  ? 73.746  0.732   17.903  1.00 68.61  ? 11   CYS A N     1 
ATOM   62   C  CA    . CYS A  1 12  ? 74.966  0.133   18.455  1.00 65.69  ? 11   CYS A CA    1 
ATOM   63   C  C     . CYS A  1 12  ? 75.825  1.158   19.226  1.00 62.53  ? 11   CYS A C     1 
ATOM   64   O  O     . CYS A  1 12  ? 75.611  2.369   19.099  1.00 60.08  ? 11   CYS A O     1 
ATOM   65   C  CB    . CYS A  1 12  ? 75.760  -0.514  17.325  1.00 65.95  ? 11   CYS A CB    1 
ATOM   66   S  SG    . CYS A  1 12  ? 76.610  0.642   16.278  1.00 74.10  ? 11   CYS A SG    1 
ATOM   67   N  N     . LYS A  1 13  ? 76.791  0.687   20.023  1.00 57.76  ? 12   LYS A N     1 
ATOM   68   C  CA    . LYS A  1 13  ? 77.656  1.599   20.781  1.00 55.25  ? 12   LYS A CA    1 
ATOM   69   C  C     . LYS A  1 13  ? 78.660  2.251   19.851  1.00 57.51  ? 12   LYS A C     1 
ATOM   70   O  O     . LYS A  1 13  ? 79.407  1.552   19.158  1.00 54.71  ? 12   LYS A O     1 
ATOM   71   C  CB    . LYS A  1 13  ? 78.423  0.893   21.902  1.00 58.40  ? 12   LYS A CB    1 
ATOM   72   C  CG    . LYS A  1 13  ? 77.581  0.018   22.783  1.00 51.10  ? 12   LYS A CG    1 
ATOM   73   C  CD    . LYS A  1 13  ? 78.339  -0.427  24.026  1.00 59.63  ? 12   LYS A CD    1 
ATOM   74   C  CE    . LYS A  1 13  ? 77.569  -1.508  24.750  1.00 52.46  ? 12   LYS A CE    1 
ATOM   75   N  NZ    . LYS A  1 13  ? 77.610  -2.816  23.955  1.00 60.79  ? 12   LYS A NZ    1 
ATOM   76   N  N     . ILE A  1 14  ? 78.647  3.584   19.840  1.00 52.12  ? 13   ILE A N     1 
ATOM   77   C  CA    . ILE A  1 14  ? 79.542  4.388   19.050  1.00 54.73  ? 13   ILE A CA    1 
ATOM   78   C  C     . ILE A  1 14  ? 80.237  5.411   19.951  1.00 53.56  ? 13   ILE A C     1 
ATOM   79   O  O     . ILE A  1 14  ? 79.597  6.264   20.595  1.00 50.82  ? 13   ILE A O     1 
ATOM   80   C  CB    . ILE A  1 14  ? 78.815  5.089   17.880  1.00 60.67  ? 13   ILE A CB    1 
ATOM   81   C  CG1   . ILE A  1 14  ? 78.106  4.050   17.021  1.00 54.56  ? 13   ILE A CG1   1 
ATOM   82   C  CG2   . ILE A  1 14  ? 79.810  5.849   17.006  1.00 55.92  ? 13   ILE A CG2   1 
ATOM   83   C  CD1   . ILE A  1 14  ? 77.302  4.633   15.867  1.00 58.71  ? 13   ILE A CD1   1 
ATOM   84   N  N     . ILE A  1 15  ? 81.559  5.268   20.019  1.00 53.22  ? 14   ILE A N     1 
ATOM   85   C  CA    . ILE A  1 15  ? 82.404  6.149   20.794  1.00 55.84  ? 14   ILE A CA    1 
ATOM   86   C  C     . ILE A  1 15  ? 83.396  6.800   19.827  1.00 52.35  ? 14   ILE A C     1 
ATOM   87   O  O     . ILE A  1 15  ? 84.010  6.122   19.018  1.00 52.22  ? 14   ILE A O     1 
ATOM   88   C  CB    . ILE A  1 15  ? 83.171  5.380   21.867  1.00 56.75  ? 14   ILE A CB    1 
ATOM   89   C  CG1   . ILE A  1 15  ? 82.194  4.660   22.797  1.00 62.26  ? 14   ILE A CG1   1 
ATOM   90   C  CG2   . ILE A  1 15  ? 84.088  6.341   22.694  1.00 57.84  ? 14   ILE A CG2   1 
ATOM   91   C  CD1   . ILE A  1 15  ? 82.879  3.631   23.653  1.00 61.76  ? 14   ILE A CD1   1 
ATOM   92   N  N     . PHE A  1 16  ? 83.501  8.116   19.877  1.00 54.48  ? 15   PHE A N     1 
ATOM   93   C  CA    . PHE A  1 16  ? 84.542  8.809   19.122  1.00 56.22  ? 15   PHE A CA    1 
ATOM   94   C  C     . PHE A  1 16  ? 85.652  9.160   20.124  1.00 55.85  ? 15   PHE A C     1 
ATOM   95   O  O     . PHE A  1 16  ? 85.382  9.586   21.240  1.00 54.42  ? 15   PHE A O     1 
ATOM   96   C  CB    . PHE A  1 16  ? 84.024  10.095  18.517  1.00 54.59  ? 15   PHE A CB    1 
ATOM   97   C  CG    . PHE A  1 16  ? 83.076  9.933   17.381  1.00 56.45  ? 15   PHE A CG    1 
ATOM   98   C  CD1   . PHE A  1 16  ? 82.463  11.061  16.856  1.00 59.90  ? 15   PHE A CD1   1 
ATOM   99   C  CD2   . PHE A  1 16  ? 82.798  8.695   16.807  1.00 67.39  ? 15   PHE A CD2   1 
ATOM   100  C  CE1   . PHE A  1 16  ? 81.583  10.961  15.787  1.00 65.98  ? 15   PHE A CE1   1 
ATOM   101  C  CE2   . PHE A  1 16  ? 81.916  8.589   15.744  1.00 62.98  ? 15   PHE A CE2   1 
ATOM   102  C  CZ    . PHE A  1 16  ? 81.313  9.727   15.225  1.00 65.49  ? 15   PHE A CZ    1 
ATOM   103  N  N     . ILE A  1 17  ? 86.893  8.973   19.720  1.00 57.25  ? 16   ILE A N     1 
ATOM   104  C  CA    . ILE A  1 17  ? 88.012  9.311   20.577  1.00 57.02  ? 16   ILE A CA    1 
ATOM   105  C  C     . ILE A  1 17  ? 88.966  10.219  19.793  1.00 58.22  ? 16   ILE A C     1 
ATOM   106  O  O     . ILE A  1 17  ? 89.415  9.883   18.700  1.00 61.69  ? 16   ILE A O     1 
ATOM   107  C  CB    . ILE A  1 17  ? 88.694  8.055   21.190  1.00 59.40  ? 16   ILE A CB    1 
ATOM   108  C  CG1   . ILE A  1 17  ? 89.884  8.489   22.070  1.00 65.56  ? 16   ILE A CG1   1 
ATOM   109  C  CG2   . ILE A  1 17  ? 89.117  7.055   20.108  1.00 66.45  ? 16   ILE A CG2   1 
ATOM   110  C  CD1   . ILE A  1 17  ? 90.124  7.567   23.219  1.00 64.07  ? 16   ILE A CD1   1 
ATOM   111  N  N     . ILE A  1 18  ? 89.212  11.392  20.366  1.00 58.99  ? 17   ILE A N     1 
ATOM   112  C  CA    . ILE A  1 18  ? 89.964  12.467  19.766  1.00 59.85  ? 17   ILE A CA    1 
ATOM   113  C  C     . ILE A  1 18  ? 91.131  12.880  20.689  1.00 59.06  ? 17   ILE A C     1 
ATOM   114  O  O     . ILE A  1 18  ? 90.984  13.004  21.892  1.00 57.16  ? 17   ILE A O     1 
ATOM   115  C  CB    . ILE A  1 18  ? 89.026  13.668  19.553  1.00 64.30  ? 17   ILE A CB    1 
ATOM   116  C  CG1   . ILE A  1 18  ? 88.021  13.346  18.446  1.00 67.94  ? 17   ILE A CG1   1 
ATOM   117  C  CG2   . ILE A  1 18  ? 89.799  14.926  19.162  1.00 71.43  ? 17   ILE A CG2   1 
ATOM   118  C  CD1   . ILE A  1 18  ? 86.755  14.126  18.582  1.00 79.50  ? 17   ILE A CD1   1 
ATOM   119  N  N     . GLY A  1 19  ? 92.302  13.078  20.108  1.00 56.10  ? 18   GLY A N     1 
ATOM   120  C  CA    . GLY A  1 19  ? 93.489  13.314  20.901  1.00 56.69  ? 18   GLY A CA    1 
ATOM   121  C  C     . GLY A  1 19  ? 94.616  13.707  19.969  1.00 54.89  ? 18   GLY A C     1 
ATOM   122  O  O     . GLY A  1 19  ? 94.681  13.241  18.849  1.00 55.14  ? 18   GLY A O     1 
ATOM   123  N  N     . GLY A  1 20  ? 95.502  14.563  20.443  1.00 53.27  ? 19   GLY A N     1 
ATOM   124  C  CA    . GLY A  1 20  ? 96.611  15.043  19.653  1.00 54.36  ? 19   GLY A CA    1 
ATOM   125  C  C     . GLY A  1 20  ? 97.741  14.051  19.568  1.00 52.35  ? 19   GLY A C     1 
ATOM   126  O  O     . GLY A  1 20  ? 97.773  13.096  20.333  1.00 54.43  ? 19   GLY A O     1 
ATOM   127  N  N     . PRO A  1 21  ? 98.657  14.246  18.599  1.00 55.00  ? 20   PRO A N     1 
ATOM   128  C  CA    . PRO A  1 21  ? 99.815  13.335  18.506  1.00 56.37  ? 20   PRO A CA    1 
ATOM   129  C  C     . PRO A  1 21  ? 100.660 13.436  19.792  1.00 54.15  ? 20   PRO A C     1 
ATOM   130  O  O     . PRO A  1 21  ? 100.927 14.522  20.264  1.00 54.27  ? 20   PRO A O     1 
ATOM   131  C  CB    . PRO A  1 21  ? 100.587 13.866  17.286  1.00 55.49  ? 20   PRO A CB    1 
ATOM   132  C  CG    . PRO A  1 21  ? 100.202 15.330  17.221  1.00 56.82  ? 20   PRO A CG    1 
ATOM   133  C  CD    . PRO A  1 21  ? 98.719  15.311  17.578  1.00 53.59  ? 20   PRO A CD    1 
ATOM   134  N  N     . GLY A  1 22  ? 101.035 12.306  20.364  1.00 54.55  ? 21   GLY A N     1 
ATOM   135  C  CA    . GLY A  1 22  ? 101.707 12.302  21.645  1.00 56.54  ? 21   GLY A CA    1 
ATOM   136  C  C     . GLY A  1 22  ? 100.793 12.213  22.854  1.00 60.03  ? 21   GLY A C     1 
ATOM   137  O  O     . GLY A  1 22  ? 101.286 12.142  23.972  1.00 59.52  ? 21   GLY A O     1 
ATOM   138  N  N     . SER A  1 23  ? 99.477  12.198  22.646  1.00 59.47  ? 22   SER A N     1 
ATOM   139  C  CA    . SER A  1 23  ? 98.519  12.166  23.760  1.00 58.20  ? 22   SER A CA    1 
ATOM   140  C  C     . SER A  1 23  ? 98.405  10.759  24.363  1.00 60.54  ? 22   SER A C     1 
ATOM   141  O  O     . SER A  1 23  ? 98.034  10.598  25.529  1.00 66.72  ? 22   SER A O     1 
ATOM   142  C  CB    . SER A  1 23  ? 97.141  12.661  23.321  1.00 52.59  ? 22   SER A CB    1 
ATOM   143  O  OG    . SER A  1 23  ? 96.589  11.854  22.281  1.00 57.36  ? 22   SER A OG    1 
ATOM   144  N  N     . GLY A  1 24  ? 98.756  9.754   23.564  1.00 58.71  ? 23   GLY A N     1 
ATOM   145  C  CA    . GLY A  1 24  ? 98.735  8.375   23.983  1.00 56.97  ? 23   GLY A CA    1 
ATOM   146  C  C     . GLY A  1 24  ? 97.512  7.663   23.458  1.00 59.63  ? 23   GLY A C     1 
ATOM   147  O  O     . GLY A  1 24  ? 97.189  6.563   23.901  1.00 60.80  ? 23   GLY A O     1 
ATOM   148  N  N     . LYS A  1 25  ? 96.844  8.282   22.498  1.00 56.78  ? 24   LYS A N     1 
ATOM   149  C  CA    . LYS A  1 25  ? 95.546  7.799   22.049  1.00 59.64  ? 24   LYS A CA    1 
ATOM   150  C  C     . LYS A  1 25  ? 95.656  6.404   21.454  1.00 58.97  ? 24   LYS A C     1 
ATOM   151  O  O     . LYS A  1 25  ? 94.856  5.541   21.769  1.00 59.16  ? 24   LYS A O     1 
ATOM   152  C  CB    . LYS A  1 25  ? 94.898  8.804   21.072  1.00 57.75  ? 24   LYS A CB    1 
ATOM   153  C  CG    . LYS A  1 25  ? 93.717  8.273   20.289  1.00 62.00  ? 24   LYS A CG    1 
ATOM   154  C  CD    . LYS A  1 25  ? 92.900  9.381   19.614  1.00 62.06  ? 24   LYS A CD    1 
ATOM   155  C  CE    . LYS A  1 25  ? 93.668  10.135  18.530  1.00 62.11  ? 24   LYS A CE    1 
ATOM   156  N  NZ    . LYS A  1 25  ? 94.395  9.318   17.553  1.00 63.70  ? 24   LYS A NZ    1 
ATOM   157  N  N     . GLY A  1 26  ? 96.661  6.180   20.614  1.00 62.39  ? 25   GLY A N     1 
ATOM   158  C  CA    . GLY A  1 26  ? 96.832  4.899   19.930  1.00 59.50  ? 25   GLY A CA    1 
ATOM   159  C  C     . GLY A  1 26  ? 96.938  3.720   20.870  1.00 62.99  ? 25   GLY A C     1 
ATOM   160  O  O     . GLY A  1 26  ? 96.253  2.708   20.708  1.00 63.62  ? 25   GLY A O     1 
ATOM   161  N  N     . THR A  1 27  ? 97.800  3.838   21.870  1.00 64.91  ? 26   THR A N     1 
ATOM   162  C  CA    . THR A  1 27  ? 98.009  2.732   22.779  1.00 63.58  ? 26   THR A CA    1 
ATOM   163  C  C     . THR A  1 27  ? 96.786  2.524   23.709  1.00 63.51  ? 26   THR A C     1 
ATOM   164  O  O     . THR A  1 27  ? 96.470  1.389   24.110  1.00 61.60  ? 26   THR A O     1 
ATOM   165  C  CB    . THR A  1 27  ? 99.324  2.895   23.586  1.00 71.77  ? 26   THR A CB    1 
ATOM   166  O  OG1   . THR A  1 27  ? 99.310  4.137   24.293  1.00 91.21  ? 26   THR A OG1   1 
ATOM   167  C  CG2   . THR A  1 27  ? 100.537 2.858   22.655  1.00 75.96  ? 26   THR A CG2   1 
ATOM   168  N  N     . GLN A  1 28  ? 96.091  3.608   24.036  1.00 59.63  ? 27   GLN A N     1 
ATOM   169  C  CA    . GLN A  1 28  ? 94.873  3.493   24.817  1.00 59.11  ? 27   GLN A CA    1 
ATOM   170  C  C     . GLN A  1 28  ? 93.755  2.737   24.078  1.00 55.27  ? 27   GLN A C     1 
ATOM   171  O  O     . GLN A  1 28  ? 92.984  2.000   24.680  1.00 57.57  ? 27   GLN A O     1 
ATOM   172  C  CB    . GLN A  1 28  ? 94.403  4.890   25.244  1.00 59.83  ? 27   GLN A CB    1 
ATOM   173  C  CG    . GLN A  1 28  ? 95.332  5.561   26.296  1.00 55.87  ? 27   GLN A CG    1 
ATOM   174  C  CD    . GLN A  1 28  ? 95.528  4.769   27.580  1.00 55.42  ? 27   GLN A CD    1 
ATOM   175  O  OE1   . GLN A  1 28  ? 94.681  3.980   27.978  1.00 66.57  ? 27   GLN A OE1   1 
ATOM   176  N  NE2   . GLN A  1 28  ? 96.660  4.989   28.240  1.00 58.98  ? 27   GLN A NE2   1 
ATOM   177  N  N     . CYS A  1 29  ? 93.676  2.929   22.774  1.00 57.59  ? 28   CYS A N     1 
ATOM   178  C  CA    . CYS A  1 29  ? 92.666  2.289   21.945  1.00 56.58  ? 28   CYS A CA    1 
ATOM   179  C  C     . CYS A  1 29  ? 92.848  0.774   21.879  1.00 56.31  ? 28   CYS A C     1 
ATOM   180  O  O     . CYS A  1 29  ? 91.868  0.034   21.899  1.00 56.91  ? 28   CYS A O     1 
ATOM   181  C  CB    . CYS A  1 29  ? 92.682  2.894   20.549  1.00 61.60  ? 28   CYS A CB    1 
ATOM   182  S  SG    . CYS A  1 29  ? 91.863  4.519   20.405  1.00 63.03  ? 28   CYS A SG    1 
ATOM   183  N  N     . GLU A  1 30  ? 94.102  0.324   21.813  1.00 58.08  ? 29   GLU A N     1 
ATOM   184  C  CA    . GLU A  1 30  ? 94.455  -1.107  21.799  1.00 62.08  ? 29   GLU A CA    1 
ATOM   185  C  C     . GLU A  1 30  ? 94.017  -1.800  23.097  1.00 61.50  ? 29   GLU A C     1 
ATOM   186  O  O     . GLU A  1 30  ? 93.540  -2.940  23.068  1.00 58.67  ? 29   GLU A O     1 
ATOM   187  C  CB    . GLU A  1 30  ? 95.970  -1.313  21.604  1.00 61.14  ? 29   GLU A CB    1 
ATOM   188  C  CG    . GLU A  1 30  ? 96.500  -0.864  20.231  1.00 77.50  ? 29   GLU A CG    1 
ATOM   189  C  CD    . GLU A  1 30  ? 98.041  -0.614  20.175  1.00 81.47  ? 29   GLU A CD    1 
ATOM   190  O  OE1   . GLU A  1 30  ? 98.741  -0.781  21.203  1.00 88.34  ? 29   GLU A OE1   1 
ATOM   191  O  OE2   . GLU A  1 30  ? 98.546  -0.243  19.078  1.00 95.09  ? 29   GLU A OE2   1 
ATOM   192  N  N     . LYS A  1 31  ? 94.187  -1.098  24.214  1.00 57.93  ? 30   LYS A N     1 
ATOM   193  C  CA    . LYS A  1 31  ? 93.761  -1.585  25.524  1.00 57.90  ? 30   LYS A CA    1 
ATOM   194  C  C     . LYS A  1 31  ? 92.249  -1.577  25.699  1.00 54.63  ? 30   LYS A C     1 
ATOM   195  O  O     . LYS A  1 31  ? 91.686  -2.485  26.276  1.00 60.65  ? 30   LYS A O     1 
ATOM   196  C  CB    . LYS A  1 31  ? 94.410  -0.727  26.621  1.00 57.88  ? 30   LYS A CB    1 
ATOM   197  C  CG    . LYS A  1 31  ? 95.921  -0.893  26.655  1.00 66.72  ? 30   LYS A CG    1 
ATOM   198  C  CD    . LYS A  1 31  ? 96.626  0.331   27.187  1.00 83.99  ? 30   LYS A CD    1 
ATOM   199  C  CE    . LYS A  1 31  ? 96.399  0.541   28.653  1.00 76.34  ? 30   LYS A CE    1 
ATOM   200  N  NZ    . LYS A  1 31  ? 97.292  1.621   29.170  1.00 84.51  ? 30   LYS A NZ    1 
ATOM   201  N  N     . LEU A  1 32  ? 91.599  -0.518  25.250  1.00 56.42  ? 31   LEU A N     1 
ATOM   202  C  CA    . LEU A  1 32  ? 90.135  -0.472  25.228  1.00 56.33  ? 31   LEU A CA    1 
ATOM   203  C  C     . LEU A  1 32  ? 89.513  -1.601  24.394  1.00 54.89  ? 31   LEU A C     1 
ATOM   204  O  O     . LEU A  1 32  ? 88.531  -2.186  24.788  1.00 57.68  ? 31   LEU A O     1 
ATOM   205  C  CB    . LEU A  1 32  ? 89.661  0.877   24.691  1.00 55.44  ? 31   LEU A CB    1 
ATOM   206  C  CG    . LEU A  1 32  ? 89.854  2.085   25.613  1.00 52.46  ? 31   LEU A CG    1 
ATOM   207  C  CD1   . LEU A  1 32  ? 89.430  3.365   24.863  1.00 63.00  ? 31   LEU A CD1   1 
ATOM   208  C  CD2   . LEU A  1 32  ? 89.101  1.943   26.937  1.00 57.44  ? 31   LEU A CD2   1 
ATOM   209  N  N     . VAL A  1 33  ? 90.081  -1.887  23.234  1.00 58.18  ? 32   VAL A N     1 
ATOM   210  C  CA    . VAL A  1 33  ? 89.596  -2.970  22.380  1.00 56.61  ? 32   VAL A CA    1 
ATOM   211  C  C     . VAL A  1 33  ? 89.643  -4.277  23.119  1.00 55.71  ? 32   VAL A C     1 
ATOM   212  O  O     . VAL A  1 33  ? 88.643  -4.988  23.211  1.00 58.38  ? 32   VAL A O     1 
ATOM   213  C  CB    . VAL A  1 33  ? 90.451  -3.061  21.085  1.00 64.26  ? 32   VAL A CB    1 
ATOM   214  C  CG1   . VAL A  1 33  ? 90.309  -4.424  20.378  1.00 64.05  ? 32   VAL A CG1   1 
ATOM   215  C  CG2   . VAL A  1 33  ? 90.073  -1.956  20.169  1.00 60.52  ? 32   VAL A CG2   1 
ATOM   216  N  N     . GLU A  1 34  ? 90.805  -4.547  23.690  1.00 53.83  ? 33   GLU A N     1 
ATOM   217  C  CA    . GLU A  1 34  ? 91.062  -5.761  24.413  1.00 56.76  ? 33   GLU A CA    1 
ATOM   218  C  C     . GLU A  1 34  ? 90.129  -5.955  25.624  1.00 59.06  ? 33   GLU A C     1 
ATOM   219  O  O     . GLU A  1 34  ? 89.667  -7.060  25.858  1.00 59.43  ? 33   GLU A O     1 
ATOM   220  C  CB    . GLU A  1 34  ? 92.534  -5.781  24.857  1.00 57.69  ? 33   GLU A CB    1 
ATOM   221  C  CG    . GLU A  1 34  ? 92.980  -7.132  25.435  1.00 77.36  ? 33   GLU A CG    1 
ATOM   222  N  N     . LYS A  1 35  ? 89.857  -4.888  26.374  1.00 56.15  ? 34   LYS A N     1 
ATOM   223  C  CA    . LYS A  1 35  ? 89.063  -4.957  27.595  1.00 55.04  ? 34   LYS A CA    1 
ATOM   224  C  C     . LYS A  1 35  ? 87.570  -5.064  27.316  1.00 53.71  ? 34   LYS A C     1 
ATOM   225  O  O     . LYS A  1 35  ? 86.873  -5.869  27.936  1.00 52.05  ? 34   LYS A O     1 
ATOM   226  C  CB    . LYS A  1 35  ? 89.310  -3.707  28.469  1.00 53.28  ? 34   LYS A CB    1 
ATOM   227  C  CG    . LYS A  1 35  ? 88.440  -3.666  29.718  1.00 60.49  ? 34   LYS A CG    1 
ATOM   228  C  CD    . LYS A  1 35  ? 88.993  -2.775  30.777  1.00 55.14  ? 34   LYS A CD    1 
ATOM   229  C  CE    . LYS A  1 35  ? 87.920  -2.041  31.584  1.00 51.93  ? 34   LYS A CE    1 
ATOM   230  N  NZ    . LYS A  1 35  ? 86.849  -2.773  32.164  1.00 51.59  ? 34   LYS A NZ    1 
ATOM   231  N  N     . TYR A  1 36  ? 87.097  -4.219  26.413  1.00 50.77  ? 35   TYR A N     1 
ATOM   232  C  CA    . TYR A  1 36  ? 85.666  -4.055  26.125  1.00 50.68  ? 35   TYR A CA    1 
ATOM   233  C  C     . TYR A  1 36  ? 85.146  -4.889  24.953  1.00 52.52  ? 35   TYR A C     1 
ATOM   234  O  O     . TYR A  1 36  ? 83.921  -5.006  24.774  1.00 51.98  ? 35   TYR A O     1 
ATOM   235  C  CB    . TYR A  1 36  ? 85.368  -2.569  25.837  1.00 49.37  ? 35   TYR A CB    1 
ATOM   236  C  CG    . TYR A  1 36  ? 85.443  -1.726  27.073  1.00 52.00  ? 35   TYR A CG    1 
ATOM   237  C  CD1   . TYR A  1 36  ? 86.504  -0.849  27.302  1.00 53.14  ? 35   TYR A CD1   1 
ATOM   238  C  CD2   . TYR A  1 36  ? 84.474  -1.856  28.056  1.00 55.17  ? 35   TYR A CD2   1 
ATOM   239  C  CE1   . TYR A  1 36  ? 86.566  -0.095  28.490  1.00 45.73  ? 35   TYR A CE1   1 
ATOM   240  C  CE2   . TYR A  1 36  ? 84.526  -1.130  29.230  1.00 49.56  ? 35   TYR A CE2   1 
ATOM   241  C  CZ    . TYR A  1 36  ? 85.538  -0.245  29.434  1.00 57.28  ? 35   TYR A CZ    1 
ATOM   242  O  OH    . TYR A  1 36  ? 85.493  0.441   30.596  1.00 50.18  ? 35   TYR A OH    1 
ATOM   243  N  N     . GLY A  1 37  ? 86.057  -5.451  24.158  1.00 51.22  ? 36   GLY A N     1 
ATOM   244  C  CA    . GLY A  1 37  ? 85.682  -6.116  22.922  1.00 53.88  ? 36   GLY A CA    1 
ATOM   245  C  C     . GLY A  1 37  ? 85.050  -5.149  21.912  1.00 56.20  ? 36   GLY A C     1 
ATOM   246  O  O     . GLY A  1 37  ? 84.086  -5.490  21.244  1.00 52.93  ? 36   GLY A O     1 
ATOM   247  N  N     . PHE A  1 38  ? 85.568  -3.924  21.837  1.00 58.35  ? 37   PHE A N     1 
ATOM   248  C  CA    . PHE A  1 38  ? 85.125  -2.987  20.827  1.00 54.54  ? 37   PHE A CA    1 
ATOM   249  C  C     . PHE A  1 38  ? 85.928  -3.221  19.552  1.00 57.04  ? 37   PHE A C     1 
ATOM   250  O  O     . PHE A  1 38  ? 87.040  -3.764  19.560  1.00 56.05  ? 37   PHE A O     1 
ATOM   251  C  CB    . PHE A  1 38  ? 85.337  -1.524  21.237  1.00 62.57  ? 37   PHE A CB    1 
ATOM   252  C  CG    . PHE A  1 38  ? 84.508  -1.073  22.384  1.00 62.00  ? 37   PHE A CG    1 
ATOM   253  C  CD1   . PHE A  1 38  ? 85.022  -0.136  23.280  1.00 75.15  ? 37   PHE A CD1   1 
ATOM   254  C  CD2   . PHE A  1 38  ? 83.230  -1.585  22.602  1.00 66.96  ? 37   PHE A CD2   1 
ATOM   255  C  CE1   . PHE A  1 38  ? 84.259  0.297   24.369  1.00 69.83  ? 37   PHE A CE1   1 
ATOM   256  C  CE2   . PHE A  1 38  ? 82.463  -1.160  23.668  1.00 57.61  ? 37   PHE A CE2   1 
ATOM   257  C  CZ    . PHE A  1 38  ? 82.970  -0.223  24.557  1.00 68.19  ? 37   PHE A CZ    1 
ATOM   258  N  N     . THR A  1 39  ? 85.358  -2.767  18.455  1.00 54.36  ? 38   THR A N     1 
ATOM   259  C  CA    . THR A  1 39  ? 86.071  -2.709  17.185  1.00 58.16  ? 38   THR A CA    1 
ATOM   260  C  C     . THR A  1 39  ? 86.666  -1.306  17.055  1.00 54.89  ? 38   THR A C     1 
ATOM   261  O  O     . THR A  1 39  ? 85.945  -0.328  17.064  1.00 53.55  ? 38   THR A O     1 
ATOM   262  C  CB    . THR A  1 39  ? 85.088  -3.021  16.044  1.00 57.02  ? 38   THR A CB    1 
ATOM   263  O  OG1   . THR A  1 39  ? 84.537  -4.334  16.273  1.00 52.41  ? 38   THR A OG1   1 
ATOM   264  C  CG2   . THR A  1 39  ? 85.762  -2.984  14.687  1.00 52.31  ? 38   THR A CG2   1 
ATOM   265  N  N     . HIS A  1 40  ? 87.989  -1.229  16.941  1.00 58.02  ? 39   HIS A N     1 
ATOM   266  C  CA    . HIS A  1 40  ? 88.697  0.036   16.695  1.00 56.12  ? 39   HIS A CA    1 
ATOM   267  C  C     . HIS A  1 40  ? 88.793  0.397   15.189  1.00 59.49  ? 39   HIS A C     1 
ATOM   268  O  O     . HIS A  1 40  ? 89.424  -0.314  14.419  1.00 58.61  ? 39   HIS A O     1 
ATOM   269  C  CB    . HIS A  1 40  ? 90.098  -0.060  17.305  1.00 55.94  ? 39   HIS A CB    1 
ATOM   270  C  CG    . HIS A  1 40  ? 90.919  1.181   17.141  1.00 66.26  ? 39   HIS A CG    1 
ATOM   271  N  ND1   . HIS A  1 40  ? 92.296  1.168   17.201  1.00 63.35  ? 39   HIS A ND1   1 
ATOM   272  C  CD2   . HIS A  1 40  ? 90.563  2.472   16.945  1.00 65.71  ? 39   HIS A CD2   1 
ATOM   273  C  CE1   . HIS A  1 40  ? 92.751  2.395   17.037  1.00 61.20  ? 39   HIS A CE1   1 
ATOM   274  N  NE2   . HIS A  1 40  ? 91.722  3.201   16.851  1.00 66.34  ? 39   HIS A NE2   1 
ATOM   275  N  N     . LEU A  1 41  ? 88.178  1.515   14.790  1.00 57.64  ? 40   LEU A N     1 
ATOM   276  C  CA    . LEU A  1 41  ? 88.190  1.971   13.412  1.00 57.62  ? 40   LEU A CA    1 
ATOM   277  C  C     . LEU A  1 41  ? 88.868  3.339   13.311  1.00 59.17  ? 40   LEU A C     1 
ATOM   278  O  O     . LEU A  1 41  ? 88.635  4.190   14.139  1.00 62.01  ? 40   LEU A O     1 
ATOM   279  C  CB    . LEU A  1 41  ? 86.763  2.062   12.867  1.00 59.79  ? 40   LEU A CB    1 
ATOM   280  C  CG    . LEU A  1 41  ? 85.960  0.752   12.865  1.00 54.27  ? 40   LEU A CG    1 
ATOM   281  C  CD1   . LEU A  1 41  ? 84.548  1.017   12.447  1.00 55.51  ? 40   LEU A CD1   1 
ATOM   282  C  CD2   . LEU A  1 41  ? 86.607  -0.273  11.979  1.00 54.38  ? 40   LEU A CD2   1 
ATOM   283  N  N     . SER A  1 42  ? 89.758  3.513   12.342  1.00 57.00  ? 41   SER A N     1 
ATOM   284  C  CA    . SER A  1 42  ? 90.304  4.830   12.041  1.00 60.53  ? 41   SER A CA    1 
ATOM   285  C  C     . SER A  1 42  ? 90.382  5.021   10.541  1.00 55.87  ? 41   SER A C     1 
ATOM   286  O  O     . SER A  1 42  ? 90.491  4.075   9.783   1.00 56.21  ? 41   SER A O     1 
ATOM   287  C  CB    . SER A  1 42  ? 91.683  5.021   12.682  1.00 56.50  ? 41   SER A CB    1 
ATOM   288  O  OG    . SER A  1 42  ? 92.599  4.131   12.094  1.00 61.16  ? 41   SER A OG    1 
ATOM   289  N  N     . THR A  1 43  ? 90.333  6.268   10.131  1.00 56.48  ? 42   THR A N     1 
ATOM   290  C  CA    . THR A  1 43  ? 90.424  6.632   8.730   1.00 59.38  ? 42   THR A CA    1 
ATOM   291  C  C     . THR A  1 43  ? 91.732  6.112   8.110   1.00 55.03  ? 42   THR A C     1 
ATOM   292  O  O     . THR A  1 43  ? 91.728  5.569   7.023   1.00 53.82  ? 42   THR A O     1 
ATOM   293  C  CB    . THR A  1 43  ? 90.336  8.176   8.583   1.00 62.85  ? 42   THR A CB    1 
ATOM   294  O  OG1   . THR A  1 43  ? 89.043  8.624   8.986   1.00 60.15  ? 42   THR A OG1   1 
ATOM   295  C  CG2   . THR A  1 43  ? 90.570  8.612   7.133   1.00 74.80  ? 42   THR A CG2   1 
ATOM   296  N  N     . GLY A  1 44  ? 92.845  6.322   8.794   1.00 52.14  ? 43   GLY A N     1 
ATOM   297  C  CA    . GLY A  1 44  ? 94.137  5.871   8.305   1.00 55.85  ? 43   GLY A CA    1 
ATOM   298  C  C     . GLY A  1 44  ? 94.110  4.382   7.997   1.00 56.51  ? 43   GLY A C     1 
ATOM   299  O  O     . GLY A  1 44  ? 94.488  3.934   6.913   1.00 57.63  ? 43   GLY A O     1 
ATOM   300  N  N     . GLU A  1 45  ? 93.627  3.607   8.952   1.00 56.53  ? 44   GLU A N     1 
ATOM   301  C  CA    . GLU A  1 45  ? 93.629  2.175   8.797   1.00 56.67  ? 44   GLU A CA    1 
ATOM   302  C  C     . GLU A  1 45  ? 92.639  1.708   7.709   1.00 53.50  ? 44   GLU A C     1 
ATOM   303  O  O     . GLU A  1 45  ? 92.942  0.811   6.948   1.00 52.89  ? 44   GLU A O     1 
ATOM   304  C  CB    . GLU A  1 45  ? 93.362  1.534   10.155  1.00 55.58  ? 44   GLU A CB    1 
ATOM   305  C  CG    . GLU A  1 45  ? 93.327  0.010   10.148  1.00 73.43  ? 44   GLU A CG    1 
ATOM   306  C  CD    . GLU A  1 45  ? 94.590  -0.629  9.564   1.00 87.17  ? 44   GLU A CD    1 
ATOM   307  O  OE1   . GLU A  1 45  ? 95.692  -0.016  9.640   1.00 84.64  ? 44   GLU A OE1   1 
ATOM   308  O  OE2   . GLU A  1 45  ? 94.463  -1.757  9.043   1.00 88.87  ? 44   GLU A OE2   1 
ATOM   309  N  N     . LEU A  1 46  ? 91.460  2.316   7.660   1.00 54.73  ? 45   LEU A N     1 
ATOM   310  C  CA    . LEU A  1 46  ? 90.475  2.044   6.614   1.00 55.69  ? 45   LEU A CA    1 
ATOM   311  C  C     . LEU A  1 46  ? 90.999  2.317   5.215   1.00 55.61  ? 45   LEU A C     1 
ATOM   312  O  O     . LEU A  1 46  ? 90.753  1.525   4.284   1.00 53.93  ? 45   LEU A O     1 
ATOM   313  C  CB    . LEU A  1 46  ? 89.208  2.869   6.846   1.00 60.86  ? 45   LEU A CB    1 
ATOM   314  C  CG    . LEU A  1 46  ? 88.326  2.412   8.032   1.00 54.29  ? 45   LEU A CG    1 
ATOM   315  C  CD1   . LEU A  1 46  ? 87.295  3.480   8.286   1.00 65.01  ? 45   LEU A CD1   1 
ATOM   316  C  CD2   . LEU A  1 46  ? 87.670  1.084   7.792   1.00 62.94  ? 45   LEU A CD2   1 
ATOM   317  N  N     . LEU A  1 47  ? 91.705  3.442   5.073   1.00 53.68  ? 46   LEU A N     1 
ATOM   318  C  CA    . LEU A  1 47  ? 92.322  3.828   3.808   1.00 56.10  ? 46   LEU A CA    1 
ATOM   319  C  C     . LEU A  1 47  ? 93.415  2.831   3.436   1.00 57.07  ? 46   LEU A C     1 
ATOM   320  O  O     . LEU A  1 47  ? 93.417  2.311   2.351   1.00 57.33  ? 46   LEU A O     1 
ATOM   321  C  CB    . LEU A  1 47  ? 92.899  5.252   3.883   1.00 55.87  ? 46   LEU A CB    1 
ATOM   322  C  CG    . LEU A  1 47  ? 91.865  6.387   3.898   1.00 54.82  ? 46   LEU A CG    1 
ATOM   323  C  CD1   . LEU A  1 47  ? 92.522  7.720   4.168   1.00 51.65  ? 46   LEU A CD1   1 
ATOM   324  C  CD2   . LEU A  1 47  ? 91.067  6.402   2.582   1.00 57.20  ? 46   LEU A CD2   1 
ATOM   325  N  N     . ARG A  1 48  ? 94.321  2.555   4.369   1.00 57.80  ? 47   ARG A N     1 
ATOM   326  C  CA    . ARG A  1 48  ? 95.369  1.555   4.161   1.00 58.86  ? 47   ARG A CA    1 
ATOM   327  C  C     . ARG A  1 48  ? 94.767  0.228   3.662   1.00 57.29  ? 47   ARG A C     1 
ATOM   328  O  O     . ARG A  1 48  ? 95.221  -0.338  2.668   1.00 61.21  ? 47   ARG A O     1 
ATOM   329  C  CB    . ARG A  1 48  ? 96.169  1.363   5.467   1.00 64.19  ? 47   ARG A CB    1 
ATOM   330  C  CG    . ARG A  1 48  ? 97.561  0.721   5.293   1.00 64.96  ? 47   ARG A CG    1 
ATOM   331  C  CD    . ARG A  1 48  ? 97.976  -0.156  6.490   1.00 77.81  ? 47   ARG A CD    1 
ATOM   332  N  NE    . ARG A  1 48  ? 96.927  -1.136  6.812   1.00 95.66  ? 47   ARG A NE    1 
ATOM   333  C  CZ    . ARG A  1 48  ? 96.641  -2.244  6.114   1.00 92.56  ? 47   ARG A CZ    1 
ATOM   334  N  NH1   . ARG A  1 48  ? 97.331  -2.592  5.025   1.00 88.29  ? 47   ARG A NH1   1 
ATOM   335  N  NH2   . ARG A  1 48  ? 95.635  -3.016  6.506   1.00 83.68  ? 47   ARG A NH2   1 
ATOM   336  N  N     . GLU A  1 49  ? 93.708  -0.228  4.326   1.00 60.53  ? 48   GLU A N     1 
ATOM   337  C  CA    . GLU A  1 49  ? 93.062  -1.503  4.002   1.00 61.38  ? 48   GLU A CA    1 
ATOM   338  C  C     . GLU A  1 49  ? 92.396  -1.551  2.627   1.00 58.44  ? 48   GLU A C     1 
ATOM   339  O  O     . GLU A  1 49  ? 92.517  -2.539  1.899   1.00 57.20  ? 48   GLU A O     1 
ATOM   340  C  CB    . GLU A  1 49  ? 92.024  -1.838  5.082   1.00 66.38  ? 48   GLU A CB    1 
ATOM   341  C  CG    . GLU A  1 49  ? 91.320  -3.203  4.885   1.00 73.91  ? 48   GLU A CG    1 
ATOM   342  C  CD    . GLU A  1 49  ? 90.248  -3.490  5.934   1.00 82.01  ? 48   GLU A CD    1 
ATOM   343  O  OE1   . GLU A  1 49  ? 89.900  -2.574  6.729   1.00 79.46  ? 48   GLU A OE1   1 
ATOM   344  O  OE2   . GLU A  1 49  ? 89.758  -4.644  5.950   1.00 97.72  ? 48   GLU A OE2   1 
ATOM   345  N  N     . GLU A  1 50  ? 91.676  -0.493  2.281   1.00 59.85  ? 49   GLU A N     1 
ATOM   346  C  CA    . GLU A  1 50  ? 91.087  -0.353  0.955   1.00 59.37  ? 49   GLU A CA    1 
ATOM   347  C  C     . GLU A  1 50  ? 92.155  -0.422  -0.147  1.00 57.61  ? 49   GLU A C     1 
ATOM   348  O  O     . GLU A  1 50  ? 92.003  -1.124  -1.176  1.00 53.61  ? 49   GLU A O     1 
ATOM   349  C  CB    . GLU A  1 50  ? 90.316  0.974   0.889   1.00 61.87  ? 49   GLU A CB    1 
ATOM   350  C  CG    . GLU A  1 50  ? 89.717  1.336   -0.469  1.00 66.88  ? 49   GLU A CG    1 
ATOM   351  C  CD    . GLU A  1 50  ? 88.524  0.482   -0.891  1.00 72.56  ? 49   GLU A CD    1 
ATOM   352  O  OE1   . GLU A  1 50  ? 87.887  0.866   -1.891  1.00 69.45  ? 49   GLU A OE1   1 
ATOM   353  O  OE2   . GLU A  1 50  ? 88.212  -0.540  -0.241  1.00 67.33  ? 49   GLU A OE2   1 
ATOM   354  N  N     . LEU A  1 51  ? 93.238  0.310   0.079   1.00 57.60  ? 50   LEU A N     1 
ATOM   355  C  CA    . LEU A  1 51  ? 94.346  0.356   -0.871  1.00 60.70  ? 50   LEU A CA    1 
ATOM   356  C  C     . LEU A  1 51  ? 94.995  -1.015  -1.076  1.00 57.77  ? 50   LEU A C     1 
ATOM   357  O  O     . LEU A  1 51  ? 95.252  -1.423  -2.197  1.00 63.97  ? 50   LEU A O     1 
ATOM   358  C  CB    . LEU A  1 51  ? 95.387  1.395   -0.419  1.00 65.01  ? 50   LEU A CB    1 
ATOM   359  C  CG    . LEU A  1 51  ? 95.014  2.884   -0.520  1.00 68.94  ? 50   LEU A CG    1 
ATOM   360  C  CD1   . LEU A  1 51  ? 96.116  3.720   0.081   1.00 69.02  ? 50   LEU A CD1   1 
ATOM   361  C  CD2   . LEU A  1 51  ? 94.746  3.322   -1.960  1.00 64.61  ? 50   LEU A CD2   1 
ATOM   362  N  N     . ALA A  1 52  ? 95.228  -1.726  0.021   1.00 59.24  ? 51   ALA A N     1 
ATOM   363  C  CA    . ALA A  1 52  ? 95.802  -3.081  -0.004  1.00 56.91  ? 51   ALA A CA    1 
ATOM   364  C  C     . ALA A  1 52  ? 94.894  -4.106  -0.698  1.00 59.08  ? 51   ALA A C     1 
ATOM   365  O  O     . ALA A  1 52  ? 95.381  -5.122  -1.201  1.00 60.75  ? 51   ALA A O     1 
ATOM   366  C  CB    . ALA A  1 52  ? 96.082  -3.540  1.444   1.00 60.68  ? 51   ALA A CB    1 
ATOM   367  N  N     . SER A  1 53  ? 93.581  -3.846  -0.691  1.00 60.72  ? 52   SER A N     1 
ATOM   368  C  CA    . SER A  1 53  ? 92.595  -4.734  -1.300  1.00 60.16  ? 52   SER A CA    1 
ATOM   369  C  C     . SER A  1 53  ? 92.799  -4.822  -2.794  1.00 62.47  ? 52   SER A C     1 
ATOM   370  O  O     . SER A  1 53  ? 92.391  -5.803  -3.392  1.00 67.18  ? 52   SER A O     1 
ATOM   371  C  CB    . SER A  1 53  ? 91.152  -4.280  -1.026  1.00 62.91  ? 52   SER A CB    1 
ATOM   372  O  OG    . SER A  1 53  ? 90.730  -3.259  -1.932  1.00 62.55  ? 52   SER A OG    1 
ATOM   373  N  N     . GLU A  1 54  ? 93.398  -3.794  -3.401  1.00 63.26  ? 53   GLU A N     1 
ATOM   374  C  CA    . GLU A  1 54  ? 93.593  -3.749  -4.866  1.00 64.51  ? 53   GLU A CA    1 
ATOM   375  C  C     . GLU A  1 54  ? 92.274  -3.747  -5.674  1.00 61.56  ? 53   GLU A C     1 
ATOM   376  O  O     . GLU A  1 54  ? 92.295  -3.944  -6.911  1.00 58.49  ? 53   GLU A O     1 
ATOM   377  C  CB    . GLU A  1 54  ? 94.486  -4.915  -5.349  1.00 68.19  ? 53   GLU A CB    1 
ATOM   378  C  CG    . GLU A  1 54  ? 95.933  -4.861  -4.868  1.00 81.20  ? 53   GLU A CG    1 
ATOM   379  C  CD    . GLU A  1 54  ? 96.707  -3.690  -5.451  1.00 93.26  ? 53   GLU A CD    1 
ATOM   380  O  OE1   . GLU A  1 54  ? 96.867  -3.605  -6.694  1.00 107.43 ? 53   GLU A OE1   1 
ATOM   381  O  OE2   . GLU A  1 54  ? 97.164  -2.851  -4.655  1.00 77.83  ? 53   GLU A OE2   1 
ATOM   382  N  N     . SER A  1 55  ? 91.144  -3.505  -5.001  1.00 58.38  ? 54   SER A N     1 
ATOM   383  C  CA    . SER A  1 55  ? 89.851  -3.376  -5.678  1.00 55.50  ? 54   SER A CA    1 
ATOM   384  C  C     . SER A  1 55  ? 89.934  -2.259  -6.705  1.00 53.85  ? 54   SER A C     1 
ATOM   385  O  O     . SER A  1 55  ? 90.803  -1.384  -6.598  1.00 55.24  ? 54   SER A O     1 
ATOM   386  C  CB    . SER A  1 55  ? 88.748  -3.059  -4.674  1.00 52.52  ? 54   SER A CB    1 
ATOM   387  O  OG    . SER A  1 55  ? 88.928  -1.757  -4.102  1.00 58.64  ? 54   SER A OG    1 
ATOM   388  N  N     . GLU A  1 56  ? 89.051  -2.295  -7.700  1.00 51.53  ? 55   GLU A N     1 
ATOM   389  C  CA    . GLU A  1 56  ? 88.973  -1.231  -8.702  1.00 52.03  ? 55   GLU A CA    1 
ATOM   390  C  C     . GLU A  1 56  ? 88.568  0.078   -8.072  1.00 49.37  ? 55   GLU A C     1 
ATOM   391  O  O     . GLU A  1 56  ? 89.072  1.139   -8.451  1.00 57.53  ? 55   GLU A O     1 
ATOM   392  C  CB    . GLU A  1 56  ? 87.967  -1.582  -9.798  1.00 58.58  ? 55   GLU A CB    1 
ATOM   393  C  CG    . GLU A  1 56  ? 88.390  -2.739  -10.647 1.00 63.63  ? 55   GLU A CG    1 
ATOM   394  C  CD    . GLU A  1 56  ? 89.538  -2.382  -11.526 1.00 59.20  ? 55   GLU A CD    1 
ATOM   395  O  OE1   . GLU A  1 56  ? 89.544  -1.255  -12.029 1.00 64.23  ? 55   GLU A OE1   1 
ATOM   396  O  OE2   . GLU A  1 56  ? 90.435  -3.224  -11.700 1.00 69.38  ? 55   GLU A OE2   1 
ATOM   397  N  N     . ARG A  1 57  ? 87.673  -0.005  -7.087  1.00 54.40  ? 56   ARG A N     1 
ATOM   398  C  CA    . ARG A  1 57  ? 87.233  1.150   -6.317  1.00 53.10  ? 56   ARG A CA    1 
ATOM   399  C  C     . ARG A  1 57  ? 88.410  1.811   -5.607  1.00 51.89  ? 56   ARG A C     1 
ATOM   400  O  O     . ARG A  1 57  ? 88.494  3.024   -5.563  1.00 56.72  ? 56   ARG A O     1 
ATOM   401  C  CB    . ARG A  1 57  ? 86.167  0.704   -5.306  1.00 58.36  ? 56   ARG A CB    1 
ATOM   402  C  CG    . ARG A  1 57  ? 85.612  1.829   -4.465  1.00 62.58  ? 56   ARG A CG    1 
ATOM   403  C  CD    . ARG A  1 57  ? 84.562  1.366   -3.503  1.00 71.48  ? 56   ARG A CD    1 
ATOM   404  N  NE    . ARG A  1 57  ? 85.169  0.748   -2.330  1.00 69.36  ? 56   ARG A NE    1 
ATOM   405  C  CZ    . ARG A  1 57  ? 84.482  0.210   -1.329  1.00 60.61  ? 56   ARG A CZ    1 
ATOM   406  N  NH1   . ARG A  1 57  ? 83.162  0.207   -1.348  1.00 72.63  ? 56   ARG A NH1   1 
ATOM   407  N  NH2   . ARG A  1 57  ? 85.125  -0.346  -0.312  1.00 63.72  ? 56   ARG A NH2   1 
ATOM   408  N  N     . SER A  1 58  ? 89.312  0.999   -5.048  1.00 52.16  ? 57   SER A N     1 
ATOM   409  C  CA    . SER A  1 58  ? 90.516  1.494   -4.372  1.00 51.11  ? 57   SER A CA    1 
ATOM   410  C  C     . SER A  1 58  ? 91.410  2.375   -5.249  1.00 53.64  ? 57   SER A C     1 
ATOM   411  O  O     . SER A  1 58  ? 92.129  3.216   -4.729  1.00 54.47  ? 57   SER A O     1 
ATOM   412  C  CB    . SER A  1 58  ? 91.358  0.323   -3.813  1.00 56.86  ? 57   SER A CB    1 
ATOM   413  O  OG    . SER A  1 58  ? 92.179  -0.312  -4.802  1.00 52.38  ? 57   SER A OG    1 
ATOM   414  N  N     . LYS A  1 59  ? 91.383  2.182   -6.567  1.00 53.86  ? 58   LYS A N     1 
ATOM   415  C  CA    . LYS A  1 59  ? 92.291  2.921   -7.466  1.00 51.95  ? 58   LYS A CA    1 
ATOM   416  C  C     . LYS A  1 59  ? 91.961  4.418   -7.548  1.00 53.08  ? 58   LYS A C     1 
ATOM   417  O  O     . LYS A  1 59  ? 92.842  5.242   -7.769  1.00 53.99  ? 58   LYS A O     1 
ATOM   418  C  CB    . LYS A  1 59  ? 92.325  2.268   -8.838  1.00 53.55  ? 58   LYS A CB    1 
ATOM   419  C  CG    . LYS A  1 59  ? 92.950  0.879   -8.779  1.00 52.88  ? 58   LYS A CG    1 
ATOM   420  C  CD    . LYS A  1 59  ? 92.824  0.126   -10.070 1.00 66.75  ? 58   LYS A CD    1 
ATOM   421  C  CE    . LYS A  1 59  ? 93.413  -1.248  -9.904  1.00 61.27  ? 58   LYS A CE    1 
ATOM   422  N  NZ    . LYS A  1 59  ? 93.128  -2.051  -11.071 1.00 62.07  ? 58   LYS A NZ    1 
ATOM   423  N  N     . LEU A  1 60  ? 90.699  4.763   -7.315  1.00 52.43  ? 59   LEU A N     1 
ATOM   424  C  CA    . LEU A  1 60  ? 90.292  6.153   -7.245  1.00 54.80  ? 59   LEU A CA    1 
ATOM   425  C  C     . LEU A  1 60  ? 90.948  6.863   -6.047  1.00 51.74  ? 59   LEU A C     1 
ATOM   426  O  O     . LEU A  1 60  ? 91.459  7.950   -6.178  1.00 57.59  ? 59   LEU A O     1 
ATOM   427  C  CB    . LEU A  1 60  ? 88.765  6.237   -7.159  1.00 54.62  ? 59   LEU A CB    1 
ATOM   428  C  CG    . LEU A  1 60  ? 88.178  7.645   -7.044  1.00 65.87  ? 59   LEU A CG    1 
ATOM   429  C  CD1   . LEU A  1 60  ? 88.927  8.742   -7.888  1.00 68.79  ? 59   LEU A CD1   1 
ATOM   430  C  CD2   . LEU A  1 60  ? 86.727  7.583   -7.435  1.00 77.11  ? 59   LEU A CD2   1 
ATOM   431  N  N     . ILE A  1 61  ? 90.965  6.204   -4.903  1.00 54.18  ? 60   ILE A N     1 
ATOM   432  C  CA    . ILE A  1 61  ? 91.653  6.704   -3.722  1.00 57.33  ? 60   ILE A CA    1 
ATOM   433  C  C     . ILE A  1 61  ? 93.170  6.766   -3.941  1.00 55.73  ? 60   ILE A C     1 
ATOM   434  O  O     . ILE A  1 61  ? 93.831  7.690   -3.493  1.00 53.99  ? 60   ILE A O     1 
ATOM   435  C  CB    . ILE A  1 61  ? 91.340  5.808   -2.489  1.00 63.11  ? 60   ILE A CB    1 
ATOM   436  C  CG1   . ILE A  1 61  ? 89.873  5.940   -2.109  1.00 67.24  ? 60   ILE A CG1   1 
ATOM   437  C  CG2   . ILE A  1 61  ? 92.198  6.188   -1.266  1.00 76.14  ? 60   ILE A CG2   1 
ATOM   438  C  CD1   . ILE A  1 61  ? 89.389  4.806   -1.200  1.00 74.93  ? 60   ILE A CD1   1 
ATOM   439  N  N     . ARG A  1 62  ? 93.726  5.755   -4.592  1.00 55.27  ? 61   ARG A N     1 
ATOM   440  C  CA    . ARG A  1 62  ? 95.136  5.778   -4.916  1.00 58.43  ? 61   ARG A CA    1 
ATOM   441  C  C     . ARG A  1 62  ? 95.478  6.997   -5.807  1.00 54.97  ? 61   ARG A C     1 
ATOM   442  O  O     . ARG A  1 62  ? 96.435  7.692   -5.537  1.00 57.64  ? 61   ARG A O     1 
ATOM   443  C  CB    . ARG A  1 62  ? 95.567  4.454   -5.549  1.00 57.96  ? 61   ARG A CB    1 
ATOM   444  C  CG    . ARG A  1 62  ? 97.068  4.346   -5.796  1.00 67.40  ? 61   ARG A CG    1 
ATOM   445  C  CD    . ARG A  1 62  ? 97.486  2.919   -6.168  1.00 65.96  ? 61   ARG A CD    1 
ATOM   446  N  N     . ASP A  1 63  ? 94.662  7.294   -6.811  1.00 52.77  ? 62   ASP A N     1 
ATOM   447  C  CA    . ASP A  1 63  ? 94.868  8.501   -7.629  1.00 55.90  ? 62   ASP A CA    1 
ATOM   448  C  C     . ASP A  1 63  ? 94.896  9.779   -6.796  1.00 57.76  ? 62   ASP A C     1 
ATOM   449  O  O     . ASP A  1 63  ? 95.735  10.652  -6.984  1.00 59.63  ? 62   ASP A O     1 
ATOM   450  C  CB    . ASP A  1 63  ? 93.750  8.646   -8.629  1.00 53.22  ? 62   ASP A CB    1 
ATOM   451  C  CG    . ASP A  1 63  ? 93.754  7.566   -9.709  1.00 65.39  ? 62   ASP A CG    1 
ATOM   452  O  OD1   . ASP A  1 63  ? 94.754  6.803   -9.844  1.00 60.71  ? 62   ASP A OD1   1 
ATOM   453  O  OD2   . ASP A  1 63  ? 92.734  7.513   -10.439 1.00 57.12  ? 62   ASP A OD2   1 
ATOM   454  N  N     . ILE A  1 64  ? 93.939  9.890   -5.894  1.00 56.99  ? 63   ILE A N     1 
ATOM   455  C  CA    . ILE A  1 64  ? 93.808  11.056  -5.024  1.00 59.61  ? 63   ILE A CA    1 
ATOM   456  C  C     . ILE A  1 64  ? 95.020  11.213  -4.111  1.00 59.88  ? 63   ILE A C     1 
ATOM   457  O  O     . ILE A  1 64  ? 95.605  12.271  -3.999  1.00 61.03  ? 63   ILE A O     1 
ATOM   458  C  CB    . ILE A  1 64  ? 92.539  10.908  -4.149  1.00 61.14  ? 63   ILE A CB    1 
ATOM   459  C  CG1   . ILE A  1 64  ? 91.283  11.085  -5.010  1.00 56.68  ? 63   ILE A CG1   1 
ATOM   460  C  CG2   . ILE A  1 64  ? 92.535  11.901  -2.987  1.00 60.42  ? 63   ILE A CG2   1 
ATOM   461  C  CD1   . ILE A  1 64  ? 90.007  10.515  -4.340  1.00 62.96  ? 63   ILE A CD1   1 
ATOM   462  N  N     . MET A  1 65  ? 95.383  10.140  -3.448  1.00 59.71  ? 64   MET A N     1 
ATOM   463  C  CA    . MET A  1 65  ? 96.444  10.184  -2.472  1.00 62.05  ? 64   MET A CA    1 
ATOM   464  C  C     . MET A  1 65  ? 97.842  10.339  -3.049  1.00 59.84  ? 64   MET A C     1 
ATOM   465  O  O     . MET A  1 65  ? 98.735  10.830  -2.367  1.00 65.06  ? 64   MET A O     1 
ATOM   466  C  CB    . MET A  1 65  ? 96.369  8.934   -1.604  1.00 56.84  ? 64   MET A CB    1 
ATOM   467  C  CG    . MET A  1 65  ? 95.137  8.964   -0.723  1.00 73.04  ? 64   MET A CG    1 
ATOM   468  S  SD    . MET A  1 65  ? 95.095  7.550   0.365   1.00 74.82  ? 64   MET A SD    1 
ATOM   469  C  CE    . MET A  1 65  ? 96.330  8.000   1.588   1.00 96.42  ? 64   MET A CE    1 
ATOM   470  N  N     . GLU A  1 66  ? 98.033  9.905   -4.280  1.00 57.51  ? 65   GLU A N     1 
ATOM   471  C  CA    . GLU A  1 66  ? 99.278  10.120  -4.990  1.00 63.19  ? 65   GLU A CA    1 
ATOM   472  C  C     . GLU A  1 66  ? 99.530  11.598  -5.356  1.00 64.40  ? 65   GLU A C     1 
ATOM   473  O  O     . GLU A  1 66  ? 100.667 11.991  -5.586  1.00 62.49  ? 65   GLU A O     1 
ATOM   474  C  CB    . GLU A  1 66  ? 99.277  9.296   -6.273  1.00 64.87  ? 65   GLU A CB    1 
ATOM   475  C  CG    . GLU A  1 66  ? 99.494  7.816   -6.013  1.00 80.19  ? 65   GLU A CG    1 
ATOM   476  C  CD    . GLU A  1 66  ? 99.517  6.999   -7.288  1.00 91.67  ? 65   GLU A CD    1 
ATOM   477  O  OE1   . GLU A  1 66  ? 99.027  7.492   -8.333  1.00 92.57  ? 65   GLU A OE1   1 
ATOM   478  O  OE2   . GLU A  1 66  ? 100.024 5.858   -7.230  1.00 103.94 ? 65   GLU A OE2   1 
ATOM   479  N  N     . ARG A  1 67  ? 98.466  12.391  -5.451  1.00 61.53  ? 66   ARG A N     1 
ATOM   480  C  CA    . ARG A  1 67  ? 98.607  13.818  -5.644  1.00 58.29  ? 66   ARG A CA    1 
ATOM   481  C  C     . ARG A  1 67  ? 98.662  14.524  -4.297  1.00 56.61  ? 66   ARG A C     1 
ATOM   482  O  O     . ARG A  1 67  ? 98.845  15.720  -4.254  1.00 59.54  ? 66   ARG A O     1 
ATOM   483  C  CB    . ARG A  1 67  ? 97.421  14.371  -6.395  1.00 54.42  ? 66   ARG A CB    1 
ATOM   484  C  CG    . ARG A  1 67  ? 97.141  13.767  -7.753  1.00 54.32  ? 66   ARG A CG    1 
ATOM   485  C  CD    . ARG A  1 67  ? 95.850  14.389  -8.249  1.00 60.33  ? 66   ARG A CD    1 
ATOM   486  N  NE    . ARG A  1 67  ? 95.016  13.468  -9.014  1.00 87.33  ? 66   ARG A NE    1 
ATOM   487  C  CZ    . ARG A  1 67  ? 93.759  13.134  -8.715  1.00 95.17  ? 66   ARG A CZ    1 
ATOM   488  N  NH1   . ARG A  1 67  ? 93.145  13.656  -7.636  1.00 76.77  ? 66   ARG A NH1   1 
ATOM   489  N  NH2   . ARG A  1 67  ? 93.104  12.274  -9.518  1.00 89.49  ? 66   ARG A NH2   1 
ATOM   490  N  N     . GLY A  1 68  ? 98.471  13.803  -3.201  1.00 53.10  ? 67   GLY A N     1 
ATOM   491  C  CA    . GLY A  1 68  ? 98.365  14.429  -1.895  1.00 54.60  ? 67   GLY A CA    1 
ATOM   492  C  C     . GLY A  1 68  ? 97.055  15.171  -1.753  1.00 59.24  ? 67   GLY A C     1 
ATOM   493  O  O     . GLY A  1 68  ? 96.923  16.062  -0.907  1.00 60.08  ? 67   GLY A O     1 
ATOM   494  N  N     . ASP A  1 69  ? 96.091  14.827  -2.611  1.00 61.15  ? 68   ASP A N     1 
ATOM   495  C  CA    . ASP A  1 69  ? 94.795  15.492  -2.611  1.00 59.34  ? 68   ASP A CA    1 
ATOM   496  C  C     . ASP A  1 69  ? 93.931  14.939  -1.458  1.00 62.24  ? 68   ASP A C     1 
ATOM   497  O  O     . ASP A  1 69  ? 94.224  13.903  -0.848  1.00 58.54  ? 68   ASP A O     1 
ATOM   498  C  CB    . ASP A  1 69  ? 94.075  15.308  -3.968  1.00 60.08  ? 68   ASP A CB    1 
ATOM   499  C  CG    . ASP A  1 69  ? 94.335  16.450  -4.961  1.00 62.23  ? 68   ASP A CG    1 
ATOM   500  O  OD1   . ASP A  1 69  ? 94.619  17.594  -4.544  1.00 78.88  ? 68   ASP A OD1   1 
ATOM   501  O  OD2   . ASP A  1 69  ? 94.234  16.201  -6.177  1.00 90.07  ? 68   ASP A OD2   1 
ATOM   502  N  N     . LEU A  1 70  ? 92.858  15.658  -1.189  1.00 60.73  ? 69   LEU A N     1 
ATOM   503  C  CA    . LEU A  1 70  ? 91.926  15.337  -0.139  1.00 62.25  ? 69   LEU A CA    1 
ATOM   504  C  C     . LEU A  1 70  ? 91.047  14.162  -0.566  1.00 62.31  ? 69   LEU A C     1 
ATOM   505  O  O     . LEU A  1 70  ? 90.499  14.156  -1.666  1.00 58.32  ? 69   LEU A O     1 
ATOM   506  C  CB    . LEU A  1 70  ? 91.043  16.561  0.073   1.00 62.30  ? 69   LEU A CB    1 
ATOM   507  C  CG    . LEU A  1 70  ? 89.742  16.407  0.830   1.00 65.19  ? 69   LEU A CG    1 
ATOM   508  C  CD1   . LEU A  1 70  ? 90.025  16.347  2.295   1.00 62.37  ? 69   LEU A CD1   1 
ATOM   509  C  CD2   . LEU A  1 70  ? 88.892  17.612  0.503   1.00 73.66  ? 69   LEU A CD2   1 
ATOM   510  N  N     . VAL A  1 71  ? 90.861  13.203  0.326   1.00 62.16  ? 70   VAL A N     1 
ATOM   511  C  CA    . VAL A  1 71  ? 89.934  12.112  0.064   1.00 62.60  ? 70   VAL A CA    1 
ATOM   512  C  C     . VAL A  1 71  ? 88.547  12.593  0.455   1.00 61.29  ? 70   VAL A C     1 
ATOM   513  O  O     . VAL A  1 71  ? 88.350  12.973  1.600   1.00 54.89  ? 70   VAL A O     1 
ATOM   514  C  CB    . VAL A  1 71  ? 90.296  10.857  0.853   1.00 55.44  ? 70   VAL A CB    1 
ATOM   515  C  CG1   . VAL A  1 71  ? 89.324  9.726   0.514   1.00 59.79  ? 70   VAL A CG1   1 
ATOM   516  C  CG2   . VAL A  1 71  ? 91.737  10.459  0.555   1.00 58.75  ? 70   VAL A CG2   1 
ATOM   517  N  N     . PRO A  1 72  ? 87.593  12.615  -0.502  1.00 58.28  ? 71   PRO A N     1 
ATOM   518  C  CA    . PRO A  1 72  ? 86.242  13.049  -0.147  1.00 58.88  ? 71   PRO A CA    1 
ATOM   519  C  C     . PRO A  1 72  ? 85.633  12.308  1.033   1.00 59.02  ? 71   PRO A C     1 
ATOM   520  O  O     . PRO A  1 72  ? 85.892  11.124  1.238   1.00 58.85  ? 71   PRO A O     1 
ATOM   521  C  CB    . PRO A  1 72  ? 85.442  12.793  -1.426  1.00 56.80  ? 71   PRO A CB    1 
ATOM   522  C  CG    . PRO A  1 72  ? 86.459  12.888  -2.526  1.00 59.22  ? 71   PRO A CG    1 
ATOM   523  C  CD    . PRO A  1 72  ? 87.701  12.286  -1.940  1.00 62.29  ? 71   PRO A CD    1 
ATOM   524  N  N     . SER A  1 73  ? 84.820  13.022  1.798   1.00 61.20  ? 72   SER A N     1 
ATOM   525  C  CA    . SER A  1 73  ? 84.230  12.493  3.022   1.00 62.30  ? 72   SER A CA    1 
ATOM   526  C  C     . SER A  1 73  ? 83.332  11.307  2.767   1.00 59.44  ? 72   SER A C     1 
ATOM   527  O  O     . SER A  1 73  ? 83.254  10.408  3.610   1.00 57.75  ? 72   SER A O     1 
ATOM   528  C  CB    . SER A  1 73  ? 83.393  13.568  3.717   1.00 62.38  ? 72   SER A CB    1 
ATOM   529  O  OG    . SER A  1 73  ? 84.208  14.629  4.126   1.00 88.58  ? 72   SER A OG    1 
ATOM   530  N  N     . GLY A  1 74  ? 82.632  11.328  1.626   1.00 57.59  ? 73   GLY A N     1 
ATOM   531  C  CA    . GLY A  1 74  ? 81.722  10.250  1.245   1.00 55.71  ? 73   GLY A CA    1 
ATOM   532  C  C     . GLY A  1 74  ? 82.445  8.925   1.092   1.00 55.75  ? 73   GLY A C     1 
ATOM   533  O  O     . GLY A  1 74  ? 81.913  7.866   1.399   1.00 57.81  ? 73   GLY A O     1 
ATOM   534  N  N     . ILE A  1 75  ? 83.676  8.991   0.623   1.00 57.21  ? 74   ILE A N     1 
ATOM   535  C  CA    . ILE A  1 75  ? 84.461  7.783   0.389   1.00 60.73  ? 74   ILE A CA    1 
ATOM   536  C  C     . ILE A  1 75  ? 84.856  7.222   1.730   1.00 57.26  ? 74   ILE A C     1 
ATOM   537  O  O     . ILE A  1 75  ? 84.740  6.035   1.970   1.00 60.97  ? 74   ILE A O     1 
ATOM   538  C  CB    . ILE A  1 75  ? 85.733  8.066   -0.495  1.00 62.93  ? 74   ILE A CB    1 
ATOM   539  C  CG1   . ILE A  1 75  ? 85.382  8.190   -1.985  1.00 73.11  ? 74   ILE A CG1   1 
ATOM   540  C  CG2   . ILE A  1 75  ? 86.755  6.946   -0.372  1.00 65.44  ? 74   ILE A CG2   1 
ATOM   541  C  CD1   . ILE A  1 75  ? 84.323  9.213   -2.291  1.00 83.51  ? 74   ILE A CD1   1 
ATOM   542  N  N     . VAL A  1 76  ? 85.314  8.087   2.630   1.00 60.10  ? 75   VAL A N     1 
ATOM   543  C  CA    . VAL A  1 76  ? 85.704  7.628   3.955   1.00 57.67  ? 75   VAL A CA    1 
ATOM   544  C  C     . VAL A  1 76  ? 84.502  7.050   4.698   1.00 57.61  ? 75   VAL A C     1 
ATOM   545  O  O     . VAL A  1 76  ? 84.612  6.020   5.359   1.00 56.51  ? 75   VAL A O     1 
ATOM   546  C  CB    . VAL A  1 76  ? 86.338  8.786   4.813   1.00 61.66  ? 75   VAL A CB    1 
ATOM   547  C  CG1   . VAL A  1 76  ? 86.676  8.282   6.214   1.00 57.13  ? 75   VAL A CG1   1 
ATOM   548  C  CG2   . VAL A  1 76  ? 87.587  9.393   4.112   1.00 53.79  ? 75   VAL A CG2   1 
ATOM   549  N  N     . LEU A  1 77  ? 83.372  7.750   4.634   1.00 54.87  ? 76   LEU A N     1 
ATOM   550  C  CA    . LEU A  1 77  ? 82.156  7.298   5.279   1.00 57.97  ? 76   LEU A CA    1 
ATOM   551  C  C     . LEU A  1 77  ? 81.718  5.945   4.752   1.00 59.99  ? 76   LEU A C     1 
ATOM   552  O  O     . LEU A  1 77  ? 81.307  5.076   5.527   1.00 60.78  ? 76   LEU A O     1 
ATOM   553  C  CB    . LEU A  1 77  ? 81.028  8.294   5.055   1.00 61.46  ? 76   LEU A CB    1 
ATOM   554  C  CG    . LEU A  1 77  ? 79.740  8.083   5.854   1.00 65.34  ? 76   LEU A CG    1 
ATOM   555  C  CD1   . LEU A  1 77  ? 79.954  8.283   7.344   1.00 69.46  ? 76   LEU A CD1   1 
ATOM   556  C  CD2   . LEU A  1 77  ? 78.676  9.029   5.370   1.00 77.90  ? 76   LEU A CD2   1 
ATOM   557  N  N     . GLU A  1 78  ? 81.819  5.762   3.442   1.00 56.70  ? 77   GLU A N     1 
ATOM   558  C  CA    . GLU A  1 78  ? 81.437  4.498   2.816   1.00 62.08  ? 77   GLU A CA    1 
ATOM   559  C  C     . GLU A  1 78  ? 82.282  3.407   3.457   1.00 55.86  ? 77   GLU A C     1 
ATOM   560  O  O     . GLU A  1 78  ? 81.749  2.431   3.937   1.00 57.51  ? 77   GLU A O     1 
ATOM   561  C  CB    . GLU A  1 78  ? 81.625  4.595   1.298   1.00 57.12  ? 77   GLU A CB    1 
ATOM   562  C  CG    . GLU A  1 78  ? 81.380  3.360   0.420   1.00 72.41  ? 77   GLU A CG    1 
ATOM   563  C  CD    . GLU A  1 78  ? 81.591  3.661   -1.112  1.00 77.80  ? 77   GLU A CD    1 
ATOM   564  O  OE1   . GLU A  1 78  ? 82.075  4.773   -1.483  1.00 94.98  ? 77   GLU A OE1   1 
ATOM   565  O  OE2   . GLU A  1 78  ? 81.264  2.790   -1.958  1.00 100.00 ? 77   GLU A OE2   1 
ATOM   566  N  N     . LEU A  1 79  ? 83.595  3.612   3.521   1.00 56.04  ? 78   LEU A N     1 
ATOM   567  C  CA    . LEU A  1 79  ? 84.505  2.600   4.078   1.00 57.12  ? 78   LEU A CA    1 
ATOM   568  C  C     . LEU A  1 79  ? 84.219  2.305   5.550   1.00 57.28  ? 78   LEU A C     1 
ATOM   569  O  O     . LEU A  1 79  ? 84.302  1.158   5.989   1.00 59.53  ? 78   LEU A O     1 
ATOM   570  C  CB    . LEU A  1 79  ? 85.957  3.040   3.941   1.00 62.45  ? 78   LEU A CB    1 
ATOM   571  C  CG    . LEU A  1 79  ? 86.540  3.248   2.552   1.00 56.52  ? 78   LEU A CG    1 
ATOM   572  C  CD1   . LEU A  1 79  ? 87.919  3.787   2.717   1.00 60.32  ? 78   LEU A CD1   1 
ATOM   573  C  CD2   . LEU A  1 79  ? 86.557  1.955   1.771   1.00 62.35  ? 78   LEU A CD2   1 
ATOM   574  N  N     . LEU A  1 80  ? 83.888  3.350   6.292   1.00 55.65  ? 79   LEU A N     1 
ATOM   575  C  CA    . LEU A  1 80  ? 83.505  3.256   7.695   1.00 56.88  ? 79   LEU A CA    1 
ATOM   576  C  C     . LEU A  1 80  ? 82.234  2.413   7.898   1.00 59.73  ? 79   LEU A C     1 
ATOM   577  O  O     . LEU A  1 80  ? 82.209  1.474   8.722   1.00 57.70  ? 79   LEU A O     1 
ATOM   578  C  CB    . LEU A  1 80  ? 83.275  4.665   8.220   1.00 63.86  ? 79   LEU A CB    1 
ATOM   579  C  CG    . LEU A  1 80  ? 83.437  5.046   9.684   1.00 71.88  ? 79   LEU A CG    1 
ATOM   580  C  CD1   . LEU A  1 80  ? 84.641  4.424   10.355  1.00 81.44  ? 79   LEU A CD1   1 
ATOM   581  C  CD2   . LEU A  1 80  ? 83.546  6.552   9.722   1.00 80.69  ? 79   LEU A CD2   1 
ATOM   582  N  N     . LYS A  1 81  ? 81.200  2.729   7.119   1.00 54.72  ? 80   LYS A N     1 
ATOM   583  C  CA    . LYS A  1 81  ? 79.946  2.009   7.185   1.00 56.70  ? 80   LYS A CA    1 
ATOM   584  C  C     . LYS A  1 81  ? 80.126  0.524   6.884   1.00 56.36  ? 80   LYS A C     1 
ATOM   585  O  O     . LYS A  1 81  ? 79.530  -0.320  7.537   1.00 57.93  ? 80   LYS A O     1 
ATOM   586  C  CB    . LYS A  1 81  ? 78.926  2.618   6.225   1.00 65.20  ? 80   LYS A CB    1 
ATOM   587  C  CG    . LYS A  1 81  ? 77.514  2.072   6.381   1.00 67.63  ? 80   LYS A CG    1 
ATOM   588  C  CD    . LYS A  1 81  ? 76.578  2.798   5.430   1.00 81.01  ? 80   LYS A CD    1 
ATOM   589  C  CE    . LYS A  1 81  ? 75.128  2.295   5.554   1.00 89.15  ? 80   LYS A CE    1 
ATOM   590  N  NZ    . LYS A  1 81  ? 74.173  3.251   4.890   1.00 82.19  ? 80   LYS A NZ    1 
ATOM   591  N  N     . GLU A  1 82  ? 80.948  0.228   5.891   1.00 54.46  ? 81   GLU A N     1 
ATOM   592  C  CA    . GLU A  1 82  ? 81.247  -1.133  5.526   1.00 55.79  ? 81   GLU A CA    1 
ATOM   593  C  C     . GLU A  1 82  ? 81.993  -1.907  6.616   1.00 55.33  ? 81   GLU A C     1 
ATOM   594  O  O     . GLU A  1 82  ? 81.705  -3.087  6.859   1.00 55.63  ? 81   GLU A O     1 
ATOM   595  C  CB    . GLU A  1 82  ? 82.019  -1.158  4.217   1.00 53.68  ? 81   GLU A CB    1 
ATOM   596  C  CG    . GLU A  1 82  ? 81.137  -0.746  3.067   1.00 67.60  ? 81   GLU A CG    1 
ATOM   597  C  CD    . GLU A  1 82  ? 81.835  -0.767  1.736   1.00 72.67  ? 81   GLU A CD    1 
ATOM   598  O  OE1   . GLU A  1 82  ? 83.057  -1.015  1.750   1.00 63.01  ? 81   GLU A OE1   1 
ATOM   599  O  OE2   . GLU A  1 82  ? 81.146  -0.548  0.699   1.00 68.82  ? 81   GLU A OE2   1 
ATOM   600  N  N     . ALA A  1 83  ? 82.927  -1.236  7.276   1.00 58.44  ? 82   ALA A N     1 
ATOM   601  C  CA    . ALA A  1 83  ? 83.683  -1.847  8.370   1.00 59.20  ? 82   ALA A CA    1 
ATOM   602  C  C     . ALA A  1 83  ? 82.778  -2.174  9.563   1.00 58.52  ? 82   ALA A C     1 
ATOM   603  O  O     . ALA A  1 83  ? 82.935  -3.218  10.204  1.00 60.29  ? 82   ALA A O     1 
ATOM   604  C  CB    . ALA A  1 83  ? 84.816  -0.946  8.788   1.00 55.57  ? 82   ALA A CB    1 
ATOM   605  N  N     . MET A  1 84  ? 81.828  -1.282  9.817   1.00 56.30  ? 83   MET A N     1 
ATOM   606  C  CA    . MET A  1 84  ? 80.879  -1.409  10.904  1.00 56.83  ? 83   MET A CA    1 
ATOM   607  C  C     . MET A  1 84  ? 79.829  -2.460  10.617  1.00 57.00  ? 83   MET A C     1 
ATOM   608  O  O     . MET A  1 84  ? 79.458  -3.210  11.511  1.00 59.65  ? 83   MET A O     1 
ATOM   609  C  CB    . MET A  1 84  ? 80.202  -0.055  11.214  1.00 47.71  ? 83   MET A CB    1 
ATOM   610  C  CG    . MET A  1 84  ? 81.169  1.010   11.690  1.00 57.14  ? 83   MET A CG    1 
ATOM   611  S  SD    . MET A  1 84  ? 80.369  2.619   11.873  1.00 57.90  ? 83   MET A SD    1 
ATOM   612  C  CE    . MET A  1 84  ? 79.338  2.346   13.317  1.00 61.38  ? 83   MET A CE    1 
ATOM   613  N  N     . VAL A  1 85  ? 79.346  -2.509  9.379   1.00 61.79  ? 84   VAL A N     1 
ATOM   614  C  CA    . VAL A  1 85  ? 78.408  -3.543  8.954   1.00 57.46  ? 84   VAL A CA    1 
ATOM   615  C  C     . VAL A  1 85  ? 79.087  -4.923  9.036   1.00 60.71  ? 84   VAL A C     1 
ATOM   616  O  O     . VAL A  1 85  ? 78.499  -5.870  9.555   1.00 61.08  ? 84   VAL A O     1 
ATOM   617  C  CB    . VAL A  1 85  ? 77.872  -3.250  7.561   1.00 59.96  ? 84   VAL A CB    1 
ATOM   618  C  CG1   . VAL A  1 85  ? 77.128  -4.456  6.974   1.00 60.12  ? 84   VAL A CG1   1 
ATOM   619  C  CG2   . VAL A  1 85  ? 76.969  -2.027  7.585   1.00 60.89  ? 84   VAL A CG2   1 
ATOM   620  N  N     . ALA A  1 86  ? 80.330  -5.032  8.568   1.00 61.30  ? 85   ALA A N     1 
ATOM   621  C  CA    . ALA A  1 86  ? 81.072  -6.304  8.637   1.00 59.50  ? 85   ALA A CA    1 
ATOM   622  C  C     . ALA A  1 86  ? 81.368  -6.780  10.057  1.00 59.62  ? 85   ALA A C     1 
ATOM   623  O  O     . ALA A  1 86  ? 81.556  -7.959  10.265  1.00 61.19  ? 85   ALA A O     1 
ATOM   624  C  CB    . ALA A  1 86  ? 82.385  -6.200  7.863   1.00 59.80  ? 85   ALA A CB    1 
ATOM   625  N  N     . SER A  1 87  ? 81.439  -5.875  11.028  1.00 64.02  ? 86   SER A N     1 
ATOM   626  C  CA    . SER A  1 87  ? 81.763  -6.252  12.425  1.00 63.18  ? 86   SER A CA    1 
ATOM   627  C  C     . SER A  1 87  ? 80.533  -6.411  13.292  1.00 59.70  ? 86   SER A C     1 
ATOM   628  O  O     . SER A  1 87  ? 80.613  -6.946  14.372  1.00 60.11  ? 86   SER A O     1 
ATOM   629  C  CB    . SER A  1 87  ? 82.664  -5.206  13.074  1.00 57.93  ? 86   SER A CB    1 
ATOM   630  O  OG    . SER A  1 87  ? 83.835  -5.000  12.312  1.00 83.09  ? 86   SER A OG    1 
ATOM   631  N  N     . LEU A  1 88  ? 79.408  -5.903  12.825  1.00 64.12  ? 87   LEU A N     1 
ATOM   632  C  CA    . LEU A  1 88  ? 78.161  -5.970  13.560  1.00 71.45  ? 87   LEU A CA    1 
ATOM   633  C  C     . LEU A  1 88  ? 77.844  -7.435  13.872  1.00 73.93  ? 87   LEU A C     1 
ATOM   634  O  O     . LEU A  1 88  ? 77.924  -8.293  12.997  1.00 75.94  ? 87   LEU A O     1 
ATOM   635  C  CB    . LEU A  1 88  ? 77.048  -5.367  12.706  1.00 74.00  ? 87   LEU A CB    1 
ATOM   636  C  CG    . LEU A  1 88  ? 76.032  -4.423  13.337  1.00 76.10  ? 87   LEU A CG    1 
ATOM   637  C  CD1   . LEU A  1 88  ? 76.700  -3.327  14.155  1.00 83.56  ? 87   LEU A CD1   1 
ATOM   638  C  CD2   . LEU A  1 88  ? 75.179  -3.838  12.206  1.00 78.18  ? 87   LEU A CD2   1 
ATOM   639  N  N     . GLY A  1 89  ? 77.519  -7.732  15.118  1.00 73.80  ? 88   GLY A N     1 
ATOM   640  C  CA    . GLY A  1 89  ? 77.170  -9.106  15.491  1.00 77.32  ? 88   GLY A CA    1 
ATOM   641  C  C     . GLY A  1 89  ? 78.334  -9.936  16.004  1.00 77.04  ? 88   GLY A C     1 
ATOM   642  O  O     . GLY A  1 89  ? 78.121  -10.985 16.584  1.00 78.77  ? 88   GLY A O     1 
ATOM   643  N  N     . ASP A  1 90  ? 79.565  -9.494  15.768  1.00 76.12  ? 89   ASP A N     1 
ATOM   644  C  CA    . ASP A  1 90  ? 80.707  -10.056 16.468  1.00 75.61  ? 89   ASP A CA    1 
ATOM   645  C  C     . ASP A  1 90  ? 81.502  -8.924  17.100  1.00 74.44  ? 89   ASP A C     1 
ATOM   646  O  O     . ASP A  1 90  ? 82.724  -8.968  17.120  1.00 77.16  ? 89   ASP A O     1 
ATOM   647  C  CB    . ASP A  1 90  ? 81.584  -10.886 15.526  1.00 75.19  ? 89   ASP A CB    1 
ATOM   648  N  N     . THR A  1 91  ? 80.806  -7.901  17.604  1.00 70.73  ? 90   THR A N     1 
ATOM   649  C  CA    . THR A  1 91  ? 81.457  -6.807  18.328  1.00 65.70  ? 90   THR A CA    1 
ATOM   650  C  C     . THR A  1 91  ? 80.553  -6.251  19.394  1.00 59.20  ? 90   THR A C     1 
ATOM   651  O  O     . THR A  1 91  ? 79.353  -6.337  19.266  1.00 58.89  ? 90   THR A O     1 
ATOM   652  C  CB    . THR A  1 91  ? 81.909  -5.627  17.395  1.00 72.00  ? 90   THR A CB    1 
ATOM   653  O  OG1   . THR A  1 91  ? 82.926  -4.879  18.062  1.00 64.42  ? 90   THR A OG1   1 
ATOM   654  C  CG2   . THR A  1 91  ? 80.745  -4.664  17.038  1.00 59.43  ? 90   THR A CG2   1 
ATOM   655  N  N     . ARG A  1 92  ? 81.142  -5.655  20.433  1.00 57.58  ? 91   ARG A N     1 
ATOM   656  C  CA    . ARG A  1 92  ? 80.381  -4.991  21.475  1.00 56.93  ? 91   ARG A CA    1 
ATOM   657  C  C     . ARG A  1 92  ? 80.226  -3.462  21.287  1.00 56.39  ? 91   ARG A C     1 
ATOM   658  O  O     . ARG A  1 92  ? 79.492  -2.816  22.016  1.00 59.83  ? 91   ARG A O     1 
ATOM   659  C  CB    . ARG A  1 92  ? 80.983  -5.360  22.840  1.00 58.08  ? 91   ARG A CB    1 
ATOM   660  C  CG    . ARG A  1 92  ? 80.607  -6.808  23.280  1.00 58.54  ? 91   ARG A CG    1 
ATOM   661  C  CD    . ARG A  1 92  ? 81.534  -7.316  24.370  1.00 84.34  ? 91   ARG A CD    1 
ATOM   662  N  NE    . ARG A  1 92  ? 81.579  -8.774  24.476  1.00 91.92  ? 91   ARG A NE    1 
ATOM   663  N  N     . GLY A  1 93  ? 80.904  -2.891  20.299  1.00 56.53  ? 92   GLY A N     1 
ATOM   664  C  CA    . GLY A  1 93  ? 80.865  -1.465  20.081  1.00 54.35  ? 92   GLY A CA    1 
ATOM   665  C  C     . GLY A  1 93  ? 81.984  -0.999  19.192  1.00 54.23  ? 92   GLY A C     1 
ATOM   666  O  O     . GLY A  1 93  ? 82.920  -1.737  18.889  1.00 55.59  ? 92   GLY A O     1 
ATOM   667  N  N     . PHE A  1 94  ? 81.864  0.239   18.759  1.00 53.66  ? 93   PHE A N     1 
ATOM   668  C  CA    . PHE A  1 94  ? 82.845  0.849   17.870  1.00 56.89  ? 93   PHE A CA    1 
ATOM   669  C  C     . PHE A  1 94  ? 83.562  1.972   18.542  1.00 55.16  ? 93   PHE A C     1 
ATOM   670  O  O     . PHE A  1 94  ? 82.934  2.833   19.143  1.00 53.63  ? 93   PHE A O     1 
ATOM   671  C  CB    . PHE A  1 94  ? 82.175  1.348   16.595  1.00 57.23  ? 93   PHE A CB    1 
ATOM   672  C  CG    . PHE A  1 94  ? 81.572  0.247   15.824  1.00 53.43  ? 93   PHE A CG    1 
ATOM   673  C  CD1   . PHE A  1 94  ? 82.378  -0.591  15.082  1.00 54.90  ? 93   PHE A CD1   1 
ATOM   674  C  CD2   . PHE A  1 94  ? 80.235  -0.047  15.946  1.00 57.93  ? 93   PHE A CD2   1 
ATOM   675  C  CE1   . PHE A  1 94  ? 81.854  -1.653  14.402  1.00 52.03  ? 93   PHE A CE1   1 
ATOM   676  C  CE2   . PHE A  1 94  ? 79.707  -1.136  15.281  1.00 53.43  ? 93   PHE A CE2   1 
ATOM   677  C  CZ    . PHE A  1 94  ? 80.519  -1.932  14.503  1.00 61.78  ? 93   PHE A CZ    1 
ATOM   678  N  N     . LEU A  1 95  ? 84.886  1.924   18.443  1.00 53.16  ? 94   LEU A N     1 
ATOM   679  C  CA    . LEU A  1 95  ? 85.752  2.997   18.878  1.00 55.67  ? 94   LEU A CA    1 
ATOM   680  C  C     . LEU A  1 95  ? 86.335  3.645   17.622  1.00 56.48  ? 94   LEU A C     1 
ATOM   681  O  O     . LEU A  1 95  ? 87.198  3.079   16.941  1.00 52.63  ? 94   LEU A O     1 
ATOM   682  C  CB    . LEU A  1 95  ? 86.846  2.424   19.762  1.00 55.05  ? 94   LEU A CB    1 
ATOM   683  C  CG    . LEU A  1 95  ? 87.760  3.366   20.501  1.00 56.59  ? 94   LEU A CG    1 
ATOM   684  C  CD1   . LEU A  1 95  ? 86.942  4.335   21.353  1.00 65.83  ? 94   LEU A CD1   1 
ATOM   685  C  CD2   . LEU A  1 95  ? 88.705  2.553   21.334  1.00 67.68  ? 94   LEU A CD2   1 
ATOM   686  N  N     . ILE A  1 96  ? 85.827  4.826   17.302  1.00 56.84  ? 95   ILE A N     1 
ATOM   687  C  CA    . ILE A  1 96  ? 86.216  5.521   16.088  1.00 58.12  ? 95   ILE A CA    1 
ATOM   688  C  C     . ILE A  1 96  ? 87.230  6.605   16.434  1.00 55.85  ? 95   ILE A C     1 
ATOM   689  O  O     . ILE A  1 96  ? 86.925  7.585   17.074  1.00 55.61  ? 95   ILE A O     1 
ATOM   690  C  CB    . ILE A  1 96  ? 84.978  6.020   15.304  1.00 57.27  ? 95   ILE A CB    1 
ATOM   691  C  CG1   . ILE A  1 96  ? 84.104  4.800   14.924  1.00 58.76  ? 95   ILE A CG1   1 
ATOM   692  C  CG2   . ILE A  1 96  ? 85.407  6.711   14.045  1.00 65.96  ? 95   ILE A CG2   1 
ATOM   693  C  CD1   . ILE A  1 96  ? 82.694  5.113   14.591  1.00 69.95  ? 95   ILE A CD1   1 
ATOM   694  N  N     . ASP A  1 97  ? 88.444  6.393   15.961  1.00 56.29  ? 96   ASP A N     1 
ATOM   695  C  CA    . ASP A  1 97  ? 89.626  7.046   16.466  1.00 57.59  ? 96   ASP A CA    1 
ATOM   696  C  C     . ASP A  1 97  ? 89.956  8.158   15.501  1.00 59.03  ? 96   ASP A C     1 
ATOM   697  O  O     . ASP A  1 97  ? 89.994  7.943   14.294  1.00 58.11  ? 96   ASP A O     1 
ATOM   698  C  CB    . ASP A  1 97  ? 90.715  5.968   16.625  1.00 60.59  ? 96   ASP A CB    1 
ATOM   699  C  CG    . ASP A  1 97  ? 92.124  6.506   16.707  1.00 63.00  ? 96   ASP A CG    1 
ATOM   700  O  OD1   . ASP A  1 97  ? 92.284  7.730   16.758  1.00 58.74  ? 96   ASP A OD1   1 
ATOM   701  O  OD2   . ASP A  1 97  ? 93.084  5.664   16.719  1.00 59.06  ? 96   ASP A OD2   1 
ATOM   702  N  N     . GLY A  1 98  ? 90.097  9.364   16.069  1.00 61.50  ? 97   GLY A N     1 
ATOM   703  C  CA    . GLY A  1 98  ? 90.472  10.578  15.357  1.00 59.58  ? 97   GLY A CA    1 
ATOM   704  C  C     . GLY A  1 98  ? 89.469  10.996  14.301  1.00 62.68  ? 97   GLY A C     1 
ATOM   705  O  O     . GLY A  1 98  ? 89.834  11.548  13.276  1.00 65.10  ? 97   GLY A O     1 
ATOM   706  N  N     . TYR A  1 99  ? 88.196  10.742  14.564  1.00 65.82  ? 98   TYR A N     1 
ATOM   707  C  CA    . TYR A  1 99  ? 87.131  11.021  13.608  1.00 68.24  ? 98   TYR A CA    1 
ATOM   708  C  C     . TYR A  1 99  ? 85.908  11.617  14.328  1.00 68.89  ? 98   TYR A C     1 
ATOM   709  O  O     . TYR A  1 99  ? 85.694  11.297  15.534  1.00 68.61  ? 98   TYR A O     1 
ATOM   710  C  CB    . TYR A  1 99  ? 86.761  9.748   12.907  1.00 67.03  ? 98   TYR A CB    1 
ATOM   711  C  CG    . TYR A  1 99  ? 85.673  9.903   11.916  1.00 68.60  ? 98   TYR A CG    1 
ATOM   712  C  CD1   . TYR A  1 99  ? 84.338  9.906   12.313  1.00 74.80  ? 98   TYR A CD1   1 
ATOM   713  C  CD2   . TYR A  1 99  ? 85.957  10.028  10.582  1.00 46.65  ? 98   TYR A CD2   1 
ATOM   714  C  CE1   . TYR A  1 99  ? 83.309  10.037  11.380  1.00 65.42  ? 98   TYR A CE1   1 
ATOM   715  C  CE2   . TYR A  1 99  ? 84.937  10.164  9.641   1.00 68.28  ? 98   TYR A CE2   1 
ATOM   716  C  CZ    . TYR A  1 99  ? 83.615  10.158  10.054  1.00 55.08  ? 98   TYR A CZ    1 
ATOM   717  O  OH    . TYR A  1 99  ? 82.599  10.311  9.143   1.00 69.37  ? 98   TYR A OH    1 
ATOM   718  N  N     . PRO A  1 100 ? 85.167  12.539  13.633  1.00 65.77  ? 99   PRO A N     1 
ATOM   719  C  CA    . PRO A  1 100 ? 85.439  13.147  12.279  1.00 63.37  ? 99   PRO A CA    1 
ATOM   720  C  C     . PRO A  1 100 ? 86.497  14.278  12.317  1.00 57.41  ? 99   PRO A C     1 
ATOM   721  O  O     . PRO A  1 100 ? 86.923  14.662  13.387  1.00 59.42  ? 99   PRO A O     1 
ATOM   722  C  CB    . PRO A  1 100 ? 84.091  13.725  11.896  1.00 64.79  ? 99   PRO A CB    1 
ATOM   723  C  CG    . PRO A  1 100 ? 83.552  14.190  13.206  1.00 70.31  ? 99   PRO A CG    1 
ATOM   724  C  CD    . PRO A  1 100 ? 83.956  13.131  14.224  1.00 69.36  ? 99   PRO A CD    1 
ATOM   725  N  N     . ARG A  1 101 ? 86.915  14.769  11.161  1.00 60.60  ? 100  ARG A N     1 
ATOM   726  C  CA    . ARG A  1 101 ? 87.942  15.833  11.050  1.00 62.45  ? 100  ARG A CA    1 
ATOM   727  C  C     . ARG A  1 101 ? 87.329  17.232  10.873  1.00 58.15  ? 100  ARG A C     1 
ATOM   728  O  O     . ARG A  1 101 ? 88.043  18.249  10.935  1.00 57.72  ? 100  ARG A O     1 
ATOM   729  C  CB    . ARG A  1 101 ? 88.889  15.555  9.866   1.00 69.53  ? 100  ARG A CB    1 
ATOM   730  C  CG    . ARG A  1 101 ? 88.174  15.374  8.489   1.00 66.05  ? 100  ARG A CG    1 
ATOM   731  C  CD    . ARG A  1 101 ? 89.099  15.481  7.312   1.00 67.33  ? 100  ARG A CD    1 
ATOM   732  N  NE    . ARG A  1 101 ? 88.840  14.514  6.222   1.00 84.12  ? 100  ARG A NE    1 
ATOM   733  C  CZ    . ARG A  1 101 ? 88.239  14.773  5.051   1.00 86.09  ? 100  ARG A CZ    1 
ATOM   734  N  NH1   . ARG A  1 101 ? 87.743  15.977  4.775   1.00 96.42  ? 100  ARG A NH1   1 
ATOM   735  N  NH2   . ARG A  1 101 ? 88.112  13.805  4.138   1.00 51.01  ? 100  ARG A NH2   1 
ATOM   736  N  N     . GLU A  1 102 ? 86.031  17.272  10.583  1.00 57.18  ? 101  GLU A N     1 
ATOM   737  C  CA    . GLU A  1 102 ? 85.264  18.514  10.580  1.00 61.10  ? 101  GLU A CA    1 
ATOM   738  C  C     . GLU A  1 102 ? 83.802  18.222  10.928  1.00 54.10  ? 101  GLU A C     1 
ATOM   739  O  O     . GLU A  1 102 ? 83.378  17.087  10.924  1.00 53.51  ? 101  GLU A O     1 
ATOM   740  C  CB    . GLU A  1 102 ? 85.375  19.220  9.228   1.00 64.96  ? 101  GLU A CB    1 
ATOM   741  C  CG    . GLU A  1 102 ? 84.598  18.515  8.142   1.00 80.47  ? 101  GLU A CG    1 
ATOM   742  C  CD    . GLU A  1 102 ? 85.299  18.555  6.810   1.00 81.45  ? 101  GLU A CD    1 
ATOM   743  O  OE1   . GLU A  1 102 ? 85.361  17.493  6.138   1.00 99.95  ? 101  GLU A OE1   1 
ATOM   744  O  OE2   . GLU A  1 102 ? 85.797  19.639  6.458   1.00 84.28  ? 101  GLU A OE2   1 
ATOM   745  N  N     . VAL A  1 103 ? 83.047  19.272  11.231  1.00 55.00  ? 102  VAL A N     1 
ATOM   746  C  CA    . VAL A  1 103 ? 81.698  19.149  11.774  1.00 53.86  ? 102  VAL A CA    1 
ATOM   747  C  C     . VAL A  1 103 ? 80.675  18.581  10.800  1.00 55.32  ? 102  VAL A C     1 
ATOM   748  O  O     . VAL A  1 103 ? 79.902  17.686  11.165  1.00 54.28  ? 102  VAL A O     1 
ATOM   749  C  CB    . VAL A  1 103 ? 81.196  20.500  12.284  1.00 50.68  ? 102  VAL A CB    1 
ATOM   750  C  CG1   . VAL A  1 103 ? 79.711  20.418  12.611  1.00 54.52  ? 102  VAL A CG1   1 
ATOM   751  C  CG2   . VAL A  1 103 ? 82.020  20.943  13.501  1.00 54.79  ? 102  VAL A CG2   1 
ATOM   752  N  N     . LYS A  1 104 ? 80.644  19.098  9.573   1.00 55.51  ? 103  LYS A N     1 
ATOM   753  C  CA    . LYS A  1 104 ? 79.706  18.578  8.573   1.00 56.62  ? 103  LYS A CA    1 
ATOM   754  C  C     . LYS A  1 104 ? 79.883  17.057  8.344   1.00 55.17  ? 103  LYS A C     1 
ATOM   755  O  O     . LYS A  1 104 ? 78.915  16.338  8.106   1.00 54.83  ? 103  LYS A O     1 
ATOM   756  C  CB    . LYS A  1 104 ? 79.823  19.361  7.261   1.00 60.96  ? 103  LYS A CB    1 
ATOM   757  C  CG    . LYS A  1 104 ? 81.092  19.113  6.479   1.00 78.28  ? 103  LYS A CG    1 
ATOM   758  N  N     . GLN A  1 105 ? 81.119  16.579  8.446   1.00 55.94  ? 104  GLN A N     1 
ATOM   759  C  CA    . GLN A  1 105 ? 81.430  15.171  8.303   1.00 58.27  ? 104  GLN A CA    1 
ATOM   760  C  C     . GLN A  1 105 ? 80.844  14.371  9.494   1.00 61.38  ? 104  GLN A C     1 
ATOM   761  O  O     . GLN A  1 105 ? 80.339  13.256  9.326   1.00 62.68  ? 104  GLN A O     1 
ATOM   762  C  CB    . GLN A  1 105 ? 82.951  15.015  8.180   1.00 55.39  ? 104  GLN A CB    1 
ATOM   763  C  CG    . GLN A  1 105 ? 83.442  13.607  7.909   1.00 79.27  ? 104  GLN A CG    1 
ATOM   764  C  CD    . GLN A  1 105 ? 84.950  13.451  8.049   1.00 77.00  ? 104  GLN A CD    1 
ATOM   765  O  OE1   . GLN A  1 105 ? 85.597  14.218  8.762   1.00 76.48  ? 104  GLN A OE1   1 
ATOM   766  N  NE2   . GLN A  1 105 ? 85.513  12.430  7.382   1.00 89.91  ? 104  GLN A NE2   1 
ATOM   767  N  N     . GLY A  1 106 ? 80.898  14.950  10.695  1.00 61.77  ? 105  GLY A N     1 
ATOM   768  C  CA    . GLY A  1 106 ? 80.208  14.396  11.855  1.00 59.09  ? 105  GLY A CA    1 
ATOM   769  C  C     . GLY A  1 106 ? 78.697  14.405  11.766  1.00 58.81  ? 105  GLY A C     1 
ATOM   770  O  O     . GLY A  1 106 ? 78.053  13.430  12.141  1.00 63.39  ? 105  GLY A O     1 
ATOM   771  N  N     . GLU A  1 107 ? 78.127  15.486  11.254  1.00 56.57  ? 106  GLU A N     1 
ATOM   772  C  CA    . GLU A  1 107 ? 76.691  15.555  10.999  1.00 56.00  ? 106  GLU A CA    1 
ATOM   773  C  C     . GLU A  1 107 ? 76.236  14.493  10.010  1.00 55.09  ? 106  GLU A C     1 
ATOM   774  O  O     . GLU A  1 107 ? 75.230  13.828  10.245  1.00 55.77  ? 106  GLU A O     1 
ATOM   775  C  CB    . GLU A  1 107 ? 76.296  16.937  10.505  1.00 56.20  ? 106  GLU A CB    1 
ATOM   776  C  CG    . GLU A  1 107 ? 76.562  18.037  11.564  1.00 68.38  ? 106  GLU A CG    1 
ATOM   777  C  CD    . GLU A  1 107 ? 76.201  19.447  11.094  1.00 63.47  ? 106  GLU A CD    1 
ATOM   778  O  OE1   . GLU A  1 107 ? 75.448  20.116  11.827  1.00 78.24  ? 106  GLU A OE1   1 
ATOM   779  O  OE2   . GLU A  1 107 ? 76.661  19.883  10.012  1.00 66.32  ? 106  GLU A OE2   1 
ATOM   780  N  N     . GLU A  1 108 ? 77.012  14.314  8.943   1.00 55.37  ? 107  GLU A N     1 
ATOM   781  C  CA    . GLU A  1 108 ? 76.766  13.292  7.926   1.00 55.44  ? 107  GLU A CA    1 
ATOM   782  C  C     . GLU A  1 108 ? 76.831  11.876  8.517   1.00 55.39  ? 107  GLU A C     1 
ATOM   783  O  O     . GLU A  1 108 ? 75.995  11.040  8.231   1.00 58.30  ? 107  GLU A O     1 
ATOM   784  C  CB    . GLU A  1 108 ? 77.754  13.460  6.758   1.00 51.82  ? 107  GLU A CB    1 
ATOM   785  C  CG    . GLU A  1 108 ? 77.478  12.603  5.520   1.00 64.91  ? 107  GLU A CG    1 
ATOM   786  N  N     . PHE A  1 109 ? 77.824  11.602  9.338   1.00 55.91  ? 108  PHE A N     1 
ATOM   787  C  CA    . PHE A  1 109 ? 77.912  10.321  10.031  1.00 54.47  ? 108  PHE A CA    1 
ATOM   788  C  C     . PHE A  1 109 ? 76.642  10.038  10.846  1.00 56.09  ? 108  PHE A C     1 
ATOM   789  O  O     . PHE A  1 109 ? 76.115  8.905   10.855  1.00 54.26  ? 108  PHE A O     1 
ATOM   790  C  CB    . PHE A  1 109 ? 79.123  10.331  10.959  1.00 50.98  ? 108  PHE A CB    1 
ATOM   791  C  CG    . PHE A  1 109 ? 79.330  9.049   11.686  1.00 54.39  ? 108  PHE A CG    1 
ATOM   792  C  CD1   . PHE A  1 109 ? 80.221  8.106   11.203  1.00 54.17  ? 108  PHE A CD1   1 
ATOM   793  C  CD2   . PHE A  1 109 ? 78.640  8.785   12.850  1.00 50.55  ? 108  PHE A CD2   1 
ATOM   794  C  CE1   . PHE A  1 109 ? 80.394  6.926   11.848  1.00 62.94  ? 108  PHE A CE1   1 
ATOM   795  C  CE2   . PHE A  1 109 ? 78.823  7.604   13.507  1.00 58.16  ? 108  PHE A CE2   1 
ATOM   796  C  CZ    . PHE A  1 109 ? 79.693  6.668   13.000  1.00 53.30  ? 108  PHE A CZ    1 
ATOM   797  N  N     . GLY A  1 110 ? 76.157  11.084  11.510  1.00 56.71  ? 109  GLY A N     1 
ATOM   798  C  CA    . GLY A  1 110 ? 75.021  10.994  12.404  1.00 57.76  ? 109  GLY A CA    1 
ATOM   799  C  C     . GLY A  1 110 ? 73.749  10.661  11.670  1.00 58.68  ? 109  GLY A C     1 
ATOM   800  O  O     . GLY A  1 110 ? 72.937  9.873   12.152  1.00 61.75  ? 109  GLY A O     1 
ATOM   801  N  N     . ARG A  1 111 ? 73.591  11.258  10.495  1.00 58.09  ? 110  ARG A N     1 
ATOM   802  C  CA    . ARG A  1 111 ? 72.441  11.015  9.650   1.00 60.48  ? 110  ARG A CA    1 
ATOM   803  C  C     . ARG A  1 111 ? 72.514  9.653   8.971   1.00 58.98  ? 110  ARG A C     1 
ATOM   804  O  O     . ARG A  1 111 ? 71.513  8.937   8.902   1.00 59.48  ? 110  ARG A O     1 
ATOM   805  C  CB    . ARG A  1 111 ? 72.341  12.096  8.579   1.00 67.16  ? 110  ARG A CB    1 
ATOM   806  C  CG    . ARG A  1 111 ? 71.962  13.475  9.103   1.00 75.55  ? 110  ARG A CG    1 
ATOM   807  C  CD    . ARG A  1 111 ? 71.819  14.494  7.948   1.00 75.60  ? 110  ARG A CD    1 
ATOM   808  N  NE    . ARG A  1 111 ? 72.802  15.587  8.049   1.00 91.03  ? 110  ARG A NE    1 
ATOM   809  C  CZ    . ARG A  1 111 ? 73.826  15.803  7.216   1.00 81.52  ? 110  ARG A CZ    1 
ATOM   810  N  NH1   . ARG A  1 111 ? 74.624  16.841  7.431   1.00 74.56  ? 110  ARG A NH1   1 
ATOM   811  N  NH2   . ARG A  1 111 ? 74.058  15.009  6.165   1.00 74.08  ? 110  ARG A NH2   1 
ATOM   812  N  N     . ARG A  1 112 ? 73.699  9.297   8.479   1.00 56.65  ? 111  ARG A N     1 
ATOM   813  C  CA    . ARG A  1 112 ? 73.853  8.106   7.654   1.00 56.03  ? 111  ARG A CA    1 
ATOM   814  C  C     . ARG A  1 112 ? 74.130  6.830   8.437   1.00 55.44  ? 111  ARG A C     1 
ATOM   815  O  O     . ARG A  1 112 ? 73.901  5.755   7.932   1.00 57.11  ? 111  ARG A O     1 
ATOM   816  C  CB    . ARG A  1 112 ? 74.956  8.331   6.624   1.00 51.62  ? 111  ARG A CB    1 
ATOM   817  C  CG    . ARG A  1 112 ? 74.601  9.362   5.553   1.00 63.37  ? 111  ARG A CG    1 
ATOM   818  C  CD    . ARG A  1 112 ? 74.227  8.719   4.208   1.00 70.94  ? 111  ARG A CD    1 
ATOM   819  N  N     . ILE A  1 113 ? 74.642  6.929   9.657   1.00 58.05  ? 112  ILE A N     1 
ATOM   820  C  CA    . ILE A  1 113 ? 75.054  5.735   10.394  1.00 57.26  ? 112  ILE A CA    1 
ATOM   821  C  C     . ILE A  1 113 ? 74.445  5.771   11.793  1.00 59.84  ? 112  ILE A C     1 
ATOM   822  O  O     . ILE A  1 113 ? 73.582  4.962   12.117  1.00 60.88  ? 112  ILE A O     1 
ATOM   823  C  CB    . ILE A  1 113 ? 76.607  5.615   10.438  1.00 57.93  ? 112  ILE A CB    1 
ATOM   824  C  CG1   . ILE A  1 113 ? 77.159  5.357   9.026   1.00 62.86  ? 112  ILE A CG1   1 
ATOM   825  C  CG2   . ILE A  1 113 ? 77.050  4.493   11.348  1.00 53.09  ? 112  ILE A CG2   1 
ATOM   826  C  CD1   . ILE A  1 113 ? 78.676  5.117   8.978   1.00 58.12  ? 112  ILE A CD1   1 
ATOM   827  N  N     . GLY A  1 114 ? 74.885  6.720   12.605  1.00 56.90  ? 113  GLY A N     1 
ATOM   828  C  CA    . GLY A  1 114 ? 74.349  6.871   13.926  1.00 60.60  ? 113  GLY A CA    1 
ATOM   829  C  C     . GLY A  1 114 ? 75.038  7.936   14.749  1.00 58.90  ? 113  GLY A C     1 
ATOM   830  O  O     . GLY A  1 114 ? 76.095  8.426   14.400  1.00 63.64  ? 113  GLY A O     1 
ATOM   831  N  N     . ASP A  1 115 ? 74.426  8.257   15.869  1.00 57.86  ? 114  ASP A N     1 
ATOM   832  C  CA    . ASP A  1 115 ? 74.930  9.268   16.792  1.00 59.08  ? 114  ASP A CA    1 
ATOM   833  C  C     . ASP A  1 115 ? 75.837  8.643   17.852  1.00 57.74  ? 114  ASP A C     1 
ATOM   834  O  O     . ASP A  1 115 ? 75.417  7.716   18.530  1.00 56.12  ? 114  ASP A O     1 
ATOM   835  C  CB    . ASP A  1 115 ? 73.743  9.921   17.481  1.00 57.61  ? 114  ASP A CB    1 
ATOM   836  C  CG    . ASP A  1 115 ? 72.832  10.624  16.506  1.00 71.10  ? 114  ASP A CG    1 
ATOM   837  O  OD1   . ASP A  1 115 ? 73.358  11.380  15.656  1.00 76.90  ? 114  ASP A OD1   1 
ATOM   838  O  OD2   . ASP A  1 115 ? 71.601  10.409  16.584  1.00 72.70  ? 114  ASP A OD2   1 
ATOM   839  N  N     . PRO A  1 116 ? 77.073  9.159   18.015  1.00 58.82  ? 115  PRO A N     1 
ATOM   840  C  CA    . PRO A  1 116 ? 77.929  8.635   19.104  1.00 58.42  ? 115  PRO A CA    1 
ATOM   841  C  C     . PRO A  1 116 ? 77.311  8.907   20.478  1.00 55.93  ? 115  PRO A C     1 
ATOM   842  O  O     . PRO A  1 116 ? 76.845  10.009  20.747  1.00 54.53  ? 115  PRO A O     1 
ATOM   843  C  CB    . PRO A  1 116 ? 79.242  9.439   18.961  1.00 54.91  ? 115  PRO A CB    1 
ATOM   844  C  CG    . PRO A  1 116 ? 78.823  10.706  18.262  1.00 64.83  ? 115  PRO A CG    1 
ATOM   845  C  CD    . PRO A  1 116 ? 77.723  10.272  17.294  1.00 56.95  ? 115  PRO A CD    1 
ATOM   846  N  N     . GLN A  1 117 ? 77.328  7.926   21.361  1.00 55.61  ? 116  GLN A N     1 
ATOM   847  C  CA    . GLN A  1 117 ? 76.825  8.167   22.725  1.00 55.58  ? 116  GLN A CA    1 
ATOM   848  C  C     . GLN A  1 117 ? 77.880  8.831   23.638  1.00 55.84  ? 116  GLN A C     1 
ATOM   849  O  O     . GLN A  1 117 ? 77.549  9.361   24.687  1.00 58.94  ? 116  GLN A O     1 
ATOM   850  C  CB    . GLN A  1 117 ? 76.325  6.863   23.334  1.00 50.34  ? 116  GLN A CB    1 
ATOM   851  C  CG    . GLN A  1 117 ? 75.211  6.203   22.531  1.00 48.59  ? 116  GLN A CG    1 
ATOM   852  C  CD    . GLN A  1 117 ? 75.711  5.072   21.631  1.00 54.35  ? 116  GLN A CD    1 
ATOM   853  O  OE1   . GLN A  1 117 ? 76.877  5.017   21.264  1.00 53.21  ? 116  GLN A OE1   1 
ATOM   854  N  NE2   . GLN A  1 117 ? 74.828  4.139   21.323  1.00 59.10  ? 116  GLN A NE2   1 
ATOM   855  N  N     . LEU A  1 118 ? 79.137  8.792   23.216  1.00 53.03  ? 117  LEU A N     1 
ATOM   856  C  CA    . LEU A  1 118 ? 80.250  9.300   23.974  1.00 52.09  ? 117  LEU A CA    1 
ATOM   857  C  C     . LEU A  1 118 ? 81.339  9.789   23.014  1.00 55.29  ? 117  LEU A C     1 
ATOM   858  O  O     . LEU A  1 118 ? 81.705  9.085   22.067  1.00 54.85  ? 117  LEU A O     1 
ATOM   859  C  CB    . LEU A  1 118 ? 80.808  8.204   24.842  1.00 51.54  ? 117  LEU A CB    1 
ATOM   860  C  CG    . LEU A  1 118 ? 82.045  8.516   25.697  1.00 62.20  ? 117  LEU A CG    1 
ATOM   861  C  CD1   . LEU A  1 118 ? 81.806  9.682   26.660  1.00 48.28  ? 117  LEU A CD1   1 
ATOM   862  C  CD2   . LEU A  1 118 ? 82.479  7.272   26.452  1.00 57.57  ? 117  LEU A CD2   1 
ATOM   863  N  N     . VAL A  1 119 ? 81.803  11.015  23.240  1.00 55.94  ? 118  VAL A N     1 
ATOM   864  C  CA    . VAL A  1 119 ? 83.034  11.529  22.649  1.00 56.07  ? 118  VAL A CA    1 
ATOM   865  C  C     . VAL A  1 119 ? 84.078  11.739  23.746  1.00 54.70  ? 118  VAL A C     1 
ATOM   866  O  O     . VAL A  1 119 ? 83.875  12.460  24.692  1.00 52.60  ? 118  VAL A O     1 
ATOM   867  C  CB    . VAL A  1 119 ? 82.814  12.853  21.877  1.00 60.18  ? 118  VAL A CB    1 
ATOM   868  C  CG1   . VAL A  1 119 ? 84.135  13.316  21.198  1.00 57.39  ? 118  VAL A CG1   1 
ATOM   869  C  CG2   . VAL A  1 119 ? 81.694  12.691  20.856  1.00 54.22  ? 118  VAL A CG2   1 
ATOM   870  N  N     . ILE A  1 120 ? 85.188  11.052  23.609  1.00 59.75  ? 119  ILE A N     1 
ATOM   871  C  CA    . ILE A  1 120 ? 86.294  11.180  24.522  1.00 58.01  ? 119  ILE A CA    1 
ATOM   872  C  C     . ILE A  1 120 ? 87.352  12.094  23.892  1.00 61.68  ? 119  ILE A C     1 
ATOM   873  O  O     . ILE A  1 120 ? 87.764  11.885  22.736  1.00 63.37  ? 119  ILE A O     1 
ATOM   874  C  CB    . ILE A  1 120 ? 86.902  9.817   24.759  1.00 58.39  ? 119  ILE A CB    1 
ATOM   875  C  CG1   . ILE A  1 120 ? 85.894  8.891   25.414  1.00 56.90  ? 119  ILE A CG1   1 
ATOM   876  C  CG2   . ILE A  1 120 ? 88.168  9.922   25.597  1.00 61.05  ? 119  ILE A CG2   1 
ATOM   877  C  CD1   . ILE A  1 120 ? 86.348  7.441   25.409  1.00 66.84  ? 119  ILE A CD1   1 
ATOM   878  N  N     . CYS A  1 121 ? 87.763  13.104  24.640  1.00 60.05  ? 120  CYS A N     1 
ATOM   879  C  CA    . CYS A  1 121 ? 88.861  13.983  24.257  1.00 63.68  ? 120  CYS A CA    1 
ATOM   880  C  C     . CYS A  1 121 ? 90.023  13.797  25.222  1.00 62.44  ? 120  CYS A C     1 
ATOM   881  O  O     . CYS A  1 121 ? 89.897  14.032  26.417  1.00 60.00  ? 120  CYS A O     1 
ATOM   882  C  CB    . CYS A  1 121 ? 88.441  15.450  24.297  1.00 63.97  ? 120  CYS A CB    1 
ATOM   883  S  SG    . CYS A  1 121 ? 86.925  15.646  23.500  1.00 82.04  ? 120  CYS A SG    1 
ATOM   884  N  N     . MET A  1 122 ? 91.153  13.386  24.674  1.00 58.58  ? 121  MET A N     1 
ATOM   885  C  CA    . MET A  1 122 ? 92.353  13.243  25.441  1.00 64.00  ? 121  MET A CA    1 
ATOM   886  C  C     . MET A  1 122 ? 93.141  14.529  25.451  1.00 63.90  ? 121  MET A C     1 
ATOM   887  O  O     . MET A  1 122 ? 93.846  14.859  24.497  1.00 70.87  ? 121  MET A O     1 
ATOM   888  C  CB    . MET A  1 122 ? 93.144  12.076  24.907  1.00 69.46  ? 121  MET A CB    1 
ATOM   889  C  CG    . MET A  1 122 ? 92.503  10.763  25.411  1.00 73.66  ? 121  MET A CG    1 
ATOM   890  S  SD    . MET A  1 122 ? 93.311  9.375   24.705  1.00 73.38  ? 121  MET A SD    1 
ATOM   891  C  CE    . MET A  1 122 ? 94.921  9.486   25.477  1.00 66.34  ? 121  MET A CE    1 
ATOM   892  N  N     . ASP A  1 123 ? 92.950  15.268  26.535  1.00 62.71  ? 122  ASP A N     1 
ATOM   893  C  CA    . ASP A  1 123 ? 93.505  16.598  26.748  1.00 64.51  ? 122  ASP A CA    1 
ATOM   894  C  C     . ASP A  1 123 ? 94.948  16.430  27.151  1.00 62.93  ? 122  ASP A C     1 
ATOM   895  O  O     . ASP A  1 123 ? 95.261  15.705  28.108  1.00 59.89  ? 122  ASP A O     1 
ATOM   896  C  CB    . ASP A  1 123 ? 92.819  17.317  27.932  1.00 72.45  ? 122  ASP A CB    1 
ATOM   897  C  CG    . ASP A  1 123 ? 91.872  18.408  27.518  1.00 85.38  ? 122  ASP A CG    1 
ATOM   898  O  OD1   . ASP A  1 123 ? 92.104  19.084  26.490  1.00 97.77  ? 122  ASP A OD1   1 
ATOM   899  O  OD2   . ASP A  1 123 ? 90.899  18.624  28.281  1.00 100.39 ? 122  ASP A OD2   1 
ATOM   900  N  N     . CYS A  1 124 ? 95.801  17.186  26.487  1.00 60.64  ? 123  CYS A N     1 
ATOM   901  C  CA    . CYS A  1 124 ? 97.193  17.192  26.777  1.00 62.04  ? 123  CYS A CA    1 
ATOM   902  C  C     . CYS A  1 124 ? 97.720  18.572  26.388  1.00 57.48  ? 123  CYS A C     1 
ATOM   903  O  O     . CYS A  1 124 ? 97.295  19.122  25.391  1.00 64.01  ? 123  CYS A O     1 
ATOM   904  C  CB    . CYS A  1 124 ? 97.842  16.087  25.940  1.00 64.36  ? 123  CYS A CB    1 
ATOM   905  S  SG    . CYS A  1 124 ? 99.452  15.638  26.502  1.00 74.82  ? 123  CYS A SG    1 
ATOM   906  N  N     . SER A  1 125 ? 98.659  19.118  27.143  1.00 54.67  ? 124  SER A N     1 
ATOM   907  C  CA    . SER A  1 125 ? 99.259  20.411  26.793  1.00 56.61  ? 124  SER A CA    1 
ATOM   908  C  C     . SER A  1 125 ? 100.184 20.301  25.582  1.00 55.91  ? 124  SER A C     1 
ATOM   909  O  O     . SER A  1 125 ? 100.701 19.235  25.249  1.00 59.46  ? 124  SER A O     1 
ATOM   910  C  CB    . SER A  1 125 ? 100.034 21.009  27.963  1.00 51.02  ? 124  SER A CB    1 
ATOM   911  O  OG    . SER A  1 125 ? 101.148 20.204  28.314  1.00 62.37  ? 124  SER A OG    1 
ATOM   912  N  N     . ALA A  1 126 ? 100.384 21.423  24.923  1.00 59.77  ? 125  ALA A N     1 
ATOM   913  C  CA    . ALA A  1 126 ? 101.260 21.486  23.782  1.00 57.77  ? 125  ALA A CA    1 
ATOM   914  C  C     . ALA A  1 126 ? 102.689 21.162  24.208  1.00 58.09  ? 125  ALA A C     1 
ATOM   915  O  O     . ALA A  1 126 ? 103.409 20.462  23.483  1.00 58.90  ? 125  ALA A O     1 
ATOM   916  C  CB    . ALA A  1 126 ? 101.182 22.858  23.149  1.00 61.70  ? 125  ALA A CB    1 
ATOM   917  N  N     . ASP A  1 127 ? 103.095 21.675  25.369  1.00 56.13  ? 126  ASP A N     1 
ATOM   918  C  CA    . ASP A  1 127 ? 104.424 21.387  25.913  1.00 60.49  ? 126  ASP A CA    1 
ATOM   919  C  C     . ASP A  1 127 ? 104.646 19.895  26.129  1.00 58.78  ? 126  ASP A C     1 
ATOM   920  O  O     . ASP A  1 127 ? 105.739 19.378  25.885  1.00 61.18  ? 126  ASP A O     1 
ATOM   921  C  CB    . ASP A  1 127 ? 104.632 22.086  27.270  1.00 62.70  ? 126  ASP A CB    1 
ATOM   922  C  CG    . ASP A  1 127 ? 104.854 23.603  27.152  1.00 88.17  ? 126  ASP A CG    1 
ATOM   923  O  OD1   . ASP A  1 127 ? 105.006 24.138  26.024  1.00 81.76  ? 126  ASP A OD1   1 
ATOM   924  O  OD2   . ASP A  1 127 ? 104.876 24.269  28.225  1.00 105.86 ? 126  ASP A OD2   1 
ATOM   925  N  N     . THR A  1 128 ? 103.634 19.214  26.666  1.00 59.04  ? 127  THR A N     1 
ATOM   926  C  CA    . THR A  1 128 ? 103.750 17.776  26.964  1.00 58.22  ? 127  THR A CA    1 
ATOM   927  C  C     . THR A  1 128 ? 103.709 16.943  25.687  1.00 55.00  ? 127  THR A C     1 
ATOM   928  O  O     . THR A  1 128 ? 104.487 16.023  25.535  1.00 60.42  ? 127  THR A O     1 
ATOM   929  C  CB    . THR A  1 128 ? 102.679 17.329  27.941  1.00 55.74  ? 127  THR A CB    1 
ATOM   930  O  OG1   . THR A  1 128 ? 102.941 17.929  29.208  1.00 61.98  ? 127  THR A OG1   1 
ATOM   931  C  CG2   . THR A  1 128 ? 102.673 15.827  28.108  1.00 62.72  ? 127  THR A CG2   1 
ATOM   932  N  N     . MET A  1 129 ? 102.821 17.272  24.764  1.00 54.59  ? 128  MET A N     1 
ATOM   933  C  CA    . MET A  1 129 ? 102.812 16.590  23.466  1.00 57.23  ? 128  MET A CA    1 
ATOM   934  C  C     . MET A  1 129 ? 104.135 16.772  22.724  1.00 54.64  ? 128  MET A C     1 
ATOM   935  O  O     . MET A  1 129 ? 104.706 15.834  22.219  1.00 57.71  ? 128  MET A O     1 
ATOM   936  C  CB    . MET A  1 129 ? 101.676 17.115  22.609  1.00 56.82  ? 128  MET A CB    1 
ATOM   937  C  CG    . MET A  1 129 ? 100.287 16.694  23.111  1.00 57.57  ? 128  MET A CG    1 
ATOM   938  S  SD    . MET A  1 129 ? 98.959  16.907  21.886  1.00 65.74  ? 128  MET A SD    1 
ATOM   939  C  CE    . MET A  1 129 ? 98.580  18.616  22.114  1.00 61.60  ? 128  MET A CE    1 
ATOM   940  N  N     . THR A  1 130 ? 104.620 17.995  22.668  1.00 55.78  ? 129  THR A N     1 
ATOM   941  C  CA    . THR A  1 130 ? 105.927 18.318  22.087  1.00 55.74  ? 129  THR A CA    1 
ATOM   942  C  C     . THR A  1 130 ? 107.066 17.492  22.667  1.00 55.32  ? 129  THR A C     1 
ATOM   943  O  O     . THR A  1 130 ? 107.847 16.904  21.940  1.00 59.19  ? 129  THR A O     1 
ATOM   944  C  CB    . THR A  1 130 ? 106.195 19.833  22.273  1.00 58.64  ? 129  THR A CB    1 
ATOM   945  O  OG1   . THR A  1 130 ? 105.142 20.549  21.614  1.00 58.45  ? 129  THR A OG1   1 
ATOM   946  C  CG2   . THR A  1 130 ? 107.538 20.250  21.703  1.00 56.63  ? 129  THR A CG2   1 
ATOM   947  N  N     . ASN A  1 131 ? 107.164 17.459  23.989  1.00 56.02  ? 130  ASN A N     1 
ATOM   948  C  CA    . ASN A  1 131 ? 108.206 16.694  24.662  1.00 56.00  ? 130  ASN A CA    1 
ATOM   949  C  C     . ASN A  1 131 ? 108.123 15.178  24.404  1.00 55.41  ? 130  ASN A C     1 
ATOM   950  O  O     . ASN A  1 131 ? 109.130 14.534  24.164  1.00 56.09  ? 130  ASN A O     1 
ATOM   951  C  CB    . ASN A  1 131 ? 108.156 16.980  26.177  1.00 55.00  ? 130  ASN A CB    1 
ATOM   952  C  CG    . ASN A  1 131 ? 109.097 16.106  26.950  1.00 58.15  ? 130  ASN A CG    1 
ATOM   953  O  OD1   . ASN A  1 131 ? 108.716 15.026  27.405  1.00 55.35  ? 130  ASN A OD1   1 
ATOM   954  N  ND2   . ASN A  1 131 ? 110.347 16.549  27.091  1.00 47.59  ? 130  ASN A ND2   1 
ATOM   955  N  N     . ARG A  1 132 ? 106.919 14.611  24.463  1.00 53.69  ? 131  ARG A N     1 
ATOM   956  C  CA    . ARG A  1 132 ? 106.721 13.209  24.102  1.00 56.77  ? 131  ARG A CA    1 
ATOM   957  C  C     . ARG A  1 132 ? 107.109 12.855  22.676  1.00 51.52  ? 131  ARG A C     1 
ATOM   958  O  O     . ARG A  1 132 ? 107.717 11.831  22.414  1.00 56.36  ? 131  ARG A O     1 
ATOM   959  C  CB    . ARG A  1 132 ? 105.268 12.802  24.356  1.00 55.66  ? 131  ARG A CB    1 
ATOM   960  C  CG    . ARG A  1 132 ? 104.967 12.669  25.869  1.00 50.56  ? 131  ARG A CG    1 
ATOM   961  C  CD    . ARG A  1 132 ? 103.463 12.479  26.059  1.00 61.20  ? 131  ARG A CD    1 
ATOM   962  N  NE    . ARG A  1 132 ? 103.059 12.361  27.451  1.00 59.18  ? 131  ARG A NE    1 
ATOM   963  C  CZ    . ARG A  1 132 ? 101.796 12.234  27.849  1.00 55.78  ? 131  ARG A CZ    1 
ATOM   964  N  NH1   . ARG A  1 132 ? 100.814 12.218  26.968  1.00 58.91  ? 131  ARG A NH1   1 
ATOM   965  N  NH2   . ARG A  1 132 ? 101.513 12.147  29.142  1.00 60.49  ? 131  ARG A NH2   1 
ATOM   966  N  N     . LEU A  1 133 ? 106.693 13.690  21.750  1.00 56.99  ? 132  LEU A N     1 
ATOM   967  C  CA    . LEU A  1 133 ? 107.015 13.522  20.365  1.00 55.20  ? 132  LEU A CA    1 
ATOM   968  C  C     . LEU A  1 133 ? 108.540 13.674  20.128  1.00 55.29  ? 132  LEU A C     1 
ATOM   969  O  O     . LEU A  1 133 ? 109.111 12.948  19.329  1.00 59.23  ? 132  LEU A O     1 
ATOM   970  C  CB    . LEU A  1 133 ? 106.188 14.493  19.500  1.00 60.51  ? 132  LEU A CB    1 
ATOM   971  C  CG    . LEU A  1 133 ? 104.685 14.184  19.365  1.00 52.88  ? 132  LEU A CG    1 
ATOM   972  C  CD1   . LEU A  1 133 ? 104.012 15.222  18.524  1.00 55.05  ? 132  LEU A CD1   1 
ATOM   973  C  CD2   . LEU A  1 133 ? 104.434 12.828  18.796  1.00 54.97  ? 132  LEU A CD2   1 
ATOM   974  N  N     . LEU A  1 134 ? 109.207 14.571  20.829  1.00 56.18  ? 133  LEU A N     1 
ATOM   975  C  CA    . LEU A  1 134 ? 110.680 14.565  20.798  1.00 54.98  ? 133  LEU A CA    1 
ATOM   976  C  C     . LEU A  1 134 ? 111.305 13.275  21.332  1.00 51.98  ? 133  LEU A C     1 
ATOM   977  O  O     . LEU A  1 134 ? 112.297 12.767  20.805  1.00 54.11  ? 133  LEU A O     1 
ATOM   978  C  CB    . LEU A  1 134 ? 111.235 15.750  21.559  1.00 54.82  ? 133  LEU A CB    1 
ATOM   979  C  CG    . LEU A  1 134 ? 110.991 17.121  20.936  1.00 49.80  ? 133  LEU A CG    1 
ATOM   980  C  CD1   . LEU A  1 134 ? 111.411 18.178  21.958  1.00 59.04  ? 133  LEU A CD1   1 
ATOM   981  C  CD2   . LEU A  1 134 ? 111.748 17.329  19.626  1.00 59.06  ? 133  LEU A CD2   1 
ATOM   982  N  N     . GLN A  1 135 ? 110.723 12.723  22.376  1.00 56.95  ? 134  GLN A N     1 
ATOM   983  C  CA    . GLN A  1 135 ? 111.205 11.450  22.899  1.00 53.76  ? 134  GLN A CA    1 
ATOM   984  C  C     . GLN A  1 135 ? 111.044 10.292  21.933  1.00 54.32  ? 134  GLN A C     1 
ATOM   985  O  O     . GLN A  1 135 ? 111.757 9.303   22.026  1.00 58.74  ? 134  GLN A O     1 
ATOM   986  C  CB    . GLN A  1 135 ? 110.501 11.116  24.202  1.00 54.34  ? 134  GLN A CB    1 
ATOM   987  C  CG    . GLN A  1 135 ? 110.950 11.958  25.394  1.00 53.69  ? 134  GLN A CG    1 
ATOM   988  C  CD    . GLN A  1 135 ? 110.291 11.479  26.671  1.00 49.05  ? 134  GLN A CD    1 
ATOM   989  O  OE1   . GLN A  1 135 ? 110.402 10.331  27.016  1.00 58.98  ? 134  GLN A OE1   1 
ATOM   990  N  NE2   . GLN A  1 135 ? 109.588 12.363  27.355  1.00 61.83  ? 134  GLN A NE2   1 
ATOM   991  N  N     . MET A  1 136 ? 110.070 10.398  21.043  1.00 57.54  ? 135  MET A N     1 
ATOM   992  C  CA    . MET A  1 136 ? 109.807 9.392   20.012  1.00 61.54  ? 135  MET A CA    1 
ATOM   993  C  C     . MET A  1 136 ? 110.411 9.784   18.668  1.00 58.77  ? 135  MET A C     1 
ATOM   994  O  O     . MET A  1 136 ? 110.202 9.115   17.679  1.00 62.69  ? 135  MET A O     1 
ATOM   995  C  CB    . MET A  1 136 ? 108.303 9.270   19.812  1.00 54.38  ? 135  MET A CB    1 
ATOM   996  C  CG    . MET A  1 136 ? 107.537 8.549   20.932  1.00 83.84  ? 135  MET A CG    1 
ATOM   997  S  SD    . MET A  1 136 ? 105.771 9.009   20.834  1.00 95.71  ? 135  MET A SD    1 
ATOM   998  C  CE    . MET A  1 136 ? 105.306 8.391   19.208  1.00 116.23 ? 135  MET A CE    1 
ATOM   999  N  N     . SER A  1 137 ? 111.143 10.882  18.614  1.00 57.71  ? 136  SER A N     1 
ATOM   1000 C  CA    . SER A  1 137 ? 111.697 11.349  17.361  1.00 58.62  ? 136  SER A CA    1 
ATOM   1001 C  C     . SER A  1 137 ? 112.842 10.470  16.850  1.00 58.69  ? 136  SER A C     1 
ATOM   1002 O  O     . SER A  1 137 ? 113.631 9.911   17.638  1.00 58.08  ? 136  SER A O     1 
ATOM   1003 C  CB    . SER A  1 137 ? 112.208 12.773  17.515  1.00 60.56  ? 136  SER A CB    1 
ATOM   1004 O  OG    . SER A  1 137 ? 112.428 13.324  16.245  1.00 61.49  ? 136  SER A OG    1 
ATOM   1005 N  N     . ARG A  1 138 ? 112.891 10.359  15.520  1.00 60.21  ? 137  ARG A N     1 
ATOM   1006 C  CA    . ARG A  1 138 ? 114.022 9.802   14.783  1.00 59.11  ? 137  ARG A CA    1 
ATOM   1007 C  C     . ARG A  1 138 ? 114.613 10.862  13.811  1.00 57.83  ? 137  ARG A C     1 
ATOM   1008 O  O     . ARG A  1 138 ? 115.261 10.548  12.827  1.00 61.18  ? 137  ARG A O     1 
ATOM   1009 C  CB    . ARG A  1 138 ? 113.573 8.544   14.065  1.00 57.80  ? 137  ARG A CB    1 
ATOM   1010 C  CG    . ARG A  1 138 ? 113.306 7.319   15.002  1.00 64.70  ? 137  ARG A CG    1 
ATOM   1011 C  CD    . ARG A  1 138 ? 114.588 6.799   15.660  1.00 85.42  ? 137  ARG A CD    1 
ATOM   1012 N  NE    . ARG A  1 138 ? 115.590 6.432   14.653  1.00 105.45 ? 137  ARG A NE    1 
ATOM   1013 C  CZ    . ARG A  1 138 ? 116.900 6.278   14.869  1.00 101.99 ? 137  ARG A CZ    1 
ATOM   1014 N  NH1   . ARG A  1 138 ? 117.434 6.446   16.082  1.00 98.77  ? 137  ARG A NH1   1 
ATOM   1015 N  NH2   . ARG A  1 138 ? 117.686 5.949   13.848  1.00 97.18  ? 137  ARG A NH2   1 
ATOM   1016 N  N     . SER A  1 139 ? 114.388 12.124  14.144  1.00 57.20  ? 138  SER A N     1 
ATOM   1017 C  CA    . SER A  1 139 ? 114.923 13.238  13.422  1.00 58.63  ? 138  SER A CA    1 
ATOM   1018 C  C     . SER A  1 139 ? 116.448 13.260  13.440  1.00 56.63  ? 138  SER A C     1 
ATOM   1019 O  O     . SER A  1 139 ? 117.057 13.122  14.472  1.00 60.35  ? 138  SER A O     1 
ATOM   1020 C  CB    . SER A  1 139 ? 114.377 14.547  13.990  1.00 52.34  ? 138  SER A CB    1 
ATOM   1021 O  OG    . SER A  1 139 ? 114.811 15.650  13.207  1.00 57.76  ? 138  SER A OG    1 
ATOM   1022 N  N     . SER A  1 140 ? 117.010 13.454  12.258  1.00 55.23  ? 139  SER A N     1 
ATOM   1023 C  CA    . SER A  1 140 ? 118.424 13.703  12.011  1.00 59.68  ? 139  SER A CA    1 
ATOM   1024 C  C     . SER A  1 140 ? 118.704 15.186  11.830  1.00 54.76  ? 139  SER A C     1 
ATOM   1025 O  O     . SER A  1 140 ? 119.758 15.554  11.321  1.00 55.50  ? 139  SER A O     1 
ATOM   1026 C  CB    . SER A  1 140 ? 118.812 13.015  10.693  1.00 53.52  ? 139  SER A CB    1 
ATOM   1027 O  OG    . SER A  1 140 ? 118.741 11.625  10.869  1.00 72.80  ? 139  SER A OG    1 
ATOM   1028 N  N     . LEU A  1 141 ? 117.730 16.016  12.181  1.00 54.42  ? 140  LEU A N     1 
ATOM   1029 C  CA    . LEU A  1 141 ? 117.828 17.463  12.055  1.00 57.35  ? 140  LEU A CA    1 
ATOM   1030 C  C     . LEU A  1 141 ? 117.942 18.039  13.463  1.00 54.82  ? 140  LEU A C     1 
ATOM   1031 O  O     . LEU A  1 141 ? 117.584 17.366  14.415  1.00 56.14  ? 140  LEU A O     1 
ATOM   1032 C  CB    . LEU A  1 141 ? 116.583 18.021  11.349  1.00 58.05  ? 140  LEU A CB    1 
ATOM   1033 C  CG    . LEU A  1 141 ? 116.326 17.529  9.926   1.00 63.30  ? 140  LEU A CG    1 
ATOM   1034 C  CD1   . LEU A  1 141 ? 114.981 18.029  9.449   1.00 59.58  ? 140  LEU A CD1   1 
ATOM   1035 C  CD2   . LEU A  1 141 ? 117.410 18.007  8.995   1.00 66.31  ? 140  LEU A CD2   1 
ATOM   1036 N  N     . PRO A  1 142 ? 118.493 19.268  13.606  1.00 54.58  ? 141  PRO A N     1 
ATOM   1037 C  CA    . PRO A  1 142 ? 118.608 19.885  14.931  1.00 54.85  ? 141  PRO A CA    1 
ATOM   1038 C  C     . PRO A  1 142 ? 117.284 19.995  15.679  1.00 56.65  ? 141  PRO A C     1 
ATOM   1039 O  O     . PRO A  1 142 ? 116.239 19.957  15.065  1.00 62.02  ? 141  PRO A O     1 
ATOM   1040 C  CB    . PRO A  1 142 ? 119.188 21.265  14.630  1.00 53.11  ? 141  PRO A CB    1 
ATOM   1041 C  CG    . PRO A  1 142 ? 119.927 21.091  13.349  1.00 58.12  ? 141  PRO A CG    1 
ATOM   1042 C  CD    . PRO A  1 142 ? 119.081 20.123  12.555  1.00 53.50  ? 141  PRO A CD    1 
ATOM   1043 N  N     . VAL A  1 143 ? 117.326 20.106  17.000  1.00 56.20  ? 142  VAL A N     1 
ATOM   1044 C  CA    . VAL A  1 143 ? 116.097 20.140  17.766  1.00 56.74  ? 142  VAL A CA    1 
ATOM   1045 C  C     . VAL A  1 143 ? 115.190 21.332  17.408  1.00 58.80  ? 142  VAL A C     1 
ATOM   1046 O  O     . VAL A  1 143 ? 113.981 21.227  17.520  1.00 60.37  ? 142  VAL A O     1 
ATOM   1047 C  CB    . VAL A  1 143 ? 116.348 20.065  19.288  1.00 59.44  ? 142  VAL A CB    1 
ATOM   1048 C  CG1   . VAL A  1 143 ? 116.973 21.377  19.849  1.00 55.54  ? 142  VAL A CG1   1 
ATOM   1049 C  CG2   . VAL A  1 143 ? 115.070 19.761  20.007  1.00 57.96  ? 142  VAL A CG2   1 
ATOM   1050 N  N     . ASP A  1 144 ? 115.774 22.463  17.017  1.00 62.28  ? 143  ASP A N     1 
ATOM   1051 C  CA    . ASP A  1 144 ? 114.973 23.633  16.619  1.00 66.01  ? 143  ASP A CA    1 
ATOM   1052 C  C     . ASP A  1 144 ? 114.124 23.363  15.382  1.00 61.92  ? 143  ASP A C     1 
ATOM   1053 O  O     . ASP A  1 144 ? 112.957 23.725  15.360  1.00 63.30  ? 143  ASP A O     1 
ATOM   1054 C  CB    . ASP A  1 144 ? 115.857 24.868  16.357  1.00 66.14  ? 143  ASP A CB    1 
ATOM   1055 C  CG    . ASP A  1 144 ? 116.379 25.515  17.652  1.00 94.02  ? 143  ASP A CG    1 
ATOM   1056 O  OD1   . ASP A  1 144 ? 116.018 25.068  18.784  1.00 96.80  ? 143  ASP A OD1   1 
ATOM   1057 O  OD2   . ASP A  1 144 ? 117.172 26.478  17.524  1.00 100.32 ? 143  ASP A OD2   1 
ATOM   1058 N  N     . ASP A  1 145 ? 114.733 22.777  14.350  1.00 58.92  ? 144  ASP A N     1 
ATOM   1059 C  CA    . ASP A  1 145 ? 114.040 22.439  13.111  1.00 57.89  ? 144  ASP A CA    1 
ATOM   1060 C  C     . ASP A  1 145 ? 113.023 21.353  13.396  1.00 57.52  ? 144  ASP A C     1 
ATOM   1061 O  O     . ASP A  1 145 ? 111.903 21.407  12.936  1.00 58.14  ? 144  ASP A O     1 
ATOM   1062 C  CB    . ASP A  1 145 ? 115.010 21.890  12.058  1.00 65.02  ? 144  ASP A CB    1 
ATOM   1063 C  CG    . ASP A  1 145 ? 116.242 22.806  11.811  1.00 87.18  ? 144  ASP A CG    1 
ATOM   1064 O  OD1   . ASP A  1 145 ? 116.606 23.635  12.694  1.00 97.58  ? 144  ASP A OD1   1 
ATOM   1065 O  OD2   . ASP A  1 145 ? 116.880 22.652  10.731  1.00 90.92  ? 144  ASP A OD2   1 
ATOM   1066 N  N     . THR A  1 146 ? 113.455 20.349  14.157  1.00 58.84  ? 145  THR A N     1 
ATOM   1067 C  CA    . THR A  1 146 ? 112.630 19.229  14.547  1.00 55.73  ? 145  THR A CA    1 
ATOM   1068 C  C     . THR A  1 146 ? 111.384 19.693  15.323  1.00 57.52  ? 145  THR A C     1 
ATOM   1069 O  O     . THR A  1 146 ? 110.268 19.258  15.054  1.00 53.23  ? 145  THR A O     1 
ATOM   1070 C  CB    . THR A  1 146 ? 113.452 18.229  15.349  1.00 54.29  ? 145  THR A CB    1 
ATOM   1071 O  OG1   . THR A  1 146 ? 114.512 17.718  14.531  1.00 58.96  ? 145  THR A OG1   1 
ATOM   1072 C  CG2   . THR A  1 146 ? 112.607 17.087  15.833  1.00 54.54  ? 145  THR A CG2   1 
ATOM   1073 N  N     . THR A  1 147 ? 111.575 20.600  16.260  1.00 56.78  ? 146  THR A N     1 
ATOM   1074 C  CA    . THR A  1 147 ? 110.468 21.106  17.074  1.00 58.47  ? 146  THR A CA    1 
ATOM   1075 C  C     . THR A  1 147 ? 109.504 21.991  16.282  1.00 57.88  ? 146  THR A C     1 
ATOM   1076 O  O     . THR A  1 147 ? 108.315 21.980  16.549  1.00 59.43  ? 146  THR A O     1 
ATOM   1077 C  CB    . THR A  1 147 ? 111.012 21.861  18.307  1.00 61.98  ? 146  THR A CB    1 
ATOM   1078 O  OG1   . THR A  1 147 ? 111.883 20.987  19.035  1.00 63.41  ? 146  THR A OG1   1 
ATOM   1079 C  CG2   . THR A  1 147 ? 109.879 22.304  19.191  1.00 67.32  ? 146  THR A CG2   1 
ATOM   1080 N  N     . LYS A  1 148 ? 110.012 22.744  15.309  1.00 58.88  ? 147  LYS A N     1 
ATOM   1081 C  CA    . LYS A  1 148 ? 109.147 23.517  14.408  1.00 61.45  ? 147  LYS A CA    1 
ATOM   1082 C  C     . LYS A  1 148 ? 108.180 22.642  13.614  1.00 59.89  ? 147  LYS A C     1 
ATOM   1083 O  O     . LYS A  1 148 ? 107.029 23.037  13.374  1.00 62.62  ? 147  LYS A O     1 
ATOM   1084 C  CB    . LYS A  1 148 ? 109.956 24.426  13.451  1.00 55.99  ? 147  LYS A CB    1 
ATOM   1085 C  CG    . LYS A  1 148 ? 110.556 25.657  14.171  1.00 68.57  ? 147  LYS A CG    1 
ATOM   1086 C  CD    . LYS A  1 148 ? 111.443 26.533  13.272  1.00 72.55  ? 147  LYS A CD    1 
ATOM   1087 N  N     . THR A  1 149 ? 108.653 21.478  13.185  1.00 58.25  ? 148  THR A N     1 
ATOM   1088 C  CA    . THR A  1 149 ? 107.816 20.530  12.479  1.00 57.08  ? 148  THR A CA    1 
ATOM   1089 C  C     . THR A  1 149 ? 106.801 19.896  13.422  1.00 55.59  ? 148  THR A C     1 
ATOM   1090 O  O     . THR A  1 149 ? 105.681 19.631  13.018  1.00 53.66  ? 148  THR A O     1 
ATOM   1091 C  CB    . THR A  1 149 ? 108.652 19.419  11.821  1.00 56.75  ? 148  THR A CB    1 
ATOM   1092 O  OG1   . THR A  1 149 ? 109.581 20.007  10.921  1.00 52.28  ? 148  THR A OG1   1 
ATOM   1093 C  CG2   . THR A  1 149 ? 107.795 18.464  11.035  1.00 54.13  ? 148  THR A CG2   1 
ATOM   1094 N  N     . ILE A  1 150 ? 107.203 19.628  14.659  1.00 56.09  ? 149  ILE A N     1 
ATOM   1095 C  CA    . ILE A  1 150 ? 106.277 19.132  15.666  1.00 57.13  ? 149  ILE A CA    1 
ATOM   1096 C  C     . ILE A  1 150 ? 105.191 20.177  15.963  1.00 57.89  ? 149  ILE A C     1 
ATOM   1097 O  O     . ILE A  1 150 ? 104.022 19.842  16.109  1.00 59.42  ? 149  ILE A O     1 
ATOM   1098 C  CB    . ILE A  1 150 ? 107.011 18.722  16.953  1.00 57.92  ? 149  ILE A CB    1 
ATOM   1099 C  CG1   . ILE A  1 150 ? 107.774 17.414  16.742  1.00 57.87  ? 149  ILE A CG1   1 
ATOM   1100 C  CG2   . ILE A  1 150 ? 106.038 18.526  18.130  1.00 61.01  ? 149  ILE A CG2   1 
ATOM   1101 C  CD1   . ILE A  1 150 ? 108.735 17.108  17.886  1.00 55.63  ? 149  ILE A CD1   1 
ATOM   1102 N  N     . ALA A  1 151 ? 105.585 21.435  16.072  1.00 54.43  ? 150  ALA A N     1 
ATOM   1103 C  CA    . ALA A  1 151 ? 104.618 22.534  16.244  1.00 59.35  ? 150  ALA A CA    1 
ATOM   1104 C  C     . ALA A  1 151 ? 103.563 22.545  15.118  1.00 58.29  ? 150  ALA A C     1 
ATOM   1105 O  O     . ALA A  1 151 ? 102.379 22.753  15.345  1.00 60.83  ? 150  ALA A O     1 
ATOM   1106 C  CB    . ALA A  1 151 ? 105.370 23.887  16.326  1.00 59.32  ? 150  ALA A CB    1 
ATOM   1107 N  N     . LYS A  1 152 ? 103.987 22.282  13.895  1.00 62.98  ? 151  LYS A N     1 
ATOM   1108 C  CA    . LYS A  1 152 ? 103.045 22.147  12.772  1.00 57.77  ? 151  LYS A CA    1 
ATOM   1109 C  C     . LYS A  1 152 ? 102.079 20.964  12.875  1.00 54.15  ? 151  LYS A C     1 
ATOM   1110 O  O     . LYS A  1 152 ? 100.924 21.043  12.442  1.00 58.37  ? 151  LYS A O     1 
ATOM   1111 C  CB    . LYS A  1 152 ? 103.817 22.034  11.476  1.00 59.24  ? 151  LYS A CB    1 
ATOM   1112 C  CG    . LYS A  1 152 ? 104.509 23.272  11.074  1.00 54.71  ? 151  LYS A CG    1 
ATOM   1113 C  CD    . LYS A  1 152 ? 105.180 23.049  9.721   1.00 68.88  ? 151  LYS A CD    1 
ATOM   1114 C  CE    . LYS A  1 152 ? 105.922 24.305  9.221   1.00 85.84  ? 151  LYS A CE    1 
ATOM   1115 N  N     . ARG A  1 153 ? 102.566 19.848  13.383  1.00 53.82  ? 152  ARG A N     1 
ATOM   1116 C  CA    . ARG A  1 153 ? 101.727 18.711  13.709  1.00 57.46  ? 152  ARG A CA    1 
ATOM   1117 C  C     . ARG A  1 153 ? 100.641 19.028  14.742  1.00 55.22  ? 152  ARG A C     1 
ATOM   1118 O  O     . ARG A  1 153 ? 99.525  18.537  14.649  1.00 61.47  ? 152  ARG A O     1 
ATOM   1119 C  CB    . ARG A  1 153 ? 102.578 17.558  14.244  1.00 59.46  ? 152  ARG A CB    1 
ATOM   1120 C  CG    . ARG A  1 153 ? 103.638 17.062  13.262  1.00 55.73  ? 152  ARG A CG    1 
ATOM   1121 C  CD    . ARG A  1 153 ? 104.415 15.931  13.888  1.00 59.66  ? 152  ARG A CD    1 
ATOM   1122 N  NE    . ARG A  1 153 ? 103.541 14.785  14.062  1.00 60.57  ? 152  ARG A NE    1 
ATOM   1123 C  CZ    . ARG A  1 153 ? 103.890 13.656  14.674  1.00 62.16  ? 152  ARG A CZ    1 
ATOM   1124 N  NH1   . ARG A  1 153 ? 105.118 13.502  15.156  1.00 62.68  ? 152  ARG A NH1   1 
ATOM   1125 N  NH2   . ARG A  1 153 ? 102.994 12.690  14.797  1.00 54.71  ? 152  ARG A NH2   1 
ATOM   1126 N  N     . LEU A  1 154 ? 100.976 19.813  15.743  1.00 57.41  ? 153  LEU A N     1 
ATOM   1127 C  CA    . LEU A  1 154 ? 99.986  20.238  16.744  1.00 56.73  ? 153  LEU A CA    1 
ATOM   1128 C  C     . LEU A  1 154 ? 98.991  21.246  16.162  1.00 56.01  ? 153  LEU A C     1 
ATOM   1129 O  O     . LEU A  1 154 ? 97.791  21.136  16.382  1.00 59.17  ? 153  LEU A O     1 
ATOM   1130 C  CB    . LEU A  1 154 ? 100.697 20.818  17.956  1.00 60.85  ? 153  LEU A CB    1 
ATOM   1131 C  CG    . LEU A  1 154 ? 101.551 19.826  18.793  1.00 59.24  ? 153  LEU A CG    1 
ATOM   1132 C  CD1   . LEU A  1 154 ? 101.907 20.459  20.087  1.00 70.51  ? 153  LEU A CD1   1 
ATOM   1133 C  CD2   . LEU A  1 154 ? 100.849 18.539  19.031  1.00 72.66  ? 153  LEU A CD2   1 
ATOM   1134 N  N     . GLU A  1 155 ? 99.490  22.188  15.374  1.00 50.90  ? 154  GLU A N     1 
ATOM   1135 C  CA    . GLU A  1 155 ? 98.641  23.130  14.661  1.00 57.30  ? 154  GLU A CA    1 
ATOM   1136 C  C     . GLU A  1 155 ? 97.595  22.409  13.861  1.00 57.78  ? 154  GLU A C     1 
ATOM   1137 O  O     . GLU A  1 155 ? 96.445  22.822  13.875  1.00 56.45  ? 154  GLU A O     1 
ATOM   1138 C  CB    . GLU A  1 155 ? 99.464  24.016  13.728  1.00 52.09  ? 154  GLU A CB    1 
ATOM   1139 C  CG    . GLU A  1 155 ? 100.332 24.989  14.534  1.00 60.81  ? 154  GLU A CG    1 
ATOM   1140 C  CD    . GLU A  1 155 ? 101.335 25.753  13.681  1.00 68.45  ? 154  GLU A CD    1 
ATOM   1141 O  OE1   . GLU A  1 155 ? 101.255 25.662  12.446  1.00 81.10  ? 154  GLU A OE1   1 
ATOM   1142 O  OE2   . GLU A  1 155 ? 102.206 26.452  14.250  1.00 87.29  ? 154  GLU A OE2   1 
ATOM   1143 N  N     . ALA A  1 156 ? 97.995  21.337  13.166  1.00 56.27  ? 155  ALA A N     1 
ATOM   1144 C  CA    . ALA A  1 156 ? 97.065  20.596  12.331  1.00 56.78  ? 155  ALA A CA    1 
ATOM   1145 C  C     . ALA A  1 156 ? 96.031  19.887  13.166  1.00 54.45  ? 155  ALA A C     1 
ATOM   1146 O  O     . ALA A  1 156 ? 94.858  19.801  12.784  1.00 60.12  ? 155  ALA A O     1 
ATOM   1147 C  CB    . ALA A  1 156 ? 97.782  19.612  11.436  1.00 59.10  ? 155  ALA A CB    1 
ATOM   1148 N  N     . TYR A  1 157 ? 96.462  19.369  14.297  1.00 56.12  ? 156  TYR A N     1 
ATOM   1149 C  CA    . TYR A  1 157 ? 95.537  18.782  15.262  1.00 56.45  ? 156  TYR A CA    1 
ATOM   1150 C  C     . TYR A  1 157 ? 94.527  19.785  15.806  1.00 54.67  ? 156  TYR A C     1 
ATOM   1151 O  O     . TYR A  1 157 ? 93.354  19.486  15.888  1.00 58.03  ? 156  TYR A O     1 
ATOM   1152 C  CB    . TYR A  1 157 ? 96.292  18.129  16.431  1.00 58.27  ? 156  TYR A CB    1 
ATOM   1153 C  CG    . TYR A  1 157 ? 95.360  17.698  17.529  1.00 54.84  ? 156  TYR A CG    1 
ATOM   1154 C  CD1   . TYR A  1 157 ? 94.409  16.702  17.302  1.00 61.74  ? 156  TYR A CD1   1 
ATOM   1155 C  CD2   . TYR A  1 157 ? 95.343  18.361  18.753  1.00 55.11  ? 156  TYR A CD2   1 
ATOM   1156 C  CE1   . TYR A  1 157 ? 93.502  16.338  18.293  1.00 57.36  ? 156  TYR A CE1   1 
ATOM   1157 C  CE2   . TYR A  1 157 ? 94.467  17.988  19.748  1.00 62.37  ? 156  TYR A CE2   1 
ATOM   1158 C  CZ    . TYR A  1 157 ? 93.538  16.986  19.501  1.00 49.59  ? 156  TYR A CZ    1 
ATOM   1159 O  OH    . TYR A  1 157 ? 92.683  16.657  20.502  1.00 64.42  ? 156  TYR A OH    1 
ATOM   1160 N  N     . TYR A  1 158 ? 94.982  20.963  16.206  1.00 57.94  ? 157  TYR A N     1 
ATOM   1161 C  CA    . TYR A  1 158 ? 94.070  21.950  16.773  1.00 54.93  ? 157  TYR A CA    1 
ATOM   1162 C  C     . TYR A  1 158 ? 93.031  22.396  15.741  1.00 55.97  ? 157  TYR A C     1 
ATOM   1163 O  O     . TYR A  1 158 ? 91.862  22.619  16.048  1.00 54.19  ? 157  TYR A O     1 
ATOM   1164 C  CB    . TYR A  1 158 ? 94.864  23.135  17.290  1.00 57.28  ? 157  TYR A CB    1 
ATOM   1165 C  CG    . TYR A  1 158 ? 95.761  22.807  18.457  1.00 52.94  ? 157  TYR A CG    1 
ATOM   1166 C  CD1   . TYR A  1 158 ? 95.286  22.097  19.544  1.00 53.21  ? 157  TYR A CD1   1 
ATOM   1167 C  CD2   . TYR A  1 158 ? 97.094  23.207  18.474  1.00 61.03  ? 157  TYR A CD2   1 
ATOM   1168 C  CE1   . TYR A  1 158 ? 96.102  21.812  20.622  1.00 51.03  ? 157  TYR A CE1   1 
ATOM   1169 C  CE2   . TYR A  1 158 ? 97.921  22.907  19.554  1.00 54.80  ? 157  TYR A CE2   1 
ATOM   1170 C  CZ    . TYR A  1 158 ? 97.418  22.209  20.625  1.00 64.20  ? 157  TYR A CZ    1 
ATOM   1171 O  OH    . TYR A  1 158 ? 98.222  21.905  21.727  1.00 59.92  ? 157  TYR A OH    1 
ATOM   1172 N  N     . ARG A  1 159 ? 93.461  22.538  14.503  1.00 57.00  ? 158  ARG A N     1 
ATOM   1173 C  CA    . ARG A  1 159 ? 92.551  22.897  13.427  1.00 58.63  ? 158  ARG A CA    1 
ATOM   1174 C  C     . ARG A  1 159 ? 91.460  21.863  13.255  1.00 59.29  ? 158  ARG A C     1 
ATOM   1175 O  O     . ARG A  1 159 ? 90.303  22.199  13.070  1.00 65.28  ? 158  ARG A O     1 
ATOM   1176 C  CB    . ARG A  1 159 ? 93.316  23.011  12.122  1.00 59.53  ? 158  ARG A CB    1 
ATOM   1177 C  CG    . ARG A  1 159 ? 93.812  24.372  11.840  1.00 58.77  ? 158  ARG A CG    1 
ATOM   1178 C  CD    . ARG A  1 159 ? 94.479  24.417  10.453  1.00 63.72  ? 158  ARG A CD    1 
ATOM   1179 N  NE    . ARG A  1 159 ? 95.917  24.681  10.595  1.00 77.67  ? 158  ARG A NE    1 
ATOM   1180 C  CZ    . ARG A  1 159 ? 96.912  23.873  10.228  1.00 80.41  ? 158  ARG A CZ    1 
ATOM   1181 N  NH1   . ARG A  1 159 ? 96.709  22.722  9.549   1.00 74.60  ? 158  ARG A NH1   1 
ATOM   1182 N  NH2   . ARG A  1 159 ? 98.147  24.281  10.484  1.00 84.97  ? 158  ARG A NH2   1 
ATOM   1183 N  N     . ALA A  1 160 ? 91.838  20.597  13.291  1.00 60.91  ? 159  ALA A N     1 
ATOM   1184 C  CA    . ALA A  1 160 ? 90.895  19.518  13.084  1.00 64.81  ? 159  ALA A CA    1 
ATOM   1185 C  C     . ALA A  1 160 ? 89.950  19.322  14.269  1.00 62.35  ? 159  ALA A C     1 
ATOM   1186 O  O     . ALA A  1 160 ? 88.807  18.900  14.091  1.00 70.34  ? 159  ALA A O     1 
ATOM   1187 C  CB    . ALA A  1 160 ? 91.651  18.209  12.795  1.00 64.15  ? 159  ALA A CB    1 
ATOM   1188 N  N     . SER A  1 161 ? 90.432  19.606  15.469  1.00 59.85  ? 160  SER A N     1 
ATOM   1189 C  CA    . SER A  1 161 ? 89.797  19.135  16.691  1.00 57.85  ? 160  SER A CA    1 
ATOM   1190 C  C     . SER A  1 161 ? 88.874  20.158  17.330  1.00 58.80  ? 160  SER A C     1 
ATOM   1191 O  O     . SER A  1 161 ? 87.805  19.813  17.816  1.00 60.15  ? 160  SER A O     1 
ATOM   1192 C  CB    . SER A  1 161 ? 90.859  18.683  17.706  1.00 61.07  ? 160  SER A CB    1 
ATOM   1193 O  OG    . SER A  1 161 ? 91.672  19.757  18.142  1.00 66.12  ? 160  SER A OG    1 
ATOM   1194 N  N     . ILE A  1 162 ? 89.293  21.417  17.344  1.00 56.26  ? 161  ILE A N     1 
ATOM   1195 C  CA    . ILE A  1 162 ? 88.572  22.450  18.094  1.00 55.88  ? 161  ILE A CA    1 
ATOM   1196 C  C     . ILE A  1 162 ? 87.094  22.593  17.682  1.00 53.00  ? 161  ILE A C     1 
ATOM   1197 O  O     . ILE A  1 162 ? 86.220  22.596  18.553  1.00 55.65  ? 161  ILE A O     1 
ATOM   1198 C  CB    . ILE A  1 162 ? 89.336  23.811  18.059  1.00 51.66  ? 161  ILE A CB    1 
ATOM   1199 C  CG1   . ILE A  1 162 ? 90.594  23.711  18.946  1.00 54.16  ? 161  ILE A CG1   1 
ATOM   1200 C  CG2   . ILE A  1 162 ? 88.433  24.959  18.495  1.00 53.10  ? 161  ILE A CG2   1 
ATOM   1201 C  CD1   . ILE A  1 162 ? 91.468  24.955  18.953  1.00 50.13  ? 161  ILE A CD1   1 
ATOM   1202 N  N     . PRO A  1 163 ? 86.811  22.726  16.374  1.00 52.33  ? 162  PRO A N     1 
ATOM   1203 C  CA    . PRO A  1 163 ? 85.413  22.868  15.949  1.00 53.90  ? 162  PRO A CA    1 
ATOM   1204 C  C     . PRO A  1 163 ? 84.572  21.650  16.290  1.00 51.15  ? 162  PRO A C     1 
ATOM   1205 O  O     . PRO A  1 163 ? 83.438  21.768  16.690  1.00 52.78  ? 162  PRO A O     1 
ATOM   1206 C  CB    . PRO A  1 163 ? 85.517  23.028  14.429  1.00 57.50  ? 162  PRO A CB    1 
ATOM   1207 C  CG    . PRO A  1 163 ? 86.919  23.359  14.137  1.00 55.59  ? 162  PRO A CG    1 
ATOM   1208 C  CD    . PRO A  1 163 ? 87.740  22.787  15.239  1.00 52.66  ? 162  PRO A CD    1 
ATOM   1209 N  N     . VAL A  1 164 ? 85.173  20.486  16.131  1.00 55.39  ? 163  VAL A N     1 
ATOM   1210 C  CA    . VAL A  1 164 ? 84.547  19.217  16.348  1.00 55.40  ? 163  VAL A CA    1 
ATOM   1211 C  C     . VAL A  1 164 ? 84.200  18.988  17.810  1.00 54.17  ? 163  VAL A C     1 
ATOM   1212 O  O     . VAL A  1 164 ? 83.066  18.608  18.144  1.00 55.04  ? 163  VAL A O     1 
ATOM   1213 C  CB    . VAL A  1 164 ? 85.444  18.076  15.764  1.00 57.95  ? 163  VAL A CB    1 
ATOM   1214 C  CG1   . VAL A  1 164 ? 84.950  16.709  16.211  1.00 63.51  ? 163  VAL A CG1   1 
ATOM   1215 C  CG2   . VAL A  1 164 ? 85.467  18.170  14.234  1.00 57.55  ? 163  VAL A CG2   1 
ATOM   1216 N  N     . ILE A  1 165 ? 85.169  19.223  18.683  1.00 58.03  ? 164  ILE A N     1 
ATOM   1217 C  CA    . ILE A  1 165 ? 84.938  19.126  20.118  1.00 54.38  ? 164  ILE A CA    1 
ATOM   1218 C  C     . ILE A  1 165 ? 83.854  20.083  20.591  1.00 53.34  ? 164  ILE A C     1 
ATOM   1219 O  O     . ILE A  1 165 ? 82.991  19.696  21.356  1.00 56.28  ? 164  ILE A O     1 
ATOM   1220 C  CB    . ILE A  1 165 ? 86.250  19.302  20.907  1.00 58.56  ? 164  ILE A CB    1 
ATOM   1221 C  CG1   . ILE A  1 165 ? 87.105  18.035  20.767  1.00 57.69  ? 164  ILE A CG1   1 
ATOM   1222 C  CG2   . ILE A  1 165 ? 85.979  19.543  22.377  1.00 61.11  ? 164  ILE A CG2   1 
ATOM   1223 C  CD1   . ILE A  1 165 ? 88.557  18.231  21.165  1.00 63.65  ? 164  ILE A CD1   1 
ATOM   1224 N  N     . ALA A  1 166 ? 83.902  21.331  20.120  1.00 56.06  ? 165  ALA A N     1 
ATOM   1225 C  CA    . ALA A  1 166 ? 82.913  22.329  20.457  1.00 52.03  ? 165  ALA A CA    1 
ATOM   1226 C  C     . ALA A  1 166 ? 81.525  21.878  20.020  1.00 51.70  ? 165  ALA A C     1 
ATOM   1227 O  O     . ALA A  1 166 ? 80.560  22.061  20.737  1.00 55.19  ? 165  ALA A O     1 
ATOM   1228 C  CB    . ALA A  1 166 ? 83.269  23.671  19.794  1.00 55.90  ? 165  ALA A CB    1 
ATOM   1229 N  N     . TYR A  1 167 ? 81.424  21.316  18.822  1.00 55.42  ? 166  TYR A N     1 
ATOM   1230 C  CA    . TYR A  1 167 ? 80.151  20.798  18.329  1.00 54.87  ? 166  TYR A CA    1 
ATOM   1231 C  C     . TYR A  1 167 ? 79.577  19.654  19.194  1.00 54.12  ? 166  TYR A C     1 
ATOM   1232 O  O     . TYR A  1 167 ? 78.422  19.716  19.612  1.00 54.18  ? 166  TYR A O     1 
ATOM   1233 C  CB    . TYR A  1 167 ? 80.271  20.388  16.854  1.00 54.09  ? 166  TYR A CB    1 
ATOM   1234 C  CG    . TYR A  1 167 ? 79.054  19.680  16.324  1.00 56.98  ? 166  TYR A CG    1 
ATOM   1235 C  CD1   . TYR A  1 167 ? 77.914  20.394  15.922  1.00 55.33  ? 166  TYR A CD1   1 
ATOM   1236 C  CD2   . TYR A  1 167 ? 79.043  18.285  16.200  1.00 48.48  ? 166  TYR A CD2   1 
ATOM   1237 C  CE1   . TYR A  1 167 ? 76.790  19.730  15.421  1.00 60.68  ? 166  TYR A CE1   1 
ATOM   1238 C  CE2   . TYR A  1 167 ? 77.923  17.614  15.711  1.00 56.17  ? 166  TYR A CE2   1 
ATOM   1239 C  CZ    . TYR A  1 167 ? 76.806  18.333  15.318  1.00 59.81  ? 166  TYR A CZ    1 
ATOM   1240 O  OH    . TYR A  1 167 ? 75.726  17.631  14.837  1.00 60.30  ? 166  TYR A OH    1 
ATOM   1241 N  N     . TYR A  1 168 ? 80.363  18.616  19.448  1.00 52.67  ? 167  TYR A N     1 
ATOM   1242 C  CA    . TYR A  1 168 ? 79.856  17.460  20.196  1.00 56.48  ? 167  TYR A CA    1 
ATOM   1243 C  C     . TYR A  1 168 ? 79.588  17.729  21.663  1.00 59.33  ? 167  TYR A C     1 
ATOM   1244 O  O     . TYR A  1 168 ? 78.820  16.996  22.281  1.00 61.93  ? 167  TYR A O     1 
ATOM   1245 C  CB    . TYR A  1 168 ? 80.754  16.234  20.037  1.00 58.03  ? 167  TYR A CB    1 
ATOM   1246 C  CG    . TYR A  1 168 ? 80.551  15.570  18.715  1.00 52.40  ? 167  TYR A CG    1 
ATOM   1247 C  CD1   . TYR A  1 168 ? 79.343  14.938  18.416  1.00 54.50  ? 167  TYR A CD1   1 
ATOM   1248 C  CD2   . TYR A  1 168 ? 81.544  15.611  17.733  1.00 61.36  ? 167  TYR A CD2   1 
ATOM   1249 C  CE1   . TYR A  1 168 ? 79.137  14.340  17.169  1.00 53.49  ? 167  TYR A CE1   1 
ATOM   1250 C  CE2   . TYR A  1 168 ? 81.346  15.019  16.486  1.00 63.56  ? 167  TYR A CE2   1 
ATOM   1251 C  CZ    . TYR A  1 168 ? 80.147  14.393  16.212  1.00 61.72  ? 167  TYR A CZ    1 
ATOM   1252 O  OH    . TYR A  1 168 ? 79.971  13.808  14.986  1.00 62.67  ? 167  TYR A OH    1 
ATOM   1253 N  N     . GLU A  1 169 ? 80.191  18.785  22.205  1.00 57.75  ? 168  GLU A N     1 
ATOM   1254 C  CA    . GLU A  1 169 ? 79.785  19.332  23.502  1.00 62.72  ? 168  GLU A CA    1 
ATOM   1255 C  C     . GLU A  1 169 ? 78.315  19.685  23.569  1.00 61.70  ? 168  GLU A C     1 
ATOM   1256 O  O     . GLU A  1 169 ? 77.691  19.532  24.607  1.00 60.48  ? 168  GLU A O     1 
ATOM   1257 C  CB    . GLU A  1 169 ? 80.579  20.607  23.830  1.00 59.17  ? 168  GLU A CB    1 
ATOM   1258 C  CG    . GLU A  1 169 ? 81.942  20.337  24.400  1.00 78.06  ? 168  GLU A CG    1 
ATOM   1259 C  CD    . GLU A  1 169 ? 82.751  21.606  24.643  1.00 79.66  ? 168  GLU A CD    1 
ATOM   1260 O  OE1   . GLU A  1 169 ? 82.160  22.714  24.775  1.00 92.94  ? 168  GLU A OE1   1 
ATOM   1261 O  OE2   . GLU A  1 169 ? 83.988  21.471  24.709  1.00 78.18  ? 168  GLU A OE2   1 
ATOM   1262 N  N     . THR A  1 170 ? 77.778  20.213  22.472  1.00 63.77  ? 169  THR A N     1 
ATOM   1263 C  CA    . THR A  1 170 ? 76.371  20.598  22.413  1.00 65.00  ? 169  THR A CA    1 
ATOM   1264 C  C     . THR A  1 170 ? 75.451  19.395  22.152  1.00 64.40  ? 169  THR A C     1 
ATOM   1265 O  O     . THR A  1 170 ? 74.266  19.449  22.461  1.00 65.09  ? 169  THR A O     1 
ATOM   1266 C  CB    . THR A  1 170 ? 76.131  21.703  21.339  1.00 60.80  ? 169  THR A CB    1 
ATOM   1267 O  OG1   . THR A  1 170 ? 76.398  21.199  20.013  1.00 67.66  ? 169  THR A OG1   1 
ATOM   1268 C  CG2   . THR A  1 170 ? 77.043  22.883  21.596  1.00 65.36  ? 169  THR A CG2   1 
ATOM   1269 N  N     . LYS A  1 171 ? 75.999  18.314  21.609  1.00 63.61  ? 170  LYS A N     1 
ATOM   1270 C  CA    . LYS A  1 171 ? 75.172  17.262  21.028  1.00 64.50  ? 170  LYS A CA    1 
ATOM   1271 C  C     . LYS A  1 171 ? 75.130  15.971  21.819  1.00 64.33  ? 170  LYS A C     1 
ATOM   1272 O  O     . LYS A  1 171 ? 74.125  15.300  21.803  1.00 68.94  ? 170  LYS A O     1 
ATOM   1273 C  CB    . LYS A  1 171 ? 75.591  16.974  19.573  1.00 61.59  ? 170  LYS A CB    1 
ATOM   1274 C  CG    . LYS A  1 171 ? 75.349  18.138  18.607  1.00 75.47  ? 170  LYS A CG    1 
ATOM   1275 C  CD    . LYS A  1 171 ? 73.856  18.510  18.432  1.00 83.97  ? 170  LYS A CD    1 
ATOM   1276 C  CE    . LYS A  1 171 ? 73.661  19.944  17.865  1.00 80.04  ? 170  LYS A CE    1 
ATOM   1277 N  N     . THR A  1 172 ? 76.196  15.609  22.514  1.00 66.32  ? 171  THR A N     1 
ATOM   1278 C  CA    . THR A  1 172 ? 76.221  14.325  23.199  1.00 62.23  ? 171  THR A CA    1 
ATOM   1279 C  C     . THR A  1 172 ? 77.024  14.445  24.487  1.00 60.61  ? 171  THR A C     1 
ATOM   1280 O  O     . THR A  1 172 ? 77.296  15.542  24.952  1.00 61.87  ? 171  THR A O     1 
ATOM   1281 C  CB    . THR A  1 172 ? 76.744  13.201  22.232  1.00 62.43  ? 171  THR A CB    1 
ATOM   1282 O  OG1   . THR A  1 172 ? 76.464  11.899  22.772  1.00 59.51  ? 171  THR A OG1   1 
ATOM   1283 C  CG2   . THR A  1 172 ? 78.226  13.336  21.931  1.00 56.91  ? 171  THR A CG2   1 
ATOM   1284 N  N     . GLN A  1 173 ? 77.367  13.317  25.085  1.00 59.42  ? 172  GLN A N     1 
ATOM   1285 C  CA    . GLN A  1 173 ? 78.261  13.298  26.249  1.00 57.17  ? 172  GLN A CA    1 
ATOM   1286 C  C     . GLN A  1 173 ? 79.692  13.347  25.761  1.00 57.82  ? 172  GLN A C     1 
ATOM   1287 O  O     . GLN A  1 173 ? 80.118  12.480  24.977  1.00 60.35  ? 172  GLN A O     1 
ATOM   1288 C  CB    . GLN A  1 173 ? 78.053  12.017  27.054  1.00 60.64  ? 172  GLN A CB    1 
ATOM   1289 C  CG    . GLN A  1 173 ? 76.711  11.950  27.711  1.00 61.56  ? 172  GLN A CG    1 
ATOM   1290 C  CD    . GLN A  1 173 ? 76.608  12.925  28.859  1.00 74.04  ? 172  GLN A CD    1 
ATOM   1291 O  OE1   . GLN A  1 173 ? 77.443  12.921  29.775  1.00 66.63  ? 172  GLN A OE1   1 
ATOM   1292 N  NE2   . GLN A  1 173 ? 75.607  13.797  28.800  1.00 87.47  ? 172  GLN A NE2   1 
ATOM   1293 N  N     . LEU A  1 174 ? 80.418  14.374  26.194  1.00 56.41  ? 173  LEU A N     1 
ATOM   1294 C  CA    . LEU A  1 174 ? 81.818  14.559  25.870  1.00 57.54  ? 173  LEU A CA    1 
ATOM   1295 C  C     . LEU A  1 174 ? 82.623  14.588  27.184  1.00 55.63  ? 173  LEU A C     1 
ATOM   1296 O  O     . LEU A  1 174 ? 82.342  15.371  28.075  1.00 56.78  ? 173  LEU A O     1 
ATOM   1297 C  CB    . LEU A  1 174 ? 82.003  15.855  25.027  1.00 61.91  ? 173  LEU A CB    1 
ATOM   1298 C  CG    . LEU A  1 174 ? 83.406  16.096  24.435  1.00 56.10  ? 173  LEU A CG    1 
ATOM   1299 C  CD1   . LEU A  1 174 ? 83.389  16.585  22.971  1.00 55.78  ? 173  LEU A CD1   1 
ATOM   1300 C  CD2   . LEU A  1 174 ? 84.131  17.090  25.308  1.00 62.69  ? 173  LEU A CD2   1 
ATOM   1301 N  N     . HIS A  1 175 ? 83.595  13.690  27.310  1.00 58.87  ? 174  HIS A N     1 
ATOM   1302 C  CA    . HIS A  1 175 ? 84.420  13.587  28.510  1.00 56.50  ? 174  HIS A CA    1 
ATOM   1303 C  C     . HIS A  1 175 ? 85.828  13.962  28.115  1.00 60.53  ? 174  HIS A C     1 
ATOM   1304 O  O     . HIS A  1 175 ? 86.384  13.387  27.181  1.00 55.42  ? 174  HIS A O     1 
ATOM   1305 C  CB    . HIS A  1 175 ? 84.373  12.191  29.109  1.00 58.40  ? 174  HIS A CB    1 
ATOM   1306 C  CG    . HIS A  1 175 ? 83.050  11.834  29.728  1.00 60.94  ? 174  HIS A CG    1 
ATOM   1307 N  ND1   . HIS A  1 175 ? 81.847  12.307  29.254  1.00 78.81  ? 174  HIS A ND1   1 
ATOM   1308 C  CD2   . HIS A  1 175 ? 82.743  11.011  30.756  1.00 72.59  ? 174  HIS A CD2   1 
ATOM   1309 C  CE1   . HIS A  1 175 ? 80.859  11.806  29.971  1.00 68.60  ? 174  HIS A CE1   1 
ATOM   1310 N  NE2   . HIS A  1 175 ? 81.375  11.004  30.878  1.00 60.41  ? 174  HIS A NE2   1 
ATOM   1311 N  N     . LYS A  1 176 ? 86.363  14.987  28.781  1.00 59.23  ? 175  LYS A N     1 
ATOM   1312 C  CA    . LYS A  1 176 ? 87.739  15.385  28.592  1.00 62.46  ? 175  LYS A CA    1 
ATOM   1313 C  C     . LYS A  1 176 ? 88.580  14.627  29.609  1.00 61.12  ? 175  LYS A C     1 
ATOM   1314 O  O     . LYS A  1 176 ? 88.359  14.734  30.788  1.00 65.45  ? 175  LYS A O     1 
ATOM   1315 C  CB    . LYS A  1 176 ? 87.888  16.910  28.698  1.00 59.13  ? 175  LYS A CB    1 
ATOM   1316 C  CG    . LYS A  1 176 ? 87.056  17.591  27.611  1.00 72.27  ? 175  LYS A CG    1 
ATOM   1317 C  CD    . LYS A  1 176 ? 87.266  19.094  27.417  1.00 76.54  ? 175  LYS A CD    1 
ATOM   1318 C  CE    . LYS A  1 176 ? 86.264  19.642  26.363  1.00 83.18  ? 175  LYS A CE    1 
ATOM   1319 N  NZ    . LYS A  1 176 ? 86.657  20.943  25.703  1.00 84.09  ? 175  LYS A NZ    1 
ATOM   1320 N  N     . ILE A  1 177 ? 89.503  13.814  29.112  1.00 63.93  ? 176  ILE A N     1 
ATOM   1321 C  CA    . ILE A  1 177 ? 90.414  13.029  29.919  1.00 61.35  ? 176  ILE A CA    1 
ATOM   1322 C  C     . ILE A  1 177 ? 91.758  13.738  29.963  1.00 59.74  ? 176  ILE A C     1 
ATOM   1323 O  O     . ILE A  1 177 ? 92.280  14.188  28.964  1.00 60.36  ? 176  ILE A O     1 
ATOM   1324 C  CB    . ILE A  1 177 ? 90.532  11.558  29.380  1.00 70.00  ? 176  ILE A CB    1 
ATOM   1325 C  CG1   . ILE A  1 177 ? 89.452  10.680  30.041  1.00 85.22  ? 176  ILE A CG1   1 
ATOM   1326 C  CG2   . ILE A  1 177 ? 91.904  10.921  29.693  1.00 72.45  ? 176  ILE A CG2   1 
ATOM   1327 C  CD1   . ILE A  1 177 ? 88.156  10.642  29.309  1.00 90.61  ? 176  ILE A CD1   1 
ATOM   1328 N  N     . ASN A  1 178 ? 92.299  13.859  31.156  1.00 61.58  ? 177  ASN A N     1 
ATOM   1329 C  CA    . ASN A  1 178 ? 93.623  14.396  31.354  1.00 58.64  ? 177  ASN A CA    1 
ATOM   1330 C  C     . ASN A  1 178 ? 94.660  13.354  30.947  1.00 60.68  ? 177  ASN A C     1 
ATOM   1331 O  O     . ASN A  1 178 ? 94.894  12.370  31.661  1.00 60.94  ? 177  ASN A O     1 
ATOM   1332 C  CB    . ASN A  1 178 ? 93.796  14.780  32.810  1.00 59.74  ? 177  ASN A CB    1 
ATOM   1333 C  CG    . ASN A  1 178 ? 95.137  15.433  33.077  1.00 63.73  ? 177  ASN A CG    1 
ATOM   1334 O  OD1   . ASN A  1 178 ? 95.940  15.596  32.185  1.00 55.33  ? 177  ASN A OD1   1 
ATOM   1335 N  ND2   . ASN A  1 178 ? 95.376  15.801  34.317  1.00 59.02  ? 177  ASN A ND2   1 
ATOM   1336 N  N     . ALA A  1 179 ? 95.246  13.547  29.766  1.00 60.23  ? 178  ALA A N     1 
ATOM   1337 C  CA    . ALA A  1 179 ? 96.191  12.589  29.232  1.00 56.85  ? 178  ALA A CA    1 
ATOM   1338 C  C     . ALA A  1 179 ? 97.617  12.985  29.601  1.00 58.66  ? 178  ALA A C     1 
ATOM   1339 O  O     . ALA A  1 179 ? 98.570  12.488  29.020  1.00 61.35  ? 178  ALA A O     1 
ATOM   1340 C  CB    . ALA A  1 179 ? 96.026  12.463  27.734  1.00 53.83  ? 178  ALA A CB    1 
ATOM   1341 N  N     . GLU A  1 180 ? 97.774  13.879  30.566  1.00 59.95  ? 179  GLU A N     1 
ATOM   1342 C  CA    . GLU A  1 180 ? 99.098  14.239  31.073  1.00 62.16  ? 179  GLU A CA    1 
ATOM   1343 C  C     . GLU A  1 180 ? 99.620  13.205  32.081  1.00 59.78  ? 179  GLU A C     1 
ATOM   1344 O  O     . GLU A  1 180 ? 100.810 13.204  32.399  1.00 59.83  ? 179  GLU A O     1 
ATOM   1345 C  CB    . GLU A  1 180 ? 99.052  15.598  31.781  1.00 68.96  ? 179  GLU A CB    1 
ATOM   1346 C  CG    . GLU A  1 180 ? 98.579  16.742  30.908  1.00 73.64  ? 179  GLU A CG    1 
ATOM   1347 C  CD    . GLU A  1 180 ? 99.688  17.630  30.433  1.00 73.18  ? 179  GLU A CD    1 
ATOM   1348 O  OE1   . GLU A  1 180 ? 100.871 17.264  30.599  1.00 78.58  ? 179  GLU A OE1   1 
ATOM   1349 O  OE2   . GLU A  1 180 ? 99.364  18.698  29.886  1.00 78.63  ? 179  GLU A OE2   1 
ATOM   1350 N  N     . GLY A  1 181 ? 98.724  12.351  32.583  1.00 61.23  ? 180  GLY A N     1 
ATOM   1351 C  CA    . GLY A  1 181 ? 99.050  11.358  33.621  1.00 56.51  ? 180  GLY A CA    1 
ATOM   1352 C  C     . GLY A  1 181 ? 99.762  10.150  33.032  1.00 59.72  ? 180  GLY A C     1 
ATOM   1353 O  O     . GLY A  1 181 ? 100.096 10.105  31.822  1.00 56.79  ? 180  GLY A O     1 
ATOM   1354 N  N     . THR A  1 182 ? 100.001 9.168   33.882  1.00 54.40  ? 181  THR A N     1 
ATOM   1355 C  CA    . THR A  1 182 ? 100.609 7.926   33.435  1.00 57.46  ? 181  THR A CA    1 
ATOM   1356 C  C     . THR A  1 182 ? 99.644  7.246   32.480  1.00 57.52  ? 181  THR A C     1 
ATOM   1357 O  O     . THR A  1 182 ? 98.441  7.475   32.568  1.00 58.04  ? 181  THR A O     1 
ATOM   1358 C  CB    . THR A  1 182 ? 100.796 6.970   34.589  1.00 59.72  ? 181  THR A CB    1 
ATOM   1359 O  OG1   . THR A  1 182 ? 99.514  6.681   35.151  1.00 60.11  ? 181  THR A OG1   1 
ATOM   1360 C  CG2   . THR A  1 182 ? 101.704 7.584   35.666  1.00 58.81  ? 181  THR A CG2   1 
ATOM   1361 N  N     . PRO A  1 183 ? 100.152 6.387   31.584  1.00 57.12  ? 182  PRO A N     1 
ATOM   1362 C  CA    . PRO A  1 183 ? 99.210  5.680   30.719  1.00 60.22  ? 182  PRO A CA    1 
ATOM   1363 C  C     . PRO A  1 183 ? 98.194  4.840   31.488  1.00 59.28  ? 182  PRO A C     1 
ATOM   1364 O  O     . PRO A  1 183 ? 97.059  4.680   31.037  1.00 62.90  ? 182  PRO A O     1 
ATOM   1365 C  CB    . PRO A  1 183 ? 100.117 4.801   29.825  1.00 61.11  ? 182  PRO A CB    1 
ATOM   1366 C  CG    . PRO A  1 183 ? 101.467 5.366   29.954  1.00 63.96  ? 182  PRO A CG    1 
ATOM   1367 C  CD    . PRO A  1 183 ? 101.551 6.029   31.297  1.00 59.73  ? 182  PRO A CD    1 
ATOM   1368 N  N     . GLU A  1 184 ? 98.592  4.321   32.636  1.00 59.85  ? 183  GLU A N     1 
ATOM   1369 C  CA    . GLU A  1 184 ? 97.700  3.472   33.431  1.00 63.50  ? 183  GLU A CA    1 
ATOM   1370 C  C     . GLU A  1 184 ? 96.602  4.303   34.105  1.00 61.82  ? 183  GLU A C     1 
ATOM   1371 O  O     . GLU A  1 184 ? 95.457  3.842   34.171  1.00 59.02  ? 183  GLU A O     1 
ATOM   1372 C  CB    . GLU A  1 184 ? 98.466  2.566   34.420  1.00 60.13  ? 183  GLU A CB    1 
ATOM   1373 C  CG    . GLU A  1 184 ? 99.837  3.047   34.876  1.00 80.40  ? 183  GLU A CG    1 
ATOM   1374 C  CD    . GLU A  1 184 ? 100.959 2.851   33.842  1.00 80.48  ? 183  GLU A CD    1 
ATOM   1375 O  OE1   . GLU A  1 184 ? 101.780 3.772   33.690  1.00 88.64  ? 183  GLU A OE1   1 
ATOM   1376 O  OE2   . GLU A  1 184 ? 101.034 1.793   33.193  1.00 82.35  ? 183  GLU A OE2   1 
ATOM   1377 N  N     . ASP A  1 185 ? 96.926  5.526   34.551  1.00 56.49  ? 184  ASP A N     1 
ATOM   1378 C  CA    . ASP A  1 185 ? 95.892  6.458   35.020  1.00 58.81  ? 184  ASP A CA    1 
ATOM   1379 C  C     . ASP A  1 185 ? 94.959  6.948   33.921  1.00 57.93  ? 184  ASP A C     1 
ATOM   1380 O  O     . ASP A  1 185 ? 93.775  7.150   34.156  1.00 56.63  ? 184  ASP A O     1 
ATOM   1381 C  CB    . ASP A  1 185 ? 96.460  7.708   35.667  1.00 59.48  ? 184  ASP A CB    1 
ATOM   1382 C  CG    . ASP A  1 185 ? 95.348  8.630   36.203  1.00 72.53  ? 184  ASP A CG    1 
ATOM   1383 O  OD1   . ASP A  1 185 ? 94.683  8.293   37.225  1.00 69.85  ? 184  ASP A OD1   1 
ATOM   1384 O  OD2   . ASP A  1 185 ? 95.113  9.683   35.584  1.00 75.67  ? 184  ASP A OD2   1 
ATOM   1385 N  N     . VAL A  1 186 ? 95.506  7.195   32.742  1.00 57.44  ? 185  VAL A N     1 
ATOM   1386 C  CA    . VAL A  1 186 ? 94.690  7.581   31.604  1.00 57.09  ? 185  VAL A CA    1 
ATOM   1387 C  C     . VAL A  1 186 ? 93.707  6.442   31.281  1.00 55.76  ? 185  VAL A C     1 
ATOM   1388 O  O     . VAL A  1 186 ? 92.529  6.688   31.056  1.00 58.23  ? 185  VAL A O     1 
ATOM   1389 C  CB    . VAL A  1 186 ? 95.572  7.943   30.404  1.00 58.56  ? 185  VAL A CB    1 
ATOM   1390 C  CG1   . VAL A  1 186 ? 94.747  8.148   29.141  1.00 54.02  ? 185  VAL A CG1   1 
ATOM   1391 C  CG2   . VAL A  1 186 ? 96.379  9.192   30.729  1.00 54.97  ? 185  VAL A CG2   1 
ATOM   1392 N  N     . PHE A  1 187 ? 94.181  5.198   31.288  1.00 55.82  ? 186  PHE A N     1 
ATOM   1393 C  CA    . PHE A  1 187 ? 93.300  4.045   31.042  1.00 52.58  ? 186  PHE A CA    1 
ATOM   1394 C  C     . PHE A  1 187 ? 92.173  3.977   32.056  1.00 53.45  ? 186  PHE A C     1 
ATOM   1395 O  O     . PHE A  1 187 ? 91.035  3.737   31.708  1.00 58.36  ? 186  PHE A O     1 
ATOM   1396 C  CB    . PHE A  1 187 ? 94.085  2.712   31.061  1.00 58.02  ? 186  PHE A CB    1 
ATOM   1397 C  CG    . PHE A  1 187 ? 93.303  1.536   30.484  1.00 52.15  ? 186  PHE A CG    1 
ATOM   1398 C  CD1   . PHE A  1 187 ? 92.752  1.617   29.201  1.00 58.91  ? 186  PHE A CD1   1 
ATOM   1399 C  CD2   . PHE A  1 187 ? 93.124  0.370   31.205  1.00 58.19  ? 186  PHE A CD2   1 
ATOM   1400 C  CE1   . PHE A  1 187 ? 92.031  0.558   28.672  1.00 58.58  ? 186  PHE A CE1   1 
ATOM   1401 C  CE2   . PHE A  1 187 ? 92.413  -0.697  30.659  1.00 52.58  ? 186  PHE A CE2   1 
ATOM   1402 C  CZ    . PHE A  1 187 ? 91.862  -0.590  29.408  1.00 57.32  ? 186  PHE A CZ    1 
ATOM   1403 N  N     . LEU A  1 188 ? 92.508  4.191   33.320  1.00 55.45  ? 187  LEU A N     1 
ATOM   1404 C  CA    . LEU A  1 188 ? 91.550  4.163   34.408  1.00 56.43  ? 187  LEU A CA    1 
ATOM   1405 C  C     . LEU A  1 188 ? 90.410  5.153   34.153  1.00 58.16  ? 187  LEU A C     1 
ATOM   1406 O  O     . LEU A  1 188 ? 89.236  4.793   34.292  1.00 58.54  ? 187  LEU A O     1 
ATOM   1407 C  CB    . LEU A  1 188 ? 92.286  4.442   35.738  1.00 53.94  ? 187  LEU A CB    1 
ATOM   1408 C  CG    . LEU A  1 188 ? 91.558  4.540   37.082  1.00 61.24  ? 187  LEU A CG    1 
ATOM   1409 C  CD1   . LEU A  1 188 ? 92.569  4.491   38.225  1.00 55.59  ? 187  LEU A CD1   1 
ATOM   1410 C  CD2   . LEU A  1 188 ? 90.739  5.798   37.203  1.00 58.95  ? 187  LEU A CD2   1 
ATOM   1411 N  N     . GLN A  1 189 ? 90.767  6.389   33.798  1.00 61.76  ? 188  GLN A N     1 
ATOM   1412 C  CA    . GLN A  1 189 ? 89.803  7.468   33.492  1.00 61.62  ? 188  GLN A CA    1 
ATOM   1413 C  C     . GLN A  1 189 ? 88.957  7.179   32.246  1.00 59.44  ? 188  GLN A C     1 
ATOM   1414 O  O     . GLN A  1 189 ? 87.793  7.520   32.178  1.00 56.97  ? 188  GLN A O     1 
ATOM   1415 C  CB    . GLN A  1 189 ? 90.543  8.768   33.227  1.00 61.20  ? 188  GLN A CB    1 
ATOM   1416 C  CG    . GLN A  1 189 ? 91.287  9.454   34.385  1.00 61.70  ? 188  GLN A CG    1 
ATOM   1417 C  CD    . GLN A  1 189 ? 92.036  10.697  33.849  1.00 71.75  ? 188  GLN A CD    1 
ATOM   1418 O  OE1   . GLN A  1 189 ? 91.416  11.730  33.532  1.00 76.90  ? 188  GLN A OE1   1 
ATOM   1419 N  NE2   . GLN A  1 189 ? 93.354  10.575  33.682  1.00 70.08  ? 188  GLN A NE2   1 
ATOM   1420 N  N     . LEU A  1 190 ? 89.576  6.603   31.234  1.00 55.89  ? 189  LEU A N     1 
ATOM   1421 C  CA    . LEU A  1 190 ? 88.855  6.197   30.044  1.00 61.15  ? 189  LEU A CA    1 
ATOM   1422 C  C     . LEU A  1 190 ? 87.763  5.175   30.363  1.00 59.58  ? 189  LEU A C     1 
ATOM   1423 O  O     . LEU A  1 190 ? 86.625  5.317   29.903  1.00 58.76  ? 189  LEU A O     1 
ATOM   1424 C  CB    . LEU A  1 190 ? 89.816  5.636   28.999  1.00 62.05  ? 189  LEU A CB    1 
ATOM   1425 C  CG    . LEU A  1 190 ? 90.675  6.648   28.233  1.00 59.52  ? 189  LEU A CG    1 
ATOM   1426 C  CD1   . LEU A  1 190 ? 91.769  5.965   27.459  1.00 58.37  ? 189  LEU A CD1   1 
ATOM   1427 C  CD2   . LEU A  1 190 ? 89.844  7.443   27.276  1.00 63.35  ? 189  LEU A CD2   1 
ATOM   1428 N  N     . CYS A  1 191 ? 88.128  4.156   31.151  1.00 59.62  ? 190  CYS A N     1 
ATOM   1429 C  CA    . CYS A  1 191 ? 87.210  3.103   31.557  1.00 57.12  ? 190  CYS A CA    1 
ATOM   1430 C  C     . CYS A  1 191 ? 86.087  3.627   32.441  1.00 56.27  ? 190  CYS A C     1 
ATOM   1431 O  O     . CYS A  1 191 ? 84.941  3.210   32.325  1.00 58.37  ? 190  CYS A O     1 
ATOM   1432 C  CB    . CYS A  1 191 ? 87.968  1.990   32.279  1.00 56.52  ? 190  CYS A CB    1 
ATOM   1433 S  SG    . CYS A  1 191 ? 89.071  1.078   31.189  1.00 55.64  ? 190  CYS A SG    1 
ATOM   1434 N  N     . THR A  1 192 ? 86.417  4.541   33.331  1.00 54.29  ? 191  THR A N     1 
ATOM   1435 C  CA    . THR A  1 192 ? 85.405  5.252   34.100  1.00 59.32  ? 191  THR A CA    1 
ATOM   1436 C  C     . THR A  1 192 ? 84.370  5.977   33.208  1.00 57.60  ? 191  THR A C     1 
ATOM   1437 O  O     . THR A  1 192 ? 83.169  5.849   33.409  1.00 62.69  ? 191  THR A O     1 
ATOM   1438 C  CB    . THR A  1 192 ? 86.078  6.250   35.044  1.00 59.92  ? 191  THR A CB    1 
ATOM   1439 O  OG1   . THR A  1 192 ? 86.944  5.527   35.932  1.00 56.65  ? 191  THR A OG1   1 
ATOM   1440 C  CG2   . THR A  1 192 ? 85.036  7.014   35.862  1.00 59.40  ? 191  THR A CG2   1 
ATOM   1441 N  N     . ALA A  1 193 ? 84.855  6.714   32.223  1.00 57.64  ? 192  ALA A N     1 
ATOM   1442 C  CA    . ALA A  1 193 ? 84.009  7.441   31.284  1.00 58.38  ? 192  ALA A CA    1 
ATOM   1443 C  C     . ALA A  1 193 ? 83.070  6.500   30.550  1.00 58.07  ? 192  ALA A C     1 
ATOM   1444 O  O     . ALA A  1 193 ? 81.866  6.717   30.509  1.00 61.27  ? 192  ALA A O     1 
ATOM   1445 C  CB    . ALA A  1 193 ? 84.872  8.175   30.282  1.00 58.06  ? 192  ALA A CB    1 
ATOM   1446 N  N     . ILE A  1 194 ? 83.644  5.452   29.978  1.00 57.37  ? 193  ILE A N     1 
ATOM   1447 C  CA    . ILE A  1 194 ? 82.895  4.476   29.182  1.00 57.04  ? 193  ILE A CA    1 
ATOM   1448 C  C     . ILE A  1 194 ? 81.849  3.701   29.995  1.00 60.14  ? 193  ILE A C     1 
ATOM   1449 O  O     . ILE A  1 194 ? 80.716  3.512   29.516  1.00 59.30  ? 193  ILE A O     1 
ATOM   1450 C  CB    . ILE A  1 194 ? 83.859  3.502   28.506  1.00 54.36  ? 193  ILE A CB    1 
ATOM   1451 C  CG1   . ILE A  1 194 ? 84.646  4.237   27.401  1.00 61.84  ? 193  ILE A CG1   1 
ATOM   1452 C  CG2   . ILE A  1 194 ? 83.119  2.290   27.943  1.00 50.19  ? 193  ILE A CG2   1 
ATOM   1453 C  CD1   . ILE A  1 194 ? 85.862  3.474   26.921  1.00 64.74  ? 193  ILE A CD1   1 
ATOM   1454 N  N     . ASP A  1 195 ? 82.238  3.259   31.200  1.00 58.12  ? 194  ASP A N     1 
ATOM   1455 C  CA    . ASP A  1 195 ? 81.344  2.570   32.124  1.00 55.51  ? 194  ASP A CA    1 
ATOM   1456 C  C     . ASP A  1 195 ? 80.201  3.474   32.557  1.00 57.12  ? 194  ASP A C     1 
ATOM   1457 O  O     . ASP A  1 195 ? 79.104  2.996   32.808  1.00 59.68  ? 194  ASP A O     1 
ATOM   1458 C  CB    . ASP A  1 195 ? 82.092  2.072   33.392  1.00 50.73  ? 194  ASP A CB    1 
ATOM   1459 C  CG    . ASP A  1 195 ? 83.152  0.981   33.093  1.00 55.32  ? 194  ASP A CG    1 
ATOM   1460 O  OD1   . ASP A  1 195 ? 83.228  0.531   31.936  1.00 59.10  ? 194  ASP A OD1   1 
ATOM   1461 O  OD2   . ASP A  1 195 ? 83.940  0.598   34.008  1.00 57.58  ? 194  ASP A OD2   1 
ATOM   1462 N  N     . SER A  1 196 ? 80.453  4.771   32.671  1.00 54.37  ? 195  SER A N     1 
ATOM   1463 C  CA    . SER A  1 196 ? 79.406  5.695   33.100  1.00 60.93  ? 195  SER A CA    1 
ATOM   1464 C  C     . SER A  1 196 ? 78.336  5.861   32.032  1.00 59.47  ? 195  SER A C     1 
ATOM   1465 O  O     . SER A  1 196 ? 77.204  6.185   32.344  1.00 61.15  ? 195  SER A O     1 
ATOM   1466 C  CB    . SER A  1 196 ? 79.987  7.080   33.479  1.00 60.15  ? 195  SER A CB    1 
ATOM   1467 O  OG    . SER A  1 196 ? 80.393  7.805   32.305  1.00 70.65  ? 195  SER A OG    1 
ATOM   1468 N  N     . ILE A  1 197 ? 78.702  5.662   30.767  1.00 61.40  ? 196  ILE A N     1 
ATOM   1469 C  CA    . ILE A  1 197 ? 77.772  5.822   29.666  1.00 62.10  ? 196  ILE A CA    1 
ATOM   1470 C  C     . ILE A  1 197 ? 77.020  4.532   29.374  1.00 59.87  ? 196  ILE A C     1 
ATOM   1471 O  O     . ILE A  1 197 ? 75.811  4.542   29.169  1.00 57.75  ? 196  ILE A O     1 
ATOM   1472 C  CB    . ILE A  1 197 ? 78.503  6.302   28.356  1.00 66.03  ? 196  ILE A CB    1 
ATOM   1473 C  CG1   . ILE A  1 197 ? 79.116  7.699   28.545  1.00 67.31  ? 196  ILE A CG1   1 
ATOM   1474 C  CG2   . ILE A  1 197 ? 77.547  6.290   27.153  1.00 66.55  ? 196  ILE A CG2   1 
ATOM   1475 C  CD1   . ILE A  1 197 ? 78.145  8.776   28.905  1.00 65.42  ? 196  ILE A CD1   1 
ATOM   1476 N  N     . PHE A  1 198 ? 77.726  3.415   29.334  1.00 59.15  ? 197  PHE A N     1 
ATOM   1477 C  CA    . PHE A  1 198 ? 77.087  2.165   28.909  1.00 59.84  ? 197  PHE A CA    1 
ATOM   1478 C  C     . PHE A  1 198 ? 76.556  1.440   30.107  1.00 60.86  ? 197  PHE A C     1 
ATOM   1479 O  O     . PHE A  1 198 ? 77.007  0.377   30.443  1.00 59.41  ? 197  PHE A O     1 
ATOM   1480 C  CB    . PHE A  1 198 ? 77.998  1.395   27.960  1.00 58.52  ? 197  PHE A CB    1 
ATOM   1481 C  CG    . PHE A  1 198 ? 78.240  2.172   26.701  1.00 54.53  ? 197  PHE A CG    1 
ATOM   1482 C  CD1   . PHE A  1 198 ? 77.197  2.374   25.798  1.00 54.25  ? 197  PHE A CD1   1 
ATOM   1483 C  CD2   . PHE A  1 198 ? 79.430  2.870   26.511  1.00 54.87  ? 197  PHE A CD2   1 
ATOM   1484 C  CE1   . PHE A  1 198 ? 77.378  3.151   24.664  1.00 54.77  ? 197  PHE A CE1   1 
ATOM   1485 C  CE2   . PHE A  1 198 ? 79.616  3.663   25.378  1.00 58.22  ? 197  PHE A CE2   1 
ATOM   1486 C  CZ    . PHE A  1 198 ? 78.592  3.789   24.447  1.00 49.52  ? 197  PHE A CZ    1 
ATOM   1487 N  N     . LEU A  1 199 ? 75.548  2.127   30.672  1.00 74.78  ? 198  LEU A N     1 
ATOM   1488 C  CA    . LEU A  1 199 ? 74.779  1.912   31.913  1.00 78.97  ? 198  LEU A CA    1 
ATOM   1489 C  C     . LEU A  1 199 ? 75.146  2.840   33.067  1.00 83.26  ? 198  LEU A C     1 
ATOM   1490 O  O     . LEU A  1 199 ? 74.324  3.671   33.439  1.00 79.11  ? 198  LEU A O     1 
ATOM   1491 C  CB    . LEU A  1 199 ? 74.783  0.490   32.383  1.00 81.01  ? 198  LEU A CB    1 
ATOM   1492 C  CG    . LEU A  1 199 ? 74.111  -0.484  31.432  1.00 92.49  ? 198  LEU A CG    1 
ATOM   1493 C  CD1   . LEU A  1 199 ? 73.667  -1.605  32.318  1.00 104.80 ? 198  LEU A CD1   1 
ATOM   1494 C  CD2   . LEU A  1 199 ? 72.941  0.094   30.583  1.00 87.43  ? 198  LEU A CD2   1 
ATOM   1495 O  OXT   . LEU A  1 199 ? 76.230  2.796   33.654  1.00 91.74  ? 198  LEU A OXT   1 
ATOM   1496 N  N     . PHE B  1 5   ? 121.740 26.786  -6.761  1.00 69.97  ? 4    PHE B N     1 
ATOM   1497 C  CA    . PHE B  1 5   ? 120.732 25.802  -7.272  1.00 69.38  ? 4    PHE B CA    1 
ATOM   1498 C  C     . PHE B  1 5   ? 119.491 26.523  -7.788  1.00 68.28  ? 4    PHE B C     1 
ATOM   1499 O  O     . PHE B  1 5   ? 118.942 26.154  -8.819  1.00 62.77  ? 4    PHE B O     1 
ATOM   1500 C  CB    . PHE B  1 5   ? 120.357 24.787  -6.193  1.00 68.96  ? 4    PHE B CB    1 
ATOM   1501 N  N     . MET B  1 6   ? 119.071 27.563  -7.072  1.00 72.30  ? 5    MET B N     1 
ATOM   1502 C  CA    . MET B  1 6   ? 118.022 28.471  -7.540  1.00 72.63  ? 5    MET B CA    1 
ATOM   1503 C  C     . MET B  1 6   ? 118.152 28.785  -9.048  1.00 71.42  ? 5    MET B C     1 
ATOM   1504 O  O     . MET B  1 6   ? 117.222 28.586  -9.823  1.00 65.87  ? 5    MET B O     1 
ATOM   1505 C  CB    . MET B  1 6   ? 118.082 29.783  -6.730  1.00 69.36  ? 5    MET B CB    1 
ATOM   1506 N  N     . GLU B  1 7   ? 119.329 29.274  -9.435  1.00 72.53  ? 6    GLU B N     1 
ATOM   1507 C  CA    . GLU B  1 7   ? 119.615 29.734  -10.801 1.00 69.02  ? 6    GLU B CA    1 
ATOM   1508 C  C     . GLU B  1 7   ? 119.898 28.563  -11.735 1.00 67.19  ? 6    GLU B C     1 
ATOM   1509 O  O     . GLU B  1 7   ? 119.572 28.612  -12.925 1.00 64.21  ? 6    GLU B O     1 
ATOM   1510 C  CB    . GLU B  1 7   ? 120.808 30.689  -10.736 1.00 72.55  ? 6    GLU B CB    1 
ATOM   1511 C  CG    . GLU B  1 7   ? 121.284 31.326  -12.032 1.00 70.20  ? 6    GLU B CG    1 
ATOM   1512 C  CD    . GLU B  1 7   ? 122.422 32.328  -11.776 1.00 70.78  ? 6    GLU B CD    1 
ATOM   1513 O  OE1   . GLU B  1 7   ? 123.352 32.416  -12.604 1.00 70.87  ? 6    GLU B OE1   1 
ATOM   1514 O  OE2   . GLU B  1 7   ? 122.398 33.025  -10.735 1.00 70.67  ? 6    GLU B OE2   1 
ATOM   1515 N  N     . ASP B  1 8   ? 120.487 27.507  -11.177 1.00 66.79  ? 7    ASP B N     1 
ATOM   1516 C  CA    . ASP B  1 8   ? 120.760 26.260  -11.906 1.00 66.09  ? 7    ASP B CA    1 
ATOM   1517 C  C     . ASP B  1 8   ? 119.480 25.501  -12.249 1.00 63.68  ? 7    ASP B C     1 
ATOM   1518 O  O     . ASP B  1 8   ? 119.306 25.084  -13.383 1.00 58.33  ? 7    ASP B O     1 
ATOM   1519 C  CB    . ASP B  1 8   ? 121.666 25.341  -11.076 1.00 64.38  ? 7    ASP B CB    1 
ATOM   1520 C  CG    . ASP B  1 8   ? 122.948 26.023  -10.633 1.00 69.27  ? 7    ASP B CG    1 
ATOM   1521 O  OD1   . ASP B  1 8   ? 123.873 26.132  -11.462 1.00 83.43  ? 7    ASP B OD1   1 
ATOM   1522 O  OD2   . ASP B  1 8   ? 123.032 26.449  -9.456  1.00 52.10  ? 7    ASP B OD2   1 
ATOM   1523 N  N     . LEU B  1 9   ? 118.615 25.319  -11.243 1.00 67.20  ? 8    LEU B N     1 
ATOM   1524 C  CA    . LEU B  1 9   ? 117.308 24.609  -11.370 1.00 68.85  ? 8    LEU B CA    1 
ATOM   1525 C  C     . LEU B  1 9   ? 116.366 25.304  -12.316 1.00 65.58  ? 8    LEU B C     1 
ATOM   1526 O  O     . LEU B  1 9   ? 115.527 24.666  -12.952 1.00 67.19  ? 8    LEU B O     1 
ATOM   1527 C  CB    . LEU B  1 9   ? 116.562 24.551  -10.019 1.00 72.89  ? 8    LEU B CB    1 
ATOM   1528 C  CG    . LEU B  1 9   ? 116.883 23.480  -8.975  1.00 72.75  ? 8    LEU B CG    1 
ATOM   1529 C  CD1   . LEU B  1 9   ? 116.343 23.865  -7.590  1.00 71.04  ? 8    LEU B CD1   1 
ATOM   1530 C  CD2   . LEU B  1 9   ? 116.319 22.163  -9.449  1.00 76.27  ? 8    LEU B CD2   1 
ATOM   1531 N  N     . ARG B  1 10  ? 116.475 26.627  -12.345 1.00 67.77  ? 9    ARG B N     1 
ATOM   1532 C  CA    . ARG B  1 10  ? 115.619 27.461  -13.163 1.00 68.79  ? 9    ARG B CA    1 
ATOM   1533 C  C     . ARG B  1 10  ? 116.021 27.340  -14.630 1.00 69.24  ? 9    ARG B C     1 
ATOM   1534 O  O     . ARG B  1 10  ? 115.160 27.117  -15.484 1.00 72.86  ? 9    ARG B O     1 
ATOM   1535 C  CB    . ARG B  1 10  ? 115.679 28.920  -12.700 1.00 68.89  ? 9    ARG B CB    1 
ATOM   1536 C  CG    . ARG B  1 10  ? 114.375 29.628  -12.943 1.00 76.09  ? 9    ARG B CG    1 
ATOM   1537 C  CD    . ARG B  1 10  ? 114.286 30.994  -12.285 1.00 73.32  ? 9    ARG B CD    1 
ATOM   1538 N  NE    . ARG B  1 10  ? 113.139 31.069  -11.381 1.00 76.95  ? 9    ARG B NE    1 
ATOM   1539 C  CZ    . ARG B  1 10  ? 111.857 30.918  -11.736 1.00 80.40  ? 9    ARG B CZ    1 
ATOM   1540 N  NH1   . ARG B  1 10  ? 110.924 30.995  -10.800 1.00 72.05  ? 9    ARG B NH1   1 
ATOM   1541 N  NH2   . ARG B  1 10  ? 111.490 30.682  -12.998 1.00 75.68  ? 9    ARG B NH2   1 
ATOM   1542 N  N     . LYS B  1 11  ? 117.327 27.439  -14.896 1.00 66.98  ? 10   LYS B N     1 
ATOM   1543 C  CA    . LYS B  1 11  ? 117.872 27.420  -16.251 1.00 66.96  ? 10   LYS B CA    1 
ATOM   1544 C  C     . LYS B  1 11  ? 118.193 25.989  -16.690 1.00 68.69  ? 10   LYS B C     1 
ATOM   1545 O  O     . LYS B  1 11  ? 119.315 25.696  -17.112 1.00 69.22  ? 10   LYS B O     1 
ATOM   1546 C  CB    . LYS B  1 11  ? 119.122 28.304  -16.315 1.00 65.85  ? 10   LYS B CB    1 
ATOM   1547 N  N     . CYS B  1 12  ? 117.180 25.120  -16.617 1.00 70.50  ? 11   CYS B N     1 
ATOM   1548 C  CA    . CYS B  1 12  ? 117.330 23.679  -16.841 1.00 68.37  ? 11   CYS B CA    1 
ATOM   1549 C  C     . CYS B  1 12  ? 116.019 23.007  -17.367 1.00 61.93  ? 11   CYS B C     1 
ATOM   1550 O  O     . CYS B  1 12  ? 114.931 23.540  -17.145 1.00 58.66  ? 11   CYS B O     1 
ATOM   1551 C  CB    . CYS B  1 12  ? 117.786 23.057  -15.522 1.00 72.54  ? 11   CYS B CB    1 
ATOM   1552 S  SG    . CYS B  1 12  ? 117.384 21.333  -15.341 1.00 85.54  ? 11   CYS B SG    1 
ATOM   1553 N  N     . LYS B  1 13  ? 116.132 21.862  -18.062 1.00 56.23  ? 12   LYS B N     1 
ATOM   1554 C  CA    . LYS B  1 13  ? 114.969 21.208  -18.719 1.00 57.88  ? 12   LYS B CA    1 
ATOM   1555 C  C     . LYS B  1 13  ? 113.921 20.621  -17.750 1.00 56.40  ? 12   LYS B C     1 
ATOM   1556 O  O     . LYS B  1 13  ? 114.209 19.650  -17.044 1.00 50.18  ? 12   LYS B O     1 
ATOM   1557 C  CB    . LYS B  1 13  ? 115.396 20.072  -19.667 1.00 60.45  ? 12   LYS B CB    1 
ATOM   1558 C  CG    . LYS B  1 13  ? 116.040 20.500  -20.992 1.00 70.01  ? 12   LYS B CG    1 
ATOM   1559 C  CD    . LYS B  1 13  ? 116.072 19.330  -22.009 1.00 67.04  ? 12   LYS B CD    1 
ATOM   1560 C  CE    . LYS B  1 13  ? 117.174 19.495  -23.077 1.00 63.44  ? 12   LYS B CE    1 
ATOM   1561 N  N     . ILE B  1 14  ? 112.711 21.198  -17.761 1.00 52.23  ? 13   ILE B N     1 
ATOM   1562 C  CA    . ILE B  1 14  ? 111.579 20.728  -16.955 1.00 51.72  ? 13   ILE B CA    1 
ATOM   1563 C  C     . ILE B  1 14  ? 110.355 20.479  -17.845 1.00 50.19  ? 13   ILE B C     1 
ATOM   1564 O  O     . ILE B  1 14  ? 109.836 21.396  -18.496 1.00 46.99  ? 13   ILE B O     1 
ATOM   1565 C  CB    . ILE B  1 14  ? 111.179 21.741  -15.829 1.00 44.94  ? 13   ILE B CB    1 
ATOM   1566 C  CG1   . ILE B  1 14  ? 112.384 22.098  -14.957 1.00 43.22  ? 13   ILE B CG1   1 
ATOM   1567 C  CG2   . ILE B  1 14  ? 110.070 21.148  -14.964 1.00 44.62  ? 13   ILE B CG2   1 
ATOM   1568 C  CD1   . ILE B  1 14  ? 112.142 23.248  -14.025 1.00 50.61  ? 13   ILE B CD1   1 
ATOM   1569 N  N     . ILE B  1 15  ? 109.899 19.234  -17.839 1.00 52.44  ? 14   ILE B N     1 
ATOM   1570 C  CA    . ILE B  1 15  ? 108.697 18.819  -18.567 1.00 55.02  ? 14   ILE B CA    1 
ATOM   1571 C  C     . ILE B  1 15  ? 107.662 18.235  -17.603 1.00 52.39  ? 14   ILE B C     1 
ATOM   1572 O  O     . ILE B  1 15  ? 107.977 17.332  -16.846 1.00 50.38  ? 14   ILE B O     1 
ATOM   1573 C  CB    . ILE B  1 15  ? 109.035 17.726  -19.619 1.00 62.09  ? 14   ILE B CB    1 
ATOM   1574 C  CG1   . ILE B  1 15  ? 110.185 18.196  -20.527 1.00 50.75  ? 14   ILE B CG1   1 
ATOM   1575 C  CG2   . ILE B  1 15  ? 107.787 17.346  -20.440 1.00 50.83  ? 14   ILE B CG2   1 
ATOM   1576 C  CD1   . ILE B  1 15  ? 110.766 17.101  -21.356 1.00 76.14  ? 14   ILE B CD1   1 
ATOM   1577 N  N     . PHE B  1 16  ? 106.445 18.775  -17.623 1.00 53.46  ? 15   PHE B N     1 
ATOM   1578 C  CA    . PHE B  1 16  ? 105.318 18.145  -16.949 1.00 52.77  ? 15   PHE B CA    1 
ATOM   1579 C  C     . PHE B  1 16  ? 104.590 17.260  -17.951 1.00 52.79  ? 15   PHE B C     1 
ATOM   1580 O  O     . PHE B  1 16  ? 104.413 17.611  -19.124 1.00 48.58  ? 15   PHE B O     1 
ATOM   1581 C  CB    . PHE B  1 16  ? 104.300 19.151  -16.403 1.00 49.23  ? 15   PHE B CB    1 
ATOM   1582 C  CG    . PHE B  1 16  ? 104.824 20.096  -15.377 1.00 44.60  ? 15   PHE B CG    1 
ATOM   1583 C  CD1   . PHE B  1 16  ? 104.071 21.230  -15.049 1.00 53.79  ? 15   PHE B CD1   1 
ATOM   1584 C  CD2   . PHE B  1 16  ? 106.047 19.904  -14.744 1.00 50.45  ? 15   PHE B CD2   1 
ATOM   1585 C  CE1   . PHE B  1 16  ? 104.520 22.127  -14.103 1.00 46.09  ? 15   PHE B CE1   1 
ATOM   1586 C  CE2   . PHE B  1 16  ? 106.499 20.800  -13.778 1.00 40.85  ? 15   PHE B CE2   1 
ATOM   1587 C  CZ    . PHE B  1 16  ? 105.741 21.916  -13.466 1.00 45.72  ? 15   PHE B CZ    1 
ATOM   1588 N  N     . ILE B  1 17  ? 104.166 16.102  -17.475 1.00 54.26  ? 16   ILE B N     1 
ATOM   1589 C  CA    . ILE B  1 17  ? 103.355 15.209  -18.283 1.00 56.72  ? 16   ILE B CA    1 
ATOM   1590 C  C     . ILE B  1 17  ? 102.128 14.763  -17.482 1.00 56.23  ? 16   ILE B C     1 
ATOM   1591 O  O     . ILE B  1 17  ? 102.235 14.299  -16.343 1.00 55.48  ? 16   ILE B O     1 
ATOM   1592 C  CB    . ILE B  1 17  ? 104.168 14.033  -18.872 1.00 55.42  ? 16   ILE B CB    1 
ATOM   1593 C  CG1   . ILE B  1 17  ? 103.261 13.203  -19.799 1.00 63.44  ? 16   ILE B CG1   1 
ATOM   1594 C  CG2   . ILE B  1 17  ? 104.812 13.201  -17.786 1.00 53.53  ? 16   ILE B CG2   1 
ATOM   1595 C  CD1   . ILE B  1 17  ? 104.032 12.350  -20.781 1.00 74.08  ? 16   ILE B CD1   1 
ATOM   1596 N  N     . ILE B  1 18  ? 100.965 14.973  -18.086 1.00 54.61  ? 17   ILE B N     1 
ATOM   1597 C  CA    . ILE B  1 18  ? 99.712  14.617  -17.483 1.00 58.78  ? 17   ILE B CA    1 
ATOM   1598 C  C     . ILE B  1 18  ? 98.860  13.748  -18.412 1.00 57.70  ? 17   ILE B C     1 
ATOM   1599 O  O     . ILE B  1 18  ? 99.033  13.702  -19.629 1.00 54.04  ? 17   ILE B O     1 
ATOM   1600 C  CB    . ILE B  1 18  ? 98.953  15.860  -16.947 1.00 60.31  ? 17   ILE B CB    1 
ATOM   1601 C  CG1   . ILE B  1 18  ? 98.529  16.783  -18.081 1.00 66.15  ? 17   ILE B CG1   1 
ATOM   1602 C  CG2   . ILE B  1 18  ? 99.837  16.596  -15.902 1.00 58.69  ? 17   ILE B CG2   1 
ATOM   1603 C  CD1   . ILE B  1 18  ? 97.534  17.799  -17.673 1.00 72.37  ? 17   ILE B CD1   1 
ATOM   1604 N  N     . GLY B  1 19  ? 98.004  12.966  -17.791 1.00 54.89  ? 18   GLY B N     1 
ATOM   1605 C  CA    . GLY B  1 19  ? 97.186  12.056  -18.536 1.00 59.94  ? 18   GLY B CA    1 
ATOM   1606 C  C     . GLY B  1 19  ? 96.395  11.257  -17.538 1.00 54.05  ? 18   GLY B C     1 
ATOM   1607 O  O     . GLY B  1 19  ? 96.862  11.031  -16.445 1.00 53.97  ? 18   GLY B O     1 
ATOM   1608 N  N     . GLY B  1 20  ? 95.208  10.816  -17.933 1.00 55.95  ? 19   GLY B N     1 
ATOM   1609 C  CA    . GLY B  1 20  ? 94.341  10.080  -17.020 1.00 54.66  ? 19   GLY B CA    1 
ATOM   1610 C  C     . GLY B  1 20  ? 94.775  8.627   -16.878 1.00 56.84  ? 19   GLY B C     1 
ATOM   1611 O  O     . GLY B  1 20  ? 95.670  8.123   -17.615 1.00 56.18  ? 19   GLY B O     1 
ATOM   1612 N  N     . PRO B  1 21  ? 94.104  7.916   -15.969 1.00 55.45  ? 20   PRO B N     1 
ATOM   1613 C  CA    . PRO B  1 21  ? 94.402  6.499   -15.832 1.00 56.00  ? 20   PRO B CA    1 
ATOM   1614 C  C     . PRO B  1 21  ? 93.963  5.793   -17.119 1.00 55.47  ? 20   PRO B C     1 
ATOM   1615 O  O     . PRO B  1 21  ? 92.916  6.117   -17.699 1.00 58.58  ? 20   PRO B O     1 
ATOM   1616 C  CB    . PRO B  1 21  ? 93.604  6.064   -14.608 1.00 54.62  ? 20   PRO B CB    1 
ATOM   1617 C  CG    . PRO B  1 21  ? 92.719  7.227   -14.228 1.00 67.25  ? 20   PRO B CG    1 
ATOM   1618 C  CD    . PRO B  1 21  ? 92.953  8.361   -15.164 1.00 58.53  ? 20   PRO B CD    1 
ATOM   1619 N  N     . GLY B  1 22  ? 94.804  4.911   -17.620 1.00 53.56  ? 21   GLY B N     1 
ATOM   1620 C  CA    . GLY B  1 22  ? 94.535  4.273   -18.900 1.00 55.98  ? 21   GLY B CA    1 
ATOM   1621 C  C     . GLY B  1 22  ? 94.988  5.056   -20.128 1.00 58.31  ? 21   GLY B C     1 
ATOM   1622 O  O     . GLY B  1 22  ? 94.736  4.610   -21.238 1.00 57.76  ? 21   GLY B O     1 
ATOM   1623 N  N     . SER B  1 23  ? 95.664  6.197   -19.941 1.00 57.48  ? 22   SER B N     1 
ATOM   1624 C  CA    . SER B  1 23  ? 96.180  7.010   -21.067 1.00 53.58  ? 22   SER B CA    1 
ATOM   1625 C  C     . SER B  1 23  ? 97.492  6.478   -21.678 1.00 56.08  ? 22   SER B C     1 
ATOM   1626 O  O     . SER B  1 23  ? 97.891  6.917   -22.766 1.00 62.03  ? 22   SER B O     1 
ATOM   1627 C  CB    . SER B  1 23  ? 96.341  8.492   -20.653 1.00 50.64  ? 22   SER B CB    1 
ATOM   1628 O  OG    . SER B  1 23  ? 97.267  8.683   -19.570 1.00 56.33  ? 22   SER B OG    1 
ATOM   1629 N  N     . GLY B  1 24  ? 98.152  5.545   -20.994 1.00 55.97  ? 23   GLY B N     1 
ATOM   1630 C  CA    . GLY B  1 24  ? 99.450  5.027   -21.425 1.00 54.82  ? 23   GLY B CA    1 
ATOM   1631 C  C     . GLY B  1 24  ? 100.642 5.841   -20.919 1.00 59.43  ? 23   GLY B C     1 
ATOM   1632 O  O     . GLY B  1 24  ? 101.765 5.635   -21.340 1.00 63.46  ? 23   GLY B O     1 
ATOM   1633 N  N     . LYS B  1 25  ? 100.384 6.769   -20.017 1.00 55.46  ? 24   LYS B N     1 
ATOM   1634 C  CA    . LYS B  1 25  ? 101.404 7.664   -19.484 1.00 59.73  ? 24   LYS B CA    1 
ATOM   1635 C  C     . LYS B  1 25  ? 102.558 6.945   -18.775 1.00 58.01  ? 24   LYS B C     1 
ATOM   1636 O  O     . LYS B  1 25  ? 103.704 7.317   -18.956 1.00 59.70  ? 24   LYS B O     1 
ATOM   1637 C  CB    . LYS B  1 25  ? 100.761 8.687   -18.510 1.00 57.68  ? 24   LYS B CB    1 
ATOM   1638 C  CG    . LYS B  1 25  ? 101.767 9.661   -17.927 1.00 61.50  ? 24   LYS B CG    1 
ATOM   1639 C  CD    . LYS B  1 25  ? 101.160 10.881  -17.296 1.00 62.29  ? 24   LYS B CD    1 
ATOM   1640 C  CE    . LYS B  1 25  ? 100.305 10.566  -16.065 1.00 55.70  ? 24   LYS B CE    1 
ATOM   1641 N  NZ    . LYS B  1 25  ? 100.902 9.610   -15.059 1.00 62.51  ? 24   LYS B NZ    1 
ATOM   1642 N  N     . GLY B  1 26  ? 102.256 5.965   -17.927 1.00 60.63  ? 25   GLY B N     1 
ATOM   1643 C  CA    . GLY B  1 26  ? 103.292 5.224   -17.207 1.00 58.03  ? 25   GLY B CA    1 
ATOM   1644 C  C     . GLY B  1 26  ? 104.341 4.633   -18.143 1.00 59.27  ? 25   GLY B C     1 
ATOM   1645 O  O     . GLY B  1 26  ? 105.535 4.863   -17.990 1.00 61.78  ? 25   GLY B O     1 
ATOM   1646 N  N     . THR B  1 27  ? 103.879 3.891   -19.136 1.00 59.43  ? 26   THR B N     1 
ATOM   1647 C  CA    . THR B  1 27  ? 104.768 3.216   -20.069 1.00 61.53  ? 26   THR B CA    1 
ATOM   1648 C  C     . THR B  1 27  ? 105.537 4.198   -20.923 1.00 57.05  ? 26   THR B C     1 
ATOM   1649 O  O     . THR B  1 27  ? 106.721 3.987   -21.194 1.00 54.64  ? 26   THR B O     1 
ATOM   1650 C  CB    . THR B  1 27  ? 103.988 2.238   -20.949 1.00 59.41  ? 26   THR B CB    1 
ATOM   1651 O  OG1   . THR B  1 27  ? 103.369 1.256   -20.111 1.00 72.68  ? 26   THR B OG1   1 
ATOM   1652 C  CG2   . THR B  1 27  ? 104.905 1.528   -21.940 1.00 66.83  ? 26   THR B CG2   1 
ATOM   1653 N  N     . GLN B  1 28  ? 104.880 5.277   -21.337 1.00 57.11  ? 27   GLN B N     1 
ATOM   1654 C  CA    . GLN B  1 28  ? 105.544 6.282   -22.173 1.00 56.69  ? 27   GLN B CA    1 
ATOM   1655 C  C     . GLN B  1 28  ? 106.633 7.036   -21.402 1.00 55.77  ? 27   GLN B C     1 
ATOM   1656 O  O     . GLN B  1 28  ? 107.698 7.311   -21.939 1.00 56.23  ? 27   GLN B O     1 
ATOM   1657 C  CB    . GLN B  1 28  ? 104.543 7.257   -22.777 1.00 61.65  ? 27   GLN B CB    1 
ATOM   1658 C  CG    . GLN B  1 28  ? 103.588 6.664   -23.834 1.00 54.66  ? 27   GLN B CG    1 
ATOM   1659 C  CD    . GLN B  1 28  ? 104.251 6.144   -25.075 1.00 57.64  ? 27   GLN B CD    1 
ATOM   1660 O  OE1   . GLN B  1 28  ? 105.385 6.507   -25.395 1.00 58.64  ? 27   GLN B OE1   1 
ATOM   1661 N  NE2   . GLN B  1 28  ? 103.537 5.278   -25.802 1.00 54.58  ? 27   GLN B NE2   1 
ATOM   1662 N  N     . CYS B  1 29  ? 106.381 7.351   -20.138 1.00 56.94  ? 28   CYS B N     1 
ATOM   1663 C  CA    . CYS B  1 29  ? 107.436 7.904   -19.282 1.00 58.30  ? 28   CYS B CA    1 
ATOM   1664 C  C     . CYS B  1 29  ? 108.687 7.020   -19.228 1.00 55.80  ? 28   CYS B C     1 
ATOM   1665 O  O     . CYS B  1 29  ? 109.784 7.512   -19.389 1.00 57.84  ? 28   CYS B O     1 
ATOM   1666 C  CB    . CYS B  1 29  ? 106.910 8.173   -17.884 1.00 58.28  ? 28   CYS B CB    1 
ATOM   1667 S  SG    . CYS B  1 29  ? 105.841 9.616   -17.843 1.00 63.43  ? 28   CYS B SG    1 
ATOM   1668 N  N     . GLU B  1 30  ? 108.529 5.719   -19.036 1.00 57.62  ? 29   GLU B N     1 
ATOM   1669 C  CA    . GLU B  1 30  ? 109.677 4.808   -19.099 1.00 58.79  ? 29   GLU B CA    1 
ATOM   1670 C  C     . GLU B  1 30  ? 110.430 4.896   -20.432 1.00 59.12  ? 29   GLU B C     1 
ATOM   1671 O  O     . GLU B  1 30  ? 111.668 4.871   -20.457 1.00 57.04  ? 29   GLU B O     1 
ATOM   1672 C  CB    . GLU B  1 30  ? 109.237 3.384   -18.870 1.00 55.02  ? 29   GLU B CB    1 
ATOM   1673 C  CG    . GLU B  1 30  ? 108.749 3.110   -17.460 1.00 59.73  ? 29   GLU B CG    1 
ATOM   1674 C  CD    . GLU B  1 30  ? 107.870 1.855   -17.349 1.00 79.24  ? 29   GLU B CD    1 
ATOM   1675 O  OE1   . GLU B  1 30  ? 107.745 1.102   -18.343 1.00 94.33  ? 29   GLU B OE1   1 
ATOM   1676 O  OE2   . GLU B  1 30  ? 107.298 1.623   -16.260 1.00 91.42  ? 29   GLU B OE2   1 
ATOM   1677 N  N     . LYS B  1 31  ? 109.687 5.025   -21.531 1.00 54.53  ? 30   LYS B N     1 
ATOM   1678 C  CA    . LYS B  1 31  ? 110.305 5.048   -22.846 1.00 56.43  ? 30   LYS B CA    1 
ATOM   1679 C  C     . LYS B  1 31  ? 111.114 6.330   -23.015 1.00 54.43  ? 30   LYS B C     1 
ATOM   1680 O  O     . LYS B  1 31  ? 112.202 6.326   -23.596 1.00 54.41  ? 30   LYS B O     1 
ATOM   1681 C  CB    . LYS B  1 31  ? 109.238 4.905   -23.942 1.00 54.09  ? 30   LYS B CB    1 
ATOM   1682 C  CG    . LYS B  1 31  ? 108.555 3.536   -23.958 1.00 65.03  ? 30   LYS B CG    1 
ATOM   1683 C  CD    . LYS B  1 31  ? 107.353 3.470   -24.921 1.00 60.69  ? 30   LYS B CD    1 
ATOM   1684 C  CE    . LYS B  1 31  ? 107.796 3.424   -26.348 1.00 70.41  ? 30   LYS B CE    1 
ATOM   1685 N  NZ    . LYS B  1 31  ? 108.661 2.233   -26.662 1.00 66.28  ? 30   LYS B NZ    1 
ATOM   1686 N  N     . LEU B  1 32  ? 110.556 7.414   -22.488 1.00 55.23  ? 31   LEU B N     1 
ATOM   1687 C  CA    . LEU B  1 32  ? 111.173 8.717   -22.515 1.00 56.46  ? 31   LEU B CA    1 
ATOM   1688 C  C     . LEU B  1 32  ? 112.416 8.734   -21.654 1.00 54.87  ? 31   LEU B C     1 
ATOM   1689 O  O     . LEU B  1 32  ? 113.434 9.319   -22.025 1.00 57.41  ? 31   LEU B O     1 
ATOM   1690 C  CB    . LEU B  1 32  ? 110.186 9.782   -22.017 1.00 56.31  ? 31   LEU B CB    1 
ATOM   1691 C  CG    . LEU B  1 32  ? 109.033 10.153  -22.957 1.00 51.92  ? 31   LEU B CG    1 
ATOM   1692 C  CD1   . LEU B  1 32  ? 108.028 11.105  -22.278 1.00 62.07  ? 31   LEU B CD1   1 
ATOM   1693 C  CD2   . LEU B  1 32  ? 109.533 10.727  -24.252 1.00 52.76  ? 31   LEU B CD2   1 
ATOM   1694 N  N     . VAL B  1 33  ? 112.332 8.112   -20.495 1.00 55.58  ? 32   VAL B N     1 
ATOM   1695 C  CA    . VAL B  1 33  ? 113.500 7.991   -19.619 1.00 55.94  ? 32   VAL B CA    1 
ATOM   1696 C  C     . VAL B  1 33  ? 114.600 7.217   -20.349 1.00 58.28  ? 32   VAL B C     1 
ATOM   1697 O  O     . VAL B  1 33  ? 115.754 7.639   -20.394 1.00 58.71  ? 32   VAL B O     1 
ATOM   1698 C  CB    . VAL B  1 33  ? 113.122 7.321   -18.281 1.00 58.05  ? 32   VAL B CB    1 
ATOM   1699 C  CG1   . VAL B  1 33  ? 114.365 6.822   -17.509 1.00 53.56  ? 32   VAL B CG1   1 
ATOM   1700 C  CG2   . VAL B  1 33  ? 112.308 8.289   -17.443 1.00 49.13  ? 32   VAL B CG2   1 
ATOM   1701 N  N     . GLU B  1 34  ? 114.221 6.102   -20.960 1.00 58.62  ? 33   GLU B N     1 
ATOM   1702 C  CA    . GLU B  1 34  ? 115.163 5.300   -21.703 1.00 55.26  ? 33   GLU B CA    1 
ATOM   1703 C  C     . GLU B  1 34  ? 115.785 6.091   -22.853 1.00 57.30  ? 33   GLU B C     1 
ATOM   1704 O  O     . GLU B  1 34  ? 116.981 6.015   -23.055 1.00 56.17  ? 33   GLU B O     1 
ATOM   1705 C  CB    . GLU B  1 34  ? 114.480 4.034   -22.228 1.00 55.85  ? 33   GLU B CB    1 
ATOM   1706 C  CG    . GLU B  1 34  ? 115.372 3.129   -23.121 1.00 68.87  ? 33   GLU B CG    1 
ATOM   1707 C  CD    . GLU B  1 34  ? 116.760 2.883   -22.525 1.00 92.35  ? 33   GLU B CD    1 
ATOM   1708 O  OE1   . GLU B  1 34  ? 117.760 2.956   -23.277 1.00 103.38 ? 33   GLU B OE1   1 
ATOM   1709 O  OE2   . GLU B  1 34  ? 116.852 2.629   -21.302 1.00 104.68 ? 33   GLU B OE2   1 
ATOM   1710 N  N     . LYS B  1 35  ? 114.986 6.840   -23.609 1.00 56.20  ? 34   LYS B N     1 
ATOM   1711 C  CA    . LYS B  1 35  ? 115.520 7.602   -24.734 1.00 53.75  ? 34   LYS B CA    1 
ATOM   1712 C  C     . LYS B  1 35  ? 116.324 8.827   -24.307 1.00 53.63  ? 34   LYS B C     1 
ATOM   1713 O  O     . LYS B  1 35  ? 117.422 9.048   -24.799 1.00 54.44  ? 34   LYS B O     1 
ATOM   1714 C  CB    . LYS B  1 35  ? 114.402 8.054   -25.677 1.00 50.66  ? 34   LYS B CB    1 
ATOM   1715 C  CG    . LYS B  1 35  ? 114.936 8.624   -27.012 1.00 51.46  ? 34   LYS B CG    1 
ATOM   1716 C  CD    . LYS B  1 35  ? 113.813 8.983   -27.980 1.00 60.55  ? 34   LYS B CD    1 
ATOM   1717 C  CE    . LYS B  1 35  ? 114.210 10.093  -28.963 1.00 56.59  ? 34   LYS B CE    1 
ATOM   1718 N  NZ    . LYS B  1 35  ? 115.239 9.683   -29.963 1.00 61.80  ? 34   LYS B NZ    1 
ATOM   1719 N  N     . TYR B  1 36  ? 115.771 9.633   -23.411 1.00 52.52  ? 35   TYR B N     1 
ATOM   1720 C  CA    . TYR B  1 36  ? 116.326 10.952  -23.142 1.00 50.53  ? 35   TYR B CA    1 
ATOM   1721 C  C     . TYR B  1 36  ? 117.205 11.024  -21.897 1.00 51.34  ? 35   TYR B C     1 
ATOM   1722 O  O     . TYR B  1 36  ? 117.977 11.969  -21.743 1.00 54.23  ? 35   TYR B O     1 
ATOM   1723 C  CB    . TYR B  1 36  ? 115.199 11.979  -23.055 1.00 50.40  ? 35   TYR B CB    1 
ATOM   1724 C  CG    . TYR B  1 36  ? 114.532 12.264  -24.395 1.00 46.06  ? 35   TYR B CG    1 
ATOM   1725 C  CD1   . TYR B  1 36  ? 113.261 11.774  -24.677 1.00 46.05  ? 35   TYR B CD1   1 
ATOM   1726 C  CD2   . TYR B  1 36  ? 115.169 13.015  -25.368 1.00 49.29  ? 35   TYR B CD2   1 
ATOM   1727 C  CE1   . TYR B  1 36  ? 112.633 12.044  -25.862 1.00 43.22  ? 35   TYR B CE1   1 
ATOM   1728 C  CE2   . TYR B  1 36  ? 114.547 13.292  -26.572 1.00 52.08  ? 35   TYR B CE2   1 
ATOM   1729 C  CZ    . TYR B  1 36  ? 113.270 12.791  -26.819 1.00 55.71  ? 35   TYR B CZ    1 
ATOM   1730 O  OH    . TYR B  1 36  ? 112.633 13.020  -28.023 1.00 50.27  ? 35   TYR B OH    1 
ATOM   1731 N  N     . GLY B  1 37  ? 117.104 10.027  -21.028 1.00 50.58  ? 36   GLY B N     1 
ATOM   1732 C  CA    . GLY B  1 37  ? 117.838 10.023  -19.780 1.00 53.83  ? 36   GLY B CA    1 
ATOM   1733 C  C     . GLY B  1 37  ? 117.271 10.947  -18.707 1.00 57.23  ? 36   GLY B C     1 
ATOM   1734 O  O     . GLY B  1 37  ? 117.963 11.272  -17.740 1.00 57.13  ? 36   GLY B O     1 
ATOM   1735 N  N     . PHE B  1 38  ? 116.010 11.345  -18.842 1.00 55.80  ? 37   PHE B N     1 
ATOM   1736 C  CA    . PHE B  1 38  ? 115.411 12.247  -17.872 1.00 53.88  ? 37   PHE B CA    1 
ATOM   1737 C  C     . PHE B  1 38  ? 115.296 11.650  -16.485 1.00 53.81  ? 37   PHE B C     1 
ATOM   1738 O  O     . PHE B  1 38  ? 115.264 10.429  -16.308 1.00 54.70  ? 37   PHE B O     1 
ATOM   1739 C  CB    . PHE B  1 38  ? 114.008 12.678  -18.306 1.00 57.83  ? 37   PHE B CB    1 
ATOM   1740 C  CG    . PHE B  1 38  ? 113.958 13.447  -19.597 1.00 49.96  ? 37   PHE B CG    1 
ATOM   1741 C  CD1   . PHE B  1 38  ? 114.922 14.403  -19.911 1.00 61.33  ? 37   PHE B CD1   1 
ATOM   1742 C  CD2   . PHE B  1 38  ? 112.905 13.242  -20.484 1.00 60.45  ? 37   PHE B CD2   1 
ATOM   1743 C  CE1   . PHE B  1 38  ? 114.861 15.118  -21.097 1.00 54.32  ? 37   PHE B CE1   1 
ATOM   1744 C  CE2   . PHE B  1 38  ? 112.833 13.963  -21.690 1.00 61.32  ? 37   PHE B CE2   1 
ATOM   1745 C  CZ    . PHE B  1 38  ? 113.813 14.903  -21.988 1.00 60.64  ? 37   PHE B CZ    1 
ATOM   1746 N  N     . THR B  1 39  ? 115.229 12.539  -15.499 1.00 52.30  ? 38   THR B N     1 
ATOM   1747 C  CA    . THR B  1 39  ? 114.898 12.159  -14.140 1.00 57.25  ? 38   THR B CA    1 
ATOM   1748 C  C     . THR B  1 39  ? 113.381 12.185  -14.008 1.00 57.99  ? 38   THR B C     1 
ATOM   1749 O  O     . THR B  1 39  ? 112.750 13.241  -14.127 1.00 56.34  ? 38   THR B O     1 
ATOM   1750 C  CB    . THR B  1 39  ? 115.546 13.093  -13.104 1.00 60.81  ? 38   THR B CB    1 
ATOM   1751 O  OG1   . THR B  1 39  ? 116.967 13.101  -13.292 1.00 62.06  ? 38   THR B OG1   1 
ATOM   1752 C  CG2   . THR B  1 39  ? 115.247 12.634  -11.697 1.00 50.60  ? 38   THR B CG2   1 
ATOM   1753 N  N     . HIS B  1 40  ? 112.812 11.002  -13.779 1.00 59.68  ? 39   HIS B N     1 
ATOM   1754 C  CA    . HIS B  1 40  ? 111.372 10.821  -13.720 1.00 55.91  ? 39   HIS B CA    1 
ATOM   1755 C  C     . HIS B  1 40  ? 110.938 10.952  -12.282 1.00 56.06  ? 39   HIS B C     1 
ATOM   1756 O  O     . HIS B  1 40  ? 111.304 10.137  -11.444 1.00 56.73  ? 39   HIS B O     1 
ATOM   1757 C  CB    . HIS B  1 40  ? 111.002 9.464   -14.321 1.00 61.82  ? 39   HIS B CB    1 
ATOM   1758 C  CG    . HIS B  1 40  ? 109.536 9.197   -14.385 1.00 57.97  ? 39   HIS B CG    1 
ATOM   1759 N  ND1   . HIS B  1 40  ? 109.025 7.946   -14.645 1.00 58.68  ? 39   HIS B ND1   1 
ATOM   1760 C  CD2   . HIS B  1 40  ? 108.474 10.011  -14.205 1.00 60.09  ? 39   HIS B CD2   1 
ATOM   1761 C  CE1   . HIS B  1 40  ? 107.709 8.001   -14.617 1.00 64.12  ? 39   HIS B CE1   1 
ATOM   1762 N  NE2   . HIS B  1 40  ? 107.350 9.245   -14.359 1.00 64.24  ? 39   HIS B NE2   1 
ATOM   1763 N  N     . LEU B  1 41  ? 110.187 12.018  -11.993 1.00 57.14  ? 40   LEU B N     1 
ATOM   1764 C  CA    . LEU B  1 41  ? 109.660 12.263  -10.669 1.00 55.41  ? 40   LEU B CA    1 
ATOM   1765 C  C     . LEU B  1 41  ? 108.131 12.302  -10.669 1.00 58.33  ? 40   LEU B C     1 
ATOM   1766 O  O     . LEU B  1 41  ? 107.499 12.623  -11.671 1.00 58.38  ? 40   LEU B O     1 
ATOM   1767 C  CB    . LEU B  1 41  ? 110.205 13.584  -10.105 1.00 56.40  ? 40   LEU B CB    1 
ATOM   1768 C  CG    . LEU B  1 41  ? 111.713 13.799  -10.061 1.00 54.09  ? 40   LEU B CG    1 
ATOM   1769 C  CD1   . LEU B  1 41  ? 112.070 15.223  -9.576  1.00 56.65  ? 40   LEU B CD1   1 
ATOM   1770 C  CD2   . LEU B  1 41  ? 112.400 12.774  -9.174  1.00 54.88  ? 40   LEU B CD2   1 
ATOM   1771 N  N     . SER B  1 42  ? 107.547 11.932  -9.533  1.00 60.28  ? 41   SER B N     1 
ATOM   1772 C  CA    . SER B  1 42  ? 106.108 12.068  -9.302  1.00 57.94  ? 41   SER B CA    1 
ATOM   1773 C  C     . SER B  1 42  ? 105.854 12.288  -7.829  1.00 57.27  ? 41   SER B C     1 
ATOM   1774 O  O     . SER B  1 42  ? 106.630 11.860  -6.973  1.00 58.75  ? 41   SER B O     1 
ATOM   1775 C  CB    . SER B  1 42  ? 105.330 10.846  -9.813  1.00 60.63  ? 41   SER B CB    1 
ATOM   1776 O  OG    . SER B  1 42  ? 105.499 9.706   -8.997  1.00 57.69  ? 41   SER B OG    1 
ATOM   1777 N  N     . THR B  1 43  ? 104.757 12.962  -7.517  1.00 58.64  ? 42   THR B N     1 
ATOM   1778 C  CA    . THR B  1 43  ? 104.483 13.279  -6.136  1.00 58.25  ? 42   THR B CA    1 
ATOM   1779 C  C     . THR B  1 43  ? 104.227 12.011  -5.323  1.00 56.72  ? 42   THR B C     1 
ATOM   1780 O  O     . THR B  1 43  ? 104.603 11.924  -4.158  1.00 61.30  ? 42   THR B O     1 
ATOM   1781 C  CB    . THR B  1 43  ? 103.316 14.268  -6.018  1.00 61.99  ? 42   THR B CB    1 
ATOM   1782 O  OG1   . THR B  1 43  ? 102.188 13.720  -6.666  1.00 63.70  ? 42   THR B OG1   1 
ATOM   1783 C  CG2   . THR B  1 43  ? 103.666 15.609  -6.668  1.00 58.04  ? 42   THR B CG2   1 
ATOM   1784 N  N     . GLY B  1 44  ? 103.618 11.009  -5.948  1.00 56.97  ? 43   GLY B N     1 
ATOM   1785 C  CA    . GLY B  1 44  ? 103.271 9.775   -5.249  1.00 58.37  ? 43   GLY B CA    1 
ATOM   1786 C  C     . GLY B  1 44  ? 104.483 9.003   -4.794  1.00 57.04  ? 43   GLY B C     1 
ATOM   1787 O  O     . GLY B  1 44  ? 104.516 8.448   -3.687  1.00 57.75  ? 43   GLY B O     1 
ATOM   1788 N  N     . GLU B  1 45  ? 105.483 8.970   -5.656  1.00 54.09  ? 44   GLU B N     1 
ATOM   1789 C  CA    . GLU B  1 45  ? 106.738 8.326   -5.331  1.00 56.72  ? 44   GLU B CA    1 
ATOM   1790 C  C     . GLU B  1 45  ? 107.540 9.143   -4.297  1.00 55.57  ? 44   GLU B C     1 
ATOM   1791 O  O     . GLU B  1 45  ? 108.225 8.597   -3.423  1.00 54.77  ? 44   GLU B O     1 
ATOM   1792 C  CB    . GLU B  1 45  ? 107.493 8.113   -6.632  1.00 62.56  ? 44   GLU B CB    1 
ATOM   1793 C  CG    . GLU B  1 45  ? 108.831 7.473   -6.529  1.00 71.33  ? 44   GLU B CG    1 
ATOM   1794 C  CD    . GLU B  1 45  ? 108.817 6.172   -5.789  1.00 85.26  ? 44   GLU B CD    1 
ATOM   1795 O  OE1   . GLU B  1 45  ? 107.825 5.393   -5.904  1.00 82.40  ? 44   GLU B OE1   1 
ATOM   1796 O  OE2   . GLU B  1 45  ? 109.834 5.946   -5.104  1.00 72.56  ? 44   GLU B OE2   1 
ATOM   1797 N  N     . LEU B  1 46  ? 107.437 10.457  -4.391  1.00 56.51  ? 45   LEU B N     1 
ATOM   1798 C  CA    . LEU B  1 46  ? 108.140 11.355  -3.472  1.00 56.68  ? 45   LEU B CA    1 
ATOM   1799 C  C     . LEU B  1 46  ? 107.529 11.288  -2.076  1.00 56.21  ? 45   LEU B C     1 
ATOM   1800 O  O     . LEU B  1 46  ? 108.246 11.294  -1.071  1.00 53.26  ? 45   LEU B O     1 
ATOM   1801 C  CB    . LEU B  1 46  ? 108.102 12.786  -3.995  1.00 56.62  ? 45   LEU B CB    1 
ATOM   1802 C  CG    . LEU B  1 46  ? 109.002 13.097  -5.197  1.00 62.49  ? 45   LEU B CG    1 
ATOM   1803 C  CD1   . LEU B  1 46  ? 108.658 14.465  -5.756  1.00 63.95  ? 45   LEU B CD1   1 
ATOM   1804 C  CD2   . LEU B  1 46  ? 110.457 13.021  -4.847  1.00 61.36  ? 45   LEU B CD2   1 
ATOM   1805 N  N     . LEU B  1 47  ? 106.202 11.215  -2.035  1.00 54.39  ? 46   LEU B N     1 
ATOM   1806 C  CA    . LEU B  1 47  ? 105.485 10.975  -0.805  1.00 54.81  ? 46   LEU B CA    1 
ATOM   1807 C  C     . LEU B  1 47  ? 105.802 9.598   -0.223  1.00 54.86  ? 46   LEU B C     1 
ATOM   1808 O  O     . LEU B  1 47  ? 105.925 9.442   0.977   1.00 57.74  ? 46   LEU B O     1 
ATOM   1809 C  CB    . LEU B  1 47  ? 103.978 11.157  -1.036  1.00 56.01  ? 46   LEU B CB    1 
ATOM   1810 C  CG    . LEU B  1 47  ? 103.573 12.643  -1.182  1.00 55.74  ? 46   LEU B CG    1 
ATOM   1811 C  CD1   . LEU B  1 47  ? 102.152 12.790  -1.716  1.00 63.06  ? 46   LEU B CD1   1 
ATOM   1812 C  CD2   . LEU B  1 47  ? 103.708 13.357  0.150   1.00 60.26  ? 46   LEU B CD2   1 
ATOM   1813 N  N     . ARG B  1 48  ? 105.953 8.596   -1.070  1.00 54.34  ? 47   ARG B N     1 
ATOM   1814 C  CA    . ARG B  1 48  ? 106.185 7.263   -0.568  1.00 58.22  ? 47   ARG B CA    1 
ATOM   1815 C  C     . ARG B  1 48  ? 107.571 7.199   0.064   1.00 54.28  ? 47   ARG B C     1 
ATOM   1816 O  O     . ARG B  1 48  ? 107.734 6.665   1.150   1.00 60.64  ? 47   ARG B O     1 
ATOM   1817 C  CB    . ARG B  1 48  ? 106.037 6.248   -1.692  1.00 56.43  ? 47   ARG B CB    1 
ATOM   1818 C  CG    . ARG B  1 48  ? 106.016 4.818   -1.222  1.00 63.59  ? 47   ARG B CG    1 
ATOM   1819 C  CD    . ARG B  1 48  ? 106.499 3.827   -2.304  1.00 68.33  ? 47   ARG B CD    1 
ATOM   1820 N  NE    . ARG B  1 48  ? 107.847 4.140   -2.791  1.00 75.59  ? 47   ARG B NE    1 
ATOM   1821 C  CZ    . ARG B  1 48  ? 108.969 4.042   -2.067  1.00 84.33  ? 47   ARG B CZ    1 
ATOM   1822 N  NH1   . ARG B  1 48  ? 108.965 3.615   -0.796  1.00 75.13  ? 47   ARG B NH1   1 
ATOM   1823 N  NH2   . ARG B  1 48  ? 110.124 4.382   -2.619  1.00 66.39  ? 47   ARG B NH2   1 
ATOM   1824 N  N     . GLU B  1 49  ? 108.553 7.781   -0.615  1.00 55.66  ? 48   GLU B N     1 
ATOM   1825 C  CA    . GLU B  1 49  ? 109.935 7.816   -0.147  1.00 61.02  ? 48   GLU B CA    1 
ATOM   1826 C  C     . GLU B  1 49  ? 110.101 8.587   1.185   1.00 58.03  ? 48   GLU B C     1 
ATOM   1827 O  O     . GLU B  1 49  ? 110.833 8.151   2.087   1.00 55.40  ? 48   GLU B O     1 
ATOM   1828 C  CB    . GLU B  1 49  ? 110.818 8.399   -1.247  1.00 58.67  ? 48   GLU B CB    1 
ATOM   1829 C  CG    . GLU B  1 49  ? 112.244 8.730   -0.839  1.00 69.41  ? 48   GLU B CG    1 
ATOM   1830 C  CD    . GLU B  1 49  ? 113.091 9.302   -2.003  1.00 83.00  ? 48   GLU B CD    1 
ATOM   1831 O  OE1   . GLU B  1 49  ? 112.556 10.065  -2.860  1.00 84.73  ? 48   GLU B OE1   1 
ATOM   1832 O  OE2   . GLU B  1 49  ? 114.305 8.984   -2.042  1.00 103.82 ? 48   GLU B OE2   1 
ATOM   1833 N  N     . GLU B  1 50  ? 109.401 9.709   1.290   1.00 58.21  ? 49   GLU B N     1 
ATOM   1834 C  CA    . GLU B  1 50  ? 109.398 10.537  2.473   1.00 57.00  ? 49   GLU B CA    1 
ATOM   1835 C  C     . GLU B  1 50  ? 108.769 9.792   3.627   1.00 54.44  ? 49   GLU B C     1 
ATOM   1836 O  O     . GLU B  1 50  ? 109.298 9.814   4.722   1.00 54.81  ? 49   GLU B O     1 
ATOM   1837 C  CB    . GLU B  1 50  ? 108.613 11.837  2.209   1.00 58.22  ? 49   GLU B CB    1 
ATOM   1838 C  CG    . GLU B  1 50  ? 108.520 12.801  3.403   1.00 64.76  ? 49   GLU B CG    1 
ATOM   1839 C  CD    . GLU B  1 50  ? 109.881 13.269  3.913   1.00 63.59  ? 49   GLU B CD    1 
ATOM   1840 O  OE1   . GLU B  1 50  ? 110.897 13.019  3.229   1.00 73.45  ? 49   GLU B OE1   1 
ATOM   1841 O  OE2   . GLU B  1 50  ? 109.945 13.879  5.000   1.00 67.80  ? 49   GLU B OE2   1 
ATOM   1842 N  N     . LEU B  1 51  ? 107.640 9.131   3.379   1.00 55.82  ? 50   LEU B N     1 
ATOM   1843 C  CA    . LEU B  1 51  ? 106.984 8.326   4.416   1.00 59.87  ? 50   LEU B CA    1 
ATOM   1844 C  C     . LEU B  1 51  ? 107.878 7.207   4.955   1.00 59.54  ? 50   LEU B C     1 
ATOM   1845 O  O     . LEU B  1 51  ? 107.819 6.878   6.134   1.00 64.91  ? 50   LEU B O     1 
ATOM   1846 C  CB    . LEU B  1 51  ? 105.636 7.768   3.918   1.00 59.55  ? 50   LEU B CB    1 
ATOM   1847 C  CG    . LEU B  1 51  ? 104.603 8.902   3.726   1.00 62.99  ? 50   LEU B CG    1 
ATOM   1848 C  CD1   . LEU B  1 51  ? 103.472 8.497   2.795   1.00 65.41  ? 50   LEU B CD1   1 
ATOM   1849 C  CD2   . LEU B  1 51  ? 104.038 9.361   5.081   1.00 66.92  ? 50   LEU B CD2   1 
ATOM   1850 N  N     . ALA B  1 52  ? 108.721 6.650   4.096   1.00 56.85  ? 51   ALA B N     1 
ATOM   1851 C  CA    . ALA B  1 52  ? 109.659 5.607   4.484   1.00 54.91  ? 51   ALA B CA    1 
ATOM   1852 C  C     . ALA B  1 52  ? 110.865 6.113   5.273   1.00 56.36  ? 51   ALA B C     1 
ATOM   1853 O  O     . ALA B  1 52  ? 111.634 5.311   5.772   1.00 58.75  ? 51   ALA B O     1 
ATOM   1854 C  CB    . ALA B  1 52  ? 110.152 4.858   3.205   1.00 51.23  ? 51   ALA B CB    1 
ATOM   1855 N  N     . SER B  1 53  ? 111.032 7.428   5.387   1.00 59.71  ? 52   SER B N     1 
ATOM   1856 C  CA    . SER B  1 53  ? 112.243 8.035   5.960   1.00 60.14  ? 52   SER B CA    1 
ATOM   1857 C  C     . SER B  1 53  ? 112.269 8.267   7.486   1.00 63.38  ? 52   SER B C     1 
ATOM   1858 O  O     . SER B  1 53  ? 113.336 8.600   8.032   1.00 67.18  ? 52   SER B O     1 
ATOM   1859 C  CB    . SER B  1 53  ? 112.473 9.400   5.318   1.00 64.43  ? 52   SER B CB    1 
ATOM   1860 O  OG    . SER B  1 53  ? 111.727 10.378  6.014   1.00 54.09  ? 52   SER B OG    1 
ATOM   1861 N  N     . GLU B  1 54  ? 111.139 8.149   8.180   1.00 60.61  ? 53   GLU B N     1 
ATOM   1862 C  CA    . GLU B  1 54  ? 111.121 8.434   9.646   1.00 64.65  ? 53   GLU B CA    1 
ATOM   1863 C  C     . GLU B  1 54  ? 111.419 9.886   10.114  1.00 57.92  ? 53   GLU B C     1 
ATOM   1864 O  O     . GLU B  1 54  ? 111.541 10.157  11.321  1.00 55.61  ? 53   GLU B O     1 
ATOM   1865 C  CB    . GLU B  1 54  ? 112.103 7.523   10.401  1.00 62.47  ? 53   GLU B CB    1 
ATOM   1866 C  CG    . GLU B  1 54  ? 111.641 6.110   10.668  1.00 80.97  ? 53   GLU B CG    1 
ATOM   1867 C  CD    . GLU B  1 54  ? 112.710 5.320   11.431  1.00 80.97  ? 53   GLU B CD    1 
ATOM   1868 O  OE1   . GLU B  1 54  ? 113.901 5.387   11.031  1.00 85.10  ? 53   GLU B OE1   1 
ATOM   1869 O  OE2   . GLU B  1 54  ? 112.367 4.655   12.439  1.00 97.32  ? 53   GLU B OE2   1 
ATOM   1870 N  N     . SER B  1 55  ? 111.564 10.812  9.182   1.00 58.93  ? 54   SER B N     1 
ATOM   1871 C  CA    . SER B  1 55  ? 111.770 12.214  9.520   1.00 54.70  ? 54   SER B CA    1 
ATOM   1872 C  C     . SER B  1 55  ? 110.562 12.741  10.296  1.00 54.11  ? 54   SER B C     1 
ATOM   1873 O  O     . SER B  1 55  ? 109.468 12.200  10.217  1.00 55.42  ? 54   SER B O     1 
ATOM   1874 C  CB    . SER B  1 55  ? 111.945 13.020  8.247   1.00 50.10  ? 54   SER B CB    1 
ATOM   1875 O  OG    . SER B  1 55  ? 110.783 12.967  7.437   1.00 53.82  ? 54   SER B OG    1 
ATOM   1876 N  N     . GLU B  1 56  ? 110.754 13.809  11.046  1.00 52.48  ? 55   GLU B N     1 
ATOM   1877 C  CA    . GLU B  1 56  ? 109.626 14.451  11.676  1.00 51.16  ? 55   GLU B CA    1 
ATOM   1878 C  C     . GLU B  1 56  ? 108.611 14.937  10.629  1.00 49.40  ? 55   GLU B C     1 
ATOM   1879 O  O     . GLU B  1 56  ? 107.411 14.894  10.865  1.00 53.39  ? 55   GLU B O     1 
ATOM   1880 C  CB    . GLU B  1 56  ? 110.097 15.598  12.549  1.00 49.83  ? 55   GLU B CB    1 
ATOM   1881 C  CG    . GLU B  1 56  ? 109.296 15.799  13.769  1.00 49.78  ? 55   GLU B CG    1 
ATOM   1882 C  CD    . GLU B  1 56  ? 109.136 14.522  14.595  1.00 70.12  ? 55   GLU B CD    1 
ATOM   1883 O  OE1   . GLU B  1 56  ? 108.025 14.370  15.154  1.00 51.98  ? 55   GLU B OE1   1 
ATOM   1884 O  OE2   . GLU B  1 56  ? 110.091 13.682  14.663  1.00 50.15  ? 55   GLU B OE2   1 
ATOM   1885 N  N     . ARG B  1 57  ? 109.104 15.408  9.483   1.00 53.78  ? 56   ARG B N     1 
ATOM   1886 C  CA    . ARG B  1 57  ? 108.228 15.846  8.420   1.00 51.10  ? 56   ARG B CA    1 
ATOM   1887 C  C     . ARG B  1 57  ? 107.352 14.723  7.850   1.00 53.64  ? 56   ARG B C     1 
ATOM   1888 O  O     . ARG B  1 57  ? 106.203 14.979  7.455   1.00 54.13  ? 56   ARG B O     1 
ATOM   1889 C  CB    . ARG B  1 57  ? 109.031 16.474  7.296   1.00 53.26  ? 56   ARG B CB    1 
ATOM   1890 C  CG    . ARG B  1 57  ? 108.170 17.014  6.144   1.00 60.36  ? 56   ARG B CG    1 
ATOM   1891 C  CD    . ARG B  1 57  ? 108.990 17.721  5.089   1.00 58.53  ? 56   ARG B CD    1 
ATOM   1892 N  NE    . ARG B  1 57  ? 109.961 16.810  4.524   1.00 61.97  ? 56   ARG B NE    1 
ATOM   1893 C  CZ    . ARG B  1 57  ? 110.996 17.168  3.775   1.00 59.39  ? 56   ARG B CZ    1 
ATOM   1894 N  NH1   . ARG B  1 57  ? 111.198 18.430  3.437   1.00 66.72  ? 56   ARG B NH1   1 
ATOM   1895 N  NH2   . ARG B  1 57  ? 111.828 16.238  3.350   1.00 56.71  ? 56   ARG B NH2   1 
ATOM   1896 N  N     . SER B  1 58  ? 107.884 13.499  7.767   1.00 49.51  ? 57   SER B N     1 
ATOM   1897 C  CA    . SER B  1 58  ? 107.084 12.368  7.291   1.00 52.14  ? 57   SER B CA    1 
ATOM   1898 C  C     . SER B  1 58  ? 105.958 12.046  8.258   1.00 53.97  ? 57   SER B C     1 
ATOM   1899 O  O     . SER B  1 58  ? 104.940 11.480  7.873   1.00 54.55  ? 57   SER B O     1 
ATOM   1900 C  CB    . SER B  1 58  ? 107.953 11.113  7.115   1.00 52.80  ? 57   SER B CB    1 
ATOM   1901 O  OG    . SER B  1 58  ? 108.467 10.680  8.351   1.00 55.07  ? 57   SER B OG    1 
ATOM   1902 N  N     . LYS B  1 59  ? 106.163 12.377  9.529   1.00 53.77  ? 58   LYS B N     1 
ATOM   1903 C  CA    . LYS B  1 59  ? 105.159 12.154  10.550  1.00 51.68  ? 58   LYS B CA    1 
ATOM   1904 C  C     . LYS B  1 59  ? 104.042 13.175  10.474  1.00 50.89  ? 58   LYS B C     1 
ATOM   1905 O  O     . LYS B  1 59  ? 102.902 12.839  10.695  1.00 53.51  ? 58   LYS B O     1 
ATOM   1906 C  CB    . LYS B  1 59  ? 105.805 12.124  11.925  1.00 54.61  ? 58   LYS B CB    1 
ATOM   1907 C  CG    . LYS B  1 59  ? 106.704 10.900  12.077  1.00 56.84  ? 58   LYS B CG    1 
ATOM   1908 C  CD    . LYS B  1 59  ? 107.349 10.877  13.419  1.00 61.99  ? 58   LYS B CD    1 
ATOM   1909 C  CE    . LYS B  1 59  ? 108.226 9.632   13.607  1.00 64.16  ? 58   LYS B CE    1 
ATOM   1910 N  NZ    . LYS B  1 59  ? 108.759 9.576   15.031  1.00 65.91  ? 58   LYS B NZ    1 
ATOM   1911 N  N     . LEU B  1 60  ? 104.379 14.409  10.154  1.00 48.79  ? 59   LEU B N     1 
ATOM   1912 C  CA    . LEU B  1 60  ? 103.402 15.415  9.822   1.00 54.97  ? 59   LEU B CA    1 
ATOM   1913 C  C     . LEU B  1 60  ? 102.545 14.989  8.625   1.00 54.18  ? 59   LEU B C     1 
ATOM   1914 O  O     . LEU B  1 60  ? 101.322 15.064  8.641   1.00 55.77  ? 59   LEU B O     1 
ATOM   1915 C  CB    . LEU B  1 60  ? 104.129 16.751  9.502   1.00 52.14  ? 59   LEU B CB    1 
ATOM   1916 C  CG    . LEU B  1 60  ? 103.264 17.898  9.002   1.00 52.21  ? 59   LEU B CG    1 
ATOM   1917 C  CD1   . LEU B  1 60  ? 102.126 18.242  9.978   1.00 51.96  ? 59   LEU B CD1   1 
ATOM   1918 C  CD2   . LEU B  1 60  ? 104.094 19.100  8.664   1.00 53.32  ? 59   LEU B CD2   1 
ATOM   1919 N  N     . ILE B  1 61  ? 103.205 14.542  7.566   1.00 56.47  ? 60   ILE B N     1 
ATOM   1920 C  CA    . ILE B  1 61  ? 102.494 14.132  6.371   1.00 55.82  ? 60   ILE B CA    1 
ATOM   1921 C  C     . ILE B  1 61  ? 101.592 12.962  6.691   1.00 56.09  ? 60   ILE B C     1 
ATOM   1922 O  O     . ILE B  1 61  ? 100.508 12.844  6.145   1.00 58.84  ? 60   ILE B O     1 
ATOM   1923 C  CB    . ILE B  1 61  ? 103.470 13.739  5.257   1.00 58.50  ? 60   ILE B CB    1 
ATOM   1924 C  CG1   . ILE B  1 61  ? 104.214 14.975  4.753   1.00 57.14  ? 60   ILE B CG1   1 
ATOM   1925 C  CG2   . ILE B  1 61  ? 102.771 13.039  4.123   1.00 58.37  ? 60   ILE B CG2   1 
ATOM   1926 C  CD1   . ILE B  1 61  ? 105.483 14.608  3.967   1.00 63.66  ? 60   ILE B CD1   1 
ATOM   1927 N  N     . ARG B  1 62  ? 102.066 12.050  7.520   1.00 59.64  ? 61   ARG B N     1 
ATOM   1928 C  CA    . ARG B  1 62  ? 101.264 10.895  7.880   1.00 57.02  ? 61   ARG B CA    1 
ATOM   1929 C  C     . ARG B  1 62  ? 100.078 11.293  8.760   1.00 55.77  ? 61   ARG B C     1 
ATOM   1930 O  O     . ARG B  1 62  ? 99.006  10.764  8.598   1.00 59.35  ? 61   ARG B O     1 
ATOM   1931 C  CB    . ARG B  1 62  ? 102.126 9.846   8.554   1.00 56.55  ? 61   ARG B CB    1 
ATOM   1932 C  CG    . ARG B  1 62  ? 101.366 8.676   8.981   1.00 62.21  ? 61   ARG B CG    1 
ATOM   1933 C  CD    . ARG B  1 62  ? 102.224 7.663   9.662   1.00 76.11  ? 61   ARG B CD    1 
ATOM   1934 N  NE    . ARG B  1 62  ? 102.936 6.861   8.683   1.00 91.56  ? 61   ARG B NE    1 
ATOM   1935 C  CZ    . ARG B  1 62  ? 104.220 6.991   8.373   1.00 84.65  ? 61   ARG B CZ    1 
ATOM   1936 N  NH1   . ARG B  1 62  ? 104.997 7.902   8.978   1.00 71.60  ? 61   ARG B NH1   1 
ATOM   1937 N  NH2   . ARG B  1 62  ? 104.725 6.177   7.449   1.00 61.98  ? 61   ARG B NH2   1 
ATOM   1938 N  N     . ASP B  1 63  ? 100.265 12.213  9.694   1.00 54.89  ? 62   ASP B N     1 
ATOM   1939 C  CA    . ASP B  1 63  ? 99.131  12.743  10.482  1.00 59.81  ? 62   ASP B CA    1 
ATOM   1940 C  C     . ASP B  1 63  ? 98.025  13.217  9.529   1.00 57.76  ? 62   ASP B C     1 
ATOM   1941 O  O     . ASP B  1 63  ? 96.869  12.895  9.708   1.00 60.65  ? 62   ASP B O     1 
ATOM   1942 C  CB    . ASP B  1 63  ? 99.544  13.951  11.373  1.00 59.06  ? 62   ASP B CB    1 
ATOM   1943 C  CG    . ASP B  1 63  ? 100.382 13.569  12.604  1.00 68.76  ? 62   ASP B CG    1 
ATOM   1944 O  OD1   . ASP B  1 63  ? 100.524 12.365  12.936  1.00 75.27  ? 62   ASP B OD1   1 
ATOM   1945 O  OD2   . ASP B  1 63  ? 100.920 14.509  13.237  1.00 69.30  ? 62   ASP B OD2   1 
ATOM   1946 N  N     . ILE B  1 64  ? 98.423  13.967  8.509   1.00 56.63  ? 63   ILE B N     1 
ATOM   1947 C  CA    . ILE B  1 64  ? 97.518  14.556  7.500   1.00 59.38  ? 63   ILE B CA    1 
ATOM   1948 C  C     . ILE B  1 64  ? 96.836  13.489  6.628   1.00 61.36  ? 63   ILE B C     1 
ATOM   1949 O  O     . ILE B  1 64  ? 95.620  13.489  6.464   1.00 60.65  ? 63   ILE B O     1 
ATOM   1950 C  CB    . ILE B  1 64  ? 98.311  15.567  6.606   1.00 62.70  ? 63   ILE B CB    1 
ATOM   1951 C  CG1   . ILE B  1 64  ? 98.831  16.732  7.459   1.00 57.20  ? 63   ILE B CG1   1 
ATOM   1952 C  CG2   . ILE B  1 64  ? 97.464  16.142  5.451   1.00 58.55  ? 63   ILE B CG2   1 
ATOM   1953 C  CD1   . ILE B  1 64  ? 99.759  17.662  6.688   1.00 55.56  ? 63   ILE B CD1   1 
ATOM   1954 N  N     . MET B  1 65  ? 97.627  12.572  6.084   1.00 60.70  ? 64   MET B N     1 
ATOM   1955 C  CA    . MET B  1 65  ? 97.120  11.565  5.179   1.00 59.37  ? 64   MET B CA    1 
ATOM   1956 C  C     . MET B  1 65  ? 96.178  10.590  5.864   1.00 61.85  ? 64   MET B C     1 
ATOM   1957 O  O     . MET B  1 65  ? 95.217  10.112  5.253   1.00 67.11  ? 64   MET B O     1 
ATOM   1958 C  CB    . MET B  1 65  ? 98.296  10.856  4.509   1.00 60.92  ? 64   MET B CB    1 
ATOM   1959 C  CG    . MET B  1 65  ? 98.977  11.785  3.493   1.00 66.25  ? 64   MET B CG    1 
ATOM   1960 S  SD    . MET B  1 65  ? 100.207 11.012  2.433   1.00 77.24  ? 64   MET B SD    1 
ATOM   1961 C  CE    . MET B  1 65  ? 99.193  10.673  0.978   1.00 96.15  ? 64   MET B CE    1 
ATOM   1962 N  N     . GLU B  1 66  ? 96.429  10.322  7.137   1.00 59.23  ? 65   GLU B N     1 
ATOM   1963 C  CA    . GLU B  1 66  ? 95.578  9.448   7.936   1.00 62.80  ? 65   GLU B CA    1 
ATOM   1964 C  C     . GLU B  1 66  ? 94.208  10.019  8.253   1.00 64.33  ? 65   GLU B C     1 
ATOM   1965 O  O     . GLU B  1 66  ? 93.308  9.280   8.639   1.00 67.96  ? 65   GLU B O     1 
ATOM   1966 C  CB    . GLU B  1 66  ? 96.293  9.099   9.251   1.00 59.19  ? 65   GLU B CB    1 
ATOM   1967 C  CG    . GLU B  1 66  ? 97.347  8.022   8.973   1.00 74.35  ? 65   GLU B CG    1 
ATOM   1968 C  CD    . GLU B  1 66  ? 98.134  7.597   10.179  1.00 78.46  ? 65   GLU B CD    1 
ATOM   1969 O  OE1   . GLU B  1 66  ? 98.707  6.480   10.092  1.00 91.25  ? 65   GLU B OE1   1 
ATOM   1970 O  OE2   . GLU B  1 66  ? 98.194  8.371   11.174  1.00 76.34  ? 65   GLU B OE2   1 
ATOM   1971 N  N     . ARG B  1 67  ? 94.067  11.333  8.145   1.00 63.29  ? 66   ARG B N     1 
ATOM   1972 C  CA    . ARG B  1 67  ? 92.780  11.973  8.265   1.00 58.50  ? 66   ARG B CA    1 
ATOM   1973 C  C     . ARG B  1 67  ? 92.116  12.070  6.904   1.00 55.05  ? 66   ARG B C     1 
ATOM   1974 O  O     . ARG B  1 67  ? 90.994  12.522  6.818   1.00 58.73  ? 66   ARG B O     1 
ATOM   1975 C  CB    . ARG B  1 67  ? 92.923  13.380  8.863   1.00 58.24  ? 66   ARG B CB    1 
ATOM   1976 C  CG    . ARG B  1 67  ? 93.486  13.405  10.265  1.00 66.38  ? 66   ARG B CG    1 
ATOM   1977 C  CD    . ARG B  1 67  ? 93.494  14.808  10.889  1.00 70.50  ? 66   ARG B CD    1 
ATOM   1978 N  NE    . ARG B  1 67  ? 94.730  15.544  10.639  1.00 89.96  ? 66   ARG B NE    1 
ATOM   1979 C  CZ    . ARG B  1 67  ? 95.678  15.832  11.541  1.00 81.31  ? 66   ARG B CZ    1 
ATOM   1980 N  NH1   . ARG B  1 67  ? 95.606  15.449  12.815  1.00 69.92  ? 66   ARG B NH1   1 
ATOM   1981 N  NH2   . ARG B  1 67  ? 96.734  16.530  11.139  1.00 78.11  ? 66   ARG B NH2   1 
ATOM   1982 N  N     . GLY B  1 68  ? 92.796  11.639  5.846   1.00 54.65  ? 67   GLY B N     1 
ATOM   1983 C  CA    . GLY B  1 68  ? 92.317  11.814  4.492   1.00 54.30  ? 67   GLY B CA    1 
ATOM   1984 C  C     . GLY B  1 68  ? 92.443  13.260  4.040   1.00 59.64  ? 67   GLY B C     1 
ATOM   1985 O  O     . GLY B  1 68  ? 91.763  13.681  3.103   1.00 60.44  ? 67   GLY B O     1 
ATOM   1986 N  N     . ASP B  1 69  ? 93.316  14.027  4.694   1.00 61.12  ? 68   ASP B N     1 
ATOM   1987 C  CA    . ASP B  1 69  ? 93.377  15.466  4.466   1.00 56.89  ? 68   ASP B CA    1 
ATOM   1988 C  C     . ASP B  1 69  ? 94.382  15.795  3.377   1.00 59.46  ? 68   ASP B C     1 
ATOM   1989 O  O     . ASP B  1 69  ? 95.262  15.007  3.049   1.00 60.34  ? 68   ASP B O     1 
ATOM   1990 C  CB    . ASP B  1 69  ? 93.750  16.226  5.746   1.00 56.87  ? 68   ASP B CB    1 
ATOM   1991 C  CG    . ASP B  1 69  ? 92.543  16.671  6.559   1.00 66.38  ? 68   ASP B CG    1 
ATOM   1992 O  OD1   . ASP B  1 69  ? 91.401  16.672  6.035   1.00 75.28  ? 68   ASP B OD1   1 
ATOM   1993 O  OD2   . ASP B  1 69  ? 92.749  17.038  7.737   1.00 70.01  ? 68   ASP B OD2   1 
ATOM   1994 N  N     . LEU B  1 70  ? 94.240  16.987  2.831   1.00 57.60  ? 69   LEU B N     1 
ATOM   1995 C  CA    . LEU B  1 70  ? 95.135  17.477  1.817   1.00 59.74  ? 69   LEU B CA    1 
ATOM   1996 C  C     . LEU B  1 70  ? 96.520  17.724  2.401   1.00 60.84  ? 69   LEU B C     1 
ATOM   1997 O  O     . LEU B  1 70  ? 96.661  18.361  3.455   1.00 57.66  ? 69   LEU B O     1 
ATOM   1998 C  CB    . LEU B  1 70  ? 94.566  18.783  1.278   1.00 67.06  ? 69   LEU B CB    1 
ATOM   1999 C  CG    . LEU B  1 70  ? 95.427  19.698  0.421   1.00 70.29  ? 69   LEU B CG    1 
ATOM   2000 C  CD1   . LEU B  1 70  ? 95.312  19.296  -1.036  1.00 62.11  ? 69   LEU B CD1   1 
ATOM   2001 C  CD2   . LEU B  1 70  ? 94.940  21.104  0.639   1.00 68.29  ? 69   LEU B CD2   1 
ATOM   2002 N  N     . VAL B  1 71  ? 97.535  17.223  1.700   1.00 62.37  ? 70   VAL B N     1 
ATOM   2003 C  CA    . VAL B  1 71  ? 98.917  17.541  2.003   1.00 63.26  ? 70   VAL B CA    1 
ATOM   2004 C  C     . VAL B  1 71  ? 99.233  18.896  1.388   1.00 63.08  ? 70   VAL B C     1 
ATOM   2005 O  O     . VAL B  1 71  ? 99.178  19.052  0.176   1.00 59.65  ? 70   VAL B O     1 
ATOM   2006 C  CB    . VAL B  1 71  ? 99.909  16.484  1.443   1.00 64.63  ? 70   VAL B CB    1 
ATOM   2007 C  CG1   . VAL B  1 71  ? 101.341 16.869  1.784   1.00 61.55  ? 70   VAL B CG1   1 
ATOM   2008 C  CG2   . VAL B  1 71  ? 99.579  15.087  1.979   1.00 60.75  ? 70   VAL B CG2   1 
ATOM   2009 N  N     . PRO B  1 72  ? 99.576  19.884  2.217   1.00 58.13  ? 71   PRO B N     1 
ATOM   2010 C  CA    . PRO B  1 72  ? 99.826  21.211  1.633   1.00 59.87  ? 71   PRO B CA    1 
ATOM   2011 C  C     . PRO B  1 72  ? 100.821 21.226  0.453   1.00 57.85  ? 71   PRO B C     1 
ATOM   2012 O  O     . PRO B  1 72  ? 101.794 20.478  0.431   1.00 61.11  ? 71   PRO B O     1 
ATOM   2013 C  CB    . PRO B  1 72  ? 100.359 22.041  2.824   1.00 56.07  ? 71   PRO B CB    1 
ATOM   2014 C  CG    . PRO B  1 72  ? 99.937  21.304  4.039   1.00 55.97  ? 71   PRO B CG    1 
ATOM   2015 C  CD    . PRO B  1 72  ? 99.712  19.867  3.680   1.00 59.17  ? 71   PRO B CD    1 
ATOM   2016 N  N     . SER B  1 73  ? 100.539 22.088  -0.506  1.00 60.91  ? 72   SER B N     1 
ATOM   2017 C  CA    . SER B  1 73  ? 101.364 22.287  -1.696  1.00 62.78  ? 72   SER B CA    1 
ATOM   2018 C  C     . SER B  1 73  ? 102.830 22.519  -1.353  1.00 59.97  ? 72   SER B C     1 
ATOM   2019 O  O     . SER B  1 73  ? 103.718 22.043  -2.051  1.00 59.33  ? 72   SER B O     1 
ATOM   2020 C  CB    . SER B  1 73  ? 100.848 23.511  -2.465  1.00 54.66  ? 72   SER B CB    1 
ATOM   2021 O  OG    . SER B  1 73  ? 99.760  23.150  -3.295  1.00 77.66  ? 72   SER B OG    1 
ATOM   2022 N  N     . GLY B  1 74  ? 103.067 23.265  -0.281  1.00 60.40  ? 73   GLY B N     1 
ATOM   2023 C  CA    . GLY B  1 74  ? 104.412 23.626  0.134   1.00 56.47  ? 73   GLY B CA    1 
ATOM   2024 C  C     . GLY B  1 74  ? 105.251 22.444  0.562   1.00 57.68  ? 73   GLY B C     1 
ATOM   2025 O  O     . GLY B  1 74  ? 106.465 22.455  0.384   1.00 60.39  ? 73   GLY B O     1 
ATOM   2026 N  N     . ILE B  1 75  ? 104.622 21.422  1.131   1.00 56.45  ? 74   ILE B N     1 
ATOM   2027 C  CA    . ILE B  1 75  ? 105.363 20.232  1.520   1.00 60.00  ? 74   ILE B CA    1 
ATOM   2028 C  C     . ILE B  1 75  ? 105.718 19.443  0.285   1.00 56.01  ? 74   ILE B C     1 
ATOM   2029 O  O     . ILE B  1 75  ? 106.845 19.052  0.099   1.00 58.06  ? 74   ILE B O     1 
ATOM   2030 C  CB    . ILE B  1 75  ? 104.581 19.360  2.539   1.00 58.30  ? 74   ILE B CB    1 
ATOM   2031 C  CG1   . ILE B  1 75  ? 104.468 20.139  3.875   1.00 61.31  ? 74   ILE B CG1   1 
ATOM   2032 C  CG2   . ILE B  1 75  ? 105.278 18.031  2.746   1.00 63.52  ? 74   ILE B CG2   1 
ATOM   2033 C  CD1   . ILE B  1 75  ? 103.475 19.585  4.857   1.00 64.55  ? 74   ILE B CD1   1 
ATOM   2034 N  N     . VAL B  1 76  ? 104.741 19.234  -0.573  1.00 60.75  ? 75   VAL B N     1 
ATOM   2035 C  CA    . VAL B  1 76  ? 104.977 18.559  -1.843  1.00 62.02  ? 75   VAL B CA    1 
ATOM   2036 C  C     . VAL B  1 76  ? 106.141 19.225  -2.624  1.00 59.50  ? 75   VAL B C     1 
ATOM   2037 O  O     . VAL B  1 76  ? 107.044 18.551  -3.104  1.00 57.74  ? 75   VAL B O     1 
ATOM   2038 C  CB    . VAL B  1 76  ? 103.681 18.533  -2.678  1.00 63.10  ? 75   VAL B CB    1 
ATOM   2039 C  CG1   . VAL B  1 76  ? 103.958 17.962  -4.073  1.00 67.13  ? 75   VAL B CG1   1 
ATOM   2040 C  CG2   . VAL B  1 76  ? 102.602 17.720  -1.942  1.00 68.28  ? 75   VAL B CG2   1 
ATOM   2041 N  N     . LEU B  1 77  ? 106.116 20.551  -2.698  1.00 55.07  ? 76   LEU B N     1 
ATOM   2042 C  CA    . LEU B  1 77  ? 107.158 21.334  -3.370  1.00 56.98  ? 76   LEU B CA    1 
ATOM   2043 C  C     . LEU B  1 77  ? 108.544 21.207  -2.758  1.00 60.55  ? 76   LEU B C     1 
ATOM   2044 O  O     . LEU B  1 77  ? 109.547 21.166  -3.487  1.00 63.01  ? 76   LEU B O     1 
ATOM   2045 C  CB    . LEU B  1 77  ? 106.763 22.807  -3.364  1.00 56.95  ? 76   LEU B CB    1 
ATOM   2046 C  CG    . LEU B  1 77  ? 107.532 23.778  -4.261  1.00 71.52  ? 76   LEU B CG    1 
ATOM   2047 C  CD1   . LEU B  1 77  ? 107.225 23.514  -5.711  1.00 64.61  ? 76   LEU B CD1   1 
ATOM   2048 C  CD2   . LEU B  1 77  ? 107.138 25.195  -3.881  1.00 75.17  ? 76   LEU B CD2   1 
ATOM   2049 N  N     . GLU B  1 78  ? 108.593 21.179  -1.422  1.00 56.49  ? 77   GLU B N     1 
ATOM   2050 C  CA    . GLU B  1 78  ? 109.812 20.884  -0.677  1.00 60.61  ? 77   GLU B CA    1 
ATOM   2051 C  C     . GLU B  1 78  ? 110.388 19.522  -1.107  1.00 54.34  ? 77   GLU B C     1 
ATOM   2052 O  O     . GLU B  1 78  ? 111.586 19.362  -1.325  1.00 58.07  ? 77   GLU B O     1 
ATOM   2053 C  CB    . GLU B  1 78  ? 109.492 20.857  0.828   1.00 63.43  ? 77   GLU B CB    1 
ATOM   2054 C  CG    . GLU B  1 78  ? 110.336 21.713  1.711   1.00 72.77  ? 77   GLU B CG    1 
ATOM   2055 C  CD    . GLU B  1 78  ? 110.031 21.508  3.236   1.00 78.19  ? 77   GLU B CD    1 
ATOM   2056 O  OE1   . GLU B  1 78  ? 108.862 21.264  3.658   1.00 69.72  ? 77   GLU B OE1   1 
ATOM   2057 O  OE2   . GLU B  1 78  ? 110.999 21.593  4.020   1.00 93.69  ? 77   GLU B OE2   1 
ATOM   2058 N  N     . LEU B  1 79  ? 109.531 18.525  -1.241  1.00 57.18  ? 78   LEU B N     1 
ATOM   2059 C  CA    . LEU B  1 79  ? 109.984 17.197  -1.666  1.00 56.00  ? 78   LEU B CA    1 
ATOM   2060 C  C     . LEU B  1 79  ? 110.494 17.176  -3.107  1.00 55.98  ? 78   LEU B C     1 
ATOM   2061 O  O     . LEU B  1 79  ? 111.475 16.497  -3.413  1.00 54.52  ? 78   LEU B O     1 
ATOM   2062 C  CB    . LEU B  1 79  ? 108.874 16.181  -1.485  1.00 55.85  ? 78   LEU B CB    1 
ATOM   2063 C  CG    . LEU B  1 79  ? 108.414 15.963  -0.040  1.00 56.71  ? 78   LEU B CG    1 
ATOM   2064 C  CD1   . LEU B  1 79  ? 107.293 14.894  -0.077  1.00 69.77  ? 78   LEU B CD1   1 
ATOM   2065 C  CD2   . LEU B  1 79  ? 109.565 15.543  0.860   1.00 62.02  ? 78   LEU B CD2   1 
ATOM   2066 N  N     . LEU B  1 80  ? 109.832 17.917  -3.982  1.00 56.49  ? 79   LEU B N     1 
ATOM   2067 C  CA    . LEU B  1 80  ? 110.283 18.068  -5.378  1.00 57.67  ? 79   LEU B CA    1 
ATOM   2068 C  C     . LEU B  1 80  ? 111.605 18.781  -5.485  1.00 57.35  ? 79   LEU B C     1 
ATOM   2069 O  O     . LEU B  1 80  ? 112.513 18.333  -6.185  1.00 57.76  ? 79   LEU B O     1 
ATOM   2070 C  CB    . LEU B  1 80  ? 109.295 18.885  -6.187  1.00 55.75  ? 79   LEU B CB    1 
ATOM   2071 C  CG    . LEU B  1 80  ? 108.214 18.065  -6.851  1.00 74.31  ? 79   LEU B CG    1 
ATOM   2072 C  CD1   . LEU B  1 80  ? 107.038 18.940  -7.220  1.00 84.51  ? 79   LEU B CD1   1 
ATOM   2073 C  CD2   . LEU B  1 80  ? 108.802 17.360  -8.083  1.00 73.56  ? 79   LEU B CD2   1 
ATOM   2074 N  N     . LYS B  1 81  ? 111.700 19.920  -4.815  1.00 58.21  ? 80   LYS B N     1 
ATOM   2075 C  CA    . LYS B  1 81  ? 112.928 20.706  -4.837  1.00 56.49  ? 80   LYS B CA    1 
ATOM   2076 C  C     . LYS B  1 81  ? 114.096 19.840  -4.373  1.00 58.29  ? 80   LYS B C     1 
ATOM   2077 O  O     . LYS B  1 81  ? 115.131 19.801  -5.010  1.00 61.40  ? 80   LYS B O     1 
ATOM   2078 C  CB    . LYS B  1 81  ? 112.789 21.935  -3.940  1.00 55.93  ? 80   LYS B CB    1 
ATOM   2079 C  CG    . LYS B  1 81  ? 113.999 22.870  -3.961  1.00 61.52  ? 80   LYS B CG    1 
ATOM   2080 C  CD    . LYS B  1 81  ? 113.657 24.291  -3.496  1.00 76.44  ? 80   LYS B CD    1 
ATOM   2081 C  CE    . LYS B  1 81  ? 114.900 25.246  -3.545  1.00 85.23  ? 80   LYS B CE    1 
ATOM   2082 N  NZ    . LYS B  1 81  ? 115.522 25.371  -4.927  1.00 97.82  ? 80   LYS B NZ    1 
ATOM   2083 N  N     . GLU B  1 82  ? 113.922 19.128  -3.270  1.00 55.82  ? 81   GLU B N     1 
ATOM   2084 C  CA    . GLU B  1 82  ? 114.993 18.272  -2.762  1.00 56.68  ? 81   GLU B CA    1 
ATOM   2085 C  C     . GLU B  1 82  ? 115.420 17.184  -3.745  1.00 57.06  ? 81   GLU B C     1 
ATOM   2086 O  O     . GLU B  1 82  ? 116.597 16.851  -3.842  1.00 59.25  ? 81   GLU B O     1 
ATOM   2087 C  CB    . GLU B  1 82  ? 114.569 17.631  -1.450  1.00 59.67  ? 81   GLU B CB    1 
ATOM   2088 C  CG    . GLU B  1 82  ? 114.671 18.625  -0.319  1.00 62.57  ? 81   GLU B CG    1 
ATOM   2089 C  CD    . GLU B  1 82  ? 114.023 18.150  0.969   1.00 69.02  ? 81   GLU B CD    1 
ATOM   2090 O  OE1   . GLU B  1 82  ? 113.615 16.974  1.053   1.00 64.27  ? 81   GLU B OE1   1 
ATOM   2091 O  OE2   . GLU B  1 82  ? 113.937 18.977  1.893   1.00 63.83  ? 81   GLU B OE2   1 
ATOM   2092 N  N     . ALA B  1 83  ? 114.456 16.617  -4.452  1.00 57.12  ? 82   ALA B N     1 
ATOM   2093 C  CA    . ALA B  1 83  ? 114.727 15.526  -5.370  1.00 57.07  ? 82   ALA B CA    1 
ATOM   2094 C  C     . ALA B  1 83  ? 115.455 16.097  -6.569  1.00 58.02  ? 82   ALA B C     1 
ATOM   2095 O  O     . ALA B  1 83  ? 116.426 15.518  -7.059  1.00 56.39  ? 82   ALA B O     1 
ATOM   2096 C  CB    . ALA B  1 83  ? 113.440 14.875  -5.779  1.00 57.02  ? 82   ALA B CB    1 
ATOM   2097 N  N     . MET B  1 84  ? 115.014 17.283  -6.978  1.00 57.09  ? 83   MET B N     1 
ATOM   2098 C  CA    . MET B  1 84  ? 115.599 17.973  -8.104  1.00 56.09  ? 83   MET B CA    1 
ATOM   2099 C  C     . MET B  1 84  ? 117.008 18.457  -7.797  1.00 55.94  ? 83   MET B C     1 
ATOM   2100 O  O     . MET B  1 84  ? 117.928 18.274  -8.596  1.00 57.02  ? 83   MET B O     1 
ATOM   2101 C  CB    . MET B  1 84  ? 114.697 19.120  -8.534  1.00 53.98  ? 83   MET B CB    1 
ATOM   2102 C  CG    . MET B  1 84  ? 113.420 18.650  -9.191  1.00 52.86  ? 83   MET B CG    1 
ATOM   2103 S  SD    . MET B  1 84  ? 112.363 20.023  -9.617  1.00 61.03  ? 83   MET B SD    1 
ATOM   2104 C  CE    . MET B  1 84  ? 113.229 20.671  -11.056 1.00 66.46  ? 83   MET B CE    1 
ATOM   2105 N  N     . VAL B  1 85  ? 117.179 19.045  -6.628  1.00 60.30  ? 84   VAL B N     1 
ATOM   2106 C  CA    . VAL B  1 85  ? 118.502 19.441  -6.163  1.00 62.51  ? 84   VAL B CA    1 
ATOM   2107 C  C     . VAL B  1 85  ? 119.448 18.239  -6.047  1.00 59.83  ? 84   VAL B C     1 
ATOM   2108 O  O     . VAL B  1 85  ? 120.596 18.329  -6.434  1.00 61.61  ? 84   VAL B O     1 
ATOM   2109 C  CB    . VAL B  1 85  ? 118.422 20.218  -4.833  1.00 65.08  ? 84   VAL B CB    1 
ATOM   2110 C  CG1   . VAL B  1 85  ? 119.794 20.337  -4.182  1.00 57.28  ? 84   VAL B CG1   1 
ATOM   2111 C  CG2   . VAL B  1 85  ? 117.841 21.591  -5.087  1.00 63.07  ? 84   VAL B CG2   1 
ATOM   2112 N  N     . ALA B  1 86  ? 118.962 17.122  -5.529  1.00 60.33  ? 85   ALA B N     1 
ATOM   2113 C  CA    . ALA B  1 86  ? 119.783 15.914  -5.434  1.00 59.46  ? 85   ALA B CA    1 
ATOM   2114 C  C     . ALA B  1 86  ? 120.194 15.356  -6.800  1.00 61.52  ? 85   ALA B C     1 
ATOM   2115 O  O     . ALA B  1 86  ? 121.180 14.652  -6.899  1.00 62.58  ? 85   ALA B O     1 
ATOM   2116 C  CB    . ALA B  1 86  ? 119.041 14.847  -4.646  1.00 60.18  ? 85   ALA B CB    1 
ATOM   2117 N  N     . SER B  1 87  ? 119.433 15.649  -7.851  1.00 64.49  ? 86   SER B N     1 
ATOM   2118 C  CA    . SER B  1 87  ? 119.718 15.080  -9.167  1.00 64.59  ? 86   SER B CA    1 
ATOM   2119 C  C     . SER B  1 87  ? 120.486 15.988  -10.104 1.00 62.89  ? 86   SER B C     1 
ATOM   2120 O  O     . SER B  1 87  ? 120.948 15.509  -11.115 1.00 62.07  ? 86   SER B O     1 
ATOM   2121 C  CB    . SER B  1 87  ? 118.421 14.643  -9.867  1.00 62.59  ? 86   SER B CB    1 
ATOM   2122 O  OG    . SER B  1 87  ? 117.691 13.740  -9.057  1.00 79.01  ? 86   SER B OG    1 
ATOM   2123 N  N     . LEU B  1 88  ? 120.588 17.285  -9.803  1.00 66.26  ? 87   LEU B N     1 
ATOM   2124 C  CA    . LEU B  1 88  ? 121.321 18.232  -10.656 1.00 71.02  ? 87   LEU B CA    1 
ATOM   2125 C  C     . LEU B  1 88  ? 122.774 17.788  -10.927 1.00 74.59  ? 87   LEU B C     1 
ATOM   2126 O  O     . LEU B  1 88  ? 123.368 17.017  -10.162 1.00 75.35  ? 87   LEU B O     1 
ATOM   2127 C  CB    . LEU B  1 88  ? 121.346 19.622  -10.023 1.00 68.62  ? 87   LEU B CB    1 
ATOM   2128 C  CG    . LEU B  1 88  ? 120.157 20.559  -10.199 1.00 76.41  ? 87   LEU B CG    1 
ATOM   2129 C  CD1   . LEU B  1 88  ? 120.407 21.791  -9.339  1.00 81.74  ? 87   LEU B CD1   1 
ATOM   2130 C  CD2   . LEU B  1 88  ? 119.927 20.959  -11.654 1.00 74.47  ? 87   LEU B CD2   1 
ATOM   2131 N  N     . GLY B  1 89  ? 123.352 18.291  -12.008 1.00 75.02  ? 88   GLY B N     1 
ATOM   2132 C  CA    . GLY B  1 89  ? 124.698 17.881  -12.394 1.00 77.25  ? 88   GLY B CA    1 
ATOM   2133 C  C     . GLY B  1 89  ? 124.614 16.626  -13.239 1.00 77.82  ? 88   GLY B C     1 
ATOM   2134 O  O     . GLY B  1 89  ? 124.799 16.684  -14.458 1.00 80.81  ? 88   GLY B O     1 
ATOM   2135 N  N     . ASP B  1 90  ? 124.297 15.494  -12.608 1.00 77.63  ? 89   ASP B N     1 
ATOM   2136 C  CA    . ASP B  1 90  ? 124.075 14.242  -13.353 1.00 78.90  ? 89   ASP B CA    1 
ATOM   2137 C  C     . ASP B  1 90  ? 122.608 14.100  -13.837 1.00 77.43  ? 89   ASP B C     1 
ATOM   2138 O  O     . ASP B  1 90  ? 121.950 13.083  -13.570 1.00 80.91  ? 89   ASP B O     1 
ATOM   2139 C  CB    . ASP B  1 90  ? 124.531 13.014  -12.537 1.00 79.07  ? 89   ASP B CB    1 
ATOM   2140 C  CG    . ASP B  1 90  ? 123.598 12.682  -11.376 1.00 96.67  ? 89   ASP B CG    1 
ATOM   2141 O  OD1   . ASP B  1 90  ? 123.338 13.566  -10.524 1.00 120.46 ? 89   ASP B OD1   1 
ATOM   2142 O  OD2   . ASP B  1 90  ? 123.129 11.524  -11.312 1.00 108.86 ? 89   ASP B OD2   1 
ATOM   2143 N  N     . THR B  1 91  ? 122.106 15.119  -14.546 1.00 72.18  ? 90   THR B N     1 
ATOM   2144 C  CA    . THR B  1 91  ? 120.734 15.099  -15.085 1.00 68.00  ? 90   THR B CA    1 
ATOM   2145 C  C     . THR B  1 91  ? 120.696 15.543  -16.518 1.00 59.94  ? 90   THR B C     1 
ATOM   2146 O  O     . THR B  1 91  ? 121.351 16.514  -16.876 1.00 57.93  ? 90   THR B O     1 
ATOM   2147 C  CB    . THR B  1 91  ? 119.775 16.111  -14.388 1.00 66.04  ? 90   THR B CB    1 
ATOM   2148 O  OG1   . THR B  1 91  ? 120.297 16.499  -13.119 1.00 88.50  ? 90   THR B OG1   1 
ATOM   2149 C  CG2   . THR B  1 91  ? 118.390 15.516  -14.233 1.00 53.23  ? 90   THR B CG2   1 
ATOM   2150 N  N     . ARG B  1 92  ? 119.855 14.891  -17.309 1.00 58.03  ? 91   ARG B N     1 
ATOM   2151 C  CA    . ARG B  1 92  ? 119.573 15.360  -18.659 1.00 57.81  ? 91   ARG B CA    1 
ATOM   2152 C  C     . ARG B  1 92  ? 118.259 16.147  -18.707 1.00 57.17  ? 91   ARG B C     1 
ATOM   2153 O  O     . ARG B  1 92  ? 117.859 16.623  -19.764 1.00 59.20  ? 91   ARG B O     1 
ATOM   2154 C  CB    . ARG B  1 92  ? 119.554 14.184  -19.644 1.00 62.87  ? 91   ARG B CB    1 
ATOM   2155 C  CG    . ARG B  1 92  ? 120.938 13.549  -19.931 1.00 65.83  ? 91   ARG B CG    1 
ATOM   2156 C  CD    . ARG B  1 92  ? 121.260 12.412  -18.964 1.00 70.43  ? 91   ARG B CD    1 
ATOM   2157 N  N     . GLY B  1 93  ? 117.594 16.294  -17.561 1.00 56.71  ? 92   GLY B N     1 
ATOM   2158 C  CA    . GLY B  1 93  ? 116.316 17.005  -17.493 1.00 54.08  ? 92   GLY B CA    1 
ATOM   2159 C  C     . GLY B  1 93  ? 115.333 16.300  -16.580 1.00 55.93  ? 92   GLY B C     1 
ATOM   2160 O  O     . GLY B  1 93  ? 115.540 15.148  -16.192 1.00 55.55  ? 92   GLY B O     1 
ATOM   2161 N  N     . PHE B  1 94  ? 114.251 17.000  -16.256 1.00 55.45  ? 93   PHE B N     1 
ATOM   2162 C  CA    . PHE B  1 94  ? 113.268 16.525  -15.292 1.00 58.39  ? 93   PHE B CA    1 
ATOM   2163 C  C     . PHE B  1 94  ? 111.950 16.274  -15.987 1.00 58.20  ? 93   PHE B C     1 
ATOM   2164 O  O     . PHE B  1 94  ? 111.443 17.144  -16.695 1.00 59.94  ? 93   PHE B O     1 
ATOM   2165 C  CB    . PHE B  1 94  ? 113.088 17.532  -14.140 1.00 62.84  ? 93   PHE B CB    1 
ATOM   2166 C  CG    . PHE B  1 94  ? 114.270 17.610  -13.237 1.00 50.28  ? 93   PHE B CG    1 
ATOM   2167 C  CD1   . PHE B  1 94  ? 115.186 18.634  -13.355 1.00 60.77  ? 93   PHE B CD1   1 
ATOM   2168 C  CD2   . PHE B  1 94  ? 114.500 16.603  -12.307 1.00 55.25  ? 93   PHE B CD2   1 
ATOM   2169 C  CE1   . PHE B  1 94  ? 116.313 18.672  -12.533 1.00 55.40  ? 93   PHE B CE1   1 
ATOM   2170 C  CE2   . PHE B  1 94  ? 115.604 16.631  -11.484 1.00 54.36  ? 93   PHE B CE2   1 
ATOM   2171 C  CZ    . PHE B  1 94  ? 116.515 17.674  -11.592 1.00 54.64  ? 93   PHE B CZ    1 
ATOM   2172 N  N     . LEU B  1 95  ? 111.424 15.064  -15.790 1.00 59.45  ? 94   LEU B N     1 
ATOM   2173 C  CA    . LEU B  1 95  ? 110.122 14.668  -16.291 1.00 56.45  ? 94   LEU B CA    1 
ATOM   2174 C  C     . LEU B  1 95  ? 109.234 14.516  -15.070 1.00 58.42  ? 94   LEU B C     1 
ATOM   2175 O  O     . LEU B  1 95  ? 109.348 13.554  -14.321 1.00 53.81  ? 94   LEU B O     1 
ATOM   2176 C  CB    . LEU B  1 95  ? 110.238 13.353  -17.063 1.00 60.95  ? 94   LEU B CB    1 
ATOM   2177 C  CG    . LEU B  1 95  ? 108.991 12.762  -17.715 1.00 60.54  ? 94   LEU B CG    1 
ATOM   2178 C  CD1   . LEU B  1 95  ? 108.417 13.738  -18.727 1.00 55.81  ? 94   LEU B CD1   1 
ATOM   2179 C  CD2   . LEU B  1 95  ? 109.317 11.406  -18.358 1.00 52.25  ? 94   LEU B CD2   1 
ATOM   2180 N  N     . ILE B  1 96  ? 108.354 15.489  -14.866 1.00 58.74  ? 95   ILE B N     1 
ATOM   2181 C  CA    . ILE B  1 96  ? 107.479 15.472  -13.710 1.00 59.39  ? 95   ILE B CA    1 
ATOM   2182 C  C     . ILE B  1 96  ? 106.075 14.987  -14.086 1.00 56.76  ? 95   ILE B C     1 
ATOM   2183 O  O     . ILE B  1 96  ? 105.279 15.643  -14.747 1.00 58.51  ? 95   ILE B O     1 
ATOM   2184 C  CB    . ILE B  1 96  ? 107.505 16.823  -12.975 1.00 55.58  ? 95   ILE B CB    1 
ATOM   2185 C  CG1   . ILE B  1 96  ? 108.971 17.207  -12.729 1.00 61.44  ? 95   ILE B CG1   1 
ATOM   2186 C  CG2   . ILE B  1 96  ? 106.751 16.711  -11.641 1.00 58.66  ? 95   ILE B CG2   1 
ATOM   2187 C  CD1   . ILE B  1 96  ? 109.154 18.549  -12.173 1.00 75.18  ? 95   ILE B CD1   1 
ATOM   2188 N  N     . ASP B  1 97  ? 105.799 13.809  -13.594 1.00 59.93  ? 96   ASP B N     1 
ATOM   2189 C  CA    . ASP B  1 97  ? 104.714 12.970  -14.040 1.00 57.14  ? 96   ASP B CA    1 
ATOM   2190 C  C     . ASP B  1 97  ? 103.518 13.170  -13.123 1.00 56.67  ? 96   ASP B C     1 
ATOM   2191 O  O     . ASP B  1 97  ? 103.597 12.919  -11.935 1.00 58.17  ? 96   ASP B O     1 
ATOM   2192 C  CB    . ASP B  1 97  ? 105.264 11.547  -13.977 1.00 59.09  ? 96   ASP B CB    1 
ATOM   2193 C  CG    . ASP B  1 97  ? 104.251 10.489  -14.255 1.00 60.38  ? 96   ASP B CG    1 
ATOM   2194 O  OD1   . ASP B  1 97  ? 103.067 10.828  -14.451 1.00 68.43  ? 96   ASP B OD1   1 
ATOM   2195 O  OD2   . ASP B  1 97  ? 104.673 9.300   -14.274 1.00 60.62  ? 96   ASP B OD2   1 
ATOM   2196 N  N     . GLY B  1 98  ? 102.408 13.624  -13.685 1.00 60.36  ? 97   GLY B N     1 
ATOM   2197 C  CA    . GLY B  1 98  ? 101.145 13.752  -12.945 1.00 60.80  ? 97   GLY B CA    1 
ATOM   2198 C  C     . GLY B  1 98  ? 101.018 15.052  -12.172 1.00 59.90  ? 97   GLY B C     1 
ATOM   2199 O  O     . GLY B  1 98  ? 100.219 15.153  -11.240 1.00 66.48  ? 97   GLY B O     1 
ATOM   2200 N  N     . TYR B  1 99  ? 101.781 16.056  -12.578 1.00 61.72  ? 98   TYR B N     1 
ATOM   2201 C  CA    . TYR B  1 99  ? 101.928 17.297  -11.824 1.00 65.78  ? 98   TYR B CA    1 
ATOM   2202 C  C     . TYR B  1 99  ? 101.698 18.499  -12.743 1.00 65.45  ? 98   TYR B C     1 
ATOM   2203 O  O     . TYR B  1 99  ? 102.075 18.428  -13.915 1.00 62.67  ? 98   TYR B O     1 
ATOM   2204 C  CB    . TYR B  1 99  ? 103.345 17.370  -11.308 1.00 61.76  ? 98   TYR B CB    1 
ATOM   2205 C  CG    . TYR B  1 99  ? 103.616 18.496  -10.359 1.00 66.39  ? 98   TYR B CG    1 
ATOM   2206 C  CD1   . TYR B  1 99  ? 103.329 18.361  -9.004  1.00 59.22  ? 98   TYR B CD1   1 
ATOM   2207 C  CD2   . TYR B  1 99  ? 104.179 19.688  -10.806 1.00 64.45  ? 98   TYR B CD2   1 
ATOM   2208 C  CE1   . TYR B  1 99  ? 103.576 19.377  -8.127  1.00 64.50  ? 98   TYR B CE1   1 
ATOM   2209 C  CE2   . TYR B  1 99  ? 104.447 20.719  -9.923  1.00 62.52  ? 98   TYR B CE2   1 
ATOM   2210 C  CZ    . TYR B  1 99  ? 104.140 20.555  -8.583  1.00 56.87  ? 98   TYR B CZ    1 
ATOM   2211 O  OH    . TYR B  1 99  ? 104.394 21.560  -7.685  1.00 62.45  ? 98   TYR B OH    1 
ATOM   2212 N  N     . PRO B  1 100 ? 101.081 19.589  -12.216 1.00 62.59  ? 99   PRO B N     1 
ATOM   2213 C  CA    . PRO B  1 100 ? 100.518 19.740  -10.857 1.00 60.80  ? 99   PRO B CA    1 
ATOM   2214 C  C     . PRO B  1 100 ? 99.072  19.253  -10.762 1.00 60.40  ? 99   PRO B C     1 
ATOM   2215 O  O     . PRO B  1 100 ? 98.436  19.020  -11.780 1.00 60.95  ? 99   PRO B O     1 
ATOM   2216 C  CB    . PRO B  1 100 ? 100.574 21.243  -10.634 1.00 62.71  ? 99   PRO B CB    1 
ATOM   2217 C  CG    . PRO B  1 100 ? 100.318 21.812  -12.004 1.00 67.28  ? 99   PRO B CG    1 
ATOM   2218 C  CD    . PRO B  1 100 ? 100.888 20.819  -13.005 1.00 62.39  ? 99   PRO B CD    1 
ATOM   2219 N  N     . ARG B  1 101 ? 98.574  19.105  -9.537  1.00 60.30  ? 100  ARG B N     1 
ATOM   2220 C  CA    . ARG B  1 101 ? 97.177  18.702  -9.275  1.00 60.33  ? 100  ARG B CA    1 
ATOM   2221 C  C     . ARG B  1 101 ? 96.180  19.868  -9.441  1.00 58.17  ? 100  ARG B C     1 
ATOM   2222 O  O     . ARG B  1 101 ? 94.980  19.646  -9.632  1.00 54.62  ? 100  ARG B O     1 
ATOM   2223 C  CB    . ARG B  1 101 ? 97.054  18.152  -7.842  1.00 61.40  ? 100  ARG B CB    1 
ATOM   2224 C  CG    . ARG B  1 101 ? 97.773  19.038  -6.820  1.00 62.27  ? 100  ARG B CG    1 
ATOM   2225 C  CD    . ARG B  1 101 ? 97.162  19.213  -5.469  1.00 65.42  ? 100  ARG B CD    1 
ATOM   2226 N  NE    . ARG B  1 101 ? 97.897  18.522  -4.434  1.00 75.59  ? 100  ARG B NE    1 
ATOM   2227 C  CZ    . ARG B  1 101 ? 98.290  18.997  -3.247  1.00 69.36  ? 100  ARG B CZ    1 
ATOM   2228 N  NH1   . ARG B  1 101 ? 98.064  20.240  -2.825  1.00 74.55  ? 100  ARG B NH1   1 
ATOM   2229 N  NH2   . ARG B  1 101 ? 98.915  18.161  -2.435  1.00 61.70  ? 100  ARG B NH2   1 
ATOM   2230 N  N     . GLU B  1 102 ? 96.698  21.098  -9.356  1.00 56.97  ? 101  GLU B N     1 
ATOM   2231 C  CA    A GLU B  1 102 ? 95.885  22.314  -9.403  0.50 55.69  ? 101  GLU B CA    1 
ATOM   2232 C  CA    B GLU B  1 102 ? 95.884  22.324  -9.352  0.50 55.24  ? 101  GLU B CA    1 
ATOM   2233 C  C     . GLU B  1 102 ? 96.726  23.482  -9.895  1.00 52.78  ? 101  GLU B C     1 
ATOM   2234 O  O     . GLU B  1 102 ? 97.947  23.440  -9.835  1.00 54.14  ? 101  GLU B O     1 
ATOM   2235 C  CB    A GLU B  1 102 ? 95.356  22.624  -8.019  0.50 50.55  ? 101  GLU B CB    1 
ATOM   2236 C  CB    B GLU B  1 102 ? 95.305  22.592  -7.937  0.50 50.52  ? 101  GLU B CB    1 
ATOM   2237 C  CG    A GLU B  1 102 ? 96.367  22.237  -6.977  0.50 55.64  ? 101  GLU B CG    1 
ATOM   2238 C  CG    B GLU B  1 102 ? 95.594  23.971  -7.272  0.50 51.99  ? 101  GLU B CG    1 
ATOM   2239 C  CD    A GLU B  1 102 ? 96.201  22.931  -5.687  0.50 52.09  ? 101  GLU B CD    1 
ATOM   2240 C  CD    B GLU B  1 102 ? 94.378  24.912  -7.195  0.50 59.76  ? 101  GLU B CD    1 
ATOM   2241 O  OE1   A GLU B  1 102 ? 95.603  24.027  -5.667  0.50 65.58  ? 101  GLU B OE1   1 
ATOM   2242 O  OE1   B GLU B  1 102 ? 93.448  24.596  -6.424  0.50 67.25  ? 101  GLU B OE1   1 
ATOM   2243 O  OE2   A GLU B  1 102 ? 96.696  22.376  -4.690  0.50 44.96  ? 101  GLU B OE2   1 
ATOM   2244 O  OE2   B GLU B  1 102 ? 94.358  25.982  -7.865  0.50 46.27  ? 101  GLU B OE2   1 
ATOM   2245 N  N     . VAL B  1 103 ? 96.056  24.508  -10.403 1.00 55.47  ? 102  VAL B N     1 
ATOM   2246 C  CA    . VAL B  1 103 ? 96.715  25.648  -11.038 1.00 55.78  ? 102  VAL B CA    1 
ATOM   2247 C  C     . VAL B  1 103 ? 97.623  26.395  -10.069 1.00 56.21  ? 102  VAL B C     1 
ATOM   2248 O  O     . VAL B  1 103 ? 98.724  26.761  -10.433 1.00 59.71  ? 102  VAL B O     1 
ATOM   2249 C  CB    . VAL B  1 103 ? 95.678  26.632  -11.628 1.00 58.08  ? 102  VAL B CB    1 
ATOM   2250 C  CG1   . VAL B  1 103 ? 96.345  27.936  -12.101 1.00 59.09  ? 102  VAL B CG1   1 
ATOM   2251 C  CG2   . VAL B  1 103 ? 94.882  25.975  -12.771 1.00 48.22  ? 102  VAL B CG2   1 
ATOM   2252 N  N     . LYS B  1 104 ? 97.149  26.641  -8.855  1.00 53.54  ? 103  LYS B N     1 
ATOM   2253 C  CA    . LYS B  1 104 ? 97.930  27.379  -7.856  1.00 58.07  ? 103  LYS B CA    1 
ATOM   2254 C  C     . LYS B  1 104 ? 99.211  26.667  -7.444  1.00 52.51  ? 103  LYS B C     1 
ATOM   2255 O  O     . LYS B  1 104 ? 100.177 27.307  -7.113  1.00 53.03  ? 103  LYS B O     1 
ATOM   2256 C  CB    . LYS B  1 104 ? 97.085  27.699  -6.604  1.00 58.23  ? 103  LYS B CB    1 
ATOM   2257 C  CG    . LYS B  1 104 ? 96.132  28.886  -6.808  1.00 64.92  ? 103  LYS B CG    1 
ATOM   2258 C  CD    . LYS B  1 104 ? 95.265  29.174  -5.578  1.00 63.70  ? 103  LYS B CD    1 
ATOM   2259 N  N     . GLN B  1 105 ? 99.207  25.343  -7.458  1.00 55.92  ? 104  GLN B N     1 
ATOM   2260 C  CA    . GLN B  1 105 ? 100.399 24.572  -7.154  1.00 57.13  ? 104  GLN B CA    1 
ATOM   2261 C  C     . GLN B  1 105 ? 101.403 24.729  -8.303  1.00 59.81  ? 104  GLN B C     1 
ATOM   2262 O  O     . GLN B  1 105 ? 102.605 24.894  -8.075  1.00 62.78  ? 104  GLN B O     1 
ATOM   2263 C  CB    . GLN B  1 105 ? 100.022 23.116  -6.919  1.00 56.17  ? 104  GLN B CB    1 
ATOM   2264 C  CG    . GLN B  1 105 ? 101.166 22.233  -6.524  1.00 59.54  ? 104  GLN B CG    1 
ATOM   2265 C  CD    . GLN B  1 105 ? 100.810 20.767  -6.574  1.00 72.95  ? 104  GLN B CD    1 
ATOM   2266 O  OE1   . GLN B  1 105 ? 100.229 20.286  -7.560  1.00 63.97  ? 104  GLN B OE1   1 
ATOM   2267 N  NE2   . GLN B  1 105 ? 101.174 20.033  -5.513  1.00 63.36  ? 104  GLN B NE2   1 
ATOM   2268 N  N     . GLY B  1 106 ? 100.906 24.697  -9.537  1.00 60.24  ? 105  GLY B N     1 
ATOM   2269 C  CA    . GLY B  1 106 ? 101.743 24.955  -10.699 1.00 59.34  ? 105  GLY B CA    1 
ATOM   2270 C  C     . GLY B  1 106 ? 102.356 26.339  -10.708 1.00 58.09  ? 105  GLY B C     1 
ATOM   2271 O  O     . GLY B  1 106 ? 103.523 26.496  -11.031 1.00 58.35  ? 105  GLY B O     1 
ATOM   2272 N  N     . GLU B  1 107 ? 101.559 27.348  -10.360 1.00 57.62  ? 106  GLU B N     1 
ATOM   2273 C  CA    . GLU B  1 107 ? 102.043 28.716  -10.268 1.00 56.34  ? 106  GLU B CA    1 
ATOM   2274 C  C     . GLU B  1 107 ? 103.164 28.857  -9.243  1.00 56.08  ? 106  GLU B C     1 
ATOM   2275 O  O     . GLU B  1 107 ? 104.187 29.466  -9.513  1.00 56.62  ? 106  GLU B O     1 
ATOM   2276 C  CB    . GLU B  1 107 ? 100.901 29.674  -9.912  1.00 60.16  ? 106  GLU B CB    1 
ATOM   2277 C  CG    . GLU B  1 107 ? 99.870  29.840  -11.022 1.00 64.82  ? 106  GLU B CG    1 
ATOM   2278 C  CD    . GLU B  1 107 ? 98.709  30.747  -10.638 1.00 56.67  ? 106  GLU B CD    1 
ATOM   2279 O  OE1   . GLU B  1 107 ? 98.217  30.656  -9.488  1.00 68.54  ? 106  GLU B OE1   1 
ATOM   2280 O  OE2   . GLU B  1 107 ? 98.284  31.544  -11.500 1.00 68.27  ? 106  GLU B OE2   1 
ATOM   2281 N  N     . GLU B  1 108 ? 102.956 28.292  -8.062  1.00 57.00  ? 107  GLU B N     1 
ATOM   2282 C  CA    . GLU B  1 108 ? 103.972 28.291  -7.000  1.00 58.20  ? 107  GLU B CA    1 
ATOM   2283 C  C     . GLU B  1 108 ? 105.258 27.543  -7.445  1.00 54.15  ? 107  GLU B C     1 
ATOM   2284 O  O     . GLU B  1 108 ? 106.383 27.961  -7.155  1.00 52.87  ? 107  GLU B O     1 
ATOM   2285 C  CB    . GLU B  1 108 ? 103.350 27.692  -5.720  1.00 50.98  ? 107  GLU B CB    1 
ATOM   2286 C  CG    . GLU B  1 108 ? 104.106 27.929  -4.449  1.00 62.00  ? 107  GLU B CG    1 
ATOM   2287 C  CD    . GLU B  1 108 ? 103.696 26.971  -3.274  1.00 71.71  ? 107  GLU B CD    1 
ATOM   2288 O  OE1   . GLU B  1 108 ? 103.077 25.877  -3.489  1.00 63.57  ? 107  GLU B OE1   1 
ATOM   2289 O  OE2   . GLU B  1 108 ? 104.032 27.329  -2.118  1.00 68.42  ? 107  GLU B OE2   1 
ATOM   2290 N  N     . PHE B  1 109 ? 105.098 26.447  -8.170  1.00 55.20  ? 108  PHE B N     1 
ATOM   2291 C  CA    . PHE B  1 109 ? 106.260 25.756  -8.759  1.00 57.38  ? 108  PHE B CA    1 
ATOM   2292 C  C     . PHE B  1 109 ? 107.041 26.679  -9.677  1.00 56.15  ? 108  PHE B C     1 
ATOM   2293 O  O     . PHE B  1 109 ? 108.279 26.722  -9.648  1.00 56.01  ? 108  PHE B O     1 
ATOM   2294 C  CB    . PHE B  1 109 ? 105.830 24.538  -9.584  1.00 59.88  ? 108  PHE B CB    1 
ATOM   2295 C  CG    . PHE B  1 109 ? 106.988 23.715  -10.092 1.00 57.75  ? 108  PHE B CG    1 
ATOM   2296 C  CD1   . PHE B  1 109 ? 107.397 22.577  -9.413  1.00 54.15  ? 108  PHE B CD1   1 
ATOM   2297 C  CD2   . PHE B  1 109 ? 107.672 24.083  -11.247 1.00 53.33  ? 108  PHE B CD2   1 
ATOM   2298 C  CE1   . PHE B  1 109 ? 108.464 21.827  -9.886  1.00 69.62  ? 108  PHE B CE1   1 
ATOM   2299 C  CE2   . PHE B  1 109 ? 108.753 23.336  -11.716 1.00 60.48  ? 108  PHE B CE2   1 
ATOM   2300 C  CZ    . PHE B  1 109 ? 109.138 22.210  -11.041 1.00 57.47  ? 108  PHE B CZ    1 
ATOM   2301 N  N     . GLY B  1 110 ? 106.299 27.373  -10.534 1.00 58.53  ? 109  GLY B N     1 
ATOM   2302 C  CA    . GLY B  1 110 ? 106.876 28.334  -11.453 1.00 57.37  ? 109  GLY B CA    1 
ATOM   2303 C  C     . GLY B  1 110 ? 107.718 29.356  -10.724 1.00 58.81  ? 109  GLY B C     1 
ATOM   2304 O  O     . GLY B  1 110 ? 108.880 29.523  -11.036 1.00 63.76  ? 109  GLY B O     1 
ATOM   2305 N  N     . ARG B  1 111 ? 107.129 30.037  -9.750  1.00 58.19  ? 110  ARG B N     1 
ATOM   2306 C  CA    . ARG B  1 111 ? 107.832 31.029  -8.924  1.00 58.79  ? 110  ARG B CA    1 
ATOM   2307 C  C     . ARG B  1 111 ? 109.029 30.499  -8.098  1.00 59.24  ? 110  ARG B C     1 
ATOM   2308 O  O     . ARG B  1 111 ? 110.025 31.191  -7.960  1.00 62.00  ? 110  ARG B O     1 
ATOM   2309 C  CB    . ARG B  1 111 ? 106.852 31.657  -7.921  1.00 60.01  ? 110  ARG B CB    1 
ATOM   2310 C  CG    . ARG B  1 111 ? 105.979 32.767  -8.445  1.00 72.27  ? 110  ARG B CG    1 
ATOM   2311 C  CD    . ARG B  1 111 ? 105.020 33.283  -7.357  1.00 71.52  ? 110  ARG B CD    1 
ATOM   2312 N  NE    . ARG B  1 111 ? 103.639 32.896  -7.660  1.00 91.52  ? 110  ARG B NE    1 
ATOM   2313 C  CZ    . ARG B  1 111 ? 102.877 32.052  -6.953  1.00 96.28  ? 110  ARG B CZ    1 
ATOM   2314 N  NH1   . ARG B  1 111 ? 101.642 31.805  -7.389  1.00 92.13  ? 110  ARG B NH1   1 
ATOM   2315 N  NH2   . ARG B  1 111 ? 103.309 31.461  -5.826  1.00 71.85  ? 110  ARG B NH2   1 
ATOM   2316 N  N     . ARG B  1 112 ? 108.911 29.323  -7.479  1.00 59.09  ? 111  ARG B N     1 
ATOM   2317 C  CA    . ARG B  1 112 ? 109.922 28.878  -6.498  1.00 58.49  ? 111  ARG B CA    1 
ATOM   2318 C  C     . ARG B  1 112 ? 110.967 27.924  -7.072  1.00 56.45  ? 111  ARG B C     1 
ATOM   2319 O  O     . ARG B  1 112 ? 111.968 27.662  -6.438  1.00 54.97  ? 111  ARG B O     1 
ATOM   2320 C  CB    . ARG B  1 112 ? 109.243 28.191  -5.315  1.00 63.26  ? 111  ARG B CB    1 
ATOM   2321 C  CG    . ARG B  1 112 ? 108.108 28.998  -4.657  1.00 74.21  ? 111  ARG B CG    1 
ATOM   2322 C  CD    . ARG B  1 112 ? 108.606 29.984  -3.642  1.00 83.31  ? 111  ARG B CD    1 
ATOM   2323 N  NE    . ARG B  1 112 ? 107.567 30.961  -3.291  1.00 105.66 ? 111  ARG B NE    1 
ATOM   2324 C  CZ    . ARG B  1 112 ? 107.480 32.220  -3.748  1.00 102.01 ? 111  ARG B CZ    1 
ATOM   2325 N  NH1   . ARG B  1 112 ? 108.373 32.730  -4.601  1.00 95.34  ? 111  ARG B NH1   1 
ATOM   2326 N  NH2   . ARG B  1 112 ? 106.478 32.989  -3.335  1.00 89.51  ? 111  ARG B NH2   1 
ATOM   2327 N  N     . ILE B  1 113 ? 110.719 27.362  -8.252  1.00 58.13  ? 112  ILE B N     1 
ATOM   2328 C  CA    . ILE B  1 113 ? 111.646 26.398  -8.841  1.00 58.55  ? 112  ILE B CA    1 
ATOM   2329 C  C     . ILE B  1 113 ? 111.943 26.825  -10.270 1.00 59.08  ? 112  ILE B C     1 
ATOM   2330 O  O     . ILE B  1 113 ? 113.054 27.216  -10.576 1.00 62.00  ? 112  ILE B O     1 
ATOM   2331 C  CB    . ILE B  1 113 ? 111.105 24.935  -8.756  1.00 58.09  ? 112  ILE B CB    1 
ATOM   2332 C  CG1   . ILE B  1 113 ? 111.017 24.486  -7.289  1.00 60.87  ? 112  ILE B CG1   1 
ATOM   2333 C  CG2   . ILE B  1 113 ? 111.995 23.952  -9.528  1.00 57.75  ? 112  ILE B CG2   1 
ATOM   2334 C  CD1   . ILE B  1 113 ? 110.609 23.009  -7.108  1.00 63.93  ? 112  ILE B CD1   1 
ATOM   2335 N  N     . GLY B  1 114 ? 110.937 26.795  -11.126 1.00 58.74  ? 113  GLY B N     1 
ATOM   2336 C  CA    . GLY B  1 114 ? 111.146 27.147  -12.517 1.00 60.31  ? 113  GLY B CA    1 
ATOM   2337 C  C     . GLY B  1 114 ? 109.924 26.828  -13.341 1.00 60.96  ? 113  GLY B C     1 
ATOM   2338 O  O     . GLY B  1 114 ? 109.086 25.971  -12.969 1.00 60.78  ? 113  GLY B O     1 
ATOM   2339 N  N     . ASP B  1 115 ? 109.799 27.528  -14.457 1.00 57.89  ? 114  ASP B N     1 
ATOM   2340 C  CA    . ASP B  1 115 ? 108.691 27.282  -15.356 1.00 59.22  ? 114  ASP B CA    1 
ATOM   2341 C  C     . ASP B  1 115 ? 109.044 26.086  -16.221 1.00 56.48  ? 114  ASP B C     1 
ATOM   2342 O  O     . ASP B  1 115 ? 110.170 25.985  -16.724 1.00 58.37  ? 114  ASP B O     1 
ATOM   2343 C  CB    . ASP B  1 115 ? 108.403 28.520  -16.193 1.00 55.97  ? 114  ASP B CB    1 
ATOM   2344 C  CG    . ASP B  1 115 ? 108.148 29.733  -15.334 1.00 71.33  ? 114  ASP B CG    1 
ATOM   2345 O  OD1   . ASP B  1 115 ? 107.279 29.639  -14.445 1.00 71.26  ? 114  ASP B OD1   1 
ATOM   2346 O  OD2   . ASP B  1 115 ? 108.835 30.765  -15.522 1.00 78.27  ? 114  ASP B OD2   1 
ATOM   2347 N  N     . PRO B  1 116 ? 108.098 25.164  -16.381 1.00 55.79  ? 115  PRO B N     1 
ATOM   2348 C  CA    . PRO B  1 116 ? 108.346 24.066  -17.298 1.00 57.86  ? 115  PRO B CA    1 
ATOM   2349 C  C     . PRO B  1 116 ? 108.394 24.584  -18.727 1.00 56.64  ? 115  PRO B C     1 
ATOM   2350 O  O     . PRO B  1 116 ? 107.588 25.425  -19.098 1.00 54.44  ? 115  PRO B O     1 
ATOM   2351 C  CB    . PRO B  1 116 ? 107.112 23.183  -17.123 1.00 54.42  ? 115  PRO B CB    1 
ATOM   2352 C  CG    . PRO B  1 116 ? 106.063 24.136  -16.686 1.00 59.11  ? 115  PRO B CG    1 
ATOM   2353 C  CD    . PRO B  1 116 ? 106.751 25.084  -15.789 1.00 55.86  ? 115  PRO B CD    1 
ATOM   2354 N  N     . GLN B  1 117 ? 109.314 24.064  -19.524 1.00 56.50  ? 116  GLN B N     1 
ATOM   2355 C  CA    . GLN B  1 117 ? 109.386 24.431  -20.932 1.00 57.38  ? 116  GLN B CA    1 
ATOM   2356 C  C     . GLN B  1 117 ? 108.255 23.754  -21.741 1.00 57.17  ? 116  GLN B C     1 
ATOM   2357 O  O     . GLN B  1 117 ? 107.819 24.258  -22.764 1.00 59.53  ? 116  GLN B O     1 
ATOM   2358 C  CB    . GLN B  1 117 ? 110.764 24.069  -21.484 1.00 56.53  ? 116  GLN B CB    1 
ATOM   2359 C  CG    . GLN B  1 117 ? 111.897 24.963  -20.966 1.00 61.96  ? 116  GLN B CG    1 
ATOM   2360 C  CD    . GLN B  1 117 ? 112.528 24.493  -19.660 1.00 68.63  ? 116  GLN B CD    1 
ATOM   2361 O  OE1   . GLN B  1 117 ? 112.456 23.324  -19.307 1.00 60.76  ? 116  GLN B OE1   1 
ATOM   2362 N  NE2   . GLN B  1 117 ? 113.154 25.414  -18.943 1.00 68.41  ? 116  GLN B NE2   1 
ATOM   2363 N  N     . LEU B  1 118 ? 107.741 22.643  -21.235 1.00 58.41  ? 117  LEU B N     1 
ATOM   2364 C  CA    . LEU B  1 118 ? 106.719 21.872  -21.927 1.00 56.59  ? 117  LEU B CA    1 
ATOM   2365 C  C     . LEU B  1 118 ? 105.812 21.170  -20.903 1.00 57.19  ? 117  LEU B C     1 
ATOM   2366 O  O     . LEU B  1 118 ? 106.311 20.561  -19.957 1.00 51.03  ? 117  LEU B O     1 
ATOM   2367 C  CB    . LEU B  1 118 ? 107.436 20.833  -22.799 1.00 60.27  ? 117  LEU B CB    1 
ATOM   2368 C  CG    . LEU B  1 118 ? 106.634 19.956  -23.751 1.00 67.77  ? 117  LEU B CG    1 
ATOM   2369 C  CD1   . LEU B  1 118 ? 105.889 20.797  -24.753 1.00 75.16  ? 117  LEU B CD1   1 
ATOM   2370 C  CD2   . LEU B  1 118 ? 107.572 19.010  -24.435 1.00 63.62  ? 117  LEU B CD2   1 
ATOM   2371 N  N     . VAL B  1 119 ? 104.496 21.305  -21.090 1.00 56.59  ? 118  VAL B N     1 
ATOM   2372 C  CA    . VAL B  1 119 ? 103.495 20.492  -20.403 1.00 55.73  ? 118  VAL B CA    1 
ATOM   2373 C  C     . VAL B  1 119 ? 102.834 19.551  -21.439 1.00 57.26  ? 118  VAL B C     1 
ATOM   2374 O  O     . VAL B  1 119 ? 102.100 19.983  -22.325 1.00 56.75  ? 118  VAL B O     1 
ATOM   2375 C  CB    . VAL B  1 119 ? 102.437 21.359  -19.676 1.00 55.13  ? 118  VAL B CB    1 
ATOM   2376 C  CG1   . VAL B  1 119 ? 101.460 20.481  -18.865 1.00 59.39  ? 118  VAL B CG1   1 
ATOM   2377 C  CG2   . VAL B  1 119 ? 103.124 22.382  -18.728 1.00 60.86  ? 118  VAL B CG2   1 
ATOM   2378 N  N     . ILE B  1 120 ? 103.158 18.268  -21.354 1.00 59.72  ? 119  ILE B N     1 
ATOM   2379 C  CA    . ILE B  1 120 ? 102.583 17.273  -22.240 1.00 58.25  ? 119  ILE B CA    1 
ATOM   2380 C  C     . ILE B  1 120 ? 101.266 16.778  -21.668 1.00 59.46  ? 119  ILE B C     1 
ATOM   2381 O  O     . ILE B  1 120 ? 101.192 16.319  -20.529 1.00 57.02  ? 119  ILE B O     1 
ATOM   2382 C  CB    . ILE B  1 120 ? 103.540 16.080  -22.462 1.00 60.86  ? 119  ILE B CB    1 
ATOM   2383 C  CG1   . ILE B  1 120 ? 104.773 16.519  -23.262 1.00 58.75  ? 119  ILE B CG1   1 
ATOM   2384 C  CG2   . ILE B  1 120 ? 102.827 14.951  -23.223 1.00 58.60  ? 119  ILE B CG2   1 
ATOM   2385 C  CD1   . ILE B  1 120 ? 105.998 15.631  -23.020 1.00 61.19  ? 119  ILE B CD1   1 
ATOM   2386 N  N     . CYS B  1 121 ? 100.222 16.877  -22.472 1.00 63.11  ? 120  CYS B N     1 
ATOM   2387 C  CA    . CYS B  1 121 ? 98.939  16.332  -22.096 1.00 62.06  ? 120  CYS B CA    1 
ATOM   2388 C  C     . CYS B  1 121 ? 98.635  15.090  -22.918 1.00 60.85  ? 120  CYS B C     1 
ATOM   2389 O  O     . CYS B  1 121 ? 98.528  15.142  -24.150 1.00 60.61  ? 120  CYS B O     1 
ATOM   2390 C  CB    . CYS B  1 121 ? 97.856  17.353  -22.330 1.00 63.41  ? 120  CYS B CB    1 
ATOM   2391 S  SG    . CYS B  1 121 ? 96.304  16.755  -21.709 1.00 74.97  ? 120  CYS B SG    1 
ATOM   2392 N  N     . MET B  1 122 ? 98.473  13.968  -22.245 1.00 60.71  ? 121  MET B N     1 
ATOM   2393 C  CA    . MET B  1 122 ? 98.172  12.732  -22.955 1.00 63.79  ? 121  MET B CA    1 
ATOM   2394 C  C     . MET B  1 122 ? 96.693  12.573  -23.113 1.00 61.85  ? 121  MET B C     1 
ATOM   2395 O  O     . MET B  1 122 ? 95.988  12.151  -22.209 1.00 66.93  ? 121  MET B O     1 
ATOM   2396 C  CB    . MET B  1 122 ? 98.905  11.555  -22.346 1.00 61.69  ? 121  MET B CB    1 
ATOM   2397 C  CG    . MET B  1 122 ? 100.246 11.482  -23.093 1.00 67.50  ? 121  MET B CG    1 
ATOM   2398 S  SD    . MET B  1 122 ? 101.273 10.235  -22.496 1.00 83.59  ? 121  MET B SD    1 
ATOM   2399 C  CE    . MET B  1 122 ? 100.641 8.799   -23.374 1.00 73.40  ? 121  MET B CE    1 
ATOM   2400 N  N     . ASP B  1 123 ? 96.250  12.973  -24.305 1.00 63.56  ? 122  ASP B N     1 
ATOM   2401 C  CA    . ASP B  1 123 ? 94.856  13.160  -24.612 1.00 65.23  ? 122  ASP B CA    1 
ATOM   2402 C  C     . ASP B  1 123 ? 94.224  11.884  -25.145 1.00 60.66  ? 122  ASP B C     1 
ATOM   2403 O  O     . ASP B  1 123 ? 94.656  11.330  -26.122 1.00 58.07  ? 122  ASP B O     1 
ATOM   2404 C  CB    . ASP B  1 123 ? 94.700  14.282  -25.635 1.00 69.71  ? 122  ASP B CB    1 
ATOM   2405 C  CG    . ASP B  1 123 ? 93.313  14.873  -25.622 1.00 83.49  ? 122  ASP B CG    1 
ATOM   2406 O  OD1   . ASP B  1 123 ? 92.906  15.402  -24.559 1.00 106.17 ? 122  ASP B OD1   1 
ATOM   2407 O  OD2   . ASP B  1 123 ? 92.632  14.808  -26.664 1.00 106.60 ? 122  ASP B OD2   1 
ATOM   2408 N  N     . CYS B  1 124 ? 93.143  11.462  -24.515 1.00 64.95  ? 123  CYS B N     1 
ATOM   2409 C  CA    . CYS B  1 124 ? 92.609  10.132  -24.735 1.00 64.71  ? 123  CYS B CA    1 
ATOM   2410 C  C     . CYS B  1 124 ? 91.125  10.105  -24.384 1.00 59.77  ? 123  CYS B C     1 
ATOM   2411 O  O     . CYS B  1 124 ? 90.704  10.736  -23.413 1.00 64.99  ? 123  CYS B O     1 
ATOM   2412 C  CB    . CYS B  1 124 ? 93.376  9.177   -23.812 1.00 65.74  ? 123  CYS B CB    1 
ATOM   2413 S  SG    . CYS B  1 124 ? 93.298  7.526   -24.294 1.00 75.03  ? 123  CYS B SG    1 
ATOM   2414 N  N     . SER B  1 125 ? 90.341  9.356   -25.145 1.00 54.82  ? 124  SER B N     1 
ATOM   2415 C  CA    . SER B  1 125 ? 88.925  9.223   -24.877 1.00 58.01  ? 124  SER B CA    1 
ATOM   2416 C  C     . SER B  1 125 ? 88.653  8.339   -23.654 1.00 56.76  ? 124  SER B C     1 
ATOM   2417 O  O     . SER B  1 125 ? 89.431  7.425   -23.311 1.00 57.14  ? 124  SER B O     1 
ATOM   2418 C  CB    . SER B  1 125 ? 88.185  8.657   -26.109 1.00 58.35  ? 124  SER B CB    1 
ATOM   2419 O  OG    . SER B  1 125 ? 88.536  7.298   -26.329 1.00 61.32  ? 124  SER B OG    1 
ATOM   2420 N  N     . ALA B  1 126 ? 87.521  8.615   -23.019 1.00 56.07  ? 125  ALA B N     1 
ATOM   2421 C  CA    . ALA B  1 126 ? 87.021  7.798   -21.931 1.00 58.10  ? 125  ALA B CA    1 
ATOM   2422 C  C     . ALA B  1 126 ? 86.934  6.288   -22.297 1.00 59.47  ? 125  ALA B C     1 
ATOM   2423 O  O     . ALA B  1 126 ? 87.310  5.410   -21.492 1.00 59.77  ? 125  ALA B O     1 
ATOM   2424 C  CB    . ALA B  1 126 ? 85.638  8.310   -21.502 1.00 60.04  ? 125  ALA B CB    1 
ATOM   2425 N  N     . ASP B  1 127 ? 86.421  6.012   -23.498 1.00 55.98  ? 126  ASP B N     1 
ATOM   2426 C  CA    . ASP B  1 127 ? 86.192  4.649   -23.976 1.00 58.96  ? 126  ASP B CA    1 
ATOM   2427 C  C     . ASP B  1 127 ? 87.501  3.872   -24.042 1.00 54.58  ? 126  ASP B C     1 
ATOM   2428 O  O     . ASP B  1 127 ? 87.601  2.739   -23.599 1.00 54.53  ? 126  ASP B O     1 
ATOM   2429 C  CB    . ASP B  1 127 ? 85.521  4.690   -25.359 1.00 64.80  ? 126  ASP B CB    1 
ATOM   2430 C  CG    . ASP B  1 127 ? 85.101  3.308   -25.849 1.00 76.65  ? 126  ASP B CG    1 
ATOM   2431 O  OD1   . ASP B  1 127 ? 85.589  2.848   -26.913 1.00 80.25  ? 126  ASP B OD1   1 
ATOM   2432 O  OD2   . ASP B  1 127 ? 84.296  2.674   -25.142 1.00 104.85 ? 126  ASP B OD2   1 
ATOM   2433 N  N     . THR B  1 128 ? 88.528  4.520   -24.554 1.00 55.11  ? 127  THR B N     1 
ATOM   2434 C  CA    . THR B  1 128 ? 89.833  3.896   -24.687 1.00 56.03  ? 127  THR B CA    1 
ATOM   2435 C  C     . THR B  1 128 ? 90.476  3.676   -23.334 1.00 54.58  ? 127  THR B C     1 
ATOM   2436 O  O     . THR B  1 128 ? 90.963  2.576   -23.038 1.00 56.23  ? 127  THR B O     1 
ATOM   2437 C  CB    . THR B  1 128 ? 90.724  4.752   -25.573 1.00 54.42  ? 127  THR B CB    1 
ATOM   2438 O  OG1   . THR B  1 128 ? 90.181  4.742   -26.900 1.00 53.48  ? 127  THR B OG1   1 
ATOM   2439 C  CG2   . THR B  1 128 ? 92.159  4.228   -25.582 1.00 48.62  ? 127  THR B CG2   1 
ATOM   2440 N  N     . MET B  1 129 ? 90.477  4.726   -22.516 1.00 55.01  ? 128  MET B N     1 
ATOM   2441 C  CA    . MET B  1 129 ? 90.945  4.597   -21.129 1.00 58.78  ? 128  MET B CA    1 
ATOM   2442 C  C     . MET B  1 129 ? 90.207  3.457   -20.413 1.00 55.46  ? 128  MET B C     1 
ATOM   2443 O  O     . MET B  1 129 ? 90.835  2.612   -19.770 1.00 52.17  ? 128  MET B O     1 
ATOM   2444 C  CB    . MET B  1 129 ? 90.799  5.927   -20.397 1.00 56.45  ? 128  MET B CB    1 
ATOM   2445 C  CG    . MET B  1 129 ? 91.773  7.023   -20.935 1.00 57.90  ? 128  MET B CG    1 
ATOM   2446 S  SD    . MET B  1 129 ? 91.901  8.491   -19.854 1.00 69.20  ? 128  MET B SD    1 
ATOM   2447 C  CE    . MET B  1 129 ? 90.357  9.254   -20.347 1.00 55.68  ? 128  MET B CE    1 
ATOM   2448 N  N     . THR B  1 130 ? 88.881  3.408   -20.581 1.00 54.81  ? 129  THR B N     1 
ATOM   2449 C  CA    . THR B  1 130 ? 88.071  2.370   -19.955 1.00 54.22  ? 129  THR B CA    1 
ATOM   2450 C  C     . THR B  1 130 ? 88.438  0.974   -20.460 1.00 56.56  ? 129  THR B C     1 
ATOM   2451 O  O     . THR B  1 130 ? 88.574  0.044   -19.649 1.00 55.64  ? 129  THR B O     1 
ATOM   2452 C  CB    . THR B  1 130 ? 86.584  2.593   -20.196 1.00 52.26  ? 129  THR B CB    1 
ATOM   2453 O  OG1   . THR B  1 130 ? 86.171  3.860   -19.655 1.00 55.48  ? 129  THR B OG1   1 
ATOM   2454 C  CG2   . THR B  1 130 ? 85.795  1.490   -19.546 1.00 51.66  ? 129  THR B CG2   1 
ATOM   2455 N  N     . ASN B  1 131 ? 88.605  0.809   -21.784 1.00 52.44  ? 130  ASN B N     1 
ATOM   2456 C  CA    . ASN B  1 131 ? 89.002  -0.501  -22.298 1.00 52.70  ? 130  ASN B CA    1 
ATOM   2457 C  C     . ASN B  1 131 ? 90.360  -0.997  -21.774 1.00 53.24  ? 130  ASN B C     1 
ATOM   2458 O  O     . ASN B  1 131 ? 90.488  -2.168  -21.379 1.00 52.75  ? 130  ASN B O     1 
ATOM   2459 C  CB    . ASN B  1 131 ? 88.930  -0.572  -23.815 1.00 48.54  ? 130  ASN B CB    1 
ATOM   2460 C  CG    . ASN B  1 131 ? 87.491  -0.642  -24.324 1.00 44.93  ? 130  ASN B CG    1 
ATOM   2461 O  OD1   . ASN B  1 131 ? 86.567  -0.760  -23.542 1.00 49.21  ? 130  ASN B OD1   1 
ATOM   2462 N  ND2   . ASN B  1 131 ? 87.310  -0.569  -25.628 1.00 42.16  ? 130  ASN B ND2   1 
ATOM   2463 N  N     . ARG B  1 132 ? 91.334  -0.098  -21.707 1.00 53.06  ? 131  ARG B N     1 
ATOM   2464 C  CA    . ARG B  1 132 ? 92.670  -0.440  -21.208 1.00 54.23  ? 131  ARG B CA    1 
ATOM   2465 C  C     . ARG B  1 132 ? 92.615  -0.840  -19.753 1.00 54.83  ? 131  ARG B C     1 
ATOM   2466 O  O     . ARG B  1 132 ? 93.248  -1.829  -19.345 1.00 55.03  ? 131  ARG B O     1 
ATOM   2467 C  CB    . ARG B  1 132 ? 93.640  0.730   -21.408 1.00 49.42  ? 131  ARG B CB    1 
ATOM   2468 C  CG    . ARG B  1 132 ? 93.930  0.989   -22.902 1.00 46.75  ? 131  ARG B CG    1 
ATOM   2469 C  CD    . ARG B  1 132 ? 94.631  2.275   -23.075 1.00 47.39  ? 131  ARG B CD    1 
ATOM   2470 N  NE    . ARG B  1 132 ? 95.004  2.589   -24.442 1.00 54.19  ? 131  ARG B NE    1 
ATOM   2471 C  CZ    . ARG B  1 132 ? 95.428  3.793   -24.833 1.00 55.38  ? 131  ARG B CZ    1 
ATOM   2472 N  NH1   . ARG B  1 132 ? 95.574  4.781   -23.971 1.00 49.36  ? 131  ARG B NH1   1 
ATOM   2473 N  NH2   . ARG B  1 132 ? 95.721  4.008   -26.093 1.00 53.39  ? 131  ARG B NH2   1 
ATOM   2474 N  N     . LEU B  1 133 ? 91.825  -0.095  -18.979 1.00 57.18  ? 132  LEU B N     1 
ATOM   2475 C  CA    . LEU B  1 133 ? 91.641  -0.398  -17.554 1.00 54.94  ? 132  LEU B CA    1 
ATOM   2476 C  C     . LEU B  1 133 ? 90.868  -1.694  -17.313 1.00 54.53  ? 132  LEU B C     1 
ATOM   2477 O  O     . LEU B  1 133 ? 91.216  -2.456  -16.408 1.00 55.50  ? 132  LEU B O     1 
ATOM   2478 C  CB    . LEU B  1 133 ? 90.983  0.789   -16.855 1.00 57.23  ? 132  LEU B CB    1 
ATOM   2479 C  CG    . LEU B  1 133 ? 91.937  1.992   -16.768 1.00 62.14  ? 132  LEU B CG    1 
ATOM   2480 C  CD1   . LEU B  1 133 ? 91.257  3.219   -16.220 1.00 59.46  ? 132  LEU B CD1   1 
ATOM   2481 C  CD2   . LEU B  1 133 ? 93.177  1.628   -15.943 1.00 55.82  ? 132  LEU B CD2   1 
ATOM   2482 N  N     . LEU B  1 134 ? 89.854  -1.960  -18.137 1.00 52.78  ? 133  LEU B N     1 
ATOM   2483 C  CA    . LEU B  1 134 ? 89.127  -3.223  -18.082 1.00 53.95  ? 133  LEU B CA    1 
ATOM   2484 C  C     . LEU B  1 134 ? 90.029  -4.415  -18.371 1.00 53.83  ? 133  LEU B C     1 
ATOM   2485 O  O     . LEU B  1 134 ? 89.985  -5.413  -17.660 1.00 54.86  ? 133  LEU B O     1 
ATOM   2486 C  CB    . LEU B  1 134 ? 87.943  -3.234  -19.034 1.00 54.69  ? 133  LEU B CB    1 
ATOM   2487 C  CG    . LEU B  1 134 ? 86.678  -2.522  -18.568 1.00 58.81  ? 133  LEU B CG    1 
ATOM   2488 C  CD1   . LEU B  1 134 ? 85.680  -2.517  -19.737 1.00 72.33  ? 133  LEU B CD1   1 
ATOM   2489 C  CD2   . LEU B  1 134 ? 86.097  -3.226  -17.335 1.00 52.00  ? 133  LEU B CD2   1 
ATOM   2490 N  N     . GLN B  1 135 ? 90.877  -4.291  -19.376 1.00 53.39  ? 134  GLN B N     1 
ATOM   2491 C  CA    . GLN B  1 135 ? 91.814  -5.350  -19.712 1.00 54.37  ? 134  GLN B CA    1 
ATOM   2492 C  C     . GLN B  1 135 ? 92.757  -5.717  -18.554 1.00 55.65  ? 134  GLN B C     1 
ATOM   2493 O  O     . GLN B  1 135 ? 93.079  -6.890  -18.371 1.00 52.72  ? 134  GLN B O     1 
ATOM   2494 C  CB    . GLN B  1 135 ? 92.655  -4.924  -20.914 1.00 55.43  ? 134  GLN B CB    1 
ATOM   2495 C  CG    . GLN B  1 135 ? 93.790  -5.870  -21.238 1.00 50.57  ? 134  GLN B CG    1 
ATOM   2496 C  CD    . GLN B  1 135 ? 93.270  -7.173  -21.803 1.00 67.75  ? 134  GLN B CD    1 
ATOM   2497 O  OE1   . GLN B  1 135 ? 92.513  -7.183  -22.779 1.00 85.18  ? 134  GLN B OE1   1 
ATOM   2498 N  NE2   . GLN B  1 135 ? 93.675  -8.283  -21.201 1.00 70.45  ? 134  GLN B NE2   1 
ATOM   2499 N  N     . MET B  1 136 ? 93.228  -4.697  -17.836 1.00 57.07  ? 135  MET B N     1 
ATOM   2500 C  CA    . MET B  1 136 ? 94.147  -4.845  -16.703 1.00 66.41  ? 135  MET B CA    1 
ATOM   2501 C  C     . MET B  1 136 ? 93.438  -5.239  -15.403 1.00 61.15  ? 135  MET B C     1 
ATOM   2502 O  O     . MET B  1 136 ? 94.086  -5.631  -14.442 1.00 63.07  ? 135  MET B O     1 
ATOM   2503 C  CB    . MET B  1 136 ? 94.861  -3.514  -16.420 1.00 60.09  ? 135  MET B CB    1 
ATOM   2504 C  CG    . MET B  1 136 ? 95.953  -3.174  -17.377 1.00 70.94  ? 135  MET B CG    1 
ATOM   2505 S  SD    . MET B  1 136 ? 96.480  -1.497  -17.039 1.00 86.93  ? 135  MET B SD    1 
ATOM   2506 C  CE    . MET B  1 136 ? 97.172  -1.671  -15.380 1.00 106.53 ? 135  MET B CE    1 
ATOM   2507 N  N     . SER B  1 137 ? 92.121  -5.074  -15.375 1.00 60.35  ? 136  SER B N     1 
ATOM   2508 C  CA    . SER B  1 137 ? 91.329  -5.330  -14.188 1.00 57.50  ? 136  SER B CA    1 
ATOM   2509 C  C     . SER B  1 137 ? 91.452  -6.795  -13.734 1.00 59.41  ? 136  SER B C     1 
ATOM   2510 O  O     . SER B  1 137 ? 91.412  -7.740  -14.551 1.00 60.80  ? 136  SER B O     1 
ATOM   2511 C  CB    . SER B  1 137 ? 89.864  -4.973  -14.468 1.00 53.40  ? 136  SER B CB    1 
ATOM   2512 O  OG    . SER B  1 137 ? 89.082  -5.159  -13.328 1.00 58.56  ? 136  SER B OG    1 
ATOM   2513 N  N     . ARG B  1 138 ? 91.606  -6.971  -12.423 1.00 59.40  ? 137  ARG B N     1 
ATOM   2514 C  CA    . ARG B  1 138 ? 91.661  -8.293  -11.817 1.00 61.18  ? 137  ARG B CA    1 
ATOM   2515 C  C     . ARG B  1 138 ? 90.317  -8.695  -11.171 1.00 59.96  ? 137  ARG B C     1 
ATOM   2516 O  O     . ARG B  1 138 ? 90.194  -9.817  -10.669 1.00 64.29  ? 137  ARG B O     1 
ATOM   2517 C  CB    . ARG B  1 138 ? 92.801  -8.358  -10.779 1.00 62.28  ? 137  ARG B CB    1 
ATOM   2518 C  CG    . ARG B  1 138 ? 94.170  -7.830  -11.277 1.00 67.75  ? 137  ARG B CG    1 
ATOM   2519 N  N     . SER B  1 139 ? 89.308  -7.818  -11.191 1.00 60.33  ? 138  SER B N     1 
ATOM   2520 C  CA    . SER B  1 139 ? 88.049  -8.124  -10.484 1.00 58.95  ? 138  SER B CA    1 
ATOM   2521 C  C     . SER B  1 139 ? 87.342  -9.214  -11.233 1.00 59.23  ? 138  SER B C     1 
ATOM   2522 O  O     . SER B  1 139 ? 87.495  -9.343  -12.439 1.00 60.68  ? 138  SER B O     1 
ATOM   2523 C  CB    . SER B  1 139 ? 87.091  -6.935  -10.383 1.00 55.43  ? 138  SER B CB    1 
ATOM   2524 O  OG    . SER B  1 139 ? 86.668  -6.506  -11.671 1.00 82.34  ? 138  SER B OG    1 
ATOM   2525 N  N     . SER B  1 140 ? 86.547  -9.983  -10.508 1.00 59.57  ? 139  SER B N     1 
ATOM   2526 C  CA    . SER B  1 140 ? 85.670  -10.944 -11.136 1.00 59.74  ? 139  SER B CA    1 
ATOM   2527 C  C     . SER B  1 140 ? 84.211  -10.511 -10.910 1.00 59.30  ? 139  SER B C     1 
ATOM   2528 O  O     . SER B  1 140 ? 83.287  -11.330 -11.004 1.00 60.03  ? 139  SER B O     1 
ATOM   2529 C  CB    . SER B  1 140 ? 85.964  -12.340 -10.581 1.00 57.68  ? 139  SER B CB    1 
ATOM   2530 O  OG    . SER B  1 140 ? 85.996  -12.314 -9.159  1.00 62.62  ? 139  SER B OG    1 
ATOM   2531 N  N     . LEU B  1 141 ? 84.002  -9.222  -10.607 1.00 59.55  ? 140  LEU B N     1 
ATOM   2532 C  CA    . LEU B  1 141 ? 82.649  -8.652  -10.633 1.00 59.19  ? 140  LEU B CA    1 
ATOM   2533 C  C     . LEU B  1 141 ? 82.181  -8.656  -12.095 1.00 56.92  ? 140  LEU B C     1 
ATOM   2534 O  O     . LEU B  1 141 ? 83.009  -8.792  -13.004 1.00 59.59  ? 140  LEU B O     1 
ATOM   2535 C  CB    . LEU B  1 141 ? 82.621  -7.227  -10.066 1.00 62.28  ? 140  LEU B CB    1 
ATOM   2536 C  CG    . LEU B  1 141 ? 82.801  -7.081  -8.550  1.00 66.06  ? 140  LEU B CG    1 
ATOM   2537 C  CD1   . LEU B  1 141 ? 82.962  -5.607  -8.192  1.00 60.52  ? 140  LEU B CD1   1 
ATOM   2538 C  CD2   . LEU B  1 141 ? 81.649  -7.713  -7.762  1.00 61.20  ? 140  LEU B CD2   1 
ATOM   2539 N  N     . PRO B  1 142 ? 80.855  -8.557  -12.329 1.00 57.26  ? 141  PRO B N     1 
ATOM   2540 C  CA    . PRO B  1 142 ? 80.381  -8.271  -13.695 1.00 57.18  ? 141  PRO B CA    1 
ATOM   2541 C  C     . PRO B  1 142 ? 81.055  -7.040  -14.321 1.00 57.99  ? 141  PRO B C     1 
ATOM   2542 O  O     . PRO B  1 142 ? 81.341  -6.069  -13.620 1.00 59.50  ? 141  PRO B O     1 
ATOM   2543 C  CB    . PRO B  1 142 ? 78.875  -8.025  -13.506 1.00 63.53  ? 141  PRO B CB    1 
ATOM   2544 C  CG    . PRO B  1 142 ? 78.501  -8.769  -12.250 1.00 54.70  ? 141  PRO B CG    1 
ATOM   2545 C  CD    . PRO B  1 142 ? 79.741  -8.773  -11.376 1.00 60.17  ? 141  PRO B CD    1 
ATOM   2546 N  N     . VAL B  1 143 ? 81.306  -7.088  -15.629 1.00 58.12  ? 142  VAL B N     1 
ATOM   2547 C  CA    . VAL B  1 143 ? 81.949  -5.973  -16.343 1.00 59.44  ? 142  VAL B CA    1 
ATOM   2548 C  C     . VAL B  1 143 ? 81.201  -4.648  -16.223 1.00 59.23  ? 142  VAL B C     1 
ATOM   2549 O  O     . VAL B  1 143 ? 81.808  -3.563  -16.279 1.00 61.29  ? 142  VAL B O     1 
ATOM   2550 C  CB    . VAL B  1 143 ? 82.143  -6.257  -17.883 1.00 66.15  ? 142  VAL B CB    1 
ATOM   2551 C  CG1   . VAL B  1 143 ? 83.339  -7.174  -18.112 1.00 67.93  ? 142  VAL B CG1   1 
ATOM   2552 C  CG2   . VAL B  1 143 ? 80.843  -6.814  -18.540 1.00 64.72  ? 142  VAL B CG2   1 
ATOM   2553 N  N     . ASP B  1 144 ? 79.882  -4.747  -16.094 1.00 60.00  ? 143  ASP B N     1 
ATOM   2554 C  CA    . ASP B  1 144 ? 79.029  -3.588  -15.928 1.00 64.90  ? 143  ASP B CA    1 
ATOM   2555 C  C     . ASP B  1 144 ? 79.450  -2.805  -14.681 1.00 59.58  ? 143  ASP B C     1 
ATOM   2556 O  O     . ASP B  1 144 ? 79.567  -1.591  -14.724 1.00 59.15  ? 143  ASP B O     1 
ATOM   2557 C  CB    . ASP B  1 144 ? 77.566  -4.059  -15.838 1.00 68.78  ? 143  ASP B CB    1 
ATOM   2558 C  CG    . ASP B  1 144 ? 76.581  -2.910  -15.663 1.00 88.91  ? 143  ASP B CG    1 
ATOM   2559 O  OD1   . ASP B  1 144 ? 76.801  -1.827  -16.252 1.00 104.04 ? 143  ASP B OD1   1 
ATOM   2560 O  OD2   . ASP B  1 144 ? 75.577  -3.099  -14.936 1.00 107.77 ? 143  ASP B OD2   1 
ATOM   2561 N  N     . ASP B  1 145 ? 79.680  -3.532  -13.589 1.00 59.18  ? 144  ASP B N     1 
ATOM   2562 C  CA    . ASP B  1 145 ? 80.071  -2.956  -12.296 1.00 60.86  ? 144  ASP B CA    1 
ATOM   2563 C  C     . ASP B  1 145 ? 81.441  -2.309  -12.388 1.00 58.39  ? 144  ASP B C     1 
ATOM   2564 O  O     . ASP B  1 145 ? 81.631  -1.156  -12.011 1.00 55.96  ? 144  ASP B O     1 
ATOM   2565 C  CB    . ASP B  1 145 ? 80.113  -4.054  -11.219 1.00 59.19  ? 144  ASP B CB    1 
ATOM   2566 C  CG    . ASP B  1 145 ? 78.783  -4.787  -11.064 1.00 73.66  ? 144  ASP B CG    1 
ATOM   2567 O  OD1   . ASP B  1 145 ? 77.782  -4.387  -11.706 1.00 79.62  ? 144  ASP B OD1   1 
ATOM   2568 O  OD2   . ASP B  1 145 ? 78.747  -5.773  -10.300 1.00 84.46  ? 144  ASP B OD2   1 
ATOM   2569 N  N     . THR B  1 146 ? 82.389  -3.079  -12.915 1.00 58.80  ? 145  THR B N     1 
ATOM   2570 C  CA    . THR B  1 146 ? 83.776  -2.639  -13.034 1.00 59.02  ? 145  THR B CA    1 
ATOM   2571 C  C     . THR B  1 146 ? 83.894  -1.383  -13.898 1.00 55.76  ? 145  THR B C     1 
ATOM   2572 O  O     . THR B  1 146 ? 84.674  -0.498  -13.602 1.00 55.57  ? 145  THR B O     1 
ATOM   2573 C  CB    . THR B  1 146 ? 84.640  -3.785  -13.583 1.00 59.58  ? 145  THR B CB    1 
ATOM   2574 O  OG1   . THR B  1 146 ? 84.548  -4.899  -12.682 1.00 54.13  ? 145  THR B OG1   1 
ATOM   2575 C  CG2   . THR B  1 146 ? 86.080  -3.350  -13.717 1.00 62.00  ? 145  THR B CG2   1 
ATOM   2576 N  N     . THR B  1 147 ? 83.072  -1.316  -14.941 1.00 57.28  ? 146  THR B N     1 
ATOM   2577 C  CA    . THR B  1 147 ? 83.019  -0.176  -15.851 1.00 58.51  ? 146  THR B CA    1 
ATOM   2578 C  C     . THR B  1 147 ? 82.436  1.085   -15.197 1.00 58.80  ? 146  THR B C     1 
ATOM   2579 O  O     . THR B  1 147 ? 82.871  2.183   -15.516 1.00 56.51  ? 146  THR B O     1 
ATOM   2580 C  CB    . THR B  1 147 ? 82.222  -0.555  -17.137 1.00 57.65  ? 146  THR B CB    1 
ATOM   2581 O  OG1   . THR B  1 147 ? 82.786  -1.733  -17.685 1.00 55.10  ? 146  THR B OG1   1 
ATOM   2582 C  CG2   . THR B  1 147 ? 82.288  0.522   -18.195 1.00 63.66  ? 146  THR B CG2   1 
ATOM   2583 N  N     . LYS B  1 148 ? 81.470  0.919   -14.282 1.00 61.56  ? 147  LYS B N     1 
ATOM   2584 C  CA    . LYS B  1 148 ? 80.901  2.045   -13.533 1.00 60.67  ? 147  LYS B CA    1 
ATOM   2585 C  C     . LYS B  1 148 ? 81.934  2.608   -12.558 1.00 60.34  ? 147  LYS B C     1 
ATOM   2586 O  O     . LYS B  1 148 ? 82.025  3.830   -12.331 1.00 61.89  ? 147  LYS B O     1 
ATOM   2587 C  CB    . LYS B  1 148 ? 79.654  1.606   -12.760 1.00 62.13  ? 147  LYS B CB    1 
ATOM   2588 C  CG    . LYS B  1 148 ? 78.517  1.070   -13.625 1.00 73.91  ? 147  LYS B CG    1 
ATOM   2589 N  N     . THR B  1 149 ? 82.701  1.703   -11.965 1.00 55.49  ? 148  THR B N     1 
ATOM   2590 C  CA    . THR B  1 149 ? 83.768  2.096   -11.071 1.00 57.06  ? 148  THR B CA    1 
ATOM   2591 C  C     . THR B  1 149 ? 84.847  2.892   -11.862 1.00 57.37  ? 148  THR B C     1 
ATOM   2592 O  O     . THR B  1 149 ? 85.237  3.990   -11.467 1.00 58.04  ? 148  THR B O     1 
ATOM   2593 C  CB    . THR B  1 149 ? 84.328  0.842   -10.329 1.00 51.13  ? 148  THR B CB    1 
ATOM   2594 O  OG1   . THR B  1 149 ? 83.276  0.208   -9.575  1.00 53.07  ? 148  THR B OG1   1 
ATOM   2595 C  CG2   . THR B  1 149 ? 85.441  1.225   -9.361  1.00 56.32  ? 148  THR B CG2   1 
ATOM   2596 N  N     . ILE B  1 150 ? 85.273  2.348   -13.004 1.00 59.30  ? 149  ILE B N     1 
ATOM   2597 C  CA    . ILE B  1 150 ? 86.293  2.984   -13.861 1.00 57.29  ? 149  ILE B CA    1 
ATOM   2598 C  C     . ILE B  1 150 ? 85.821  4.360   -14.342 1.00 56.62  ? 149  ILE B C     1 
ATOM   2599 O  O     . ILE B  1 150 ? 86.577  5.339   -14.341 1.00 55.88  ? 149  ILE B O     1 
ATOM   2600 C  CB    . ILE B  1 150 ? 86.630  2.077   -15.047 1.00 58.82  ? 149  ILE B CB    1 
ATOM   2601 C  CG1   . ILE B  1 150 ? 87.420  0.839   -14.578 1.00 58.68  ? 149  ILE B CG1   1 
ATOM   2602 C  CG2   . ILE B  1 150 ? 87.364  2.835   -16.134 1.00 58.80  ? 149  ILE B CG2   1 
ATOM   2603 C  CD1   . ILE B  1 150 ? 87.419  -0.330  -15.627 1.00 57.67  ? 149  ILE B CD1   1 
ATOM   2604 N  N     . ALA B  1 151 ? 84.552  4.423   -14.722 1.00 55.87  ? 150  ALA B N     1 
ATOM   2605 C  CA    . ALA B  1 151 ? 83.907  5.677   -15.087 1.00 57.01  ? 150  ALA B CA    1 
ATOM   2606 C  C     . ALA B  1 151 ? 84.056  6.758   -14.024 1.00 55.67  ? 150  ALA B C     1 
ATOM   2607 O  O     . ALA B  1 151 ? 84.393  7.877   -14.344 1.00 61.28  ? 150  ALA B O     1 
ATOM   2608 C  CB    . ALA B  1 151 ? 82.442  5.435   -15.406 1.00 53.77  ? 150  ALA B CB    1 
ATOM   2609 N  N     . LYS B  1 152 ? 83.827  6.410   -12.760 1.00 60.25  ? 151  LYS B N     1 
ATOM   2610 C  CA    . LYS B  1 152 ? 83.948  7.348   -11.620 1.00 58.05  ? 151  LYS B CA    1 
ATOM   2611 C  C     . LYS B  1 152 ? 85.392  7.878   -11.481 1.00 55.95  ? 151  LYS B C     1 
ATOM   2612 O  O     . LYS B  1 152 ? 85.643  9.059   -11.212 1.00 56.86  ? 151  LYS B O     1 
ATOM   2613 C  CB    . LYS B  1 152 ? 83.536  6.612   -10.333 1.00 59.43  ? 151  LYS B CB    1 
ATOM   2614 C  CG    . LYS B  1 152 ? 82.874  7.436   -9.250  1.00 74.75  ? 151  LYS B CG    1 
ATOM   2615 N  N     . ARG B  1 153 ? 86.338  6.964   -11.650 1.00 53.40  ? 152  ARG B N     1 
ATOM   2616 C  CA    . ARG B  1 153 ? 87.751  7.284   -11.619 1.00 56.25  ? 152  ARG B CA    1 
ATOM   2617 C  C     . ARG B  1 153 ? 88.171  8.260   -12.756 1.00 55.14  ? 152  ARG B C     1 
ATOM   2618 O  O     . ARG B  1 153 ? 88.928  9.196   -12.516 1.00 53.74  ? 152  ARG B O     1 
ATOM   2619 C  CB    . ARG B  1 153 ? 88.527  5.973   -11.714 1.00 55.17  ? 152  ARG B CB    1 
ATOM   2620 C  CG    . ARG B  1 153 ? 89.948  6.064   -11.333 1.00 53.06  ? 152  ARG B CG    1 
ATOM   2621 C  CD    . ARG B  1 153 ? 90.645  4.787   -11.638 1.00 55.96  ? 152  ARG B CD    1 
ATOM   2622 N  NE    . ARG B  1 153 ? 92.067  5.002   -11.483 1.00 63.97  ? 152  ARG B NE    1 
ATOM   2623 C  CZ    . ARG B  1 153 ? 93.001  4.142   -11.849 1.00 59.94  ? 152  ARG B CZ    1 
ATOM   2624 N  NH1   . ARG B  1 153 ? 92.683  2.964   -12.365 1.00 59.97  ? 152  ARG B NH1   1 
ATOM   2625 N  NH2   . ARG B  1 153 ? 94.271  4.469   -11.659 1.00 67.23  ? 152  ARG B NH2   1 
ATOM   2626 N  N     . LEU B  1 154 ? 87.658  8.038   -13.974 1.00 58.49  ? 153  LEU B N     1 
ATOM   2627 C  CA    . LEU B  1 154 ? 87.938  8.930   -15.119 1.00 57.12  ? 153  LEU B CA    1 
ATOM   2628 C  C     . LEU B  1 154 ? 87.289  10.263  -14.890 1.00 57.49  ? 153  LEU B C     1 
ATOM   2629 O  O     . LEU B  1 154 ? 87.887  11.311  -15.154 1.00 58.02  ? 153  LEU B O     1 
ATOM   2630 C  CB    . LEU B  1 154 ? 87.410  8.351   -16.428 1.00 59.54  ? 153  LEU B CB    1 
ATOM   2631 C  CG    . LEU B  1 154 ? 88.003  7.009   -16.887 1.00 63.62  ? 153  LEU B CG    1 
ATOM   2632 C  CD1   . LEU B  1 154 ? 87.561  6.708   -18.312 1.00 72.00  ? 153  LEU B CD1   1 
ATOM   2633 C  CD2   . LEU B  1 154 ? 89.520  6.997   -16.770 1.00 65.49  ? 153  LEU B CD2   1 
ATOM   2634 N  N     . GLU B  1 155 ? 86.073  10.231  -14.354 1.00 56.59  ? 154  GLU B N     1 
ATOM   2635 C  CA    . GLU B  1 155 ? 85.318  11.462  -14.141 1.00 58.81  ? 154  GLU B CA    1 
ATOM   2636 C  C     . GLU B  1 155 ? 86.060  12.378  -13.180 1.00 58.11  ? 154  GLU B C     1 
ATOM   2637 O  O     . GLU B  1 155 ? 86.171  13.574  -13.442 1.00 60.85  ? 154  GLU B O     1 
ATOM   2638 C  CB    . GLU B  1 155 ? 83.869  11.176  -13.683 1.00 56.86  ? 154  GLU B CB    1 
ATOM   2639 C  CG    . GLU B  1 155 ? 82.972  12.440  -13.538 1.00 73.86  ? 154  GLU B CG    1 
ATOM   2640 C  CD    . GLU B  1 155 ? 83.036  13.432  -14.744 1.00 100.22 ? 154  GLU B CD    1 
ATOM   2641 O  OE1   . GLU B  1 155 ? 83.091  12.996  -15.931 1.00 79.17  ? 154  GLU B OE1   1 
ATOM   2642 O  OE2   . GLU B  1 155 ? 83.026  14.665  -14.488 1.00 93.53  ? 154  GLU B OE2   1 
ATOM   2643 N  N     . ALA B  1 156 ? 86.614  11.812  -12.107 1.00 56.75  ? 155  ALA B N     1 
ATOM   2644 C  CA    . ALA B  1 156 ? 87.412  12.590  -11.149 1.00 55.08  ? 155  ALA B CA    1 
ATOM   2645 C  C     . ALA B  1 156 ? 88.729  13.075  -11.703 1.00 54.10  ? 155  ALA B C     1 
ATOM   2646 O  O     . ALA B  1 156 ? 89.187  14.150  -11.349 1.00 54.70  ? 155  ALA B O     1 
ATOM   2647 C  CB    . ALA B  1 156 ? 87.676  11.780  -9.892  1.00 53.81  ? 155  ALA B CB    1 
ATOM   2648 N  N     . TYR B  1 157 ? 89.380  12.266  -12.534 1.00 56.05  ? 156  TYR B N     1 
ATOM   2649 C  CA    . TYR B  1 157 ? 90.561  12.746  -13.226 1.00 54.11  ? 156  TYR B CA    1 
ATOM   2650 C  C     . TYR B  1 157 ? 90.203  13.977  -14.093 1.00 55.47  ? 156  TYR B C     1 
ATOM   2651 O  O     . TYR B  1 157 ? 90.886  14.995  -14.081 1.00 58.02  ? 156  TYR B O     1 
ATOM   2652 C  CB    . TYR B  1 157 ? 91.190  11.661  -14.118 1.00 54.79  ? 156  TYR B CB    1 
ATOM   2653 C  CG    . TYR B  1 157 ? 92.246  12.287  -14.984 1.00 59.21  ? 156  TYR B CG    1 
ATOM   2654 C  CD1   . TYR B  1 157 ? 93.502  12.581  -14.460 1.00 61.08  ? 156  TYR B CD1   1 
ATOM   2655 C  CD2   . TYR B  1 157 ? 91.960  12.691  -16.285 1.00 61.46  ? 156  TYR B CD2   1 
ATOM   2656 C  CE1   . TYR B  1 157 ? 94.463  13.209  -15.226 1.00 68.91  ? 156  TYR B CE1   1 
ATOM   2657 C  CE2   . TYR B  1 157 ? 92.918  13.317  -17.060 1.00 68.57  ? 156  TYR B CE2   1 
ATOM   2658 C  CZ    . TYR B  1 157 ? 94.166  13.584  -16.511 1.00 60.90  ? 156  TYR B CZ    1 
ATOM   2659 O  OH    . TYR B  1 157 ? 95.131  14.197  -17.275 1.00 74.30  ? 156  TYR B OH    1 
ATOM   2660 N  N     . TYR B  1 158 ? 89.132  13.840  -14.863 1.00 58.48  ? 157  TYR B N     1 
ATOM   2661 C  CA    A TYR B  1 158 ? 88.716  14.865  -15.815 0.60 60.49  ? 157  TYR B CA    1 
ATOM   2662 C  CA    B TYR B  1 158 ? 88.714  14.864  -15.816 0.40 59.97  ? 157  TYR B CA    1 
ATOM   2663 C  C     . TYR B  1 158 ? 88.426  16.175  -15.072 1.00 57.80  ? 157  TYR B C     1 
ATOM   2664 O  O     . TYR B  1 158 ? 88.890  17.234  -15.460 1.00 57.27  ? 157  TYR B O     1 
ATOM   2665 C  CB    A TYR B  1 158 ? 87.530  14.340  -16.648 0.60 62.59  ? 157  TYR B CB    1 
ATOM   2666 C  CB    B TYR B  1 158 ? 87.520  14.344  -16.640 0.40 61.78  ? 157  TYR B CB    1 
ATOM   2667 C  CG    A TYR B  1 158 ? 86.892  15.334  -17.593 0.60 72.02  ? 157  TYR B CG    1 
ATOM   2668 C  CG    B TYR B  1 158 ? 86.889  15.337  -17.591 0.40 69.12  ? 157  TYR B CG    1 
ATOM   2669 C  CD1   . TYR B  1 158 ? 87.506  15.683  -18.791 0.60 63.30  ? 157  TYR B CD1   1 
ATOM   2670 C  CD2   . TYR B  1 158 ? 85.650  15.906  -17.298 0.60 69.13  ? 157  TYR B CD2   1 
ATOM   2671 C  CE1   . TYR B  1 158 ? 86.910  16.599  -19.669 0.60 63.49  ? 157  TYR B CE1   1 
ATOM   2672 C  CE2   . TYR B  1 158 ? 85.045  16.816  -18.163 0.60 58.11  ? 157  TYR B CE2   1 
ATOM   2673 C  CZ    . TYR B  1 158 ? 85.678  17.161  -19.341 0.60 59.33  ? 157  TYR B CZ    1 
ATOM   2674 O  OH    . TYR B  1 158 ? 85.072  18.067  -20.184 0.60 61.78  ? 157  TYR B OH    1 
ATOM   2675 N  N     . ARG B  1 159 ? 87.736  16.100  -13.947 1.00 60.43  ? 158  ARG B N     1 
ATOM   2676 C  CA    . ARG B  1 159 ? 87.476  17.299  -13.135 1.00 61.19  ? 158  ARG B CA    1 
ATOM   2677 C  C     . ARG B  1 159 ? 88.719  17.995  -12.500 1.00 62.92  ? 158  ARG B C     1 
ATOM   2678 O  O     . ARG B  1 159 ? 88.763  19.233  -12.411 1.00 67.67  ? 158  ARG B O     1 
ATOM   2679 C  CB    . ARG B  1 159 ? 86.417  16.975  -12.067 1.00 70.16  ? 158  ARG B CB    1 
ATOM   2680 C  CG    . ARG B  1 159 ? 85.102  16.447  -12.696 1.00 67.82  ? 158  ARG B CG    1 
ATOM   2681 N  N     . ALA B  1 160 ? 89.727  17.235  -12.088 1.00 61.65  ? 159  ALA B N     1 
ATOM   2682 C  CA    . ALA B  1 160 ? 91.002  17.822  -11.611 1.00 63.27  ? 159  ALA B CA    1 
ATOM   2683 C  C     . ALA B  1 160 ? 91.869  18.439  -12.725 1.00 63.60  ? 159  ALA B C     1 
ATOM   2684 O  O     . ALA B  1 160 ? 92.513  19.475  -12.531 1.00 68.39  ? 159  ALA B O     1 
ATOM   2685 C  CB    . ALA B  1 160 ? 91.821  16.758  -10.902 1.00 66.16  ? 159  ALA B CB    1 
ATOM   2686 N  N     . SER B  1 161 ? 91.909  17.769  -13.873 1.00 60.12  ? 160  SER B N     1 
ATOM   2687 C  CA    . SER B  1 161 ? 92.851  18.110  -14.958 1.00 60.18  ? 160  SER B CA    1 
ATOM   2688 C  C     . SER B  1 161 ? 92.429  19.317  -15.784 1.00 55.57  ? 160  SER B C     1 
ATOM   2689 O  O     . SER B  1 161 ? 93.274  20.040  -16.299 1.00 56.53  ? 160  SER B O     1 
ATOM   2690 C  CB    . SER B  1 161 ? 93.049  16.903  -15.892 1.00 62.80  ? 160  SER B CB    1 
ATOM   2691 O  OG    . SER B  1 161 ? 91.858  16.549  -16.576 1.00 60.86  ? 160  SER B OG    1 
ATOM   2692 N  N     . ILE B  1 162 ? 91.121  19.508  -15.916 1.00 56.41  ? 161  ILE B N     1 
ATOM   2693 C  CA    . ILE B  1 162 ? 90.549  20.543  -16.804 1.00 59.29  ? 161  ILE B CA    1 
ATOM   2694 C  C     . ILE B  1 162 ? 91.119  21.948  -16.571 1.00 53.94  ? 161  ILE B C     1 
ATOM   2695 O  O     . ILE B  1 162 ? 91.507  22.595  -17.529 1.00 55.26  ? 161  ILE B O     1 
ATOM   2696 C  CB    . ILE B  1 162 ? 88.989  20.606  -16.669 1.00 65.30  ? 161  ILE B CB    1 
ATOM   2697 C  CG1   . ILE B  1 162 ? 88.319  19.477  -17.452 1.00 72.71  ? 161  ILE B CG1   1 
ATOM   2698 C  CG2   . ILE B  1 162 ? 88.408  21.952  -17.177 1.00 64.28  ? 161  ILE B CG2   1 
ATOM   2699 C  CD1   . ILE B  1 162 ? 86.839  19.340  -17.057 1.00 70.59  ? 161  ILE B CD1   1 
ATOM   2700 N  N     . PRO B  1 163 ? 91.076  22.455  -15.314 1.00 53.38  ? 162  PRO B N     1 
ATOM   2701 C  CA    . PRO B  1 163 ? 91.632  23.788  -15.061 1.00 51.55  ? 162  PRO B CA    1 
ATOM   2702 C  C     . PRO B  1 163 ? 93.138  23.878  -15.258 1.00 51.83  ? 162  PRO B C     1 
ATOM   2703 O  O     . PRO B  1 163 ? 93.646  24.920  -15.692 1.00 53.23  ? 162  PRO B O     1 
ATOM   2704 C  CB    . PRO B  1 163 ? 91.226  24.087  -13.616 1.00 46.81  ? 162  PRO B CB    1 
ATOM   2705 C  CG    . PRO B  1 163 ? 90.867  22.785  -13.003 1.00 55.16  ? 162  PRO B CG    1 
ATOM   2706 C  CD    . PRO B  1 163 ? 90.444  21.878  -14.111 1.00 52.45  ? 162  PRO B CD    1 
ATOM   2707 N  N     . VAL B  1 164 ? 93.835  22.788  -14.973 1.00 55.66  ? 163  VAL B N     1 
ATOM   2708 C  CA    . VAL B  1 164 ? 95.275  22.716  -15.195 1.00 57.79  ? 163  VAL B CA    1 
ATOM   2709 C  C     . VAL B  1 164 ? 95.580  22.831  -16.683 1.00 53.41  ? 163  VAL B C     1 
ATOM   2710 O  O     . VAL B  1 164 ? 96.389  23.660  -17.113 1.00 53.74  ? 163  VAL B O     1 
ATOM   2711 C  CB    . VAL B  1 164 ? 95.893  21.412  -14.584 1.00 52.74  ? 163  VAL B CB    1 
ATOM   2712 C  CG1   . VAL B  1 164 ? 97.363  21.264  -14.963 1.00 60.93  ? 163  VAL B CG1   1 
ATOM   2713 C  CG2   . VAL B  1 164 ? 95.737  21.435  -13.079 1.00 55.93  ? 163  VAL B CG2   1 
ATOM   2714 N  N     . ILE B  1 165 ? 94.903  22.009  -17.471 1.00 58.28  ? 164  ILE B N     1 
ATOM   2715 C  CA    . ILE B  1 165 ? 95.063  22.031  -18.915 1.00 54.46  ? 164  ILE B CA    1 
ATOM   2716 C  C     . ILE B  1 165 ? 94.786  23.435  -19.461 1.00 55.55  ? 164  ILE B C     1 
ATOM   2717 O  O     . ILE B  1 165 ? 95.539  23.954  -20.298 1.00 57.49  ? 164  ILE B O     1 
ATOM   2718 C  CB    . ILE B  1 165 ? 94.100  21.015  -19.573 1.00 57.71  ? 164  ILE B CB    1 
ATOM   2719 C  CG1   . ILE B  1 165 ? 94.619  19.592  -19.370 1.00 69.22  ? 164  ILE B CG1   1 
ATOM   2720 C  CG2   . ILE B  1 165 ? 93.888  21.331  -21.092 1.00 65.44  ? 164  ILE B CG2   1 
ATOM   2721 C  CD1   . ILE B  1 165 ? 93.599  18.497  -19.697 1.00 60.64  ? 164  ILE B CD1   1 
ATOM   2722 N  N     . ALA B  1 166 ? 93.673  24.016  -19.018 1.00 53.94  ? 165  ALA B N     1 
ATOM   2723 C  CA    . ALA B  1 166 ? 93.269  25.356  -19.416 1.00 53.80  ? 165  ALA B CA    1 
ATOM   2724 C  C     . ALA B  1 166 ? 94.337  26.408  -19.119 1.00 52.70  ? 165  ALA B C     1 
ATOM   2725 O  O     . ALA B  1 166 ? 94.550  27.325  -19.918 1.00 52.49  ? 165  ALA B O     1 
ATOM   2726 C  CB    . ALA B  1 166 ? 91.970  25.731  -18.704 1.00 49.06  ? 165  ALA B CB    1 
ATOM   2727 N  N     . TYR B  1 167 ? 94.976  26.291  -17.953 1.00 54.70  ? 166  TYR B N     1 
ATOM   2728 C  CA    . TYR B  1 167 ? 95.996  27.262  -17.529 1.00 54.35  ? 166  TYR B CA    1 
ATOM   2729 C  C     . TYR B  1 167 ? 97.199  27.245  -18.478 1.00 53.91  ? 166  TYR B C     1 
ATOM   2730 O  O     . TYR B  1 167 ? 97.625  28.273  -18.995 1.00 53.70  ? 166  TYR B O     1 
ATOM   2731 C  CB    . TYR B  1 167 ? 96.430  26.961  -16.092 1.00 60.12  ? 166  TYR B CB    1 
ATOM   2732 C  CG    . TYR B  1 167 ? 97.600  27.797  -15.615 1.00 60.36  ? 166  TYR B CG    1 
ATOM   2733 C  CD1   . TYR B  1 167 ? 97.438  29.132  -15.259 1.00 54.53  ? 166  TYR B CD1   1 
ATOM   2734 C  CD2   . TYR B  1 167 ? 98.874  27.245  -15.531 1.00 55.12  ? 166  TYR B CD2   1 
ATOM   2735 C  CE1   . TYR B  1 167 ? 98.527  29.897  -14.832 1.00 60.64  ? 166  TYR B CE1   1 
ATOM   2736 C  CE2   . TYR B  1 167 ? 99.947  27.982  -15.104 1.00 64.91  ? 166  TYR B CE2   1 
ATOM   2737 C  CZ    . TYR B  1 167 ? 99.776  29.304  -14.752 1.00 66.28  ? 166  TYR B CZ    1 
ATOM   2738 O  OH    . TYR B  1 167 ? 100.879 30.005  -14.340 1.00 66.53  ? 166  TYR B OH    1 
ATOM   2739 N  N     . TYR B  1 168 ? 97.696  26.048  -18.745 1.00 54.18  ? 167  TYR B N     1 
ATOM   2740 C  CA    . TYR B  1 168 ? 98.848  25.860  -19.613 1.00 57.60  ? 167  TYR B CA    1 
ATOM   2741 C  C     . TYR B  1 168 ? 98.535  26.061  -21.098 1.00 56.11  ? 167  TYR B C     1 
ATOM   2742 O  O     . TYR B  1 168 ? 99.399  26.466  -21.855 1.00 58.49  ? 167  TYR B O     1 
ATOM   2743 C  CB    . TYR B  1 168 ? 99.472  24.483  -19.332 1.00 54.59  ? 167  TYR B CB    1 
ATOM   2744 C  CG    . TYR B  1 168 ? 100.157 24.480  -18.007 1.00 52.87  ? 167  TYR B CG    1 
ATOM   2745 C  CD1   . TYR B  1 168 ? 101.277 25.304  -17.773 1.00 51.00  ? 167  TYR B CD1   1 
ATOM   2746 C  CD2   . TYR B  1 168 ? 99.686  23.700  -16.955 1.00 54.59  ? 167  TYR B CD2   1 
ATOM   2747 C  CE1   . TYR B  1 168 ? 101.908 25.313  -16.541 1.00 50.55  ? 167  TYR B CE1   1 
ATOM   2748 C  CE2   . TYR B  1 168 ? 100.317 23.717  -15.724 1.00 57.80  ? 167  TYR B CE2   1 
ATOM   2749 C  CZ    . TYR B  1 168 ? 101.429 24.520  -15.512 1.00 51.17  ? 167  TYR B CZ    1 
ATOM   2750 O  OH    . TYR B  1 168 ? 102.037 24.532  -14.245 1.00 58.76  ? 167  TYR B OH    1 
ATOM   2751 N  N     . GLU B  1 169 ? 97.299  25.799  -21.510 1.00 57.81  ? 168  GLU B N     1 
ATOM   2752 C  CA    . GLU B  1 169 ? 96.865  26.127  -22.872 1.00 59.36  ? 168  GLU B CA    1 
ATOM   2753 C  C     . GLU B  1 169 ? 96.787  27.656  -23.042 1.00 60.69  ? 168  GLU B C     1 
ATOM   2754 O  O     . GLU B  1 169 ? 97.120  28.214  -24.103 1.00 60.42  ? 168  GLU B O     1 
ATOM   2755 C  CB    . GLU B  1 169 ? 95.509  25.465  -23.168 1.00 59.28  ? 168  GLU B CB    1 
ATOM   2756 C  CG    . GLU B  1 169 ? 94.991  25.618  -24.606 1.00 70.15  ? 168  GLU B CG    1 
ATOM   2757 N  N     . THR B  1 170 ? 96.368  28.334  -21.975 1.00 64.19  ? 169  THR B N     1 
ATOM   2758 C  CA    . THR B  1 170 ? 96.312  29.795  -21.944 1.00 64.01  ? 169  THR B CA    1 
ATOM   2759 C  C     . THR B  1 170 ? 97.726  30.420  -21.934 1.00 64.65  ? 169  THR B C     1 
ATOM   2760 O  O     . THR B  1 170 ? 97.926  31.477  -22.503 1.00 63.73  ? 169  THR B O     1 
ATOM   2761 C  CB    . THR B  1 170 ? 95.477  30.280  -20.730 1.00 64.97  ? 169  THR B CB    1 
ATOM   2762 O  OG1   . THR B  1 170 ? 94.182  29.661  -20.747 1.00 53.49  ? 169  THR B OG1   1 
ATOM   2763 C  CG2   . THR B  1 170 ? 95.313  31.772  -20.751 1.00 54.07  ? 169  THR B CG2   1 
ATOM   2764 N  N     . LYS B  1 171 ? 98.697  29.755  -21.306 1.00 64.70  ? 170  LYS B N     1 
ATOM   2765 C  CA    . LYS B  1 171 ? 100.085 30.220  -21.325 1.00 65.28  ? 170  LYS B CA    1 
ATOM   2766 C  C     . LYS B  1 171 ? 100.831 29.716  -22.556 1.00 66.16  ? 170  LYS B C     1 
ATOM   2767 O  O     . LYS B  1 171 ? 101.994 30.045  -22.739 1.00 69.68  ? 170  LYS B O     1 
ATOM   2768 C  CB    . LYS B  1 171 ? 100.841 29.762  -20.072 1.00 65.59  ? 170  LYS B CB    1 
ATOM   2769 C  CG    . LYS B  1 171 ? 100.429 30.436  -18.780 1.00 66.96  ? 170  LYS B CG    1 
ATOM   2770 C  CD    . LYS B  1 171 ? 101.460 30.157  -17.667 1.00 80.64  ? 170  LYS B CD    1 
ATOM   2771 C  CE    . LYS B  1 171 ? 102.412 31.350  -17.431 1.00 84.60  ? 170  LYS B CE    1 
ATOM   2772 N  N     . THR B  1 172 ? 100.165 28.888  -23.362 1.00 65.70  ? 171  THR B N     1 
ATOM   2773 C  CA    . THR B  1 172 ? 100.714 28.277  -24.582 1.00 65.86  ? 171  THR B CA    1 
ATOM   2774 C  C     . THR B  1 172 ? 101.898 27.298  -24.412 1.00 64.08  ? 171  THR B C     1 
ATOM   2775 O  O     . THR B  1 172 ? 102.615 27.043  -25.375 1.00 65.95  ? 171  THR B O     1 
ATOM   2776 C  CB    . THR B  1 172 ? 101.093 29.319  -25.673 1.00 69.75  ? 171  THR B CB    1 
ATOM   2777 O  OG1   . THR B  1 172 ? 102.245 30.059  -25.257 1.00 75.89  ? 171  THR B OG1   1 
ATOM   2778 C  CG2   . THR B  1 172 ? 99.921  30.269  -25.991 1.00 77.09  ? 171  THR B CG2   1 
ATOM   2779 N  N     . GLN B  1 173 ? 102.082 26.735  -23.226 1.00 57.85  ? 172  GLN B N     1 
ATOM   2780 C  CA    . GLN B  1 173 ? 103.111 25.717  -23.003 1.00 60.76  ? 172  GLN B CA    1 
ATOM   2781 C  C     . GLN B  1 173 ? 102.586 24.264  -23.105 1.00 58.41  ? 172  GLN B C     1 
ATOM   2782 O  O     . GLN B  1 173 ? 103.340 23.313  -22.902 1.00 59.83  ? 172  GLN B O     1 
ATOM   2783 C  CB    . GLN B  1 173 ? 103.732 25.936  -21.623 1.00 69.53  ? 172  GLN B CB    1 
ATOM   2784 C  CG    . GLN B  1 173 ? 104.437 27.273  -21.495 1.00 58.63  ? 172  GLN B CG    1 
ATOM   2785 C  CD    . GLN B  1 173 ? 104.113 28.001  -20.204 1.00 88.01  ? 172  GLN B CD    1 
ATOM   2786 O  OE1   . GLN B  1 173 ? 103.997 29.225  -20.206 1.00 108.49 ? 172  GLN B OE1   1 
ATOM   2787 N  NE2   . GLN B  1 173 ? 103.969 27.261  -19.093 1.00 79.46  ? 172  GLN B NE2   1 
ATOM   2788 N  N     . LEU B  1 174 ? 101.312 24.091  -23.451 1.00 55.78  ? 173  LEU B N     1 
ATOM   2789 C  CA    . LEU B  1 174 ? 100.723 22.764  -23.516 1.00 55.71  ? 173  LEU B CA    1 
ATOM   2790 C  C     . LEU B  1 174 ? 100.799 22.142  -24.919 1.00 54.79  ? 173  LEU B C     1 
ATOM   2791 O  O     . LEU B  1 174 ? 100.432 22.770  -25.896 1.00 59.10  ? 173  LEU B O     1 
ATOM   2792 C  CB    . LEU B  1 174 ? 99.266  22.833  -23.080 1.00 57.80  ? 173  LEU B CB    1 
ATOM   2793 C  CG    . LEU B  1 174 ? 98.572  21.479  -22.869 1.00 66.70  ? 173  LEU B CG    1 
ATOM   2794 C  CD1   . LEU B  1 174 ? 98.750  21.008  -21.441 1.00 62.46  ? 173  LEU B CD1   1 
ATOM   2795 C  CD2   . LEU B  1 174 ? 97.093  21.575  -23.233 1.00 74.28  ? 173  LEU B CD2   1 
ATOM   2796 N  N     . HIS B  1 175 ? 101.278 20.903  -24.988 1.00 58.10  ? 174  HIS B N     1 
ATOM   2797 C  CA    . HIS B  1 175 ? 101.204 20.067  -26.171 1.00 58.62  ? 174  HIS B CA    1 
ATOM   2798 C  C     . HIS B  1 175 ? 100.263 18.915  -25.895 1.00 57.44  ? 174  HIS B C     1 
ATOM   2799 O  O     . HIS B  1 175 ? 100.535 18.074  -25.030 1.00 59.10  ? 174  HIS B O     1 
ATOM   2800 C  CB    . HIS B  1 175 ? 102.571 19.487  -26.535 1.00 64.49  ? 174  HIS B CB    1 
ATOM   2801 C  CG    . HIS B  1 175 ? 103.432 20.417  -27.319 1.00 80.66  ? 174  HIS B CG    1 
ATOM   2802 N  ND1   . HIS B  1 175 ? 104.014 20.058  -28.518 1.00 77.00  ? 174  HIS B ND1   1 
ATOM   2803 C  CD2   . HIS B  1 175 ? 103.800 21.702  -27.085 1.00 94.96  ? 174  HIS B CD2   1 
ATOM   2804 C  CE1   . HIS B  1 175 ? 104.714 21.081  -28.980 1.00 95.52  ? 174  HIS B CE1   1 
ATOM   2805 N  NE2   . HIS B  1 175 ? 104.601 22.090  -28.131 1.00 75.50  ? 174  HIS B NE2   1 
ATOM   2806 N  N     . LYS B  1 176 ? 99.166  18.875  -26.646 1.00 55.96  ? 175  LYS B N     1 
ATOM   2807 C  CA    . LYS B  1 176 ? 98.213  17.790  -26.562 1.00 62.75  ? 175  LYS B CA    1 
ATOM   2808 C  C     . LYS B  1 176 ? 98.710  16.683  -27.470 1.00 61.25  ? 175  LYS B C     1 
ATOM   2809 O  O     . LYS B  1 176 ? 99.070  16.901  -28.604 1.00 62.00  ? 175  LYS B O     1 
ATOM   2810 C  CB    . LYS B  1 176 ? 96.810  18.256  -26.958 1.00 63.60  ? 175  LYS B CB    1 
ATOM   2811 C  CG    . LYS B  1 176 ? 96.050  18.919  -25.808 1.00 75.84  ? 175  LYS B CG    1 
ATOM   2812 C  CD    . LYS B  1 176 ? 94.643  19.351  -26.202 1.00 74.69  ? 175  LYS B CD    1 
ATOM   2813 N  N     . ILE B  1 177 ? 98.788  15.495  -26.932 1.00 63.17  ? 176  ILE B N     1 
ATOM   2814 C  CA    . ILE B  1 177 ? 99.221  14.352  -27.690 1.00 63.29  ? 176  ILE B CA    1 
ATOM   2815 C  C     . ILE B  1 177 ? 98.068  13.378  -27.751 1.00 60.66  ? 176  ILE B C     1 
ATOM   2816 O  O     . ILE B  1 177 ? 97.348  13.169  -26.765 1.00 57.68  ? 176  ILE B O     1 
ATOM   2817 C  CB    . ILE B  1 177 ? 100.500 13.772  -27.058 1.00 68.90  ? 176  ILE B CB    1 
ATOM   2818 C  CG1   . ILE B  1 177 ? 101.667 14.588  -27.617 1.00 76.39  ? 176  ILE B CG1   1 
ATOM   2819 C  CG2   . ILE B  1 177 ? 100.644 12.260  -27.342 1.00 63.07  ? 176  ILE B CG2   1 
ATOM   2820 C  CD1   . ILE B  1 177 ? 102.914 14.390  -26.913 1.00 96.71  ? 176  ILE B CD1   1 
ATOM   2821 N  N     . ASN B  1 178 ? 97.874  12.834  -28.942 1.00 61.75  ? 177  ASN B N     1 
ATOM   2822 C  CA    . ASN B  1 178 ? 96.875  11.821  -29.193 1.00 59.15  ? 177  ASN B CA    1 
ATOM   2823 C  C     . ASN B  1 178 ? 97.392  10.492  -28.657 1.00 60.40  ? 177  ASN B C     1 
ATOM   2824 O  O     . ASN B  1 178 ? 98.238  9.827   -29.265 1.00 58.97  ? 177  ASN B O     1 
ATOM   2825 C  CB    . ASN B  1 178 ? 96.545  11.762  -30.682 1.00 56.98  ? 177  ASN B CB    1 
ATOM   2826 C  CG    . ASN B  1 178 ? 95.472  10.700  -31.024 1.00 69.57  ? 177  ASN B CG    1 
ATOM   2827 O  OD1   . ASN B  1 178 ? 94.753  10.201  -30.167 1.00 59.94  ? 177  ASN B OD1   1 
ATOM   2828 N  ND2   . ASN B  1 178 ? 95.378  10.376  -32.293 1.00 57.00  ? 177  ASN B ND2   1 
ATOM   2829 N  N     . ALA B  1 179 ? 96.857  10.126  -27.493 1.00 58.79  ? 178  ALA B N     1 
ATOM   2830 C  CA    . ALA B  1 179 ? 97.262  8.937   -26.792 1.00 59.38  ? 178  ALA B CA    1 
ATOM   2831 C  C     . ALA B  1 179 ? 96.494  7.665   -27.199 1.00 55.53  ? 178  ALA B C     1 
ATOM   2832 O  O     . ALA B  1 179 ? 96.666  6.626   -26.570 1.00 58.51  ? 178  ALA B O     1 
ATOM   2833 C  CB    . ALA B  1 179 ? 97.126  9.180   -25.329 1.00 61.49  ? 178  ALA B CB    1 
ATOM   2834 N  N     . GLU B  1 180 ? 95.687  7.752   -28.250 1.00 58.45  ? 179  GLU B N     1 
ATOM   2835 C  CA    . GLU B  1 180 ? 94.847  6.651   -28.746 1.00 56.70  ? 179  GLU B CA    1 
ATOM   2836 C  C     . GLU B  1 180 ? 95.565  5.622   -29.629 1.00 58.16  ? 179  GLU B C     1 
ATOM   2837 O  O     . GLU B  1 180 ? 95.107  4.480   -29.771 1.00 61.42  ? 179  GLU B O     1 
ATOM   2838 C  CB    . GLU B  1 180 ? 93.718  7.251   -29.564 1.00 57.78  ? 179  GLU B CB    1 
ATOM   2839 C  CG    . GLU B  1 180 ? 92.744  8.122   -28.773 1.00 60.17  ? 179  GLU B CG    1 
ATOM   2840 C  CD    . GLU B  1 180 ? 91.559  7.339   -28.256 1.00 63.60  ? 179  GLU B CD    1 
ATOM   2841 O  OE1   . GLU B  1 180 ? 91.509  6.116   -28.478 1.00 70.33  ? 179  GLU B OE1   1 
ATOM   2842 O  OE2   . GLU B  1 180 ? 90.669  7.946   -27.638 1.00 67.94  ? 179  GLU B OE2   1 
ATOM   2843 N  N     . GLY B  1 181 ? 96.656  6.010   -30.269 1.00 56.04  ? 180  GLY B N     1 
ATOM   2844 C  CA    . GLY B  1 181 ? 97.303  5.122   -31.247 1.00 57.07  ? 180  GLY B CA    1 
ATOM   2845 C  C     . GLY B  1 181 ? 98.151  4.038   -30.593 1.00 58.20  ? 180  GLY B C     1 
ATOM   2846 O  O     . GLY B  1 181 ? 98.128  3.866   -29.369 1.00 57.66  ? 180  GLY B O     1 
ATOM   2847 N  N     . THR B  1 182 ? 98.907  3.313   -31.419 1.00 57.89  ? 181  THR B N     1 
ATOM   2848 C  CA    . THR B  1 182 ? 99.832  2.297   -30.939 1.00 53.23  ? 181  THR B CA    1 
ATOM   2849 C  C     . THR B  1 182 ? 100.817 3.000   -30.030 1.00 54.01  ? 181  THR B C     1 
ATOM   2850 O  O     . THR B  1 182 ? 101.107 4.167   -30.236 1.00 56.95  ? 181  THR B O     1 
ATOM   2851 C  CB    . THR B  1 182 ? 100.605 1.593   -32.078 1.00 56.03  ? 181  THR B CB    1 
ATOM   2852 O  OG1   . THR B  1 182 ? 101.482 2.513   -32.726 1.00 57.86  ? 181  THR B OG1   1 
ATOM   2853 C  CG2   . THR B  1 182 ? 99.657  0.954   -33.145 1.00 55.55  ? 181  THR B CG2   1 
ATOM   2854 N  N     . PRO B  1 183 ? 101.331 2.297   -29.018 1.00 55.08  ? 182  PRO B N     1 
ATOM   2855 C  CA    . PRO B  1 183 ? 102.400 2.822   -28.190 1.00 59.00  ? 182  PRO B CA    1 
ATOM   2856 C  C     . PRO B  1 183 ? 103.559 3.420   -28.990 1.00 59.44  ? 182  PRO B C     1 
ATOM   2857 O  O     . PRO B  1 183 ? 104.059 4.500   -28.637 1.00 61.78  ? 182  PRO B O     1 
ATOM   2858 C  CB    . PRO B  1 183 ? 102.839 1.587   -27.388 1.00 60.20  ? 182  PRO B CB    1 
ATOM   2859 C  CG    . PRO B  1 183 ? 101.619 0.763   -27.257 1.00 52.60  ? 182  PRO B CG    1 
ATOM   2860 C  CD    . PRO B  1 183 ? 100.913 0.946   -28.583 1.00 58.26  ? 182  PRO B CD    1 
ATOM   2861 N  N     . GLU B  1 184 ? 103.942 2.735   -30.069 1.00 58.87  ? 183  GLU B N     1 
ATOM   2862 C  CA    . GLU B  1 184 ? 104.959 3.187   -31.025 1.00 62.07  ? 183  GLU B CA    1 
ATOM   2863 C  C     . GLU B  1 184 ? 104.666 4.576   -31.606 1.00 60.41  ? 183  GLU B C     1 
ATOM   2864 O  O     . GLU B  1 184 ? 105.549 5.437   -31.704 1.00 59.16  ? 183  GLU B O     1 
ATOM   2865 C  CB    . GLU B  1 184 ? 105.012 2.177   -32.169 1.00 63.67  ? 183  GLU B CB    1 
ATOM   2866 C  CG    . GLU B  1 184 ? 106.164 2.318   -33.112 1.00 70.02  ? 183  GLU B CG    1 
ATOM   2867 C  CD    . GLU B  1 184 ? 106.152 1.270   -34.231 1.00 73.22  ? 183  GLU B CD    1 
ATOM   2868 O  OE1   . GLU B  1 184 ? 106.483 1.651   -35.372 1.00 74.51  ? 183  GLU B OE1   1 
ATOM   2869 O  OE2   . GLU B  1 184 ? 105.828 0.078   -33.974 1.00 70.75  ? 183  GLU B OE2   1 
ATOM   2870 N  N     . ASP B  1 185 ? 103.429 4.766   -32.041 1.00 58.35  ? 184  ASP B N     1 
ATOM   2871 C  CA    . ASP B  1 185 ? 103.023 6.014   -32.678 1.00 54.89  ? 184  ASP B CA    1 
ATOM   2872 C  C     . ASP B  1 185 ? 102.879 7.145   -31.642 1.00 55.55  ? 184  ASP B C     1 
ATOM   2873 O  O     . ASP B  1 185 ? 103.223 8.270   -31.912 1.00 57.30  ? 184  ASP B O     1 
ATOM   2874 C  CB    . ASP B  1 185 ? 101.719 5.809   -33.434 1.00 56.35  ? 184  ASP B CB    1 
ATOM   2875 C  CG    . ASP B  1 185 ? 101.846 4.788   -34.555 1.00 67.84  ? 184  ASP B CG    1 
ATOM   2876 O  OD1   . ASP B  1 185 ? 102.933 4.769   -35.169 1.00 61.04  ? 184  ASP B OD1   1 
ATOM   2877 O  OD2   . ASP B  1 185 ? 100.871 4.006   -34.815 1.00 62.67  ? 184  ASP B OD2   1 
ATOM   2878 N  N     . VAL B  1 186 ? 102.431 6.819   -30.432 1.00 58.12  ? 185  VAL B N     1 
ATOM   2879 C  CA    . VAL B  1 186 ? 102.313 7.816   -29.370 1.00 56.83  ? 185  VAL B CA    1 
ATOM   2880 C  C     . VAL B  1 186 ? 103.684 8.351   -28.972 1.00 56.99  ? 185  VAL B C     1 
ATOM   2881 O  O     . VAL B  1 186 ? 103.874 9.570   -28.884 1.00 57.28  ? 185  VAL B O     1 
ATOM   2882 C  CB    . VAL B  1 186 ? 101.583 7.267   -28.172 1.00 54.12  ? 185  VAL B CB    1 
ATOM   2883 C  CG1   . VAL B  1 186 ? 101.548 8.292   -27.033 1.00 58.96  ? 185  VAL B CG1   1 
ATOM   2884 C  CG2   . VAL B  1 186 ? 100.177 6.875   -28.579 1.00 58.89  ? 185  VAL B CG2   1 
ATOM   2885 N  N     . PHE B  1 187 ? 104.628 7.431   -28.795 1.00 54.75  ? 186  PHE B N     1 
ATOM   2886 C  CA    . PHE B  1 187 ? 106.006 7.753   -28.466 1.00 53.80  ? 186  PHE B CA    1 
ATOM   2887 C  C     . PHE B  1 187 ? 106.669 8.709   -29.482 1.00 56.23  ? 186  PHE B C     1 
ATOM   2888 O  O     . PHE B  1 187 ? 107.358 9.669   -29.102 1.00 59.30  ? 186  PHE B O     1 
ATOM   2889 C  CB    . PHE B  1 187 ? 106.809 6.450   -28.317 1.00 50.18  ? 186  PHE B CB    1 
ATOM   2890 C  CG    . PHE B  1 187 ? 108.205 6.655   -27.816 1.00 61.83  ? 186  PHE B CG    1 
ATOM   2891 C  CD1   . PHE B  1 187 ? 108.436 7.273   -26.597 1.00 59.06  ? 186  PHE B CD1   1 
ATOM   2892 C  CD2   . PHE B  1 187 ? 109.297 6.243   -28.576 1.00 67.53  ? 186  PHE B CD2   1 
ATOM   2893 C  CE1   . PHE B  1 187 ? 109.719 7.464   -26.126 1.00 54.92  ? 186  PHE B CE1   1 
ATOM   2894 C  CE2   . PHE B  1 187 ? 110.585 6.432   -28.111 1.00 59.01  ? 186  PHE B CE2   1 
ATOM   2895 C  CZ    . PHE B  1 187 ? 110.798 7.038   -26.880 1.00 57.24  ? 186  PHE B CZ    1 
ATOM   2896 N  N     . LEU B  1 188 ? 106.446 8.462   -30.760 1.00 55.39  ? 187  LEU B N     1 
ATOM   2897 C  CA    . LEU B  1 188 ? 106.972 9.318   -31.814 1.00 57.81  ? 187  LEU B CA    1 
ATOM   2898 C  C     . LEU B  1 188 ? 106.476 10.742  -31.682 1.00 57.09  ? 187  LEU B C     1 
ATOM   2899 O  O     . LEU B  1 188 ? 107.226 11.699  -31.826 1.00 57.32  ? 187  LEU B O     1 
ATOM   2900 C  CB    . LEU B  1 188 ? 106.535 8.787   -33.188 1.00 62.94  ? 187  LEU B CB    1 
ATOM   2901 C  CG    . LEU B  1 188 ? 107.421 7.707   -33.791 1.00 76.57  ? 187  LEU B CG    1 
ATOM   2902 C  CD1   . LEU B  1 188 ? 106.712 7.022   -34.967 1.00 93.94  ? 187  LEU B CD1   1 
ATOM   2903 C  CD2   . LEU B  1 188 ? 108.739 8.318   -34.216 1.00 70.48  ? 187  LEU B CD2   1 
ATOM   2904 N  N     . GLN B  1 189 ? 105.182 10.858  -31.442 1.00 61.70  ? 188  GLN B N     1 
ATOM   2905 C  CA    . GLN B  1 189 ? 104.534 12.138  -31.227 1.00 60.85  ? 188  GLN B CA    1 
ATOM   2906 C  C     . GLN B  1 189 ? 105.130 12.874  -30.022 1.00 60.31  ? 188  GLN B C     1 
ATOM   2907 O  O     . GLN B  1 189 ? 105.364 14.095  -30.085 1.00 56.43  ? 188  GLN B O     1 
ATOM   2908 C  CB    . GLN B  1 189 ? 103.044 11.906  -31.022 1.00 68.55  ? 188  GLN B CB    1 
ATOM   2909 C  CG    . GLN B  1 189 ? 102.160 12.784  -31.868 1.00 84.54  ? 188  GLN B CG    1 
ATOM   2910 C  CD    . GLN B  1 189 ? 100.683 12.576  -31.559 1.00 98.21  ? 188  GLN B CD    1 
ATOM   2911 O  OE1   . GLN B  1 189 ? 99.967  13.534  -31.215 1.00 66.77  ? 188  GLN B OE1   1 
ATOM   2912 N  NE2   . GLN B  1 189 ? 100.221 11.320  -31.670 1.00 87.97  ? 188  GLN B NE2   1 
ATOM   2913 N  N     . LEU B  1 190 ? 105.382 12.118  -28.947 1.00 58.35  ? 189  LEU B N     1 
ATOM   2914 C  CA    . LEU B  1 190 ? 106.022 12.627  -27.733 1.00 60.29  ? 189  LEU B CA    1 
ATOM   2915 C  C     . LEU B  1 190 ? 107.414 13.154  -27.990 1.00 58.77  ? 189  LEU B C     1 
ATOM   2916 O  O     . LEU B  1 190 ? 107.777 14.230  -27.499 1.00 57.08  ? 189  LEU B O     1 
ATOM   2917 C  CB    . LEU B  1 190 ? 106.129 11.539  -26.648 1.00 61.73  ? 189  LEU B CB    1 
ATOM   2918 C  CG    . LEU B  1 190 ? 104.869 11.260  -25.829 1.00 61.27  ? 189  LEU B CG    1 
ATOM   2919 C  CD1   . LEU B  1 190 ? 105.006 9.947   -25.035 1.00 57.27  ? 189  LEU B CD1   1 
ATOM   2920 C  CD2   . LEU B  1 190 ? 104.556 12.405  -24.916 1.00 65.96  ? 189  LEU B CD2   1 
ATOM   2921 N  N     . CYS B  1 191 ? 108.197 12.377  -28.729 1.00 55.94  ? 190  CYS B N     1 
ATOM   2922 C  CA    . CYS B  1 191 ? 109.555 12.786  -29.087 1.00 58.94  ? 190  CYS B CA    1 
ATOM   2923 C  C     . CYS B  1 191 ? 109.548 13.993  -30.023 1.00 56.67  ? 190  CYS B C     1 
ATOM   2924 O  O     . CYS B  1 191 ? 110.448 14.815  -29.981 1.00 58.49  ? 190  CYS B O     1 
ATOM   2925 C  CB    . CYS B  1 191 ? 110.315 11.618  -29.736 1.00 58.72  ? 190  CYS B CB    1 
ATOM   2926 S  SG    . CYS B  1 191 ? 110.536 10.227  -28.597 1.00 56.44  ? 190  CYS B SG    1 
ATOM   2927 N  N     . THR B  1 192 ? 108.533 14.083  -30.876 1.00 56.78  ? 191  THR B N     1 
ATOM   2928 C  CA    . THR B  1 192 ? 108.430 15.194  -31.822 1.00 59.46  ? 191  THR B CA    1 
ATOM   2929 C  C     . THR B  1 192 ? 108.186 16.493  -31.045 1.00 59.20  ? 191  THR B C     1 
ATOM   2930 O  O     . THR B  1 192 ? 108.780 17.517  -31.334 1.00 63.05  ? 191  THR B O     1 
ATOM   2931 C  CB    . THR B  1 192 ? 107.321 14.914  -32.886 1.00 62.89  ? 191  THR B CB    1 
ATOM   2932 O  OG1   . THR B  1 192 ? 107.725 13.820  -33.730 1.00 64.39  ? 191  THR B OG1   1 
ATOM   2933 C  CG2   . THR B  1 192 ? 107.062 16.127  -33.763 1.00 56.12  ? 191  THR B CG2   1 
ATOM   2934 N  N     . ALA B  1 193 ? 107.344 16.410  -30.021 1.00 61.09  ? 192  ALA B N     1 
ATOM   2935 C  CA    . ALA B  1 193 ? 107.036 17.526  -29.138 1.00 60.41  ? 192  ALA B CA    1 
ATOM   2936 C  C     . ALA B  1 193 ? 108.259 17.925  -28.303 1.00 60.19  ? 192  ALA B C     1 
ATOM   2937 O  O     . ALA B  1 193 ? 108.610 19.096  -28.230 1.00 61.00  ? 192  ALA B O     1 
ATOM   2938 C  CB    . ALA B  1 193 ? 105.892 17.142  -28.225 1.00 64.26  ? 192  ALA B CB    1 
ATOM   2939 N  N     . ILE B  1 194 ? 108.913 16.941  -27.698 1.00 58.12  ? 193  ILE B N     1 
ATOM   2940 C  CA    . ILE B  1 194 ? 110.120 17.183  -26.903 1.00 58.38  ? 193  ILE B CA    1 
ATOM   2941 C  C     . ILE B  1 194 ? 111.276 17.759  -27.739 1.00 60.77  ? 193  ILE B C     1 
ATOM   2942 O  O     . ILE B  1 194 ? 111.943 18.718  -27.324 1.00 61.02  ? 193  ILE B O     1 
ATOM   2943 C  CB    . ILE B  1 194 ? 110.558 15.884  -26.165 1.00 55.85  ? 193  ILE B CB    1 
ATOM   2944 C  CG1   . ILE B  1 194 ? 109.545 15.559  -25.067 1.00 64.29  ? 193  ILE B CG1   1 
ATOM   2945 C  CG2   . ILE B  1 194 ? 111.932 16.027  -25.548 1.00 58.73  ? 193  ILE B CG2   1 
ATOM   2946 C  CD1   . ILE B  1 194 ? 109.516 14.129  -24.663 1.00 68.00  ? 193  ILE B CD1   1 
ATOM   2947 N  N     . ASP B  1 195 ? 111.516 17.192  -28.914 1.00 59.17  ? 194  ASP B N     1 
ATOM   2948 C  CA    . ASP B  1 195 ? 112.606 17.668  -29.765 1.00 56.32  ? 194  ASP B CA    1 
ATOM   2949 C  C     . ASP B  1 195 ? 112.357 19.095  -30.272 1.00 58.25  ? 194  ASP B C     1 
ATOM   2950 O  O     . ASP B  1 195 ? 113.310 19.864  -30.515 1.00 60.48  ? 194  ASP B O     1 
ATOM   2951 C  CB    . ASP B  1 195 ? 112.815 16.707  -30.943 1.00 56.24  ? 194  ASP B CB    1 
ATOM   2952 C  CG    . ASP B  1 195 ? 113.382 15.350  -30.510 1.00 64.19  ? 194  ASP B CG    1 
ATOM   2953 O  OD1   . ASP B  1 195 ? 113.870 15.240  -29.370 1.00 65.17  ? 194  ASP B OD1   1 
ATOM   2954 O  OD2   . ASP B  1 195 ? 113.360 14.396  -31.316 1.00 56.91  ? 194  ASP B OD2   1 
ATOM   2955 N  N     . SER B  1 196 ? 111.079 19.445  -30.422 1.00 61.14  ? 195  SER B N     1 
ATOM   2956 C  CA    . SER B  1 196 ? 110.662 20.770  -30.928 1.00 63.35  ? 195  SER B CA    1 
ATOM   2957 C  C     . SER B  1 196 ? 110.848 21.901  -29.928 1.00 61.26  ? 195  SER B C     1 
ATOM   2958 O  O     . SER B  1 196 ? 110.830 23.048  -30.309 1.00 63.55  ? 195  SER B O     1 
ATOM   2959 C  CB    . SER B  1 196 ? 109.181 20.761  -31.363 1.00 69.63  ? 195  SER B CB    1 
ATOM   2960 O  OG    . SER B  1 196 ? 108.301 20.844  -30.233 1.00 75.26  ? 195  SER B OG    1 
ATOM   2961 N  N     . ILE B  1 197 ? 110.969 21.593  -28.648 1.00 63.57  ? 196  ILE B N     1 
ATOM   2962 C  CA    . ILE B  1 197 ? 111.265 22.625  -27.663 1.00 65.96  ? 196  ILE B CA    1 
ATOM   2963 C  C     . ILE B  1 197 ? 112.751 22.601  -27.336 1.00 64.11  ? 196  ILE B C     1 
ATOM   2964 O  O     . ILE B  1 197 ? 113.341 23.640  -27.085 1.00 62.55  ? 196  ILE B O     1 
ATOM   2965 C  CB    . ILE B  1 197 ? 110.389 22.477  -26.351 1.00 73.86  ? 196  ILE B CB    1 
ATOM   2966 C  CG1   . ILE B  1 197 ? 108.978 23.061  -26.540 1.00 74.88  ? 196  ILE B CG1   1 
ATOM   2967 C  CG2   . ILE B  1 197 ? 111.006 23.243  -25.176 1.00 74.18  ? 196  ILE B CG2   1 
ATOM   2968 C  CD1   . ILE B  1 197 ? 108.123 22.324  -27.515 1.00 87.77  ? 196  ILE B CD1   1 
ATOM   2969 N  N     . PHE B  1 198 ? 113.363 21.422  -27.346 1.00 73.92  ? 197  PHE B N     1 
ATOM   2970 C  CA    . PHE B  1 198 ? 114.711 21.270  -26.809 1.00 80.45  ? 197  PHE B CA    1 
ATOM   2971 C  C     . PHE B  1 198 ? 115.719 20.908  -27.889 1.00 84.57  ? 197  PHE B C     1 
ATOM   2972 O  O     . PHE B  1 198 ? 116.327 19.838  -27.867 1.00 85.84  ? 197  PHE B O     1 
ATOM   2973 C  CB    . PHE B  1 198 ? 114.695 20.222  -25.698 1.00 86.94  ? 197  PHE B CB    1 
ATOM   2974 C  CG    . PHE B  1 198 ? 113.725 20.534  -24.580 1.00 85.77  ? 197  PHE B CG    1 
ATOM   2975 C  CD1   . PHE B  1 198 ? 112.555 19.807  -24.439 1.00 87.08  ? 197  PHE B CD1   1 
ATOM   2976 C  CD2   . PHE B  1 198 ? 113.987 21.554  -23.676 1.00 83.89  ? 197  PHE B CD2   1 
ATOM   2977 C  CE1   . PHE B  1 198 ? 111.668 20.076  -23.419 1.00 86.04  ? 197  PHE B CE1   1 
ATOM   2978 C  CE2   . PHE B  1 198 ? 113.099 21.831  -22.653 1.00 87.40  ? 197  PHE B CE2   1 
ATOM   2979 C  CZ    . PHE B  1 198 ? 111.935 21.085  -22.530 1.00 91.41  ? 197  PHE B CZ    1 
ATOM   2980 N  N     . LEU B  1 199 ? 115.880 21.825  -28.835 1.00 88.79  ? 198  LEU B N     1 
ATOM   2981 C  CA    . LEU B  1 199 ? 116.822 21.676  -29.934 1.00 91.80  ? 198  LEU B CA    1 
ATOM   2982 C  C     . LEU B  1 199 ? 117.052 23.058  -30.525 1.00 96.11  ? 198  LEU B C     1 
ATOM   2983 O  O     . LEU B  1 199 ? 118.120 23.379  -31.062 1.00 97.41  ? 198  LEU B O     1 
ATOM   2984 C  CB    . LEU B  1 199 ? 116.272 20.722  -30.999 1.00 92.46  ? 198  LEU B CB    1 
ATOM   2985 O  OXT   . LEU B  1 199 ? 116.148 23.895  -30.452 1.00 97.12  ? 198  LEU B OXT   1 
ATOM   2986 N  N     . MET C  1 6   ? 114.972 37.515  20.780  1.00 71.73  ? 5    MET C N     1 
ATOM   2987 C  CA    . MET C  1 6   ? 115.029 38.727  21.658  1.00 72.51  ? 5    MET C CA    1 
ATOM   2988 C  C     . MET C  1 6   ? 116.436 39.361  21.664  1.00 71.85  ? 5    MET C C     1 
ATOM   2989 O  O     . MET C  1 6   ? 116.617 40.491  21.192  1.00 65.06  ? 5    MET C O     1 
ATOM   2990 C  CB    . MET C  1 6   ? 114.584 38.372  23.086  1.00 71.36  ? 5    MET C CB    1 
ATOM   2991 N  N     . GLU C  1 7   ? 117.417 38.627  22.209  1.00 72.28  ? 6    GLU C N     1 
ATOM   2992 C  CA    . GLU C  1 7   ? 118.833 39.037  22.184  1.00 68.96  ? 6    GLU C CA    1 
ATOM   2993 C  C     . GLU C  1 7   ? 119.378 39.000  20.753  1.00 65.99  ? 6    GLU C C     1 
ATOM   2994 O  O     . GLU C  1 7   ? 120.162 39.857  20.354  1.00 62.22  ? 6    GLU C O     1 
ATOM   2995 C  CB    . GLU C  1 7   ? 119.679 38.136  23.094  1.00 69.57  ? 6    GLU C CB    1 
ATOM   2996 N  N     . ASP C  1 8   ? 118.950 37.994  19.994  1.00 66.16  ? 7    ASP C N     1 
ATOM   2997 C  CA    . ASP C  1 8   ? 119.190 37.927  18.549  1.00 66.32  ? 7    ASP C CA    1 
ATOM   2998 C  C     . ASP C  1 8   ? 118.609 39.163  17.864  1.00 64.67  ? 7    ASP C C     1 
ATOM   2999 O  O     . ASP C  1 8   ? 119.298 39.823  17.089  1.00 61.26  ? 7    ASP C O     1 
ATOM   3000 C  CB    . ASP C  1 8   ? 118.543 36.669  17.944  1.00 66.93  ? 7    ASP C CB    1 
ATOM   3001 C  CG    . ASP C  1 8   ? 118.955 35.382  18.656  1.00 72.23  ? 7    ASP C CG    1 
ATOM   3002 O  OD1   . ASP C  1 8   ? 120.074 35.326  19.212  1.00 80.40  ? 7    ASP C OD1   1 
ATOM   3003 O  OD2   . ASP C  1 8   ? 118.152 34.424  18.662  1.00 62.12  ? 7    ASP C OD2   1 
ATOM   3004 N  N     . LEU C  1 9   ? 117.344 39.469  18.169  1.00 66.15  ? 8    LEU C N     1 
ATOM   3005 C  CA    . LEU C  1 9   ? 116.639 40.643  17.595  1.00 68.95  ? 8    LEU C CA    1 
ATOM   3006 C  C     . LEU C  1 9   ? 117.285 41.979  17.951  1.00 66.61  ? 8    LEU C C     1 
ATOM   3007 O  O     . LEU C  1 9   ? 117.168 42.942  17.199  1.00 67.53  ? 8    LEU C O     1 
ATOM   3008 C  CB    . LEU C  1 9   ? 115.163 40.697  18.058  1.00 71.35  ? 8    LEU C CB    1 
ATOM   3009 C  CG    . LEU C  1 9   ? 114.126 39.787  17.388  1.00 71.67  ? 8    LEU C CG    1 
ATOM   3010 C  CD1   . LEU C  1 9   ? 112.830 39.653  18.214  1.00 64.07  ? 8    LEU C CD1   1 
ATOM   3011 C  CD2   . LEU C  1 9   ? 113.829 40.312  16.002  1.00 68.67  ? 8    LEU C CD2   1 
ATOM   3012 N  N     . ARG C  1 10  ? 117.927 42.037  19.115  1.00 67.43  ? 9    ARG C N     1 
ATOM   3013 C  CA    . ARG C  1 10  ? 118.514 43.276  19.614  1.00 69.20  ? 9    ARG C CA    1 
ATOM   3014 C  C     . ARG C  1 10  ? 119.895 43.532  18.970  1.00 70.42  ? 9    ARG C C     1 
ATOM   3015 O  O     . ARG C  1 10  ? 120.302 44.689  18.824  1.00 74.12  ? 9    ARG C O     1 
ATOM   3016 C  CB    . ARG C  1 10  ? 118.615 43.246  21.152  1.00 70.33  ? 9    ARG C CB    1 
ATOM   3017 C  CG    . ARG C  1 10  ? 118.247 44.568  21.828  1.00 73.33  ? 9    ARG C CG    1 
ATOM   3018 N  N     . LYS C  1 11  ? 120.601 42.468  18.574  1.00 67.79  ? 10   LYS C N     1 
ATOM   3019 C  CA    . LYS C  1 11  ? 121.899 42.591  17.889  1.00 67.34  ? 10   LYS C CA    1 
ATOM   3020 C  C     . LYS C  1 11  ? 121.728 42.494  16.362  1.00 67.56  ? 10   LYS C C     1 
ATOM   3021 O  O     . LYS C  1 11  ? 122.539 41.889  15.666  1.00 67.99  ? 10   LYS C O     1 
ATOM   3022 C  CB    . LYS C  1 11  ? 122.884 41.523  18.404  1.00 64.42  ? 10   LYS C CB    1 
ATOM   3023 N  N     . CYS C  1 12  ? 120.674 43.120  15.850  1.00 70.44  ? 11   CYS C N     1 
ATOM   3024 C  CA    . CYS C  1 12  ? 120.286 42.998  14.446  1.00 68.34  ? 11   CYS C CA    1 
ATOM   3025 C  C     . CYS C  1 12  ? 120.062 44.366  13.772  1.00 61.76  ? 11   CYS C C     1 
ATOM   3026 O  O     . CYS C  1 12  ? 119.634 45.311  14.427  1.00 58.27  ? 11   CYS C O     1 
ATOM   3027 C  CB    . CYS C  1 12  ? 119.006 42.178  14.383  1.00 73.28  ? 11   CYS C CB    1 
ATOM   3028 S  SG    . CYS C  1 12  ? 118.757 41.361  12.833  1.00 88.59  ? 11   CYS C SG    1 
ATOM   3029 N  N     . LYS C  1 13  ? 120.352 44.465  12.475  1.00 56.86  ? 12   LYS C N     1 
ATOM   3030 C  CA    . LYS C  1 13  ? 120.220 45.745  11.750  1.00 58.69  ? 12   LYS C CA    1 
ATOM   3031 C  C     . LYS C  1 13  ? 118.747 46.136  11.483  1.00 56.77  ? 12   LYS C C     1 
ATOM   3032 O  O     . LYS C  1 13  ? 118.062 45.507  10.666  1.00 53.71  ? 12   LYS C O     1 
ATOM   3033 C  CB    . LYS C  1 13  ? 121.019 45.723  10.434  1.00 62.21  ? 12   LYS C CB    1 
ATOM   3034 N  N     . ILE C  1 14  ? 118.282 47.180  12.179  1.00 54.03  ? 13   ILE C N     1 
ATOM   3035 C  CA    . ILE C  1 14  ? 116.905 47.677  12.070  1.00 53.38  ? 13   ILE C CA    1 
ATOM   3036 C  C     . ILE C  1 14  ? 116.873 49.120  11.553  1.00 52.20  ? 13   ILE C C     1 
ATOM   3037 O  O     . ILE C  1 14  ? 117.468 50.019  12.141  1.00 50.78  ? 13   ILE C O     1 
ATOM   3038 C  CB    . ILE C  1 14  ? 116.172 47.594  13.441  1.00 51.98  ? 13   ILE C CB    1 
ATOM   3039 C  CG1   . ILE C  1 14  ? 116.018 46.139  13.860  1.00 48.82  ? 13   ILE C CG1   1 
ATOM   3040 C  CG2   . ILE C  1 14  ? 114.797 48.228  13.378  1.00 54.29  ? 13   ILE C CG2   1 
ATOM   3041 C  CD1   . ILE C  1 14  ? 115.669 45.946  15.298  1.00 49.54  ? 13   ILE C CD1   1 
ATOM   3042 N  N     . ILE C  1 15  ? 116.123 49.337  10.479  1.00 54.00  ? 14   ILE C N     1 
ATOM   3043 C  CA    . ILE C  1 15  ? 116.015 50.649  9.868   1.00 54.20  ? 14   ILE C CA    1 
ATOM   3044 C  C     . ILE C  1 15  ? 114.543 51.044  9.772   1.00 53.89  ? 14   ILE C C     1 
ATOM   3045 O  O     . ILE C  1 15  ? 113.696 50.266  9.291   1.00 52.30  ? 14   ILE C O     1 
ATOM   3046 C  CB    . ILE C  1 15  ? 116.683 50.663  8.456   1.00 56.92  ? 14   ILE C CB    1 
ATOM   3047 C  CG1   . ILE C  1 15  ? 118.142 50.187  8.559   1.00 54.77  ? 14   ILE C CG1   1 
ATOM   3048 C  CG2   . ILE C  1 15  ? 116.618 52.065  7.806   1.00 53.04  ? 14   ILE C CG2   1 
ATOM   3049 C  CD1   . ILE C  1 15  ? 118.851 50.109  7.234   1.00 57.06  ? 14   ILE C CD1   1 
ATOM   3050 N  N     . PHE C  1 16  ? 114.228 52.241  10.259  1.00 54.00  ? 15   PHE C N     1 
ATOM   3051 C  CA    . PHE C  1 16  ? 112.906 52.795  10.074  1.00 53.12  ? 15   PHE C CA    1 
ATOM   3052 C  C     . PHE C  1 16  ? 113.008 53.800  8.949   1.00 53.68  ? 15   PHE C C     1 
ATOM   3053 O  O     . PHE C  1 16  ? 113.915 54.614  8.932   1.00 53.58  ? 15   PHE C O     1 
ATOM   3054 C  CB    . PHE C  1 16  ? 112.397 53.518  11.327  1.00 57.86  ? 15   PHE C CB    1 
ATOM   3055 C  CG    . PHE C  1 16  ? 112.108 52.627  12.507  1.00 52.68  ? 15   PHE C CG    1 
ATOM   3056 C  CD1   . PHE C  1 16  ? 112.101 51.245  12.409  1.00 55.23  ? 15   PHE C CD1   1 
ATOM   3057 C  CD2   . PHE C  1 16  ? 111.814 53.200  13.739  1.00 57.55  ? 15   PHE C CD2   1 
ATOM   3058 C  CE1   . PHE C  1 16  ? 111.818 50.452  13.524  1.00 54.92  ? 15   PHE C CE1   1 
ATOM   3059 C  CE2   . PHE C  1 16  ? 111.530 52.411  14.843  1.00 61.68  ? 15   PHE C CE2   1 
ATOM   3060 C  CZ    . PHE C  1 16  ? 111.531 51.037  14.734  1.00 55.71  ? 15   PHE C CZ    1 
ATOM   3061 N  N     . ILE C  1 17  ? 112.060 53.754  8.022   1.00 56.64  ? 16   ILE C N     1 
ATOM   3062 C  CA    . ILE C  1 17  ? 111.976 54.728  6.947   1.00 56.24  ? 16   ILE C CA    1 
ATOM   3063 C  C     . ILE C  1 17  ? 110.585 55.403  6.972   1.00 54.97  ? 16   ILE C C     1 
ATOM   3064 O  O     . ILE C  1 17  ? 109.569 54.762  6.973   1.00 56.94  ? 16   ILE C O     1 
ATOM   3065 C  CB    . ILE C  1 17  ? 112.348 54.085  5.601   1.00 59.20  ? 16   ILE C CB    1 
ATOM   3066 C  CG1   . ILE C  1 17  ? 112.353 55.124  4.470   1.00 66.05  ? 16   ILE C CG1   1 
ATOM   3067 C  CG2   . ILE C  1 17  ? 111.442 52.918  5.273   1.00 60.20  ? 16   ILE C CG2   1 
ATOM   3068 C  CD1   . ILE C  1 17  ? 113.245 54.718  3.311   1.00 57.39  ? 16   ILE C CD1   1 
ATOM   3069 N  N     . ILE C  1 18  ? 110.595 56.723  7.070   1.00 58.40  ? 17   ILE C N     1 
ATOM   3070 C  CA    . ILE C  1 18  ? 109.418 57.556  7.222   1.00 59.84  ? 17   ILE C CA    1 
ATOM   3071 C  C     . ILE C  1 18  ? 109.371 58.520  6.045   1.00 59.08  ? 17   ILE C C     1 
ATOM   3072 O  O     . ILE C  1 18  ? 110.397 59.062  5.637   1.00 59.17  ? 17   ILE C O     1 
ATOM   3073 C  CB    . ILE C  1 18  ? 109.512 58.431  8.513   1.00 67.84  ? 17   ILE C CB    1 
ATOM   3074 C  CG1   . ILE C  1 18  ? 109.671 57.569  9.779   1.00 76.73  ? 17   ILE C CG1   1 
ATOM   3075 C  CG2   . ILE C  1 18  ? 108.293 59.377  8.640   1.00 68.83  ? 17   ILE C CG2   1 
ATOM   3076 C  CD1   . ILE C  1 18  ? 108.475 56.668  10.067  1.00 85.69  ? 17   ILE C CD1   1 
ATOM   3077 N  N     . GLY C  1 19  ? 108.187 58.769  5.510   1.00 56.60  ? 18   GLY C N     1 
ATOM   3078 C  CA    . GLY C  1 19  ? 108.056 59.775  4.461   1.00 58.00  ? 18   GLY C CA    1 
ATOM   3079 C  C     . GLY C  1 19  ? 106.620 59.912  4.050   1.00 54.14  ? 18   GLY C C     1 
ATOM   3080 O  O     . GLY C  1 19  ? 105.877 58.963  4.141   1.00 55.62  ? 18   GLY C O     1 
ATOM   3081 N  N     . GLY C  1 20  ? 106.233 61.092  3.593   1.00 57.56  ? 19   GLY C N     1 
ATOM   3082 C  CA    . GLY C  1 20  ? 104.831 61.370  3.289   1.00 56.10  ? 19   GLY C CA    1 
ATOM   3083 C  C     . GLY C  1 20  ? 104.376 60.802  1.964   1.00 55.59  ? 19   GLY C C     1 
ATOM   3084 O  O     . GLY C  1 20  ? 105.193 60.371  1.141   1.00 57.62  ? 19   GLY C O     1 
ATOM   3085 N  N     . PRO C  1 21  ? 103.056 60.796  1.744   1.00 55.70  ? 20   PRO C N     1 
ATOM   3086 C  CA    . PRO C  1 21  ? 102.504 60.327  0.477   1.00 54.23  ? 20   PRO C CA    1 
ATOM   3087 C  C     . PRO C  1 21  ? 103.018 61.158  -0.689  1.00 53.68  ? 20   PRO C C     1 
ATOM   3088 O  O     . PRO C  1 21  ? 103.022 62.388  -0.638  1.00 53.83  ? 20   PRO C O     1 
ATOM   3089 C  CB    . PRO C  1 21  ? 100.998 60.488  0.652   1.00 53.38  ? 20   PRO C CB    1 
ATOM   3090 C  CG    . PRO C  1 21  ? 100.803 61.344  1.844   1.00 58.71  ? 20   PRO C CG    1 
ATOM   3091 C  CD    . PRO C  1 21  ? 102.022 61.249  2.685   1.00 56.10  ? 20   PRO C CD    1 
ATOM   3092 N  N     . GLY C  1 22  ? 103.497 60.480  -1.718  1.00 56.69  ? 21   GLY C N     1 
ATOM   3093 C  CA    . GLY C  1 22  ? 104.097 61.155  -2.868  1.00 55.84  ? 21   GLY C CA    1 
ATOM   3094 C  C     . GLY C  1 22  ? 105.563 61.503  -2.723  1.00 57.25  ? 21   GLY C C     1 
ATOM   3095 O  O     . GLY C  1 22  ? 106.110 62.126  -3.613  1.00 60.43  ? 21   GLY C O     1 
ATOM   3096 N  N     . SER C  1 23  ? 106.208 61.114  -1.618  1.00 58.59  ? 22   SER C N     1 
ATOM   3097 C  CA    . SER C  1 23  ? 107.636 61.418  -1.398  1.00 57.77  ? 22   SER C CA    1 
ATOM   3098 C  C     . SER C  1 23  ? 108.588 60.533  -2.206  1.00 57.03  ? 22   SER C C     1 
ATOM   3099 O  O     . SER C  1 23  ? 109.766 60.866  -2.344  1.00 61.87  ? 22   SER C O     1 
ATOM   3100 C  CB    . SER C  1 23  ? 108.003 61.308  0.099   1.00 58.71  ? 22   SER C CB    1 
ATOM   3101 O  OG    . SER C  1 23  ? 107.748 60.003  0.602   1.00 58.84  ? 22   SER C OG    1 
ATOM   3102 N  N     . GLY C  1 24  ? 108.082 59.396  -2.685  1.00 57.61  ? 23   GLY C N     1 
ATOM   3103 C  CA    . GLY C  1 24  ? 108.855 58.375  -3.399  1.00 54.05  ? 23   GLY C CA    1 
ATOM   3104 C  C     . GLY C  1 24  ? 109.369 57.254  -2.505  1.00 56.69  ? 23   GLY C C     1 
ATOM   3105 O  O     . GLY C  1 24  ? 110.283 56.524  -2.877  1.00 59.65  ? 23   GLY C O     1 
ATOM   3106 N  N     . LYS C  1 25  ? 108.800 57.120  -1.313  1.00 58.97  ? 24   LYS C N     1 
ATOM   3107 C  CA    . LYS C  1 25  ? 109.302 56.157  -0.322  1.00 57.66  ? 24   LYS C CA    1 
ATOM   3108 C  C     . LYS C  1 25  ? 109.106 54.709  -0.797  1.00 60.16  ? 24   LYS C C     1 
ATOM   3109 O  O     . LYS C  1 25  ? 109.970 53.858  -0.584  1.00 61.04  ? 24   LYS C O     1 
ATOM   3110 C  CB    . LYS C  1 25  ? 108.627 56.382  1.050   1.00 55.56  ? 24   LYS C CB    1 
ATOM   3111 C  CG    . LYS C  1 25  ? 109.018 55.359  2.120   1.00 60.46  ? 24   LYS C CG    1 
ATOM   3112 C  CD    . LYS C  1 25  ? 108.656 55.784  3.556   1.00 51.83  ? 24   LYS C CD    1 
ATOM   3113 C  CE    . LYS C  1 25  ? 107.161 55.931  3.805   1.00 57.11  ? 24   LYS C CE    1 
ATOM   3114 N  NZ    . LYS C  1 25  ? 106.375 54.865  3.187   1.00 64.88  ? 24   LYS C NZ    1 
ATOM   3115 N  N     . GLY C  1 26  ? 107.961 54.442  -1.417  1.00 61.48  ? 25   GLY C N     1 
ATOM   3116 C  CA    . GLY C  1 26  ? 107.651 53.125  -1.967  1.00 61.61  ? 25   GLY C CA    1 
ATOM   3117 C  C     . GLY C  1 26  ? 108.706 52.620  -2.933  1.00 61.19  ? 25   GLY C C     1 
ATOM   3118 O  O     . GLY C  1 26  ? 109.245 51.521  -2.763  1.00 61.59  ? 25   GLY C O     1 
ATOM   3119 N  N     . THR C  1 27  ? 109.000 53.429  -3.944  1.00 61.42  ? 26   THR C N     1 
ATOM   3120 C  CA    . THR C  1 27  ? 110.029 53.107  -4.939  1.00 61.14  ? 26   THR C CA    1 
ATOM   3121 C  C     . THR C  1 27  ? 111.432 52.968  -4.330  1.00 58.84  ? 26   THR C C     1 
ATOM   3122 O  O     . THR C  1 27  ? 112.224 52.126  -4.755  1.00 56.45  ? 26   THR C O     1 
ATOM   3123 C  CB    . THR C  1 27  ? 110.067 54.186  -6.016  1.00 61.20  ? 26   THR C CB    1 
ATOM   3124 O  OG1   . THR C  1 27  ? 108.784 54.255  -6.640  1.00 65.30  ? 26   THR C OG1   1 
ATOM   3125 C  CG2   . THR C  1 27  ? 111.129 53.888  -7.074  1.00 64.66  ? 26   THR C CG2   1 
ATOM   3126 N  N     . GLN C  1 28  ? 111.736 53.794  -3.333  1.00 58.66  ? 27   GLN C N     1 
ATOM   3127 C  CA    . GLN C  1 28  ? 113.046 53.746  -2.691  1.00 59.84  ? 27   GLN C CA    1 
ATOM   3128 C  C     . GLN C  1 28  ? 113.226 52.502  -1.825  1.00 57.14  ? 27   GLN C C     1 
ATOM   3129 O  O     . GLN C  1 28  ? 114.335 51.974  -1.708  1.00 59.52  ? 27   GLN C O     1 
ATOM   3130 C  CB    . GLN C  1 28  ? 113.302 55.023  -1.885  1.00 63.43  ? 27   GLN C CB    1 
ATOM   3131 C  CG    . GLN C  1 28  ? 113.503 56.282  -2.769  1.00 69.76  ? 27   GLN C CG    1 
ATOM   3132 C  CD    . GLN C  1 28  ? 114.732 56.205  -3.665  1.00 58.40  ? 27   GLN C CD    1 
ATOM   3133 O  OE1   . GLN C  1 28  ? 115.758 55.658  -3.282  1.00 67.39  ? 27   GLN C OE1   1 
ATOM   3134 N  NE2   . GLN C  1 28  ? 114.628 56.762  -4.856  1.00 58.88  ? 27   GLN C NE2   1 
ATOM   3135 N  N     . CYS C  1 29  ? 112.142 52.028  -1.235  1.00 56.81  ? 28   CYS C N     1 
ATOM   3136 C  CA    . CYS C  1 29  ? 112.180 50.787  -0.468  1.00 59.02  ? 28   CYS C CA    1 
ATOM   3137 C  C     . CYS C  1 29  ? 112.451 49.573  -1.353  1.00 58.17  ? 28   CYS C C     1 
ATOM   3138 O  O     . CYS C  1 29  ? 113.143 48.646  -0.948  1.00 60.52  ? 28   CYS C O     1 
ATOM   3139 C  CB    . CYS C  1 29  ? 110.878 50.614  0.300   1.00 63.02  ? 28   CYS C CB    1 
ATOM   3140 S  SG    . CYS C  1 29  ? 110.806 51.698  1.721   1.00 62.79  ? 28   CYS C SG    1 
ATOM   3141 N  N     . GLU C  1 30  ? 111.932 49.596  -2.571  1.00 57.91  ? 29   GLU C N     1 
ATOM   3142 C  CA    . GLU C  1 30  ? 112.192 48.524  -3.519  1.00 60.96  ? 29   GLU C CA    1 
ATOM   3143 C  C     . GLU C  1 30  ? 113.650 48.516  -3.980  1.00 59.92  ? 29   GLU C C     1 
ATOM   3144 O  O     . GLU C  1 30  ? 114.268 47.458  -4.084  1.00 60.35  ? 29   GLU C O     1 
ATOM   3145 C  CB    . GLU C  1 30  ? 111.242 48.639  -4.708  1.00 60.42  ? 29   GLU C CB    1 
ATOM   3146 C  CG    . GLU C  1 30  ? 109.788 48.406  -4.327  1.00 73.72  ? 29   GLU C CG    1 
ATOM   3147 C  CD    . GLU C  1 30  ? 108.832 48.575  -5.492  1.00 83.44  ? 29   GLU C CD    1 
ATOM   3148 O  OE1   . GLU C  1 30  ? 109.092 49.437  -6.360  1.00 87.34  ? 29   GLU C OE1   1 
ATOM   3149 O  OE2   . GLU C  1 30  ? 107.817 47.846  -5.529  1.00 94.05  ? 29   GLU C OE2   1 
ATOM   3150 N  N     . LYS C  1 31  ? 114.187 49.699  -4.249  1.00 57.72  ? 30   LYS C N     1 
ATOM   3151 C  CA    . LYS C  1 31  ? 115.604 49.869  -4.574  1.00 57.04  ? 30   LYS C CA    1 
ATOM   3152 C  C     . LYS C  1 31  ? 116.535 49.398  -3.434  1.00 55.56  ? 30   LYS C C     1 
ATOM   3153 O  O     . LYS C  1 31  ? 117.516 48.699  -3.667  1.00 57.79  ? 30   LYS C O     1 
ATOM   3154 C  CB    . LYS C  1 31  ? 115.888 51.345  -4.923  1.00 56.70  ? 30   LYS C CB    1 
ATOM   3155 C  CG    . LYS C  1 31  ? 115.221 51.854  -6.220  1.00 63.75  ? 30   LYS C CG    1 
ATOM   3156 C  CD    . LYS C  1 31  ? 115.621 53.301  -6.586  1.00 58.38  ? 30   LYS C CD    1 
ATOM   3157 N  N     . LEU C  1 32  ? 116.216 49.791  -2.203  1.00 59.17  ? 31   LEU C N     1 
ATOM   3158 C  CA    . LEU C  1 32  ? 116.980 49.381  -1.009  1.00 56.89  ? 31   LEU C CA    1 
ATOM   3159 C  C     . LEU C  1 32  ? 116.934 47.877  -0.736  1.00 56.63  ? 31   LEU C C     1 
ATOM   3160 O  O     . LEU C  1 32  ? 117.881 47.293  -0.196  1.00 60.22  ? 31   LEU C O     1 
ATOM   3161 C  CB    . LEU C  1 32  ? 116.447 50.112  0.226   1.00 58.02  ? 31   LEU C CB    1 
ATOM   3162 C  CG    . LEU C  1 32  ? 116.749 51.607  0.268   1.00 59.24  ? 31   LEU C CG    1 
ATOM   3163 C  CD1   . LEU C  1 32  ? 115.921 52.252  1.356   1.00 66.62  ? 31   LEU C CD1   1 
ATOM   3164 C  CD2   . LEU C  1 32  ? 118.254 51.876  0.458   1.00 55.60  ? 31   LEU C CD2   1 
ATOM   3165 N  N     . VAL C  1 33  ? 115.814 47.264  -1.078  1.00 55.94  ? 32   VAL C N     1 
ATOM   3166 C  CA    . VAL C  1 33  ? 115.673 45.825  -0.975  1.00 56.72  ? 32   VAL C CA    1 
ATOM   3167 C  C     . VAL C  1 33  ? 116.529 45.153  -2.059  1.00 57.50  ? 32   VAL C C     1 
ATOM   3168 O  O     . VAL C  1 33  ? 117.265 44.209  -1.765  1.00 59.67  ? 32   VAL C O     1 
ATOM   3169 C  CB    . VAL C  1 33  ? 114.170 45.421  -1.052  1.00 56.98  ? 32   VAL C CB    1 
ATOM   3170 C  CG1   . VAL C  1 33  ? 114.002 43.943  -1.332  1.00 50.74  ? 32   VAL C CG1   1 
ATOM   3171 C  CG2   . VAL C  1 33  ? 113.456 45.843  0.252   1.00 56.83  ? 32   VAL C CG2   1 
ATOM   3172 N  N     . GLU C  1 34  ? 116.467 45.655  -3.294  1.00 56.88  ? 33   GLU C N     1 
ATOM   3173 C  CA    . GLU C  1 34  ? 117.301 45.121  -4.380  1.00 56.35  ? 33   GLU C CA    1 
ATOM   3174 C  C     . GLU C  1 34  ? 118.801 45.171  -4.032  1.00 56.83  ? 33   GLU C C     1 
ATOM   3175 O  O     . GLU C  1 34  ? 119.504 44.185  -4.208  1.00 54.18  ? 33   GLU C O     1 
ATOM   3176 C  CB    . GLU C  1 34  ? 117.026 45.855  -5.703  1.00 56.77  ? 33   GLU C CB    1 
ATOM   3177 C  CG    . GLU C  1 34  ? 117.692 45.211  -6.935  1.00 54.27  ? 33   GLU C CG    1 
ATOM   3178 N  N     . LYS C  1 35  ? 119.264 46.306  -3.507  1.00 55.61  ? 34   LYS C N     1 
ATOM   3179 C  CA    . LYS C  1 35  ? 120.681 46.518  -3.217  1.00 54.04  ? 34   LYS C CA    1 
ATOM   3180 C  C     . LYS C  1 35  ? 121.146 45.766  -1.961  1.00 53.66  ? 34   LYS C C     1 
ATOM   3181 O  O     . LYS C  1 35  ? 122.083 44.972  -2.028  1.00 53.36  ? 34   LYS C O     1 
ATOM   3182 C  CB    . LYS C  1 35  ? 120.986 48.020  -3.080  1.00 54.64  ? 34   LYS C CB    1 
ATOM   3183 C  CG    . LYS C  1 35  ? 122.479 48.402  -3.230  1.00 48.14  ? 34   LYS C CG    1 
ATOM   3184 N  N     . TYR C  1 36  ? 120.483 46.004  -0.831  1.00 53.65  ? 35   TYR C N     1 
ATOM   3185 C  CA    . TYR C  1 36  ? 120.912 45.442  0.461   1.00 51.53  ? 35   TYR C CA    1 
ATOM   3186 C  C     . TYR C  1 36  ? 120.223 44.132  0.857   1.00 52.04  ? 35   TYR C C     1 
ATOM   3187 O  O     . TYR C  1 36  ? 120.676 43.461  1.775   1.00 53.28  ? 35   TYR C O     1 
ATOM   3188 C  CB    . TYR C  1 36  ? 120.695 46.464  1.582   1.00 52.56  ? 35   TYR C CB    1 
ATOM   3189 C  CG    . TYR C  1 36  ? 121.477 47.744  1.400   1.00 48.83  ? 35   TYR C CG    1 
ATOM   3190 C  CD1   . TYR C  1 36  ? 120.891 48.872  0.809   1.00 46.54  ? 35   TYR C CD1   1 
ATOM   3191 C  CD2   . TYR C  1 36  ? 122.802 47.829  1.814   1.00 37.97  ? 35   TYR C CD2   1 
ATOM   3192 C  CE1   . TYR C  1 36  ? 121.615 50.055  0.634   1.00 45.74  ? 35   TYR C CE1   1 
ATOM   3193 C  CE2   . TYR C  1 36  ? 123.536 49.006  1.634   1.00 51.04  ? 35   TYR C CE2   1 
ATOM   3194 C  CZ    . TYR C  1 36  ? 122.938 50.111  1.042   1.00 50.03  ? 35   TYR C CZ    1 
ATOM   3195 O  OH    . TYR C  1 36  ? 123.667 51.270  0.876   1.00 56.70  ? 35   TYR C OH    1 
ATOM   3196 N  N     . GLY C  1 37  ? 119.135 43.765  0.191   1.00 51.10  ? 36   GLY C N     1 
ATOM   3197 C  CA    . GLY C  1 37  ? 118.391 42.565  0.580   1.00 54.10  ? 36   GLY C CA    1 
ATOM   3198 C  C     . GLY C  1 37  ? 117.732 42.624  1.961   1.00 57.08  ? 36   GLY C C     1 
ATOM   3199 O  O     . GLY C  1 37  ? 117.564 41.589  2.627   1.00 57.20  ? 36   GLY C O     1 
ATOM   3200 N  N     . PHE C  1 38  ? 117.348 43.821  2.399   1.00 56.72  ? 37   PHE C N     1 
ATOM   3201 C  CA    . PHE C  1 38  ? 116.632 43.956  3.667   1.00 55.62  ? 37   PHE C CA    1 
ATOM   3202 C  C     . PHE C  1 38  ? 115.255 43.316  3.581   1.00 54.56  ? 37   PHE C C     1 
ATOM   3203 O  O     . PHE C  1 38  ? 114.678 43.215  2.500   1.00 53.50  ? 37   PHE C O     1 
ATOM   3204 C  CB    . PHE C  1 38  ? 116.464 45.425  4.079   1.00 59.33  ? 37   PHE C CB    1 
ATOM   3205 C  CG    . PHE C  1 38  ? 117.769 46.166  4.290   1.00 50.74  ? 37   PHE C CG    1 
ATOM   3206 C  CD1   . PHE C  1 38  ? 118.774 45.632  5.094   1.00 58.42  ? 37   PHE C CD1   1 
ATOM   3207 C  CD2   . PHE C  1 38  ? 117.970 47.418  3.700   1.00 55.93  ? 37   PHE C CD2   1 
ATOM   3208 C  CE1   . PHE C  1 38  ? 119.969 46.319  5.293   1.00 49.39  ? 37   PHE C CE1   1 
ATOM   3209 C  CE2   . PHE C  1 38  ? 119.152 48.113  3.893   1.00 62.60  ? 37   PHE C CE2   1 
ATOM   3210 C  CZ    . PHE C  1 38  ? 120.161 47.560  4.691   1.00 61.88  ? 37   PHE C CZ    1 
ATOM   3211 N  N     . THR C  1 39  ? 114.756 42.865  4.731   1.00 53.86  ? 38   THR C N     1 
ATOM   3212 C  CA    . THR C  1 39  ? 113.388 42.393  4.865   1.00 56.41  ? 38   THR C CA    1 
ATOM   3213 C  C     . THR C  1 39  ? 112.458 43.592  5.068   1.00 55.99  ? 38   THR C C     1 
ATOM   3214 O  O     . THR C  1 39  ? 112.497 44.243  6.107   1.00 55.30  ? 38   THR C O     1 
ATOM   3215 C  CB    . THR C  1 39  ? 113.231 41.451  6.060   1.00 56.62  ? 38   THR C CB    1 
ATOM   3216 O  OG1   . THR C  1 39  ? 114.081 40.305  5.900   1.00 60.46  ? 38   THR C OG1   1 
ATOM   3217 C  CG2   . THR C  1 39  ? 111.792 41.012  6.186   1.00 54.00  ? 38   THR C CG2   1 
ATOM   3218 N  N     . HIS C  1 40  ? 111.619 43.857  4.072   1.00 56.67  ? 39   HIS C N     1 
ATOM   3219 C  CA    . HIS C  1 40  ? 110.760 45.037  4.037   1.00 54.93  ? 39   HIS C CA    1 
ATOM   3220 C  C     . HIS C  1 40  ? 109.427 44.721  4.687   1.00 55.63  ? 39   HIS C C     1 
ATOM   3221 O  O     . HIS C  1 40  ? 108.689 43.852  4.223   1.00 56.93  ? 39   HIS C O     1 
ATOM   3222 C  CB    . HIS C  1 40  ? 110.569 45.483  2.585   1.00 57.25  ? 39   HIS C CB    1 
ATOM   3223 C  CG    . HIS C  1 40  ? 109.784 46.743  2.428   1.00 55.16  ? 39   HIS C CG    1 
ATOM   3224 N  ND1   . HIS C  1 40  ? 109.074 47.034  1.285   1.00 65.51  ? 39   HIS C ND1   1 
ATOM   3225 C  CD2   . HIS C  1 40  ? 109.613 47.798  3.258   1.00 59.93  ? 39   HIS C CD2   1 
ATOM   3226 C  CE1   . HIS C  1 40  ? 108.491 48.210  1.423   1.00 72.97  ? 39   HIS C CE1   1 
ATOM   3227 N  NE2   . HIS C  1 40  ? 108.791 48.689  2.616   1.00 64.93  ? 39   HIS C NE2   1 
ATOM   3228 N  N     . LEU C  1 41  ? 109.154 45.423  5.779   1.00 56.69  ? 40   LEU C N     1 
ATOM   3229 C  CA    . LEU C  1 41  ? 107.968 45.251  6.582   1.00 55.13  ? 40   LEU C CA    1 
ATOM   3230 C  C     . LEU C  1 41  ? 107.234 46.591  6.704   1.00 58.93  ? 40   LEU C C     1 
ATOM   3231 O  O     . LEU C  1 41  ? 107.845 47.677  6.744   1.00 57.82  ? 40   LEU C O     1 
ATOM   3232 C  CB    . LEU C  1 41  ? 108.348 44.739  7.986   1.00 58.57  ? 40   LEU C CB    1 
ATOM   3233 C  CG    . LEU C  1 41  ? 109.140 43.412  8.100   1.00 58.19  ? 40   LEU C CG    1 
ATOM   3234 C  CD1   . LEU C  1 41  ? 109.409 43.078  9.545   1.00 65.51  ? 40   LEU C CD1   1 
ATOM   3235 C  CD2   . LEU C  1 41  ? 108.447 42.224  7.445   1.00 55.27  ? 40   LEU C CD2   1 
ATOM   3236 N  N     . SER C  1 42  ? 105.911 46.493  6.740   1.00 58.55  ? 41   SER C N     1 
ATOM   3237 C  CA    . SER C  1 42  ? 105.012 47.615  7.016   1.00 57.66  ? 41   SER C CA    1 
ATOM   3238 C  C     . SER C  1 42  ? 103.800 47.104  7.785   1.00 56.31  ? 41   SER C C     1 
ATOM   3239 O  O     . SER C  1 42  ? 103.379 45.980  7.614   1.00 56.64  ? 41   SER C O     1 
ATOM   3240 C  CB    . SER C  1 42  ? 104.524 48.290  5.733   1.00 52.16  ? 41   SER C CB    1 
ATOM   3241 O  OG    . SER C  1 42  ? 103.755 47.385  4.946   1.00 57.80  ? 41   SER C OG    1 
ATOM   3242 N  N     . THR C  1 43  ? 103.238 47.971  8.609   1.00 58.14  ? 42   THR C N     1 
ATOM   3243 C  CA    . THR C  1 43  ? 102.039 47.677  9.353   1.00 58.96  ? 42   THR C CA    1 
ATOM   3244 C  C     . THR C  1 43  ? 100.883 47.213  8.461   1.00 55.48  ? 42   THR C C     1 
ATOM   3245 O  O     . THR C  1 43  ? 100.241 46.204  8.755   1.00 59.20  ? 42   THR C O     1 
ATOM   3246 C  CB    . THR C  1 43  ? 101.671 48.904  10.218  1.00 51.79  ? 42   THR C CB    1 
ATOM   3247 O  OG1   . THR C  1 43  ? 102.643 49.003  11.267  1.00 59.51  ? 42   THR C OG1   1 
ATOM   3248 C  CG2   . THR C  1 43  ? 100.263 48.740  10.835  1.00 69.69  ? 42   THR C CG2   1 
ATOM   3249 N  N     . GLY C  1 44  ? 100.646 47.909  7.352   1.00 58.67  ? 43   GLY C N     1 
ATOM   3250 C  CA    . GLY C  1 44  ? 99.527  47.566  6.449   1.00 52.60  ? 43   GLY C CA    1 
ATOM   3251 C  C     . GLY C  1 44  ? 99.650  46.174  5.883   1.00 56.30  ? 43   GLY C C     1 
ATOM   3252 O  O     . GLY C  1 44  ? 98.666  45.433  5.783   1.00 56.09  ? 43   GLY C O     1 
ATOM   3253 N  N     . GLU C  1 45  ? 100.870 45.805  5.502   1.00 57.62  ? 44   GLU C N     1 
ATOM   3254 C  CA    . GLU C  1 45  ? 101.115 44.485  4.940   1.00 54.58  ? 44   GLU C CA    1 
ATOM   3255 C  C     . GLU C  1 45  ? 101.023 43.383  6.015   1.00 53.14  ? 44   GLU C C     1 
ATOM   3256 O  O     . GLU C  1 45  ? 100.501 42.309  5.744   1.00 52.89  ? 44   GLU C O     1 
ATOM   3257 C  CB    . GLU C  1 45  ? 102.449 44.456  4.207   1.00 58.76  ? 44   GLU C CB    1 
ATOM   3258 C  CG    . GLU C  1 45  ? 102.680 43.188  3.371   1.00 76.54  ? 44   GLU C CG    1 
ATOM   3259 C  CD    . GLU C  1 45  ? 101.679 43.002  2.215   1.00 89.88  ? 44   GLU C CD    1 
ATOM   3260 O  OE1   . GLU C  1 45  ? 101.005 43.979  1.775   1.00 78.40  ? 44   GLU C OE1   1 
ATOM   3261 O  OE2   . GLU C  1 45  ? 101.575 41.850  1.744   1.00 96.08  ? 44   GLU C OE2   1 
ATOM   3262 N  N     . LEU C  1 46  ? 101.474 43.669  7.235   1.00 53.68  ? 45   LEU C N     1 
ATOM   3263 C  CA    . LEU C  1 46  ? 101.368 42.722  8.360   1.00 53.63  ? 45   LEU C CA    1 
ATOM   3264 C  C     . LEU C  1 46  ? 99.913  42.461  8.708   1.00 53.86  ? 45   LEU C C     1 
ATOM   3265 O  O     . LEU C  1 46  ? 99.553  41.333  8.935   1.00 54.62  ? 45   LEU C O     1 
ATOM   3266 C  CB    . LEU C  1 46  ? 102.093 43.243  9.592   1.00 52.34  ? 45   LEU C CB    1 
ATOM   3267 C  CG    . LEU C  1 46  ? 103.624 43.267  9.516   1.00 60.92  ? 45   LEU C CG    1 
ATOM   3268 C  CD1   . LEU C  1 46  ? 104.203 44.002  10.677  1.00 55.57  ? 45   LEU C CD1   1 
ATOM   3269 C  CD2   . LEU C  1 46  ? 104.186 41.881  9.458   1.00 58.60  ? 45   LEU C CD2   1 
ATOM   3270 N  N     . LEU C  1 47  ? 99.100  43.514  8.722   1.00 55.26  ? 46   LEU C N     1 
ATOM   3271 C  CA    . LEU C  1 47  ? 97.642  43.430  8.922   1.00 56.09  ? 46   LEU C CA    1 
ATOM   3272 C  C     . LEU C  1 47  ? 96.934  42.687  7.837   1.00 54.03  ? 46   LEU C C     1 
ATOM   3273 O  O     . LEU C  1 47  ? 96.118  41.836  8.111   1.00 58.75  ? 46   LEU C O     1 
ATOM   3274 C  CB    . LEU C  1 47  ? 97.032  44.838  9.022   1.00 55.15  ? 46   LEU C CB    1 
ATOM   3275 C  CG    . LEU C  1 47  ? 97.364  45.597  10.315  1.00 53.67  ? 46   LEU C CG    1 
ATOM   3276 C  CD1   . LEU C  1 47  ? 96.786  46.990  10.256  1.00 62.47  ? 46   LEU C CD1   1 
ATOM   3277 C  CD2   . LEU C  1 47  ? 96.854  44.844  11.555  1.00 57.48  ? 46   LEU C CD2   1 
ATOM   3278 N  N     . ARG C  1 48  ? 97.240  43.012  6.592   1.00 56.76  ? 47   ARG C N     1 
ATOM   3279 C  CA    . ARG C  1 48  ? 96.680  42.304  5.433   1.00 58.50  ? 47   ARG C CA    1 
ATOM   3280 C  C     . ARG C  1 48  ? 96.952  40.785  5.494   1.00 58.19  ? 47   ARG C C     1 
ATOM   3281 O  O     . ARG C  1 48  ? 96.058  39.970  5.249   1.00 61.06  ? 47   ARG C O     1 
ATOM   3282 C  CB    . ARG C  1 48  ? 97.291  42.901  4.162   1.00 58.07  ? 47   ARG C CB    1 
ATOM   3283 C  CG    . ARG C  1 48  ? 96.655  42.492  2.844   1.00 66.54  ? 47   ARG C CG    1 
ATOM   3284 C  CD    . ARG C  1 48  ? 97.689  42.260  1.717   1.00 79.80  ? 47   ARG C CD    1 
ATOM   3285 N  NE    . ARG C  1 48  ? 97.857  40.813  1.512   1.00 103.34 ? 47   ARG C NE    1 
ATOM   3286 C  CZ    . ARG C  1 48  ? 98.777  40.030  2.090   1.00 87.16  ? 47   ARG C CZ    1 
ATOM   3287 N  NH1   . ARG C  1 48  ? 98.757  38.729  1.849   1.00 84.42  ? 47   ARG C NH1   1 
ATOM   3288 N  NH2   . ARG C  1 48  ? 99.706  40.513  2.910   1.00 99.92  ? 47   ARG C NH2   1 
ATOM   3289 N  N     . GLU C  1 49  ? 98.205  40.439  5.797   1.00 56.65  ? 48   GLU C N     1 
ATOM   3290 C  CA    . GLU C  1 49  ? 98.668  39.068  5.963   1.00 60.67  ? 48   GLU C CA    1 
ATOM   3291 C  C     . GLU C  1 49  ? 97.966  38.378  7.134   1.00 58.54  ? 48   GLU C C     1 
ATOM   3292 O  O     . GLU C  1 49  ? 97.517  37.263  6.992   1.00 55.90  ? 48   GLU C O     1 
ATOM   3293 C  CB    . GLU C  1 49  ? 100.191 39.069  6.181   1.00 66.03  ? 48   GLU C CB    1 
ATOM   3294 C  CG    . GLU C  1 49  ? 100.875 37.697  6.128   1.00 73.42  ? 48   GLU C CG    1 
ATOM   3295 C  CD    . GLU C  1 49  ? 102.350 37.715  6.602   1.00 80.94  ? 48   GLU C CD    1 
ATOM   3296 O  OE1   . GLU C  1 49  ? 102.772 38.617  7.403   1.00 81.75  ? 48   GLU C OE1   1 
ATOM   3297 O  OE2   . GLU C  1 49  ? 103.086 36.793  6.172   1.00 98.65  ? 48   GLU C OE2   1 
ATOM   3298 N  N     . GLU C  1 50  ? 97.849  39.050  8.281   1.00 56.32  ? 49   GLU C N     1 
ATOM   3299 C  CA    . GLU C  1 50  ? 97.150  38.472  9.422   1.00 57.45  ? 49   GLU C CA    1 
ATOM   3300 C  C     . GLU C  1 50  ? 95.668  38.204  9.120   1.00 57.95  ? 49   GLU C C     1 
ATOM   3301 O  O     . GLU C  1 50  ? 95.137  37.121  9.428   1.00 55.32  ? 49   GLU C O     1 
ATOM   3302 C  CB    . GLU C  1 50  ? 97.296  39.369  10.660  1.00 56.85  ? 49   GLU C CB    1 
ATOM   3303 C  CG    . GLU C  1 50  ? 96.578  38.854  11.925  1.00 63.12  ? 49   GLU C CG    1 
ATOM   3304 C  CD    . GLU C  1 50  ? 97.085  37.505  12.426  1.00 71.84  ? 49   GLU C CD    1 
ATOM   3305 O  OE1   . GLU C  1 50  ? 98.065  36.946  11.853  1.00 72.90  ? 49   GLU C OE1   1 
ATOM   3306 O  OE2   . GLU C  1 50  ? 96.492  37.005  13.413  1.00 66.57  ? 49   GLU C OE2   1 
ATOM   3307 N  N     . LEU C  1 51  ? 95.033  39.183  8.491   1.00 56.47  ? 50   LEU C N     1 
ATOM   3308 C  CA    . LEU C  1 51  ? 93.642  39.113  8.127   1.00 58.87  ? 50   LEU C CA    1 
ATOM   3309 C  C     . LEU C  1 51  ? 93.359  37.967  7.191   1.00 61.07  ? 50   LEU C C     1 
ATOM   3310 O  O     . LEU C  1 51  ? 92.233  37.478  7.190   1.00 64.22  ? 50   LEU C O     1 
ATOM   3311 C  CB    . LEU C  1 51  ? 93.169  40.395  7.452   1.00 62.04  ? 50   LEU C CB    1 
ATOM   3312 C  CG    . LEU C  1 51  ? 92.893  41.629  8.306   1.00 66.21  ? 50   LEU C CG    1 
ATOM   3313 C  CD1   . LEU C  1 51  ? 92.499  42.763  7.364   1.00 71.59  ? 50   LEU C CD1   1 
ATOM   3314 C  CD2   . LEU C  1 51  ? 91.803  41.371  9.318   1.00 71.52  ? 50   LEU C CD2   1 
ATOM   3315 N  N     . ALA C  1 52  ? 94.354  37.545  6.402   1.00 56.94  ? 51   ALA C N     1 
ATOM   3316 C  CA    . ALA C  1 52  ? 94.186  36.394  5.544   1.00 55.00  ? 51   ALA C CA    1 
ATOM   3317 C  C     . ALA C  1 52  ? 94.482  35.051  6.219   1.00 56.65  ? 51   ALA C C     1 
ATOM   3318 O  O     . ALA C  1 52  ? 94.207  34.010  5.624   1.00 58.10  ? 51   ALA C O     1 
ATOM   3319 C  CB    . ALA C  1 52  ? 95.044  36.543  4.287   1.00 59.24  ? 51   ALA C CB    1 
ATOM   3320 N  N     . SER C  1 53  ? 95.037  35.066  7.434   1.00 58.19  ? 52   SER C N     1 
ATOM   3321 C  CA    . SER C  1 53  ? 95.437  33.844  8.157   1.00 56.53  ? 52   SER C CA    1 
ATOM   3322 C  C     . SER C  1 53  ? 94.295  33.007  8.725   1.00 58.58  ? 52   SER C C     1 
ATOM   3323 O  O     . SER C  1 53  ? 94.509  31.832  9.057   1.00 64.63  ? 52   SER C O     1 
ATOM   3324 C  CB    . SER C  1 53  ? 96.369  34.189  9.336   1.00 52.18  ? 52   SER C CB    1 
ATOM   3325 O  OG    . SER C  1 53  ? 95.658  34.856  10.391  1.00 55.62  ? 52   SER C OG    1 
ATOM   3326 N  N     . GLU C  1 54  ? 93.110  33.599  8.879   1.00 55.26  ? 53   GLU C N     1 
ATOM   3327 C  CA    . GLU C  1 54  ? 91.961  32.912  9.514   1.00 62.69  ? 53   GLU C CA    1 
ATOM   3328 C  C     . GLU C  1 54  ? 92.149  32.602  11.033  1.00 58.88  ? 53   GLU C C     1 
ATOM   3329 O  O     . GLU C  1 54  ? 91.367  31.869  11.645  1.00 55.23  ? 53   GLU C O     1 
ATOM   3330 C  CB    . GLU C  1 54  ? 91.614  31.623  8.771   1.00 56.39  ? 53   GLU C CB    1 
ATOM   3331 C  CG    . GLU C  1 54  ? 91.280  31.805  7.286   1.00 72.52  ? 53   GLU C CG    1 
ATOM   3332 C  CD    . GLU C  1 54  ? 91.108  30.473  6.557   1.00 72.76  ? 53   GLU C CD    1 
ATOM   3333 O  OE1   . GLU C  1 54  ? 92.028  29.626  6.616   1.00 93.53  ? 53   GLU C OE1   1 
ATOM   3334 O  OE2   . GLU C  1 54  ? 90.049  30.269  5.925   1.00 106.15 ? 53   GLU C OE2   1 
ATOM   3335 N  N     . SER C  1 55  ? 93.170  33.196  11.634  1.00 57.28  ? 54   SER C N     1 
ATOM   3336 C  CA    . SER C  1 55  ? 93.413  33.037  13.039  1.00 53.35  ? 54   SER C CA    1 
ATOM   3337 C  C     . SER C  1 55  ? 92.272  33.690  13.841  1.00 54.36  ? 54   SER C C     1 
ATOM   3338 O  O     . SER C  1 55  ? 91.537  34.550  13.348  1.00 53.71  ? 54   SER C O     1 
ATOM   3339 C  CB    . SER C  1 55  ? 94.774  33.628  13.412  1.00 51.39  ? 54   SER C CB    1 
ATOM   3340 O  OG    . SER C  1 55  ? 94.754  35.048  13.484  1.00 47.60  ? 54   SER C OG    1 
ATOM   3341 N  N     . GLU C  1 56  ? 92.120  33.262  15.082  1.00 50.77  ? 55   GLU C N     1 
ATOM   3342 C  CA    . GLU C  1 56  ? 91.161  33.893  15.950  1.00 51.49  ? 55   GLU C CA    1 
ATOM   3343 C  C     . GLU C  1 56  ? 91.537  35.345  16.189  1.00 47.46  ? 55   GLU C C     1 
ATOM   3344 O  O     . GLU C  1 56  ? 90.666  36.210  16.272  1.00 53.15  ? 55   GLU C O     1 
ATOM   3345 C  CB    . GLU C  1 56  ? 91.082  33.155  17.296  1.00 50.51  ? 55   GLU C CB    1 
ATOM   3346 C  CG    . GLU C  1 56  ? 89.707  33.024  17.791  1.00 44.81  ? 55   GLU C CG    1 
ATOM   3347 C  CD    . GLU C  1 56  ? 88.812  32.284  16.802  1.00 59.30  ? 55   GLU C CD    1 
ATOM   3348 O  OE1   . GLU C  1 56  ? 89.311  31.375  16.114  1.00 54.12  ? 55   GLU C OE1   1 
ATOM   3349 O  OE2   . GLU C  1 56  ? 87.608  32.612  16.712  1.00 52.77  ? 55   GLU C OE2   1 
ATOM   3350 N  N     . ARG C  1 57  ? 92.828  35.608  16.361  1.00 53.19  ? 56   ARG C N     1 
ATOM   3351 C  CA    . ARG C  1 57  ? 93.304  36.983  16.510  1.00 49.53  ? 56   ARG C CA    1 
ATOM   3352 C  C     . ARG C  1 57  ? 92.878  37.828  15.299  1.00 46.32  ? 56   ARG C C     1 
ATOM   3353 O  O     . ARG C  1 57  ? 92.428  38.934  15.450  1.00 51.85  ? 56   ARG C O     1 
ATOM   3354 C  CB    . ARG C  1 57  ? 94.825  37.020  16.674  1.00 48.06  ? 56   ARG C CB    1 
ATOM   3355 C  CG    . ARG C  1 57  ? 95.375  38.434  16.923  1.00 52.73  ? 56   ARG C CG    1 
ATOM   3356 C  CD    . ARG C  1 57  ? 96.858  38.458  17.076  1.00 51.50  ? 56   ARG C CD    1 
ATOM   3357 N  NE    . ARG C  1 57  ? 97.555  37.878  15.936  1.00 55.13  ? 56   ARG C NE    1 
ATOM   3358 C  CZ    . ARG C  1 57  ? 98.808  37.412  15.985  1.00 59.55  ? 56   ARG C CZ    1 
ATOM   3359 N  NH1   . ARG C  1 57  ? 99.526  37.502  17.097  1.00 61.75  ? 56   ARG C NH1   1 
ATOM   3360 N  NH2   . ARG C  1 57  ? 99.357  36.873  14.911  1.00 54.43  ? 56   ARG C NH2   1 
ATOM   3361 N  N     . SER C  1 58  ? 92.969  37.270  14.101  1.00 52.79  ? 57   SER C N     1 
ATOM   3362 C  CA    . SER C  1 58  ? 92.634  37.990  12.899  1.00 50.76  ? 57   SER C CA    1 
ATOM   3363 C  C     . SER C  1 58  ? 91.182  38.451  12.883  1.00 54.52  ? 57   SER C C     1 
ATOM   3364 O  O     . SER C  1 58  ? 90.883  39.477  12.291  1.00 53.81  ? 57   SER C O     1 
ATOM   3365 C  CB    . SER C  1 58  ? 92.966  37.147  11.651  1.00 48.59  ? 57   SER C CB    1 
ATOM   3366 O  OG    . SER C  1 58  ? 91.961  36.198  11.315  1.00 59.72  ? 57   SER C OG    1 
ATOM   3367 N  N     . LYS C  1 59  ? 90.288  37.690  13.511  1.00 54.16  ? 58   LYS C N     1 
ATOM   3368 C  CA    . LYS C  1 59  ? 88.873  38.060  13.591  1.00 51.86  ? 58   LYS C CA    1 
ATOM   3369 C  C     . LYS C  1 59  ? 88.655  39.205  14.601  1.00 52.87  ? 58   LYS C C     1 
ATOM   3370 O  O     . LYS C  1 59  ? 87.774  40.038  14.421  1.00 54.87  ? 58   LYS C O     1 
ATOM   3371 C  CB    . LYS C  1 59  ? 88.024  36.846  13.982  1.00 49.26  ? 58   LYS C CB    1 
ATOM   3372 C  CG    . LYS C  1 59  ? 88.034  35.698  12.968  1.00 52.93  ? 58   LYS C CG    1 
ATOM   3373 C  CD    . LYS C  1 59  ? 87.174  34.572  13.464  1.00 57.44  ? 58   LYS C CD    1 
ATOM   3374 C  CE    . LYS C  1 59  ? 86.978  33.467  12.431  1.00 60.87  ? 58   LYS C CE    1 
ATOM   3375 N  NZ    . LYS C  1 59  ? 85.776  32.625  12.818  1.00 75.77  ? 58   LYS C NZ    1 
ATOM   3376 N  N     . LEU C  1 60  ? 89.438  39.235  15.672  1.00 52.72  ? 59   LEU C N     1 
ATOM   3377 C  CA    . LEU C  1 60  ? 89.502  40.413  16.534  1.00 54.77  ? 59   LEU C CA    1 
ATOM   3378 C  C     . LEU C  1 60  ? 89.977  41.654  15.744  1.00 52.86  ? 59   LEU C C     1 
ATOM   3379 O  O     . LEU C  1 60  ? 89.355  42.704  15.765  1.00 56.19  ? 59   LEU C O     1 
ATOM   3380 C  CB    . LEU C  1 60  ? 90.405  40.151  17.758  1.00 55.71  ? 59   LEU C CB    1 
ATOM   3381 C  CG    . LEU C  1 60  ? 90.594  41.334  18.743  1.00 63.17  ? 59   LEU C CG    1 
ATOM   3382 C  CD1   . LEU C  1 60  ? 89.261  41.937  19.187  1.00 61.29  ? 59   LEU C CD1   1 
ATOM   3383 C  CD2   . LEU C  1 60  ? 91.396  40.922  19.943  1.00 58.45  ? 59   LEU C CD2   1 
ATOM   3384 N  N     . ILE C  1 61  ? 91.073  41.524  15.029  1.00 55.18  ? 60   ILE C N     1 
ATOM   3385 C  CA    . ILE C  1 61  ? 91.583  42.626  14.202  1.00 57.15  ? 60   ILE C CA    1 
ATOM   3386 C  C     . ILE C  1 61  ? 90.581  43.049  13.106  1.00 60.26  ? 60   ILE C C     1 
ATOM   3387 O  O     . ILE C  1 61  ? 90.402  44.236  12.831  1.00 57.92  ? 60   ILE C O     1 
ATOM   3388 C  CB    . ILE C  1 61  ? 92.936  42.245  13.566  1.00 60.91  ? 60   ILE C CB    1 
ATOM   3389 C  CG1   . ILE C  1 61  ? 93.996  42.096  14.665  1.00 60.08  ? 60   ILE C CG1   1 
ATOM   3390 C  CG2   . ILE C  1 61  ? 93.369  43.266  12.522  1.00 63.67  ? 60   ILE C CG2   1 
ATOM   3391 C  CD1   . ILE C  1 61  ? 95.248  41.416  14.198  1.00 64.87  ? 60   ILE C CD1   1 
ATOM   3392 N  N     . ARG C  1 62  ? 89.913  42.082  12.485  1.00 58.90  ? 61   ARG C N     1 
ATOM   3393 C  CA    . ARG C  1 62  ? 88.965  42.419  11.453  1.00 57.54  ? 61   ARG C CA    1 
ATOM   3394 C  C     . ARG C  1 62  ? 87.807  43.272  11.996  1.00 58.44  ? 61   ARG C C     1 
ATOM   3395 O  O     . ARG C  1 62  ? 87.425  44.247  11.345  1.00 58.87  ? 61   ARG C O     1 
ATOM   3396 C  CB    . ARG C  1 62  ? 88.431  41.167  10.762  1.00 60.16  ? 61   ARG C CB    1 
ATOM   3397 C  CG    . ARG C  1 62  ? 87.451  41.481  9.627   1.00 54.10  ? 61   ARG C CG    1 
ATOM   3398 C  CD    . ARG C  1 62  ? 86.979  40.223  8.936   1.00 64.64  ? 61   ARG C CD    1 
ATOM   3399 N  NE    . ARG C  1 62  ? 88.086  39.402  8.450   1.00 61.77  ? 61   ARG C NE    1 
ATOM   3400 C  CZ    . ARG C  1 62  ? 88.785  39.657  7.343   1.00 75.97  ? 61   ARG C CZ    1 
ATOM   3401 N  NH1   . ARG C  1 62  ? 88.507  40.723  6.584   1.00 63.96  ? 61   ARG C NH1   1 
ATOM   3402 N  NH2   . ARG C  1 62  ? 89.775  38.837  6.986   1.00 64.48  ? 61   ARG C NH2   1 
ATOM   3403 N  N     . ASP C  1 63  ? 87.237  42.890  13.140  1.00 53.28  ? 62   ASP C N     1 
ATOM   3404 C  CA    . ASP C  1 63  ? 86.255  43.735  13.829  1.00 58.02  ? 62   ASP C CA    1 
ATOM   3405 C  C     . ASP C  1 63  ? 86.690  45.208  13.879  1.00 57.84  ? 62   ASP C C     1 
ATOM   3406 O  O     . ASP C  1 63  ? 85.992  46.100  13.431  1.00 60.05  ? 62   ASP C O     1 
ATOM   3407 C  CB    . ASP C  1 63  ? 86.031  43.244  15.267  1.00 55.84  ? 62   ASP C CB    1 
ATOM   3408 C  CG    . ASP C  1 63  ? 85.257  41.938  15.328  1.00 69.99  ? 62   ASP C CG    1 
ATOM   3409 O  OD1   . ASP C  1 63  ? 84.735  41.535  14.269  1.00 73.24  ? 62   ASP C OD1   1 
ATOM   3410 O  OD2   . ASP C  1 63  ? 85.154  41.316  16.422  1.00 61.61  ? 62   ASP C OD2   1 
ATOM   3411 N  N     . ILE C  1 64  ? 87.868  45.444  14.423  1.00 59.79  ? 63   ILE C N     1 
ATOM   3412 C  CA    . ILE C  1 64  ? 88.380  46.789  14.600  1.00 59.28  ? 63   ILE C CA    1 
ATOM   3413 C  C     . ILE C  1 64  ? 88.568  47.513  13.263  1.00 62.19  ? 63   ILE C C     1 
ATOM   3414 O  O     . ILE C  1 64  ? 88.188  48.683  13.110  1.00 62.46  ? 63   ILE C O     1 
ATOM   3415 C  CB    . ILE C  1 64  ? 89.754  46.743  15.383  1.00 59.63  ? 63   ILE C CB    1 
ATOM   3416 C  CG1   . ILE C  1 64  ? 89.531  46.317  16.845  1.00 62.07  ? 63   ILE C CG1   1 
ATOM   3417 C  CG2   . ILE C  1 64  ? 90.462  48.093  15.353  1.00 63.39  ? 63   ILE C CG2   1 
ATOM   3418 C  CD1   . ILE C  1 64  ? 90.742  45.612  17.468  1.00 65.41  ? 63   ILE C CD1   1 
ATOM   3419 N  N     . MET C  1 65  ? 89.193  46.844  12.302  1.00 59.35  ? 64   MET C N     1 
ATOM   3420 C  CA    . MET C  1 65  ? 89.533  47.514  11.055  1.00 63.97  ? 64   MET C CA    1 
ATOM   3421 C  C     . MET C  1 65  ? 88.278  47.908  10.278  1.00 62.19  ? 64   MET C C     1 
ATOM   3422 O  O     . MET C  1 65  ? 88.245  48.945  9.622   1.00 63.77  ? 64   MET C O     1 
ATOM   3423 C  CB    . MET C  1 65  ? 90.487  46.672  10.217  1.00 62.17  ? 64   MET C CB    1 
ATOM   3424 C  CG    . MET C  1 65  ? 91.890  46.656  10.804  1.00 62.42  ? 64   MET C CG    1 
ATOM   3425 S  SD    . MET C  1 65  ? 92.977  45.632  9.807   1.00 74.51  ? 64   MET C SD    1 
ATOM   3426 C  CE    . MET C  1 65  ? 93.054  46.575  8.266   1.00 87.99  ? 64   MET C CE    1 
ATOM   3427 N  N     . GLU C  1 66  ? 87.235  47.094  10.419  1.00 64.79  ? 65   GLU C N     1 
ATOM   3428 C  CA    . GLU C  1 66  ? 85.924  47.329  9.794   1.00 62.73  ? 65   GLU C CA    1 
ATOM   3429 C  C     . GLU C  1 66  ? 85.176  48.526  10.366  1.00 63.29  ? 65   GLU C C     1 
ATOM   3430 O  O     . GLU C  1 66  ? 84.230  49.004  9.742   1.00 60.23  ? 65   GLU C O     1 
ATOM   3431 C  CB    . GLU C  1 66  ? 85.063  46.092  9.978   1.00 64.44  ? 65   GLU C CB    1 
ATOM   3432 C  CG    . GLU C  1 66  ? 85.388  44.968  8.990   1.00 66.75  ? 65   GLU C CG    1 
ATOM   3433 C  CD    . GLU C  1 66  ? 84.458  43.787  9.170   1.00 71.58  ? 65   GLU C CD    1 
ATOM   3434 O  OE1   . GLU C  1 66  ? 83.770  43.740  10.221  1.00 74.58  ? 65   GLU C OE1   1 
ATOM   3435 O  OE2   . GLU C  1 66  ? 84.432  42.915  8.271   1.00 69.07  ? 65   GLU C OE2   1 
ATOM   3436 N  N     . ARG C  1 67  ? 85.570  48.983  11.568  1.00 62.23  ? 66   ARG C N     1 
ATOM   3437 C  CA    . ARG C  1 67  ? 85.070  50.263  12.095  1.00 59.01  ? 66   ARG C CA    1 
ATOM   3438 C  C     . ARG C  1 67  ? 85.938  51.442  11.664  1.00 56.12  ? 66   ARG C C     1 
ATOM   3439 O  O     . ARG C  1 67  ? 85.546  52.596  11.815  1.00 60.02  ? 66   ARG C O     1 
ATOM   3440 C  CB    . ARG C  1 67  ? 84.991  50.236  13.602  1.00 56.03  ? 66   ARG C CB    1 
ATOM   3441 C  CG    . ARG C  1 67  ? 84.104  49.143  14.153  1.00 61.20  ? 66   ARG C CG    1 
ATOM   3442 C  CD    . ARG C  1 67  ? 84.830  48.528  15.323  1.00 73.39  ? 66   ARG C CD    1 
ATOM   3443 N  NE    . ARG C  1 67  ? 84.135  47.403  15.932  1.00 81.56  ? 66   ARG C NE    1 
ATOM   3444 C  CZ    . ARG C  1 67  ? 84.701  46.570  16.807  1.00 80.56  ? 66   ARG C CZ    1 
ATOM   3445 N  NH1   . ARG C  1 67  ? 84.000  45.564  17.324  1.00 83.38  ? 66   ARG C NH1   1 
ATOM   3446 N  NH2   . ARG C  1 67  ? 85.965  46.751  17.183  1.00 74.70  ? 66   ARG C NH2   1 
ATOM   3447 N  N     . GLY C  1 68  ? 87.097  51.146  11.074  1.00 58.96  ? 67   GLY C N     1 
ATOM   3448 C  CA    . GLY C  1 68  ? 88.120  52.157  10.811  1.00 57.25  ? 67   GLY C CA    1 
ATOM   3449 C  C     . GLY C  1 68  ? 88.644  52.633  12.148  1.00 58.26  ? 67   GLY C C     1 
ATOM   3450 O  O     . GLY C  1 68  ? 88.930  53.816  12.318  1.00 58.99  ? 67   GLY C O     1 
ATOM   3451 N  N     . ASP C  1 69  ? 88.716  51.707  13.107  1.00 60.20  ? 68   ASP C N     1 
ATOM   3452 C  CA    . ASP C  1 69  ? 89.187  52.011  14.450  1.00 65.57  ? 68   ASP C CA    1 
ATOM   3453 C  C     . ASP C  1 69  ? 90.633  51.645  14.561  1.00 62.73  ? 68   ASP C C     1 
ATOM   3454 O  O     . ASP C  1 69  ? 91.191  50.923  13.709  1.00 59.63  ? 68   ASP C O     1 
ATOM   3455 C  CB    . ASP C  1 69  ? 88.390  51.273  15.539  1.00 65.14  ? 68   ASP C CB    1 
ATOM   3456 C  CG    . ASP C  1 69  ? 87.102  51.975  15.884  1.00 79.20  ? 68   ASP C CG    1 
ATOM   3457 O  OD1   . ASP C  1 69  ? 86.777  53.005  15.224  1.00 74.67  ? 68   ASP C OD1   1 
ATOM   3458 O  OD2   . ASP C  1 69  ? 86.425  51.508  16.827  1.00 63.34  ? 68   ASP C OD2   1 
ATOM   3459 N  N     . LEU C  1 70  ? 91.209  52.179  15.633  1.00 62.48  ? 69   LEU C N     1 
ATOM   3460 C  CA    . LEU C  1 70  ? 92.608  52.020  15.992  1.00 62.87  ? 69   LEU C CA    1 
ATOM   3461 C  C     . LEU C  1 70  ? 92.911  50.570  16.348  1.00 61.61  ? 69   LEU C C     1 
ATOM   3462 O  O     . LEU C  1 70  ? 92.274  49.964  17.241  1.00 60.29  ? 69   LEU C O     1 
ATOM   3463 C  CB    . LEU C  1 70  ? 92.920  52.923  17.194  1.00 61.49  ? 69   LEU C CB    1 
ATOM   3464 C  CG    . LEU C  1 70  ? 94.332  52.943  17.765  1.00 69.87  ? 69   LEU C CG    1 
ATOM   3465 C  CD1   . LEU C  1 70  ? 95.281  53.863  16.978  1.00 74.01  ? 69   LEU C CD1   1 
ATOM   3466 C  CD2   . LEU C  1 70  ? 94.237  53.404  19.195  1.00 72.10  ? 69   LEU C CD2   1 
ATOM   3467 N  N     . VAL C  1 71  ? 93.877  50.014  15.628  1.00 62.96  ? 70   VAL C N     1 
ATOM   3468 C  CA    . VAL C  1 71  ? 94.415  48.711  15.965  1.00 64.82  ? 70   VAL C CA    1 
ATOM   3469 C  C     . VAL C  1 71  ? 95.373  48.988  17.104  1.00 64.02  ? 70   VAL C C     1 
ATOM   3470 O  O     . VAL C  1 71  ? 96.290  49.804  16.935  1.00 61.84  ? 70   VAL C O     1 
ATOM   3471 C  CB    . VAL C  1 71  ? 95.129  48.048  14.756  1.00 59.62  ? 70   VAL C CB    1 
ATOM   3472 C  CG1   . VAL C  1 71  ? 95.701  46.740  15.158  1.00 64.85  ? 70   VAL C CG1   1 
ATOM   3473 C  CG2   . VAL C  1 71  ? 94.119  47.855  13.612  1.00 65.53  ? 70   VAL C CG2   1 
ATOM   3474 N  N     . PRO C  1 72  ? 95.125  48.385  18.284  1.00 58.13  ? 71   PRO C N     1 
ATOM   3475 C  CA    . PRO C  1 72  ? 96.042  48.550  19.417  1.00 61.18  ? 71   PRO C CA    1 
ATOM   3476 C  C     . PRO C  1 72  ? 97.496  48.279  19.046  1.00 59.53  ? 71   PRO C C     1 
ATOM   3477 O  O     . PRO C  1 72  ? 97.805  47.335  18.309  1.00 60.36  ? 71   PRO C O     1 
ATOM   3478 C  CB    . PRO C  1 72  ? 95.538  47.530  20.429  1.00 60.25  ? 71   PRO C CB    1 
ATOM   3479 C  CG    . PRO C  1 72  ? 94.077  47.414  20.124  1.00 64.58  ? 71   PRO C CG    1 
ATOM   3480 C  CD    . PRO C  1 72  ? 93.962  47.560  18.641  1.00 60.54  ? 71   PRO C CD    1 
ATOM   3481 N  N     . SER C  1 73  ? 98.379  49.128  19.542  1.00 60.72  ? 72   SER C N     1 
ATOM   3482 C  CA    . SER C  1 73  ? 99.772  49.077  19.147  1.00 63.52  ? 72   SER C CA    1 
ATOM   3483 C  C     . SER C  1 73  ? 100.404 47.752  19.594  1.00 58.81  ? 72   SER C C     1 
ATOM   3484 O  O     . SER C  1 73  ? 101.263 47.229  18.910  1.00 58.45  ? 72   SER C O     1 
ATOM   3485 C  CB    . SER C  1 73  ? 100.535 50.329  19.666  1.00 62.66  ? 72   SER C CB    1 
ATOM   3486 O  OG    . SER C  1 73  ? 100.714 50.302  21.066  1.00 85.03  ? 72   SER C OG    1 
ATOM   3487 N  N     . GLY C  1 74  ? 99.957  47.218  20.734  1.00 59.78  ? 73   GLY C N     1 
ATOM   3488 C  CA    . GLY C  1 74  ? 100.378 45.901  21.213  1.00 54.86  ? 73   GLY C CA    1 
ATOM   3489 C  C     . GLY C  1 74  ? 100.081 44.773  20.252  1.00 57.75  ? 73   GLY C C     1 
ATOM   3490 O  O     . GLY C  1 74  ? 100.814 43.801  20.182  1.00 56.11  ? 73   GLY C O     1 
ATOM   3491 N  N     . ILE C  1 75  ? 98.983  44.882  19.514  1.00 58.13  ? 74   ILE C N     1 
ATOM   3492 C  CA    . ILE C  1 75  ? 98.671  43.888  18.493  1.00 58.53  ? 74   ILE C CA    1 
ATOM   3493 C  C     . ILE C  1 75  ? 99.612  44.018  17.291  1.00 57.79  ? 74   ILE C C     1 
ATOM   3494 O  O     . ILE C  1 75  ? 100.148 43.028  16.809  1.00 59.85  ? 74   ILE C O     1 
ATOM   3495 C  CB    . ILE C  1 75  ? 97.193  43.965  18.066  1.00 58.64  ? 74   ILE C CB    1 
ATOM   3496 C  CG1   . ILE C  1 75  ? 96.332  43.524  19.253  1.00 64.71  ? 74   ILE C CG1   1 
ATOM   3497 C  CG2   . ILE C  1 75  ? 96.934  43.085  16.826  1.00 64.33  ? 74   ILE C CG2   1 
ATOM   3498 C  CD1   . ILE C  1 75  ? 94.854  43.580  19.023  1.00 77.16  ? 74   ILE C CD1   1 
ATOM   3499 N  N     . VAL C  1 76  ? 99.810  45.246  16.825  1.00 59.20  ? 75   VAL C N     1 
ATOM   3500 C  CA    . VAL C  1 76  ? 100.723 45.507  15.734  1.00 61.06  ? 75   VAL C CA    1 
ATOM   3501 C  C     . VAL C  1 76  ? 102.125 45.010  16.057  1.00 59.21  ? 75   VAL C C     1 
ATOM   3502 O  O     . VAL C  1 76  ? 102.774 44.438  15.198  1.00 59.89  ? 75   VAL C O     1 
ATOM   3503 C  CB    . VAL C  1 76  ? 100.776 47.012  15.375  1.00 59.73  ? 75   VAL C CB    1 
ATOM   3504 C  CG1   . VAL C  1 76  ? 101.881 47.267  14.336  1.00 61.60  ? 75   VAL C CG1   1 
ATOM   3505 C  CG2   . VAL C  1 76  ? 99.399  47.467  14.849  1.00 58.48  ? 75   VAL C CG2   1 
ATOM   3506 N  N     . LEU C  1 77  ? 102.562 45.231  17.296  1.00 56.04  ? 76   LEU C N     1 
ATOM   3507 C  CA    . LEU C  1 77  ? 103.852 44.774  17.789  1.00 58.01  ? 76   LEU C CA    1 
ATOM   3508 C  C     . LEU C  1 77  ? 104.027 43.252  17.776  1.00 58.46  ? 76   LEU C C     1 
ATOM   3509 O  O     . LEU C  1 77  ? 105.090 42.758  17.372  1.00 59.72  ? 76   LEU C O     1 
ATOM   3510 C  CB    . LEU C  1 77  ? 104.051 45.286  19.206  1.00 60.82  ? 76   LEU C CB    1 
ATOM   3511 C  CG    . LEU C  1 77  ? 105.490 45.228  19.734  1.00 63.28  ? 76   LEU C CG    1 
ATOM   3512 C  CD1   . LEU C  1 77  ? 106.411 46.161  18.936  1.00 68.23  ? 76   LEU C CD1   1 
ATOM   3513 C  CD2   . LEU C  1 77  ? 105.477 45.605  21.189  1.00 66.14  ? 76   LEU C CD2   1 
ATOM   3514 N  N     . GLU C  1 78  ? 103.014 42.526  18.270  1.00 58.17  ? 77   GLU C N     1 
ATOM   3515 C  CA    . GLU C  1 78  ? 102.929 41.074  18.112  1.00 62.29  ? 77   GLU C CA    1 
ATOM   3516 C  C     . GLU C  1 78  ? 103.212 40.684  16.658  1.00 55.19  ? 77   GLU C C     1 
ATOM   3517 O  O     . GLU C  1 78  ? 104.004 39.787  16.377  1.00 58.12  ? 77   GLU C O     1 
ATOM   3518 C  CB    . GLU C  1 78  ? 101.519 40.561  18.428  1.00 62.51  ? 77   GLU C CB    1 
ATOM   3519 C  CG    . GLU C  1 78  ? 101.203 40.078  19.823  1.00 75.55  ? 77   GLU C CG    1 
ATOM   3520 C  CD    . GLU C  1 78  ? 99.793  39.413  19.886  1.00 84.06  ? 77   GLU C CD    1 
ATOM   3521 O  OE1   . GLU C  1 78  ? 99.729  38.168  20.011  1.00 88.03  ? 77   GLU C OE1   1 
ATOM   3522 O  OE2   . GLU C  1 78  ? 98.752  40.120  19.782  1.00 90.77  ? 77   GLU C OE2   1 
ATOM   3523 N  N     . LEU C  1 79  ? 102.493 41.312  15.733  1.00 55.86  ? 78   LEU C N     1 
ATOM   3524 C  CA    . LEU C  1 79  ? 102.593 40.946  14.325  1.00 53.66  ? 78   LEU C CA    1 
ATOM   3525 C  C     . LEU C  1 79  ? 103.974 41.224  13.767  1.00 55.71  ? 78   LEU C C     1 
ATOM   3526 O  O     . LEU C  1 79  ? 104.508 40.448  12.984  1.00 57.21  ? 78   LEU C O     1 
ATOM   3527 C  CB    . LEU C  1 79  ? 101.564 41.696  13.499  1.00 54.91  ? 78   LEU C CB    1 
ATOM   3528 C  CG    . LEU C  1 79  ? 100.085 41.414  13.803  1.00 61.82  ? 78   LEU C CG    1 
ATOM   3529 C  CD1   . LEU C  1 79  ? 99.267  42.188  12.803  1.00 49.63  ? 78   LEU C CD1   1 
ATOM   3530 C  CD2   . LEU C  1 79  ? 99.756  39.937  13.751  1.00 59.94  ? 78   LEU C CD2   1 
ATOM   3531 N  N     . LEU C  1 80  ? 104.544 42.339  14.200  1.00 55.05  ? 79   LEU C N     1 
ATOM   3532 C  CA    . LEU C  1 80  ? 105.835 42.784  13.747  1.00 57.13  ? 79   LEU C CA    1 
ATOM   3533 C  C     . LEU C  1 80  ? 106.939 41.879  14.286  1.00 55.97  ? 79   LEU C C     1 
ATOM   3534 O  O     . LEU C  1 80  ? 107.863 41.479  13.559  1.00 55.77  ? 79   LEU C O     1 
ATOM   3535 C  CB    . LEU C  1 80  ? 106.004 44.217  14.229  1.00 60.96  ? 79   LEU C CB    1 
ATOM   3536 C  CG    . LEU C  1 80  ? 107.147 45.076  13.732  1.00 71.76  ? 79   LEU C CG    1 
ATOM   3537 C  CD1   . LEU C  1 80  ? 107.319 44.965  12.231  1.00 72.99  ? 79   LEU C CD1   1 
ATOM   3538 C  CD2   . LEU C  1 80  ? 106.854 46.502  14.163  1.00 74.84  ? 79   LEU C CD2   1 
ATOM   3539 N  N     . LYS C  1 81  ? 106.829 41.537  15.564  1.00 56.15  ? 80   LYS C N     1 
ATOM   3540 C  CA    . LYS C  1 81  ? 107.760 40.610  16.187  1.00 58.22  ? 80   LYS C CA    1 
ATOM   3541 C  C     . LYS C  1 81  ? 107.724 39.237  15.527  1.00 58.62  ? 80   LYS C C     1 
ATOM   3542 O  O     . LYS C  1 81  ? 108.769 38.641  15.288  1.00 62.00  ? 80   LYS C O     1 
ATOM   3543 C  CB    . LYS C  1 81  ? 107.466 40.456  17.683  1.00 63.49  ? 80   LYS C CB    1 
ATOM   3544 C  CG    . LYS C  1 81  ? 108.354 39.439  18.376  1.00 59.79  ? 80   LYS C CG    1 
ATOM   3545 C  CD    . LYS C  1 81  ? 108.244 39.519  19.901  1.00 71.71  ? 80   LYS C CD    1 
ATOM   3546 N  N     . GLU C  1 82  ? 106.529 38.717  15.267  1.00 56.22  ? 81   GLU C N     1 
ATOM   3547 C  CA    . GLU C  1 82  ? 106.419 37.433  14.593  1.00 54.78  ? 81   GLU C CA    1 
ATOM   3548 C  C     . GLU C  1 82  ? 107.105 37.441  13.227  1.00 55.80  ? 81   GLU C C     1 
ATOM   3549 O  O     . GLU C  1 82  ? 107.894 36.535  12.931  1.00 58.40  ? 81   GLU C O     1 
ATOM   3550 C  CB    . GLU C  1 82  ? 104.965 37.026  14.469  1.00 57.90  ? 81   GLU C CB    1 
ATOM   3551 C  CG    . GLU C  1 82  ? 104.356 36.594  15.796  1.00 64.88  ? 81   GLU C CG    1 
ATOM   3552 C  CD    . GLU C  1 82  ? 102.831 36.465  15.761  1.00 73.26  ? 81   GLU C CD    1 
ATOM   3553 O  OE1   . GLU C  1 82  ? 102.266 36.353  14.653  1.00 67.96  ? 81   GLU C OE1   1 
ATOM   3554 O  OE2   . GLU C  1 82  ? 102.206 36.463  16.848  1.00 70.08  ? 81   GLU C OE2   1 
ATOM   3555 N  N     . ALA C  1 83  ? 106.838 38.465  12.412  1.00 57.96  ? 82   ALA C N     1 
ATOM   3556 C  CA    . ALA C  1 83  ? 107.493 38.617  11.091  1.00 57.30  ? 82   ALA C CA    1 
ATOM   3557 C  C     . ALA C  1 83  ? 109.000 38.679  11.206  1.00 58.12  ? 82   ALA C C     1 
ATOM   3558 O  O     . ALA C  1 83  ? 109.726 38.140  10.367  1.00 58.40  ? 82   ALA C O     1 
ATOM   3559 C  CB    . ALA C  1 83  ? 106.997 39.871  10.380  1.00 54.56  ? 82   ALA C CB    1 
ATOM   3560 N  N     . MET C  1 84  ? 109.463 39.370  12.239  1.00 59.74  ? 83   MET C N     1 
ATOM   3561 C  CA    . MET C  1 84  ? 110.888 39.541  12.470  1.00 56.84  ? 83   MET C CA    1 
ATOM   3562 C  C     . MET C  1 84  ? 111.516 38.233  12.903  1.00 57.76  ? 83   MET C C     1 
ATOM   3563 O  O     . MET C  1 84  ? 112.598 37.882  12.431  1.00 58.93  ? 83   MET C O     1 
ATOM   3564 C  CB    . MET C  1 84  ? 111.143 40.660  13.491  1.00 57.20  ? 83   MET C CB    1 
ATOM   3565 C  CG    . MET C  1 84  ? 110.900 42.058  12.887  1.00 60.37  ? 83   MET C CG    1 
ATOM   3566 S  SD    . MET C  1 84  ? 111.060 43.459  14.018  1.00 54.66  ? 83   MET C SD    1 
ATOM   3567 C  CE    . MET C  1 84  ? 112.819 43.490  14.312  1.00 62.13  ? 83   MET C CE    1 
ATOM   3568 N  N     . VAL C  1 85  ? 110.841 37.499  13.781  1.00 60.06  ? 84   VAL C N     1 
ATOM   3569 C  CA    . VAL C  1 85  ? 111.326 36.170  14.204  1.00 59.78  ? 84   VAL C CA    1 
ATOM   3570 C  C     . VAL C  1 85  ? 111.400 35.195  13.025  1.00 59.00  ? 84   VAL C C     1 
ATOM   3571 O  O     . VAL C  1 85  ? 112.382 34.481  12.869  1.00 62.14  ? 84   VAL C O     1 
ATOM   3572 C  CB    . VAL C  1 85  ? 110.442 35.555  15.334  1.00 60.72  ? 84   VAL C CB    1 
ATOM   3573 C  CG1   . VAL C  1 85  ? 110.673 34.041  15.448  1.00 63.84  ? 84   VAL C CG1   1 
ATOM   3574 C  CG2   . VAL C  1 85  ? 110.721 36.244  16.673  1.00 52.93  ? 84   VAL C CG2   1 
ATOM   3575 N  N     . ALA C  1 86  ? 110.360 35.178  12.200  1.00 60.93  ? 85   ALA C N     1 
ATOM   3576 C  CA    . ALA C  1 86  ? 110.277 34.263  11.062  1.00 61.74  ? 85   ALA C CA    1 
ATOM   3577 C  C     . ALA C  1 86  ? 111.279 34.550  9.942   1.00 62.50  ? 85   ALA C C     1 
ATOM   3578 O  O     . ALA C  1 86  ? 111.475 33.705  9.071   1.00 64.42  ? 85   ALA C O     1 
ATOM   3579 C  CB    . ALA C  1 86  ? 108.866 34.265  10.491  1.00 64.74  ? 85   ALA C CB    1 
ATOM   3580 N  N     . SER C  1 87  ? 111.886 35.733  9.924   1.00 63.01  ? 86   SER C N     1 
ATOM   3581 C  CA    . SER C  1 87  ? 112.920 36.011  8.927   1.00 64.44  ? 86   SER C CA    1 
ATOM   3582 C  C     . SER C  1 87  ? 114.311 36.205  9.550   1.00 63.52  ? 86   SER C C     1 
ATOM   3583 O  O     . SER C  1 87  ? 115.301 36.400  8.839   1.00 61.05  ? 86   SER C O     1 
ATOM   3584 C  CB    . SER C  1 87  ? 112.516 37.183  8.021   1.00 60.94  ? 86   SER C CB    1 
ATOM   3585 O  OG    . SER C  1 87  ? 112.208 38.331  8.772   1.00 72.81  ? 86   SER C OG    1 
ATOM   3586 N  N     . LEU C  1 88  ? 114.384 36.131  10.874  1.00 66.53  ? 87   LEU C N     1 
ATOM   3587 C  CA    . LEU C  1 88  ? 115.662 36.129  11.570  1.00 71.39  ? 87   LEU C CA    1 
ATOM   3588 C  C     . LEU C  1 88  ? 116.395 34.841  11.196  1.00 73.88  ? 87   LEU C C     1 
ATOM   3589 O  O     . LEU C  1 88  ? 115.810 33.755  11.213  1.00 74.95  ? 87   LEU C O     1 
ATOM   3590 C  CB    . LEU C  1 88  ? 115.444 36.212  13.083  1.00 70.31  ? 87   LEU C CB    1 
ATOM   3591 C  CG    . LEU C  1 88  ? 116.585 36.751  13.941  1.00 74.26  ? 87   LEU C CG    1 
ATOM   3592 C  CD1   . LEU C  1 88  ? 117.095 38.118  13.461  1.00 67.11  ? 87   LEU C CD1   1 
ATOM   3593 C  CD2   . LEU C  1 88  ? 116.098 36.825  15.375  1.00 77.11  ? 87   LEU C CD2   1 
ATOM   3594 N  N     . GLY C  1 89  ? 117.661 34.968  10.829  1.00 73.65  ? 88   GLY C N     1 
ATOM   3595 C  CA    . GLY C  1 89  ? 118.412 33.838  10.316  1.00 76.19  ? 88   GLY C CA    1 
ATOM   3596 C  C     . GLY C  1 89  ? 118.912 34.145  8.925   1.00 77.10  ? 88   GLY C C     1 
ATOM   3597 O  O     . GLY C  1 89  ? 120.115 34.293  8.714   1.00 79.63  ? 88   GLY C O     1 
ATOM   3598 N  N     . ASP C  1 90  ? 117.989 34.255  7.974   1.00 76.50  ? 89   ASP C N     1 
ATOM   3599 C  CA    . ASP C  1 90  ? 118.355 34.546  6.586   1.00 77.58  ? 89   ASP C CA    1 
ATOM   3600 C  C     . ASP C  1 90  ? 118.024 35.992  6.207   1.00 75.83  ? 89   ASP C C     1 
ATOM   3601 O  O     . ASP C  1 90  ? 117.907 36.320  5.028   1.00 79.68  ? 89   ASP C O     1 
ATOM   3602 C  CB    . ASP C  1 90  ? 117.688 33.549  5.625   1.00 79.96  ? 89   ASP C CB    1 
ATOM   3603 C  CG    . ASP C  1 90  ? 116.165 33.641  5.636   1.00 90.60  ? 89   ASP C CG    1 
ATOM   3604 O  OD1   . ASP C  1 90  ? 115.593 34.162  6.620   1.00 104.49 ? 89   ASP C OD1   1 
ATOM   3605 O  OD2   . ASP C  1 90  ? 115.538 33.181  4.658   1.00 103.75 ? 89   ASP C OD2   1 
ATOM   3606 N  N     . THR C  1 91  ? 117.879 36.858  7.204   1.00 70.51  ? 90   THR C N     1 
ATOM   3607 C  CA    . THR C  1 91  ? 117.706 38.280  6.942   1.00 66.18  ? 90   THR C CA    1 
ATOM   3608 C  C     . THR C  1 91  ? 119.065 38.992  6.905   1.00 61.16  ? 90   THR C C     1 
ATOM   3609 O  O     . THR C  1 91  ? 119.980 38.666  7.672   1.00 56.51  ? 90   THR C O     1 
ATOM   3610 C  CB    . THR C  1 91  ? 116.752 38.977  7.980   1.00 66.15  ? 90   THR C CB    1 
ATOM   3611 O  OG1   . THR C  1 91  ? 116.398 40.280  7.506   1.00 59.18  ? 90   THR C OG1   1 
ATOM   3612 C  CG2   . THR C  1 91  ? 117.390 39.101  9.360   1.00 57.99  ? 90   THR C CG2   1 
ATOM   3613 N  N     . ARG C  1 92  ? 119.184 39.958  5.995   1.00 58.31  ? 91   ARG C N     1 
ATOM   3614 C  CA    . ARG C  1 92  ? 120.293 40.884  6.009   1.00 56.95  ? 91   ARG C CA    1 
ATOM   3615 C  C     . ARG C  1 92  ? 119.931 42.115  6.842   1.00 56.52  ? 91   ARG C C     1 
ATOM   3616 O  O     . ARG C  1 92  ? 120.771 42.972  7.061   1.00 58.91  ? 91   ARG C O     1 
ATOM   3617 C  CB    . ARG C  1 92  ? 120.676 41.277  4.585   1.00 59.17  ? 91   ARG C CB    1 
ATOM   3618 N  N     . GLY C  1 93  ? 118.687 42.200  7.317   1.00 57.61  ? 92   GLY C N     1 
ATOM   3619 C  CA    . GLY C  1 93  ? 118.256 43.325  8.146   1.00 54.61  ? 92   GLY C CA    1 
ATOM   3620 C  C     . GLY C  1 93  ? 116.839 43.744  7.838   1.00 55.19  ? 92   GLY C C     1 
ATOM   3621 O  O     . GLY C  1 93  ? 116.282 43.356  6.821   1.00 55.95  ? 92   GLY C O     1 
ATOM   3622 N  N     . PHE C  1 94  ? 116.256 44.543  8.725   1.00 56.46  ? 93   PHE C N     1 
ATOM   3623 C  CA    . PHE C  1 94  ? 114.849 44.952  8.610   1.00 56.58  ? 93   PHE C CA    1 
ATOM   3624 C  C     . PHE C  1 94  ? 114.709 46.407  8.213   1.00 58.50  ? 93   PHE C C     1 
ATOM   3625 O  O     . PHE C  1 94  ? 115.357 47.307  8.790   1.00 57.81  ? 93   PHE C O     1 
ATOM   3626 C  CB    . PHE C  1 94  ? 114.122 44.692  9.917   1.00 50.57  ? 93   PHE C CB    1 
ATOM   3627 C  CG    . PHE C  1 94  ? 114.091 43.247  10.275  1.00 50.18  ? 93   PHE C CG    1 
ATOM   3628 C  CD1   . PHE C  1 94  ? 113.209 42.389  9.625   1.00 57.16  ? 93   PHE C CD1   1 
ATOM   3629 C  CD2   . PHE C  1 94  ? 114.968 42.727  11.216  1.00 55.32  ? 93   PHE C CD2   1 
ATOM   3630 C  CE1   . PHE C  1 94  ? 113.179 41.039  9.926   1.00 53.95  ? 93   PHE C CE1   1 
ATOM   3631 C  CE2   . PHE C  1 94  ? 114.951 41.368  11.526  1.00 60.35  ? 93   PHE C CE2   1 
ATOM   3632 C  CZ    . PHE C  1 94  ? 114.054 40.518  10.875  1.00 51.42  ? 93   PHE C CZ    1 
ATOM   3633 N  N     . LEU C  1 95  ? 113.888 46.618  7.187   1.00 58.34  ? 94   LEU C N     1 
ATOM   3634 C  CA    . LEU C  1 95  ? 113.539 47.942  6.734   1.00 56.59  ? 94   LEU C CA    1 
ATOM   3635 C  C     . LEU C  1 95  ? 112.062 48.056  7.077   1.00 57.53  ? 94   LEU C C     1 
ATOM   3636 O  O     . LEU C  1 95  ? 111.217 47.439  6.441   1.00 52.06  ? 94   LEU C O     1 
ATOM   3637 C  CB    . LEU C  1 95  ? 113.798 48.092  5.233   1.00 61.20  ? 94   LEU C CB    1 
ATOM   3638 C  CG    . LEU C  1 95  ? 113.517 49.471  4.618   1.00 55.33  ? 94   LEU C CG    1 
ATOM   3639 C  CD1   . LEU C  1 95  ? 114.511 50.518  5.149   1.00 62.62  ? 94   LEU C CD1   1 
ATOM   3640 C  CD2   . LEU C  1 95  ? 113.576 49.373  3.104   1.00 60.01  ? 94   LEU C CD2   1 
ATOM   3641 N  N     . ILE C  1 96  ? 111.776 48.820  8.125   1.00 58.98  ? 95   ILE C N     1 
ATOM   3642 C  CA    . ILE C  1 96  ? 110.430 48.947  8.635   1.00 58.68  ? 95   ILE C CA    1 
ATOM   3643 C  C     . ILE C  1 96  ? 109.896 50.302  8.213   1.00 57.80  ? 95   ILE C C     1 
ATOM   3644 O  O     . ILE C  1 96  ? 110.433 51.361  8.563   1.00 55.86  ? 95   ILE C O     1 
ATOM   3645 C  CB    . ILE C  1 96  ? 110.380 48.714  10.151  1.00 62.73  ? 95   ILE C CB    1 
ATOM   3646 C  CG1   . ILE C  1 96  ? 111.029 47.358  10.461  1.00 55.84  ? 95   ILE C CG1   1 
ATOM   3647 C  CG2   . ILE C  1 96  ? 108.949 48.719  10.644  1.00 65.82  ? 95   ILE C CG2   1 
ATOM   3648 C  CD1   . ILE C  1 96  ? 110.972 46.993  11.872  1.00 67.95  ? 95   ILE C CD1   1 
ATOM   3649 N  N     . ASP C  1 97  ? 108.820 50.222  7.443   1.00 57.77  ? 96   ASP C N     1 
ATOM   3650 C  CA    . ASP C  1 97  ? 108.364 51.271  6.565   1.00 57.28  ? 96   ASP C CA    1 
ATOM   3651 C  C     . ASP C  1 97  ? 107.133 51.930  7.161   1.00 60.09  ? 96   ASP C C     1 
ATOM   3652 O  O     . ASP C  1 97  ? 106.127 51.262  7.408   1.00 60.33  ? 96   ASP C O     1 
ATOM   3653 C  CB    . ASP C  1 97  ? 108.032 50.597  5.241   1.00 62.21  ? 96   ASP C CB    1 
ATOM   3654 C  CG    . ASP C  1 97  ? 107.479 51.527  4.208   1.00 69.04  ? 96   ASP C CG    1 
ATOM   3655 O  OD1   . ASP C  1 97  ? 107.175 52.697  4.526   1.00 70.97  ? 96   ASP C OD1   1 
ATOM   3656 O  OD2   . ASP C  1 97  ? 107.347 51.049  3.055   1.00 65.03  ? 96   ASP C OD2   1 
ATOM   3657 N  N     . GLY C  1 98  ? 107.227 53.239  7.389   1.00 61.39  ? 97   GLY C N     1 
ATOM   3658 C  CA    . GLY C  1 98  ? 106.135 54.047  7.932   1.00 60.23  ? 97   GLY C CA    1 
ATOM   3659 C  C     . GLY C  1 98  ? 105.910 53.871  9.423   1.00 60.08  ? 97   GLY C C     1 
ATOM   3660 O  O     . GLY C  1 98  ? 104.862 54.226  9.940   1.00 63.24  ? 97   GLY C O     1 
ATOM   3661 N  N     . TYR C  1 99  ? 106.899 53.338  10.118  1.00 61.39  ? 98   TYR C N     1 
ATOM   3662 C  CA    . TYR C  1 99  ? 106.721 52.922  11.495  1.00 64.75  ? 98   TYR C CA    1 
ATOM   3663 C  C     . TYR C  1 99  ? 107.700 53.711  12.361  1.00 63.50  ? 98   TYR C C     1 
ATOM   3664 O  O     . TYR C  1 99  ? 108.791 54.005  11.906  1.00 67.00  ? 98   TYR C O     1 
ATOM   3665 C  CB    . TYR C  1 99  ? 106.989 51.418  11.588  1.00 64.93  ? 98   TYR C CB    1 
ATOM   3666 C  CG    . TYR C  1 99  ? 106.776 50.819  12.947  1.00 59.93  ? 98   TYR C CG    1 
ATOM   3667 C  CD1   . TYR C  1 99  ? 105.553 50.252  13.283  1.00 60.85  ? 98   TYR C CD1   1 
ATOM   3668 C  CD2   . TYR C  1 99  ? 107.802 50.806  13.903  1.00 63.42  ? 98   TYR C CD2   1 
ATOM   3669 C  CE1   . TYR C  1 99  ? 105.343 49.699  14.530  1.00 68.13  ? 98   TYR C CE1   1 
ATOM   3670 C  CE2   . TYR C  1 99  ? 107.601 50.245  15.169  1.00 61.24  ? 98   TYR C CE2   1 
ATOM   3671 C  CZ    . TYR C  1 99  ? 106.364 49.689  15.463  1.00 54.99  ? 98   TYR C CZ    1 
ATOM   3672 O  OH    . TYR C  1 99  ? 106.106 49.135  16.679  1.00 62.57  ? 98   TYR C OH    1 
ATOM   3673 N  N     . PRO C  1 100 ? 107.310 54.073  13.600  1.00 60.19  ? 99   PRO C N     1 
ATOM   3674 C  CA    . PRO C  1 100 ? 105.974 53.941  14.195  1.00 60.64  ? 99   PRO C CA    1 
ATOM   3675 C  C     . PRO C  1 100 ? 105.094 55.133  13.851  1.00 59.55  ? 99   PRO C C     1 
ATOM   3676 O  O     . PRO C  1 100 ? 105.566 56.105  13.260  1.00 59.25  ? 99   PRO C O     1 
ATOM   3677 C  CB    . PRO C  1 100 ? 106.270 53.904  15.697  1.00 60.62  ? 99   PRO C CB    1 
ATOM   3678 C  CG    . PRO C  1 100 ? 107.443 54.804  15.826  1.00 56.55  ? 99   PRO C CG    1 
ATOM   3679 C  CD    . PRO C  1 100 ? 108.262 54.645  14.565  1.00 60.90  ? 99   PRO C CD    1 
ATOM   3680 N  N     . ARG C  1 101 ? 103.831 55.051  14.246  1.00 60.19  ? 100  ARG C N     1 
ATOM   3681 C  CA    . ARG C  1 101 ? 102.826 56.075  13.962  1.00 61.34  ? 100  ARG C CA    1 
ATOM   3682 C  C     . ARG C  1 101 ? 102.719 57.086  15.128  1.00 59.57  ? 100  ARG C C     1 
ATOM   3683 O  O     . ARG C  1 101 ? 102.046 58.109  15.022  1.00 55.77  ? 100  ARG C O     1 
ATOM   3684 C  CB    . ARG C  1 101 ? 101.469 55.386  13.708  1.00 64.29  ? 100  ARG C CB    1 
ATOM   3685 C  CG    . ARG C  1 101 ? 100.789 54.886  14.988  1.00 53.39  ? 100  ARG C CG    1 
ATOM   3686 C  CD    . ARG C  1 101 ? 99.872  53.708  14.770  1.00 72.63  ? 100  ARG C CD    1 
ATOM   3687 N  NE    . ARG C  1 101 ? 99.379  53.181  16.043  1.00 61.22  ? 100  ARG C NE    1 
ATOM   3688 C  CZ    . ARG C  1 101 ? 98.635  52.082  16.195  1.00 73.15  ? 100  ARG C CZ    1 
ATOM   3689 N  NH1   . ARG C  1 101 ? 98.241  51.344  15.153  1.00 71.03  ? 100  ARG C NH1   1 
ATOM   3690 N  NH2   . ARG C  1 101 ? 98.276  51.720  17.421  1.00 62.27  ? 100  ARG C NH2   1 
ATOM   3691 N  N     . GLU C  1 102 ? 103.393 56.791  16.236  1.00 54.57  ? 101  GLU C N     1 
ATOM   3692 C  CA    . GLU C  1 102 ? 103.365 57.646  17.409  1.00 55.40  ? 101  GLU C CA    1 
ATOM   3693 C  C     . GLU C  1 102 ? 104.529 57.229  18.281  1.00 54.39  ? 101  GLU C C     1 
ATOM   3694 O  O     . GLU C  1 102 ? 105.088 56.153  18.092  1.00 55.08  ? 101  GLU C O     1 
ATOM   3695 C  CB    . GLU C  1 102 ? 102.062 57.458  18.179  1.00 57.91  ? 101  GLU C CB    1 
ATOM   3696 C  CG    . GLU C  1 102 ? 101.730 55.989  18.312  1.00 79.18  ? 101  GLU C CG    1 
ATOM   3697 C  CD    . GLU C  1 102 ? 100.699 55.684  19.356  1.00 103.50 ? 101  GLU C CD    1 
ATOM   3698 O  OE1   . GLU C  1 102 ? 99.718  54.975  18.991  1.00 88.64  ? 101  GLU C OE1   1 
ATOM   3699 O  OE2   . GLU C  1 102 ? 100.888 56.125  20.524  1.00 103.61 ? 101  GLU C OE2   1 
ATOM   3700 N  N     . VAL C  1 103 ? 104.867 58.076  19.245  1.00 56.01  ? 102  VAL C N     1 
ATOM   3701 C  CA    . VAL C  1 103 ? 106.041 57.888  20.072  1.00 55.29  ? 102  VAL C CA    1 
ATOM   3702 C  C     . VAL C  1 103 ? 105.866 56.696  21.010  1.00 55.89  ? 102  VAL C C     1 
ATOM   3703 O  O     . VAL C  1 103 ? 106.772 55.875  21.121  1.00 57.79  ? 102  VAL C O     1 
ATOM   3704 C  CB    . VAL C  1 103 ? 106.374 59.190  20.853  1.00 54.02  ? 102  VAL C CB    1 
ATOM   3705 C  CG1   . VAL C  1 103 ? 107.400 58.942  21.967  1.00 54.38  ? 102  VAL C CG1   1 
ATOM   3706 C  CG2   . VAL C  1 103 ? 106.864 60.264  19.893  1.00 55.92  ? 102  VAL C CG2   1 
ATOM   3707 N  N     . LYS C  1 104 ? 104.720 56.580  21.677  1.00 54.94  ? 103  LYS C N     1 
ATOM   3708 C  CA    . LYS C  1 104 ? 104.554 55.469  22.628  1.00 60.19  ? 103  LYS C CA    1 
ATOM   3709 C  C     . LYS C  1 104 ? 104.767 54.115  21.933  1.00 53.90  ? 103  LYS C C     1 
ATOM   3710 O  O     . LYS C  1 104 ? 105.434 53.232  22.471  1.00 55.49  ? 103  LYS C O     1 
ATOM   3711 C  CB    . LYS C  1 104 ? 103.223 55.546  23.400  1.00 61.08  ? 103  LYS C CB    1 
ATOM   3712 C  CG    . LYS C  1 104 ? 103.274 56.560  24.573  1.00 67.21  ? 103  LYS C CG    1 
ATOM   3713 C  CD    . LYS C  1 104 ? 102.001 56.566  25.435  1.00 71.55  ? 103  LYS C CD    1 
ATOM   3714 C  CE    . LYS C  1 104 ? 102.165 57.345  26.756  1.00 67.47  ? 103  LYS C CE    1 
ATOM   3715 N  NZ    . LYS C  1 104 ? 102.976 56.618  27.804  1.00 81.76  ? 103  LYS C NZ    1 
ATOM   3716 N  N     . GLN C  1 105 ? 104.248 53.989  20.723  1.00 55.69  ? 104  GLN C N     1 
ATOM   3717 C  CA    . GLN C  1 105 ? 104.418 52.795  19.911  1.00 58.83  ? 104  GLN C CA    1 
ATOM   3718 C  C     . GLN C  1 105 ? 105.903 52.459  19.688  1.00 58.39  ? 104  GLN C C     1 
ATOM   3719 O  O     . GLN C  1 105 ? 106.315 51.303  19.824  1.00 59.61  ? 104  GLN C O     1 
ATOM   3720 C  CB    . GLN C  1 105 ? 103.707 52.977  18.571  1.00 56.10  ? 104  GLN C CB    1 
ATOM   3721 C  CG    . GLN C  1 105 ? 103.812 51.757  17.659  1.00 73.11  ? 104  GLN C CG    1 
ATOM   3722 C  CD    . GLN C  1 105 ? 103.120 51.926  16.320  1.00 63.33  ? 104  GLN C CD    1 
ATOM   3723 O  OE1   . GLN C  1 105 ? 103.208 52.967  15.685  1.00 66.91  ? 104  GLN C OE1   1 
ATOM   3724 N  NE2   . GLN C  1 105 ? 102.458 50.877  15.877  1.00 50.72  ? 104  GLN C NE2   1 
ATOM   3725 N  N     . GLY C  1 106 ? 106.689 53.468  19.329  1.00 58.90  ? 105  GLY C N     1 
ATOM   3726 C  CA    . GLY C  1 106 ? 108.124 53.297  19.127  1.00 59.24  ? 105  GLY C CA    1 
ATOM   3727 C  C     . GLY C  1 106 ? 108.890 52.963  20.389  1.00 60.21  ? 105  GLY C C     1 
ATOM   3728 O  O     . GLY C  1 106 ? 109.872 52.222  20.343  1.00 62.81  ? 105  GLY C O     1 
ATOM   3729 N  N     . GLU C  1 107 ? 108.463 53.535  21.516  1.00 58.69  ? 106  GLU C N     1 
ATOM   3730 C  CA    . GLU C  1 107 ? 109.075 53.248  22.804  1.00 57.90  ? 106  GLU C CA    1 
ATOM   3731 C  C     . GLU C  1 107 ? 108.820 51.788  23.196  1.00 56.10  ? 106  GLU C C     1 
ATOM   3732 O  O     . GLU C  1 107 ? 109.720 51.109  23.675  1.00 57.07  ? 106  GLU C O     1 
ATOM   3733 C  CB    . GLU C  1 107 ? 108.555 54.200  23.906  1.00 61.37  ? 106  GLU C CB    1 
ATOM   3734 C  CG    . GLU C  1 107 ? 108.938 55.670  23.736  1.00 59.76  ? 106  GLU C CG    1 
ATOM   3735 C  CD    . GLU C  1 107 ? 108.324 56.603  24.805  1.00 61.85  ? 106  GLU C CD    1 
ATOM   3736 O  OE1   . GLU C  1 107 ? 107.096 56.547  25.072  1.00 61.69  ? 106  GLU C OE1   1 
ATOM   3737 O  OE2   . GLU C  1 107 ? 109.084 57.419  25.368  1.00 72.21  ? 106  GLU C OE2   1 
ATOM   3738 N  N     . GLU C  1 108 ? 107.603 51.297  22.992  1.00 55.06  ? 107  GLU C N     1 
ATOM   3739 C  CA    . GLU C  1 108 ? 107.312 49.891  23.269  1.00 55.70  ? 107  GLU C CA    1 
ATOM   3740 C  C     . GLU C  1 108 ? 108.095 48.962  22.324  1.00 56.00  ? 107  GLU C C     1 
ATOM   3741 O  O     . GLU C  1 108 ? 108.524 47.875  22.715  1.00 54.89  ? 107  GLU C O     1 
ATOM   3742 C  CB    . GLU C  1 108 ? 105.806 49.614  23.192  1.00 58.53  ? 107  GLU C CB    1 
ATOM   3743 C  CG    . GLU C  1 108 ? 105.362 48.270  23.808  1.00 76.32  ? 107  GLU C CG    1 
ATOM   3744 C  CD    . GLU C  1 108 ? 105.483 48.215  25.349  1.00 97.02  ? 107  GLU C CD    1 
ATOM   3745 O  OE1   . GLU C  1 108 ? 105.112 49.199  26.024  1.00 102.96 ? 107  GLU C OE1   1 
ATOM   3746 O  OE2   . GLU C  1 108 ? 105.925 47.175  25.893  1.00 93.35  ? 107  GLU C OE2   1 
ATOM   3747 N  N     . PHE C  1 109 ? 108.293 49.393  21.087  1.00 54.57  ? 108  PHE C N     1 
ATOM   3748 C  CA    . PHE C  1 109 ? 109.118 48.649  20.148  1.00 55.67  ? 108  PHE C CA    1 
ATOM   3749 C  C     . PHE C  1 109 ? 110.542 48.535  20.674  1.00 56.62  ? 108  PHE C C     1 
ATOM   3750 O  O     . PHE C  1 109 ? 111.120 47.448  20.677  1.00 56.02  ? 108  PHE C O     1 
ATOM   3751 C  CB    . PHE C  1 109 ? 109.108 49.324  18.770  1.00 57.12  ? 108  PHE C CB    1 
ATOM   3752 C  CG    . PHE C  1 109 ? 109.944 48.617  17.735  1.00 56.87  ? 108  PHE C CG    1 
ATOM   3753 C  CD1   . PHE C  1 109 ? 109.351 47.790  16.802  1.00 61.45  ? 108  PHE C CD1   1 
ATOM   3754 C  CD2   . PHE C  1 109 ? 111.323 48.790  17.690  1.00 55.23  ? 108  PHE C CD2   1 
ATOM   3755 C  CE1   . PHE C  1 109 ? 110.107 47.150  15.831  1.00 58.36  ? 108  PHE C CE1   1 
ATOM   3756 C  CE2   . PHE C  1 109 ? 112.085 48.147  16.729  1.00 59.02  ? 108  PHE C CE2   1 
ATOM   3757 C  CZ    . PHE C  1 109 ? 111.471 47.324  15.796  1.00 56.29  ? 108  PHE C CZ    1 
ATOM   3758 N  N     . GLY C  1 110 ? 111.104 49.661  21.118  1.00 58.72  ? 109  GLY C N     1 
ATOM   3759 C  CA    . GLY C  1 110 ? 112.418 49.675  21.750  1.00 57.01  ? 109  GLY C CA    1 
ATOM   3760 C  C     . GLY C  1 110 ? 112.542 48.683  22.899  1.00 60.58  ? 109  GLY C C     1 
ATOM   3761 O  O     . GLY C  1 110 ? 113.495 47.894  22.951  1.00 62.70  ? 109  GLY C O     1 
ATOM   3762 N  N     . ARG C  1 111 ? 111.585 48.725  23.826  1.00 58.51  ? 110  ARG C N     1 
ATOM   3763 C  CA    . ARG C  1 111 ? 111.636 47.879  25.015  1.00 60.21  ? 110  ARG C CA    1 
ATOM   3764 C  C     . ARG C  1 111 ? 111.507 46.416  24.636  1.00 58.29  ? 110  ARG C C     1 
ATOM   3765 O  O     . ARG C  1 111 ? 112.267 45.577  25.101  1.00 58.71  ? 110  ARG C O     1 
ATOM   3766 C  CB    . ARG C  1 111 ? 110.527 48.260  26.007  1.00 63.94  ? 110  ARG C CB    1 
ATOM   3767 C  CG    . ARG C  1 111 ? 110.708 49.662  26.587  1.00 73.34  ? 110  ARG C CG    1 
ATOM   3768 C  CD    . ARG C  1 111 ? 109.656 50.052  27.623  1.00 72.80  ? 110  ARG C CD    1 
ATOM   3769 N  NE    . ARG C  1 111 ? 109.167 51.421  27.402  1.00 80.10  ? 110  ARG C NE    1 
ATOM   3770 C  CZ    . ARG C  1 111 ? 107.962 51.738  26.927  1.00 81.00  ? 110  ARG C CZ    1 
ATOM   3771 N  NH1   . ARG C  1 111 ? 107.636 53.013  26.761  1.00 98.27  ? 110  ARG C NH1   1 
ATOM   3772 N  NH2   . ARG C  1 111 ? 107.072 50.798  26.629  1.00 70.24  ? 110  ARG C NH2   1 
ATOM   3773 N  N     . ARG C  1 112 ? 110.559 46.127  23.750  1.00 60.04  ? 111  ARG C N     1 
ATOM   3774 C  CA    . ARG C  1 112 ? 110.138 44.753  23.499  1.00 59.64  ? 111  ARG C CA    1 
ATOM   3775 C  C     . ARG C  1 112 ? 110.824 44.060  22.311  1.00 56.77  ? 111  ARG C C     1 
ATOM   3776 O  O     . ARG C  1 112 ? 110.829 42.830  22.264  1.00 55.40  ? 111  ARG C O     1 
ATOM   3777 C  CB    . ARG C  1 112 ? 108.605 44.691  23.384  1.00 60.48  ? 111  ARG C CB    1 
ATOM   3778 C  CG    . ARG C  1 112 ? 107.911 44.804  24.758  1.00 68.11  ? 111  ARG C CG    1 
ATOM   3779 C  CD    . ARG C  1 112 ? 106.462 44.299  24.729  1.00 72.50  ? 111  ARG C CD    1 
ATOM   3780 N  N     . ILE C  1 113 ? 111.412 44.818  21.377  1.00 57.56  ? 112  ILE C N     1 
ATOM   3781 C  CA    . ILE C  1 113 ? 112.038 44.217  20.182  1.00 58.22  ? 112  ILE C CA    1 
ATOM   3782 C  C     . ILE C  1 113 ? 113.480 44.659  19.978  1.00 59.46  ? 112  ILE C C     1 
ATOM   3783 O  O     . ILE C  1 113 ? 114.407 43.851  20.032  1.00 62.46  ? 112  ILE C O     1 
ATOM   3784 C  CB    . ILE C  1 113 ? 111.205 44.486  18.916  1.00 58.51  ? 112  ILE C CB    1 
ATOM   3785 C  CG1   . ILE C  1 113 ? 109.840 43.792  19.048  1.00 64.23  ? 112  ILE C CG1   1 
ATOM   3786 C  CG2   . ILE C  1 113 ? 111.925 43.984  17.667  1.00 59.93  ? 112  ILE C CG2   1 
ATOM   3787 C  CD1   . ILE C  1 113 ? 108.917 43.937  17.831  1.00 62.23  ? 112  ILE C CD1   1 
ATOM   3788 N  N     . GLY C  1 114 ? 113.679 45.944  19.757  1.00 60.11  ? 113  GLY C N     1 
ATOM   3789 C  CA    . GLY C  1 114 ? 115.021 46.454  19.580  1.00 59.09  ? 113  GLY C CA    1 
ATOM   3790 C  C     . GLY C  1 114 ? 115.009 47.920  19.243  1.00 59.84  ? 113  GLY C C     1 
ATOM   3791 O  O     . GLY C  1 114 ? 113.970 48.494  18.960  1.00 61.73  ? 113  GLY C O     1 
ATOM   3792 N  N     . ASP C  1 115 ? 116.182 48.531  19.282  1.00 60.06  ? 114  ASP C N     1 
ATOM   3793 C  CA    . ASP C  1 115 ? 116.321 49.935  18.941  1.00 59.99  ? 114  ASP C CA    1 
ATOM   3794 C  C     . ASP C  1 115 ? 116.810 50.027  17.487  1.00 59.26  ? 114  ASP C C     1 
ATOM   3795 O  O     . ASP C  1 115 ? 117.732 49.305  17.102  1.00 58.62  ? 114  ASP C O     1 
ATOM   3796 C  CB    . ASP C  1 115 ? 117.271 50.610  19.930  1.00 57.18  ? 114  ASP C CB    1 
ATOM   3797 C  CG    . ASP C  1 115 ? 116.893 50.319  21.387  1.00 69.74  ? 114  ASP C CG    1 
ATOM   3798 O  OD1   . ASP C  1 115 ? 115.722 50.561  21.759  1.00 76.42  ? 114  ASP C OD1   1 
ATOM   3799 O  OD2   . ASP C  1 115 ? 117.752 49.822  22.153  1.00 72.40  ? 114  ASP C OD2   1 
ATOM   3800 N  N     . PRO C  1 116 ? 116.169 50.885  16.662  1.00 58.56  ? 115  PRO C N     1 
ATOM   3801 C  CA    . PRO C  1 116 ? 116.661 51.057  15.302  1.00 56.96  ? 115  PRO C CA    1 
ATOM   3802 C  C     . PRO C  1 116 ? 117.981 51.800  15.351  1.00 56.63  ? 115  PRO C C     1 
ATOM   3803 O  O     . PRO C  1 116 ? 118.128 52.755  16.131  1.00 55.20  ? 115  PRO C O     1 
ATOM   3804 C  CB    . PRO C  1 116 ? 115.593 51.930  14.654  1.00 51.18  ? 115  PRO C CB    1 
ATOM   3805 C  CG    . PRO C  1 116 ? 115.049 52.702  15.768  1.00 51.38  ? 115  PRO C CG    1 
ATOM   3806 C  CD    . PRO C  1 116 ? 115.017 51.762  16.925  1.00 57.30  ? 115  PRO C CD    1 
ATOM   3807 N  N     . GLN C  1 117 ? 118.937 51.351  14.547  1.00 57.57  ? 116  GLN C N     1 
ATOM   3808 C  CA    . GLN C  1 117 ? 120.244 52.012  14.482  1.00 58.19  ? 116  GLN C CA    1 
ATOM   3809 C  C     . GLN C  1 117 ? 120.065 53.280  13.660  1.00 56.57  ? 116  GLN C C     1 
ATOM   3810 O  O     . GLN C  1 117 ? 120.727 54.275  13.890  1.00 60.66  ? 116  GLN C O     1 
ATOM   3811 C  CB    . GLN C  1 117 ? 121.311 51.105  13.849  1.00 57.61  ? 116  GLN C CB    1 
ATOM   3812 C  CG    . GLN C  1 117 ? 121.631 49.824  14.642  1.00 57.40  ? 116  GLN C CG    1 
ATOM   3813 C  CD    . GLN C  1 117 ? 120.587 48.736  14.462  1.00 65.10  ? 116  GLN C CD    1 
ATOM   3814 O  OE1   . GLN C  1 117 ? 119.921 48.664  13.431  1.00 72.38  ? 116  GLN C OE1   1 
ATOM   3815 N  NE2   . GLN C  1 117 ? 120.429 47.896  15.470  1.00 64.60  ? 116  GLN C NE2   1 
ATOM   3816 N  N     . LEU C  1 118 ? 119.131 53.243  12.723  1.00 56.19  ? 117  LEU C N     1 
ATOM   3817 C  CA    . LEU C  1 118 ? 118.922 54.356  11.809  1.00 54.53  ? 117  LEU C CA    1 
ATOM   3818 C  C     . LEU C  1 118 ? 117.432 54.602  11.546  1.00 56.12  ? 117  LEU C C     1 
ATOM   3819 O  O     . LEU C  1 118 ? 116.648 53.680  11.335  1.00 54.51  ? 117  LEU C O     1 
ATOM   3820 C  CB    . LEU C  1 118 ? 119.661 54.063  10.499  1.00 51.61  ? 117  LEU C CB    1 
ATOM   3821 C  CG    . LEU C  1 118 ? 119.485 55.008  9.315   1.00 57.83  ? 117  LEU C CG    1 
ATOM   3822 C  CD1   . LEU C  1 118 ? 120.009 56.426  9.610   1.00 62.66  ? 117  LEU C CD1   1 
ATOM   3823 C  CD2   . LEU C  1 118 ? 120.160 54.393  8.106   1.00 52.87  ? 117  LEU C CD2   1 
ATOM   3824 N  N     . VAL C  1 119 ? 117.058 55.874  11.574  1.00 59.25  ? 118  VAL C N     1 
ATOM   3825 C  CA    . VAL C  1 119 ? 115.743 56.314  11.176  1.00 55.55  ? 118  VAL C CA    1 
ATOM   3826 C  C     . VAL C  1 119 ? 115.960 57.253  10.006  1.00 56.58  ? 118  VAL C C     1 
ATOM   3827 O  O     . VAL C  1 119 ? 116.591 58.294  10.157  1.00 55.52  ? 118  VAL C O     1 
ATOM   3828 C  CB    . VAL C  1 119 ? 115.013 57.050  12.327  1.00 58.79  ? 118  VAL C CB    1 
ATOM   3829 C  CG1   . VAL C  1 119 ? 113.678 57.637  11.837  1.00 61.74  ? 118  VAL C CG1   1 
ATOM   3830 C  CG2   . VAL C  1 119 ? 114.810 56.108  13.518  1.00 55.43  ? 118  VAL C CG2   1 
ATOM   3831 N  N     . ILE C  1 120 ? 115.460 56.854  8.843   1.00 57.37  ? 119  ILE C N     1 
ATOM   3832 C  CA    . ILE C  1 120 ? 115.509 57.656  7.643   1.00 58.45  ? 119  ILE C CA    1 
ATOM   3833 C  C     . ILE C  1 120 ? 114.207 58.446  7.468   1.00 62.61  ? 119  ILE C C     1 
ATOM   3834 O  O     . ILE C  1 120 ? 113.093 57.889  7.427   1.00 59.47  ? 119  ILE C O     1 
ATOM   3835 C  CB    . ILE C  1 120 ? 115.668 56.783  6.387   1.00 59.08  ? 119  ILE C CB    1 
ATOM   3836 C  CG1   . ILE C  1 120 ? 117.026 56.092  6.369   1.00 59.28  ? 119  ILE C CG1   1 
ATOM   3837 C  CG2   . ILE C  1 120 ? 115.457 57.630  5.128   1.00 65.10  ? 119  ILE C CG2   1 
ATOM   3838 C  CD1   . ILE C  1 120 ? 117.087 54.912  5.416   1.00 68.66  ? 119  ILE C CD1   1 
ATOM   3839 N  N     . CYS C  1 121 ? 114.367 59.747  7.297   1.00 64.77  ? 120  CYS C N     1 
ATOM   3840 C  CA    . CYS C  1 121 ? 113.252 60.628  7.147   1.00 63.95  ? 120  CYS C CA    1 
ATOM   3841 C  C     . CYS C  1 121 ? 113.302 61.319  5.775   1.00 62.92  ? 120  CYS C C     1 
ATOM   3842 O  O     . CYS C  1 121 ? 114.179 62.161  5.515   1.00 62.35  ? 120  CYS C O     1 
ATOM   3843 C  CB    . CYS C  1 121 ? 113.245 61.647  8.286   1.00 62.25  ? 120  CYS C CB    1 
ATOM   3844 S  SG    . CYS C  1 121 ? 111.962 62.880  7.977   1.00 90.43  ? 120  CYS C SG    1 
ATOM   3845 N  N     . MET C  1 122 ? 112.359 60.957  4.905   1.00 62.91  ? 121  MET C N     1 
ATOM   3846 C  CA    . MET C  1 122 ? 112.301 61.527  3.569   1.00 64.67  ? 121  MET C CA    1 
ATOM   3847 C  C     . MET C  1 122 ? 111.512 62.821  3.571   1.00 64.31  ? 121  MET C C     1 
ATOM   3848 O  O     . MET C  1 122 ? 110.287 62.819  3.633   1.00 69.77  ? 121  MET C O     1 
ATOM   3849 C  CB    . MET C  1 122 ? 111.754 60.514  2.572   1.00 64.84  ? 121  MET C CB    1 
ATOM   3850 C  CG    . MET C  1 122 ? 112.832 59.488  2.219   1.00 67.17  ? 121  MET C CG    1 
ATOM   3851 S  SD    . MET C  1 122 ? 112.194 58.138  1.261   1.00 71.58  ? 121  MET C SD    1 
ATOM   3852 C  CE    . MET C  1 122 ? 111.897 58.969  -0.313  1.00 67.26  ? 121  MET C CE    1 
ATOM   3853 N  N     . ASP C  1 123 ? 112.251 63.927  3.545   1.00 64.71  ? 122  ASP C N     1 
ATOM   3854 C  CA    . ASP C  1 123 ? 111.667 65.267  3.549   1.00 66.19  ? 122  ASP C CA    1 
ATOM   3855 C  C     . ASP C  1 123 ? 111.270 65.651  2.142   1.00 64.19  ? 122  ASP C C     1 
ATOM   3856 O  O     . ASP C  1 123 ? 112.011 65.405  1.163   1.00 62.33  ? 122  ASP C O     1 
ATOM   3857 C  CB    . ASP C  1 123 ? 112.651 66.323  4.085   1.00 65.08  ? 122  ASP C CB    1 
ATOM   3858 C  CG    . ASP C  1 123 ? 112.794 66.287  5.590   1.00 79.92  ? 122  ASP C CG    1 
ATOM   3859 O  OD1   . ASP C  1 123 ? 111.814 65.905  6.275   1.00 88.03  ? 122  ASP C OD1   1 
ATOM   3860 O  OD2   . ASP C  1 123 ? 113.890 66.653  6.087   1.00 95.70  ? 122  ASP C OD2   1 
ATOM   3861 N  N     . CYS C  1 124 ? 110.102 66.276  2.055   1.00 63.37  ? 123  CYS C N     1 
ATOM   3862 C  CA    . CYS C  1 124 ? 109.559 66.694  0.791   1.00 63.10  ? 123  CYS C CA    1 
ATOM   3863 C  C     . CYS C  1 124 ? 108.599 67.844  1.032   1.00 59.41  ? 123  CYS C C     1 
ATOM   3864 O  O     . CYS C  1 124 ? 107.843 67.818  1.997   1.00 64.42  ? 123  CYS C O     1 
ATOM   3865 C  CB    . CYS C  1 124 ? 108.838 65.508  0.145   1.00 68.56  ? 123  CYS C CB    1 
ATOM   3866 S  SG    . CYS C  1 124 ? 108.574 65.731  -1.602  1.00 68.59  ? 123  CYS C SG    1 
ATOM   3867 N  N     . SER C  1 125 ? 108.617 68.850  0.162   1.00 57.34  ? 124  SER C N     1 
ATOM   3868 C  CA    . SER C  1 125 ? 107.693 69.983  0.302   1.00 55.87  ? 124  SER C CA    1 
ATOM   3869 C  C     . SER C  1 125 ? 106.282 69.527  0.035   1.00 55.69  ? 124  SER C C     1 
ATOM   3870 O  O     . SER C  1 125 ? 106.073 68.579  -0.691  1.00 58.73  ? 124  SER C O     1 
ATOM   3871 C  CB    . SER C  1 125 ? 108.054 71.159  -0.624  1.00 52.61  ? 124  SER C CB    1 
ATOM   3872 O  OG    . SER C  1 125 ? 107.688 70.925  -1.966  1.00 54.68  ? 124  SER C OG    1 
ATOM   3873 N  N     . ALA C  1 126 ? 105.325 70.209  0.655   1.00 59.31  ? 125  ALA C N     1 
ATOM   3874 C  CA    . ALA C  1 126 ? 103.903 69.973  0.433   1.00 59.33  ? 125  ALA C CA    1 
ATOM   3875 C  C     . ALA C  1 126 ? 103.509 70.207  -1.026  1.00 58.73  ? 125  ALA C C     1 
ATOM   3876 O  O     . ALA C  1 126 ? 102.692 69.471  -1.573  1.00 62.24  ? 125  ALA C O     1 
ATOM   3877 C  CB    . ALA C  1 126 ? 103.078 70.892  1.336   1.00 62.54  ? 125  ALA C CB    1 
ATOM   3878 N  N     . ASP C  1 127 ? 104.066 71.248  -1.631  1.00 56.91  ? 126  ASP C N     1 
ATOM   3879 C  CA    . ASP C  1 127 ? 103.854 71.539  -3.050  1.00 61.91  ? 126  ASP C CA    1 
ATOM   3880 C  C     . ASP C  1 127 ? 104.275 70.378  -3.926  1.00 56.44  ? 126  ASP C C     1 
ATOM   3881 O  O     . ASP C  1 127 ? 103.577 70.032  -4.845  1.00 55.51  ? 126  ASP C O     1 
ATOM   3882 C  CB    . ASP C  1 127 ? 104.677 72.764  -3.500  1.00 69.71  ? 126  ASP C CB    1 
ATOM   3883 C  CG    . ASP C  1 127 ? 104.006 74.087  -3.190  1.00 81.08  ? 126  ASP C CG    1 
ATOM   3884 O  OD1   . ASP C  1 127 ? 102.784 74.113  -2.956  1.00 86.39  ? 126  ASP C OD1   1 
ATOM   3885 O  OD2   . ASP C  1 127 ? 104.713 75.117  -3.203  1.00 97.38  ? 126  ASP C OD2   1 
ATOM   3886 N  N     . THR C  1 128 ? 105.448 69.810  -3.664  1.00 58.54  ? 127  THR C N     1 
ATOM   3887 C  CA    . THR C  1 128 ? 105.930 68.690  -4.470  1.00 59.29  ? 127  THR C CA    1 
ATOM   3888 C  C     . THR C  1 128 ? 105.099 67.421  -4.247  1.00 57.68  ? 127  THR C C     1 
ATOM   3889 O  O     . THR C  1 128 ? 104.769 66.717  -5.196  1.00 57.18  ? 127  THR C O     1 
ATOM   3890 C  CB    . THR C  1 128 ? 107.416 68.424  -4.213  1.00 59.98  ? 127  THR C CB    1 
ATOM   3891 O  OG1   . THR C  1 128 ? 108.134 69.638  -4.441  1.00 61.15  ? 127  THR C OG1   1 
ATOM   3892 C  CG2   . THR C  1 128 ? 107.957 67.358  -5.178  1.00 58.99  ? 127  THR C CG2   1 
ATOM   3893 N  N     . MET C  1 129 ? 104.756 67.141  -2.995  1.00 57.08  ? 128  MET C N     1 
ATOM   3894 C  CA    . MET C  1 129 ? 103.965 65.965  -2.699  1.00 60.10  ? 128  MET C CA    1 
ATOM   3895 C  C     . MET C  1 129 ? 102.593 66.143  -3.349  1.00 58.07  ? 128  MET C C     1 
ATOM   3896 O  O     . MET C  1 129 ? 102.053 65.197  -3.903  1.00 56.88  ? 128  MET C O     1 
ATOM   3897 C  CB    . MET C  1 129 ? 103.844 65.725  -1.183  1.00 62.55  ? 128  MET C CB    1 
ATOM   3898 C  CG    . MET C  1 129 ? 105.092 65.111  -0.527  1.00 67.63  ? 128  MET C CG    1 
ATOM   3899 S  SD    . MET C  1 129 ? 104.859 64.694  1.238   1.00 68.49  ? 128  MET C SD    1 
ATOM   3900 C  CE    . MET C  1 129 ? 104.784 66.336  1.946   1.00 49.14  ? 128  MET C CE    1 
ATOM   3901 N  N     . THR C  1 130 ? 102.046 67.357  -3.303  1.00 55.97  ? 129  THR C N     1 
ATOM   3902 C  CA    . THR C  1 130 ? 100.725 67.609  -3.866  1.00 57.40  ? 129  THR C CA    1 
ATOM   3903 C  C     . THR C  1 130 ? 100.748 67.343  -5.383  1.00 56.98  ? 129  THR C C     1 
ATOM   3904 O  O     . THR C  1 130 ? 99.929  66.583  -5.906  1.00 53.18  ? 129  THR C O     1 
ATOM   3905 C  CB    . THR C  1 130 ? 100.230 69.049  -3.537  1.00 58.50  ? 129  THR C CB    1 
ATOM   3906 O  OG1   . THR C  1 130 ? 100.061 69.198  -2.114  1.00 58.78  ? 129  THR C OG1   1 
ATOM   3907 C  CG2   . THR C  1 130 ? 98.917  69.318  -4.190  1.00 54.68  ? 129  THR C CG2   1 
ATOM   3908 N  N     . ASN C  1 131 ? 101.732 67.913  -6.075  1.00 55.60  ? 130  ASN C N     1 
ATOM   3909 C  CA    . ASN C  1 131 ? 101.835 67.742  -7.530  1.00 53.84  ? 130  ASN C CA    1 
ATOM   3910 C  C     . ASN C  1 131 ? 102.032 66.292  -7.944  1.00 53.32  ? 130  ASN C C     1 
ATOM   3911 O  O     . ASN C  1 131 ? 101.466 65.824  -8.945  1.00 53.87  ? 130  ASN C O     1 
ATOM   3912 C  CB    . ASN C  1 131 ? 102.983 68.571  -8.095  1.00 50.37  ? 130  ASN C CB    1 
ATOM   3913 C  CG    . ASN C  1 131 ? 103.131 68.395  -9.609  1.00 51.92  ? 130  ASN C CG    1 
ATOM   3914 O  OD1   . ASN C  1 131 ? 103.935 67.589  -10.071 1.00 67.10  ? 130  ASN C OD1   1 
ATOM   3915 N  ND2   . ASN C  1 131 ? 102.335 69.132  -10.377 1.00 51.46  ? 130  ASN C ND2   1 
ATOM   3916 N  N     . ARG C  1 132 ? 102.843 65.585  -7.166  1.00 54.10  ? 131  ARG C N     1 
ATOM   3917 C  CA    . ARG C  1 132 ? 103.096 64.174  -7.423  1.00 55.91  ? 131  ARG C CA    1 
ATOM   3918 C  C     . ARG C  1 132 ? 101.875 63.317  -7.222  1.00 52.46  ? 131  ARG C C     1 
ATOM   3919 O  O     . ARG C  1 132 ? 101.614 62.416  -8.009  1.00 56.99  ? 131  ARG C O     1 
ATOM   3920 C  CB    . ARG C  1 132 ? 104.232 63.685  -6.552  1.00 56.44  ? 131  ARG C CB    1 
ATOM   3921 C  CG    . ARG C  1 132 ? 105.571 64.198  -7.028  1.00 51.67  ? 131  ARG C CG    1 
ATOM   3922 C  CD    . ARG C  1 132 ? 106.626 63.684  -6.094  1.00 61.67  ? 131  ARG C CD    1 
ATOM   3923 N  NE    . ARG C  1 132 ? 107.962 64.106  -6.471  1.00 66.25  ? 131  ARG C NE    1 
ATOM   3924 C  CZ    . ARG C  1 132 ? 109.036 63.942  -5.706  1.00 58.36  ? 131  ARG C CZ    1 
ATOM   3925 N  NH1   . ARG C  1 132 ? 108.926 63.363  -4.521  1.00 61.37  ? 131  ARG C NH1   1 
ATOM   3926 N  NH2   . ARG C  1 132 ? 110.222 64.357  -6.131  1.00 66.83  ? 131  ARG C NH2   1 
ATOM   3927 N  N     . LEU C  1 133 ? 101.125 63.603  -6.166  1.00 55.06  ? 132  LEU C N     1 
ATOM   3928 C  CA    . LEU C  1 133 ? 99.909  62.859  -5.865  1.00 52.97  ? 132  LEU C CA    1 
ATOM   3929 C  C     . LEU C  1 133 ? 98.804  63.113  -6.884  1.00 53.81  ? 132  LEU C C     1 
ATOM   3930 O  O     . LEU C  1 133 ? 98.033  62.216  -7.171  1.00 53.04  ? 132  LEU C O     1 
ATOM   3931 C  CB    . LEU C  1 133 ? 99.419  63.164  -4.454  1.00 54.53  ? 132  LEU C CB    1 
ATOM   3932 C  CG    . LEU C  1 133 ? 100.342 62.635  -3.340  1.00 56.41  ? 132  LEU C CG    1 
ATOM   3933 C  CD1   . LEU C  1 133 ? 99.910  63.173  -1.979  1.00 60.30  ? 132  LEU C CD1   1 
ATOM   3934 C  CD2   . LEU C  1 133 ? 100.404 61.111  -3.343  1.00 54.21  ? 132  LEU C CD2   1 
ATOM   3935 N  N     . LEU C  1 134 ? 98.725  64.342  -7.402  1.00 56.59  ? 133  LEU C N     1 
ATOM   3936 C  CA    . LEU C  1 134 ? 97.838  64.674  -8.540  1.00 54.94  ? 133  LEU C CA    1 
ATOM   3937 C  C     . LEU C  1 134 ? 98.178  63.911  -9.796  1.00 52.60  ? 133  LEU C C     1 
ATOM   3938 O  O     . LEU C  1 134 ? 97.287  63.458  -10.500 1.00 55.54  ? 133  LEU C O     1 
ATOM   3939 C  CB    . LEU C  1 134 ? 97.869  66.169  -8.855  1.00 58.13  ? 133  LEU C CB    1 
ATOM   3940 C  CG    . LEU C  1 134 ? 97.113  67.070  -7.863  1.00 55.15  ? 133  LEU C CG    1 
ATOM   3941 C  CD1   . LEU C  1 134 ? 97.204  68.526  -8.308  1.00 51.46  ? 133  LEU C CD1   1 
ATOM   3942 C  CD2   . LEU C  1 134 ? 95.646  66.672  -7.714  1.00 69.41  ? 133  LEU C CD2   1 
ATOM   3943 N  N     . GLN C  1 135 ? 99.469  63.760  -10.071 1.00 56.28  ? 134  GLN C N     1 
ATOM   3944 C  CA    . GLN C  1 135 ? 99.940  62.891  -11.171 1.00 53.11  ? 134  GLN C CA    1 
ATOM   3945 C  C     . GLN C  1 135 ? 99.605  61.415  -11.020 1.00 54.17  ? 134  GLN C C     1 
ATOM   3946 O  O     . GLN C  1 135 ? 99.487  60.704  -12.023 1.00 57.27  ? 134  GLN C O     1 
ATOM   3947 C  CB    . GLN C  1 135 ? 101.445 63.042  -11.344 1.00 51.27  ? 134  GLN C CB    1 
ATOM   3948 C  CG    . GLN C  1 135 ? 101.820 64.336  -12.035 1.00 48.41  ? 134  GLN C CG    1 
ATOM   3949 C  CD    . GLN C  1 135 ? 103.294 64.416  -12.339 1.00 51.83  ? 134  GLN C CD    1 
ATOM   3950 O  OE1   . GLN C  1 135 ? 103.826 63.684  -13.193 1.00 54.55  ? 134  GLN C OE1   1 
ATOM   3951 N  NE2   . GLN C  1 135 ? 103.961 65.320  -11.663 1.00 45.72  ? 134  GLN C NE2   1 
ATOM   3952 N  N     . MET C  1 136 ? 99.457  60.980  -9.771  1.00 57.84  ? 135  MET C N     1 
ATOM   3953 C  CA    A MET C  1 136 ? 99.114  59.594  -9.461  0.60 60.81  ? 135  MET C CA    1 
ATOM   3954 C  CA    B MET C  1 136 ? 99.124  59.601  -9.395  0.40 59.20  ? 135  MET C CA    1 
ATOM   3955 C  C     . MET C  1 136 ? 97.610  59.397  -9.215  1.00 57.90  ? 135  MET C C     1 
ATOM   3956 O  O     . MET C  1 136 ? 97.147  58.273  -9.021  1.00 61.30  ? 135  MET C O     1 
ATOM   3957 C  CB    A MET C  1 136 ? 99.918  59.126  -8.237  0.60 59.82  ? 135  MET C CB    1 
ATOM   3958 C  CB    B MET C  1 136 ? 99.817  59.245  -8.060  0.40 56.92  ? 135  MET C CB    1 
ATOM   3959 C  CG    A MET C  1 136 ? 101.410 58.926  -8.507  0.60 64.99  ? 135  MET C CG    1 
ATOM   3960 C  CG    B MET C  1 136 ? 101.319 58.961  -8.144  0.40 60.56  ? 135  MET C CG    1 
ATOM   3961 S  SD    A MET C  1 136 ? 101.742 57.793  -9.870  0.60 75.42  ? 135  MET C SD    1 
ATOM   3962 S  SD    B MET C  1 136 ? 102.164 59.124  -6.545  0.40 58.10  ? 135  MET C SD    1 
ATOM   3963 C  CE    A MET C  1 136 ? 100.938 56.302  -9.264  0.60 79.73  ? 135  MET C CE    1 
ATOM   3964 C  CE    B MET C  1 136 ? 101.259 57.984  -5.501  0.40 56.87  ? 135  MET C CE    1 
ATOM   3965 N  N     . SER C  1 137 ? 96.853  60.483  -9.242  1.00 56.79  ? 136  SER C N     1 
ATOM   3966 C  CA    . SER C  1 137 ? 95.416  60.463  -8.948  1.00 58.09  ? 136  SER C CA    1 
ATOM   3967 C  C     . SER C  1 137 ? 94.566  59.731  -9.980  1.00 58.71  ? 136  SER C C     1 
ATOM   3968 O  O     . SER C  1 137 ? 94.865  59.742  -11.177 1.00 58.35  ? 136  SER C O     1 
ATOM   3969 C  CB    . SER C  1 137 ? 94.889  61.902  -8.804  1.00 61.45  ? 136  SER C CB    1 
ATOM   3970 O  OG    . SER C  1 137 ? 93.538  61.943  -8.359  1.00 70.92  ? 136  SER C OG    1 
ATOM   3971 N  N     . ARG C  1 138 ? 93.516  59.075  -9.476  1.00 59.11  ? 137  ARG C N     1 
ATOM   3972 C  CA    . ARG C  1 138 ? 92.456  58.486  -10.285 1.00 59.00  ? 137  ARG C CA    1 
ATOM   3973 C  C     . ARG C  1 138 ? 91.114  59.136  -9.921  1.00 57.06  ? 137  ARG C C     1 
ATOM   3974 O  O     . ARG C  1 138 ? 90.059  58.585  -10.160 1.00 60.53  ? 137  ARG C O     1 
ATOM   3975 C  CB    . ARG C  1 138 ? 92.389  56.982  -10.043 1.00 59.16  ? 137  ARG C CB    1 
ATOM   3976 C  CG    . ARG C  1 138 ? 93.617  56.203  -10.495 1.00 61.20  ? 137  ARG C CG    1 
ATOM   3977 C  CD    . ARG C  1 138 ? 93.587  55.904  -11.986 1.00 79.67  ? 137  ARG C CD    1 
ATOM   3978 N  NE    . ARG C  1 138 ? 92.406  55.127  -12.388 1.00 89.25  ? 137  ARG C NE    1 
ATOM   3979 C  CZ    . ARG C  1 138 ? 91.789  55.217  -13.571 1.00 88.95  ? 137  ARG C CZ    1 
ATOM   3980 N  NH1   . ARG C  1 138 ? 92.212  56.063  -14.518 1.00 69.51  ? 137  ARG C NH1   1 
ATOM   3981 N  NH2   . ARG C  1 138 ? 90.722  54.460  -13.804 1.00 86.18  ? 137  ARG C NH2   1 
ATOM   3982 N  N     . SER C  1 139 ? 91.167  60.336  -9.365  1.00 59.61  ? 138  SER C N     1 
ATOM   3983 C  CA    . SER C  1 139 ? 89.967  61.073  -8.996  1.00 58.33  ? 138  SER C CA    1 
ATOM   3984 C  C     . SER C  1 139 ? 89.041  61.381  -10.177 1.00 56.98  ? 138  SER C C     1 
ATOM   3985 O  O     . SER C  1 139 ? 89.475  61.811  -11.234 1.00 57.57  ? 138  SER C O     1 
ATOM   3986 C  CB    . SER C  1 139 ? 90.357  62.360  -8.296  1.00 58.42  ? 138  SER C CB    1 
ATOM   3987 O  OG    . SER C  1 139 ? 89.218  63.079  -7.894  1.00 57.32  ? 138  SER C OG    1 
ATOM   3988 N  N     . SER C  1 140 ? 87.755  61.127  -9.953  1.00 56.26  ? 139  SER C N     1 
ATOM   3989 C  CA    . SER C  1 140 ? 86.683  61.450  -10.862 1.00 56.57  ? 139  SER C CA    1 
ATOM   3990 C  C     . SER C  1 140 ? 86.034  62.777  -10.521 1.00 54.72  ? 139  SER C C     1 
ATOM   3991 O  O     . SER C  1 140 ? 85.004  63.135  -11.100 1.00 58.51  ? 139  SER C O     1 
ATOM   3992 C  CB    . SER C  1 140 ? 85.629  60.367  -10.768 1.00 56.52  ? 139  SER C CB    1 
ATOM   3993 O  OG    . SER C  1 140 ? 86.127  59.198  -11.342 1.00 62.33  ? 139  SER C OG    1 
ATOM   3994 N  N     . LEU C  1 141 ? 86.646  63.496  -9.592  1.00 52.97  ? 140  LEU C N     1 
ATOM   3995 C  CA    . LEU C  1 141 ? 86.147  64.744  -9.073  1.00 56.39  ? 140  LEU C CA    1 
ATOM   3996 C  C     . LEU C  1 141 ? 87.047  65.837  -9.606  1.00 53.60  ? 140  LEU C C     1 
ATOM   3997 O  O     . LEU C  1 141 ? 88.183  65.562  -9.936  1.00 58.10  ? 140  LEU C O     1 
ATOM   3998 C  CB    . LEU C  1 141 ? 86.205  64.732  -7.526  1.00 56.02  ? 140  LEU C CB    1 
ATOM   3999 C  CG    . LEU C  1 141 ? 85.400  63.621  -6.863  1.00 59.45  ? 140  LEU C CG    1 
ATOM   4000 C  CD1   . LEU C  1 141 ? 85.498  63.687  -5.347  1.00 52.59  ? 140  LEU C CD1   1 
ATOM   4001 C  CD2   . LEU C  1 141 ? 83.919  63.695  -7.297  1.00 52.25  ? 140  LEU C CD2   1 
ATOM   4002 N  N     . PRO C  1 142 ? 86.546  67.085  -9.666  1.00 53.85  ? 141  PRO C N     1 
ATOM   4003 C  CA    . PRO C  1 142 ? 87.356  68.213  -10.124 1.00 54.42  ? 141  PRO C CA    1 
ATOM   4004 C  C     . PRO C  1 142 ? 88.629  68.428  -9.302  1.00 54.12  ? 141  PRO C C     1 
ATOM   4005 O  O     . PRO C  1 142 ? 88.683  68.097  -8.112  1.00 58.72  ? 141  PRO C O     1 
ATOM   4006 C  CB    . PRO C  1 142 ? 86.407  69.426  -9.979  1.00 57.92  ? 141  PRO C CB    1 
ATOM   4007 C  CG    . PRO C  1 142 ? 85.057  68.877  -9.764  1.00 52.65  ? 141  PRO C CG    1 
ATOM   4008 C  CD    . PRO C  1 142 ? 85.172  67.484  -9.292  1.00 48.06  ? 141  PRO C CD    1 
ATOM   4009 N  N     . VAL C  1 143 ? 89.630  69.037  -9.915  1.00 55.30  ? 142  VAL C N     1 
ATOM   4010 C  CA    . VAL C  1 143 ? 90.921  69.198  -9.257  1.00 54.56  ? 142  VAL C CA    1 
ATOM   4011 C  C     . VAL C  1 143 ? 90.828  69.906  -7.908  1.00 56.83  ? 142  VAL C C     1 
ATOM   4012 O  O     . VAL C  1 143 ? 91.534  69.531  -6.982  1.00 61.17  ? 142  VAL C O     1 
ATOM   4013 C  CB    . VAL C  1 143 ? 91.948  69.886  -10.175 1.00 58.68  ? 142  VAL C CB    1 
ATOM   4014 C  CG1   . VAL C  1 143 ? 91.676  71.382  -10.319 1.00 56.50  ? 142  VAL C CG1   1 
ATOM   4015 C  CG2   . VAL C  1 143 ? 93.360  69.638  -9.675  1.00 53.22  ? 142  VAL C CG2   1 
ATOM   4016 N  N     . ASP C  1 144 ? 89.962  70.907  -7.771  1.00 57.25  ? 143  ASP C N     1 
ATOM   4017 C  CA    . ASP C  1 144 ? 89.833  71.620  -6.498  1.00 63.32  ? 143  ASP C CA    1 
ATOM   4018 C  C     . ASP C  1 144 ? 89.440  70.703  -5.335  1.00 59.63  ? 143  ASP C C     1 
ATOM   4019 O  O     . ASP C  1 144 ? 89.992  70.820  -4.263  1.00 59.32  ? 143  ASP C O     1 
ATOM   4020 C  CB    . ASP C  1 144 ? 88.831  72.786  -6.607  1.00 69.03  ? 143  ASP C CB    1 
ATOM   4021 C  CG    . ASP C  1 144 ? 89.399  74.003  -7.391  1.00 91.21  ? 143  ASP C CG    1 
ATOM   4022 O  OD1   . ASP C  1 144 ? 90.641  74.198  -7.438  1.00 99.24  ? 143  ASP C OD1   1 
ATOM   4023 O  OD2   . ASP C  1 144 ? 88.590  74.778  -7.956  1.00 101.65 ? 143  ASP C OD2   1 
ATOM   4024 N  N     . ASP C  1 145 ? 88.484  69.802  -5.564  1.00 59.54  ? 144  ASP C N     1 
ATOM   4025 C  CA    . ASP C  1 145 ? 88.019  68.862  -4.545  1.00 60.65  ? 144  ASP C CA    1 
ATOM   4026 C  C     . ASP C  1 145 ? 89.137  67.858  -4.278  1.00 56.07  ? 144  ASP C C     1 
ATOM   4027 O  O     . ASP C  1 145 ? 89.446  67.555  -3.144  1.00 59.15  ? 144  ASP C O     1 
ATOM   4028 C  CB    . ASP C  1 145 ? 86.742  68.104  -4.994  1.00 63.27  ? 144  ASP C CB    1 
ATOM   4029 C  CG    . ASP C  1 145 ? 85.667  69.021  -5.609  1.00 81.01  ? 144  ASP C CG    1 
ATOM   4030 O  OD1   . ASP C  1 145 ? 84.476  68.652  -5.586  1.00 90.15  ? 144  ASP C OD1   1 
ATOM   4031 O  OD2   . ASP C  1 145 ? 85.998  70.094  -6.161  1.00 99.75  ? 144  ASP C OD2   1 
ATOM   4032 N  N     . THR C  1 146 ? 89.727  67.345  -5.348  1.00 57.87  ? 145  THR C N     1 
ATOM   4033 C  CA    . THR C  1 146 ? 90.785  66.357  -5.274  1.00 54.02  ? 145  THR C CA    1 
ATOM   4034 C  C     . THR C  1 146 ? 91.993  66.892  -4.458  1.00 57.24  ? 145  THR C C     1 
ATOM   4035 O  O     . THR C  1 146 ? 92.571  66.186  -3.638  1.00 53.48  ? 145  THR C O     1 
ATOM   4036 C  CB    . THR C  1 146 ? 91.228  65.988  -6.703  1.00 52.78  ? 145  THR C CB    1 
ATOM   4037 O  OG1   . THR C  1 146 ? 90.089  65.530  -7.440  1.00 49.81  ? 145  THR C OG1   1 
ATOM   4038 C  CG2   . THR C  1 146 ? 92.329  64.899  -6.710  1.00 50.86  ? 145  THR C CG2   1 
ATOM   4039 N  N     . THR C  1 147 ? 92.337  68.151  -4.695  1.00 56.10  ? 146  THR C N     1 
ATOM   4040 C  CA    . THR C  1 147 ? 93.433  68.812  -4.042  1.00 58.45  ? 146  THR C CA    1 
ATOM   4041 C  C     . THR C  1 147 ? 93.157  69.109  -2.548  1.00 59.15  ? 146  THR C C     1 
ATOM   4042 O  O     . THR C  1 147 ? 94.078  69.070  -1.752  1.00 57.03  ? 146  THR C O     1 
ATOM   4043 C  CB    . THR C  1 147 ? 93.766  70.106  -4.807  1.00 60.15  ? 146  THR C CB    1 
ATOM   4044 O  OG1   . THR C  1 147 ? 94.027  69.774  -6.172  1.00 61.75  ? 146  THR C OG1   1 
ATOM   4045 C  CG2   . THR C  1 147 ? 94.976  70.800  -4.217  1.00 70.07  ? 146  THR C CG2   1 
ATOM   4046 N  N     . LYS C  1 148 ? 91.905  69.382  -2.172  1.00 59.32  ? 147  LYS C N     1 
ATOM   4047 C  CA    . LYS C  1 148 ? 91.564  69.590  -0.753  1.00 59.95  ? 147  LYS C CA    1 
ATOM   4048 C  C     . LYS C  1 148 ? 91.775  68.296  0.031   1.00 57.64  ? 147  LYS C C     1 
ATOM   4049 O  O     . LYS C  1 148 ? 92.261  68.300  1.171   1.00 61.61  ? 147  LYS C O     1 
ATOM   4050 C  CB    . LYS C  1 148 ? 90.117  70.068  -0.552  1.00 61.02  ? 147  LYS C CB    1 
ATOM   4051 C  CG    . LYS C  1 148 ? 89.715  71.307  -1.333  1.00 74.92  ? 147  LYS C CG    1 
ATOM   4052 C  CD    . LYS C  1 148 ? 88.928  72.340  -0.519  1.00 87.85  ? 147  LYS C CD    1 
ATOM   4053 C  CE    . LYS C  1 148 ? 87.722  71.763  0.231   1.00 105.59 ? 147  LYS C CE    1 
ATOM   4054 N  NZ    . LYS C  1 148 ? 86.845  72.843  0.826   1.00 102.77 ? 147  LYS C NZ    1 
ATOM   4055 N  N     . THR C  1 149 ? 91.427  67.194  -0.607  1.00 56.37  ? 148  THR C N     1 
ATOM   4056 C  CA    . THR C  1 149 ? 91.595  65.880  -0.019  1.00 59.74  ? 148  THR C CA    1 
ATOM   4057 C  C     . THR C  1 149 ? 93.064  65.512  0.131   1.00 56.29  ? 148  THR C C     1 
ATOM   4058 O  O     . THR C  1 149 ? 93.466  65.059  1.192   1.00 56.89  ? 148  THR C O     1 
ATOM   4059 C  CB    . THR C  1 149 ? 90.853  64.804  -0.838  1.00 54.26  ? 148  THR C CB    1 
ATOM   4060 O  OG1   . THR C  1 149 ? 89.438  65.036  -0.727  1.00 55.19  ? 148  THR C OG1   1 
ATOM   4061 C  CG2   . THR C  1 149 ? 91.162  63.421  -0.285  1.00 58.87  ? 148  THR C CG2   1 
ATOM   4062 N  N     . ILE C  1 150 ? 93.854  65.725  -0.920  1.00 57.29  ? 149  ILE C N     1 
ATOM   4063 C  CA    . ILE C  1 150 ? 95.315  65.558  -0.840  1.00 58.05  ? 149  ILE C CA    1 
ATOM   4064 C  C     . ILE C  1 150 ? 95.909  66.398  0.325   1.00 58.48  ? 149  ILE C C     1 
ATOM   4065 O  O     . ILE C  1 150 ? 96.750  65.922  1.071   1.00 59.47  ? 149  ILE C O     1 
ATOM   4066 C  CB    . ILE C  1 150 ? 95.989  65.936  -2.199  1.00 55.27  ? 149  ILE C CB    1 
ATOM   4067 C  CG1   . ILE C  1 150 ? 95.693  64.874  -3.262  1.00 55.52  ? 149  ILE C CG1   1 
ATOM   4068 C  CG2   . ILE C  1 150 ? 97.499  66.096  -2.031  1.00 61.63  ? 149  ILE C CG2   1 
ATOM   4069 C  CD1   . ILE C  1 150 ? 95.982  65.321  -4.699  1.00 55.08  ? 149  ILE C CD1   1 
ATOM   4070 N  N     . ALA C  1 151 ? 95.465  67.646  0.488   1.00 56.58  ? 150  ALA C N     1 
ATOM   4071 C  CA    . ALA C  1 151 ? 95.903  68.447  1.643   1.00 58.92  ? 150  ALA C CA    1 
ATOM   4072 C  C     . ALA C  1 151 ? 95.572  67.777  2.992   1.00 57.92  ? 150  ALA C C     1 
ATOM   4073 O  O     . ALA C  1 151 ? 96.337  67.900  3.948   1.00 58.59  ? 150  ALA C O     1 
ATOM   4074 C  CB    . ALA C  1 151 ? 95.309  69.869  1.584   1.00 56.56  ? 150  ALA C CB    1 
ATOM   4075 N  N     . LYS C  1 152 ? 94.433  67.083  3.071   1.00 58.59  ? 151  LYS C N     1 
ATOM   4076 C  CA    . LYS C  1 152 ? 94.099  66.296  4.271   1.00 57.29  ? 151  LYS C CA    1 
ATOM   4077 C  C     . LYS C  1 152 ? 95.050  65.129  4.496   1.00 56.11  ? 151  LYS C C     1 
ATOM   4078 O  O     . LYS C  1 152 ? 95.361  64.785  5.631   1.00 58.65  ? 151  LYS C O     1 
ATOM   4079 C  CB    . LYS C  1 152 ? 92.685  65.739  4.183   1.00 59.51  ? 151  LYS C CB    1 
ATOM   4080 C  CG    . LYS C  1 152 ? 91.611  66.753  4.423   1.00 58.43  ? 151  LYS C CG    1 
ATOM   4081 C  CD    . LYS C  1 152 ? 90.258  66.119  4.206   1.00 64.07  ? 151  LYS C CD    1 
ATOM   4082 C  CE    . LYS C  1 152 ? 89.139  67.141  4.317   1.00 69.58  ? 151  LYS C CE    1 
ATOM   4083 N  NZ    . LYS C  1 152 ? 87.917  66.637  3.639   1.00 86.52  ? 151  LYS C NZ    1 
ATOM   4084 N  N     . ARG C  1 153 ? 95.488  64.520  3.402   1.00 54.95  ? 152  ARG C N     1 
ATOM   4085 C  CA    . ARG C  1 153 ? 96.433  63.429  3.448   1.00 56.41  ? 152  ARG C CA    1 
ATOM   4086 C  C     . ARG C  1 153 ? 97.777  63.870  3.970   1.00 56.47  ? 152  ARG C C     1 
ATOM   4087 O  O     . ARG C  1 153 ? 98.415  63.134  4.733   1.00 59.56  ? 152  ARG C O     1 
ATOM   4088 C  CB    . ARG C  1 153 ? 96.603  62.821  2.054   1.00 57.21  ? 152  ARG C CB    1 
ATOM   4089 C  CG    . ARG C  1 153 ? 95.318  62.151  1.543   1.00 65.67  ? 152  ARG C CG    1 
ATOM   4090 C  CD    . ARG C  1 153 ? 95.500  61.541  0.153   1.00 68.75  ? 152  ARG C CD    1 
ATOM   4091 N  NE    . ARG C  1 153 ? 96.506  60.477  0.172   1.00 67.46  ? 152  ARG C NE    1 
ATOM   4092 C  CZ    . ARG C  1 153 ? 97.083  59.979  -0.918  1.00 62.95  ? 152  ARG C CZ    1 
ATOM   4093 N  NH1   . ARG C  1 153 ? 96.744  60.422  -2.132  1.00 61.55  ? 152  ARG C NH1   1 
ATOM   4094 N  NH2   . ARG C  1 153 ? 97.991  59.026  -0.793  1.00 61.36  ? 152  ARG C NH2   1 
ATOM   4095 N  N     . LEU C  1 154 ? 98.223  65.051  3.548   1.00 56.46  ? 153  LEU C N     1 
ATOM   4096 C  CA    . LEU C  1 154 ? 99.520  65.558  3.982   1.00 57.78  ? 153  LEU C CA    1 
ATOM   4097 C  C     . LEU C  1 154 ? 99.468  65.973  5.460   1.00 56.69  ? 153  LEU C C     1 
ATOM   4098 O  O     . LEU C  1 154 ? 100.392 65.712  6.213   1.00 58.83  ? 153  LEU C O     1 
ATOM   4099 C  CB    . LEU C  1 154 ? 99.987  66.734  3.112   1.00 54.17  ? 153  LEU C CB    1 
ATOM   4100 C  CG    . LEU C  1 154 ? 100.183 66.499  1.611   1.00 65.58  ? 153  LEU C CG    1 
ATOM   4101 C  CD1   . LEU C  1 154 ? 100.841 67.723  0.977   1.00 61.81  ? 153  LEU C CD1   1 
ATOM   4102 C  CD2   . LEU C  1 154 ? 100.984 65.247  1.337   1.00 67.97  ? 153  LEU C CD2   1 
ATOM   4103 N  N     . GLU C  1 155 ? 98.375  66.615  5.859   1.00 56.42  ? 154  GLU C N     1 
ATOM   4104 C  CA    . GLU C  1 155 ? 98.132  66.953  7.263   1.00 58.21  ? 154  GLU C CA    1 
ATOM   4105 C  C     . GLU C  1 155 ? 98.109  65.713  8.183   1.00 55.46  ? 154  GLU C C     1 
ATOM   4106 O  O     . GLU C  1 155 ? 98.693  65.726  9.257   1.00 57.96  ? 154  GLU C O     1 
ATOM   4107 C  CB    . GLU C  1 155 ? 96.836  67.784  7.393   1.00 61.10  ? 154  GLU C CB    1 
ATOM   4108 C  CG    . GLU C  1 155 ? 96.406  68.113  8.841   1.00 77.77  ? 154  GLU C CG    1 
ATOM   4109 C  CD    . GLU C  1 155 ? 97.455  68.898  9.663   1.00 89.02  ? 154  GLU C CD    1 
ATOM   4110 O  OE1   . GLU C  1 155 ? 98.465  69.380  9.094   1.00 79.28  ? 154  GLU C OE1   1 
ATOM   4111 O  OE2   . GLU C  1 155 ? 97.250  69.042  10.895  1.00 89.09  ? 154  GLU C OE2   1 
ATOM   4112 N  N     . ALA C  1 156 ? 97.464  64.644  7.752   1.00 56.68  ? 155  ALA C N     1 
ATOM   4113 C  CA    . ALA C  1 156 ? 97.485  63.370  8.506   1.00 57.83  ? 155  ALA C CA    1 
ATOM   4114 C  C     . ALA C  1 156 ? 98.880  62.775  8.590   1.00 55.15  ? 155  ALA C C     1 
ATOM   4115 O  O     . ALA C  1 156 ? 99.275  62.228  9.611   1.00 57.44  ? 155  ALA C O     1 
ATOM   4116 C  CB    . ALA C  1 156 ? 96.563  62.363  7.864   1.00 57.34  ? 155  ALA C CB    1 
ATOM   4117 N  N     . TYR C  1 157 ? 99.630  62.881  7.506   1.00 54.08  ? 156  TYR C N     1 
ATOM   4118 C  CA    . TYR C  1 157 ? 101.017 62.469  7.545   1.00 54.66  ? 156  TYR C CA    1 
ATOM   4119 C  C     . TYR C  1 157 ? 101.832 63.314  8.513   1.00 56.62  ? 156  TYR C C     1 
ATOM   4120 O  O     . TYR C  1 157 ? 102.676 62.782  9.221   1.00 58.53  ? 156  TYR C O     1 
ATOM   4121 C  CB    . TYR C  1 157 ? 101.671 62.540  6.164   1.00 52.85  ? 156  TYR C CB    1 
ATOM   4122 C  CG    . TYR C  1 157 ? 103.170 62.448  6.274   1.00 57.41  ? 156  TYR C CG    1 
ATOM   4123 C  CD1   . TYR C  1 157 ? 103.780 61.247  6.627   1.00 50.86  ? 156  TYR C CD1   1 
ATOM   4124 C  CD2   . TYR C  1 157 ? 103.977 63.569  6.080   1.00 56.84  ? 156  TYR C CD2   1 
ATOM   4125 C  CE1   . TYR C  1 157 ? 105.145 61.148  6.750   1.00 56.50  ? 156  TYR C CE1   1 
ATOM   4126 C  CE2   . TYR C  1 157 ? 105.360 63.478  6.212   1.00 60.47  ? 156  TYR C CE2   1 
ATOM   4127 C  CZ    . TYR C  1 157 ? 105.930 62.268  6.546   1.00 54.10  ? 156  TYR C CZ    1 
ATOM   4128 O  OH    . TYR C  1 157 ? 107.284 62.169  6.680   1.00 64.89  ? 156  TYR C OH    1 
ATOM   4129 N  N     . TYR C  1 158 ? 101.630 64.633  8.512   1.00 55.81  ? 157  TYR C N     1 
ATOM   4130 C  CA    . TYR C  1 158 ? 102.419 65.481  9.392   1.00 54.61  ? 157  TYR C CA    1 
ATOM   4131 C  C     . TYR C  1 158 ? 102.150 65.179  10.879  1.00 57.38  ? 157  TYR C C     1 
ATOM   4132 O  O     . TYR C  1 158 ? 103.069 65.207  11.720  1.00 54.39  ? 157  TYR C O     1 
ATOM   4133 C  CB    . TYR C  1 158 ? 102.173 66.955  9.090   1.00 56.71  ? 157  TYR C CB    1 
ATOM   4134 C  CG    . TYR C  1 158 ? 102.698 67.423  7.742   1.00 64.05  ? 157  TYR C CG    1 
ATOM   4135 C  CD1   . TYR C  1 158 ? 103.962 67.047  7.289   1.00 68.41  ? 157  TYR C CD1   1 
ATOM   4136 C  CD2   . TYR C  1 158 ? 101.941 68.266  6.933   1.00 67.76  ? 157  TYR C CD2   1 
ATOM   4137 C  CE1   . TYR C  1 158 ? 104.446 67.473  6.062   1.00 63.45  ? 157  TYR C CE1   1 
ATOM   4138 C  CE2   . TYR C  1 158 ? 102.418 68.705  5.701   1.00 63.21  ? 157  TYR C CE2   1 
ATOM   4139 C  CZ    . TYR C  1 158 ? 103.674 68.306  5.275   1.00 66.82  ? 157  TYR C CZ    1 
ATOM   4140 O  OH    . TYR C  1 158 ? 104.166 68.737  4.060   1.00 75.68  ? 157  TYR C OH    1 
ATOM   4141 N  N     . ARG C  1 159 ? 100.892 64.900  11.205  1.00 57.30  ? 158  ARG C N     1 
ATOM   4142 C  CA    . ARG C  1 159 ? 100.532 64.585  12.579  1.00 57.71  ? 158  ARG C CA    1 
ATOM   4143 C  C     . ARG C  1 159 ? 101.162 63.271  13.024  1.00 58.87  ? 158  ARG C C     1 
ATOM   4144 O  O     . ARG C  1 159 ? 101.582 63.136  14.167  1.00 62.97  ? 158  ARG C O     1 
ATOM   4145 C  CB    . ARG C  1 159 ? 99.013  64.563  12.751  1.00 55.74  ? 158  ARG C CB    1 
ATOM   4146 C  CG    . ARG C  1 159 ? 98.375  65.959  12.628  1.00 63.48  ? 158  ARG C CG    1 
ATOM   4147 C  CD    . ARG C  1 159 ? 97.014  66.001  13.321  1.00 90.15  ? 158  ARG C CD    1 
ATOM   4148 N  NE    . ARG C  1 159 ? 96.111  66.979  12.721  1.00 105.63 ? 158  ARG C NE    1 
ATOM   4149 N  N     . ALA C  1 160 ? 101.252 62.319  12.105  1.00 61.89  ? 159  ALA C N     1 
ATOM   4150 C  CA    . ALA C  1 160 ? 101.840 61.025  12.391  1.00 63.09  ? 159  ALA C CA    1 
ATOM   4151 C  C     . ALA C  1 160 ? 103.351 61.136  12.520  1.00 64.49  ? 159  ALA C C     1 
ATOM   4152 O  O     . ALA C  1 160 ? 103.938 60.536  13.430  1.00 71.96  ? 159  ALA C O     1 
ATOM   4153 C  CB    . ALA C  1 160 ? 101.468 60.002  11.315  1.00 66.89  ? 159  ALA C CB    1 
ATOM   4154 N  N     . SER C  1 161 ? 103.979 61.925  11.648  1.00 60.73  ? 160  SER C N     1 
ATOM   4155 C  CA    . SER C  1 161 ? 105.456 61.916  11.513  1.00 59.15  ? 160  SER C CA    1 
ATOM   4156 C  C     . SER C  1 161 ? 106.217 62.893  12.431  1.00 55.85  ? 160  SER C C     1 
ATOM   4157 O  O     . SER C  1 161 ? 107.309 62.589  12.886  1.00 57.37  ? 160  SER C O     1 
ATOM   4158 C  CB    . SER C  1 161 ? 105.848 62.147  10.039  1.00 59.74  ? 160  SER C CB    1 
ATOM   4159 O  OG    . SER C  1 161 ? 105.472 63.437  9.567   1.00 62.28  ? 160  SER C OG    1 
ATOM   4160 N  N     . ILE C  1 162 ? 105.652 64.066  12.682  1.00 54.63  ? 161  ILE C N     1 
ATOM   4161 C  CA    . ILE C  1 162 ? 106.386 65.139  13.385  1.00 56.08  ? 161  ILE C CA    1 
ATOM   4162 C  C     . ILE C  1 162 ? 106.807 64.790  14.829  1.00 54.59  ? 161  ILE C C     1 
ATOM   4163 O  O     . ILE C  1 162 ? 107.983 64.983  15.183  1.00 56.98  ? 161  ILE C O     1 
ATOM   4164 C  CB    . ILE C  1 162 ? 105.599 66.496  13.323  1.00 57.85  ? 161  ILE C CB    1 
ATOM   4165 C  CG1   . ILE C  1 162 ? 105.768 67.107  11.912  1.00 57.28  ? 161  ILE C CG1   1 
ATOM   4166 C  CG2   . ILE C  1 162 ? 106.027 67.470  14.450  1.00 57.24  ? 161  ILE C CG2   1 
ATOM   4167 C  CD1   . ILE C  1 162 ? 104.829 68.277  11.573  1.00 54.10  ? 161  ILE C CD1   1 
ATOM   4168 N  N     . PRO C  1 163 ? 105.861 64.298  15.668  1.00 50.43  ? 162  PRO C N     1 
ATOM   4169 C  CA    . PRO C  1 163 ? 106.259 63.872  17.022  1.00 53.42  ? 162  PRO C CA    1 
ATOM   4170 C  C     . PRO C  1 163 ? 107.195 62.654  17.055  1.00 51.27  ? 162  PRO C C     1 
ATOM   4171 O  O     . PRO C  1 163 ? 107.986 62.508  17.988  1.00 53.14  ? 162  PRO C O     1 
ATOM   4172 C  CB    . PRO C  1 163 ? 104.926 63.580  17.734  1.00 56.95  ? 162  PRO C CB    1 
ATOM   4173 C  CG    . PRO C  1 163 ? 103.817 63.866  16.733  1.00 52.43  ? 162  PRO C CG    1 
ATOM   4174 C  CD    . PRO C  1 163 ? 104.416 64.128  15.406  1.00 53.42  ? 162  PRO C CD    1 
ATOM   4175 N  N     . VAL C  1 164 ? 107.091 61.800  16.041  1.00 55.26  ? 163  VAL C N     1 
ATOM   4176 C  CA    . VAL C  1 164 ? 107.973 60.644  15.857  1.00 55.65  ? 163  VAL C CA    1 
ATOM   4177 C  C     . VAL C  1 164 ? 109.398 61.068  15.457  1.00 51.54  ? 163  VAL C C     1 
ATOM   4178 O  O     . VAL C  1 164 ? 110.385 60.605  16.040  1.00 53.43  ? 163  VAL C O     1 
ATOM   4179 C  CB    . VAL C  1 164 ? 107.333 59.642  14.826  1.00 56.06  ? 163  VAL C CB    1 
ATOM   4180 C  CG1   . VAL C  1 164 ? 108.303 58.574  14.383  1.00 59.63  ? 163  VAL C CG1   1 
ATOM   4181 C  CG2   . VAL C  1 164 ? 106.098 59.003  15.428  1.00 54.43  ? 163  VAL C CG2   1 
ATOM   4182 N  N     . ILE C  1 165 ? 109.518 61.947  14.476  1.00 53.74  ? 164  ILE C N     1 
ATOM   4183 C  CA    . ILE C  1 165 ? 110.855 62.411  14.060  1.00 56.72  ? 164  ILE C CA    1 
ATOM   4184 C  C     . ILE C  1 165 ? 111.511 63.205  15.184  1.00 51.06  ? 164  ILE C C     1 
ATOM   4185 O  O     . ILE C  1 165 ? 112.687 63.048  15.438  1.00 53.26  ? 164  ILE C O     1 
ATOM   4186 C  CB    . ILE C  1 165 ? 110.784 63.238  12.758  1.00 55.91  ? 164  ILE C CB    1 
ATOM   4187 C  CG1   . ILE C  1 165 ? 110.414 62.332  11.596  1.00 56.46  ? 164  ILE C CG1   1 
ATOM   4188 C  CG2   . ILE C  1 165 ? 112.095 63.910  12.435  1.00 59.26  ? 164  ILE C CG2   1 
ATOM   4189 C  CD1   . ILE C  1 165 ? 109.688 63.084  10.491  1.00 67.70  ? 164  ILE C CD1   1 
ATOM   4190 N  N     . ALA C  1 166 ? 110.725 64.021  15.876  1.00 51.64  ? 165  ALA C N     1 
ATOM   4191 C  CA    . ALA C  1 166 ? 111.227 64.813  17.013  1.00 54.13  ? 165  ALA C CA    1 
ATOM   4192 C  C     . ALA C  1 166 ? 111.730 63.925  18.152  1.00 52.87  ? 165  ALA C C     1 
ATOM   4193 O  O     . ALA C  1 166 ? 112.686 64.283  18.843  1.00 51.81  ? 165  ALA C O     1 
ATOM   4194 C  CB    . ALA C  1 166 ? 110.135 65.749  17.531  1.00 55.31  ? 165  ALA C CB    1 
ATOM   4195 N  N     . TYR C  1 167 ? 111.063 62.781  18.348  1.00 54.42  ? 166  TYR C N     1 
ATOM   4196 C  CA    . TYR C  1 167 ? 111.453 61.815  19.374  1.00 54.00  ? 166  TYR C CA    1 
ATOM   4197 C  C     . TYR C  1 167 ? 112.743 61.111  19.021  1.00 52.86  ? 166  TYR C C     1 
ATOM   4198 O  O     . TYR C  1 167 ? 113.626 61.001  19.865  1.00 57.75  ? 166  TYR C O     1 
ATOM   4199 C  CB    . TYR C  1 167 ? 110.371 60.761  19.611  1.00 56.89  ? 166  TYR C CB    1 
ATOM   4200 C  CG    . TYR C  1 167 ? 110.869 59.585  20.445  1.00 49.58  ? 166  TYR C CG    1 
ATOM   4201 C  CD1   . TYR C  1 167 ? 111.058 59.690  21.814  1.00 58.67  ? 166  TYR C CD1   1 
ATOM   4202 C  CD2   . TYR C  1 167 ? 111.150 58.368  19.842  1.00 60.75  ? 166  TYR C CD2   1 
ATOM   4203 C  CE1   . TYR C  1 167 ? 111.518 58.583  22.565  1.00 67.14  ? 166  TYR C CE1   1 
ATOM   4204 C  CE2   . TYR C  1 167 ? 111.602 57.283  20.567  1.00 53.15  ? 166  TYR C CE2   1 
ATOM   4205 C  CZ    . TYR C  1 167 ? 111.781 57.382  21.915  1.00 57.40  ? 166  TYR C CZ    1 
ATOM   4206 O  OH    . TYR C  1 167 ? 112.242 56.266  22.565  1.00 64.69  ? 166  TYR C OH    1 
ATOM   4207 N  N     . TYR C  1 168 ? 112.860 60.645  17.779  1.00 54.29  ? 167  TYR C N     1 
ATOM   4208 C  CA    . TYR C  1 168 ? 114.023 59.828  17.394  1.00 57.33  ? 167  TYR C CA    1 
ATOM   4209 C  C     . TYR C  1 168 ? 115.272 60.662  17.249  1.00 58.61  ? 167  TYR C C     1 
ATOM   4210 O  O     . TYR C  1 168 ? 116.377 60.133  17.396  1.00 58.05  ? 167  TYR C O     1 
ATOM   4211 C  CB    . TYR C  1 168 ? 113.752 58.962  16.139  1.00 55.40  ? 167  TYR C CB    1 
ATOM   4212 C  CG    . TYR C  1 168 ? 112.995 57.703  16.511  1.00 51.08  ? 167  TYR C CG    1 
ATOM   4213 C  CD1   . TYR C  1 168 ? 111.697 57.498  16.084  1.00 56.06  ? 167  TYR C CD1   1 
ATOM   4214 C  CD2   . TYR C  1 168 ? 113.572 56.739  17.363  1.00 59.33  ? 167  TYR C CD2   1 
ATOM   4215 C  CE1   . TYR C  1 168 ? 110.981 56.350  16.447  1.00 61.10  ? 167  TYR C CE1   1 
ATOM   4216 C  CE2   . TYR C  1 168 ? 112.863 55.580  17.736  1.00 60.67  ? 167  TYR C CE2   1 
ATOM   4217 C  CZ    . TYR C  1 168 ? 111.560 55.397  17.272  1.00 50.46  ? 167  TYR C CZ    1 
ATOM   4218 O  OH    . TYR C  1 168 ? 110.824 54.278  17.622  1.00 58.45  ? 167  TYR C OH    1 
ATOM   4219 N  N     . GLU C  1 169 ? 115.085 61.955  16.972  1.00 59.35  ? 168  GLU C N     1 
ATOM   4220 C  CA    . GLU C  1 169 ? 116.165 62.931  17.035  1.00 62.28  ? 168  GLU C CA    1 
ATOM   4221 C  C     . GLU C  1 169 ? 116.918 62.770  18.356  1.00 61.09  ? 168  GLU C C     1 
ATOM   4222 O  O     . GLU C  1 169 ? 118.148 62.641  18.370  1.00 60.13  ? 168  GLU C O     1 
ATOM   4223 C  CB    . GLU C  1 169 ? 115.593 64.348  16.930  1.00 66.43  ? 168  GLU C CB    1 
ATOM   4224 C  CG    . GLU C  1 169 ? 116.627 65.404  16.563  1.00 81.11  ? 168  GLU C CG    1 
ATOM   4225 C  CD    . GLU C  1 169 ? 117.110 65.254  15.126  1.00 104.78 ? 168  GLU C CD    1 
ATOM   4226 O  OE1   . GLU C  1 169 ? 116.266 65.370  14.195  1.00 93.17  ? 168  GLU C OE1   1 
ATOM   4227 O  OE2   . GLU C  1 169 ? 118.330 65.018  14.940  1.00 101.54 ? 168  GLU C OE2   1 
ATOM   4228 N  N     . THR C  1 170 ? 116.146 62.724  19.450  1.00 62.73  ? 169  THR C N     1 
ATOM   4229 C  CA    . THR C  1 170 ? 116.669 62.612  20.819  1.00 64.74  ? 169  THR C CA    1 
ATOM   4230 C  C     . THR C  1 170 ? 117.270 61.243  21.179  1.00 65.92  ? 169  THR C C     1 
ATOM   4231 O  O     . THR C  1 170 ? 117.909 61.134  22.220  1.00 65.02  ? 169  THR C O     1 
ATOM   4232 C  CB    . THR C  1 170 ? 115.561 62.925  21.924  1.00 64.86  ? 169  THR C CB    1 
ATOM   4233 O  OG1   . THR C  1 170 ? 114.736 61.766  22.187  1.00 51.03  ? 169  THR C OG1   1 
ATOM   4234 C  CG2   . THR C  1 170 ? 114.680 64.126  21.533  1.00 55.45  ? 169  THR C CG2   1 
ATOM   4235 N  N     . LYS C  1 171 ? 117.049 60.216  20.344  1.00 66.73  ? 170  LYS C N     1 
ATOM   4236 C  CA    . LYS C  1 171 ? 117.342 58.815  20.709  1.00 66.17  ? 170  LYS C CA    1 
ATOM   4237 C  C     . LYS C  1 171 ? 118.326 58.040  19.806  1.00 65.35  ? 170  LYS C C     1 
ATOM   4238 O  O     . LYS C  1 171 ? 118.937 57.081  20.262  1.00 67.23  ? 170  LYS C O     1 
ATOM   4239 C  CB    . LYS C  1 171 ? 116.024 58.016  20.848  1.00 67.49  ? 170  LYS C CB    1 
ATOM   4240 C  CG    . LYS C  1 171 ? 115.632 57.738  22.313  1.00 74.75  ? 170  LYS C CG    1 
ATOM   4241 N  N     . THR C  1 172 ? 118.479 58.421  18.542  1.00 67.41  ? 171  THR C N     1 
ATOM   4242 C  CA    . THR C  1 172 ? 119.308 57.625  17.619  1.00 64.85  ? 171  THR C CA    1 
ATOM   4243 C  C     . THR C  1 172 ? 119.793 58.442  16.433  1.00 62.66  ? 171  THR C C     1 
ATOM   4244 O  O     . THR C  1 172 ? 119.566 59.648  16.359  1.00 64.18  ? 171  THR C O     1 
ATOM   4245 C  CB    . THR C  1 172 ? 118.547 56.335  17.108  1.00 67.42  ? 171  THR C CB    1 
ATOM   4246 O  OG1   . THR C  1 172 ? 119.475 55.414  16.513  1.00 61.16  ? 171  THR C OG1   1 
ATOM   4247 C  CG2   . THR C  1 172 ? 117.441 56.669  16.093  1.00 61.50  ? 171  THR C CG2   1 
ATOM   4248 N  N     . GLN C  1 173 ? 120.477 57.774  15.514  1.00 59.52  ? 172  GLN C N     1 
ATOM   4249 C  CA    . GLN C  1 173 ? 120.905 58.407  14.287  1.00 59.37  ? 172  GLN C CA    1 
ATOM   4250 C  C     . GLN C  1 173 ? 119.659 58.628  13.426  1.00 58.76  ? 172  GLN C C     1 
ATOM   4251 O  O     . GLN C  1 173 ? 118.945 57.673  13.070  1.00 59.10  ? 172  GLN C O     1 
ATOM   4252 C  CB    . GLN C  1 173 ? 121.946 57.546  13.562  1.00 59.35  ? 172  GLN C CB    1 
ATOM   4253 C  CG    . GLN C  1 173 ? 122.939 58.354  12.735  1.00 69.62  ? 172  GLN C CG    1 
ATOM   4254 C  CD    . GLN C  1 173 ? 123.841 59.235  13.584  1.00 62.07  ? 172  GLN C CD    1 
ATOM   4255 O  OE1   . GLN C  1 173 ? 123.896 60.449  13.391  1.00 62.56  ? 172  GLN C OE1   1 
ATOM   4256 N  NE2   . GLN C  1 173 ? 124.540 58.630  14.538  1.00 46.36  ? 172  GLN C NE2   1 
ATOM   4257 N  N     . LEU C  1 174 ? 119.376 59.901  13.162  1.00 56.55  ? 173  LEU C N     1 
ATOM   4258 C  CA    . LEU C  1 174 ? 118.282 60.306  12.303  1.00 57.91  ? 173  LEU C CA    1 
ATOM   4259 C  C     . LEU C  1 174 ? 118.885 61.024  11.113  1.00 55.24  ? 173  LEU C C     1 
ATOM   4260 O  O     . LEU C  1 174 ? 119.600 62.011  11.281  1.00 58.08  ? 173  LEU C O     1 
ATOM   4261 C  CB    . LEU C  1 174 ? 117.296 61.214  13.059  1.00 60.69  ? 173  LEU C CB    1 
ATOM   4262 C  CG    . LEU C  1 174 ? 115.904 61.322  12.414  1.00 71.78  ? 173  LEU C CG    1 
ATOM   4263 C  CD1   . LEU C  1 174 ? 114.818 61.594  13.449  1.00 82.68  ? 173  LEU C CD1   1 
ATOM   4264 C  CD2   . LEU C  1 174 ? 115.876 62.372  11.316  1.00 76.00  ? 173  LEU C CD2   1 
ATOM   4265 N  N     . HIS C  1 175 ? 118.612 60.513  9.917   1.00 56.54  ? 174  HIS C N     1 
ATOM   4266 C  CA    . HIS C  1 175 ? 119.103 61.111  8.678   1.00 57.44  ? 174  HIS C CA    1 
ATOM   4267 C  C     . HIS C  1 175 ? 117.925 61.625  7.859   1.00 57.59  ? 174  HIS C C     1 
ATOM   4268 O  O     . HIS C  1 175 ? 116.990 60.891  7.586   1.00 57.42  ? 174  HIS C O     1 
ATOM   4269 C  CB    . HIS C  1 175 ? 119.888 60.087  7.861   1.00 57.43  ? 174  HIS C CB    1 
ATOM   4270 C  CG    . HIS C  1 175 ? 121.332 59.995  8.234   1.00 65.74  ? 174  HIS C CG    1 
ATOM   4271 N  ND1   . HIS C  1 175 ? 121.766 59.414  9.408   1.00 73.15  ? 174  HIS C ND1   1 
ATOM   4272 C  CD2   . HIS C  1 175 ? 122.445 60.402  7.579   1.00 73.78  ? 174  HIS C CD2   1 
ATOM   4273 C  CE1   . HIS C  1 175 ? 123.085 59.470  9.460   1.00 67.22  ? 174  HIS C CE1   1 
ATOM   4274 N  NE2   . HIS C  1 175 ? 123.520 60.065  8.363   1.00 74.84  ? 174  HIS C NE2   1 
ATOM   4275 N  N     . LYS C  1 176 ? 117.969 62.900  7.495   1.00 57.95  ? 175  LYS C N     1 
ATOM   4276 C  CA    . LYS C  1 176 ? 116.950 63.495  6.664   1.00 62.56  ? 175  LYS C CA    1 
ATOM   4277 C  C     . LYS C  1 176 ? 117.435 63.441  5.212   1.00 61.11  ? 175  LYS C C     1 
ATOM   4278 O  O     . LYS C  1 176 ? 118.590 63.662  4.934   1.00 63.08  ? 175  LYS C O     1 
ATOM   4279 C  CB    . LYS C  1 176 ? 116.620 64.917  7.147   1.00 61.62  ? 175  LYS C CB    1 
ATOM   4280 C  CG    . LYS C  1 176 ? 115.854 64.948  8.507   1.00 61.78  ? 175  LYS C CG    1 
ATOM   4281 C  CD    . LYS C  1 176 ? 115.585 66.380  9.019   1.00 68.20  ? 175  LYS C CD    1 
ATOM   4282 C  CE    . LYS C  1 176 ? 114.399 66.461  10.004  1.00 75.68  ? 175  LYS C CE    1 
ATOM   4283 N  NZ    . LYS C  1 176 ? 113.037 66.415  9.323   1.00 71.51  ? 175  LYS C NZ    1 
ATOM   4284 N  N     . ILE C  1 177 ? 116.553 63.058  4.301   1.00 64.04  ? 176  ILE C N     1 
ATOM   4285 C  CA    . ILE C  1 177 ? 116.902 62.916  2.895   1.00 62.77  ? 176  ILE C CA    1 
ATOM   4286 C  C     . ILE C  1 177 ? 116.033 63.900  2.129   1.00 61.47  ? 176  ILE C C     1 
ATOM   4287 O  O     . ILE C  1 177 ? 114.815 63.972  2.361   1.00 58.13  ? 176  ILE C O     1 
ATOM   4288 C  CB    . ILE C  1 177 ? 116.671 61.442  2.411   1.00 65.76  ? 176  ILE C CB    1 
ATOM   4289 C  CG1   . ILE C  1 177 ? 117.917 60.576  2.671   1.00 78.06  ? 176  ILE C CG1   1 
ATOM   4290 C  CG2   . ILE C  1 177 ? 116.360 61.376  0.912   1.00 69.79  ? 176  ILE C CG2   1 
ATOM   4291 C  CD1   . ILE C  1 177 ? 118.244 60.351  4.117   1.00 79.83  ? 176  ILE C CD1   1 
ATOM   4292 N  N     . ASN C  1 178 ? 116.647 64.677  1.239   1.00 61.04  ? 177  ASN C N     1 
ATOM   4293 C  CA    . ASN C  1 178 ? 115.871 65.559  0.364   1.00 61.42  ? 177  ASN C CA    1 
ATOM   4294 C  C     . ASN C  1 178 ? 115.231 64.755  -0.788  1.00 60.01  ? 177  ASN C C     1 
ATOM   4295 O  O     . ASN C  1 178 ? 115.887 64.416  -1.777  1.00 60.54  ? 177  ASN C O     1 
ATOM   4296 C  CB    . ASN C  1 178 ? 116.729 66.702  -0.171  1.00 61.60  ? 177  ASN C CB    1 
ATOM   4297 C  CG    . ASN C  1 178 ? 115.906 67.796  -0.865  1.00 68.01  ? 177  ASN C CG    1 
ATOM   4298 O  OD1   . ASN C  1 178 ? 114.681 67.870  -0.728  1.00 61.48  ? 177  ASN C OD1   1 
ATOM   4299 N  ND2   . ASN C  1 178 ? 116.596 68.663  -1.602  1.00 63.97  ? 177  ASN C ND2   1 
ATOM   4300 N  N     . ALA C  1 179 ? 113.943 64.467  -0.636  1.00 59.01  ? 178  ALA C N     1 
ATOM   4301 C  CA    . ALA C  1 179 ? 113.204 63.665  -1.598  1.00 57.93  ? 178  ALA C CA    1 
ATOM   4302 C  C     . ALA C  1 179 ? 112.666 64.506  -2.780  1.00 57.31  ? 178  ALA C C     1 
ATOM   4303 O  O     . ALA C  1 179 ? 111.940 63.999  -3.625  1.00 56.49  ? 178  ALA C O     1 
ATOM   4304 C  CB    . ALA C  1 179 ? 112.082 62.950  -0.894  1.00 59.26  ? 178  ALA C CB    1 
ATOM   4305 N  N     . GLU C  1 180 ? 113.037 65.784  -2.835  1.00 58.68  ? 179  GLU C N     1 
ATOM   4306 C  CA    . GLU C  1 180 ? 112.748 66.633  -3.995  1.00 60.45  ? 179  GLU C CA    1 
ATOM   4307 C  C     . GLU C  1 180 ? 113.530 66.185  -5.234  1.00 60.18  ? 179  GLU C C     1 
ATOM   4308 O  O     . GLU C  1 180 ? 113.095 66.395  -6.377  1.00 60.87  ? 179  GLU C O     1 
ATOM   4309 C  CB    . GLU C  1 180 ? 113.129 68.080  -3.691  1.00 62.49  ? 179  GLU C CB    1 
ATOM   4310 C  CG    . GLU C  1 180 ? 112.346 68.712  -2.571  1.00 62.61  ? 179  GLU C CG    1 
ATOM   4311 C  CD    . GLU C  1 180 ? 110.957 69.042  -2.959  1.00 62.56  ? 179  GLU C CD    1 
ATOM   4312 O  OE1   . GLU C  1 180 ? 110.641 68.982  -4.164  1.00 76.75  ? 179  GLU C OE1   1 
ATOM   4313 O  OE2   . GLU C  1 180 ? 110.172 69.368  -2.056  1.00 79.23  ? 179  GLU C OE2   1 
ATOM   4314 N  N     . GLY C  1 181 ? 114.694 65.583  -4.992  1.00 58.52  ? 180  GLY C N     1 
ATOM   4315 C  CA    . GLY C  1 181 ? 115.582 65.167  -6.055  1.00 58.26  ? 180  GLY C CA    1 
ATOM   4316 C  C     . GLY C  1 181 ? 115.033 64.012  -6.863  1.00 57.96  ? 180  GLY C C     1 
ATOM   4317 O  O     . GLY C  1 181 ? 114.035 63.401  -6.491  1.00 59.06  ? 180  GLY C O     1 
ATOM   4318 N  N     . THR C  1 182 ? 115.703 63.732  -7.977  1.00 57.33  ? 181  THR C N     1 
ATOM   4319 C  CA    . THR C  1 182 ? 115.390 62.602  -8.835  1.00 57.29  ? 181  THR C CA    1 
ATOM   4320 C  C     . THR C  1 182 ? 115.532 61.311  -8.018  1.00 56.05  ? 181  THR C C     1 
ATOM   4321 O  O     . THR C  1 182 ? 116.206 61.298  -6.998  1.00 55.21  ? 181  THR C O     1 
ATOM   4322 C  CB    . THR C  1 182 ? 116.299 62.631  -10.110 1.00 61.06  ? 181  THR C CB    1 
ATOM   4323 O  OG1   . THR C  1 182 ? 115.978 61.552  -10.995 1.00 74.90  ? 181  THR C OG1   1 
ATOM   4324 C  CG2   . THR C  1 182 ? 117.762 62.563  -9.755  1.00 62.73  ? 181  THR C CG2   1 
ATOM   4325 N  N     . PRO C  1 183 ? 114.858 60.226  -8.434  1.00 58.20  ? 182  PRO C N     1 
ATOM   4326 C  CA    . PRO C  1 183 ? 114.919 59.032  -7.579  1.00 60.19  ? 182  PRO C CA    1 
ATOM   4327 C  C     . PRO C  1 183 ? 116.329 58.459  -7.412  1.00 59.85  ? 182  PRO C C     1 
ATOM   4328 O  O     . PRO C  1 183 ? 116.618 57.805  -6.409  1.00 60.04  ? 182  PRO C O     1 
ATOM   4329 C  CB    . PRO C  1 183 ? 114.005 58.027  -8.303  1.00 59.29  ? 182  PRO C CB    1 
ATOM   4330 C  CG    . PRO C  1 183 ? 113.185 58.842  -9.244  1.00 58.78  ? 182  PRO C CG    1 
ATOM   4331 C  CD    . PRO C  1 183 ? 114.017 60.008  -9.626  1.00 56.99  ? 182  PRO C CD    1 
ATOM   4332 N  N     . GLU C  1 184 ? 117.190 58.712  -8.391  1.00 60.63  ? 183  GLU C N     1 
ATOM   4333 C  CA    . GLU C  1 184 ? 118.550 58.221  -8.353  1.00 61.59  ? 183  GLU C CA    1 
ATOM   4334 C  C     . GLU C  1 184 ? 119.383 59.005  -7.337  1.00 59.58  ? 183  GLU C C     1 
ATOM   4335 O  O     . GLU C  1 184 ? 120.106 58.405  -6.551  1.00 58.52  ? 183  GLU C O     1 
ATOM   4336 C  CB    . GLU C  1 184 ? 119.163 58.263  -9.752  1.00 63.54  ? 183  GLU C CB    1 
ATOM   4337 C  CG    . GLU C  1 184 ? 118.489 57.293  -10.744 1.00 69.69  ? 183  GLU C CG    1 
ATOM   4338 C  CD    . GLU C  1 184 ? 117.191 57.829  -11.357 1.00 80.46  ? 183  GLU C CD    1 
ATOM   4339 O  OE1   . GLU C  1 184 ? 117.182 58.979  -11.851 1.00 87.33  ? 183  GLU C OE1   1 
ATOM   4340 O  OE2   . GLU C  1 184 ? 116.180 57.092  -11.358 1.00 80.20  ? 183  GLU C OE2   1 
ATOM   4341 N  N     . ASP C  1 185 ? 119.271 60.334  -7.342  1.00 57.82  ? 184  ASP C N     1 
ATOM   4342 C  CA    . ASP C  1 185 ? 119.896 61.171  -6.297  1.00 59.90  ? 184  ASP C CA    1 
ATOM   4343 C  C     . ASP C  1 185 ? 119.430 60.739  -4.914  1.00 58.46  ? 184  ASP C C     1 
ATOM   4344 O  O     . ASP C  1 185 ? 120.233 60.621  -3.996  1.00 57.36  ? 184  ASP C O     1 
ATOM   4345 C  CB    . ASP C  1 185 ? 119.540 62.660  -6.439  1.00 59.73  ? 184  ASP C CB    1 
ATOM   4346 C  CG    . ASP C  1 185 ? 120.236 63.334  -7.598  1.00 75.13  ? 184  ASP C CG    1 
ATOM   4347 O  OD1   . ASP C  1 185 ? 121.367 62.934  -7.972  1.00 73.85  ? 184  ASP C OD1   1 
ATOM   4348 O  OD2   . ASP C  1 185 ? 119.637 64.298  -8.123  1.00 91.83  ? 184  ASP C OD2   1 
ATOM   4349 N  N     . VAL C  1 186 ? 118.122 60.535  -4.764  1.00 55.87  ? 185  VAL C N     1 
ATOM   4350 C  CA    . VAL C  1 186 ? 117.567 60.200  -3.461  1.00 56.58  ? 185  VAL C CA    1 
ATOM   4351 C  C     . VAL C  1 186 ? 118.131 58.859  -2.970  1.00 55.89  ? 185  VAL C C     1 
ATOM   4352 O  O     . VAL C  1 186 ? 118.431 58.700  -1.792  1.00 57.42  ? 185  VAL C O     1 
ATOM   4353 C  CB    . VAL C  1 186 ? 116.020 60.185  -3.491  1.00 59.29  ? 185  VAL C CB    1 
ATOM   4354 C  CG1   . VAL C  1 186 ? 115.451 59.672  -2.169  1.00 54.73  ? 185  VAL C CG1   1 
ATOM   4355 C  CG2   . VAL C  1 186 ? 115.494 61.587  -3.791  1.00 53.80  ? 185  VAL C CG2   1 
ATOM   4356 N  N     . PHE C  1 187 ? 118.300 57.916  -3.888  1.00 55.41  ? 186  PHE C N     1 
ATOM   4357 C  CA    . PHE C  1 187 ? 118.796 56.588  -3.559  1.00 55.49  ? 186  PHE C CA    1 
ATOM   4358 C  C     . PHE C  1 187 ? 120.252 56.673  -3.101  1.00 55.64  ? 186  PHE C C     1 
ATOM   4359 O  O     . PHE C  1 187 ? 120.638 56.084  -2.091  1.00 57.86  ? 186  PHE C O     1 
ATOM   4360 C  CB    . PHE C  1 187 ? 118.637 55.677  -4.779  1.00 57.16  ? 186  PHE C CB    1 
ATOM   4361 C  CG    . PHE C  1 187 ? 119.015 54.249  -4.535  1.00 60.66  ? 186  PHE C CG    1 
ATOM   4362 C  CD1   . PHE C  1 187 ? 118.377 53.509  -3.553  1.00 52.05  ? 186  PHE C CD1   1 
ATOM   4363 C  CD2   . PHE C  1 187 ? 119.998 53.633  -5.311  1.00 53.47  ? 186  PHE C CD2   1 
ATOM   4364 C  CE1   . PHE C  1 187 ? 118.727 52.179  -3.326  1.00 65.27  ? 186  PHE C CE1   1 
ATOM   4365 C  CE2   . PHE C  1 187 ? 120.349 52.309  -5.096  1.00 49.77  ? 186  PHE C CE2   1 
ATOM   4366 C  CZ    . PHE C  1 187 ? 119.713 51.579  -4.106  1.00 64.68  ? 186  PHE C CZ    1 
ATOM   4367 N  N     . LEU C  1 188 ? 121.053 57.424  -3.838  1.00 56.56  ? 187  LEU C N     1 
ATOM   4368 C  CA    . LEU C  1 188 ? 122.427 57.716  -3.422  1.00 58.00  ? 187  LEU C CA    1 
ATOM   4369 C  C     . LEU C  1 188 ? 122.495 58.290  -2.006  1.00 57.62  ? 187  LEU C C     1 
ATOM   4370 O  O     . LEU C  1 188 ? 123.339 57.883  -1.213  1.00 60.64  ? 187  LEU C O     1 
ATOM   4371 C  CB    . LEU C  1 188 ? 123.084 58.689  -4.398  1.00 55.72  ? 187  LEU C CB    1 
ATOM   4372 C  CG    . LEU C  1 188 ? 123.638 58.051  -5.669  1.00 64.49  ? 187  LEU C CG    1 
ATOM   4373 C  CD1   . LEU C  1 188 ? 123.860 59.119  -6.739  1.00 68.73  ? 187  LEU C CD1   1 
ATOM   4374 C  CD2   . LEU C  1 188 ? 124.940 57.301  -5.373  1.00 70.68  ? 187  LEU C CD2   1 
ATOM   4375 N  N     . GLN C  1 189 ? 121.620 59.239  -1.698  1.00 59.02  ? 188  GLN C N     1 
ATOM   4376 C  CA    . GLN C  1 189 ? 121.566 59.817  -0.358  1.00 62.62  ? 188  GLN C CA    1 
ATOM   4377 C  C     . GLN C  1 189 ? 121.236 58.744  0.682   1.00 60.47  ? 188  GLN C C     1 
ATOM   4378 O  O     . GLN C  1 189 ? 121.939 58.596  1.692   1.00 57.12  ? 188  GLN C O     1 
ATOM   4379 C  CB    . GLN C  1 189 ? 120.515 60.931  -0.276  1.00 66.29  ? 188  GLN C CB    1 
ATOM   4380 C  CG    . GLN C  1 189 ? 120.835 62.214  -1.045  1.00 67.24  ? 188  GLN C CG    1 
ATOM   4381 C  CD    . GLN C  1 189 ? 119.677 63.211  -0.965  1.00 72.84  ? 188  GLN C CD    1 
ATOM   4382 O  OE1   . GLN C  1 189 ? 119.449 63.822  0.083   1.00 79.14  ? 188  GLN C OE1   1 
ATOM   4383 N  NE2   . GLN C  1 189 ? 118.931 63.368  -2.069  1.00 73.21  ? 188  GLN C NE2   1 
ATOM   4384 N  N     . LEU C  1 190 ? 120.153 58.015  0.427   1.00 58.11  ? 189  LEU C N     1 
ATOM   4385 C  CA    . LEU C  1 190 ? 119.734 56.918  1.293   1.00 59.44  ? 189  LEU C CA    1 
ATOM   4386 C  C     . LEU C  1 190 ? 120.875 55.950  1.551   1.00 57.87  ? 189  LEU C C     1 
ATOM   4387 O  O     . LEU C  1 190 ? 121.119 55.574  2.693   1.00 57.07  ? 189  LEU C O     1 
ATOM   4388 C  CB    . LEU C  1 190 ? 118.571 56.143  0.662   1.00 59.21  ? 189  LEU C CB    1 
ATOM   4389 C  CG    . LEU C  1 190 ? 117.194 56.813  0.641   1.00 62.19  ? 189  LEU C CG    1 
ATOM   4390 C  CD1   . LEU C  1 190 ? 116.247 56.028  -0.231  1.00 63.93  ? 189  LEU C CD1   1 
ATOM   4391 C  CD2   . LEU C  1 190 ? 116.620 56.931  2.023   1.00 64.22  ? 189  LEU C CD2   1 
ATOM   4392 N  N     . CYS C  1 191 ? 121.558 55.547  0.481   1.00 56.35  ? 190  CYS C N     1 
ATOM   4393 C  CA    . CYS C  1 191 ? 122.645 54.579  0.578   1.00 57.54  ? 190  CYS C CA    1 
ATOM   4394 C  C     . CYS C  1 191 ? 123.813 55.107  1.380   1.00 56.20  ? 190  CYS C C     1 
ATOM   4395 O  O     . CYS C  1 191 ? 124.396 54.380  2.176   1.00 59.86  ? 190  CYS C O     1 
ATOM   4396 C  CB    . CYS C  1 191 ? 123.124 54.174  -0.804  1.00 54.37  ? 190  CYS C CB    1 
ATOM   4397 S  SG    . CYS C  1 191 ? 121.909 53.223  -1.646  1.00 56.28  ? 190  CYS C SG    1 
ATOM   4398 N  N     . THR C  1 192 ? 124.159 56.368  1.163   1.00 56.71  ? 191  THR C N     1 
ATOM   4399 C  CA    . THR C  1 192 ? 125.193 57.015  1.964   1.00 58.58  ? 191  THR C CA    1 
ATOM   4400 C  C     . THR C  1 192 ? 124.834 56.854  3.436   1.00 58.97  ? 191  THR C C     1 
ATOM   4401 O  O     . THR C  1 192 ? 125.639 56.368  4.216   1.00 61.05  ? 191  THR C O     1 
ATOM   4402 C  CB    . THR C  1 192 ? 125.325 58.512  1.618   1.00 57.36  ? 191  THR C CB    1 
ATOM   4403 O  OG1   . THR C  1 192 ? 125.634 58.656  0.224   1.00 53.25  ? 191  THR C OG1   1 
ATOM   4404 C  CG2   . THR C  1 192 ? 126.406 59.180  2.465   1.00 55.89  ? 191  THR C CG2   1 
ATOM   4405 N  N     . ALA C  1 193 ? 123.604 57.230  3.789   1.00 59.10  ? 192  ALA C N     1 
ATOM   4406 C  CA    . ALA C  1 193 ? 123.108 57.124  5.167   1.00 60.19  ? 192  ALA C CA    1 
ATOM   4407 C  C     . ALA C  1 193 ? 123.163 55.690  5.725   1.00 59.98  ? 192  ALA C C     1 
ATOM   4408 O  O     . ALA C  1 193 ? 123.531 55.490  6.890   1.00 61.42  ? 192  ALA C O     1 
ATOM   4409 C  CB    . ALA C  1 193 ? 121.682 57.669  5.264   1.00 61.55  ? 192  ALA C CB    1 
ATOM   4410 N  N     . ILE C  1 194 ? 122.807 54.708  4.898   1.00 57.07  ? 193  ILE C N     1 
ATOM   4411 C  CA    . ILE C  1 194 ? 122.850 53.298  5.310   1.00 58.88  ? 193  ILE C CA    1 
ATOM   4412 C  C     . ILE C  1 194 ? 124.287 52.790  5.433   1.00 59.07  ? 193  ILE C C     1 
ATOM   4413 O  O     . ILE C  1 194 ? 124.673 52.240  6.461   1.00 59.87  ? 193  ILE C O     1 
ATOM   4414 C  CB    . ILE C  1 194 ? 122.040 52.397  4.344   1.00 56.76  ? 193  ILE C CB    1 
ATOM   4415 C  CG1   . ILE C  1 194 ? 120.549 52.696  4.485   1.00 61.57  ? 193  ILE C CG1   1 
ATOM   4416 C  CG2   . ILE C  1 194 ? 122.256 50.924  4.651   1.00 55.56  ? 193  ILE C CG2   1 
ATOM   4417 C  CD1   . ILE C  1 194 ? 119.735 52.193  3.339   1.00 62.77  ? 193  ILE C CD1   1 
ATOM   4418 N  N     . ASP C  1 195 ? 125.075 52.974  4.383   1.00 58.89  ? 194  ASP C N     1 
ATOM   4419 C  CA    . ASP C  1 195 ? 126.485 52.571  4.403   1.00 58.35  ? 194  ASP C CA    1 
ATOM   4420 C  C     . ASP C  1 195 ? 127.235 53.239  5.553   1.00 58.63  ? 194  ASP C C     1 
ATOM   4421 O  O     . ASP C  1 195 ? 128.097 52.622  6.189   1.00 60.36  ? 194  ASP C O     1 
ATOM   4422 C  CB    . ASP C  1 195 ? 127.161 52.933  3.080   1.00 59.86  ? 194  ASP C CB    1 
ATOM   4423 C  CG    . ASP C  1 195 ? 126.623 52.137  1.910   1.00 62.46  ? 194  ASP C CG    1 
ATOM   4424 O  OD1   . ASP C  1 195 ? 125.938 51.121  2.150   1.00 59.89  ? 194  ASP C OD1   1 
ATOM   4425 O  OD2   . ASP C  1 195 ? 126.892 52.533  0.754   1.00 57.99  ? 194  ASP C OD2   1 
ATOM   4426 N  N     . SER C  1 196 ? 126.892 54.503  5.798   1.00 60.26  ? 195  SER C N     1 
ATOM   4427 C  CA    . SER C  1 196 ? 127.437 55.302  6.900   1.00 62.78  ? 195  SER C CA    1 
ATOM   4428 C  C     . SER C  1 196 ? 127.324 54.623  8.265   1.00 62.69  ? 195  SER C C     1 
ATOM   4429 O  O     . SER C  1 196 ? 128.155 54.849  9.143   1.00 62.30  ? 195  SER C O     1 
ATOM   4430 C  CB    . SER C  1 196 ? 126.732 56.675  6.943   1.00 66.88  ? 195  SER C CB    1 
ATOM   4431 O  OG    . SER C  1 196 ? 126.696 57.232  8.247   1.00 73.61  ? 195  SER C OG    1 
ATOM   4432 N  N     . ILE C  1 197 ? 126.300 53.795  8.446   1.00 63.63  ? 196  ILE C N     1 
ATOM   4433 C  CA    . ILE C  1 197 ? 126.027 53.204  9.754   1.00 65.00  ? 196  ILE C CA    1 
ATOM   4434 C  C     . ILE C  1 197 ? 126.407 51.709  9.849   1.00 62.71  ? 196  ILE C C     1 
ATOM   4435 O  O     . ILE C  1 197 ? 126.595 51.186  10.951  1.00 59.76  ? 196  ILE C O     1 
ATOM   4436 C  CB    . ILE C  1 197 ? 124.550 53.517  10.136  1.00 66.86  ? 196  ILE C CB    1 
ATOM   4437 C  CG1   . ILE C  1 197 ? 124.394 55.048  10.180  1.00 73.11  ? 196  ILE C CG1   1 
ATOM   4438 C  CG2   . ILE C  1 197 ? 124.146 52.877  11.470  1.00 68.32  ? 196  ILE C CG2   1 
ATOM   4439 C  CD1   . ILE C  1 197 ? 123.025 55.546  10.528  1.00 81.38  ? 196  ILE C CD1   1 
ATOM   4440 N  N     . PHE C  1 198 ? 126.569 51.042  8.705   1.00 61.83  ? 197  PHE C N     1 
ATOM   4441 C  CA    . PHE C  1 198 ? 126.794 49.597  8.671   1.00 59.72  ? 197  PHE C CA    1 
ATOM   4442 C  C     . PHE C  1 198 ? 127.972 49.243  7.774   1.00 56.13  ? 197  PHE C C     1 
ATOM   4443 O  O     . PHE C  1 198 ? 129.036 48.864  8.262   1.00 56.01  ? 197  PHE C O     1 
ATOM   4444 C  CB    . PHE C  1 198 ? 125.534 48.883  8.172   1.00 63.77  ? 197  PHE C CB    1 
ATOM   4445 C  CG    . PHE C  1 198 ? 124.281 49.210  8.964   1.00 70.25  ? 197  PHE C CG    1 
ATOM   4446 C  CD1   . PHE C  1 198 ? 123.537 50.359  8.682   1.00 58.87  ? 197  PHE C CD1   1 
ATOM   4447 C  CD2   . PHE C  1 198 ? 123.838 48.362  9.981   1.00 74.68  ? 197  PHE C CD2   1 
ATOM   4448 C  CE1   . PHE C  1 198 ? 122.383 50.670  9.401   1.00 53.03  ? 197  PHE C CE1   1 
ATOM   4449 C  CE2   . PHE C  1 198 ? 122.684 48.661  10.710  1.00 67.88  ? 197  PHE C CE2   1 
ATOM   4450 C  CZ    . PHE C  1 198 ? 121.958 49.822  10.419  1.00 69.61  ? 197  PHE C CZ    1 
ATOM   4451 N  N     . MET D  1 6   ? 134.310 -1.719  -12.277 1.00 73.00  ? 5    MET D N     1 
ATOM   4452 C  CA    . MET D  1 6   ? 133.010 -2.422  -12.053 1.00 72.64  ? 5    MET D CA    1 
ATOM   4453 C  C     . MET D  1 6   ? 132.971 -3.784  -12.763 1.00 71.54  ? 5    MET D C     1 
ATOM   4454 O  O     . MET D  1 6   ? 132.797 -4.822  -12.118 1.00 66.52  ? 5    MET D O     1 
ATOM   4455 C  CB    . MET D  1 6   ? 131.847 -1.542  -12.533 1.00 71.24  ? 5    MET D CB    1 
ATOM   4456 N  N     . GLU D  1 7   ? 133.145 -3.756  -14.087 1.00 72.00  ? 6    GLU D N     1 
ATOM   4457 C  CA    . GLU D  1 7   ? 133.070 -4.951  -14.949 1.00 69.36  ? 6    GLU D CA    1 
ATOM   4458 C  C     . GLU D  1 7   ? 134.229 -5.931  -14.730 1.00 66.76  ? 6    GLU D C     1 
ATOM   4459 O  O     . GLU D  1 7   ? 134.033 -7.151  -14.762 1.00 63.02  ? 6    GLU D O     1 
ATOM   4460 C  CB    . GLU D  1 7   ? 133.029 -4.532  -16.426 1.00 68.27  ? 6    GLU D CB    1 
ATOM   4461 N  N     . ASP D  1 8   ? 135.430 -5.387  -14.531 1.00 66.17  ? 7    ASP D N     1 
ATOM   4462 C  CA    . ASP D  1 8   ? 136.605 -6.180  -14.158 1.00 65.83  ? 7    ASP D CA    1 
ATOM   4463 C  C     . ASP D  1 8   ? 136.416 -6.810  -12.775 1.00 64.82  ? 7    ASP D C     1 
ATOM   4464 O  O     . ASP D  1 8   ? 136.717 -7.989  -12.580 1.00 61.54  ? 7    ASP D O     1 
ATOM   4465 C  CB    . ASP D  1 8   ? 137.868 -5.309  -14.167 1.00 64.56  ? 7    ASP D CB    1 
ATOM   4466 N  N     . LEU D  1 9   ? 135.910 -6.017  -11.828 1.00 65.79  ? 8    LEU D N     1 
ATOM   4467 C  CA    . LEU D  1 9   ? 135.624 -6.496  -10.473 1.00 67.92  ? 8    LEU D CA    1 
ATOM   4468 C  C     . LEU D  1 9   ? 134.414 -7.441  -10.418 1.00 66.53  ? 8    LEU D C     1 
ATOM   4469 O  O     . LEU D  1 9   ? 134.281 -8.221  -9.473  1.00 65.43  ? 8    LEU D O     1 
ATOM   4470 C  CB    . LEU D  1 9   ? 135.400 -5.314  -9.520  1.00 68.00  ? 8    LEU D CB    1 
ATOM   4471 N  N     . ARG D  1 10  ? 133.535 -7.362  -11.419 1.00 66.61  ? 9    ARG D N     1 
ATOM   4472 C  CA    . ARG D  1 10  ? 132.371 -8.248  -11.506 1.00 67.65  ? 9    ARG D CA    1 
ATOM   4473 C  C     . ARG D  1 10  ? 132.732 -9.625  -12.079 1.00 68.71  ? 9    ARG D C     1 
ATOM   4474 O  O     . ARG D  1 10  ? 131.976 -10.583 -11.906 1.00 70.73  ? 9    ARG D O     1 
ATOM   4475 C  CB    . ARG D  1 10  ? 131.273 -7.600  -12.357 1.00 65.96  ? 9    ARG D CB    1 
ATOM   4476 N  N     . LYS D  1 11  ? 133.886 -9.719  -12.745 1.00 67.73  ? 10   LYS D N     1 
ATOM   4477 C  CA    . LYS D  1 11  ? 134.300 -10.942 -13.442 1.00 67.75  ? 10   LYS D CA    1 
ATOM   4478 C  C     . LYS D  1 11  ? 135.615 -11.521 -12.908 1.00 68.20  ? 10   LYS D C     1 
ATOM   4479 O  O     . LYS D  1 11  ? 136.566 -11.709 -13.667 1.00 69.43  ? 10   LYS D O     1 
ATOM   4480 C  CB    . LYS D  1 11  ? 134.431 -10.659 -14.946 1.00 67.35  ? 10   LYS D CB    1 
ATOM   4481 N  N     . CYS D  1 12  ? 135.670 -11.807 -11.608 1.00 69.23  ? 11   CYS D N     1 
ATOM   4482 C  CA    . CYS D  1 12  ? 136.849 -12.458 -11.017 1.00 67.74  ? 11   CYS D CA    1 
ATOM   4483 C  C     . CYS D  1 12  ? 136.510 -13.324 -9.789  1.00 62.32  ? 11   CYS D C     1 
ATOM   4484 O  O     . CYS D  1 12  ? 135.406 -13.248 -9.243  1.00 59.54  ? 11   CYS D O     1 
ATOM   4485 C  CB    . CYS D  1 12  ? 137.911 -11.417 -10.658 1.00 68.40  ? 11   CYS D CB    1 
ATOM   4486 S  SG    . CYS D  1 12  ? 137.657 -10.628 -9.067  1.00 79.15  ? 11   CYS D SG    1 
ATOM   4487 N  N     . LYS D  1 13  ? 137.479 -14.134 -9.361  1.00 57.59  ? 12   LYS D N     1 
ATOM   4488 C  CA    . LYS D  1 13  ? 137.246 -15.165 -8.346  1.00 56.61  ? 12   LYS D CA    1 
ATOM   4489 C  C     . LYS D  1 13  ? 137.082 -14.581 -6.945  1.00 55.87  ? 12   LYS D C     1 
ATOM   4490 O  O     . LYS D  1 13  ? 138.008 -13.971 -6.405  1.00 53.01  ? 12   LYS D O     1 
ATOM   4491 C  CB    . LYS D  1 13  ? 138.392 -16.182 -8.344  1.00 54.27  ? 12   LYS D CB    1 
ATOM   4492 N  N     . ILE D  1 14  ? 135.892 -14.766 -6.371  1.00 53.85  ? 13   ILE D N     1 
ATOM   4493 C  CA    . ILE D  1 14  ? 135.621 -14.399 -4.979  1.00 53.40  ? 13   ILE D CA    1 
ATOM   4494 C  C     . ILE D  1 14  ? 134.869 -15.546 -4.293  1.00 52.08  ? 13   ILE D C     1 
ATOM   4495 O  O     . ILE D  1 14  ? 133.865 -16.033 -4.813  1.00 50.20  ? 13   ILE D O     1 
ATOM   4496 C  CB    . ILE D  1 14  ? 134.826 -13.049 -4.861  1.00 54.35  ? 13   ILE D CB    1 
ATOM   4497 C  CG1   . ILE D  1 14  ? 133.307 -13.268 -4.919  1.00 57.24  ? 13   ILE D CG1   1 
ATOM   4498 C  CG2   . ILE D  1 14  ? 135.268 -12.050 -5.949  1.00 52.39  ? 13   ILE D CG2   1 
ATOM   4499 C  CD1   . ILE D  1 14  ? 132.492 -11.993 -5.039  1.00 57.98  ? 13   ILE D CD1   1 
ATOM   4500 N  N     . ILE D  1 15  ? 135.374 -15.988 -3.142  1.00 53.94  ? 14   ILE D N     1 
ATOM   4501 C  CA    . ILE D  1 15  ? 134.705 -17.013 -2.334  1.00 53.91  ? 14   ILE D CA    1 
ATOM   4502 C  C     . ILE D  1 15  ? 134.469 -16.476 -0.918  1.00 52.98  ? 14   ILE D C     1 
ATOM   4503 O  O     . ILE D  1 15  ? 135.354 -15.853 -0.319  1.00 51.24  ? 14   ILE D O     1 
ATOM   4504 C  CB    . ILE D  1 15  ? 135.513 -18.344 -2.281  1.00 50.54  ? 14   ILE D CB    1 
ATOM   4505 N  N     . PHE D  1 16  ? 133.255 -16.685 -0.408  1.00 54.76  ? 15   PHE D N     1 
ATOM   4506 C  CA    . PHE D  1 16  ? 132.927 -16.374 0.984   1.00 54.15  ? 15   PHE D CA    1 
ATOM   4507 C  C     . PHE D  1 16  ? 133.230 -17.600 1.844   1.00 54.45  ? 15   PHE D C     1 
ATOM   4508 O  O     . PHE D  1 16  ? 133.050 -18.745 1.405   1.00 50.57  ? 15   PHE D O     1 
ATOM   4509 C  CB    . PHE D  1 16  ? 131.440 -16.017 1.158   1.00 55.66  ? 15   PHE D CB    1 
ATOM   4510 C  CG    . PHE D  1 16  ? 131.010 -14.709 0.512   1.00 57.87  ? 15   PHE D CG    1 
ATOM   4511 C  CD1   . PHE D  1 16  ? 129.674 -14.323 0.573   1.00 55.04  ? 15   PHE D CD1   1 
ATOM   4512 C  CD2   . PHE D  1 16  ? 131.912 -13.872 -0.151  1.00 58.26  ? 15   PHE D CD2   1 
ATOM   4513 C  CE1   . PHE D  1 16  ? 129.241 -13.126 -0.003  1.00 58.27  ? 15   PHE D CE1   1 
ATOM   4514 C  CE2   . PHE D  1 16  ? 131.480 -12.674 -0.730  1.00 63.16  ? 15   PHE D CE2   1 
ATOM   4515 C  CZ    . PHE D  1 16  ? 130.142 -12.306 -0.652  1.00 55.36  ? 15   PHE D CZ    1 
ATOM   4516 N  N     . ILE D  1 17  ? 133.682 -17.347 3.069   1.00 55.99  ? 16   ILE D N     1 
ATOM   4517 C  CA    . ILE D  1 17  ? 133.872 -18.409 4.055   1.00 58.10  ? 16   ILE D CA    1 
ATOM   4518 C  C     . ILE D  1 17  ? 133.197 -18.044 5.383   1.00 57.32  ? 16   ILE D C     1 
ATOM   4519 O  O     . ILE D  1 17  ? 133.418 -16.966 5.938   1.00 58.34  ? 16   ILE D O     1 
ATOM   4520 C  CB    . ILE D  1 17  ? 135.368 -18.794 4.246   1.00 60.57  ? 16   ILE D CB    1 
ATOM   4521 C  CG1   . ILE D  1 17  ? 135.490 -19.950 5.256   1.00 64.17  ? 16   ILE D CG1   1 
ATOM   4522 C  CG2   . ILE D  1 17  ? 136.207 -17.589 4.663   1.00 55.92  ? 16   ILE D CG2   1 
ATOM   4523 C  CD1   . ILE D  1 17  ? 136.871 -20.542 5.359   1.00 61.88  ? 16   ILE D CD1   1 
ATOM   4524 N  N     . ILE D  1 18  ? 132.369 -18.967 5.866   1.00 58.15  ? 17   ILE D N     1 
ATOM   4525 C  CA    . ILE D  1 18  ? 131.484 -18.748 7.003   1.00 60.03  ? 17   ILE D CA    1 
ATOM   4526 C  C     . ILE D  1 18  ? 131.680 -19.874 8.019   1.00 59.37  ? 17   ILE D C     1 
ATOM   4527 O  O     . ILE D  1 18  ? 131.697 -21.048 7.651   1.00 57.36  ? 17   ILE D O     1 
ATOM   4528 C  CB    . ILE D  1 18  ? 130.013 -18.721 6.536   1.00 59.81  ? 17   ILE D CB    1 
ATOM   4529 C  CG1   . ILE D  1 18  ? 129.852 -17.743 5.369   1.00 71.75  ? 17   ILE D CG1   1 
ATOM   4530 C  CG2   . ILE D  1 18  ? 129.092 -18.313 7.673   1.00 67.48  ? 17   ILE D CG2   1 
ATOM   4531 C  CD1   . ILE D  1 18  ? 128.490 -17.775 4.711   1.00 83.09  ? 17   ILE D CD1   1 
ATOM   4532 N  N     . GLY D  1 19  ? 131.824 -19.521 9.293   1.00 56.88  ? 18   GLY D N     1 
ATOM   4533 C  CA    . GLY D  1 19  ? 132.028 -20.531 10.323  1.00 56.84  ? 18   GLY D CA    1 
ATOM   4534 C  C     . GLY D  1 19  ? 132.032 -19.986 11.737  1.00 55.35  ? 18   GLY D C     1 
ATOM   4535 O  O     . GLY D  1 19  ? 132.585 -18.922 11.997  1.00 55.17  ? 18   GLY D O     1 
ATOM   4536 N  N     . GLY D  1 20  ? 131.445 -20.742 12.660  1.00 56.02  ? 19   GLY D N     1 
ATOM   4537 C  CA    . GLY D  1 20  ? 131.298 -20.296 14.039  1.00 55.97  ? 19   GLY D CA    1 
ATOM   4538 C  C     . GLY D  1 20  ? 132.613 -20.068 14.760  1.00 55.09  ? 19   GLY D C     1 
ATOM   4539 O  O     . GLY D  1 20  ? 133.668 -20.534 14.313  1.00 56.06  ? 19   GLY D O     1 
ATOM   4540 N  N     . PRO D  1 21  ? 132.566 -19.327 15.876  1.00 55.47  ? 20   PRO D N     1 
ATOM   4541 C  CA    . PRO D  1 21  ? 133.761 -19.230 16.711  1.00 57.33  ? 20   PRO D CA    1 
ATOM   4542 C  C     . PRO D  1 21  ? 134.246 -20.619 17.138  1.00 54.64  ? 20   PRO D C     1 
ATOM   4543 O  O     . PRO D  1 21  ? 133.452 -21.430 17.604  1.00 55.79  ? 20   PRO D O     1 
ATOM   4544 C  CB    . PRO D  1 21  ? 133.295 -18.385 17.911  1.00 61.09  ? 20   PRO D CB    1 
ATOM   4545 C  CG    . PRO D  1 21  ? 131.806 -18.320 17.826  1.00 54.80  ? 20   PRO D CG    1 
ATOM   4546 C  CD    . PRO D  1 21  ? 131.442 -18.538 16.409  1.00 55.76  ? 20   PRO D CD    1 
ATOM   4547 N  N     . GLY D  1 22  ? 135.527 -20.901 16.929  1.00 55.59  ? 21   GLY D N     1 
ATOM   4548 C  CA    . GLY D  1 22  ? 136.082 -22.206 17.259  1.00 55.73  ? 21   GLY D CA    1 
ATOM   4549 C  C     . GLY D  1 22  ? 135.695 -23.320 16.292  1.00 58.27  ? 21   GLY D C     1 
ATOM   4550 O  O     . GLY D  1 22  ? 135.731 -24.500 16.655  1.00 58.24  ? 21   GLY D O     1 
ATOM   4551 N  N     . SER D  1 23  ? 135.329 -22.954 15.067  1.00 57.31  ? 22   SER D N     1 
ATOM   4552 C  CA    . SER D  1 23  ? 135.131 -23.924 13.998  1.00 56.74  ? 22   SER D CA    1 
ATOM   4553 C  C     . SER D  1 23  ? 136.451 -24.274 13.286  1.00 58.02  ? 22   SER D C     1 
ATOM   4554 O  O     . SER D  1 23  ? 136.484 -25.185 12.452  1.00 61.93  ? 22   SER D O     1 
ATOM   4555 C  CB    . SER D  1 23  ? 134.101 -23.406 12.980  1.00 57.92  ? 22   SER D CB    1 
ATOM   4556 O  OG    . SER D  1 23  ? 134.503 -22.159 12.429  1.00 53.59  ? 22   SER D OG    1 
ATOM   4557 N  N     . GLY D  1 24  ? 137.530 -23.565 13.618  1.00 56.38  ? 23   GLY D N     1 
ATOM   4558 C  CA    . GLY D  1 24  ? 138.831 -23.771 12.983  1.00 55.41  ? 23   GLY D CA    1 
ATOM   4559 C  C     . GLY D  1 24  ? 138.964 -23.019 11.670  1.00 58.56  ? 23   GLY D C     1 
ATOM   4560 O  O     . GLY D  1 24  ? 139.750 -23.401 10.808  1.00 61.50  ? 23   GLY D O     1 
ATOM   4561 N  N     . LYS D  1 25  ? 138.199 -21.939 11.530  1.00 58.94  ? 24   LYS D N     1 
ATOM   4562 C  CA    . LYS D  1 25  ? 138.162 -21.139 10.312  1.00 58.49  ? 24   LYS D CA    1 
ATOM   4563 C  C     . LYS D  1 25  ? 139.439 -20.327 10.171  1.00 59.12  ? 24   LYS D C     1 
ATOM   4564 O  O     . LYS D  1 25  ? 140.112 -20.387 9.139   1.00 60.15  ? 24   LYS D O     1 
ATOM   4565 C  CB    . LYS D  1 25  ? 136.950 -20.204 10.361  1.00 54.50  ? 24   LYS D CB    1 
ATOM   4566 C  CG    . LYS D  1 25  ? 136.703 -19.402 9.092   1.00 61.48  ? 24   LYS D CG    1 
ATOM   4567 C  CD    . LYS D  1 25  ? 135.316 -18.752 9.112   1.00 61.23  ? 24   LYS D CD    1 
ATOM   4568 C  CE    . LYS D  1 25  ? 135.223 -17.603 10.103  1.00 65.21  ? 24   LYS D CE    1 
ATOM   4569 N  NZ    . LYS D  1 25  ? 134.939 -16.313 9.418   1.00 74.00  ? 24   LYS D NZ    1 
ATOM   4570 N  N     . GLY D  1 26  ? 139.762 -19.579 11.225  1.00 61.41  ? 25   GLY D N     1 
ATOM   4571 C  CA    . GLY D  1 26  ? 140.948 -18.738 11.266  1.00 60.01  ? 25   GLY D CA    1 
ATOM   4572 C  C     . GLY D  1 26  ? 142.179 -19.501 10.843  1.00 61.40  ? 25   GLY D C     1 
ATOM   4573 O  O     . GLY D  1 26  ? 142.890 -19.081 9.928   1.00 63.42  ? 25   GLY D O     1 
ATOM   4574 N  N     . THR D  1 27  ? 142.415 -20.637 11.495  1.00 62.09  ? 26   THR D N     1 
ATOM   4575 C  CA    . THR D  1 27  ? 143.564 -21.495 11.170  1.00 61.75  ? 26   THR D CA    1 
ATOM   4576 C  C     . THR D  1 27  ? 143.516 -21.987 9.703   1.00 60.15  ? 26   THR D C     1 
ATOM   4577 O  O     . THR D  1 27  ? 144.544 -22.032 9.014   1.00 57.92  ? 26   THR D O     1 
ATOM   4578 C  CB    . THR D  1 27  ? 143.768 -22.703 12.192  1.00 63.46  ? 26   THR D CB    1 
ATOM   4579 O  OG1   . THR D  1 27  ? 143.920 -23.937 11.477  1.00 70.58  ? 26   THR D OG1   1 
ATOM   4580 C  CG2   . THR D  1 27  ? 142.614 -22.869 13.204  1.00 67.03  ? 26   THR D CG2   1 
ATOM   4581 N  N     . GLN D  1 28  ? 142.322 -22.325 9.224   1.00 58.95  ? 27   GLN D N     1 
ATOM   4582 C  CA    . GLN D  1 28  ? 142.153 -22.820 7.860   1.00 57.46  ? 27   GLN D CA    1 
ATOM   4583 C  C     . GLN D  1 28  ? 142.375 -21.749 6.793   1.00 56.42  ? 27   GLN D C     1 
ATOM   4584 O  O     . GLN D  1 28  ? 142.954 -22.033 5.745   1.00 57.07  ? 27   GLN D O     1 
ATOM   4585 C  CB    . GLN D  1 28  ? 140.768 -23.461 7.690   1.00 55.97  ? 27   GLN D CB    1 
ATOM   4586 C  CG    . GLN D  1 28  ? 140.640 -24.844 8.327   1.00 58.92  ? 27   GLN D CG    1 
ATOM   4587 C  CD    . GLN D  1 28  ? 141.579 -25.876 7.717   1.00 60.70  ? 27   GLN D CD    1 
ATOM   4588 O  OE1   . GLN D  1 28  ? 142.031 -25.730 6.580   1.00 64.98  ? 27   GLN D OE1   1 
ATOM   4589 N  NE2   . GLN D  1 28  ? 141.889 -26.918 8.482   1.00 58.06  ? 27   GLN D NE2   1 
ATOM   4590 N  N     . CYS D  1 29  ? 141.919 -20.526 7.054   1.00 57.45  ? 28   CYS D N     1 
ATOM   4591 C  CA    . CYS D  1 29  ? 142.104 -19.426 6.107   1.00 58.13  ? 28   CYS D CA    1 
ATOM   4592 C  C     . CYS D  1 29  ? 143.584 -19.111 5.865   1.00 58.17  ? 28   CYS D C     1 
ATOM   4593 O  O     . CYS D  1 29  ? 143.972 -18.782 4.742   1.00 59.11  ? 28   CYS D O     1 
ATOM   4594 C  CB    . CYS D  1 29  ? 141.392 -18.165 6.591   1.00 61.01  ? 28   CYS D CB    1 
ATOM   4595 S  SG    . CYS D  1 29  ? 139.596 -18.284 6.677   1.00 59.96  ? 28   CYS D SG    1 
ATOM   4596 N  N     . GLU D  1 30  ? 144.397 -19.206 6.917   1.00 58.57  ? 29   GLU D N     1 
ATOM   4597 C  CA    . GLU D  1 30  ? 145.850 -19.011 6.808   1.00 61.38  ? 29   GLU D CA    1 
ATOM   4598 C  C     . GLU D  1 30  ? 146.497 -20.063 5.888   1.00 60.20  ? 29   GLU D C     1 
ATOM   4599 O  O     . GLU D  1 30  ? 147.398 -19.756 5.095   1.00 59.29  ? 29   GLU D O     1 
ATOM   4600 C  CB    . GLU D  1 30  ? 146.497 -19.066 8.198   1.00 61.07  ? 29   GLU D CB    1 
ATOM   4601 C  CG    . GLU D  1 30  ? 146.089 -17.920 9.139   1.00 71.81  ? 29   GLU D CG    1 
ATOM   4602 C  CD    . GLU D  1 30  ? 146.385 -18.206 10.616  1.00 69.71  ? 29   GLU D CD    1 
ATOM   4603 O  OE1   . GLU D  1 30  ? 146.449 -19.394 11.004  1.00 76.66  ? 29   GLU D OE1   1 
ATOM   4604 O  OE2   . GLU D  1 30  ? 146.542 -17.236 11.393  1.00 71.44  ? 29   GLU D OE2   1 
ATOM   4605 N  N     . LYS D  1 31  ? 146.030 -21.302 6.003   1.00 57.73  ? 30   LYS D N     1 
ATOM   4606 C  CA    . LYS D  1 31  ? 146.489 -22.381 5.135   1.00 57.66  ? 30   LYS D CA    1 
ATOM   4607 C  C     . LYS D  1 31  ? 146.051 -22.139 3.689   1.00 56.00  ? 30   LYS D C     1 
ATOM   4608 O  O     . LYS D  1 31  ? 146.802 -22.429 2.762   1.00 58.35  ? 30   LYS D O     1 
ATOM   4609 C  CB    . LYS D  1 31  ? 145.968 -23.738 5.635   1.00 56.52  ? 30   LYS D CB    1 
ATOM   4610 N  N     . LEU D  1 32  ? 144.842 -21.606 3.510   1.00 57.44  ? 31   LEU D N     1 
ATOM   4611 C  CA    . LEU D  1 32  ? 144.307 -21.285 2.176   1.00 57.50  ? 31   LEU D CA    1 
ATOM   4612 C  C     . LEU D  1 32  ? 145.017 -20.089 1.539   1.00 56.70  ? 31   LEU D C     1 
ATOM   4613 O  O     . LEU D  1 32  ? 145.174 -20.025 0.315   1.00 57.58  ? 31   LEU D O     1 
ATOM   4614 C  CB    . LEU D  1 32  ? 142.799 -21.003 2.249   1.00 56.75  ? 31   LEU D CB    1 
ATOM   4615 C  CG    . LEU D  1 32  ? 141.899 -22.213 2.522   1.00 58.58  ? 31   LEU D CG    1 
ATOM   4616 C  CD1   . LEU D  1 32  ? 140.473 -21.780 2.849   1.00 60.29  ? 31   LEU D CD1   1 
ATOM   4617 C  CD2   . LEU D  1 32  ? 141.912 -23.171 1.341   1.00 56.27  ? 31   LEU D CD2   1 
ATOM   4618 N  N     . VAL D  1 33  ? 145.423 -19.138 2.374   1.00 56.95  ? 32   VAL D N     1 
ATOM   4619 C  CA    . VAL D  1 33  ? 146.227 -18.008 1.923   1.00 56.87  ? 32   VAL D CA    1 
ATOM   4620 C  C     . VAL D  1 33  ? 147.563 -18.529 1.383   1.00 57.79  ? 32   VAL D C     1 
ATOM   4621 O  O     . VAL D  1 33  ? 147.929 -18.247 0.240   1.00 58.99  ? 32   VAL D O     1 
ATOM   4622 C  CB    . VAL D  1 33  ? 146.437 -16.969 3.069   1.00 57.39  ? 32   VAL D CB    1 
ATOM   4623 C  CG1   . VAL D  1 33  ? 147.605 -16.021 2.774   1.00 57.19  ? 32   VAL D CG1   1 
ATOM   4624 C  CG2   . VAL D  1 33  ? 145.148 -16.177 3.310   1.00 53.42  ? 32   VAL D CG2   1 
ATOM   4625 N  N     . GLU D  1 34  ? 148.265 -19.317 2.194   1.00 56.84  ? 33   GLU D N     1 
ATOM   4626 C  CA    . GLU D  1 34  ? 149.585 -19.823 1.821   1.00 56.77  ? 33   GLU D CA    1 
ATOM   4627 C  C     . GLU D  1 34  ? 149.545 -20.859 0.684   1.00 57.34  ? 33   GLU D C     1 
ATOM   4628 O  O     . GLU D  1 34  ? 150.553 -21.068 0.011   1.00 55.95  ? 33   GLU D O     1 
ATOM   4629 C  CB    . GLU D  1 34  ? 150.293 -20.415 3.046   1.00 57.70  ? 33   GLU D CB    1 
ATOM   4630 C  CG    . GLU D  1 34  ? 150.587 -19.405 4.151   1.00 59.42  ? 33   GLU D CG    1 
ATOM   4631 N  N     . LYS D  1 35  ? 148.388 -21.490 0.465   1.00 56.66  ? 34   LYS D N     1 
ATOM   4632 C  CA    . LYS D  1 35  ? 148.259 -22.580 -0.514  1.00 54.68  ? 34   LYS D CA    1 
ATOM   4633 C  C     . LYS D  1 35  ? 147.535 -22.210 -1.807  1.00 53.74  ? 34   LYS D C     1 
ATOM   4634 O  O     . LYS D  1 35  ? 147.464 -23.031 -2.719  1.00 52.72  ? 34   LYS D O     1 
ATOM   4635 C  CB    . LYS D  1 35  ? 147.542 -23.769 0.119   1.00 55.75  ? 34   LYS D CB    1 
ATOM   4636 N  N     . TYR D  1 36  ? 146.976 -21.006 -1.885  1.00 52.45  ? 35   TYR D N     1 
ATOM   4637 C  CA    . TYR D  1 36  ? 146.414 -20.517 -3.146  1.00 51.13  ? 35   TYR D CA    1 
ATOM   4638 C  C     . TYR D  1 36  ? 146.547 -18.993 -3.352  1.00 52.01  ? 35   TYR D C     1 
ATOM   4639 O  O     . TYR D  1 36  ? 145.929 -18.436 -4.259  1.00 53.11  ? 35   TYR D O     1 
ATOM   4640 C  CB    . TYR D  1 36  ? 144.954 -20.965 -3.269  1.00 49.98  ? 35   TYR D CB    1 
ATOM   4641 N  N     . GLY D  1 37  ? 147.360 -18.330 -2.528  1.00 51.66  ? 36   GLY D N     1 
ATOM   4642 C  CA    . GLY D  1 37  ? 147.681 -16.907 -2.702  1.00 53.91  ? 36   GLY D CA    1 
ATOM   4643 C  C     . GLY D  1 37  ? 146.522 -15.916 -2.690  1.00 56.31  ? 36   GLY D C     1 
ATOM   4644 O  O     . GLY D  1 37  ? 146.631 -14.822 -3.254  1.00 55.80  ? 36   GLY D O     1 
ATOM   4645 N  N     . PHE D  1 38  ? 145.422 -16.281 -2.036  1.00 57.17  ? 37   PHE D N     1 
ATOM   4646 C  CA    . PHE D  1 38  ? 144.218 -15.444 -2.015  1.00 55.40  ? 37   PHE D CA    1 
ATOM   4647 C  C     . PHE D  1 38  ? 144.402 -14.163 -1.219  1.00 54.80  ? 37   PHE D C     1 
ATOM   4648 O  O     . PHE D  1 38  ? 145.266 -14.079 -0.345  1.00 54.31  ? 37   PHE D O     1 
ATOM   4649 C  CB    . PHE D  1 38  ? 143.032 -16.219 -1.431  1.00 56.69  ? 37   PHE D CB    1 
ATOM   4650 C  CG    . PHE D  1 38  ? 142.322 -17.076 -2.431  1.00 57.08  ? 37   PHE D CG    1 
ATOM   4651 C  CD1   . PHE D  1 38  ? 142.825 -18.320 -2.781  1.00 60.10  ? 37   PHE D CD1   1 
ATOM   4652 C  CD2   . PHE D  1 38  ? 141.147 -16.640 -3.024  1.00 59.39  ? 37   PHE D CD2   1 
ATOM   4653 C  CE1   . PHE D  1 38  ? 142.166 -19.111 -3.708  1.00 60.01  ? 37   PHE D CE1   1 
ATOM   4654 C  CE2   . PHE D  1 38  ? 140.484 -17.427 -3.952  1.00 57.26  ? 37   PHE D CE2   1 
ATOM   4655 C  CZ    . PHE D  1 38  ? 140.992 -18.661 -4.292  1.00 58.21  ? 37   PHE D CZ    1 
ATOM   4656 N  N     . THR D  1 39  ? 143.577 -13.169 -1.537  1.00 53.98  ? 38   THR D N     1 
ATOM   4657 C  CA    . THR D  1 39  ? 143.466 -11.965 -0.719  1.00 56.80  ? 38   THR D CA    1 
ATOM   4658 C  C     . THR D  1 39  ? 142.417 -12.211 0.369   1.00 56.67  ? 38   THR D C     1 
ATOM   4659 O  O     . THR D  1 39  ? 141.216 -12.280 0.088   1.00 54.75  ? 38   THR D O     1 
ATOM   4660 C  CB    . THR D  1 39  ? 143.070 -10.723 -1.549  1.00 55.38  ? 38   THR D CB    1 
ATOM   4661 O  OG1   . THR D  1 39  ? 143.899 -10.633 -2.715  1.00 55.97  ? 38   THR D OG1   1 
ATOM   4662 C  CG2   . THR D  1 39  ? 143.230 -9.455  -0.721  1.00 53.68  ? 38   THR D CG2   1 
ATOM   4663 N  N     . HIS D  1 40  ? 142.895 -12.358 1.603   1.00 58.08  ? 39   HIS D N     1 
ATOM   4664 C  CA    . HIS D  1 40  ? 142.044 -12.590 2.770   1.00 57.21  ? 39   HIS D CA    1 
ATOM   4665 C  C     . HIS D  1 40  ? 141.501 -11.248 3.295   1.00 57.43  ? 39   HIS D C     1 
ATOM   4666 O  O     . HIS D  1 40  ? 142.279 -10.363 3.669   1.00 55.13  ? 39   HIS D O     1 
ATOM   4667 C  CB    . HIS D  1 40  ? 142.867 -13.294 3.857   1.00 57.96  ? 39   HIS D CB    1 
ATOM   4668 C  CG    . HIS D  1 40  ? 142.054 -13.861 4.979   1.00 57.81  ? 39   HIS D CG    1 
ATOM   4669 N  ND1   . HIS D  1 40  ? 142.601 -14.682 5.943   1.00 62.59  ? 39   HIS D ND1   1 
ATOM   4670 C  CD2   . HIS D  1 40  ? 140.741 -13.742 5.286   1.00 56.64  ? 39   HIS D CD2   1 
ATOM   4671 C  CE1   . HIS D  1 40  ? 141.662 -15.029 6.805   1.00 65.35  ? 39   HIS D CE1   1 
ATOM   4672 N  NE2   . HIS D  1 40  ? 140.523 -14.478 6.425   1.00 61.56  ? 39   HIS D NE2   1 
ATOM   4673 N  N     . LEU D  1 41  ? 140.173 -11.102 3.314   1.00 58.03  ? 40   LEU D N     1 
ATOM   4674 C  CA    . LEU D  1 41  ? 139.515 -9.884  3.828   1.00 57.56  ? 40   LEU D CA    1 
ATOM   4675 C  C     . LEU D  1 41  ? 138.428 -10.240 4.857   1.00 58.34  ? 40   LEU D C     1 
ATOM   4676 O  O     . LEU D  1 41  ? 137.678 -11.197 4.676   1.00 58.25  ? 40   LEU D O     1 
ATOM   4677 C  CB    . LEU D  1 41  ? 138.919 -9.052  2.679   1.00 52.74  ? 40   LEU D CB    1 
ATOM   4678 N  N     . SER D  1 42  ? 138.386 -9.484  5.953   1.00 58.42  ? 41   SER D N     1 
ATOM   4679 C  CA    . SER D  1 42  ? 137.303 -9.571  6.932   1.00 57.71  ? 41   SER D CA    1 
ATOM   4680 C  C     . SER D  1 42  ? 136.914 -8.153  7.307   1.00 56.94  ? 41   SER D C     1 
ATOM   4681 O  O     . SER D  1 42  ? 137.749 -7.248  7.253   1.00 56.06  ? 41   SER D O     1 
ATOM   4682 C  CB    . SER D  1 42  ? 137.718 -10.377 8.175   1.00 56.34  ? 41   SER D CB    1 
ATOM   4683 O  OG    . SER D  1 42  ? 138.832 -9.812  8.839   1.00 51.01  ? 41   SER D OG    1 
ATOM   4684 N  N     . THR D  1 43  ? 135.647 -7.958  7.670   1.00 56.65  ? 42   THR D N     1 
ATOM   4685 C  CA    . THR D  1 43  ? 135.157 -6.628  8.038   1.00 58.31  ? 42   THR D CA    1 
ATOM   4686 C  C     . THR D  1 43  ? 135.886 -6.087  9.272   1.00 56.05  ? 42   THR D C     1 
ATOM   4687 O  O     . THR D  1 43  ? 136.197 -4.899  9.329   1.00 59.19  ? 42   THR D O     1 
ATOM   4688 C  CB    . THR D  1 43  ? 133.631 -6.595  8.301   1.00 54.93  ? 42   THR D CB    1 
ATOM   4689 O  OG1   . THR D  1 43  ? 133.332 -7.297  9.511   1.00 69.90  ? 42   THR D OG1   1 
ATOM   4690 C  CG2   . THR D  1 43  ? 132.851 -7.206  7.145   1.00 54.98  ? 42   THR D CG2   1 
ATOM   4691 N  N     . GLY D  1 44  ? 136.160 -6.961  10.243  1.00 55.19  ? 43   GLY D N     1 
ATOM   4692 C  CA    . GLY D  1 44  ? 136.899 -6.588  11.444  1.00 54.60  ? 43   GLY D CA    1 
ATOM   4693 C  C     . GLY D  1 44  ? 138.237 -5.942  11.138  1.00 56.81  ? 43   GLY D C     1 
ATOM   4694 O  O     . GLY D  1 44  ? 138.607 -4.916  11.731  1.00 56.94  ? 43   GLY D O     1 
ATOM   4695 N  N     . GLU D  1 45  ? 138.966 -6.531  10.195  1.00 56.40  ? 44   GLU D N     1 
ATOM   4696 C  CA    . GLU D  1 45  ? 140.268 -5.997  9.822   1.00 56.77  ? 44   GLU D CA    1 
ATOM   4697 C  C     . GLU D  1 45  ? 140.105 -4.741  8.978   1.00 54.21  ? 44   GLU D C     1 
ATOM   4698 O  O     . GLU D  1 45  ? 140.873 -3.793  9.126   1.00 53.90  ? 44   GLU D O     1 
ATOM   4699 C  CB    . GLU D  1 45  ? 141.105 -7.053  9.088   1.00 59.47  ? 44   GLU D CB    1 
ATOM   4700 C  CG    . GLU D  1 45  ? 142.605 -6.764  9.082   1.00 68.21  ? 44   GLU D CG    1 
ATOM   4701 C  CD    . GLU D  1 45  ? 143.156 -6.521  10.475  1.00 71.27  ? 44   GLU D CD    1 
ATOM   4702 O  OE1   . GLU D  1 45  ? 142.758 -7.255  11.401  1.00 66.07  ? 44   GLU D OE1   1 
ATOM   4703 O  OE2   . GLU D  1 45  ? 143.969 -5.587  10.648  1.00 78.38  ? 44   GLU D OE2   1 
ATOM   4704 N  N     . LEU D  1 46  ? 139.093 -4.733  8.110   1.00 53.60  ? 45   LEU D N     1 
ATOM   4705 C  CA    . LEU D  1 46  ? 138.792 -3.565  7.275   1.00 56.10  ? 45   LEU D CA    1 
ATOM   4706 C  C     . LEU D  1 46  ? 138.464 -2.311  8.094   1.00 55.87  ? 45   LEU D C     1 
ATOM   4707 O  O     . LEU D  1 46  ? 138.895 -1.210  7.748   1.00 53.18  ? 45   LEU D O     1 
ATOM   4708 C  CB    . LEU D  1 46  ? 137.643 -3.873  6.309   1.00 57.78  ? 45   LEU D CB    1 
ATOM   4709 C  CG    . LEU D  1 46  ? 138.008 -4.707  5.077   1.00 54.17  ? 45   LEU D CG    1 
ATOM   4710 C  CD1   . LEU D  1 46  ? 136.755 -5.045  4.279   1.00 51.23  ? 45   LEU D CD1   1 
ATOM   4711 C  CD2   . LEU D  1 46  ? 139.024 -3.967  4.210   1.00 59.21  ? 45   LEU D CD2   1 
ATOM   4712 N  N     . LEU D  1 47  ? 137.699 -2.495  9.169   1.00 55.68  ? 46   LEU D N     1 
ATOM   4713 C  CA    . LEU D  1 47  ? 137.388 -1.419  10.103  1.00 55.69  ? 46   LEU D CA    1 
ATOM   4714 C  C     . LEU D  1 47  ? 138.624 -0.976  10.881  1.00 56.53  ? 46   LEU D C     1 
ATOM   4715 O  O     . LEU D  1 47  ? 138.867 0.226   11.010  1.00 57.19  ? 46   LEU D O     1 
ATOM   4716 C  CB    . LEU D  1 47  ? 136.288 -1.855  11.073  1.00 53.89  ? 46   LEU D CB    1 
ATOM   4717 C  CG    . LEU D  1 47  ? 134.912 -2.019  10.420  1.00 58.26  ? 46   LEU D CG    1 
ATOM   4718 C  CD1   . LEU D  1 47  ? 133.968 -2.815  11.311  1.00 63.10  ? 46   LEU D CD1   1 
ATOM   4719 C  CD2   . LEU D  1 47  ? 134.308 -0.662  10.090  1.00 65.16  ? 46   LEU D CD2   1 
ATOM   4720 N  N     . ARG D  1 48  ? 139.392 -1.942  11.393  1.00 55.66  ? 47   ARG D N     1 
ATOM   4721 C  CA    . ARG D  1 48  ? 140.652 -1.652  12.099  1.00 57.85  ? 47   ARG D CA    1 
ATOM   4722 C  C     . ARG D  1 48  ? 141.577 -0.787  11.225  1.00 57.05  ? 47   ARG D C     1 
ATOM   4723 O  O     . ARG D  1 48  ? 142.121 0.220   11.683  1.00 58.40  ? 47   ARG D O     1 
ATOM   4724 C  CB    . ARG D  1 48  ? 141.375 -2.957  12.523  1.00 57.52  ? 47   ARG D CB    1 
ATOM   4725 C  CG    . ARG D  1 48  ? 142.373 -2.801  13.690  1.00 64.20  ? 47   ARG D CG    1 
ATOM   4726 C  CD    . ARG D  1 48  ? 143.469 -3.885  13.708  1.00 52.94  ? 47   ARG D CD    1 
ATOM   4727 N  N     . GLU D  1 49  ? 141.736 -1.188  9.966   1.00 58.21  ? 48   GLU D N     1 
ATOM   4728 C  CA    . GLU D  1 49  ? 142.580 -0.455  9.021   1.00 60.60  ? 48   GLU D CA    1 
ATOM   4729 C  C     . GLU D  1 49  ? 142.069 0.966   8.812   1.00 58.31  ? 48   GLU D C     1 
ATOM   4730 O  O     . GLU D  1 49  ? 142.863 1.911   8.804   1.00 57.12  ? 48   GLU D O     1 
ATOM   4731 C  CB    . GLU D  1 49  ? 142.677 -1.190  7.672   1.00 60.86  ? 48   GLU D CB    1 
ATOM   4732 N  N     . GLU D  1 50  ? 140.752 1.119   8.661   1.00 58.69  ? 49   GLU D N     1 
ATOM   4733 C  CA    . GLU D  1 50  ? 140.154 2.449   8.433   1.00 58.74  ? 49   GLU D CA    1 
ATOM   4734 C  C     . GLU D  1 50  ? 140.266 3.354   9.657   1.00 57.03  ? 49   GLU D C     1 
ATOM   4735 O  O     . GLU D  1 50  ? 140.564 4.540   9.518   1.00 54.74  ? 49   GLU D O     1 
ATOM   4736 C  CB    . GLU D  1 50  ? 138.689 2.345   7.975   1.00 58.12  ? 49   GLU D CB    1 
ATOM   4737 C  CG    . GLU D  1 50  ? 137.989 3.696   7.663   1.00 62.69  ? 49   GLU D CG    1 
ATOM   4738 C  CD    . GLU D  1 50  ? 138.669 4.514   6.562   1.00 71.46  ? 49   GLU D CD    1 
ATOM   4739 O  OE1   . GLU D  1 50  ? 139.596 3.997   5.906   1.00 76.52  ? 49   GLU D OE1   1 
ATOM   4740 O  OE2   . GLU D  1 50  ? 138.273 5.681   6.340   1.00 70.07  ? 49   GLU D OE2   1 
ATOM   4741 N  N     . LEU D  1 51  ? 140.034 2.795   10.843  1.00 56.97  ? 50   LEU D N     1 
ATOM   4742 C  CA    . LEU D  1 51  ? 140.185 3.545   12.096  1.00 59.24  ? 50   LEU D CA    1 
ATOM   4743 C  C     . LEU D  1 51  ? 141.610 4.065   12.286  1.00 58.50  ? 50   LEU D C     1 
ATOM   4744 O  O     . LEU D  1 51  ? 141.813 5.167   12.792  1.00 61.32  ? 50   LEU D O     1 
ATOM   4745 C  CB    . LEU D  1 51  ? 139.774 2.691   13.299  1.00 56.48  ? 50   LEU D CB    1 
ATOM   4746 C  CG    . LEU D  1 51  ? 138.278 2.453   13.497  1.00 62.30  ? 50   LEU D CG    1 
ATOM   4747 C  CD1   . LEU D  1 51  ? 138.054 1.538   14.691  1.00 64.27  ? 50   LEU D CD1   1 
ATOM   4748 C  CD2   . LEU D  1 51  ? 137.537 3.767   13.677  1.00 58.73  ? 50   LEU D CD2   1 
ATOM   4749 N  N     . ALA D  1 52  ? 142.584 3.262   11.871  1.00 57.70  ? 51   ALA D N     1 
ATOM   4750 C  CA    . ALA D  1 52  ? 143.995 3.643   11.928  1.00 56.97  ? 51   ALA D CA    1 
ATOM   4751 C  C     . ALA D  1 52  ? 144.384 4.676   10.862  1.00 58.03  ? 51   ALA D C     1 
ATOM   4752 O  O     . ALA D  1 52  ? 145.472 5.240   10.924  1.00 57.97  ? 51   ALA D O     1 
ATOM   4753 C  CB    . ALA D  1 52  ? 144.867 2.410   11.783  1.00 57.03  ? 51   ALA D CB    1 
ATOM   4754 N  N     . SER D  1 53  ? 143.503 4.913   9.889   1.00 60.03  ? 52   SER D N     1 
ATOM   4755 C  CA    . SER D  1 53  ? 143.790 5.840   8.792   1.00 59.83  ? 52   SER D CA    1 
ATOM   4756 C  C     . SER D  1 53  ? 143.660 7.306   9.181   1.00 61.92  ? 52   SER D C     1 
ATOM   4757 O  O     . SER D  1 53  ? 144.169 8.169   8.467   1.00 65.94  ? 52   SER D O     1 
ATOM   4758 C  CB    . SER D  1 53  ? 142.864 5.586   7.603   1.00 60.10  ? 52   SER D CB    1 
ATOM   4759 O  OG    . SER D  1 53  ? 141.639 6.271   7.768   1.00 60.01  ? 52   SER D OG    1 
ATOM   4760 N  N     . GLU D  1 54  ? 142.956 7.593   10.275  1.00 60.80  ? 53   GLU D N     1 
ATOM   4761 C  CA    . GLU D  1 54  ? 142.717 8.979   10.707  1.00 63.00  ? 53   GLU D CA    1 
ATOM   4762 C  C     . GLU D  1 54  ? 141.985 9.829   9.634   1.00 59.63  ? 53   GLU D C     1 
ATOM   4763 O  O     . GLU D  1 54  ? 142.027 11.075  9.666   1.00 56.88  ? 53   GLU D O     1 
ATOM   4764 C  CB    . GLU D  1 54  ? 144.037 9.645   11.138  1.00 62.73  ? 53   GLU D CB    1 
ATOM   4765 N  N     . SER D  1 55  ? 141.302 9.140   8.708   1.00 58.97  ? 54   SER D N     1 
ATOM   4766 C  CA    . SER D  1 55  ? 140.498 9.786   7.658   1.00 56.46  ? 54   SER D CA    1 
ATOM   4767 C  C     . SER D  1 55  ? 139.219 10.388  8.247   1.00 54.12  ? 54   SER D C     1 
ATOM   4768 O  O     . SER D  1 55  ? 138.855 10.124  9.396   1.00 52.95  ? 54   SER D O     1 
ATOM   4769 C  CB    . SER D  1 55  ? 140.149 8.787   6.536   1.00 57.41  ? 54   SER D CB    1 
ATOM   4770 O  OG    . SER D  1 55  ? 139.098 7.906   6.907   1.00 53.45  ? 54   SER D OG    1 
ATOM   4771 N  N     . GLU D  1 56  ? 138.548 11.210  7.456   1.00 52.80  ? 55   GLU D N     1 
ATOM   4772 C  CA    . GLU D  1 56  ? 137.326 11.869  7.920   1.00 54.43  ? 55   GLU D CA    1 
ATOM   4773 C  C     . GLU D  1 56  ? 136.181 10.864  8.116   1.00 50.01  ? 55   GLU D C     1 
ATOM   4774 O  O     . GLU D  1 56  ? 135.391 10.984  9.050   1.00 53.94  ? 55   GLU D O     1 
ATOM   4775 C  CB    . GLU D  1 56  ? 136.935 13.003  6.950   1.00 57.46  ? 55   GLU D CB    1 
ATOM   4776 C  CG    . GLU D  1 56  ? 135.694 13.807  7.370   1.00 67.89  ? 55   GLU D CG    1 
ATOM   4777 C  CD    . GLU D  1 56  ? 135.807 14.405  8.770   1.00 75.40  ? 55   GLU D CD    1 
ATOM   4778 O  OE1   . GLU D  1 56  ? 134.965 14.027  9.642   1.00 59.94  ? 55   GLU D OE1   1 
ATOM   4779 O  OE2   . GLU D  1 56  ? 136.740 15.236  8.980   1.00 51.09  ? 55   GLU D OE2   1 
ATOM   4780 N  N     . ARG D  1 57  ? 136.106 9.877   7.229   1.00 53.40  ? 56   ARG D N     1 
ATOM   4781 C  CA    . ARG D  1 57  ? 135.137 8.785   7.359   1.00 53.39  ? 56   ARG D CA    1 
ATOM   4782 C  C     . ARG D  1 57  ? 135.408 7.906   8.577   1.00 51.62  ? 56   ARG D C     1 
ATOM   4783 O  O     . ARG D  1 57  ? 134.468 7.439   9.218   1.00 52.85  ? 56   ARG D O     1 
ATOM   4784 C  CB    . ARG D  1 57  ? 135.145 7.910   6.103   1.00 58.40  ? 56   ARG D CB    1 
ATOM   4785 C  CG    . ARG D  1 57  ? 134.271 6.650   6.207   1.00 61.94  ? 56   ARG D CG    1 
ATOM   4786 C  CD    . ARG D  1 57  ? 134.296 5.888   4.913   1.00 61.61  ? 56   ARG D CD    1 
ATOM   4787 N  NE    . ARG D  1 57  ? 135.643 5.401   4.632   1.00 56.84  ? 56   ARG D NE    1 
ATOM   4788 C  CZ    . ARG D  1 57  ? 136.100 5.113   3.418   1.00 57.77  ? 56   ARG D CZ    1 
ATOM   4789 N  NH1   . ARG D  1 57  ? 135.330 5.243   2.338   1.00 63.09  ? 56   ARG D NH1   1 
ATOM   4790 N  NH2   . ARG D  1 57  ? 137.342 4.689   3.284   1.00 63.90  ? 56   ARG D NH2   1 
ATOM   4791 N  N     . SER D  1 58  ? 136.684 7.667   8.884   1.00 50.87  ? 57   SER D N     1 
ATOM   4792 C  CA    . SER D  1 58  ? 137.049 6.917   10.092  1.00 51.73  ? 57   SER D CA    1 
ATOM   4793 C  C     . SER D  1 58  ? 136.509 7.583   11.356  1.00 52.74  ? 57   SER D C     1 
ATOM   4794 O  O     . SER D  1 58  ? 136.259 6.903   12.348  1.00 51.89  ? 57   SER D O     1 
ATOM   4795 C  CB    . SER D  1 58  ? 138.576 6.727   10.211  1.00 55.95  ? 57   SER D CB    1 
ATOM   4796 O  OG    . SER D  1 58  ? 139.238 7.857   10.777  1.00 45.18  ? 57   SER D OG    1 
ATOM   4797 N  N     . LYS D  1 59  ? 136.339 8.907   11.312  1.00 52.95  ? 58   LYS D N     1 
ATOM   4798 C  CA    . LYS D  1 59  ? 135.868 9.669   12.465  1.00 51.69  ? 58   LYS D CA    1 
ATOM   4799 C  C     . LYS D  1 59  ? 134.386 9.383   12.713  1.00 50.50  ? 58   LYS D C     1 
ATOM   4800 O  O     . LYS D  1 59  ? 133.941 9.364   13.849  1.00 53.04  ? 58   LYS D O     1 
ATOM   4801 C  CB    . LYS D  1 59  ? 136.114 11.171  12.280  1.00 50.41  ? 58   LYS D CB    1 
ATOM   4802 C  CG    . LYS D  1 59  ? 137.548 11.555  11.918  1.00 48.69  ? 58   LYS D CG    1 
ATOM   4803 C  CD    . LYS D  1 59  ? 137.852 13.025  12.237  1.00 54.43  ? 58   LYS D CD    1 
ATOM   4804 C  CE    . LYS D  1 59  ? 139.319 13.425  11.951  1.00 61.29  ? 58   LYS D CE    1 
ATOM   4805 N  NZ    . LYS D  1 59  ? 139.529 14.208  10.674  1.00 63.51  ? 58   LYS D NZ    1 
ATOM   4806 N  N     . LEU D  1 60  ? 133.637 9.154   11.643  1.00 51.83  ? 59   LEU D N     1 
ATOM   4807 C  CA    . LEU D  1 60  ? 132.240 8.745   11.735  1.00 52.33  ? 59   LEU D CA    1 
ATOM   4808 C  C     . LEU D  1 60  ? 132.136 7.337   12.294  1.00 53.02  ? 59   LEU D C     1 
ATOM   4809 O  O     . LEU D  1 60  ? 131.372 7.085   13.212  1.00 55.20  ? 59   LEU D O     1 
ATOM   4810 C  CB    . LEU D  1 60  ? 131.575 8.783   10.360  1.00 48.10  ? 59   LEU D CB    1 
ATOM   4811 C  CG    . LEU D  1 60  ? 130.149 8.233   10.260  1.00 48.19  ? 59   LEU D CG    1 
ATOM   4812 C  CD1   . LEU D  1 60  ? 129.196 9.000   11.152  1.00 49.69  ? 59   LEU D CD1   1 
ATOM   4813 C  CD2   . LEU D  1 60  ? 129.668 8.272   8.817   1.00 50.94  ? 59   LEU D CD2   1 
ATOM   4814 N  N     . ILE D  1 61  ? 132.905 6.421   11.722  1.00 53.04  ? 60   ILE D N     1 
ATOM   4815 C  CA    . ILE D  1 61  ? 132.958 5.059   12.219  1.00 55.49  ? 60   ILE D CA    1 
ATOM   4816 C  C     . ILE D  1 61  ? 133.280 5.044   13.726  1.00 56.36  ? 60   ILE D C     1 
ATOM   4817 O  O     . ILE D  1 61  ? 132.568 4.413   14.517  1.00 56.98  ? 60   ILE D O     1 
ATOM   4818 C  CB    . ILE D  1 61  ? 133.971 4.215   11.414  1.00 55.77  ? 60   ILE D CB    1 
ATOM   4819 C  CG1   . ILE D  1 61  ? 133.452 3.996   9.987   1.00 57.36  ? 60   ILE D CG1   1 
ATOM   4820 C  CG2   . ILE D  1 61  ? 134.217 2.869   12.093  1.00 62.33  ? 60   ILE D CG2   1 
ATOM   4821 C  CD1   . ILE D  1 61  ? 134.525 3.614   8.983   1.00 63.02  ? 60   ILE D CD1   1 
ATOM   4822 N  N     . ARG D  1 62  ? 134.322 5.766   14.122  1.00 55.79  ? 61   ARG D N     1 
ATOM   4823 C  CA    . ARG D  1 62  ? 134.694 5.859   15.528  1.00 56.80  ? 61   ARG D CA    1 
ATOM   4824 C  C     . ARG D  1 62  ? 133.529 6.292   16.431  1.00 55.38  ? 61   ARG D C     1 
ATOM   4825 O  O     . ARG D  1 62  ? 133.260 5.639   17.433  1.00 58.67  ? 61   ARG D O     1 
ATOM   4826 C  CB    . ARG D  1 62  ? 135.894 6.789   15.704  1.00 58.65  ? 61   ARG D CB    1 
ATOM   4827 C  CG    . ARG D  1 62  ? 136.368 6.908   17.150  1.00 65.12  ? 61   ARG D CG    1 
ATOM   4828 C  CD    . ARG D  1 62  ? 137.749 7.533   17.267  1.00 65.13  ? 61   ARG D CD    1 
ATOM   4829 N  NE    . ARG D  1 62  ? 138.797 6.515   17.319  1.00 74.83  ? 61   ARG D NE    1 
ATOM   4830 C  CZ    . ARG D  1 62  ? 139.526 6.092   16.284  1.00 83.52  ? 61   ARG D CZ    1 
ATOM   4831 N  NH1   . ARG D  1 62  ? 139.353 6.595   15.057  1.00 82.33  ? 61   ARG D NH1   1 
ATOM   4832 N  NH2   . ARG D  1 62  ? 140.449 5.151   16.488  1.00 68.99  ? 61   ARG D NH2   1 
ATOM   4833 N  N     . ASP D  1 63  ? 132.839 7.374   16.081  1.00 54.40  ? 62   ASP D N     1 
ATOM   4834 C  CA    . ASP D  1 63  ? 131.645 7.797   16.826  1.00 57.46  ? 62   ASP D CA    1 
ATOM   4835 C  C     . ASP D  1 63  ? 130.682 6.634   17.031  1.00 59.21  ? 62   ASP D C     1 
ATOM   4836 O  O     . ASP D  1 63  ? 130.192 6.388   18.140  1.00 60.35  ? 62   ASP D O     1 
ATOM   4837 C  CB    . ASP D  1 63  ? 130.900 8.895   16.083  1.00 55.92  ? 62   ASP D CB    1 
ATOM   4838 C  CG    . ASP D  1 63  ? 131.664 10.201  16.037  1.00 68.88  ? 62   ASP D CG    1 
ATOM   4839 O  OD1   . ASP D  1 63  ? 132.808 10.250  16.555  1.00 65.13  ? 62   ASP D OD1   1 
ATOM   4840 O  OD2   . ASP D  1 63  ? 131.109 11.176  15.472  1.00 59.57  ? 62   ASP D OD2   1 
ATOM   4841 N  N     . ILE D  1 64  ? 130.439 5.915   15.943  1.00 58.23  ? 63   ILE D N     1 
ATOM   4842 C  CA    . ILE D  1 64  ? 129.474 4.833   15.928  1.00 60.48  ? 63   ILE D CA    1 
ATOM   4843 C  C     . ILE D  1 64  ? 129.920 3.655   16.819  1.00 62.04  ? 63   ILE D C     1 
ATOM   4844 O  O     . ILE D  1 64  ? 129.159 3.212   17.680  1.00 61.17  ? 63   ILE D O     1 
ATOM   4845 C  CB    . ILE D  1 64  ? 129.201 4.377   14.461  1.00 60.97  ? 63   ILE D CB    1 
ATOM   4846 C  CG1   . ILE D  1 64  ? 128.518 5.504   13.677  1.00 61.29  ? 63   ILE D CG1   1 
ATOM   4847 C  CG2   . ILE D  1 64  ? 128.326 3.131   14.415  1.00 61.01  ? 63   ILE D CG2   1 
ATOM   4848 C  CD1   . ILE D  1 64  ? 128.315 5.188   12.203  1.00 62.28  ? 63   ILE D CD1   1 
ATOM   4849 N  N     . MET D  1 65  ? 131.149 3.172   16.615  1.00 62.58  ? 64   MET D N     1 
ATOM   4850 C  CA    . MET D  1 65  ? 131.661 1.965   17.293  1.00 62.56  ? 64   MET D CA    1 
ATOM   4851 C  C     . MET D  1 65  ? 131.920 2.156   18.786  1.00 63.46  ? 64   MET D C     1 
ATOM   4852 O  O     . MET D  1 65  ? 131.967 1.177   19.564  1.00 63.74  ? 64   MET D O     1 
ATOM   4853 C  CB    . MET D  1 65  ? 132.971 1.507   16.648  1.00 60.54  ? 64   MET D CB    1 
ATOM   4854 C  CG    . MET D  1 65  ? 132.816 0.983   15.244  1.00 66.01  ? 64   MET D CG    1 
ATOM   4855 S  SD    . MET D  1 65  ? 134.365 0.333   14.589  1.00 75.02  ? 64   MET D SD    1 
ATOM   4856 C  CE    . MET D  1 65  ? 134.486 -1.206  15.517  1.00 87.75  ? 64   MET D CE    1 
ATOM   4857 N  N     . GLU D  1 66  ? 132.123 3.412   19.172  1.00 63.21  ? 65   GLU D N     1 
ATOM   4858 C  CA    . GLU D  1 66  ? 132.372 3.759   20.561  1.00 63.86  ? 65   GLU D CA    1 
ATOM   4859 C  C     . GLU D  1 66  ? 131.065 3.788   21.335  1.00 62.99  ? 65   GLU D C     1 
ATOM   4860 O  O     . GLU D  1 66  ? 131.058 3.550   22.536  1.00 63.27  ? 65   GLU D O     1 
ATOM   4861 C  CB    . GLU D  1 66  ? 133.109 5.099   20.649  1.00 67.52  ? 65   GLU D CB    1 
ATOM   4862 C  CG    . GLU D  1 66  ? 134.601 4.965   20.311  1.00 70.18  ? 65   GLU D CG    1 
ATOM   4863 C  CD    . GLU D  1 66  ? 135.371 6.275   20.412  1.00 65.55  ? 65   GLU D CD    1 
ATOM   4864 O  OE1   . GLU D  1 66  ? 136.616 6.205   20.474  1.00 52.37  ? 65   GLU D OE1   1 
ATOM   4865 O  OE2   . GLU D  1 66  ? 134.744 7.363   20.422  1.00 60.95  ? 65   GLU D OE2   1 
ATOM   4866 N  N     . ARG D  1 67  ? 129.968 4.071   20.634  1.00 62.11  ? 66   ARG D N     1 
ATOM   4867 C  CA    . ARG D  1 67  ? 128.627 3.993   21.201  1.00 59.70  ? 66   ARG D CA    1 
ATOM   4868 C  C     . ARG D  1 67  ? 128.138 2.537   21.321  1.00 57.03  ? 66   ARG D C     1 
ATOM   4869 O  O     . ARG D  1 67  ? 127.089 2.288   21.913  1.00 59.76  ? 66   ARG D O     1 
ATOM   4870 C  CB    . ARG D  1 67  ? 127.639 4.781   20.339  1.00 57.38  ? 66   ARG D CB    1 
ATOM   4871 C  CG    . ARG D  1 67  ? 127.840 6.299   20.294  1.00 65.33  ? 66   ARG D CG    1 
ATOM   4872 C  CD    . ARG D  1 67  ? 126.868 6.921   19.257  1.00 71.69  ? 66   ARG D CD    1 
ATOM   4873 N  NE    . ARG D  1 67  ? 126.881 8.393   19.223  1.00 86.06  ? 66   ARG D NE    1 
ATOM   4874 C  CZ    . ARG D  1 67  ? 127.021 9.150   18.126  1.00 85.84  ? 66   ARG D CZ    1 
ATOM   4875 N  NH1   . ARG D  1 67  ? 127.156 8.600   16.915  1.00 80.26  ? 66   ARG D NH1   1 
ATOM   4876 N  NH2   . ARG D  1 67  ? 127.015 10.484  18.241  1.00 63.93  ? 66   ARG D NH2   1 
ATOM   4877 N  N     . GLY D  1 68  ? 128.894 1.585   20.772  1.00 55.63  ? 67   GLY D N     1 
ATOM   4878 C  CA    . GLY D  1 68  ? 128.463 0.186   20.694  1.00 56.29  ? 67   GLY D CA    1 
ATOM   4879 C  C     . GLY D  1 68  ? 127.414 -0.062  19.614  1.00 59.80  ? 67   GLY D C     1 
ATOM   4880 O  O     . GLY D  1 68  ? 126.780 -1.122  19.596  1.00 58.78  ? 67   GLY D O     1 
ATOM   4881 N  N     . ASP D  1 69  ? 127.254 0.920   18.716  1.00 61.97  ? 68   ASP D N     1 
ATOM   4882 C  CA    . ASP D  1 69  ? 126.265 0.903   17.636  1.00 60.11  ? 68   ASP D CA    1 
ATOM   4883 C  C     . ASP D  1 69  ? 126.805 0.160   16.421  1.00 59.28  ? 68   ASP D C     1 
ATOM   4884 O  O     . ASP D  1 69  ? 127.998 -0.058  16.292  1.00 58.45  ? 68   ASP D O     1 
ATOM   4885 C  CB    . ASP D  1 69  ? 125.875 2.339   17.225  1.00 61.85  ? 68   ASP D CB    1 
ATOM   4886 C  CG    . ASP D  1 69  ? 124.871 3.003   18.192  1.00 70.07  ? 68   ASP D CG    1 
ATOM   4887 O  OD1   . ASP D  1 69  ? 124.172 2.291   18.952  1.00 78.61  ? 68   ASP D OD1   1 
ATOM   4888 O  OD2   . ASP D  1 69  ? 124.766 4.256   18.172  1.00 63.10  ? 68   ASP D OD2   1 
ATOM   4889 N  N     . LEU D  1 70  ? 125.914 -0.227  15.519  1.00 60.65  ? 69   LEU D N     1 
ATOM   4890 C  CA    . LEU D  1 70  ? 126.329 -0.950  14.326  1.00 62.28  ? 69   LEU D CA    1 
ATOM   4891 C  C     . LEU D  1 70  ? 126.768 0.028   13.218  1.00 62.99  ? 69   LEU D C     1 
ATOM   4892 O  O     . LEU D  1 70  ? 126.223 1.130   13.075  1.00 59.24  ? 69   LEU D O     1 
ATOM   4893 C  CB    . LEU D  1 70  ? 125.228 -1.917  13.864  1.00 60.76  ? 69   LEU D CB    1 
ATOM   4894 C  CG    . LEU D  1 70  ? 124.142 -1.492  12.879  1.00 65.43  ? 69   LEU D CG    1 
ATOM   4895 C  CD1   . LEU D  1 70  ? 124.560 -1.777  11.441  1.00 71.01  ? 69   LEU D CD1   1 
ATOM   4896 C  CD2   . LEU D  1 70  ? 122.847 -2.220  13.183  1.00 71.99  ? 69   LEU D CD2   1 
ATOM   4897 N  N     . VAL D  1 71  ? 127.787 -0.389  12.472  1.00 63.81  ? 70   VAL D N     1 
ATOM   4898 C  CA    . VAL D  1 71  ? 128.339 0.371   11.358  1.00 63.12  ? 70   VAL D CA    1 
ATOM   4899 C  C     . VAL D  1 71  ? 127.505 0.018   10.138  1.00 63.26  ? 70   VAL D C     1 
ATOM   4900 O  O     . VAL D  1 71  ? 127.428 -1.161  9.780   1.00 61.02  ? 70   VAL D O     1 
ATOM   4901 C  CB    . VAL D  1 71  ? 129.796 -0.061  11.099  1.00 66.92  ? 70   VAL D CB    1 
ATOM   4902 C  CG1   . VAL D  1 71  ? 130.394 0.677   9.900   1.00 67.52  ? 70   VAL D CG1   1 
ATOM   4903 C  CG2   . VAL D  1 71  ? 130.637 0.133   12.366  1.00 68.58  ? 70   VAL D CG2   1 
ATOM   4904 N  N     . PRO D  1 72  ? 126.859 1.023   9.504   1.00 60.60  ? 71   PRO D N     1 
ATOM   4905 C  CA    . PRO D  1 72  ? 125.943 0.748   8.391   1.00 60.38  ? 71   PRO D CA    1 
ATOM   4906 C  C     . PRO D  1 72  ? 126.540 -0.185  7.337   1.00 59.94  ? 71   PRO D C     1 
ATOM   4907 O  O     . PRO D  1 72  ? 127.720 -0.060  7.010   1.00 61.80  ? 71   PRO D O     1 
ATOM   4908 C  CB    . PRO D  1 72  ? 125.685 2.140   7.803   1.00 61.96  ? 71   PRO D CB    1 
ATOM   4909 C  CG    . PRO D  1 72  ? 125.842 3.054   8.959   1.00 58.47  ? 71   PRO D CG    1 
ATOM   4910 C  CD    . PRO D  1 72  ? 126.942 2.469   9.792   1.00 62.47  ? 71   PRO D CD    1 
ATOM   4911 N  N     . SER D  1 73  ? 125.736 -1.113  6.822   1.00 60.27  ? 72   SER D N     1 
ATOM   4912 C  CA    . SER D  1 73  ? 126.212 -2.062  5.813   1.00 62.45  ? 72   SER D CA    1 
ATOM   4913 C  C     . SER D  1 73  ? 126.955 -1.340  4.694   1.00 60.81  ? 72   SER D C     1 
ATOM   4914 O  O     . SER D  1 73  ? 127.987 -1.814  4.219   1.00 61.29  ? 72   SER D O     1 
ATOM   4915 C  CB    . SER D  1 73  ? 125.052 -2.871  5.210   1.00 63.56  ? 72   SER D CB    1 
ATOM   4916 O  OG    . SER D  1 73  ? 124.643 -3.922  6.067   1.00 73.98  ? 72   SER D OG    1 
ATOM   4917 N  N     . GLY D  1 74  ? 126.424 -0.190  4.285   1.00 60.22  ? 73   GLY D N     1 
ATOM   4918 C  CA    . GLY D  1 74  ? 126.985 0.585   3.179   1.00 58.31  ? 73   GLY D CA    1 
ATOM   4919 C  C     . GLY D  1 74  ? 128.397 1.081   3.425   1.00 57.89  ? 73   GLY D C     1 
ATOM   4920 O  O     . GLY D  1 74  ? 129.209 1.127   2.498   1.00 56.71  ? 73   GLY D O     1 
ATOM   4921 N  N     . ILE D  1 75  ? 128.700 1.449   4.671   1.00 58.70  ? 74   ILE D N     1 
ATOM   4922 C  CA    . ILE D  1 75  ? 130.055 1.884   5.007   1.00 60.11  ? 74   ILE D CA    1 
ATOM   4923 C  C     . ILE D  1 75  ? 130.996 0.699   4.892   1.00 59.04  ? 74   ILE D C     1 
ATOM   4924 O  O     . ILE D  1 75  ? 132.061 0.806   4.282   1.00 60.85  ? 74   ILE D O     1 
ATOM   4925 C  CB    . ILE D  1 75  ? 130.166 2.477   6.418   1.00 61.98  ? 74   ILE D CB    1 
ATOM   4926 C  CG1   . ILE D  1 75  ? 129.289 3.727   6.534   1.00 63.10  ? 74   ILE D CG1   1 
ATOM   4927 C  CG2   . ILE D  1 75  ? 131.626 2.840   6.716   1.00 63.95  ? 74   ILE D CG2   1 
ATOM   4928 C  CD1   . ILE D  1 75  ? 129.490 4.534   7.825   1.00 63.35  ? 74   ILE D CD1   1 
ATOM   4929 N  N     . VAL D  1 76  ? 130.587 -0.429  5.467   1.00 59.08  ? 75   VAL D N     1 
ATOM   4930 C  CA    . VAL D  1 76  ? 131.377 -1.650  5.400   1.00 60.24  ? 75   VAL D CA    1 
ATOM   4931 C  C     . VAL D  1 76  ? 131.606 -2.083  3.948   1.00 59.38  ? 75   VAL D C     1 
ATOM   4932 O  O     . VAL D  1 76  ? 132.689 -2.556  3.588   1.00 57.65  ? 75   VAL D O     1 
ATOM   4933 C  CB    . VAL D  1 76  ? 130.690 -2.808  6.150   1.00 59.40  ? 75   VAL D CB    1 
ATOM   4934 C  CG1   . VAL D  1 76  ? 131.541 -4.067  6.058   1.00 60.78  ? 75   VAL D CG1   1 
ATOM   4935 C  CG2   . VAL D  1 76  ? 130.429 -2.432  7.614   1.00 62.75  ? 75   VAL D CG2   1 
ATOM   4936 N  N     . LEU D  1 77  ? 130.563 -1.924  3.137   1.00 57.47  ? 76   LEU D N     1 
ATOM   4937 C  CA    . LEU D  1 77  ? 130.572 -2.299  1.729   1.00 58.29  ? 76   LEU D CA    1 
ATOM   4938 C  C     . LEU D  1 77  ? 131.528 -1.419  0.908   1.00 59.08  ? 76   LEU D C     1 
ATOM   4939 O  O     . LEU D  1 77  ? 132.179 -1.902  -0.022  1.00 59.92  ? 76   LEU D O     1 
ATOM   4940 C  CB    . LEU D  1 77  ? 129.144 -2.196  1.184   1.00 58.22  ? 76   LEU D CB    1 
ATOM   4941 C  CG    . LEU D  1 77  ? 128.841 -2.812  -0.176  1.00 59.43  ? 76   LEU D CG    1 
ATOM   4942 C  CD1   . LEU D  1 77  ? 129.128 -4.305  -0.158  1.00 59.27  ? 76   LEU D CD1   1 
ATOM   4943 C  CD2   . LEU D  1 77  ? 127.389 -2.540  -0.533  1.00 64.21  ? 76   LEU D CD2   1 
ATOM   4944 N  N     . GLU D  1 78  ? 131.587 -0.130  1.251   1.00 59.02  ? 77   GLU D N     1 
ATOM   4945 C  CA    . GLU D  1 78  ? 132.588 0.805   0.708   1.00 62.05  ? 77   GLU D CA    1 
ATOM   4946 C  C     . GLU D  1 78  ? 134.008 0.319   0.976   1.00 57.49  ? 77   GLU D C     1 
ATOM   4947 O  O     . GLU D  1 78  ? 134.851 0.316   0.079   1.00 57.88  ? 77   GLU D O     1 
ATOM   4948 C  CB    . GLU D  1 78  ? 132.447 2.188   1.358   1.00 63.80  ? 77   GLU D CB    1 
ATOM   4949 C  CG    . GLU D  1 78  ? 131.892 3.276   0.484   1.00 68.16  ? 77   GLU D CG    1 
ATOM   4950 C  CD    . GLU D  1 78  ? 131.974 4.647   1.162   1.00 73.72  ? 77   GLU D CD    1 
ATOM   4951 O  OE1   . GLU D  1 78  ? 131.672 4.739   2.378   1.00 76.61  ? 77   GLU D OE1   1 
ATOM   4952 O  OE2   . GLU D  1 78  ? 132.334 5.634   0.477   1.00 92.82  ? 77   GLU D OE2   1 
ATOM   4953 N  N     . LEU D  1 79  ? 134.261 -0.072  2.226   1.00 56.35  ? 78   LEU D N     1 
ATOM   4954 C  CA    . LEU D  1 79  ? 135.586 -0.524  2.653   1.00 57.16  ? 78   LEU D CA    1 
ATOM   4955 C  C     . LEU D  1 79  ? 136.017 -1.795  1.941   1.00 56.19  ? 78   LEU D C     1 
ATOM   4956 O  O     . LEU D  1 79  ? 137.189 -1.965  1.616   1.00 56.99  ? 78   LEU D O     1 
ATOM   4957 C  CB    . LEU D  1 79  ? 135.616 -0.768  4.170   1.00 61.14  ? 78   LEU D CB    1 
ATOM   4958 C  CG    . LEU D  1 79  ? 135.371 0.443   5.071   1.00 57.83  ? 78   LEU D CG    1 
ATOM   4959 C  CD1   . LEU D  1 79  ? 135.433 -0.005  6.525   1.00 61.29  ? 78   LEU D CD1   1 
ATOM   4960 C  CD2   . LEU D  1 79  ? 136.365 1.551   4.772   1.00 47.05  ? 78   LEU D CD2   1 
ATOM   4961 N  N     . LEU D  1 80  ? 135.060 -2.692  1.733   1.00 57.77  ? 79   LEU D N     1 
ATOM   4962 C  CA    . LEU D  1 80  ? 135.283 -3.910  0.954   1.00 59.73  ? 79   LEU D CA    1 
ATOM   4963 C  C     . LEU D  1 80  ? 135.729 -3.571  -0.459  1.00 57.37  ? 79   LEU D C     1 
ATOM   4964 O  O     . LEU D  1 80  ? 136.790 -4.010  -0.898  1.00 58.04  ? 79   LEU D O     1 
ATOM   4965 C  CB    . LEU D  1 80  ? 134.001 -4.751  0.875   1.00 63.69  ? 79   LEU D CB    1 
ATOM   4966 C  CG    . LEU D  1 80  ? 133.767 -5.773  1.978   1.00 71.70  ? 79   LEU D CG    1 
ATOM   4967 C  CD1   . LEU D  1 80  ? 132.281 -6.099  2.073   1.00 78.75  ? 79   LEU D CD1   1 
ATOM   4968 C  CD2   . LEU D  1 80  ? 134.592 -7.025  1.707   1.00 74.29  ? 79   LEU D CD2   1 
ATOM   4969 N  N     . LYS D  1 81  ? 134.907 -2.791  -1.158  1.00 56.11  ? 80   LYS D N     1 
ATOM   4970 C  CA    . LYS D  1 81  ? 135.159 -2.445  -2.558  1.00 56.77  ? 80   LYS D CA    1 
ATOM   4971 C  C     . LYS D  1 81  ? 136.533 -1.809  -2.745  1.00 57.76  ? 80   LYS D C     1 
ATOM   4972 O  O     . LYS D  1 81  ? 137.219 -2.083  -3.728  1.00 59.68  ? 80   LYS D O     1 
ATOM   4973 C  CB    . LYS D  1 81  ? 134.073 -1.506  -3.093  1.00 55.81  ? 80   LYS D CB    1 
ATOM   4974 C  CG    . LYS D  1 81  ? 134.141 -1.260  -4.600  1.00 53.85  ? 80   LYS D CG    1 
ATOM   4975 N  N     . GLU D  1 82  ? 136.935 -0.976  -1.791  1.00 56.68  ? 81   GLU D N     1 
ATOM   4976 C  CA    . GLU D  1 82  ? 138.231 -0.294  -1.864  1.00 57.44  ? 81   GLU D CA    1 
ATOM   4977 C  C     . GLU D  1 82  ? 139.425 -1.247  -1.797  1.00 56.71  ? 81   GLU D C     1 
ATOM   4978 O  O     . GLU D  1 82  ? 140.303 -1.208  -2.663  1.00 56.33  ? 81   GLU D O     1 
ATOM   4979 C  CB    . GLU D  1 82  ? 138.354 0.735   -0.747  1.00 57.25  ? 81   GLU D CB    1 
ATOM   4980 C  CG    . GLU D  1 82  ? 137.498 1.950   -0.960  1.00 61.18  ? 81   GLU D CG    1 
ATOM   4981 C  CD    . GLU D  1 82  ? 137.690 2.986   0.121   1.00 65.95  ? 81   GLU D CD    1 
ATOM   4982 O  OE1   . GLU D  1 82  ? 138.491 2.743   1.048   1.00 67.29  ? 81   GLU D OE1   1 
ATOM   4983 O  OE2   . GLU D  1 82  ? 137.045 4.048   0.036   1.00 58.51  ? 81   GLU D OE2   1 
ATOM   4984 N  N     . ALA D  1 83  ? 139.458 -2.084  -0.762  1.00 57.77  ? 82   ALA D N     1 
ATOM   4985 C  CA    . ALA D  1 83  ? 140.545 -3.053  -0.591  1.00 58.37  ? 82   ALA D CA    1 
ATOM   4986 C  C     . ALA D  1 83  ? 140.634 -4.012  -1.787  1.00 58.75  ? 82   ALA D C     1 
ATOM   4987 O  O     . ALA D  1 83  ? 141.730 -4.435  -2.180  1.00 58.45  ? 82   ALA D O     1 
ATOM   4988 C  CB    . ALA D  1 83  ? 140.374 -3.830  0.713   1.00 55.57  ? 82   ALA D CB    1 
ATOM   4989 N  N     . MET D  1 84  ? 139.476 -4.336  -2.363  1.00 58.13  ? 83   MET D N     1 
ATOM   4990 C  CA    . MET D  1 84  ? 139.398 -5.182  -3.552  1.00 57.54  ? 83   MET D CA    1 
ATOM   4991 C  C     . MET D  1 84  ? 139.969 -4.479  -4.783  1.00 57.95  ? 83   MET D C     1 
ATOM   4992 O  O     . MET D  1 84  ? 140.822 -5.034  -5.483  1.00 58.28  ? 83   MET D O     1 
ATOM   4993 C  CB    . MET D  1 84  ? 137.946 -5.584  -3.811  1.00 59.17  ? 83   MET D CB    1 
ATOM   4994 C  CG    . MET D  1 84  ? 137.421 -6.636  -2.847  1.00 58.95  ? 83   MET D CG    1 
ATOM   4995 S  SD    . MET D  1 84  ? 135.718 -7.100  -3.211  1.00 59.69  ? 83   MET D SD    1 
ATOM   4996 C  CE    . MET D  1 84  ? 135.853 -8.884  -3.269  1.00 69.56  ? 83   MET D CE    1 
ATOM   4997 N  N     . VAL D  1 85  ? 139.482 -3.264  -5.035  1.00 59.80  ? 84   VAL D N     1 
ATOM   4998 C  CA    . VAL D  1 85  ? 139.992 -2.395  -6.097  1.00 58.87  ? 84   VAL D CA    1 
ATOM   4999 C  C     . VAL D  1 85  ? 141.511 -2.265  -6.015  1.00 59.71  ? 84   VAL D C     1 
ATOM   5000 O  O     . VAL D  1 85  ? 142.204 -2.381  -7.028  1.00 61.42  ? 84   VAL D O     1 
ATOM   5001 C  CB    . VAL D  1 85  ? 139.350 -0.980  -6.007  1.00 59.37  ? 84   VAL D CB    1 
ATOM   5002 C  CG1   . VAL D  1 85  ? 140.139 0.054   -6.820  1.00 59.50  ? 84   VAL D CG1   1 
ATOM   5003 C  CG2   . VAL D  1 85  ? 137.889 -1.025  -6.453  1.00 58.63  ? 84   VAL D CG2   1 
ATOM   5004 N  N     . ALA D  1 86  ? 142.015 -2.039  -4.804  1.00 59.93  ? 85   ALA D N     1 
ATOM   5005 C  CA    . ALA D  1 86  ? 143.450 -1.865  -4.563  1.00 60.54  ? 85   ALA D CA    1 
ATOM   5006 C  C     . ALA D  1 86  ? 144.290 -3.093  -4.938  1.00 61.58  ? 85   ALA D C     1 
ATOM   5007 O  O     . ALA D  1 86  ? 145.446 -2.957  -5.343  1.00 61.71  ? 85   ALA D O     1 
ATOM   5008 C  CB    . ALA D  1 86  ? 143.692 -1.495  -3.101  1.00 60.47  ? 85   ALA D CB    1 
ATOM   5009 N  N     . SER D  1 87  ? 143.704 -4.280  -4.807  1.00 63.40  ? 86   SER D N     1 
ATOM   5010 C  CA    . SER D  1 87  ? 144.421 -5.537  -5.023  1.00 64.06  ? 86   SER D CA    1 
ATOM   5011 C  C     . SER D  1 87  ? 144.304 -6.086  -6.446  1.00 63.59  ? 86   SER D C     1 
ATOM   5012 O  O     . SER D  1 87  ? 145.150 -6.879  -6.866  1.00 62.69  ? 86   SER D O     1 
ATOM   5013 C  CB    . SER D  1 87  ? 143.921 -6.585  -4.031  1.00 64.80  ? 86   SER D CB    1 
ATOM   5014 O  OG    . SER D  1 87  ? 142.512 -6.548  -3.958  1.00 69.87  ? 86   SER D OG    1 
ATOM   5015 N  N     . LEU D  1 88  ? 143.259 -5.681  -7.172  1.00 66.84  ? 87   LEU D N     1 
ATOM   5016 C  CA    . LEU D  1 88  ? 143.055 -6.106  -8.569  1.00 71.30  ? 87   LEU D CA    1 
ATOM   5017 C  C     . LEU D  1 88  ? 144.339 -6.013  -9.395  1.00 73.68  ? 87   LEU D C     1 
ATOM   5018 O  O     . LEU D  1 88  ? 145.055 -5.013  -9.326  1.00 74.44  ? 87   LEU D O     1 
ATOM   5019 C  CB    . LEU D  1 88  ? 141.957 -5.273  -9.251  1.00 71.45  ? 87   LEU D CB    1 
ATOM   5020 C  CG    . LEU D  1 88  ? 140.610 -5.963  -9.485  1.00 72.84  ? 87   LEU D CG    1 
ATOM   5021 C  CD1   . LEU D  1 88  ? 139.871 -6.196  -8.182  1.00 73.66  ? 87   LEU D CD1   1 
ATOM   5022 C  CD2   . LEU D  1 88  ? 139.755 -5.141  -10.440 1.00 72.62  ? 87   LEU D CD2   1 
ATOM   5023 N  N     . GLY D  1 89  ? 144.619 -7.058  -10.172 1.00 74.44  ? 88   GLY D N     1 
ATOM   5024 C  CA    . GLY D  1 89  ? 145.830 -7.122  -10.987 1.00 76.30  ? 88   GLY D CA    1 
ATOM   5025 C  C     . GLY D  1 89  ? 146.929 -7.893  -10.285 1.00 76.91  ? 88   GLY D C     1 
ATOM   5026 O  O     . GLY D  1 89  ? 147.581 -8.741  -10.892 1.00 78.79  ? 88   GLY D O     1 
ATOM   5027 N  N     . ASP D  1 90  ? 147.134 -7.592  -9.005  1.00 76.41  ? 89   ASP D N     1 
ATOM   5028 C  CA    . ASP D  1 90  ? 148.097 -8.307  -8.175  1.00 76.65  ? 89   ASP D CA    1 
ATOM   5029 C  C     . ASP D  1 90  ? 147.461 -9.489  -7.434  1.00 75.44  ? 89   ASP D C     1 
ATOM   5030 O  O     . ASP D  1 90  ? 148.155 -10.199 -6.707  1.00 78.59  ? 89   ASP D O     1 
ATOM   5031 C  CB    . ASP D  1 90  ? 148.729 -7.347  -7.159  1.00 75.31  ? 89   ASP D CB    1 
ATOM   5032 N  N     . THR D  1 91  ? 146.157 -9.706  -7.629  1.00 71.20  ? 90   THR D N     1 
ATOM   5033 C  CA    . THR D  1 91  ? 145.392 -10.696 -6.850  1.00 66.68  ? 90   THR D CA    1 
ATOM   5034 C  C     . THR D  1 91  ? 145.150 -12.003 -7.615  1.00 61.32  ? 90   THR D C     1 
ATOM   5035 O  O     . THR D  1 91  ? 144.970 -11.988 -8.831  1.00 59.04  ? 90   THR D O     1 
ATOM   5036 C  CB    . THR D  1 91  ? 144.016 -10.114 -6.390  1.00 66.54  ? 90   THR D CB    1 
ATOM   5037 O  OG1   . THR D  1 91  ? 143.446 -10.948 -5.374  1.00 64.71  ? 90   THR D OG1   1 
ATOM   5038 C  CG2   . THR D  1 91  ? 143.028 -9.994  -7.560  1.00 64.43  ? 90   THR D CG2   1 
ATOM   5039 N  N     . ARG D  1 92  ? 145.149 -13.123 -6.892  1.00 58.53  ? 91   ARG D N     1 
ATOM   5040 C  CA    . ARG D  1 92  ? 144.782 -14.424 -7.455  1.00 57.53  ? 91   ARG D CA    1 
ATOM   5041 C  C     . ARG D  1 92  ? 143.334 -14.802 -7.093  1.00 57.02  ? 91   ARG D C     1 
ATOM   5042 O  O     . ARG D  1 92  ? 142.866 -15.881 -7.450  1.00 58.22  ? 91   ARG D O     1 
ATOM   5043 C  CB    . ARG D  1 92  ? 145.754 -15.510 -6.970  1.00 56.09  ? 91   ARG D CB    1 
ATOM   5044 C  CG    . ARG D  1 92  ? 147.210 -15.276 -7.362  1.00 51.58  ? 91   ARG D CG    1 
ATOM   5045 N  N     . GLY D  1 93  ? 142.630 -13.907 -6.396  1.00 56.85  ? 92   GLY D N     1 
ATOM   5046 C  CA    . GLY D  1 93  ? 141.255 -14.159 -5.946  1.00 55.50  ? 92   GLY D CA    1 
ATOM   5047 C  C     . GLY D  1 93  ? 140.991 -13.628 -4.544  1.00 55.52  ? 92   GLY D C     1 
ATOM   5048 O  O     . GLY D  1 93  ? 141.929 -13.299 -3.812  1.00 55.30  ? 92   GLY D O     1 
ATOM   5049 N  N     . PHE D  1 94  ? 139.714 -13.573 -4.165  1.00 55.71  ? 93   PHE D N     1 
ATOM   5050 C  CA    . PHE D  1 94  ? 139.296 -12.992 -2.885  1.00 56.77  ? 93   PHE D CA    1 
ATOM   5051 C  C     . PHE D  1 94  ? 138.628 -13.993 -1.963  1.00 56.82  ? 93   PHE D C     1 
ATOM   5052 O  O     . PHE D  1 94  ? 137.715 -14.705 -2.370  1.00 57.04  ? 93   PHE D O     1 
ATOM   5053 C  CB    . PHE D  1 94  ? 138.334 -11.833 -3.126  1.00 57.08  ? 93   PHE D CB    1 
ATOM   5054 C  CG    . PHE D  1 94  ? 138.969 -10.673 -3.814  1.00 56.40  ? 93   PHE D CG    1 
ATOM   5055 C  CD1   . PHE D  1 94  ? 138.749 -10.432 -5.164  1.00 49.07  ? 93   PHE D CD1   1 
ATOM   5056 C  CD2   . PHE D  1 94  ? 139.817 -9.834  -3.114  1.00 57.85  ? 93   PHE D CD2   1 
ATOM   5057 C  CE1   . PHE D  1 94  ? 139.355 -9.365  -5.795  1.00 52.67  ? 93   PHE D CE1   1 
ATOM   5058 C  CE2   . PHE D  1 94  ? 140.424 -8.768  -3.737  1.00 55.32  ? 93   PHE D CE2   1 
ATOM   5059 C  CZ    . PHE D  1 94  ? 140.194 -8.528  -5.081  1.00 52.49  ? 93   PHE D CZ    1 
ATOM   5060 N  N     . LEU D  1 95  ? 139.081 -14.015 -0.713  1.00 57.41  ? 94   LEU D N     1 
ATOM   5061 C  CA    . LEU D  1 95  ? 138.525 -14.880 0.325   1.00 57.21  ? 94   LEU D CA    1 
ATOM   5062 C  C     . LEU D  1 95  ? 137.940 -13.994 1.423   1.00 57.46  ? 94   LEU D C     1 
ATOM   5063 O  O     . LEU D  1 95  ? 138.679 -13.468 2.260   1.00 54.28  ? 94   LEU D O     1 
ATOM   5064 C  CB    . LEU D  1 95  ? 139.624 -15.784 0.893   1.00 58.37  ? 94   LEU D CB    1 
ATOM   5065 C  CG    . LEU D  1 95  ? 139.237 -16.809 1.962   1.00 60.81  ? 94   LEU D CG    1 
ATOM   5066 C  CD1   . LEU D  1 95  ? 138.403 -17.935 1.357   1.00 61.37  ? 94   LEU D CD1   1 
ATOM   5067 C  CD2   . LEU D  1 95  ? 140.490 -17.364 2.639   1.00 61.75  ? 94   LEU D CD2   1 
ATOM   5068 N  N     . ILE D  1 96  ? 136.619 -13.824 1.416   1.00 58.06  ? 95   ILE D N     1 
ATOM   5069 C  CA    . ILE D  1 96  ? 135.963 -12.922 2.370   1.00 58.36  ? 95   ILE D CA    1 
ATOM   5070 C  C     . ILE D  1 96  ? 135.480 -13.674 3.617   1.00 56.05  ? 95   ILE D C     1 
ATOM   5071 O  O     . ILE D  1 96  ? 134.464 -14.366 3.598   1.00 54.33  ? 95   ILE D O     1 
ATOM   5072 C  CB    . ILE D  1 96  ? 134.792 -12.136 1.730   1.00 59.25  ? 95   ILE D CB    1 
ATOM   5073 C  CG1   . ILE D  1 96  ? 135.172 -11.588 0.342   1.00 60.58  ? 95   ILE D CG1   1 
ATOM   5074 C  CG2   . ILE D  1 96  ? 134.355 -11.003 2.653   1.00 58.98  ? 95   ILE D CG2   1 
ATOM   5075 C  CD1   . ILE D  1 96  ? 136.456 -10.771 0.293   1.00 64.53  ? 95   ILE D CD1   1 
ATOM   5076 N  N     . ASP D  1 97  ? 136.220 -13.492 4.705   1.00 57.76  ? 96   ASP D N     1 
ATOM   5077 C  CA    . ASP D  1 97  ? 136.027 -14.232 5.951   1.00 57.75  ? 96   ASP D CA    1 
ATOM   5078 C  C     . ASP D  1 97  ? 134.891 -13.653 6.801   1.00 59.08  ? 96   ASP D C     1 
ATOM   5079 O  O     . ASP D  1 97  ? 134.900 -12.468 7.135   1.00 59.80  ? 96   ASP D O     1 
ATOM   5080 C  CB    . ASP D  1 97  ? 137.357 -14.252 6.726   1.00 57.77  ? 96   ASP D CB    1 
ATOM   5081 C  CG    . ASP D  1 97  ? 137.200 -14.655 8.182   1.00 62.79  ? 96   ASP D CG    1 
ATOM   5082 O  OD1   . ASP D  1 97  ? 136.838 -13.785 9.007   1.00 69.86  ? 96   ASP D OD1   1 
ATOM   5083 O  OD2   . ASP D  1 97  ? 137.477 -15.829 8.509   1.00 49.25  ? 96   ASP D OD2   1 
ATOM   5084 N  N     . GLY D  1 98  ? 133.921 -14.505 7.141   1.00 59.95  ? 97   GLY D N     1 
ATOM   5085 C  CA    . GLY D  1 98  ? 132.811 -14.139 8.021   1.00 60.34  ? 97   GLY D CA    1 
ATOM   5086 C  C     . GLY D  1 98  ? 131.915 -13.048 7.469   1.00 61.58  ? 97   GLY D C     1 
ATOM   5087 O  O     . GLY D  1 98  ? 131.586 -12.093 8.177   1.00 63.51  ? 97   GLY D O     1 
ATOM   5088 N  N     . TYR D  1 99  ? 131.526 -13.193 6.202   1.00 63.34  ? 98   TYR D N     1 
ATOM   5089 C  CA    . TYR D  1 99  ? 130.688 -12.208 5.514   1.00 65.73  ? 98   TYR D CA    1 
ATOM   5090 C  C     . TYR D  1 99  ? 129.753 -12.909 4.525   1.00 64.96  ? 98   TYR D C     1 
ATOM   5091 O  O     . TYR D  1 99  ? 130.142 -13.927 3.944   1.00 65.60  ? 98   TYR D O     1 
ATOM   5092 C  CB    . TYR D  1 99  ? 131.574 -11.207 4.768   1.00 65.99  ? 98   TYR D CB    1 
ATOM   5093 C  CG    . TYR D  1 99  ? 130.830 -10.040 4.144   1.00 69.07  ? 98   TYR D CG    1 
ATOM   5094 C  CD1   . TYR D  1 99  ? 130.554 -8.885  4.879   1.00 65.00  ? 98   TYR D CD1   1 
ATOM   5095 C  CD2   . TYR D  1 99  ? 130.405 -10.090 2.814   1.00 69.43  ? 98   TYR D CD2   1 
ATOM   5096 C  CE1   . TYR D  1 99  ? 129.867 -7.808  4.306   1.00 68.47  ? 98   TYR D CE1   1 
ATOM   5097 C  CE2   . TYR D  1 99  ? 129.722 -9.018  2.232   1.00 68.62  ? 98   TYR D CE2   1 
ATOM   5098 C  CZ    . TYR D  1 99  ? 129.456 -7.880  2.982   1.00 67.65  ? 98   TYR D CZ    1 
ATOM   5099 O  OH    . TYR D  1 99  ? 128.780 -6.821  2.404   1.00 70.71  ? 98   TYR D OH    1 
ATOM   5100 N  N     . PRO D  1 100 ? 128.513 -12.389 4.345   1.00 62.14  ? 99   PRO D N     1 
ATOM   5101 C  CA    . PRO D  1 100 ? 127.832 -11.300 5.064   1.00 60.32  ? 99   PRO D CA    1 
ATOM   5102 C  C     . PRO D  1 100 ? 127.155 -11.762 6.357   1.00 60.03  ? 99   PRO D C     1 
ATOM   5103 O  O     . PRO D  1 100 ? 127.075 -12.962 6.619   1.00 58.78  ? 99   PRO D O     1 
ATOM   5104 C  CB    . PRO D  1 100 ? 126.773 -10.849 4.066   1.00 58.44  ? 99   PRO D CB    1 
ATOM   5105 C  CG    . PRO D  1 100 ? 126.403 -12.098 3.367   1.00 59.36  ? 99   PRO D CG    1 
ATOM   5106 C  CD    . PRO D  1 100 ? 127.657 -12.922 3.268   1.00 59.99  ? 99   PRO D CD    1 
ATOM   5107 N  N     . ARG D  1 101 ? 126.678 -10.802 7.150   1.00 60.88  ? 100  ARG D N     1 
ATOM   5108 C  CA    . ARG D  1 101 ? 125.946 -11.090 8.396   1.00 62.37  ? 100  ARG D CA    1 
ATOM   5109 C  C     . ARG D  1 101 ? 124.422 -11.124 8.175   1.00 58.58  ? 100  ARG D C     1 
ATOM   5110 O  O     . ARG D  1 101 ? 123.694 -11.714 8.978   1.00 57.69  ? 100  ARG D O     1 
ATOM   5111 C  CB    . ARG D  1 101 ? 126.303 -10.079 9.509   1.00 63.87  ? 100  ARG D CB    1 
ATOM   5112 C  CG    . ARG D  1 101 ? 126.302 -8.614  9.072   1.00 65.00  ? 100  ARG D CG    1 
ATOM   5113 C  CD    . ARG D  1 101 ? 126.228 -7.643  10.241  1.00 70.75  ? 100  ARG D CD    1 
ATOM   5114 N  NE    . ARG D  1 101 ? 126.662 -6.284  9.866   1.00 87.87  ? 100  ARG D NE    1 
ATOM   5115 C  CZ    . ARG D  1 101 ? 125.899 -5.185  9.844   1.00 83.83  ? 100  ARG D CZ    1 
ATOM   5116 N  NH1   . ARG D  1 101 ? 124.611 -5.225  10.183  1.00 90.12  ? 100  ARG D NH1   1 
ATOM   5117 N  NH2   . ARG D  1 101 ? 126.438 -4.021  9.483   1.00 68.79  ? 100  ARG D NH2   1 
ATOM   5118 N  N     . GLU D  1 102 ? 123.953 -10.483 7.102   1.00 55.96  ? 101  GLU D N     1 
ATOM   5119 C  CA    . GLU D  1 102 ? 122.534 -10.471 6.735   1.00 54.52  ? 101  GLU D CA    1 
ATOM   5120 C  C     . GLU D  1 102 ? 122.377 -10.807 5.259   1.00 53.99  ? 101  GLU D C     1 
ATOM   5121 O  O     . GLU D  1 102 ? 123.350 -10.769 4.500   1.00 54.37  ? 101  GLU D O     1 
ATOM   5122 C  CB    . GLU D  1 102 ? 121.911 -9.093  6.953   1.00 51.66  ? 101  GLU D CB    1 
ATOM   5123 C  CG    . GLU D  1 102 ? 122.347 -8.349  8.186   1.00 60.21  ? 101  GLU D CG    1 
ATOM   5124 C  CD    . GLU D  1 102 ? 122.036 -6.867  8.076   1.00 71.60  ? 101  GLU D CD    1 
ATOM   5125 O  OE1   . GLU D  1 102 ? 120.840 -6.531  7.941   1.00 79.45  ? 101  GLU D OE1   1 
ATOM   5126 O  OE2   . GLU D  1 102 ? 122.983 -6.045  8.104   1.00 57.40  ? 101  GLU D OE2   1 
ATOM   5127 N  N     . VAL D  1 103 ? 121.144 -11.106 4.849   1.00 54.88  ? 102  VAL D N     1 
ATOM   5128 C  CA    . VAL D  1 103 ? 120.842 -11.254 3.421   1.00 56.57  ? 102  VAL D CA    1 
ATOM   5129 C  C     . VAL D  1 103 ? 120.867 -9.885  2.733   1.00 56.76  ? 102  VAL D C     1 
ATOM   5130 O  O     . VAL D  1 103 ? 121.409 -9.750  1.635   1.00 57.59  ? 102  VAL D O     1 
ATOM   5131 C  CB    . VAL D  1 103 ? 119.488 -11.995 3.132   1.00 57.60  ? 102  VAL D CB    1 
ATOM   5132 C  CG1   . VAL D  1 103 ? 119.470 -13.363 3.809   1.00 53.67  ? 102  VAL D CG1   1 
ATOM   5133 C  CG2   . VAL D  1 103 ? 118.269 -11.154 3.544   1.00 59.54  ? 102  VAL D CG2   1 
ATOM   5134 N  N     . LYS D  1 104 ? 120.303 -8.872  3.390   1.00 55.94  ? 103  LYS D N     1 
ATOM   5135 C  CA    . LYS D  1 104 ? 120.305 -7.517  2.842   1.00 57.24  ? 103  LYS D CA    1 
ATOM   5136 C  C     . LYS D  1 104 ? 121.726 -7.118  2.480   1.00 54.60  ? 103  LYS D C     1 
ATOM   5137 O  O     . LYS D  1 104 ? 121.966 -6.522  1.439   1.00 54.80  ? 103  LYS D O     1 
ATOM   5138 C  CB    . LYS D  1 104 ? 119.709 -6.518  3.839   1.00 55.79  ? 103  LYS D CB    1 
ATOM   5139 C  CG    . LYS D  1 104 ? 118.200 -6.630  3.993   1.00 62.46  ? 103  LYS D CG    1 
ATOM   5140 N  N     . GLN D  1 105 ? 122.667 -7.486  3.336   1.00 55.70  ? 104  GLN D N     1 
ATOM   5141 C  CA    . GLN D  1 105 ? 124.069 -7.161  3.127   1.00 58.69  ? 104  GLN D CA    1 
ATOM   5142 C  C     . GLN D  1 105 ? 124.670 -8.006  2.003   1.00 58.62  ? 104  GLN D C     1 
ATOM   5143 O  O     . GLN D  1 105 ? 125.461 -7.516  1.198   1.00 60.36  ? 104  GLN D O     1 
ATOM   5144 C  CB    . GLN D  1 105 ? 124.839 -7.374  4.427   1.00 60.37  ? 104  GLN D CB    1 
ATOM   5145 C  CG    . GLN D  1 105 ? 126.112 -6.579  4.530   1.00 64.94  ? 104  GLN D CG    1 
ATOM   5146 C  CD    . GLN D  1 105 ? 126.843 -6.857  5.821   1.00 67.90  ? 104  GLN D CD    1 
ATOM   5147 O  OE1   . GLN D  1 105 ? 127.044 -8.015  6.187   1.00 68.58  ? 104  GLN D OE1   1 
ATOM   5148 N  NE2   . GLN D  1 105 ? 127.246 -5.800  6.521   1.00 66.22  ? 104  GLN D NE2   1 
ATOM   5149 N  N     . GLY D  1 106 ? 124.292 -9.278  1.958   1.00 58.84  ? 105  GLY D N     1 
ATOM   5150 C  CA    . GLY D  1 106 ? 124.692 -10.159 0.866   1.00 59.25  ? 105  GLY D CA    1 
ATOM   5151 C  C     . GLY D  1 106 ? 124.095 -9.779  -0.481  1.00 59.04  ? 105  GLY D C     1 
ATOM   5152 O  O     . GLY D  1 106 ? 124.688 -10.048 -1.525  1.00 60.71  ? 105  GLY D O     1 
ATOM   5153 N  N     . GLU D  1 107 ? 122.915 -9.164  -0.458  1.00 57.04  ? 106  GLU D N     1 
ATOM   5154 C  CA    . GLU D  1 107 ? 122.250 -8.715  -1.680  1.00 56.32  ? 106  GLU D CA    1 
ATOM   5155 C  C     . GLU D  1 107 ? 122.910 -7.473  -2.248  1.00 55.45  ? 106  GLU D C     1 
ATOM   5156 O  O     . GLU D  1 107 ? 123.245 -7.435  -3.430  1.00 55.72  ? 106  GLU D O     1 
ATOM   5157 C  CB    . GLU D  1 107 ? 120.771 -8.442  -1.418  1.00 56.09  ? 106  GLU D CB    1 
ATOM   5158 C  CG    . GLU D  1 107 ? 119.945 -9.717  -1.321  1.00 56.22  ? 106  GLU D CG    1 
ATOM   5159 C  CD    . GLU D  1 107 ? 118.586 -9.495  -0.700  1.00 55.75  ? 106  GLU D CD    1 
ATOM   5160 O  OE1   . GLU D  1 107 ? 118.379 -8.445  -0.053  1.00 63.85  ? 106  GLU D OE1   1 
ATOM   5161 O  OE2   . GLU D  1 107 ? 117.724 -10.381 -0.856  1.00 58.60  ? 106  GLU D OE2   1 
ATOM   5162 N  N     . GLU D  1 108 ? 123.093 -6.462  -1.400  1.00 56.03  ? 107  GLU D N     1 
ATOM   5163 C  CA    . GLU D  1 108 ? 123.776 -5.222  -1.787  1.00 56.55  ? 107  GLU D CA    1 
ATOM   5164 C  C     . GLU D  1 108 ? 125.168 -5.503  -2.368  1.00 55.90  ? 107  GLU D C     1 
ATOM   5165 O  O     . GLU D  1 108 ? 125.597 -4.832  -3.311  1.00 56.53  ? 107  GLU D O     1 
ATOM   5166 C  CB    . GLU D  1 108 ? 123.889 -4.262  -0.590  1.00 55.59  ? 107  GLU D CB    1 
ATOM   5167 N  N     . PHE D  1 109 ? 125.857 -6.497  -1.803  1.00 56.21  ? 108  PHE D N     1 
ATOM   5168 C  CA    . PHE D  1 109 ? 127.189 -6.907  -2.272  1.00 56.34  ? 108  PHE D CA    1 
ATOM   5169 C  C     . PHE D  1 109 ? 127.144 -7.432  -3.710  1.00 56.17  ? 108  PHE D C     1 
ATOM   5170 O  O     . PHE D  1 109 ? 128.039 -7.146  -4.510  1.00 54.21  ? 108  PHE D O     1 
ATOM   5171 C  CB    . PHE D  1 109 ? 127.789 -7.971  -1.332  1.00 55.95  ? 108  PHE D CB    1 
ATOM   5172 C  CG    . PHE D  1 109 ? 129.223 -8.329  -1.649  1.00 54.53  ? 108  PHE D CG    1 
ATOM   5173 C  CD1   . PHE D  1 109 ? 130.270 -7.733  -0.968  1.00 59.30  ? 108  PHE D CD1   1 
ATOM   5174 C  CD2   . PHE D  1 109 ? 129.521 -9.255  -2.636  1.00 53.79  ? 108  PHE D CD2   1 
ATOM   5175 C  CE1   . PHE D  1 109 ? 131.586 -8.061  -1.265  1.00 58.85  ? 108  PHE D CE1   1 
ATOM   5176 C  CE2   . PHE D  1 109 ? 130.834 -9.580  -2.936  1.00 47.89  ? 108  PHE D CE2   1 
ATOM   5177 C  CZ    . PHE D  1 109 ? 131.863 -8.986  -2.253  1.00 49.15  ? 108  PHE D CZ    1 
ATOM   5178 N  N     . GLY D  1 110 ? 126.111 -8.213  -4.019  1.00 57.38  ? 109  GLY D N     1 
ATOM   5179 C  CA    . GLY D  1 110 ? 125.900 -8.722  -5.369  1.00 58.02  ? 109  GLY D CA    1 
ATOM   5180 C  C     . GLY D  1 110 ? 125.602 -7.594  -6.330  1.00 58.98  ? 109  GLY D C     1 
ATOM   5181 O  O     . GLY D  1 110 ? 126.149 -7.547  -7.426  1.00 61.26  ? 109  GLY D O     1 
ATOM   5182 N  N     . ARG D  1 111 ? 124.744 -6.673  -5.899  1.00 58.58  ? 110  ARG D N     1 
ATOM   5183 C  CA    . ARG D  1 111 ? 124.322 -5.551  -6.732  1.00 59.61  ? 110  ARG D CA    1 
ATOM   5184 C  C     . ARG D  1 111 ? 125.443 -4.543  -6.977  1.00 58.92  ? 110  ARG D C     1 
ATOM   5185 O  O     . ARG D  1 111 ? 125.520 -3.969  -8.064  1.00 60.39  ? 110  ARG D O     1 
ATOM   5186 C  CB    . ARG D  1 111 ? 123.106 -4.846  -6.111  1.00 60.10  ? 110  ARG D CB    1 
ATOM   5187 C  CG    . ARG D  1 111 ? 121.832 -5.691  -6.112  1.00 65.02  ? 110  ARG D CG    1 
ATOM   5188 C  CD    . ARG D  1 111 ? 120.686 -4.997  -5.396  1.00 62.91  ? 110  ARG D CD    1 
ATOM   5189 N  N     . ARG D  1 112 ? 126.309 -4.331  -5.984  1.00 58.02  ? 111  ARG D N     1 
ATOM   5190 C  CA    . ARG D  1 112 ? 127.320 -3.269  -6.059  1.00 57.02  ? 111  ARG D CA    1 
ATOM   5191 C  C     . ARG D  1 112 ? 128.744 -3.744  -6.371  1.00 56.03  ? 111  ARG D C     1 
ATOM   5192 O  O     . ARG D  1 112 ? 129.557 -2.949  -6.830  1.00 56.65  ? 111  ARG D O     1 
ATOM   5193 C  CB    . ARG D  1 112 ? 127.319 -2.436  -4.774  1.00 55.93  ? 111  ARG D CB    1 
ATOM   5194 C  CG    . ARG D  1 112 ? 126.118 -1.516  -4.634  1.00 56.15  ? 111  ARG D CG    1 
ATOM   5195 N  N     . ILE D  1 113 ? 129.053 -5.014  -6.124  1.00 57.36  ? 112  ILE D N     1 
ATOM   5196 C  CA    . ILE D  1 113 ? 130.390 -5.558  -6.417  1.00 58.62  ? 112  ILE D CA    1 
ATOM   5197 C  C     . ILE D  1 113 ? 130.289 -6.762  -7.355  1.00 59.26  ? 112  ILE D C     1 
ATOM   5198 O  O     . ILE D  1 113 ? 130.732 -6.701  -8.505  1.00 60.73  ? 112  ILE D O     1 
ATOM   5199 C  CB    . ILE D  1 113 ? 131.170 -5.957  -5.118  1.00 59.28  ? 112  ILE D CB    1 
ATOM   5200 C  CG1   . ILE D  1 113 ? 131.479 -4.724  -4.260  1.00 63.10  ? 112  ILE D CG1   1 
ATOM   5201 C  CG2   . ILE D  1 113 ? 132.475 -6.673  -5.457  1.00 57.40  ? 112  ILE D CG2   1 
ATOM   5202 C  CD1   . ILE D  1 113 ? 130.493 -4.497  -3.148  1.00 68.47  ? 112  ILE D CD1   1 
ATOM   5203 N  N     . GLY D  1 114 ? 129.706 -7.849  -6.858  1.00 58.91  ? 113  GLY D N     1 
ATOM   5204 C  CA    . GLY D  1 114 ? 129.587 -9.085  -7.626  1.00 59.82  ? 113  GLY D CA    1 
ATOM   5205 C  C     . GLY D  1 114 ? 129.173 -10.267 -6.764  1.00 60.83  ? 113  GLY D C     1 
ATOM   5206 O  O     . GLY D  1 114 ? 129.356 -10.257 -5.547  1.00 62.52  ? 113  GLY D O     1 
ATOM   5207 N  N     . ASP D  1 115 ? 128.629 -11.297 -7.404  1.00 59.66  ? 114  ASP D N     1 
ATOM   5208 C  CA    . ASP D  1 115 ? 128.110 -12.464 -6.694  1.00 59.18  ? 114  ASP D CA    1 
ATOM   5209 C  C     . ASP D  1 115 ? 129.235 -13.470 -6.459  1.00 57.64  ? 114  ASP D C     1 
ATOM   5210 O  O     . ASP D  1 115 ? 130.147 -13.573 -7.282  1.00 57.09  ? 114  ASP D O     1 
ATOM   5211 C  CB    . ASP D  1 115 ? 126.974 -13.097 -7.498  1.00 59.41  ? 114  ASP D CB    1 
ATOM   5212 C  CG    . ASP D  1 115 ? 125.895 -12.091 -7.861  1.00 63.31  ? 114  ASP D CG    1 
ATOM   5213 O  OD1   . ASP D  1 115 ? 125.304 -11.513 -6.925  1.00 70.79  ? 114  ASP D OD1   1 
ATOM   5214 O  OD2   . ASP D  1 115 ? 125.651 -11.864 -9.070  1.00 45.15  ? 114  ASP D OD2   1 
ATOM   5215 N  N     . PRO D  1 116 ? 129.188 -14.204 -5.330  1.00 57.90  ? 115  PRO D N     1 
ATOM   5216 C  CA    . PRO D  1 116 ? 130.252 -15.170 -5.037  1.00 57.53  ? 115  PRO D CA    1 
ATOM   5217 C  C     . PRO D  1 116 ? 130.124 -16.478 -5.832  1.00 56.49  ? 115  PRO D C     1 
ATOM   5218 O  O     . PRO D  1 116 ? 129.014 -16.993 -6.012  1.00 54.74  ? 115  PRO D O     1 
ATOM   5219 C  CB    . PRO D  1 116 ? 130.113 -15.409 -3.528  1.00 56.16  ? 115  PRO D CB    1 
ATOM   5220 C  CG    . PRO D  1 116 ? 128.691 -15.117 -3.215  1.00 57.52  ? 115  PRO D CG    1 
ATOM   5221 C  CD    . PRO D  1 116 ? 128.160 -14.172 -4.271  1.00 58.35  ? 115  PRO D CD    1 
ATOM   5222 N  N     . GLN D  1 117 ? 131.265 -16.992 -6.296  1.00 56.43  ? 116  GLN D N     1 
ATOM   5223 C  CA    . GLN D  1 117 ? 131.325 -18.225 -7.087  1.00 57.14  ? 116  GLN D CA    1 
ATOM   5224 C  C     . GLN D  1 117 ? 131.316 -19.498 -6.217  1.00 56.78  ? 116  GLN D C     1 
ATOM   5225 O  O     . GLN D  1 117 ? 130.933 -20.569 -6.687  1.00 59.05  ? 116  GLN D O     1 
ATOM   5226 C  CB    . GLN D  1 117 ? 132.561 -18.205 -7.997  1.00 55.95  ? 116  GLN D CB    1 
ATOM   5227 N  N     . LEU D  1 118 ? 131.746 -19.383 -4.962  1.00 56.16  ? 117  LEU D N     1 
ATOM   5228 C  CA    . LEU D  1 118 ? 131.652 -20.484 -3.995  1.00 55.06  ? 117  LEU D CA    1 
ATOM   5229 C  C     . LEU D  1 118 ? 131.558 -19.923 -2.582  1.00 56.07  ? 117  LEU D C     1 
ATOM   5230 O  O     . LEU D  1 118 ? 132.392 -19.108 -2.177  1.00 53.74  ? 117  LEU D O     1 
ATOM   5231 C  CB    . LEU D  1 118 ? 132.862 -21.422 -4.092  1.00 55.03  ? 117  LEU D CB    1 
ATOM   5232 N  N     . VAL D  1 119 ? 130.533 -20.357 -1.848  1.00 57.14  ? 118  VAL D N     1 
ATOM   5233 C  CA    . VAL D  1 119 ? 130.375 -20.017 -0.430  1.00 56.76  ? 118  VAL D CA    1 
ATOM   5234 C  C     . VAL D  1 119 ? 130.772 -21.230 0.418   1.00 56.90  ? 118  VAL D C     1 
ATOM   5235 O  O     . VAL D  1 119 ? 129.981 -22.164 0.603   1.00 55.62  ? 118  VAL D O     1 
ATOM   5236 C  CB    . VAL D  1 119 ? 128.925 -19.570 -0.105  1.00 56.77  ? 118  VAL D CB    1 
ATOM   5237 C  CG1   . VAL D  1 119 ? 128.727 -19.391 1.398   1.00 52.66  ? 118  VAL D CG1   1 
ATOM   5238 C  CG2   . VAL D  1 119 ? 128.591 -18.273 -0.860  1.00 56.77  ? 118  VAL D CG2   1 
ATOM   5239 N  N     . ILE D  1 120 ? 132.011 -21.209 0.910   1.00 59.43  ? 119  ILE D N     1 
ATOM   5240 C  CA    . ILE D  1 120 ? 132.510 -22.246 1.811   1.00 60.27  ? 119  ILE D CA    1 
ATOM   5241 C  C     . ILE D  1 120 ? 131.841 -22.053 3.158   1.00 61.15  ? 119  ILE D C     1 
ATOM   5242 O  O     . ILE D  1 120 ? 131.569 -20.931 3.573   1.00 60.28  ? 119  ILE D O     1 
ATOM   5243 C  CB    . ILE D  1 120 ? 134.050 -22.185 1.989   1.00 62.60  ? 119  ILE D CB    1 
ATOM   5244 C  CG1   . ILE D  1 120 ? 134.761 -22.437 0.655   1.00 64.52  ? 119  ILE D CG1   1 
ATOM   5245 C  CG2   . ILE D  1 120 ? 134.520 -23.214 3.023   1.00 63.62  ? 119  ILE D CG2   1 
ATOM   5246 C  CD1   . ILE D  1 120 ? 136.263 -22.200 0.701   1.00 63.86  ? 119  ILE D CD1   1 
ATOM   5247 N  N     . CYS D  1 121 ? 131.582 -23.152 3.844   1.00 62.39  ? 120  CYS D N     1 
ATOM   5248 C  CA    . CYS D  1 121 ? 130.814 -23.087 5.060   1.00 62.98  ? 120  CYS D CA    1 
ATOM   5249 C  C     . CYS D  1 121 ? 131.229 -24.183 6.063   1.00 62.58  ? 120  CYS D C     1 
ATOM   5250 O  O     . CYS D  1 121 ? 131.110 -25.383 5.782   1.00 60.00  ? 120  CYS D O     1 
ATOM   5251 C  CB    . CYS D  1 121 ? 129.341 -23.170 4.684   1.00 61.58  ? 120  CYS D CB    1 
ATOM   5252 S  SG    . CYS D  1 121 ? 128.258 -23.303 6.073   1.00 67.83  ? 120  CYS D SG    1 
ATOM   5253 N  N     . MET D  1 122 ? 131.720 -23.745 7.226   1.00 62.10  ? 121  MET D N     1 
ATOM   5254 C  CA    . MET D  1 122 ? 132.223 -24.644 8.260   1.00 63.64  ? 121  MET D CA    1 
ATOM   5255 C  C     . MET D  1 122 ? 131.084 -25.203 9.096   1.00 64.22  ? 121  MET D C     1 
ATOM   5256 O  O     . MET D  1 122 ? 130.573 -24.526 9.988   1.00 68.08  ? 121  MET D O     1 
ATOM   5257 C  CB    . MET D  1 122 ? 133.201 -23.925 9.183   1.00 62.43  ? 121  MET D CB    1 
ATOM   5258 C  CG    . MET D  1 122 ? 134.375 -23.260 8.484   1.00 68.32  ? 121  MET D CG    1 
ATOM   5259 S  SD    . MET D  1 122 ? 135.439 -24.420 7.628   1.00 72.73  ? 121  MET D SD    1 
ATOM   5260 C  CE    . MET D  1 122 ? 137.056 -23.712 7.920   1.00 71.18  ? 121  MET D CE    1 
ATOM   5261 N  N     . ASP D  1 123 ? 130.707 -26.446 8.790   1.00 65.06  ? 122  ASP D N     1 
ATOM   5262 C  CA    . ASP D  1 123 ? 129.672 -27.188 9.515   1.00 65.74  ? 122  ASP D CA    1 
ATOM   5263 C  C     . ASP D  1 123 ? 130.321 -27.928 10.681  1.00 63.07  ? 122  ASP D C     1 
ATOM   5264 O  O     . ASP D  1 123 ? 130.918 -28.995 10.505  1.00 62.52  ? 122  ASP D O     1 
ATOM   5265 C  CB    . ASP D  1 123 ? 128.970 -28.172 8.564   1.00 67.13  ? 122  ASP D CB    1 
ATOM   5266 C  CG    . ASP D  1 123 ? 127.924 -29.045 9.261   1.00 78.56  ? 122  ASP D CG    1 
ATOM   5267 O  OD1   . ASP D  1 123 ? 127.645 -28.841 10.466  1.00 84.43  ? 122  ASP D OD1   1 
ATOM   5268 O  OD2   . ASP D  1 123 ? 127.378 -29.947 8.584   1.00 75.96  ? 122  ASP D OD2   1 
ATOM   5269 N  N     . CYS D  1 124 ? 130.182 -27.364 11.875  1.00 62.90  ? 123  CYS D N     1 
ATOM   5270 C  CA    . CYS D  1 124 ? 130.861 -27.878 13.058  1.00 62.19  ? 123  CYS D CA    1 
ATOM   5271 C  C     . CYS D  1 124 ? 129.896 -28.043 14.241  1.00 59.40  ? 123  CYS D C     1 
ATOM   5272 O  O     . CYS D  1 124 ? 129.068 -27.171 14.509  1.00 63.73  ? 123  CYS D O     1 
ATOM   5273 C  CB    . CYS D  1 124 ? 131.989 -26.918 13.411  1.00 61.03  ? 123  CYS D CB    1 
ATOM   5274 S  SG    . CYS D  1 124 ? 133.058 -27.442 14.730  1.00 66.26  ? 123  CYS D SG    1 
ATOM   5275 N  N     . SER D  1 125 ? 129.994 -29.168 14.946  1.00 58.27  ? 124  SER D N     1 
ATOM   5276 C  CA    . SER D  1 125 ? 129.115 -29.423 16.089  1.00 57.15  ? 124  SER D CA    1 
ATOM   5277 C  C     . SER D  1 125 ? 129.336 -28.367 17.162  1.00 56.92  ? 124  SER D C     1 
ATOM   5278 O  O     . SER D  1 125 ? 130.418 -27.783 17.251  1.00 58.38  ? 124  SER D O     1 
ATOM   5279 C  CB    . SER D  1 125 ? 129.368 -30.812 16.664  1.00 58.64  ? 124  SER D CB    1 
ATOM   5280 O  OG    . SER D  1 125 ? 130.734 -30.972 16.985  1.00 58.41  ? 124  SER D OG    1 
ATOM   5281 N  N     . ALA D  1 126 ? 128.300 -28.102 17.953  1.00 58.18  ? 125  ALA D N     1 
ATOM   5282 C  CA    . ALA D  1 126 ? 128.419 -27.194 19.094  1.00 58.00  ? 125  ALA D CA    1 
ATOM   5283 C  C     . ALA D  1 126 ? 129.502 -27.702 20.044  1.00 58.58  ? 125  ALA D C     1 
ATOM   5284 O  O     . ALA D  1 126 ? 130.355 -26.938 20.486  1.00 61.30  ? 125  ALA D O     1 
ATOM   5285 C  CB    . ALA D  1 126 ? 127.088 -27.080 19.819  1.00 59.09  ? 125  ALA D CB    1 
ATOM   5286 N  N     . ASP D  1 127 ? 129.457 -29.006 20.328  1.00 59.46  ? 126  ASP D N     1 
ATOM   5287 C  CA    . ASP D  1 127 ? 130.443 -29.703 21.167  1.00 60.27  ? 126  ASP D CA    1 
ATOM   5288 C  C     . ASP D  1 127 ? 131.893 -29.379 20.773  1.00 56.70  ? 126  ASP D C     1 
ATOM   5289 O  O     . ASP D  1 127 ? 132.667 -28.911 21.602  1.00 57.22  ? 126  ASP D O     1 
ATOM   5290 C  CB    . ASP D  1 127 ? 130.193 -31.218 21.087  1.00 64.26  ? 126  ASP D CB    1 
ATOM   5291 C  CG    . ASP D  1 127 ? 131.061 -32.018 22.051  1.00 76.17  ? 126  ASP D CG    1 
ATOM   5292 O  OD1   . ASP D  1 127 ? 131.631 -33.044 21.625  1.00 79.91  ? 126  ASP D OD1   1 
ATOM   5293 O  OD2   . ASP D  1 127 ? 131.171 -31.626 23.233  1.00 97.59  ? 126  ASP D OD2   1 
ATOM   5294 N  N     . THR D  1 128 ? 132.250 -29.617 19.511  1.00 56.10  ? 127  THR D N     1 
ATOM   5295 C  CA    . THR D  1 128 ? 133.604 -29.305 19.002  1.00 57.54  ? 127  THR D CA    1 
ATOM   5296 C  C     . THR D  1 128 ? 134.013 -27.833 19.141  1.00 56.20  ? 127  THR D C     1 
ATOM   5297 O  O     . THR D  1 128 ? 135.150 -27.533 19.522  1.00 56.28  ? 127  THR D O     1 
ATOM   5298 C  CB    . THR D  1 128 ? 133.760 -29.669 17.500  1.00 58.07  ? 127  THR D CB    1 
ATOM   5299 O  OG1   . THR D  1 128 ? 133.384 -31.029 17.292  1.00 60.23  ? 127  THR D OG1   1 
ATOM   5300 C  CG2   . THR D  1 128 ? 135.217 -29.451 17.005  1.00 52.29  ? 127  THR D CG2   1 
ATOM   5301 N  N     . MET D  1 129 ? 133.093 -26.935 18.794  1.00 54.70  ? 128  MET D N     1 
ATOM   5302 C  CA    . MET D  1 129 ? 133.334 -25.499 18.883  1.00 57.55  ? 128  MET D CA    1 
ATOM   5303 C  C     . MET D  1 129 ? 133.488 -25.056 20.334  1.00 55.30  ? 128  MET D C     1 
ATOM   5304 O  O     . MET D  1 129 ? 134.408 -24.309 20.675  1.00 53.52  ? 128  MET D O     1 
ATOM   5305 C  CB    . MET D  1 129 ? 132.184 -24.715 18.245  1.00 54.56  ? 128  MET D CB    1 
ATOM   5306 C  CG    . MET D  1 129 ? 132.152 -24.757 16.732  1.00 56.71  ? 128  MET D CG    1 
ATOM   5307 S  SD    . MET D  1 129 ? 130.998 -23.532 16.054  1.00 60.92  ? 128  MET D SD    1 
ATOM   5308 C  CE    . MET D  1 129 ? 129.457 -24.442 16.207  1.00 54.46  ? 128  MET D CE    1 
ATOM   5309 N  N     . THR D  1 130 ? 132.565 -25.511 21.174  1.00 55.73  ? 129  THR D N     1 
ATOM   5310 C  CA    . THR D  1 130 ? 132.605 -25.245 22.604  1.00 56.72  ? 129  THR D CA    1 
ATOM   5311 C  C     . THR D  1 130 ? 133.932 -25.677 23.242  1.00 56.11  ? 129  THR D C     1 
ATOM   5312 O  O     . THR D  1 130 ? 134.512 -24.943 24.042  1.00 55.42  ? 129  THR D O     1 
ATOM   5313 C  CB    . THR D  1 130 ? 131.462 -25.986 23.303  1.00 57.08  ? 129  THR D CB    1 
ATOM   5314 O  OG1   . THR D  1 130 ? 130.223 -25.592 22.705  1.00 64.58  ? 129  THR D OG1   1 
ATOM   5315 C  CG2   . THR D  1 130 ? 131.438 -25.660 24.791  1.00 60.46  ? 129  THR D CG2   1 
ATOM   5316 N  N     . ASN D  1 131 ? 134.401 -26.867 22.888  1.00 52.72  ? 130  ASN D N     1 
ATOM   5317 C  CA    . ASN D  1 131 ? 135.623 -27.387 23.481  1.00 54.19  ? 130  ASN D CA    1 
ATOM   5318 C  C     . ASN D  1 131 ? 136.841 -26.642 22.988  1.00 53.37  ? 130  ASN D C     1 
ATOM   5319 O  O     . ASN D  1 131 ? 137.758 -26.388 23.768  1.00 56.72  ? 130  ASN D O     1 
ATOM   5320 C  CB    . ASN D  1 131 ? 135.788 -28.890 23.216  1.00 51.57  ? 130  ASN D CB    1 
ATOM   5321 C  CG    . ASN D  1 131 ? 134.704 -29.715 23.868  1.00 54.49  ? 130  ASN D CG    1 
ATOM   5322 O  OD1   . ASN D  1 131 ? 134.014 -29.271 24.802  1.00 57.58  ? 130  ASN D OD1   1 
ATOM   5323 N  ND2   . ASN D  1 131 ? 134.540 -30.924 23.374  1.00 41.66  ? 130  ASN D ND2   1 
ATOM   5324 N  N     . ARG D  1 132 ? 136.865 -26.305 21.701  1.00 53.63  ? 131  ARG D N     1 
ATOM   5325 C  CA    . ARG D  1 132 ? 137.959 -25.491 21.142  1.00 56.44  ? 131  ARG D CA    1 
ATOM   5326 C  C     . ARG D  1 132 ? 138.005 -24.116 21.800  1.00 53.95  ? 131  ARG D C     1 
ATOM   5327 O  O     . ARG D  1 132 ? 139.078 -23.576 22.037  1.00 57.96  ? 131  ARG D O     1 
ATOM   5328 C  CB    . ARG D  1 132 ? 137.841 -25.354 19.609  1.00 57.33  ? 131  ARG D CB    1 
ATOM   5329 C  CG    . ARG D  1 132 ? 138.999 -24.576 18.945  1.00 59.96  ? 131  ARG D CG    1 
ATOM   5330 C  CD    . ARG D  1 132 ? 139.013 -24.679 17.400  1.00 60.67  ? 131  ARG D CD    1 
ATOM   5331 N  NE    . ARG D  1 132 ? 139.653 -25.910 16.902  1.00 64.68  ? 131  ARG D NE    1 
ATOM   5332 C  CZ    . ARG D  1 132 ? 139.136 -26.769 16.014  1.00 59.87  ? 131  ARG D CZ    1 
ATOM   5333 N  NH1   . ARG D  1 132 ? 137.944 -26.574 15.468  1.00 51.57  ? 131  ARG D NH1   1 
ATOM   5334 N  NH2   . ARG D  1 132 ? 139.831 -27.850 15.662  1.00 51.45  ? 131  ARG D NH2   1 
ATOM   5335 N  N     . LEU D  1 133 ? 136.839 -23.565 22.105  1.00 55.30  ? 132  LEU D N     1 
ATOM   5336 C  CA    . LEU D  1 133 ? 136.766 -22.267 22.763  1.00 54.48  ? 132  LEU D CA    1 
ATOM   5337 C  C     . LEU D  1 133 ? 137.116 -22.368 24.238  1.00 52.78  ? 132  LEU D C     1 
ATOM   5338 O  O     . LEU D  1 133 ? 137.715 -21.461 24.778  1.00 48.61  ? 132  LEU D O     1 
ATOM   5339 C  CB    . LEU D  1 133 ? 135.380 -21.647 22.578  1.00 56.09  ? 132  LEU D CB    1 
ATOM   5340 C  CG    . LEU D  1 133 ? 135.054 -21.238 21.138  1.00 56.51  ? 132  LEU D CG    1 
ATOM   5341 C  CD1   . LEU D  1 133 ? 133.659 -20.634 21.085  1.00 51.06  ? 132  LEU D CD1   1 
ATOM   5342 C  CD2   . LEU D  1 133 ? 136.104 -20.262 20.590  1.00 55.33  ? 132  LEU D CD2   1 
ATOM   5343 N  N     . LEU D  1 134 ? 136.775 -23.485 24.879  1.00 54.11  ? 133  LEU D N     1 
ATOM   5344 C  CA    . LEU D  1 134 ? 137.236 -23.733 26.253  1.00 53.36  ? 133  LEU D CA    1 
ATOM   5345 C  C     . LEU D  1 134 ? 138.768 -23.842 26.336  1.00 51.89  ? 133  LEU D C     1 
ATOM   5346 O  O     . LEU D  1 134 ? 139.392 -23.191 27.169  1.00 53.01  ? 133  LEU D O     1 
ATOM   5347 C  CB    . LEU D  1 134 ? 136.584 -24.987 26.832  1.00 53.04  ? 133  LEU D CB    1 
ATOM   5348 C  CG    . LEU D  1 134 ? 135.223 -24.814 27.496  1.00 50.99  ? 133  LEU D CG    1 
ATOM   5349 C  CD1   . LEU D  1 134 ? 134.731 -26.164 27.951  1.00 63.53  ? 133  LEU D CD1   1 
ATOM   5350 C  CD2   . LEU D  1 134 ? 135.292 -23.848 28.673  1.00 61.05  ? 133  LEU D CD2   1 
ATOM   5351 N  N     . GLN D  1 135 ? 139.360 -24.663 25.470  1.00 54.92  ? 134  GLN D N     1 
ATOM   5352 C  CA    . GLN D  1 135 ? 140.815 -24.817 25.402  1.00 55.83  ? 134  GLN D CA    1 
ATOM   5353 C  C     . GLN D  1 135 ? 141.454 -23.447 25.303  1.00 54.18  ? 134  GLN D C     1 
ATOM   5354 O  O     . GLN D  1 135 ? 142.305 -23.078 26.122  1.00 54.01  ? 134  GLN D O     1 
ATOM   5355 C  CB    . GLN D  1 135 ? 141.216 -25.663 24.185  1.00 57.52  ? 134  GLN D CB    1 
ATOM   5356 C  CG    . GLN D  1 135 ? 142.729 -25.934 24.061  1.00 61.81  ? 134  GLN D CG    1 
ATOM   5357 C  CD    . GLN D  1 135 ? 143.107 -26.700 22.791  1.00 61.33  ? 134  GLN D CD    1 
ATOM   5358 O  OE1   . GLN D  1 135 ? 142.292 -26.878 21.882  1.00 69.20  ? 134  GLN D OE1   1 
ATOM   5359 N  NE2   . GLN D  1 135 ? 144.352 -27.150 22.726  1.00 56.70  ? 134  GLN D NE2   1 
ATOM   5360 N  N     . MET D  1 136 ? 140.977 -22.699 24.307  1.00 58.85  ? 135  MET D N     1 
ATOM   5361 C  CA    . MET D  1 136 ? 141.447 -21.347 23.968  1.00 58.38  ? 135  MET D CA    1 
ATOM   5362 C  C     . MET D  1 136 ? 141.190 -20.273 25.022  1.00 58.07  ? 135  MET D C     1 
ATOM   5363 O  O     . MET D  1 136 ? 141.815 -19.227 24.990  1.00 60.39  ? 135  MET D O     1 
ATOM   5364 C  CB    . MET D  1 136 ? 140.801 -20.904 22.658  1.00 60.64  ? 135  MET D CB    1 
ATOM   5365 C  CG    . MET D  1 136 ? 141.304 -21.658 21.442  1.00 76.33  ? 135  MET D CG    1 
ATOM   5366 S  SD    . MET D  1 136 ? 143.051 -21.370 21.104  1.00 111.87 ? 135  MET D SD    1 
ATOM   5367 C  CE    . MET D  1 136 ? 143.026 -19.660 20.538  1.00 107.23 ? 135  MET D CE    1 
ATOM   5368 N  N     . SER D  1 137 ? 140.283 -20.538 25.954  1.00 58.60  ? 136  SER D N     1 
ATOM   5369 C  CA    . SER D  1 137 ? 139.896 -19.569 26.982  1.00 58.21  ? 136  SER D CA    1 
ATOM   5370 C  C     . SER D  1 137 ? 141.033 -19.199 27.933  1.00 57.80  ? 136  SER D C     1 
ATOM   5371 O  O     . SER D  1 137 ? 141.915 -20.000 28.204  1.00 58.90  ? 136  SER D O     1 
ATOM   5372 C  CB    . SER D  1 137 ? 138.731 -20.129 27.806  1.00 58.14  ? 136  SER D CB    1 
ATOM   5373 O  OG    . SER D  1 137 ? 138.103 -19.106 28.545  1.00 59.39  ? 136  SER D OG    1 
ATOM   5374 N  N     . ARG D  1 138 ? 141.009 -17.963 28.418  1.00 59.15  ? 137  ARG D N     1 
ATOM   5375 C  CA    . ARG D  1 138 ? 141.871 -17.535 29.517  1.00 60.61  ? 137  ARG D CA    1 
ATOM   5376 C  C     . ARG D  1 138 ? 140.999 -17.019 30.676  1.00 59.79  ? 137  ARG D C     1 
ATOM   5377 O  O     . ARG D  1 138 ? 141.490 -16.359 31.580  1.00 63.30  ? 137  ARG D O     1 
ATOM   5378 C  CB    . ARG D  1 138 ? 142.860 -16.457 29.045  1.00 63.97  ? 137  ARG D CB    1 
ATOM   5379 C  CG    . ARG D  1 138 ? 143.643 -16.806 27.762  1.00 63.83  ? 137  ARG D CG    1 
ATOM   5380 C  CD    . ARG D  1 138 ? 144.758 -17.833 27.989  1.00 57.36  ? 137  ARG D CD    1 
ATOM   5381 N  NE    . ARG D  1 138 ? 144.648 -18.989 27.089  1.00 63.59  ? 137  ARG D NE    1 
ATOM   5382 C  CZ    . ARG D  1 138 ? 145.660 -19.744 26.657  1.00 68.02  ? 137  ARG D CZ    1 
ATOM   5383 N  NH1   . ARG D  1 138 ? 146.914 -19.483 27.012  1.00 83.67  ? 137  ARG D NH1   1 
ATOM   5384 N  NH2   . ARG D  1 138 ? 145.416 -20.775 25.853  1.00 64.98  ? 137  ARG D NH2   1 
ATOM   5385 N  N     . SER D  1 139 ? 139.708 -17.346 30.636  1.00 59.59  ? 138  SER D N     1 
ATOM   5386 C  CA    . SER D  1 139 ? 138.746 -17.039 31.696  1.00 57.51  ? 138  SER D CA    1 
ATOM   5387 C  C     . SER D  1 139 ? 139.251 -17.477 33.074  1.00 57.98  ? 138  SER D C     1 
ATOM   5388 O  O     . SER D  1 139 ? 139.755 -18.595 33.235  1.00 59.07  ? 138  SER D O     1 
ATOM   5389 C  CB    . SER D  1 139 ? 137.406 -17.733 31.366  1.00 56.54  ? 138  SER D CB    1 
ATOM   5390 O  OG    . SER D  1 139 ? 136.421 -17.573 32.373  1.00 55.39  ? 138  SER D OG    1 
ATOM   5391 N  N     . SER D  1 140 ? 139.130 -16.577 34.054  1.00 56.99  ? 139  SER D N     1 
ATOM   5392 C  CA    . SER D  1 140 ? 139.431 -16.882 35.459  1.00 58.88  ? 139  SER D CA    1 
ATOM   5393 C  C     . SER D  1 140 ? 138.164 -17.239 36.250  1.00 57.22  ? 139  SER D C     1 
ATOM   5394 O  O     . SER D  1 140 ? 138.230 -17.600 37.430  1.00 57.66  ? 139  SER D O     1 
ATOM   5395 C  CB    . SER D  1 140 ? 140.136 -15.694 36.124  1.00 61.61  ? 139  SER D CB    1 
ATOM   5396 O  OG    . SER D  1 140 ? 139.382 -14.498 35.987  1.00 66.83  ? 139  SER D OG    1 
ATOM   5397 N  N     . LEU D  1 141 ? 137.015 -17.140 35.586  1.00 56.99  ? 140  LEU D N     1 
ATOM   5398 C  CA    . LEU D  1 141 ? 135.721 -17.383 36.206  1.00 57.05  ? 140  LEU D CA    1 
ATOM   5399 C  C     . LEU D  1 141 ? 135.486 -18.882 36.298  1.00 57.27  ? 140  LEU D C     1 
ATOM   5400 O  O     . LEU D  1 141 ? 136.233 -19.672 35.700  1.00 60.66  ? 140  LEU D O     1 
ATOM   5401 C  CB    . LEU D  1 141 ? 134.616 -16.716 35.377  1.00 59.04  ? 140  LEU D CB    1 
ATOM   5402 C  CG    . LEU D  1 141 ? 134.783 -15.200 35.176  1.00 65.83  ? 140  LEU D CG    1 
ATOM   5403 C  CD1   . LEU D  1 141 ? 133.775 -14.640 34.161  1.00 67.48  ? 140  LEU D CD1   1 
ATOM   5404 C  CD2   . LEU D  1 141 ? 134.680 -14.466 36.515  1.00 64.55  ? 140  LEU D CD2   1 
ATOM   5405 N  N     . PRO D  1 142 ? 134.465 -19.298 37.069  1.00 57.34  ? 141  PRO D N     1 
ATOM   5406 C  CA    . PRO D  1 142 ? 134.134 -20.725 37.009  1.00 56.67  ? 141  PRO D CA    1 
ATOM   5407 C  C     . PRO D  1 142 ? 133.700 -21.137 35.591  1.00 57.06  ? 141  PRO D C     1 
ATOM   5408 O  O     . PRO D  1 142 ? 133.259 -20.291 34.793  1.00 58.64  ? 141  PRO D O     1 
ATOM   5409 C  CB    . PRO D  1 142 ? 132.985 -20.883 38.022  1.00 59.42  ? 141  PRO D CB    1 
ATOM   5410 C  CG    . PRO D  1 142 ? 132.995 -19.618 38.855  1.00 59.01  ? 141  PRO D CG    1 
ATOM   5411 C  CD    . PRO D  1 142 ? 133.598 -18.548 38.000  1.00 55.05  ? 141  PRO D CD    1 
ATOM   5412 N  N     . VAL D  1 143 ? 133.846 -22.424 35.287  1.00 57.21  ? 142  VAL D N     1 
ATOM   5413 C  CA    . VAL D  1 143 ? 133.554 -22.941 33.949  1.00 59.33  ? 142  VAL D CA    1 
ATOM   5414 C  C     . VAL D  1 143 ? 132.107 -22.703 33.534  1.00 58.85  ? 142  VAL D C     1 
ATOM   5415 O  O     . VAL D  1 143 ? 131.844 -22.444 32.367  1.00 61.00  ? 142  VAL D O     1 
ATOM   5416 C  CB    . VAL D  1 143 ? 133.908 -24.456 33.795  1.00 59.61  ? 142  VAL D CB    1 
ATOM   5417 C  CG1   . VAL D  1 143 ? 135.392 -24.668 34.049  1.00 61.31  ? 142  VAL D CG1   1 
ATOM   5418 C  CG2   . VAL D  1 143 ? 133.057 -25.342 34.718  1.00 65.84  ? 142  VAL D CG2   1 
ATOM   5419 N  N     . ASP D  1 144 ? 131.186 -22.775 34.493  1.00 60.91  ? 143  ASP D N     1 
ATOM   5420 C  CA    . ASP D  1 144 ? 129.764 -22.527 34.229  1.00 64.02  ? 143  ASP D CA    1 
ATOM   5421 C  C     . ASP D  1 144 ? 129.532 -21.173 33.576  1.00 60.41  ? 143  ASP D C     1 
ATOM   5422 O  O     . ASP D  1 144 ? 128.722 -21.060 32.659  1.00 61.27  ? 143  ASP D O     1 
ATOM   5423 C  CB    . ASP D  1 144 ? 128.968 -22.602 35.526  1.00 63.33  ? 143  ASP D CB    1 
ATOM   5424 C  CG    . ASP D  1 144 ? 129.159 -23.920 36.236  1.00 78.13  ? 143  ASP D CG    1 
ATOM   5425 O  OD1   . ASP D  1 144 ? 128.535 -24.910 35.800  1.00 72.55  ? 143  ASP D OD1   1 
ATOM   5426 O  OD2   . ASP D  1 144 ? 129.950 -23.962 37.209  1.00 83.48  ? 143  ASP D OD2   1 
ATOM   5427 N  N     . ASP D  1 145 ? 130.250 -20.156 34.053  1.00 59.45  ? 144  ASP D N     1 
ATOM   5428 C  CA    . ASP D  1 145 ? 130.135 -18.787 33.532  1.00 59.88  ? 144  ASP D CA    1 
ATOM   5429 C  C     . ASP D  1 145 ? 130.751 -18.691 32.140  1.00 57.47  ? 144  ASP D C     1 
ATOM   5430 O  O     . ASP D  1 145 ? 130.183 -18.096 31.227  1.00 56.51  ? 144  ASP D O     1 
ATOM   5431 C  CB    . ASP D  1 145 ? 130.860 -17.785 34.452  1.00 64.00  ? 144  ASP D CB    1 
ATOM   5432 C  CG    . ASP D  1 145 ? 130.310 -17.762 35.880  1.00 68.39  ? 144  ASP D CG    1 
ATOM   5433 O  OD1   . ASP D  1 145 ? 129.574 -18.685 36.285  1.00 78.66  ? 144  ASP D OD1   1 
ATOM   5434 O  OD2   . ASP D  1 145 ? 130.637 -16.806 36.607  1.00 76.31  ? 144  ASP D OD2   1 
ATOM   5435 N  N     . THR D  1 146 ? 131.944 -19.262 32.013  1.00 58.70  ? 145  THR D N     1 
ATOM   5436 C  CA    . THR D  1 146 ? 132.676 -19.349 30.751  1.00 57.79  ? 145  THR D CA    1 
ATOM   5437 C  C     . THR D  1 146 ? 131.877 -20.124 29.695  1.00 56.26  ? 145  THR D C     1 
ATOM   5438 O  O     . THR D  1 146 ? 131.841 -19.754 28.525  1.00 52.55  ? 145  THR D O     1 
ATOM   5439 C  CB    . THR D  1 146 ? 134.013 -20.066 30.991  1.00 58.91  ? 145  THR D CB    1 
ATOM   5440 O  OG1   . THR D  1 146 ? 134.579 -19.614 32.230  1.00 65.33  ? 145  THR D OG1   1 
ATOM   5441 C  CG2   . THR D  1 146 ? 134.978 -19.795 29.861  1.00 61.64  ? 145  THR D CG2   1 
ATOM   5442 N  N     . THR D  1 147 ? 131.234 -21.196 30.144  1.00 55.61  ? 146  THR D N     1 
ATOM   5443 C  CA    . THR D  1 147 ? 130.288 -21.960 29.349  1.00 56.31  ? 146  THR D CA    1 
ATOM   5444 C  C     . THR D  1 147 ? 129.044 -21.165 28.930  1.00 57.58  ? 146  THR D C     1 
ATOM   5445 O  O     . THR D  1 147 ? 128.635 -21.252 27.777  1.00 57.39  ? 146  THR D O     1 
ATOM   5446 C  CB    . THR D  1 147 ? 129.866 -23.205 30.118  1.00 49.42  ? 146  THR D CB    1 
ATOM   5447 O  OG1   . THR D  1 147 ? 130.957 -24.119 30.114  1.00 56.69  ? 146  THR D OG1   1 
ATOM   5448 C  CG2   . THR D  1 147 ? 128.648 -23.888 29.494  1.00 68.93  ? 146  THR D CG2   1 
ATOM   5449 N  N     . LYS D  1 148 ? 128.432 -20.423 29.855  1.00 58.60  ? 147  LYS D N     1 
ATOM   5450 C  CA    . LYS D  1 148 ? 127.297 -19.562 29.509  1.00 58.66  ? 147  LYS D CA    1 
ATOM   5451 C  C     . LYS D  1 148 ? 127.689 -18.601 28.395  1.00 57.78  ? 147  LYS D C     1 
ATOM   5452 O  O     . LYS D  1 148 ? 126.954 -18.431 27.426  1.00 59.88  ? 147  LYS D O     1 
ATOM   5453 C  CB    . LYS D  1 148 ? 126.798 -18.753 30.717  1.00 59.45  ? 147  LYS D CB    1 
ATOM   5454 C  CG    . LYS D  1 148 ? 125.908 -19.519 31.690  1.00 61.45  ? 147  LYS D CG    1 
ATOM   5455 N  N     . THR D  1 149 ? 128.853 -17.980 28.538  1.00 55.78  ? 148  THR D N     1 
ATOM   5456 C  CA    . THR D  1 149 ? 129.325 -16.986 27.575  1.00 56.87  ? 148  THR D CA    1 
ATOM   5457 C  C     . THR D  1 149 ? 129.672 -17.606 26.229  1.00 56.43  ? 148  THR D C     1 
ATOM   5458 O  O     . THR D  1 149 ? 129.507 -16.960 25.185  1.00 56.31  ? 148  THR D O     1 
ATOM   5459 C  CB    . THR D  1 149 ? 130.580 -16.237 28.075  1.00 53.81  ? 148  THR D CB    1 
ATOM   5460 O  OG1   . THR D  1 149 ? 130.373 -15.762 29.411  1.00 48.45  ? 148  THR D OG1   1 
ATOM   5461 C  CG2   . THR D  1 149 ? 130.899 -15.063 27.161  1.00 65.21  ? 148  THR D CG2   1 
ATOM   5462 N  N     . ILE D  1 150 ? 130.191 -18.832 26.250  1.00 55.86  ? 149  ILE D N     1 
ATOM   5463 C  CA    . ILE D  1 150 ? 130.505 -19.536 25.014  1.00 57.05  ? 149  ILE D CA    1 
ATOM   5464 C  C     . ILE D  1 150 ? 129.200 -19.881 24.293  1.00 57.50  ? 149  ILE D C     1 
ATOM   5465 O  O     . ILE D  1 150 ? 129.100 -19.754 23.070  1.00 58.59  ? 149  ILE D O     1 
ATOM   5466 C  CB    . ILE D  1 150 ? 131.376 -20.787 25.263  1.00 56.47  ? 149  ILE D CB    1 
ATOM   5467 C  CG1   . ILE D  1 150 ? 132.814 -20.361 25.583  1.00 59.28  ? 149  ILE D CG1   1 
ATOM   5468 C  CG2   . ILE D  1 150 ? 131.394 -21.700 24.032  1.00 59.31  ? 149  ILE D CG2   1 
ATOM   5469 C  CD1   . ILE D  1 150 ? 133.672 -21.456 26.208  1.00 59.04  ? 149  ILE D CD1   1 
ATOM   5470 N  N     . ALA D  1 151 ? 128.192 -20.284 25.055  1.00 55.93  ? 150  ALA D N     1 
ATOM   5471 C  CA    . ALA D  1 151 ? 126.883 -20.591 24.480  1.00 58.88  ? 150  ALA D CA    1 
ATOM   5472 C  C     . ALA D  1 151 ? 126.267 -19.366 23.789  1.00 58.98  ? 150  ALA D C     1 
ATOM   5473 O  O     . ALA D  1 151 ? 125.659 -19.489 22.722  1.00 62.15  ? 150  ALA D O     1 
ATOM   5474 C  CB    . ALA D  1 151 ? 125.945 -21.140 25.556  1.00 59.53  ? 150  ALA D CB    1 
ATOM   5475 N  N     . LYS D  1 152 ? 126.436 -18.193 24.398  1.00 59.53  ? 151  LYS D N     1 
ATOM   5476 C  CA    . LYS D  1 152 ? 126.009 -16.920 23.802  1.00 57.31  ? 151  LYS D CA    1 
ATOM   5477 C  C     . LYS D  1 152 ? 126.783 -16.597 22.519  1.00 56.12  ? 151  LYS D C     1 
ATOM   5478 O  O     . LYS D  1 152 ? 126.232 -16.038 21.567  1.00 57.09  ? 151  LYS D O     1 
ATOM   5479 C  CB    . LYS D  1 152 ? 126.183 -15.779 24.805  1.00 56.37  ? 151  LYS D CB    1 
ATOM   5480 C  CG    . LYS D  1 152 ? 125.152 -15.776 25.904  1.00 58.44  ? 151  LYS D CG    1 
ATOM   5481 C  CD    . LYS D  1 152 ? 125.523 -14.840 27.048  1.00 61.47  ? 151  LYS D CD    1 
ATOM   5482 C  CE    . LYS D  1 152 ? 124.269 -14.294 27.731  1.00 67.11  ? 151  LYS D CE    1 
ATOM   5483 N  NZ    . LYS D  1 152 ? 124.475 -14.038 29.177  1.00 66.47  ? 151  LYS D NZ    1 
ATOM   5484 N  N     . ARG D  1 153 ? 128.067 -16.940 22.506  1.00 55.91  ? 152  ARG D N     1 
ATOM   5485 C  CA    . ARG D  1 153 ? 128.877 -16.779 21.312  1.00 57.09  ? 152  ARG D CA    1 
ATOM   5486 C  C     . ARG D  1 153 ? 128.352 -17.668 20.183  1.00 57.12  ? 152  ARG D C     1 
ATOM   5487 O  O     . ARG D  1 153 ? 128.273 -17.232 19.039  1.00 63.40  ? 152  ARG D O     1 
ATOM   5488 C  CB    . ARG D  1 153 ? 130.350 -17.077 21.604  1.00 59.16  ? 152  ARG D CB    1 
ATOM   5489 C  CG    . ARG D  1 153 ? 131.050 -15.999 22.425  1.00 62.26  ? 152  ARG D CG    1 
ATOM   5490 C  CD    . ARG D  1 153 ? 132.500 -16.368 22.737  1.00 56.57  ? 152  ARG D CD    1 
ATOM   5491 N  NE    . ARG D  1 153 ? 133.343 -16.234 21.553  1.00 60.08  ? 152  ARG D NE    1 
ATOM   5492 C  CZ    . ARG D  1 153 ? 134.623 -16.592 21.485  1.00 69.73  ? 152  ARG D CZ    1 
ATOM   5493 N  NH1   . ARG D  1 153 ? 135.230 -17.122 22.538  1.00 57.44  ? 152  ARG D NH1   1 
ATOM   5494 N  NH2   . ARG D  1 153 ? 135.300 -16.430 20.349  1.00 65.70  ? 152  ARG D NH2   1 
ATOM   5495 N  N     . LEU D  1 154 ? 127.972 -18.905 20.491  1.00 59.05  ? 153  LEU D N     1 
ATOM   5496 C  CA    . LEU D  1 154 ? 127.467 -19.792 19.450  1.00 57.28  ? 153  LEU D CA    1 
ATOM   5497 C  C     . LEU D  1 154 ? 126.111 -19.323 18.929  1.00 56.69  ? 153  LEU D C     1 
ATOM   5498 O  O     . LEU D  1 154 ? 125.882 -19.336 17.715  1.00 58.31  ? 153  LEU D O     1 
ATOM   5499 C  CB    . LEU D  1 154 ? 127.385 -21.241 19.937  1.00 61.88  ? 153  LEU D CB    1 
ATOM   5500 C  CG    . LEU D  1 154 ? 128.676 -21.931 20.407  1.00 65.74  ? 153  LEU D CG    1 
ATOM   5501 C  CD1   . LEU D  1 154 ? 128.427 -23.428 20.525  1.00 61.52  ? 153  LEU D CD1   1 
ATOM   5502 C  CD2   . LEU D  1 154 ? 129.870 -21.639 19.495  1.00 66.47  ? 153  LEU D CD2   1 
ATOM   5503 N  N     . GLU D  1 155 ? 125.220 -18.918 19.836  1.00 55.22  ? 154  GLU D N     1 
ATOM   5504 C  CA    . GLU D  1 155 ? 123.909 -18.384 19.444  1.00 57.52  ? 154  GLU D CA    1 
ATOM   5505 C  C     . GLU D  1 155 ? 124.039 -17.201 18.496  1.00 56.62  ? 154  GLU D C     1 
ATOM   5506 O  O     . GLU D  1 155 ? 123.387 -17.168 17.451  1.00 55.92  ? 154  GLU D O     1 
ATOM   5507 C  CB    . GLU D  1 155 ? 123.061 -17.990 20.661  1.00 59.25  ? 154  GLU D CB    1 
ATOM   5508 C  CG    . GLU D  1 155 ? 122.247 -19.144 21.239  1.00 66.88  ? 154  GLU D CG    1 
ATOM   5509 N  N     . ALA D  1 156 ? 124.892 -16.242 18.852  1.00 57.43  ? 155  ALA D N     1 
ATOM   5510 C  CA    . ALA D  1 156 ? 125.085 -15.049 18.019  1.00 55.75  ? 155  ALA D CA    1 
ATOM   5511 C  C     . ALA D  1 156 ? 125.523 -15.447 16.611  1.00 55.67  ? 155  ALA D C     1 
ATOM   5512 O  O     . ALA D  1 156 ? 125.028 -14.884 15.624  1.00 57.87  ? 155  ALA D O     1 
ATOM   5513 C  CB    . ALA D  1 156 ? 126.087 -14.091 18.652  1.00 53.13  ? 155  ALA D CB    1 
ATOM   5514 N  N     . TYR D  1 157 ? 126.419 -16.436 16.519  1.00 56.33  ? 156  TYR D N     1 
ATOM   5515 C  CA    . TYR D  1 157 ? 126.804 -16.988 15.220  1.00 55.44  ? 156  TYR D CA    1 
ATOM   5516 C  C     . TYR D  1 157 ? 125.627 -17.632 14.473  1.00 56.82  ? 156  TYR D C     1 
ATOM   5517 O  O     . TYR D  1 157 ? 125.516 -17.482 13.253  1.00 58.46  ? 156  TYR D O     1 
ATOM   5518 C  CB    . TYR D  1 157 ? 127.938 -18.001 15.334  1.00 56.37  ? 156  TYR D CB    1 
ATOM   5519 C  CG    . TYR D  1 157 ? 128.199 -18.665 14.006  1.00 61.85  ? 156  TYR D CG    1 
ATOM   5520 C  CD1   . TYR D  1 157 ? 128.722 -17.933 12.944  1.00 64.99  ? 156  TYR D CD1   1 
ATOM   5521 C  CD2   . TYR D  1 157 ? 127.880 -20.003 13.787  1.00 64.74  ? 156  TYR D CD2   1 
ATOM   5522 C  CE1   . TYR D  1 157 ? 128.943 -18.512 11.706  1.00 58.88  ? 156  TYR D CE1   1 
ATOM   5523 C  CE2   . TYR D  1 157 ? 128.100 -20.593 12.542  1.00 59.52  ? 156  TYR D CE2   1 
ATOM   5524 C  CZ    . TYR D  1 157 ? 128.635 -19.833 11.511  1.00 52.58  ? 156  TYR D CZ    1 
ATOM   5525 O  OH    . TYR D  1 157 ? 128.874 -20.388 10.283  1.00 60.08  ? 156  TYR D OH    1 
ATOM   5526 N  N     . TYR D  1 158 ? 124.767 -18.353 15.193  1.00 57.78  ? 157  TYR D N     1 
ATOM   5527 C  CA    . TYR D  1 158 ? 123.615 -19.015 14.564  1.00 59.43  ? 157  TYR D CA    1 
ATOM   5528 C  C     . TYR D  1 158 ? 122.661 -17.973 13.961  1.00 58.55  ? 157  TYR D C     1 
ATOM   5529 O  O     . TYR D  1 158 ? 122.308 -18.041 12.774  1.00 56.84  ? 157  TYR D O     1 
ATOM   5530 C  CB    . TYR D  1 158 ? 122.862 -19.906 15.559  1.00 58.95  ? 157  TYR D CB    1 
ATOM   5531 C  CG    . TYR D  1 158 ? 123.638 -21.096 16.104  1.00 67.21  ? 157  TYR D CG    1 
ATOM   5532 C  CD1   . TYR D  1 158 ? 123.504 -21.474 17.445  1.00 69.87  ? 157  TYR D CD1   1 
ATOM   5533 C  CD2   . TYR D  1 158 ? 124.492 -21.854 15.295  1.00 68.00  ? 157  TYR D CD2   1 
ATOM   5534 C  CE1   . TYR D  1 158 ? 124.198 -22.561 17.973  1.00 64.73  ? 157  TYR D CE1   1 
ATOM   5535 C  CE2   . TYR D  1 158 ? 125.198 -22.954 15.817  1.00 67.26  ? 157  TYR D CE2   1 
ATOM   5536 C  CZ    . TYR D  1 158 ? 125.043 -23.301 17.160  1.00 71.24  ? 157  TYR D CZ    1 
ATOM   5537 O  OH    . TYR D  1 158 ? 125.715 -24.386 17.705  1.00 67.12  ? 157  TYR D OH    1 
ATOM   5538 N  N     . ARG D  1 159 ? 122.266 -16.996 14.772  1.00 58.54  ? 158  ARG D N     1 
ATOM   5539 C  CA    . ARG D  1 159 ? 121.410 -15.913 14.299  1.00 59.74  ? 158  ARG D CA    1 
ATOM   5540 C  C     . ARG D  1 159 ? 122.012 -15.176 13.093  1.00 60.70  ? 158  ARG D C     1 
ATOM   5541 O  O     . ARG D  1 159 ? 121.283 -14.764 12.180  1.00 63.73  ? 158  ARG D O     1 
ATOM   5542 C  CB    . ARG D  1 159 ? 121.134 -14.927 15.432  1.00 59.61  ? 158  ARG D CB    1 
ATOM   5543 C  CG    . ARG D  1 159 ? 120.133 -15.440 16.449  1.00 66.40  ? 158  ARG D CG    1 
ATOM   5544 C  CD    . ARG D  1 159 ? 119.771 -14.372 17.477  1.00 84.50  ? 158  ARG D CD    1 
ATOM   5545 N  NE    . ARG D  1 159 ? 120.745 -14.326 18.573  1.00 96.42  ? 158  ARG D NE    1 
ATOM   5546 C  CZ    . ARG D  1 159 ? 121.736 -13.439 18.710  1.00 98.64  ? 158  ARG D CZ    1 
ATOM   5547 N  NH1   . ARG D  1 159 ? 122.541 -13.534 19.763  1.00 95.16  ? 158  ARG D NH1   1 
ATOM   5548 N  NH2   . ARG D  1 159 ? 121.942 -12.464 17.822  1.00 94.66  ? 158  ARG D NH2   1 
ATOM   5549 N  N     . ALA D  1 160 ? 123.338 -15.031 13.098  1.00 62.14  ? 159  ALA D N     1 
ATOM   5550 C  CA    . ALA D  1 160 ? 124.074 -14.355 12.018  1.00 63.42  ? 159  ALA D CA    1 
ATOM   5551 C  C     . ALA D  1 160 ? 124.328 -15.247 10.798  1.00 63.16  ? 159  ALA D C     1 
ATOM   5552 O  O     . ALA D  1 160 ? 124.596 -14.740 9.708   1.00 68.06  ? 159  ALA D O     1 
ATOM   5553 C  CB    . ALA D  1 160 ? 125.412 -13.810 12.550  1.00 64.22  ? 159  ALA D CB    1 
ATOM   5554 N  N     . SER D  1 161 ? 124.255 -16.564 10.983  1.00 60.95  ? 160  SER D N     1 
ATOM   5555 C  CA    . SER D  1 161 ? 124.569 -17.518 9.913   1.00 58.71  ? 160  SER D CA    1 
ATOM   5556 C  C     . SER D  1 161 ? 123.332 -18.133 9.260   1.00 56.94  ? 160  SER D C     1 
ATOM   5557 O  O     . SER D  1 161 ? 123.267 -18.243 8.042   1.00 58.61  ? 160  SER D O     1 
ATOM   5558 C  CB    . SER D  1 161 ? 125.472 -18.634 10.453  1.00 62.11  ? 160  SER D CB    1 
ATOM   5559 O  OG    . SER D  1 161 ? 124.839 -19.363 11.501  1.00 58.77  ? 160  SER D OG    1 
ATOM   5560 N  N     . ILE D  1 162 ? 122.357 -18.532 10.069  1.00 56.21  ? 161  ILE D N     1 
ATOM   5561 C  CA    . ILE D  1 162 ? 121.276 -19.406 9.600   1.00 56.39  ? 161  ILE D CA    1 
ATOM   5562 C  C     . ILE D  1 162 ? 120.483 -18.838 8.415   1.00 55.16  ? 161  ILE D C     1 
ATOM   5563 O  O     . ILE D  1 162 ? 120.242 -19.558 7.442   1.00 55.76  ? 161  ILE D O     1 
ATOM   5564 C  CB    . ILE D  1 162 ? 120.329 -19.800 10.755  1.00 55.00  ? 161  ILE D CB    1 
ATOM   5565 C  CG1   . ILE D  1 162 ? 121.059 -20.753 11.712  1.00 61.13  ? 161  ILE D CG1   1 
ATOM   5566 C  CG2   . ILE D  1 162 ? 119.070 -20.477 10.215  1.00 54.37  ? 161  ILE D CG2   1 
ATOM   5567 C  CD1   . ILE D  1 162 ? 120.425 -20.883 13.087  1.00 62.06  ? 161  ILE D CD1   1 
ATOM   5568 N  N     . PRO D  1 163 ? 120.085 -17.550 8.485   1.00 54.86  ? 162  PRO D N     1 
ATOM   5569 C  CA    . PRO D  1 163 ? 119.360 -16.948 7.346   1.00 54.63  ? 162  PRO D CA    1 
ATOM   5570 C  C     . PRO D  1 163 ? 120.235 -16.747 6.099   1.00 54.07  ? 162  PRO D C     1 
ATOM   5571 O  O     . PRO D  1 163 ? 119.715 -16.733 4.973   1.00 52.35  ? 162  PRO D O     1 
ATOM   5572 C  CB    . PRO D  1 163 ? 118.878 -15.591 7.891   1.00 54.31  ? 162  PRO D CB    1 
ATOM   5573 C  CG    . PRO D  1 163 ? 119.196 -15.592 9.371   1.00 59.38  ? 162  PRO D CG    1 
ATOM   5574 C  CD    . PRO D  1 163 ? 120.284 -16.591 9.588   1.00 57.41  ? 162  PRO D CD    1 
ATOM   5575 N  N     . VAL D  1 164 ? 121.546 -16.598 6.315   1.00 56.14  ? 163  VAL D N     1 
ATOM   5576 C  CA    . VAL D  1 164 ? 122.514 -16.395 5.230   1.00 56.32  ? 163  VAL D CA    1 
ATOM   5577 C  C     . VAL D  1 164 ? 122.802 -17.710 4.500   1.00 54.47  ? 163  VAL D C     1 
ATOM   5578 O  O     . VAL D  1 164 ? 122.841 -17.741 3.270   1.00 54.18  ? 163  VAL D O     1 
ATOM   5579 C  CB    . VAL D  1 164 ? 123.838 -15.765 5.768   1.00 57.68  ? 163  VAL D CB    1 
ATOM   5580 C  CG1   . VAL D  1 164 ? 124.900 -15.647 4.659   1.00 56.36  ? 163  VAL D CG1   1 
ATOM   5581 C  CG2   . VAL D  1 164 ? 123.557 -14.399 6.394   1.00 56.39  ? 163  VAL D CG2   1 
ATOM   5582 N  N     . ILE D  1 165 ? 123.002 -18.787 5.264   1.00 56.33  ? 164  ILE D N     1 
ATOM   5583 C  CA    . ILE D  1 165 ? 123.222 -20.120 4.693   1.00 56.14  ? 164  ILE D CA    1 
ATOM   5584 C  C     . ILE D  1 165 ? 122.058 -20.517 3.782   1.00 54.57  ? 164  ILE D C     1 
ATOM   5585 O  O     . ILE D  1 165 ? 122.267 -20.955 2.648   1.00 55.74  ? 164  ILE D O     1 
ATOM   5586 C  CB    . ILE D  1 165 ? 123.398 -21.193 5.792   1.00 55.52  ? 164  ILE D CB    1 
ATOM   5587 N  N     . ALA D  1 166 ? 120.838 -20.332 4.284   1.00 54.53  ? 165  ALA D N     1 
ATOM   5588 C  CA    . ALA D  1 166 ? 119.612 -20.656 3.543   1.00 53.45  ? 165  ALA D CA    1 
ATOM   5589 C  C     . ALA D  1 166 ? 119.493 -19.881 2.227   1.00 52.62  ? 165  ALA D C     1 
ATOM   5590 O  O     . ALA D  1 166 ? 119.005 -20.410 1.218   1.00 52.73  ? 165  ALA D O     1 
ATOM   5591 C  CB    . ALA D  1 166 ? 118.395 -20.390 4.418   1.00 53.24  ? 165  ALA D CB    1 
ATOM   5592 N  N     . TYR D  1 167 ? 119.934 -18.625 2.246   1.00 54.25  ? 166  TYR D N     1 
ATOM   5593 C  CA    . TYR D  1 167 ? 119.913 -17.786 1.057   1.00 53.33  ? 166  TYR D CA    1 
ATOM   5594 C  C     . TYR D  1 167 ? 120.905 -18.281 0.003   1.00 53.23  ? 166  TYR D C     1 
ATOM   5595 O  O     . TYR D  1 167 ? 120.542 -18.466 -1.161  1.00 53.69  ? 166  TYR D O     1 
ATOM   5596 C  CB    . TYR D  1 167 ? 120.214 -16.331 1.423   1.00 52.99  ? 166  TYR D CB    1 
ATOM   5597 C  CG    . TYR D  1 167 ? 120.401 -15.441 0.221   1.00 51.64  ? 166  TYR D CG    1 
ATOM   5598 C  CD1   . TYR D  1 167 ? 119.314 -15.067 -0.563  1.00 55.81  ? 166  TYR D CD1   1 
ATOM   5599 C  CD2   . TYR D  1 167 ? 121.664 -14.988 -0.146  1.00 47.08  ? 166  TYR D CD2   1 
ATOM   5600 C  CE1   . TYR D  1 167 ? 119.476 -14.257 -1.675  1.00 53.24  ? 166  TYR D CE1   1 
ATOM   5601 C  CE2   . TYR D  1 167 ? 121.838 -14.175 -1.258  1.00 49.99  ? 166  TYR D CE2   1 
ATOM   5602 C  CZ    . TYR D  1 167 ? 120.739 -13.815 -2.020  1.00 52.03  ? 166  TYR D CZ    1 
ATOM   5603 O  OH    . TYR D  1 167 ? 120.897 -13.010 -3.128  1.00 57.13  ? 166  TYR D OH    1 
ATOM   5604 N  N     . TYR D  1 168 ? 122.151 -18.506 0.416   1.00 53.53  ? 167  TYR D N     1 
ATOM   5605 C  CA    . TYR D  1 168 ? 123.220 -18.863 -0.530  1.00 56.64  ? 167  TYR D CA    1 
ATOM   5606 C  C     . TYR D  1 168 ? 123.164 -20.311 -1.047  1.00 58.45  ? 167  TYR D C     1 
ATOM   5607 O  O     . TYR D  1 168 ? 123.735 -20.616 -2.098  1.00 57.41  ? 167  TYR D O     1 
ATOM   5608 C  CB    . TYR D  1 168 ? 124.601 -18.523 0.054   1.00 56.37  ? 167  TYR D CB    1 
ATOM   5609 C  CG    . TYR D  1 168 ? 124.933 -17.049 -0.076  1.00 56.90  ? 167  TYR D CG    1 
ATOM   5610 C  CD1   . TYR D  1 168 ? 124.987 -16.215 1.041   1.00 56.87  ? 167  TYR D CD1   1 
ATOM   5611 C  CD2   . TYR D  1 168 ? 125.162 -16.482 -1.327  1.00 59.21  ? 167  TYR D CD2   1 
ATOM   5612 C  CE1   . TYR D  1 168 ? 125.279 -14.852 0.912   1.00 52.01  ? 167  TYR D CE1   1 
ATOM   5613 C  CE2   . TYR D  1 168 ? 125.451 -15.128 -1.467  1.00 62.24  ? 167  TYR D CE2   1 
ATOM   5614 C  CZ    . TYR D  1 168 ? 125.510 -14.319 -0.347  1.00 60.71  ? 167  TYR D CZ    1 
ATOM   5615 O  OH    . TYR D  1 168 ? 125.796 -12.982 -0.506  1.00 56.97  ? 167  TYR D OH    1 
ATOM   5616 N  N     . GLU D  1 169 ? 122.476 -21.195 -0.325  1.00 59.25  ? 168  GLU D N     1 
ATOM   5617 C  CA    . GLU D  1 169 ? 122.156 -22.522 -0.865  1.00 61.84  ? 168  GLU D CA    1 
ATOM   5618 C  C     . GLU D  1 169 ? 121.334 -22.409 -2.151  1.00 61.25  ? 168  GLU D C     1 
ATOM   5619 O  O     . GLU D  1 169 ? 121.617 -23.091 -3.139  1.00 59.90  ? 168  GLU D O     1 
ATOM   5620 C  CB    . GLU D  1 169 ? 121.385 -23.366 0.151   1.00 60.58  ? 168  GLU D CB    1 
ATOM   5621 C  CG    . GLU D  1 169 ? 122.260 -24.015 1.202   1.00 67.36  ? 168  GLU D CG    1 
ATOM   5622 C  CD    . GLU D  1 169 ? 121.457 -24.806 2.212   1.00 69.34  ? 168  GLU D CD    1 
ATOM   5623 O  OE1   . GLU D  1 169 ? 121.982 -25.085 3.312   1.00 65.85  ? 168  GLU D OE1   1 
ATOM   5624 O  OE2   . GLU D  1 169 ? 120.296 -25.148 1.907   1.00 70.92  ? 168  GLU D OE2   1 
ATOM   5625 N  N     . THR D  1 170 ? 120.328 -21.537 -2.132  1.00 63.38  ? 169  THR D N     1 
ATOM   5626 C  CA    . THR D  1 170 ? 119.409 -21.391 -3.261  1.00 64.36  ? 169  THR D CA    1 
ATOM   5627 C  C     . THR D  1 170 ? 120.023 -20.611 -4.428  1.00 64.87  ? 169  THR D C     1 
ATOM   5628 O  O     . THR D  1 170 ? 119.899 -21.023 -5.584  1.00 65.84  ? 169  THR D O     1 
ATOM   5629 C  CB    . THR D  1 170 ? 118.086 -20.708 -2.831  1.00 62.83  ? 169  THR D CB    1 
ATOM   5630 O  OG1   . THR D  1 170 ? 118.357 -19.396 -2.327  1.00 60.85  ? 169  THR D OG1   1 
ATOM   5631 C  CG2   . THR D  1 170 ? 117.380 -21.524 -1.755  1.00 63.72  ? 169  THR D CG2   1 
ATOM   5632 N  N     . LYS D  1 171 ? 120.689 -19.500 -4.123  1.00 65.12  ? 170  LYS D N     1 
ATOM   5633 C  CA    . LYS D  1 171 ? 121.143 -18.562 -5.155  1.00 65.01  ? 170  LYS D CA    1 
ATOM   5634 C  C     . LYS D  1 171 ? 122.521 -18.879 -5.753  1.00 65.45  ? 170  LYS D C     1 
ATOM   5635 O  O     . LYS D  1 171 ? 122.947 -18.204 -6.686  1.00 67.77  ? 170  LYS D O     1 
ATOM   5636 C  CB    . LYS D  1 171 ? 121.135 -17.130 -4.608  1.00 63.45  ? 170  LYS D CB    1 
ATOM   5637 N  N     . THR D  1 172 ? 123.214 -19.892 -5.235  1.00 66.46  ? 171  THR D N     1 
ATOM   5638 C  CA    . THR D  1 172 ? 124.564 -20.225 -5.719  1.00 64.55  ? 171  THR D CA    1 
ATOM   5639 C  C     . THR D  1 172 ? 125.004 -21.624 -5.232  1.00 62.84  ? 171  THR D C     1 
ATOM   5640 O  O     . THR D  1 172 ? 124.161 -22.448 -4.856  1.00 62.94  ? 171  THR D O     1 
ATOM   5641 C  CB    . THR D  1 172 ? 125.600 -19.099 -5.320  1.00 64.90  ? 171  THR D CB    1 
ATOM   5642 O  OG1   . THR D  1 172 ? 126.850 -19.304 -5.990  1.00 60.71  ? 171  THR D OG1   1 
ATOM   5643 C  CG2   . THR D  1 172 ? 125.832 -19.045 -3.813  1.00 63.57  ? 171  THR D CG2   1 
ATOM   5644 N  N     . GLN D  1 173 ? 126.309 -21.893 -5.272  1.00 59.72  ? 172  GLN D N     1 
ATOM   5645 C  CA    . GLN D  1 173 ? 126.870 -23.137 -4.745  1.00 59.31  ? 172  GLN D CA    1 
ATOM   5646 C  C     . GLN D  1 173 ? 127.477 -22.892 -3.357  1.00 58.36  ? 172  GLN D C     1 
ATOM   5647 O  O     . GLN D  1 173 ? 128.543 -22.277 -3.239  1.00 58.84  ? 172  GLN D O     1 
ATOM   5648 C  CB    . GLN D  1 173 ? 127.928 -23.697 -5.703  1.00 58.89  ? 172  GLN D CB    1 
ATOM   5649 N  N     . LEU D  1 174 ? 126.785 -23.361 -2.317  1.00 56.86  ? 173  LEU D N     1 
ATOM   5650 C  CA    . LEU D  1 174 ? 127.274 -23.284 -0.936  1.00 56.96  ? 173  LEU D CA    1 
ATOM   5651 C  C     . LEU D  1 174 ? 127.688 -24.673 -0.457  1.00 55.70  ? 173  LEU D C     1 
ATOM   5652 O  O     . LEU D  1 174 ? 126.841 -25.460 -0.056  1.00 56.57  ? 173  LEU D O     1 
ATOM   5653 C  CB    . LEU D  1 174 ? 126.190 -22.727 -0.007  1.00 56.19  ? 173  LEU D CB    1 
ATOM   5654 N  N     . HIS D  1 175 ? 128.987 -24.963 -0.499  1.00 57.03  ? 174  HIS D N     1 
ATOM   5655 C  CA    . HIS D  1 175 ? 129.509 -26.268 -0.105  1.00 57.08  ? 174  HIS D CA    1 
ATOM   5656 C  C     . HIS D  1 175 ? 129.811 -26.312 1.399   1.00 58.26  ? 174  HIS D C     1 
ATOM   5657 O  O     . HIS D  1 175 ? 130.654 -25.560 1.890   1.00 58.32  ? 174  HIS D O     1 
ATOM   5658 C  CB    . HIS D  1 175 ? 130.770 -26.599 -0.910  1.00 56.57  ? 174  HIS D CB    1 
ATOM   5659 N  N     . LYS D  1 176 ? 129.113 -27.192 2.117   1.00 58.59  ? 175  LYS D N     1 
ATOM   5660 C  CA    . LYS D  1 176 ? 129.332 -27.400 3.552   1.00 61.98  ? 175  LYS D CA    1 
ATOM   5661 C  C     . LYS D  1 176 ? 130.573 -28.261 3.811   1.00 62.60  ? 175  LYS D C     1 
ATOM   5662 O  O     . LYS D  1 176 ? 130.635 -29.405 3.366   1.00 65.17  ? 175  LYS D O     1 
ATOM   5663 C  CB    . LYS D  1 176 ? 128.137 -28.118 4.191   1.00 61.31  ? 175  LYS D CB    1 
ATOM   5664 C  CG    . LYS D  1 176 ? 126.908 -27.277 4.461   1.00 64.48  ? 175  LYS D CG    1 
ATOM   5665 C  CD    . LYS D  1 176 ? 126.019 -28.015 5.452   1.00 68.98  ? 175  LYS D CD    1 
ATOM   5666 C  CE    . LYS D  1 176 ? 124.665 -27.365 5.623   1.00 72.51  ? 175  LYS D CE    1 
ATOM   5667 N  NZ    . LYS D  1 176 ? 123.730 -28.313 6.303   1.00 79.05  ? 175  LYS D NZ    1 
ATOM   5668 N  N     . ILE D  1 177 ? 131.542 -27.726 4.547   1.00 63.36  ? 176  ILE D N     1 
ATOM   5669 C  CA    . ILE D  1 177 ? 132.702 -28.503 4.981   1.00 62.60  ? 176  ILE D CA    1 
ATOM   5670 C  C     . ILE D  1 177 ? 132.434 -28.995 6.402   1.00 61.41  ? 176  ILE D C     1 
ATOM   5671 O  O     . ILE D  1 177 ? 132.133 -28.199 7.287   1.00 61.26  ? 176  ILE D O     1 
ATOM   5672 C  CB    . ILE D  1 177 ? 134.011 -27.656 4.916   1.00 64.75  ? 176  ILE D CB    1 
ATOM   5673 C  CG1   . ILE D  1 177 ? 134.616 -27.704 3.504   1.00 73.52  ? 176  ILE D CG1   1 
ATOM   5674 C  CG2   . ILE D  1 177 ? 135.058 -28.142 5.928   1.00 63.27  ? 176  ILE D CG2   1 
ATOM   5675 C  CD1   . ILE D  1 177 ? 133.712 -27.172 2.406   1.00 75.22  ? 176  ILE D CD1   1 
ATOM   5676 N  N     . ASN D  1 178 ? 132.521 -30.305 6.618   1.00 61.96  ? 177  ASN D N     1 
ATOM   5677 C  CA    . ASN D  1 178 ? 132.484 -30.850 7.973   1.00 60.74  ? 177  ASN D CA    1 
ATOM   5678 C  C     . ASN D  1 178 ? 133.809 -30.492 8.651   1.00 60.56  ? 177  ASN D C     1 
ATOM   5679 O  O     . ASN D  1 178 ? 134.874 -30.946 8.216   1.00 61.72  ? 177  ASN D O     1 
ATOM   5680 C  CB    . ASN D  1 178 ? 132.256 -32.372 7.964   1.00 57.55  ? 177  ASN D CB    1 
ATOM   5681 C  CG    . ASN D  1 178 ? 131.644 -32.893 9.272   1.00 56.25  ? 177  ASN D CG    1 
ATOM   5682 O  OD1   . ASN D  1 178 ? 130.989 -32.160 10.024  1.00 56.35  ? 177  ASN D OD1   1 
ATOM   5683 N  ND2   . ASN D  1 178 ? 131.843 -34.173 9.531   1.00 33.03  ? 177  ASN D ND2   1 
ATOM   5684 N  N     . ALA D  1 179 ? 133.736 -29.661 9.693   1.00 59.36  ? 178  ALA D N     1 
ATOM   5685 C  CA    . ALA D  1 179 ? 134.925 -29.176 10.396  1.00 58.45  ? 178  ALA D CA    1 
ATOM   5686 C  C     . ALA D  1 179 ? 135.121 -29.961 11.692  1.00 57.46  ? 178  ALA D C     1 
ATOM   5687 O  O     . ALA D  1 179 ? 135.138 -29.395 12.782  1.00 56.76  ? 178  ALA D O     1 
ATOM   5688 C  CB    . ALA D  1 179 ? 134.802 -27.676 10.673  1.00 57.86  ? 178  ALA D CB    1 
ATOM   5689 N  N     . GLU D  1 180 ? 135.279 -31.274 11.557  1.00 58.90  ? 179  GLU D N     1 
ATOM   5690 C  CA    . GLU D  1 180 ? 135.378 -32.161 12.719  1.00 60.41  ? 179  GLU D CA    1 
ATOM   5691 C  C     . GLU D  1 180 ? 136.762 -32.763 12.920  1.00 60.10  ? 179  GLU D C     1 
ATOM   5692 O  O     . GLU D  1 180 ? 137.280 -32.747 14.043  1.00 61.96  ? 179  GLU D O     1 
ATOM   5693 C  CB    . GLU D  1 180 ? 134.337 -33.275 12.625  1.00 60.25  ? 179  GLU D CB    1 
ATOM   5694 C  CG    . GLU D  1 180 ? 132.904 -32.757 12.468  1.00 68.21  ? 179  GLU D CG    1 
ATOM   5695 C  CD    . GLU D  1 180 ? 132.415 -31.934 13.652  1.00 67.31  ? 179  GLU D CD    1 
ATOM   5696 O  OE1   . GLU D  1 180 ? 133.099 -31.917 14.701  1.00 53.23  ? 179  GLU D OE1   1 
ATOM   5697 O  OE2   . GLU D  1 180 ? 131.336 -31.309 13.525  1.00 75.00  ? 179  GLU D OE2   1 
ATOM   5698 N  N     . GLY D  1 181 ? 137.362 -33.273 11.847  1.00 57.58  ? 180  GLY D N     1 
ATOM   5699 C  CA    . GLY D  1 181 ? 138.633 -33.996 11.947  1.00 57.35  ? 180  GLY D CA    1 
ATOM   5700 C  C     . GLY D  1 181 ? 139.857 -33.123 12.178  1.00 57.99  ? 180  GLY D C     1 
ATOM   5701 O  O     . GLY D  1 181 ? 139.762 -32.031 12.747  1.00 59.04  ? 180  GLY D O     1 
ATOM   5702 N  N     . THR D  1 182 ? 141.013 -33.607 11.723  1.00 57.23  ? 181  THR D N     1 
ATOM   5703 C  CA    . THR D  1 182 ? 142.281 -32.877 11.861  1.00 56.82  ? 181  THR D CA    1 
ATOM   5704 C  C     . THR D  1 182 ? 142.300 -31.631 10.956  1.00 56.92  ? 181  THR D C     1 
ATOM   5705 O  O     . THR D  1 182 ? 141.397 -31.448 10.128  1.00 56.60  ? 181  THR D O     1 
ATOM   5706 C  CB    . THR D  1 182 ? 143.515 -33.775 11.519  1.00 57.86  ? 181  THR D CB    1 
ATOM   5707 O  OG1   . THR D  1 182 ? 143.650 -33.906 10.096  1.00 55.10  ? 181  THR D OG1   1 
ATOM   5708 C  CG2   . THR D  1 182 ? 143.404 -35.165 12.173  1.00 57.20  ? 181  THR D CG2   1 
ATOM   5709 N  N     . PRO D  1 183 ? 143.321 -30.762 11.114  1.00 58.32  ? 182  PRO D N     1 
ATOM   5710 C  CA    . PRO D  1 183 ? 143.439 -29.624 10.195  1.00 59.57  ? 182  PRO D CA    1 
ATOM   5711 C  C     . PRO D  1 183 ? 143.684 -30.066 8.755   1.00 59.31  ? 182  PRO D C     1 
ATOM   5712 O  O     . PRO D  1 183 ? 143.068 -29.532 7.839   1.00 60.48  ? 182  PRO D O     1 
ATOM   5713 C  CB    . PRO D  1 183 ? 144.654 -28.853 10.733  1.00 61.01  ? 182  PRO D CB    1 
ATOM   5714 C  CG    . PRO D  1 183 ? 144.848 -29.337 12.134  1.00 60.23  ? 182  PRO D CG    1 
ATOM   5715 C  CD    . PRO D  1 183 ? 144.393 -30.757 12.129  1.00 57.90  ? 182  PRO D CD    1 
ATOM   5716 N  N     . GLU D  1 184 ? 144.566 -31.047 8.573   1.00 60.85  ? 183  GLU D N     1 
ATOM   5717 C  CA    . GLU D  1 184 ? 144.875 -31.584 7.249   1.00 60.99  ? 183  GLU D CA    1 
ATOM   5718 C  C     . GLU D  1 184 ? 143.645 -32.198 6.570   1.00 59.91  ? 183  GLU D C     1 
ATOM   5719 O  O     . GLU D  1 184 ? 143.442 -31.999 5.374   1.00 59.17  ? 183  GLU D O     1 
ATOM   5720 C  CB    . GLU D  1 184 ? 145.997 -32.615 7.347   1.00 59.50  ? 183  GLU D CB    1 
ATOM   5721 N  N     . ASP D  1 185 ? 142.831 -32.932 7.336   1.00 58.20  ? 184  ASP D N     1 
ATOM   5722 C  CA    . ASP D  1 185 ? 141.564 -33.510 6.841   1.00 58.22  ? 184  ASP D CA    1 
ATOM   5723 C  C     . ASP D  1 185 ? 140.573 -32.440 6.372   1.00 57.59  ? 184  ASP D C     1 
ATOM   5724 O  O     . ASP D  1 185 ? 139.955 -32.557 5.311   1.00 57.00  ? 184  ASP D O     1 
ATOM   5725 C  CB    . ASP D  1 185 ? 140.876 -34.334 7.938   1.00 57.65  ? 184  ASP D CB    1 
ATOM   5726 C  CG    . ASP D  1 185 ? 141.580 -35.647 8.228   1.00 63.27  ? 184  ASP D CG    1 
ATOM   5727 O  OD1   . ASP D  1 185 ? 140.909 -36.569 8.741   1.00 55.74  ? 184  ASP D OD1   1 
ATOM   5728 O  OD2   . ASP D  1 185 ? 142.792 -35.766 7.949   1.00 71.61  ? 184  ASP D OD2   1 
ATOM   5729 N  N     . VAL D  1 186 ? 140.414 -31.406 7.183   1.00 56.65  ? 185  VAL D N     1 
ATOM   5730 C  CA    . VAL D  1 186 ? 139.462 -30.339 6.892   1.00 56.13  ? 185  VAL D CA    1 
ATOM   5731 C  C     . VAL D  1 186 ? 139.964 -29.478 5.717   1.00 55.21  ? 185  VAL D C     1 
ATOM   5732 O  O     . VAL D  1 186 ? 139.173 -29.002 4.905   1.00 55.98  ? 185  VAL D O     1 
ATOM   5733 C  CB    . VAL D  1 186 ? 139.201 -29.478 8.159   1.00 56.98  ? 185  VAL D CB    1 
ATOM   5734 C  CG1   . VAL D  1 186 ? 138.246 -28.311 7.850   1.00 59.95  ? 185  VAL D CG1   1 
ATOM   5735 C  CG2   . VAL D  1 186 ? 138.660 -30.352 9.318   1.00 44.95  ? 185  VAL D CG2   1 
ATOM   5736 N  N     . PHE D  1 187 ? 141.284 -29.312 5.635   1.00 55.00  ? 186  PHE D N     1 
ATOM   5737 C  CA    . PHE D  1 187 ? 141.946 -28.554 4.569   1.00 54.45  ? 186  PHE D CA    1 
ATOM   5738 C  C     . PHE D  1 187 ? 141.805 -29.226 3.195   1.00 54.96  ? 186  PHE D C     1 
ATOM   5739 O  O     . PHE D  1 187 ? 141.433 -28.574 2.218   1.00 55.49  ? 186  PHE D O     1 
ATOM   5740 C  CB    . PHE D  1 187 ? 143.425 -28.384 4.936   1.00 55.67  ? 186  PHE D CB    1 
ATOM   5741 C  CG    . PHE D  1 187 ? 144.204 -27.500 4.001   1.00 60.92  ? 186  PHE D CG    1 
ATOM   5742 C  CD1   . PHE D  1 187 ? 143.821 -26.182 3.782   1.00 58.32  ? 186  PHE D CD1   1 
ATOM   5743 C  CD2   . PHE D  1 187 ? 145.353 -27.975 3.373   1.00 60.66  ? 186  PHE D CD2   1 
ATOM   5744 C  CE1   . PHE D  1 187 ? 144.553 -25.361 2.933   1.00 59.05  ? 186  PHE D CE1   1 
ATOM   5745 C  CE2   . PHE D  1 187 ? 146.089 -27.158 2.521   1.00 59.23  ? 186  PHE D CE2   1 
ATOM   5746 C  CZ    . PHE D  1 187 ? 145.686 -25.850 2.303   1.00 59.17  ? 186  PHE D CZ    1 
ATOM   5747 N  N     . LEU D  1 188 ? 142.098 -30.526 3.125   1.00 56.36  ? 187  LEU D N     1 
ATOM   5748 C  CA    . LEU D  1 188 ? 141.935 -31.300 1.883   1.00 57.32  ? 187  LEU D CA    1 
ATOM   5749 C  C     . LEU D  1 188 ? 140.474 -31.307 1.410   1.00 58.35  ? 187  LEU D C     1 
ATOM   5750 O  O     . LEU D  1 188 ? 140.199 -31.375 0.209   1.00 58.52  ? 187  LEU D O     1 
ATOM   5751 C  CB    . LEU D  1 188 ? 142.434 -32.742 2.065   1.00 57.26  ? 187  LEU D CB    1 
ATOM   5752 N  N     . GLN D  1 189 ? 139.551 -31.231 2.370   1.00 60.71  ? 188  GLN D N     1 
ATOM   5753 C  CA    . GLN D  1 189 ? 138.117 -31.139 2.101   1.00 61.45  ? 188  GLN D CA    1 
ATOM   5754 C  C     . GLN D  1 189 ? 137.740 -29.741 1.600   1.00 60.09  ? 188  GLN D C     1 
ATOM   5755 O  O     . GLN D  1 189 ? 136.827 -29.591 0.785   1.00 58.17  ? 188  GLN D O     1 
ATOM   5756 C  CB    . GLN D  1 189 ? 137.347 -31.475 3.380   1.00 60.89  ? 188  GLN D CB    1 
ATOM   5757 C  CG    . GLN D  1 189 ? 135.865 -31.739 3.201   1.00 59.89  ? 188  GLN D CG    1 
ATOM   5758 C  CD    . GLN D  1 189 ? 135.195 -32.211 4.489   1.00 65.40  ? 188  GLN D CD    1 
ATOM   5759 O  OE1   . GLN D  1 189 ? 135.848 -32.408 5.524   1.00 53.68  ? 188  GLN D OE1   1 
ATOM   5760 N  NE2   . GLN D  1 189 ? 133.883 -32.396 4.427   1.00 72.55  ? 188  GLN D NE2   1 
ATOM   5761 N  N     . LEU D  1 190 ? 138.447 -28.728 2.101   1.00 58.31  ? 189  LEU D N     1 
ATOM   5762 C  CA    . LEU D  1 190 ? 138.284 -27.344 1.645   1.00 60.04  ? 189  LEU D CA    1 
ATOM   5763 C  C     . LEU D  1 190 ? 138.784 -27.169 0.217   1.00 58.69  ? 189  LEU D C     1 
ATOM   5764 O  O     . LEU D  1 190 ? 138.111 -26.551 -0.610  1.00 58.66  ? 189  LEU D O     1 
ATOM   5765 C  CB    . LEU D  1 190 ? 139.044 -26.372 2.564   1.00 60.76  ? 189  LEU D CB    1 
ATOM   5766 C  CG    . LEU D  1 190 ? 138.393 -26.021 3.906   1.00 63.03  ? 189  LEU D CG    1 
ATOM   5767 C  CD1   . LEU D  1 190 ? 139.423 -25.507 4.907   1.00 56.92  ? 189  LEU D CD1   1 
ATOM   5768 C  CD2   . LEU D  1 190 ? 137.299 -25.001 3.701   1.00 66.54  ? 189  LEU D CD2   1 
ATOM   5769 N  N     . CYS D  1 191 ? 139.974 -27.702 -0.058  1.00 56.63  ? 190  CYS D N     1 
ATOM   5770 C  CA    . CYS D  1 191 ? 140.575 -27.619 -1.391  1.00 58.12  ? 190  CYS D CA    1 
ATOM   5771 C  C     . CYS D  1 191 ? 139.705 -28.277 -2.452  1.00 56.67  ? 190  CYS D C     1 
ATOM   5772 O  O     . CYS D  1 191 ? 139.599 -27.773 -3.564  1.00 57.59  ? 190  CYS D O     1 
ATOM   5773 C  CB    . CYS D  1 191 ? 141.957 -28.272 -1.402  1.00 57.22  ? 190  CYS D CB    1 
ATOM   5774 S  SG    . CYS D  1 191 ? 143.148 -27.462 -0.325  1.00 63.41  ? 190  CYS D SG    1 
ATOM   5775 N  N     . THR D  1 192 ? 139.092 -29.403 -2.092  1.00 57.26  ? 191  THR D N     1 
ATOM   5776 C  CA    . THR D  1 192 ? 138.197 -30.139 -2.987  1.00 58.74  ? 191  THR D CA    1 
ATOM   5777 C  C     . THR D  1 192 ? 136.998 -29.284 -3.421  1.00 59.63  ? 191  THR D C     1 
ATOM   5778 O  O     . THR D  1 192 ? 136.557 -29.367 -4.573  1.00 62.24  ? 191  THR D O     1 
ATOM   5779 C  CB    . THR D  1 192 ? 137.713 -31.457 -2.326  1.00 56.94  ? 191  THR D CB    1 
ATOM   5780 O  OG1   . THR D  1 192 ? 138.824 -32.350 -2.187  1.00 45.70  ? 191  THR D OG1   1 
ATOM   5781 C  CG2   . THR D  1 192 ? 136.633 -32.140 -3.153  1.00 52.67  ? 191  THR D CG2   1 
ATOM   5782 N  N     . ALA D  1 193 ? 136.481 -28.470 -2.501  1.00 58.72  ? 192  ALA D N     1 
ATOM   5783 C  CA    . ALA D  1 193 ? 135.401 -27.537 -2.820  1.00 59.34  ? 192  ALA D CA    1 
ATOM   5784 C  C     . ALA D  1 193 ? 135.933 -26.360 -3.645  1.00 59.54  ? 192  ALA D C     1 
ATOM   5785 O  O     . ALA D  1 193 ? 135.269 -25.891 -4.572  1.00 60.36  ? 192  ALA D O     1 
ATOM   5786 C  CB    . ALA D  1 193 ? 134.736 -27.041 -1.546  1.00 59.77  ? 192  ALA D CB    1 
ATOM   5787 N  N     . ILE D  1 194 ? 137.135 -25.897 -3.301  1.00 58.48  ? 193  ILE D N     1 
ATOM   5788 C  CA    . ILE D  1 194 ? 137.816 -24.826 -4.044  1.00 58.94  ? 193  ILE D CA    1 
ATOM   5789 C  C     . ILE D  1 194 ? 138.186 -25.265 -5.465  1.00 59.68  ? 193  ILE D C     1 
ATOM   5790 O  O     . ILE D  1 194 ? 137.874 -24.573 -6.437  1.00 59.36  ? 193  ILE D O     1 
ATOM   5791 C  CB    . ILE D  1 194 ? 139.081 -24.337 -3.275  1.00 60.19  ? 193  ILE D CB    1 
ATOM   5792 C  CG1   . ILE D  1 194 ? 138.655 -23.388 -2.153  1.00 62.80  ? 193  ILE D CG1   1 
ATOM   5793 C  CG2   . ILE D  1 194 ? 140.091 -23.639 -4.205  1.00 58.78  ? 193  ILE D CG2   1 
ATOM   5794 C  CD1   . ILE D  1 194 ? 139.736 -23.109 -1.142  1.00 68.12  ? 193  ILE D CD1   1 
ATOM   5795 N  N     . ASP D  1 195 ? 138.846 -26.416 -5.572  1.00 59.20  ? 194  ASP D N     1 
ATOM   5796 C  CA    . ASP D  1 195 ? 139.248 -26.974 -6.870  1.00 58.68  ? 194  ASP D CA    1 
ATOM   5797 C  C     . ASP D  1 195 ? 138.036 -27.285 -7.758  1.00 58.76  ? 194  ASP D C     1 
ATOM   5798 O  O     . ASP D  1 195 ? 138.154 -27.288 -8.985  1.00 59.98  ? 194  ASP D O     1 
ATOM   5799 C  CB    . ASP D  1 195 ? 140.110 -28.237 -6.687  1.00 59.22  ? 194  ASP D CB    1 
ATOM   5800 C  CG    . ASP D  1 195 ? 141.369 -27.982 -5.851  1.00 65.20  ? 194  ASP D CG    1 
ATOM   5801 O  OD1   . ASP D  1 195 ? 141.777 -26.805 -5.709  1.00 70.22  ? 194  ASP D OD1   1 
ATOM   5802 O  OD2   . ASP D  1 195 ? 141.940 -28.963 -5.323  1.00 59.29  ? 194  ASP D OD2   1 
ATOM   5803 N  N     . SER D  1 196 ? 136.882 -27.540 -7.135  1.00 59.69  ? 195  SER D N     1 
ATOM   5804 C  CA    . SER D  1 196 ? 135.613 -27.677 -7.858  1.00 61.89  ? 195  SER D CA    1 
ATOM   5805 C  C     . SER D  1 196 ? 135.344 -26.459 -8.749  1.00 62.40  ? 195  SER D C     1 
ATOM   5806 O  O     . SER D  1 196 ? 134.836 -26.604 -9.863  1.00 63.01  ? 195  SER D O     1 
ATOM   5807 C  CB    . SER D  1 196 ? 134.451 -27.869 -6.882  1.00 60.52  ? 195  SER D CB    1 
ATOM   5808 O  OG    . SER D  1 196 ? 133.250 -28.153 -7.575  1.00 61.11  ? 195  SER D OG    1 
ATOM   5809 N  N     . ILE D  1 197 ? 135.686 -25.271 -8.250  1.00 63.14  ? 196  ILE D N     1 
ATOM   5810 C  CA    . ILE D  1 197 ? 135.634 -24.038 -9.038  1.00 64.04  ? 196  ILE D CA    1 
ATOM   5811 C  C     . ILE D  1 197 ? 136.973 -23.838 -9.737  1.00 62.08  ? 196  ILE D C     1 
ATOM   5812 O  O     . ILE D  1 197 ? 137.024 -23.573 -10.933 1.00 59.95  ? 196  ILE D O     1 
ATOM   5813 C  CB    . ILE D  1 197 ? 135.322 -22.806 -8.149  1.00 65.59  ? 196  ILE D CB    1 
ATOM   5814 C  CG1   . ILE D  1 197 ? 133.852 -22.821 -7.710  1.00 71.16  ? 196  ILE D CG1   1 
ATOM   5815 C  CG2   . ILE D  1 197 ? 135.630 -21.497 -8.885  1.00 63.38  ? 196  ILE D CG2   1 
ATOM   5816 C  CD1   . ILE D  1 197 ? 133.493 -23.920 -6.720  1.00 72.28  ? 196  ILE D CD1   1 
ATOM   5817 N  N     . LEU E  1 9   ? 121.991 0.528   43.362  1.00 68.31  ? 8    LEU E N     1 
ATOM   5818 C  CA    . LEU E  1 9   ? 122.746 0.416   44.664  1.00 71.58  ? 8    LEU E CA    1 
ATOM   5819 C  C     . LEU E  1 9   ? 123.077 1.799   45.264  1.00 76.19  ? 8    LEU E C     1 
ATOM   5820 O  O     . LEU E  1 9   ? 123.282 1.937   46.488  1.00 77.24  ? 8    LEU E O     1 
ATOM   5821 C  CB    . LEU E  1 9   ? 124.050 -0.380  44.451  1.00 69.98  ? 8    LEU E CB    1 
ATOM   5822 C  CG    . LEU E  1 9   ? 124.629 -1.327  45.538  1.00 65.03  ? 8    LEU E CG    1 
ATOM   5823 C  CD1   . LEU E  1 9   ? 124.157 -1.015  46.967  1.00 56.40  ? 8    LEU E CD1   1 
ATOM   5824 C  CD2   . LEU E  1 9   ? 124.385 -2.803  45.203  1.00 60.28  ? 8    LEU E CD2   1 
ATOM   5825 N  N     . ARG E  1 10  ? 123.061 2.812   44.394  1.00 79.14  ? 9    ARG E N     1 
ATOM   5826 C  CA    . ARG E  1 10  ? 123.784 4.073   44.584  1.00 82.24  ? 9    ARG E CA    1 
ATOM   5827 C  C     . ARG E  1 10  ? 122.894 5.243   45.042  1.00 85.30  ? 9    ARG E C     1 
ATOM   5828 O  O     . ARG E  1 10  ? 121.664 5.204   44.906  1.00 86.47  ? 9    ARG E O     1 
ATOM   5829 C  CB    . ARG E  1 10  ? 124.488 4.436   43.255  1.00 78.74  ? 9    ARG E CB    1 
ATOM   5830 C  CG    . ARG E  1 10  ? 125.518 5.548   43.345  1.00 71.38  ? 9    ARG E CG    1 
ATOM   5831 C  CD    . ARG E  1 10  ? 126.575 5.433   42.264  1.00 64.78  ? 9    ARG E CD    1 
ATOM   5832 N  N     . LYS E  1 11  ? 123.542 6.267   45.602  1.00 84.73  ? 10   LYS E N     1 
ATOM   5833 C  CA    . LYS E  1 11  ? 122.909 7.555   45.902  1.00 80.81  ? 10   LYS E CA    1 
ATOM   5834 C  C     . LYS E  1 11  ? 123.981 8.635   46.124  1.00 77.91  ? 10   LYS E C     1 
ATOM   5835 O  O     . LYS E  1 11  ? 123.998 9.294   47.167  1.00 81.48  ? 10   LYS E O     1 
ATOM   5836 C  CB    . LYS E  1 11  ? 122.002 7.438   47.132  1.00 80.43  ? 10   LYS E CB    1 
ATOM   5837 N  N     . CYS E  1 12  ? 124.888 8.780   45.150  1.00 71.43  ? 11   CYS E N     1 
ATOM   5838 C  CA    . CYS E  1 12  ? 125.903 9.864   45.122  1.00 68.60  ? 11   CYS E CA    1 
ATOM   5839 C  C     . CYS E  1 12  ? 125.977 10.479  43.709  1.00 62.54  ? 11   CYS E C     1 
ATOM   5840 O  O     . CYS E  1 12  ? 125.188 10.101  42.842  1.00 62.32  ? 11   CYS E O     1 
ATOM   5841 C  CB    . CYS E  1 12  ? 127.281 9.351   45.560  1.00 69.14  ? 11   CYS E CB    1 
ATOM   5842 S  SG    . CYS E  1 12  ? 128.301 8.709   44.211  1.00 77.30  ? 11   CYS E SG    1 
ATOM   5843 N  N     . LYS E  1 13  ? 126.931 11.383  43.472  1.00 56.30  ? 12   LYS E N     1 
ATOM   5844 C  CA    . LYS E  1 13  ? 126.949 12.217  42.255  1.00 58.02  ? 12   LYS E CA    1 
ATOM   5845 C  C     . LYS E  1 13  ? 127.113 11.469  40.896  1.00 55.31  ? 12   LYS E C     1 
ATOM   5846 O  O     . LYS E  1 13  ? 128.153 10.898  40.600  1.00 52.86  ? 12   LYS E O     1 
ATOM   5847 C  CB    . LYS E  1 13  ? 128.018 13.314  42.397  1.00 60.41  ? 12   LYS E CB    1 
ATOM   5848 N  N     . ILE E  1 14  ? 126.059 11.468  40.088  1.00 53.71  ? 13   ILE E N     1 
ATOM   5849 C  CA    . ILE E  1 14  ? 126.118 11.013  38.694  1.00 52.90  ? 13   ILE E CA    1 
ATOM   5850 C  C     . ILE E  1 14  ? 125.694 12.162  37.769  1.00 52.46  ? 13   ILE E C     1 
ATOM   5851 O  O     . ILE E  1 14  ? 124.591 12.720  37.913  1.00 49.47  ? 13   ILE E O     1 
ATOM   5852 C  CB    . ILE E  1 14  ? 125.190 9.802   38.435  1.00 51.94  ? 13   ILE E CB    1 
ATOM   5853 C  CG1   . ILE E  1 14  ? 125.516 8.644   39.375  1.00 55.53  ? 13   ILE E CG1   1 
ATOM   5854 C  CG2   . ILE E  1 14  ? 125.288 9.352   36.974  1.00 61.70  ? 13   ILE E CG2   1 
ATOM   5855 C  CD1   . ILE E  1 14  ? 124.405 7.633   39.505  1.00 45.18  ? 13   ILE E CD1   1 
ATOM   5856 N  N     . ILE E  1 15  ? 126.581 12.492  36.830  1.00 52.96  ? 14   ILE E N     1 
ATOM   5857 C  CA    . ILE E  1 15  ? 126.402 13.582  35.880  1.00 52.26  ? 14   ILE E CA    1 
ATOM   5858 C  C     . ILE E  1 15  ? 126.492 13.007  34.473  1.00 52.03  ? 14   ILE E C     1 
ATOM   5859 O  O     . ILE E  1 15  ? 127.474 12.358  34.138  1.00 49.98  ? 14   ILE E O     1 
ATOM   5860 C  CB    . ILE E  1 15  ? 127.553 14.616  35.995  1.00 54.06  ? 14   ILE E CB    1 
ATOM   5861 C  CG1   . ILE E  1 15  ? 127.774 15.086  37.450  1.00 70.68  ? 14   ILE E CG1   1 
ATOM   5862 C  CG2   . ILE E  1 15  ? 127.341 15.800  35.052  1.00 42.83  ? 14   ILE E CG2   1 
ATOM   5863 C  CD1   . ILE E  1 15  ? 126.604 15.803  38.077  1.00 77.69  ? 14   ILE E CD1   1 
ATOM   5864 N  N     . PHE E  1 16  ? 125.476 13.239  33.648  1.00 56.54  ? 15   PHE E N     1 
ATOM   5865 C  CA    . PHE E  1 16  ? 125.570 12.916  32.233  1.00 54.24  ? 15   PHE E CA    1 
ATOM   5866 C  C     . PHE E  1 16  ? 125.958 14.165  31.475  1.00 55.89  ? 15   PHE E C     1 
ATOM   5867 O  O     . PHE E  1 16  ? 125.441 15.252  31.746  1.00 53.84  ? 15   PHE E O     1 
ATOM   5868 C  CB    . PHE E  1 16  ? 124.253 12.404  31.668  1.00 53.58  ? 15   PHE E CB    1 
ATOM   5869 C  CG    . PHE E  1 16  ? 123.781 11.080  32.237  1.00 56.80  ? 15   PHE E CG    1 
ATOM   5870 C  CD1   . PHE E  1 16  ? 124.600 10.264  33.001  1.00 54.20  ? 15   PHE E CD1   1 
ATOM   5871 C  CD2   . PHE E  1 16  ? 122.490 10.647  31.974  1.00 53.56  ? 15   PHE E CD2   1 
ATOM   5872 C  CE1   . PHE E  1 16  ? 124.131 9.057   33.494  1.00 59.53  ? 15   PHE E CE1   1 
ATOM   5873 C  CE2   . PHE E  1 16  ? 122.021 9.426   32.469  1.00 58.81  ? 15   PHE E CE2   1 
ATOM   5874 C  CZ    . PHE E  1 16  ? 122.836 8.642   33.217  1.00 59.38  ? 15   PHE E CZ    1 
ATOM   5875 N  N     . ILE E  1 17  ? 126.855 14.007  30.512  1.00 55.78  ? 16   ILE E N     1 
ATOM   5876 C  CA    . ILE E  1 17  ? 127.221 15.110  29.645  1.00 57.86  ? 16   ILE E CA    1 
ATOM   5877 C  C     . ILE E  1 17  ? 127.082 14.712  28.159  1.00 57.86  ? 16   ILE E C     1 
ATOM   5878 O  O     . ILE E  1 17  ? 127.627 13.718  27.715  1.00 60.08  ? 16   ILE E O     1 
ATOM   5879 C  CB    . ILE E  1 17  ? 128.626 15.683  29.990  1.00 60.46  ? 16   ILE E CB    1 
ATOM   5880 C  CG1   . ILE E  1 17  ? 128.907 16.939  29.147  1.00 63.04  ? 16   ILE E CG1   1 
ATOM   5881 C  CG2   . ILE E  1 17  ? 129.728 14.634  29.800  1.00 64.60  ? 16   ILE E CG2   1 
ATOM   5882 C  CD1   . ILE E  1 17  ? 130.138 17.674  29.575  1.00 66.88  ? 16   ILE E CD1   1 
ATOM   5883 N  N     . ILE E  1 18  ? 126.332 15.517  27.415  1.00 57.75  ? 17   ILE E N     1 
ATOM   5884 C  CA    . ILE E  1 18  ? 125.973 15.238  26.031  1.00 62.65  ? 17   ILE E CA    1 
ATOM   5885 C  C     . ILE E  1 18  ? 126.394 16.422  25.158  1.00 60.20  ? 17   ILE E C     1 
ATOM   5886 O  O     . ILE E  1 18  ? 126.216 17.566  25.541  1.00 59.76  ? 17   ILE E O     1 
ATOM   5887 C  CB    . ILE E  1 18  ? 124.439 15.008  25.921  1.00 62.99  ? 17   ILE E CB    1 
ATOM   5888 C  CG1   . ILE E  1 18  ? 124.058 13.698  26.620  1.00 73.83  ? 17   ILE E CG1   1 
ATOM   5889 C  CG2   . ILE E  1 18  ? 123.973 14.972  24.474  1.00 73.79  ? 17   ILE E CG2   1 
ATOM   5890 C  CD1   . ILE E  1 18  ? 122.692 13.751  27.240  1.00 79.41  ? 17   ILE E CD1   1 
ATOM   5891 N  N     . GLY E  1 19  ? 126.963 16.136  23.994  1.00 56.37  ? 18   GLY E N     1 
ATOM   5892 C  CA    . GLY E  1 19  ? 127.312 17.187  23.038  1.00 57.34  ? 18   GLY E CA    1 
ATOM   5893 C  C     . GLY E  1 19  ? 127.684 16.576  21.706  1.00 55.45  ? 18   GLY E C     1 
ATOM   5894 O  O     . GLY E  1 19  ? 128.152 15.459  21.655  1.00 54.08  ? 18   GLY E O     1 
ATOM   5895 N  N     . GLY E  1 20  ? 127.481 17.311  20.622  1.00 57.59  ? 19   GLY E N     1 
ATOM   5896 C  CA    . GLY E  1 20  ? 127.782 16.799  19.288  1.00 54.81  ? 19   GLY E CA    1 
ATOM   5897 C  C     . GLY E  1 20  ? 129.258 16.837  18.998  1.00 54.18  ? 19   GLY E C     1 
ATOM   5898 O  O     . GLY E  1 20  ? 130.024 17.406  19.775  1.00 53.12  ? 19   GLY E O     1 
ATOM   5899 N  N     . PRO E  1 21  ? 129.666 16.219  17.880  1.00 55.50  ? 20   PRO E N     1 
ATOM   5900 C  CA    . PRO E  1 21  ? 131.060 16.219  17.463  1.00 56.32  ? 20   PRO E CA    1 
ATOM   5901 C  C     . PRO E  1 21  ? 131.535 17.639  17.214  1.00 54.37  ? 20   PRO E C     1 
ATOM   5902 O  O     . PRO E  1 21  ? 130.887 18.389  16.502  1.00 52.31  ? 20   PRO E O     1 
ATOM   5903 C  CB    . PRO E  1 21  ? 131.036 15.405  16.160  1.00 58.74  ? 20   PRO E CB    1 
ATOM   5904 C  CG    . PRO E  1 21  ? 129.657 15.549  15.642  1.00 55.81  ? 20   PRO E CG    1 
ATOM   5905 C  CD    . PRO E  1 21  ? 128.820 15.506  16.904  1.00 57.44  ? 20   PRO E CD    1 
ATOM   5906 N  N     . GLY E  1 22  ? 132.644 18.021  17.832  1.00 56.74  ? 21   GLY E N     1 
ATOM   5907 C  CA    . GLY E  1 22  ? 133.147 19.387  17.702  1.00 56.65  ? 21   GLY E CA    1 
ATOM   5908 C  C     . GLY E  1 22  ? 132.478 20.398  18.620  1.00 58.26  ? 21   GLY E C     1 
ATOM   5909 O  O     . GLY E  1 22  ? 132.770 21.581  18.535  1.00 57.26  ? 21   GLY E O     1 
ATOM   5910 N  N     . SER E  1 23  ? 131.585 19.944  19.498  1.00 58.22  ? 22   SER E N     1 
ATOM   5911 C  CA    . SER E  1 23  ? 131.009 20.807  20.534  1.00 58.19  ? 22   SER E CA    1 
ATOM   5912 C  C     . SER E  1 23  ? 132.045 21.294  21.567  1.00 59.94  ? 22   SER E C     1 
ATOM   5913 O  O     . SER E  1 23  ? 131.830 22.316  22.229  1.00 63.21  ? 22   SER E O     1 
ATOM   5914 C  CB    . SER E  1 23  ? 129.890 20.082  21.271  1.00 57.86  ? 22   SER E CB    1 
ATOM   5915 O  OG    . SER E  1 23  ? 130.364 18.880  21.855  1.00 60.90  ? 22   SER E OG    1 
ATOM   5916 N  N     . GLY E  1 24  ? 133.156 20.569  21.689  1.00 56.74  ? 23   GLY E N     1 
ATOM   5917 C  CA    . GLY E  1 24  ? 134.154 20.825  22.706  1.00 55.21  ? 23   GLY E CA    1 
ATOM   5918 C  C     . GLY E  1 24  ? 134.005 19.963  23.956  1.00 59.16  ? 23   GLY E C     1 
ATOM   5919 O  O     . GLY E  1 24  ? 134.591 20.259  24.991  1.00 61.71  ? 23   GLY E O     1 
ATOM   5920 N  N     . LYS E  1 25  ? 133.246 18.876  23.859  1.00 62.02  ? 24   LYS E N     1 
ATOM   5921 C  CA    . LYS E  1 25  ? 132.913 18.068  25.022  1.00 58.36  ? 24   LYS E CA    1 
ATOM   5922 C  C     . LYS E  1 25  ? 134.127 17.337  25.603  1.00 58.88  ? 24   LYS E C     1 
ATOM   5923 O  O     . LYS E  1 25  ? 134.261 17.223  26.817  1.00 59.29  ? 24   LYS E O     1 
ATOM   5924 C  CB    . LYS E  1 25  ? 131.818 17.070  24.658  1.00 59.09  ? 24   LYS E CB    1 
ATOM   5925 C  CG    . LYS E  1 25  ? 131.507 16.074  25.776  1.00 60.30  ? 24   LYS E CG    1 
ATOM   5926 C  CD    . LYS E  1 25  ? 130.176 15.383  25.579  1.00 57.40  ? 24   LYS E CD    1 
ATOM   5927 C  CE    . LYS E  1 25  ? 130.110 14.590  24.310  1.00 56.14  ? 24   LYS E CE    1 
ATOM   5928 N  NZ    . LYS E  1 25  ? 131.071 13.503  24.296  1.00 60.13  ? 24   LYS E NZ    1 
ATOM   5929 N  N     . GLY E  1 26  ? 135.006 16.845  24.736  1.00 60.72  ? 25   GLY E N     1 
ATOM   5930 C  CA    . GLY E  1 26  ? 136.179 16.103  25.177  1.00 58.36  ? 25   GLY E CA    1 
ATOM   5931 C  C     . GLY E  1 26  ? 137.126 16.909  26.046  1.00 59.87  ? 25   GLY E C     1 
ATOM   5932 O  O     . GLY E  1 26  ? 137.529 16.462  27.119  1.00 61.52  ? 25   GLY E O     1 
ATOM   5933 N  N     . THR E  1 27  ? 137.478 18.099  25.577  1.00 60.74  ? 26   THR E N     1 
ATOM   5934 C  CA    . THR E  1 27  ? 138.343 18.991  26.335  1.00 62.04  ? 26   THR E CA    1 
ATOM   5935 C  C     . THR E  1 27  ? 137.645 19.485  27.602  1.00 60.21  ? 26   THR E C     1 
ATOM   5936 O  O     . THR E  1 27  ? 138.273 19.629  28.647  1.00 58.68  ? 26   THR E O     1 
ATOM   5937 C  CB    . THR E  1 27  ? 138.856 20.200  25.482  1.00 59.34  ? 26   THR E CB    1 
ATOM   5938 O  OG1   . THR E  1 27  ? 137.993 20.421  24.368  1.00 73.74  ? 26   THR E OG1   1 
ATOM   5939 C  CG2   . THR E  1 27  ? 140.236 19.919  24.935  1.00 73.23  ? 26   THR E CG2   1 
ATOM   5940 N  N     . GLN E  1 28  ? 136.343 19.734  27.529  1.00 59.33  ? 27   GLN E N     1 
ATOM   5941 C  CA    . GLN E  1 28  ? 135.630 20.190  28.721  1.00 58.58  ? 27   GLN E CA    1 
ATOM   5942 C  C     . GLN E  1 28  ? 135.590 19.109  29.822  1.00 57.59  ? 27   GLN E C     1 
ATOM   5943 O  O     . GLN E  1 28  ? 135.725 19.413  31.006  1.00 57.52  ? 27   GLN E O     1 
ATOM   5944 C  CB    . GLN E  1 28  ? 134.237 20.697  28.353  1.00 54.64  ? 27   GLN E CB    1 
ATOM   5945 C  CG    . GLN E  1 28  ? 134.241 22.030  27.579  1.00 58.37  ? 27   GLN E CG    1 
ATOM   5946 C  CD    . GLN E  1 28  ? 134.857 23.197  28.353  1.00 58.35  ? 27   GLN E CD    1 
ATOM   5947 O  OE1   . GLN E  1 28  ? 134.839 23.223  29.579  1.00 59.06  ? 27   GLN E OE1   1 
ATOM   5948 N  NE2   . GLN E  1 28  ? 135.398 24.172  27.626  1.00 52.84  ? 27   GLN E NE2   1 
ATOM   5949 N  N     . CYS E  1 29  ? 135.448 17.847  29.424  1.00 58.31  ? 28   CYS E N     1 
ATOM   5950 C  CA    . CYS E  1 29  ? 135.523 16.734  30.368  1.00 58.85  ? 28   CYS E CA    1 
ATOM   5951 C  C     . CYS E  1 29  ? 136.870 16.631  31.092  1.00 58.28  ? 28   CYS E C     1 
ATOM   5952 O  O     . CYS E  1 29  ? 136.905 16.278  32.264  1.00 58.69  ? 28   CYS E O     1 
ATOM   5953 C  CB    . CYS E  1 29  ? 135.217 15.414  29.657  1.00 62.15  ? 28   CYS E CB    1 
ATOM   5954 S  SG    . CYS E  1 29  ? 133.522 15.288  29.155  1.00 66.25  ? 28   CYS E SG    1 
ATOM   5955 N  N     . GLU E  1 30  ? 137.966 16.936  30.398  1.00 58.35  ? 29   GLU E N     1 
ATOM   5956 C  CA    . GLU E  1 30  ? 139.300 16.920  31.011  1.00 59.93  ? 29   GLU E CA    1 
ATOM   5957 C  C     . GLU E  1 30  ? 139.415 18.001  32.062  1.00 60.56  ? 29   GLU E C     1 
ATOM   5958 O  O     . GLU E  1 30  ? 139.983 17.774  33.133  1.00 59.94  ? 29   GLU E O     1 
ATOM   5959 C  CB    . GLU E  1 30  ? 140.397 17.149  29.968  1.00 58.55  ? 29   GLU E CB    1 
ATOM   5960 C  CG    . GLU E  1 30  ? 140.530 16.036  28.939  1.00 73.32  ? 29   GLU E CG    1 
ATOM   5961 C  CD    . GLU E  1 30  ? 141.287 16.466  27.693  1.00 79.98  ? 29   GLU E CD    1 
ATOM   5962 O  OE1   . GLU E  1 30  ? 142.155 17.358  27.795  1.00 79.82  ? 29   GLU E OE1   1 
ATOM   5963 O  OE2   . GLU E  1 30  ? 141.010 15.909  26.607  1.00 95.70  ? 29   GLU E OE2   1 
ATOM   5964 N  N     . LYS E  1 31  ? 138.912 19.189  31.723  1.00 59.19  ? 30   LYS E N     1 
ATOM   5965 C  CA    . LYS E  1 31  ? 138.859 20.319  32.647  1.00 57.64  ? 30   LYS E CA    1 
ATOM   5966 C  C     . LYS E  1 31  ? 138.031 19.998  33.890  1.00 55.46  ? 30   LYS E C     1 
ATOM   5967 O  O     . LYS E  1 31  ? 138.439 20.324  35.004  1.00 60.73  ? 30   LYS E O     1 
ATOM   5968 C  CB    . LYS E  1 31  ? 138.278 21.560  31.962  1.00 58.54  ? 30   LYS E CB    1 
ATOM   5969 C  CG    . LYS E  1 31  ? 139.147 22.175  30.859  1.00 70.08  ? 30   LYS E CG    1 
ATOM   5970 C  CD    . LYS E  1 31  ? 138.594 23.544  30.414  1.00 66.66  ? 30   LYS E CD    1 
ATOM   5971 C  CE    . LYS E  1 31  ? 139.482 24.226  29.366  1.00 73.05  ? 30   LYS E CE    1 
ATOM   5972 N  NZ    . LYS E  1 31  ? 139.466 25.724  29.477  1.00 66.47  ? 30   LYS E NZ    1 
ATOM   5973 N  N     . LEU E  1 32  ? 136.875 19.366  33.705  1.00 57.04  ? 31   LEU E N     1 
ATOM   5974 C  CA    . LEU E  1 32  ? 136.021 18.980  34.837  1.00 57.81  ? 31   LEU E CA    1 
ATOM   5975 C  C     . LEU E  1 32  ? 136.695 17.970  35.751  1.00 57.33  ? 31   LEU E C     1 
ATOM   5976 O  O     . LEU E  1 32  ? 136.614 18.080  36.976  1.00 58.37  ? 31   LEU E O     1 
ATOM   5977 C  CB    . LEU E  1 32  ? 134.693 18.394  34.348  1.00 57.99  ? 31   LEU E CB    1 
ATOM   5978 C  CG    . LEU E  1 32  ? 133.784 19.427  33.701  1.00 56.41  ? 31   LEU E CG    1 
ATOM   5979 C  CD1   . LEU E  1 32  ? 132.605 18.737  33.001  1.00 66.32  ? 31   LEU E CD1   1 
ATOM   5980 C  CD2   . LEU E  1 32  ? 133.329 20.476  34.730  1.00 57.62  ? 31   LEU E CD2   1 
ATOM   5981 N  N     . VAL E  1 33  ? 137.350 16.984  35.144  1.00 57.59  ? 32   VAL E N     1 
ATOM   5982 C  CA    . VAL E  1 33  ? 138.082 15.963  35.890  1.00 56.60  ? 32   VAL E CA    1 
ATOM   5983 C  C     . VAL E  1 33  ? 139.228 16.618  36.680  1.00 58.20  ? 32   VAL E C     1 
ATOM   5984 O  O     . VAL E  1 33  ? 139.379 16.362  37.882  1.00 58.06  ? 32   VAL E O     1 
ATOM   5985 C  CB    . VAL E  1 33  ? 138.596 14.837  34.937  1.00 56.57  ? 32   VAL E CB    1 
ATOM   5986 C  CG1   . VAL E  1 33  ? 139.590 13.927  35.642  1.00 61.26  ? 32   VAL E CG1   1 
ATOM   5987 C  CG2   . VAL E  1 33  ? 137.420 14.019  34.390  1.00 54.27  ? 32   VAL E CG2   1 
ATOM   5988 N  N     . GLU E  1 34  ? 140.005 17.477  36.013  1.00 56.90  ? 33   GLU E N     1 
ATOM   5989 C  CA    . GLU E  1 34  ? 141.076 18.225  36.673  1.00 56.71  ? 33   GLU E CA    1 
ATOM   5990 C  C     . GLU E  1 34  ? 140.539 19.022  37.873  1.00 57.73  ? 33   GLU E C     1 
ATOM   5991 O  O     . GLU E  1 34  ? 141.136 18.993  38.942  1.00 55.13  ? 33   GLU E O     1 
ATOM   5992 C  CB    . GLU E  1 34  ? 141.801 19.164  35.686  1.00 57.94  ? 33   GLU E CB    1 
ATOM   5993 C  CG    . GLU E  1 34  ? 143.005 19.944  36.292  1.00 60.90  ? 33   GLU E CG    1 
ATOM   5994 N  N     . LYS E  1 35  ? 139.409 19.708  37.700  1.00 57.21  ? 34   LYS E N     1 
ATOM   5995 C  CA    . LYS E  1 35  ? 138.864 20.572  38.752  1.00 53.41  ? 34   LYS E CA    1 
ATOM   5996 C  C     . LYS E  1 35  ? 138.130 19.795  39.837  1.00 53.56  ? 34   LYS E C     1 
ATOM   5997 O  O     . LYS E  1 35  ? 138.318 20.073  41.011  1.00 51.52  ? 34   LYS E O     1 
ATOM   5998 C  CB    . LYS E  1 35  ? 137.898 21.590  38.158  1.00 57.19  ? 34   LYS E CB    1 
ATOM   5999 C  CG    . LYS E  1 35  ? 137.599 22.784  39.081  1.00 47.95  ? 34   LYS E CG    1 
ATOM   6000 C  CD    . LYS E  1 35  ? 136.137 23.212  38.988  1.00 66.07  ? 34   LYS E CD    1 
ATOM   6001 C  CE    . LYS E  1 35  ? 135.915 24.692  39.177  1.00 41.48  ? 34   LYS E CE    1 
ATOM   6002 N  NZ    . LYS E  1 35  ? 136.648 25.206  40.318  1.00 53.74  ? 34   LYS E NZ    1 
ATOM   6003 N  N     . TYR E  1 36  ? 137.282 18.841  39.441  1.00 52.95  ? 35   TYR E N     1 
ATOM   6004 C  CA    . TYR E  1 36  ? 136.352 18.180  40.374  1.00 50.90  ? 35   TYR E CA    1 
ATOM   6005 C  C     . TYR E  1 36  ? 136.779 16.792  40.855  1.00 52.26  ? 35   TYR E C     1 
ATOM   6006 O  O     . TYR E  1 36  ? 136.242 16.297  41.849  1.00 51.71  ? 35   TYR E O     1 
ATOM   6007 C  CB    . TYR E  1 36  ? 134.962 18.077  39.747  1.00 55.55  ? 35   TYR E CB    1 
ATOM   6008 C  CG    . TYR E  1 36  ? 134.241 19.401  39.627  1.00 55.29  ? 35   TYR E CG    1 
ATOM   6009 C  CD1   . TYR E  1 36  ? 133.616 19.982  40.731  1.00 59.66  ? 35   TYR E CD1   1 
ATOM   6010 C  CD2   . TYR E  1 36  ? 134.173 20.066  38.416  1.00 50.22  ? 35   TYR E CD2   1 
ATOM   6011 C  CE1   . TYR E  1 36  ? 132.946 21.200  40.627  1.00 56.13  ? 35   TYR E CE1   1 
ATOM   6012 C  CE2   . TYR E  1 36  ? 133.504 21.289  38.302  1.00 66.76  ? 35   TYR E CE2   1 
ATOM   6013 C  CZ    . TYR E  1 36  ? 132.898 21.850  39.412  1.00 56.63  ? 35   TYR E CZ    1 
ATOM   6014 O  OH    . TYR E  1 36  ? 132.236 23.054  39.294  1.00 57.14  ? 35   TYR E OH    1 
ATOM   6015 N  N     . GLY E  1 37  ? 137.722 16.163  40.152  1.00 51.56  ? 36   GLY E N     1 
ATOM   6016 C  CA    . GLY E  1 37  ? 138.169 14.808  40.494  1.00 54.10  ? 36   GLY E CA    1 
ATOM   6017 C  C     . GLY E  1 37  ? 137.181 13.706  40.131  1.00 56.40  ? 36   GLY E C     1 
ATOM   6018 O  O     . GLY E  1 37  ? 137.215 12.608  40.706  1.00 56.03  ? 36   GLY E O     1 
ATOM   6019 N  N     . PHE E  1 38  ? 136.310 13.988  39.163  1.00 58.06  ? 37   PHE E N     1 
ATOM   6020 C  CA    . PHE E  1 38  ? 135.297 13.020  38.740  1.00 55.19  ? 37   PHE E CA    1 
ATOM   6021 C  C     . PHE E  1 38  ? 135.879 11.831  37.987  1.00 54.60  ? 37   PHE E C     1 
ATOM   6022 O  O     . PHE E  1 38  ? 136.885 11.935  37.275  1.00 55.30  ? 37   PHE E O     1 
ATOM   6023 C  CB    . PHE E  1 38  ? 134.256 13.678  37.843  1.00 55.85  ? 37   PHE E CB    1 
ATOM   6024 C  CG    . PHE E  1 38  ? 133.359 14.649  38.548  1.00 62.84  ? 37   PHE E CG    1 
ATOM   6025 C  CD1   . PHE E  1 38  ? 132.934 14.425  39.857  1.00 61.42  ? 37   PHE E CD1   1 
ATOM   6026 C  CD2   . PHE E  1 38  ? 132.902 15.784  37.880  1.00 61.87  ? 37   PHE E CD2   1 
ATOM   6027 C  CE1   . PHE E  1 38  ? 132.087 15.324  40.497  1.00 61.41  ? 37   PHE E CE1   1 
ATOM   6028 C  CE2   . PHE E  1 38  ? 132.059 16.685  38.514  1.00 67.86  ? 37   PHE E CE2   1 
ATOM   6029 C  CZ    . PHE E  1 38  ? 131.650 16.450  39.833  1.00 65.84  ? 37   PHE E CZ    1 
ATOM   6030 N  N     . THR E  1 39  ? 135.222 10.696  38.146  1.00 52.88  ? 38   THR E N     1 
ATOM   6031 C  CA    . THR E  1 39  ? 135.535 9.529   37.354  1.00 57.38  ? 38   THR E CA    1 
ATOM   6032 C  C     . THR E  1 39  ? 134.804 9.702   36.020  1.00 56.99  ? 38   THR E C     1 
ATOM   6033 O  O     . THR E  1 39  ? 133.581 9.662   35.972  1.00 55.53  ? 38   THR E O     1 
ATOM   6034 C  CB    . THR E  1 39  ? 135.053 8.240   38.057  1.00 57.26  ? 38   THR E CB    1 
ATOM   6035 O  OG1   . THR E  1 39  ? 135.505 8.233   39.415  1.00 68.18  ? 38   THR E OG1   1 
ATOM   6036 C  CG2   . THR E  1 39  ? 135.563 6.992   37.333  1.00 57.96  ? 38   THR E CG2   1 
ATOM   6037 N  N     . HIS E  1 40  ? 135.562 9.929   34.955  1.00 57.98  ? 39   HIS E N     1 
ATOM   6038 C  CA    . HIS E  1 40  ? 135.005 10.118  33.627  1.00 56.42  ? 39   HIS E CA    1 
ATOM   6039 C  C     . HIS E  1 40  ? 134.897 8.762   32.927  1.00 57.58  ? 39   HIS E C     1 
ATOM   6040 O  O     . HIS E  1 40  ? 135.896 8.070   32.739  1.00 53.71  ? 39   HIS E O     1 
ATOM   6041 C  CB    . HIS E  1 40  ? 135.882 11.094  32.827  1.00 60.22  ? 39   HIS E CB    1 
ATOM   6042 C  CG    . HIS E  1 40  ? 135.464 11.273  31.399  1.00 57.44  ? 39   HIS E CG    1 
ATOM   6043 N  ND1   . HIS E  1 40  ? 136.336 11.700  30.423  1.00 69.15  ? 39   HIS E ND1   1 
ATOM   6044 C  CD2   . HIS E  1 40  ? 134.268 11.103  30.785  1.00 62.81  ? 39   HIS E CD2   1 
ATOM   6045 C  CE1   . HIS E  1 40  ? 135.701 11.778  29.268  1.00 73.57  ? 39   HIS E CE1   1 
ATOM   6046 N  NE2   . HIS E  1 40  ? 134.444 11.419  29.459  1.00 74.33  ? 39   HIS E NE2   1 
ATOM   6047 N  N     . LEU E  1 41  ? 133.677 8.404   32.527  1.00 57.82  ? 40   LEU E N     1 
ATOM   6048 C  CA    . LEU E  1 41  ? 133.408 7.138   31.845  1.00 57.42  ? 40   LEU E CA    1 
ATOM   6049 C  C     . LEU E  1 41  ? 132.732 7.377   30.507  1.00 59.07  ? 40   LEU E C     1 
ATOM   6050 O  O     . LEU E  1 41  ? 131.840 8.233   30.391  1.00 59.01  ? 40   LEU E O     1 
ATOM   6051 C  CB    . LEU E  1 41  ? 132.483 6.270   32.688  1.00 56.70  ? 40   LEU E CB    1 
ATOM   6052 C  CG    . LEU E  1 41  ? 133.005 5.890   34.064  1.00 56.95  ? 40   LEU E CG    1 
ATOM   6053 C  CD1   . LEU E  1 41  ? 131.919 5.187   34.893  1.00 64.16  ? 40   LEU E CD1   1 
ATOM   6054 C  CD2   . LEU E  1 41  ? 134.225 4.996   33.912  1.00 64.62  ? 40   LEU E CD2   1 
ATOM   6055 N  N     . SER E  1 42  ? 133.153 6.618   29.502  1.00 56.20  ? 41   SER E N     1 
ATOM   6056 C  CA    . SER E  1 42  ? 132.457 6.591   28.233  1.00 57.40  ? 41   SER E CA    1 
ATOM   6057 C  C     . SER E  1 42  ? 132.374 5.159   27.742  1.00 56.58  ? 41   SER E C     1 
ATOM   6058 O  O     . SER E  1 42  ? 133.225 4.336   28.090  1.00 56.31  ? 41   SER E O     1 
ATOM   6059 C  CB    . SER E  1 42  ? 133.160 7.475   27.197  1.00 56.75  ? 41   SER E CB    1 
ATOM   6060 O  OG    . SER E  1 42  ? 134.385 6.919   26.794  1.00 59.29  ? 41   SER E OG    1 
ATOM   6061 N  N     . THR E  1 43  ? 131.364 4.865   26.924  1.00 54.62  ? 42   THR E N     1 
ATOM   6062 C  CA    . THR E  1 43  ? 131.187 3.506   26.424  1.00 59.20  ? 42   THR E CA    1 
ATOM   6063 C  C     . THR E  1 43  ? 132.392 3.028   25.597  1.00 57.42  ? 42   THR E C     1 
ATOM   6064 O  O     . THR E  1 43  ? 132.785 1.858   25.684  1.00 59.65  ? 42   THR E O     1 
ATOM   6065 C  CB    . THR E  1 43  ? 129.924 3.354   25.585  1.00 60.41  ? 42   THR E CB    1 
ATOM   6066 O  OG1   . THR E  1 43  ? 130.054 4.123   24.397  1.00 67.62  ? 42   THR E OG1   1 
ATOM   6067 C  CG2   . THR E  1 43  ? 128.698 3.802   26.355  1.00 62.98  ? 42   THR E CG2   1 
ATOM   6068 N  N     . GLY E  1 44  ? 132.975 3.938   24.818  1.00 52.63  ? 43   GLY E N     1 
ATOM   6069 C  CA    . GLY E  1 44  ? 134.095 3.621   23.958  1.00 53.09  ? 43   GLY E CA    1 
ATOM   6070 C  C     . GLY E  1 44  ? 135.309 3.164   24.733  1.00 57.15  ? 43   GLY E C     1 
ATOM   6071 O  O     . GLY E  1 44  ? 135.956 2.170   24.366  1.00 56.49  ? 43   GLY E O     1 
ATOM   6072 N  N     . GLU E  1 45  ? 135.605 3.875   25.817  1.00 55.65  ? 44   GLU E N     1 
ATOM   6073 C  CA    . GLU E  1 45  ? 136.713 3.505   26.695  1.00 57.50  ? 44   GLU E CA    1 
ATOM   6074 C  C     . GLU E  1 45  ? 136.403 2.226   27.500  1.00 53.98  ? 44   GLU E C     1 
ATOM   6075 O  O     . GLU E  1 45  ? 137.293 1.385   27.710  1.00 55.08  ? 44   GLU E O     1 
ATOM   6076 C  CB    . GLU E  1 45  ? 137.098 4.700   27.598  1.00 61.30  ? 44   GLU E CB    1 
ATOM   6077 C  CG    . GLU E  1 45  ? 138.201 4.442   28.644  1.00 68.05  ? 44   GLU E CG    1 
ATOM   6078 C  CD    . GLU E  1 45  ? 139.472 3.778   28.077  1.00 84.67  ? 44   GLU E CD    1 
ATOM   6079 O  OE1   . GLU E  1 45  ? 140.032 2.877   28.759  1.00 72.87  ? 44   GLU E OE1   1 
ATOM   6080 O  OE2   . GLU E  1 45  ? 139.906 4.154   26.959  1.00 79.53  ? 44   GLU E OE2   1 
ATOM   6081 N  N     . LEU E  1 46  ? 135.158 2.066   27.941  1.00 53.58  ? 45   LEU E N     1 
ATOM   6082 C  CA    . LEU E  1 46  ? 134.748 0.847   28.644  1.00 55.37  ? 45   LEU E CA    1 
ATOM   6083 C  C     . LEU E  1 46  ? 134.938 -0.393  27.756  1.00 57.48  ? 45   LEU E C     1 
ATOM   6084 O  O     . LEU E  1 46  ? 135.483 -1.431  28.193  1.00 55.96  ? 45   LEU E O     1 
ATOM   6085 C  CB    . LEU E  1 46  ? 133.277 0.931   29.073  1.00 61.20  ? 45   LEU E CB    1 
ATOM   6086 C  CG    . LEU E  1 46  ? 132.881 1.866   30.226  1.00 64.66  ? 45   LEU E CG    1 
ATOM   6087 C  CD1   . LEU E  1 46  ? 131.356 2.001   30.247  1.00 62.67  ? 45   LEU E CD1   1 
ATOM   6088 C  CD2   . LEU E  1 46  ? 133.405 1.378   31.580  1.00 62.34  ? 45   LEU E CD2   1 
ATOM   6089 N  N     . LEU E  1 47  ? 134.458 -0.276  26.518  1.00 56.26  ? 46   LEU E N     1 
ATOM   6090 C  CA    . LEU E  1 47  ? 134.627 -1.317  25.509  1.00 57.13  ? 46   LEU E CA    1 
ATOM   6091 C  C     . LEU E  1 47  ? 136.093 -1.589  25.201  1.00 54.73  ? 46   LEU E C     1 
ATOM   6092 O  O     . LEU E  1 47  ? 136.507 -2.735  25.187  1.00 59.29  ? 46   LEU E O     1 
ATOM   6093 C  CB    . LEU E  1 47  ? 133.881 -0.930  24.216  1.00 59.20  ? 46   LEU E CB    1 
ATOM   6094 C  CG    . LEU E  1 47  ? 132.365 -1.138  24.244  1.00 50.78  ? 46   LEU E CG    1 
ATOM   6095 C  CD1   . LEU E  1 47  ? 131.690 -0.421  23.068  1.00 60.69  ? 46   LEU E CD1   1 
ATOM   6096 C  CD2   . LEU E  1 47  ? 132.020 -2.612  24.235  1.00 66.48  ? 46   LEU E CD2   1 
ATOM   6097 N  N     . ARG E  1 48  ? 136.869 -0.544  24.929  1.00 55.16  ? 47   ARG E N     1 
ATOM   6098 C  CA    . ARG E  1 48  ? 138.319 -0.680  24.705  1.00 57.76  ? 47   ARG E CA    1 
ATOM   6099 C  C     . ARG E  1 48  ? 138.989 -1.459  25.855  1.00 57.46  ? 47   ARG E C     1 
ATOM   6100 O  O     . ARG E  1 48  ? 139.766 -2.392  25.618  1.00 60.88  ? 47   ARG E O     1 
ATOM   6101 C  CB    . ARG E  1 48  ? 138.965 0.706   24.523  1.00 58.49  ? 47   ARG E CB    1 
ATOM   6102 C  CG    . ARG E  1 48  ? 140.504 0.750   24.589  1.00 64.57  ? 47   ARG E CG    1 
ATOM   6103 N  N     . GLU E  1 49  ? 138.658 -1.085  27.089  1.00 58.67  ? 48   GLU E N     1 
ATOM   6104 C  CA    . GLU E  1 49  ? 139.211 -1.711  28.292  1.00 60.49  ? 48   GLU E CA    1 
ATOM   6105 C  C     . GLU E  1 49  ? 138.811 -3.185  28.402  1.00 58.85  ? 48   GLU E C     1 
ATOM   6106 O  O     . GLU E  1 49  ? 139.630 -4.042  28.748  1.00 56.00  ? 48   GLU E O     1 
ATOM   6107 C  CB    . GLU E  1 49  ? 138.739 -0.949  29.530  1.00 59.31  ? 48   GLU E CB    1 
ATOM   6108 C  CG    . GLU E  1 49  ? 139.428 -1.350  30.827  1.00 74.18  ? 48   GLU E CG    1 
ATOM   6109 C  CD    . GLU E  1 49  ? 138.905 -0.604  32.072  1.00 78.57  ? 48   GLU E CD    1 
ATOM   6110 O  OE1   . GLU E  1 49  ? 139.518 -0.789  33.162  1.00 89.38  ? 48   GLU E OE1   1 
ATOM   6111 O  OE2   . GLU E  1 49  ? 137.894 0.144   31.966  1.00 75.24  ? 48   GLU E OE2   1 
ATOM   6112 N  N     . GLU E  1 50  ? 137.547 -3.476  28.105  1.00 59.37  ? 49   GLU E N     1 
ATOM   6113 C  CA    . GLU E  1 50  ? 137.055 -4.852  28.102  1.00 58.07  ? 49   GLU E CA    1 
ATOM   6114 C  C     . GLU E  1 50  ? 137.777 -5.683  27.060  1.00 56.88  ? 49   GLU E C     1 
ATOM   6115 O  O     . GLU E  1 50  ? 138.222 -6.798  27.352  1.00 55.73  ? 49   GLU E O     1 
ATOM   6116 C  CB    . GLU E  1 50  ? 135.545 -4.895  27.819  1.00 59.91  ? 49   GLU E CB    1 
ATOM   6117 C  CG    . GLU E  1 50  ? 134.901 -6.294  27.829  1.00 59.53  ? 49   GLU E CG    1 
ATOM   6118 C  CD    . GLU E  1 50  ? 135.011 -7.000  29.180  1.00 59.07  ? 49   GLU E CD    1 
ATOM   6119 O  OE1   . GLU E  1 50  ? 135.513 -6.396  30.150  1.00 74.21  ? 49   GLU E OE1   1 
ATOM   6120 O  OE2   . GLU E  1 50  ? 134.581 -8.162  29.281  1.00 71.90  ? 49   GLU E OE2   1 
ATOM   6121 N  N     . LEU E  1 51  ? 137.891 -5.139  25.850  1.00 56.78  ? 50   LEU E N     1 
ATOM   6122 C  CA    . LEU E  1 51  ? 138.512 -5.865  24.743  1.00 60.37  ? 50   LEU E CA    1 
ATOM   6123 C  C     . LEU E  1 51  ? 139.979 -6.191  25.006  1.00 59.82  ? 50   LEU E C     1 
ATOM   6124 O  O     . LEU E  1 51  ? 140.501 -7.148  24.441  1.00 62.96  ? 50   LEU E O     1 
ATOM   6125 C  CB    . LEU E  1 51  ? 138.358 -5.116  23.411  1.00 59.86  ? 50   LEU E CB    1 
ATOM   6126 C  CG    . LEU E  1 51  ? 136.952 -5.118  22.791  1.00 66.27  ? 50   LEU E CG    1 
ATOM   6127 C  CD1   . LEU E  1 51  ? 137.000 -4.504  21.410  1.00 67.33  ? 50   LEU E CD1   1 
ATOM   6128 C  CD2   . LEU E  1 51  ? 136.352 -6.516  22.730  1.00 72.64  ? 50   LEU E CD2   1 
ATOM   6129 N  N     . ALA E  1 52  ? 140.632 -5.401  25.861  1.00 58.74  ? 51   ALA E N     1 
ATOM   6130 C  CA    . ALA E  1 52  ? 141.992 -5.707  26.326  1.00 56.32  ? 51   ALA E CA    1 
ATOM   6131 C  C     . ALA E  1 52  ? 142.051 -6.845  27.363  1.00 57.20  ? 51   ALA E C     1 
ATOM   6132 O  O     . ALA E  1 52  ? 143.107 -7.427  27.572  1.00 59.98  ? 51   ALA E O     1 
ATOM   6133 C  CB    . ALA E  1 52  ? 142.635 -4.450  26.899  1.00 54.88  ? 51   ALA E CB    1 
ATOM   6134 N  N     . SER E  1 53  ? 140.925 -7.173  27.993  1.00 60.48  ? 52   SER E N     1 
ATOM   6135 C  CA    . SER E  1 53  ? 140.921 -8.023  29.186  1.00 59.29  ? 52   SER E CA    1 
ATOM   6136 C  C     . SER E  1 53  ? 141.157 -9.506  28.932  1.00 62.77  ? 52   SER E C     1 
ATOM   6137 O  O     . SER E  1 53  ? 141.476 -10.246 29.881  1.00 67.32  ? 52   SER E O     1 
ATOM   6138 C  CB    . SER E  1 53  ? 139.620 -7.844  29.981  1.00 61.01  ? 52   SER E CB    1 
ATOM   6139 O  OG    . SER E  1 53  ? 138.543 -8.542  29.391  1.00 60.95  ? 52   SER E OG    1 
ATOM   6140 N  N     . GLU E  1 54  ? 141.008 -9.964  27.686  1.00 61.67  ? 53   GLU E N     1 
ATOM   6141 C  CA    . GLU E  1 54  ? 141.181 -11.408 27.382  1.00 62.81  ? 53   GLU E CA    1 
ATOM   6142 C  C     . GLU E  1 54  ? 140.051 -12.264 28.020  1.00 58.49  ? 53   GLU E C     1 
ATOM   6143 O  O     . GLU E  1 54  ? 140.097 -13.489 27.984  1.00 58.68  ? 53   GLU E O     1 
ATOM   6144 C  CB    . GLU E  1 54  ? 142.583 -11.887 27.842  1.00 62.71  ? 53   GLU E CB    1 
ATOM   6145 C  CG    . GLU E  1 54  ? 143.148 -13.152 27.172  1.00 64.42  ? 53   GLU E CG    1 
ATOM   6146 N  N     . SER E  1 55  ? 139.030 -11.615 28.584  1.00 57.60  ? 54   SER E N     1 
ATOM   6147 C  CA    . SER E  1 55  ? 137.919 -12.314 29.234  1.00 54.29  ? 54   SER E CA    1 
ATOM   6148 C  C     . SER E  1 55  ? 137.033 -12.967 28.186  1.00 53.64  ? 54   SER E C     1 
ATOM   6149 O  O     . SER E  1 55  ? 137.068 -12.606 27.008  1.00 51.84  ? 54   SER E O     1 
ATOM   6150 C  CB    . SER E  1 55  ? 137.069 -11.345 30.081  1.00 54.54  ? 54   SER E CB    1 
ATOM   6151 O  OG    . SER E  1 55  ? 136.217 -10.515 29.272  1.00 50.69  ? 54   SER E OG    1 
ATOM   6152 N  N     . GLU E  1 56  ? 136.209 -13.903 28.635  1.00 52.27  ? 55   GLU E N     1 
ATOM   6153 C  CA    . GLU E  1 56  ? 135.322 -14.634 27.739  1.00 53.49  ? 55   GLU E CA    1 
ATOM   6154 C  C     . GLU E  1 56  ? 134.193 -13.752 27.206  1.00 51.36  ? 55   GLU E C     1 
ATOM   6155 O  O     . GLU E  1 56  ? 133.766 -13.902 26.058  1.00 55.26  ? 55   GLU E O     1 
ATOM   6156 C  CB    . GLU E  1 56  ? 134.765 -15.877 28.450  1.00 59.74  ? 55   GLU E CB    1 
ATOM   6157 C  CG    . GLU E  1 56  ? 134.229 -16.929 27.509  1.00 57.31  ? 55   GLU E CG    1 
ATOM   6158 C  CD    . GLU E  1 56  ? 135.275 -17.407 26.534  1.00 65.42  ? 55   GLU E CD    1 
ATOM   6159 O  OE1   . GLU E  1 56  ? 136.417 -17.712 26.960  1.00 55.05  ? 55   GLU E OE1   1 
ATOM   6160 O  OE2   . GLU E  1 56  ? 134.946 -17.462 25.338  1.00 65.86  ? 55   GLU E OE2   1 
ATOM   6161 N  N     . ARG E  1 57  ? 133.722 -12.823 28.030  1.00 53.96  ? 56   ARG E N     1 
ATOM   6162 C  CA    . ARG E  1 57  ? 132.747 -11.847 27.576  1.00 53.42  ? 56   ARG E CA    1 
ATOM   6163 C  C     . ARG E  1 57  ? 133.349 -10.889 26.537  1.00 52.02  ? 56   ARG E C     1 
ATOM   6164 O  O     . ARG E  1 57  ? 132.663 -10.481 25.614  1.00 52.66  ? 56   ARG E O     1 
ATOM   6165 C  CB    . ARG E  1 57  ? 132.175 -11.056 28.754  1.00 59.02  ? 56   ARG E CB    1 
ATOM   6166 C  CG    . ARG E  1 57  ? 131.253 -9.888  28.323  1.00 59.39  ? 56   ARG E CG    1 
ATOM   6167 C  CD    . ARG E  1 57  ? 130.710 -9.164  29.529  1.00 60.34  ? 56   ARG E CD    1 
ATOM   6168 N  NE    . ARG E  1 57  ? 131.798 -8.555  30.288  1.00 61.48  ? 56   ARG E NE    1 
ATOM   6169 C  CZ    . ARG E  1 57  ? 131.708 -8.174  31.560  1.00 64.87  ? 56   ARG E CZ    1 
ATOM   6170 N  NH1   . ARG E  1 57  ? 130.571 -8.315  32.238  1.00 64.90  ? 56   ARG E NH1   1 
ATOM   6171 N  NH2   . ARG E  1 57  ? 132.766 -7.637  32.157  1.00 50.23  ? 56   ARG E NH2   1 
ATOM   6172 N  N     . SER E  1 58  ? 134.627 -10.538 26.690  1.00 52.79  ? 57   SER E N     1 
ATOM   6173 C  CA    . SER E  1 58  ? 135.323 -9.717  25.694  1.00 50.00  ? 57   SER E CA    1 
ATOM   6174 C  C     . SER E  1 58  ? 135.379 -10.388 24.308  1.00 52.81  ? 57   SER E C     1 
ATOM   6175 O  O     . SER E  1 58  ? 135.355 -9.704  23.286  1.00 51.70  ? 57   SER E O     1 
ATOM   6176 C  CB    . SER E  1 58  ? 136.744 -9.364  26.163  1.00 48.42  ? 57   SER E CB    1 
ATOM   6177 O  OG    . SER E  1 58  ? 137.700 -10.373 25.844  1.00 49.18  ? 57   SER E OG    1 
ATOM   6178 N  N     . LYS E  1 59  ? 135.462 -11.720 24.276  1.00 54.21  ? 58   LYS E N     1 
ATOM   6179 C  CA    . LYS E  1 59  ? 135.562 -12.462 23.017  1.00 51.36  ? 58   LYS E CA    1 
ATOM   6180 C  C     . LYS E  1 59  ? 134.198 -12.424 22.304  1.00 52.93  ? 58   LYS E C     1 
ATOM   6181 O  O     . LYS E  1 59  ? 134.115 -12.364 21.071  1.00 52.04  ? 58   LYS E O     1 
ATOM   6182 C  CB    . LYS E  1 59  ? 136.009 -13.902 23.271  1.00 54.75  ? 58   LYS E CB    1 
ATOM   6183 C  CG    . LYS E  1 59  ? 137.257 -14.068 24.173  1.00 54.25  ? 58   LYS E CG    1 
ATOM   6184 C  CD    . LYS E  1 59  ? 138.541 -14.327 23.401  1.00 62.13  ? 58   LYS E CD    1 
ATOM   6185 N  N     . LEU E  1 60  ? 133.133 -12.442 23.100  1.00 53.64  ? 59   LEU E N     1 
ATOM   6186 C  CA    . LEU E  1 60  ? 131.772 -12.279 22.596  1.00 54.86  ? 59   LEU E CA    1 
ATOM   6187 C  C     . LEU E  1 60  ? 131.585 -10.911 21.979  1.00 54.30  ? 59   LEU E C     1 
ATOM   6188 O  O     . LEU E  1 60  ? 131.031 -10.792 20.886  1.00 54.91  ? 59   LEU E O     1 
ATOM   6189 C  CB    . LEU E  1 60  ? 130.765 -12.435 23.737  1.00 57.82  ? 59   LEU E CB    1 
ATOM   6190 C  CG    . LEU E  1 60  ? 129.311 -12.079 23.441  1.00 53.87  ? 59   LEU E CG    1 
ATOM   6191 C  CD1   . LEU E  1 60  ? 128.795 -12.954 22.310  1.00 47.83  ? 59   LEU E CD1   1 
ATOM   6192 C  CD2   . LEU E  1 60  ? 128.474 -12.258 24.709  1.00 62.50  ? 59   LEU E CD2   1 
ATOM   6193 N  N     . ILE E  1 61  ? 132.037 -9.884  22.703  1.00 56.12  ? 60   ILE E N     1 
ATOM   6194 C  CA    . ILE E  1 61  ? 131.945 -8.505  22.249  1.00 55.67  ? 60   ILE E CA    1 
ATOM   6195 C  C     . ILE E  1 61  ? 132.758 -8.338  20.985  1.00 56.03  ? 60   ILE E C     1 
ATOM   6196 O  O     . ILE E  1 61  ? 132.310 -7.683  20.043  1.00 56.16  ? 60   ILE E O     1 
ATOM   6197 C  CB    . ILE E  1 61  ? 132.423 -7.516  23.319  1.00 59.75  ? 60   ILE E CB    1 
ATOM   6198 C  CG1   . ILE E  1 61  ? 131.430 -7.494  24.487  1.00 61.26  ? 60   ILE E CG1   1 
ATOM   6199 C  CG2   . ILE E  1 61  ? 132.564 -6.102  22.731  1.00 59.23  ? 60   ILE E CG2   1 
ATOM   6200 C  CD1   . ILE E  1 61  ? 131.970 -6.848  25.749  1.00 62.36  ? 60   ILE E CD1   1 
ATOM   6201 N  N     . ARG E  1 62  ? 133.932 -8.960  20.972  1.00 55.70  ? 61   ARG E N     1 
ATOM   6202 C  CA    . ARG E  1 62  ? 134.827 -8.970  19.817  1.00 55.89  ? 61   ARG E CA    1 
ATOM   6203 C  C     . ARG E  1 62  ? 134.211 -9.705  18.611  1.00 55.74  ? 61   ARG E C     1 
ATOM   6204 O  O     . ARG E  1 62  ? 134.364 -9.244  17.488  1.00 56.47  ? 61   ARG E O     1 
ATOM   6205 C  CB    . ARG E  1 62  ? 136.187 -9.573  20.224  1.00 54.83  ? 61   ARG E CB    1 
ATOM   6206 C  CG    . ARG E  1 62  ? 137.337 -9.384  19.234  1.00 58.33  ? 61   ARG E CG    1 
ATOM   6207 C  CD    . ARG E  1 62  ? 138.721 -9.622  19.900  1.00 59.47  ? 61   ARG E CD    1 
ATOM   6208 N  NE    . ARG E  1 62  ? 139.378 -8.382  20.335  1.00 61.40  ? 61   ARG E NE    1 
ATOM   6209 N  N     . ASP E  1 63  ? 133.515 -10.825 18.836  1.00 55.09  ? 62   ASP E N     1 
ATOM   6210 C  CA    . ASP E  1 63  ? 132.793 -11.529 17.751  1.00 58.25  ? 62   ASP E CA    1 
ATOM   6211 C  C     . ASP E  1 63  ? 131.815 -10.585 17.056  1.00 57.57  ? 62   ASP E C     1 
ATOM   6212 O  O     . ASP E  1 63  ? 131.758 -10.521 15.824  1.00 57.54  ? 62   ASP E O     1 
ATOM   6213 C  CB    . ASP E  1 63  ? 131.950 -12.705 18.280  1.00 58.17  ? 62   ASP E CB    1 
ATOM   6214 C  CG    . ASP E  1 63  ? 132.759 -13.937 18.626  1.00 67.45  ? 62   ASP E CG    1 
ATOM   6215 O  OD1   . ASP E  1 63  ? 133.933 -14.085 18.190  1.00 55.55  ? 62   ASP E OD1   1 
ATOM   6216 O  OD2   . ASP E  1 63  ? 132.167 -14.776 19.342  1.00 50.60  ? 62   ASP E OD2   1 
ATOM   6217 N  N     . ILE E  1 64  ? 131.039 -9.887  17.885  1.00 57.17  ? 63   ILE E N     1 
ATOM   6218 C  CA    . ILE E  1 64  ? 129.953 -9.011  17.454  1.00 59.56  ? 63   ILE E CA    1 
ATOM   6219 C  C     . ILE E  1 64  ? 130.481 -7.797  16.705  1.00 60.38  ? 63   ILE E C     1 
ATOM   6220 O  O     . ILE E  1 64  ? 129.974 -7.447  15.643  1.00 61.92  ? 63   ILE E O     1 
ATOM   6221 C  CB    . ILE E  1 64  ? 129.125 -8.517  18.666  1.00 58.69  ? 63   ILE E CB    1 
ATOM   6222 C  CG1   . ILE E  1 64  ? 128.398 -9.689  19.334  1.00 59.02  ? 63   ILE E CG1   1 
ATOM   6223 C  CG2   . ILE E  1 64  ? 128.105 -7.461  18.238  1.00 67.01  ? 63   ILE E CG2   1 
ATOM   6224 C  CD1   . ILE E  1 64  ? 127.837 -9.361  20.685  1.00 60.73  ? 63   ILE E CD1   1 
ATOM   6225 N  N     . MET E  1 65  ? 131.486 -7.148  17.283  1.00 60.66  ? 64   MET E N     1 
ATOM   6226 C  CA    . MET E  1 65  ? 132.098 -5.971  16.676  1.00 61.61  ? 64   MET E CA    1 
ATOM   6227 C  C     . MET E  1 65  ? 132.866 -6.313  15.392  1.00 61.47  ? 64   MET E C     1 
ATOM   6228 O  O     . MET E  1 65  ? 132.923 -5.501  14.473  1.00 64.63  ? 64   MET E O     1 
ATOM   6229 C  CB    . MET E  1 65  ? 132.999 -5.257  17.688  1.00 53.80  ? 64   MET E CB    1 
ATOM   6230 C  CG    . MET E  1 65  ? 132.216 -4.645  18.845  1.00 57.93  ? 64   MET E CG    1 
ATOM   6231 S  SD    . MET E  1 65  ? 133.181 -3.640  19.996  1.00 69.73  ? 64   MET E SD    1 
ATOM   6232 C  CE    . MET E  1 65  ? 133.991 -2.508  18.862  1.00 80.63  ? 64   MET E CE    1 
ATOM   6233 N  N     . GLU E  1 66  ? 133.422 -7.522  15.322  1.00 62.14  ? 65   GLU E N     1 
ATOM   6234 C  CA    . GLU E  1 66  ? 134.135 -8.008  14.126  1.00 63.67  ? 65   GLU E CA    1 
ATOM   6235 C  C     . GLU E  1 66  ? 133.178 -8.293  12.943  1.00 63.97  ? 65   GLU E C     1 
ATOM   6236 O  O     . GLU E  1 66  ? 133.630 -8.480  11.807  1.00 63.56  ? 65   GLU E O     1 
ATOM   6237 C  CB    . GLU E  1 66  ? 134.968 -9.263  14.473  1.00 64.09  ? 65   GLU E CB    1 
ATOM   6238 C  CG    . GLU E  1 66  ? 136.158 -9.543  13.552  1.00 70.48  ? 65   GLU E CG    1 
ATOM   6239 N  N     . ARG E  1 67  ? 131.871 -8.346  13.221  1.00 63.39  ? 66   ARG E N     1 
ATOM   6240 C  CA    . ARG E  1 67  ? 130.832 -8.366  12.177  1.00 60.04  ? 66   ARG E CA    1 
ATOM   6241 C  C     . ARG E  1 67  ? 130.379 -6.962  11.831  1.00 57.81  ? 66   ARG E C     1 
ATOM   6242 O  O     . ARG E  1 67  ? 129.671 -6.772  10.842  1.00 60.24  ? 66   ARG E O     1 
ATOM   6243 C  CB    . ARG E  1 67  ? 129.590 -9.127  12.636  1.00 61.23  ? 66   ARG E CB    1 
ATOM   6244 C  CG    . ARG E  1 67  ? 129.691 -10.623 12.581  1.00 64.53  ? 66   ARG E CG    1 
ATOM   6245 C  CD    . ARG E  1 67  ? 128.390 -11.244 13.083  1.00 73.34  ? 66   ARG E CD    1 
ATOM   6246 N  NE    . ARG E  1 67  ? 128.376 -11.442 14.536  1.00 73.29  ? 66   ARG E NE    1 
ATOM   6247 C  CZ    . ARG E  1 67  ? 128.694 -12.582 15.157  1.00 74.12  ? 66   ARG E CZ    1 
ATOM   6248 N  NH1   . ARG E  1 67  ? 129.065 -13.665 14.477  1.00 73.42  ? 66   ARG E NH1   1 
ATOM   6249 N  NH2   . ARG E  1 67  ? 128.630 -12.645 16.479  1.00 67.42  ? 66   ARG E NH2   1 
ATOM   6250 N  N     . GLY E  1 68  ? 130.755 -5.982  12.652  1.00 56.33  ? 67   GLY E N     1 
ATOM   6251 C  CA    . GLY E  1 68  ? 130.224 -4.623  12.513  1.00 56.61  ? 67   GLY E CA    1 
ATOM   6252 C  C     . GLY E  1 68  ? 128.795 -4.531  13.026  1.00 60.12  ? 67   GLY E C     1 
ATOM   6253 O  O     . GLY E  1 68  ? 128.048 -3.628  12.622  1.00 61.66  ? 67   GLY E O     1 
ATOM   6254 N  N     . ASP E  1 69  ? 128.432 -5.457  13.926  1.00 61.25  ? 68   ASP E N     1 
ATOM   6255 C  CA    A ASP E  1 69  ? 127.073 -5.536  14.470  0.50 61.70  ? 68   ASP E CA    1 
ATOM   6256 C  CA    B ASP E  1 69  ? 127.079 -5.544  14.481  0.50 61.65  ? 68   ASP E CA    1 
ATOM   6257 C  C     . ASP E  1 69  ? 126.953 -4.818  15.825  1.00 61.50  ? 68   ASP E C     1 
ATOM   6258 O  O     . ASP E  1 69  ? 127.942 -4.292  16.373  1.00 55.64  ? 68   ASP E O     1 
ATOM   6259 C  CB    A ASP E  1 69  ? 126.638 -7.006  14.595  0.50 61.85  ? 68   ASP E CB    1 
ATOM   6260 C  CB    B ASP E  1 69  ? 126.654 -7.019  14.626  0.50 61.88  ? 68   ASP E CB    1 
ATOM   6261 C  CG    A ASP E  1 69  ? 125.111 -7.188  14.597  0.50 69.74  ? 68   ASP E CG    1 
ATOM   6262 C  CG    B ASP E  1 69  ? 125.764 -7.497  13.479  0.50 69.03  ? 68   ASP E CG    1 
ATOM   6263 O  OD1   A ASP E  1 69  ? 124.362 -6.185  14.458  0.50 55.57  ? 68   ASP E OD1   1 
ATOM   6264 O  OD1   B ASP E  1 69  ? 124.988 -6.683  12.924  0.50 66.58  ? 68   ASP E OD1   1 
ATOM   6265 O  OD2   A ASP E  1 69  ? 124.663 -8.348  14.744  0.50 64.08  ? 68   ASP E OD2   1 
ATOM   6266 O  OD2   B ASP E  1 69  ? 125.829 -8.699  13.142  0.50 59.39  ? 68   ASP E OD2   1 
ATOM   6267 N  N     . LEU E  1 70  ? 125.727 -4.789  16.347  1.00 62.57  ? 69   LEU E N     1 
ATOM   6268 C  CA    . LEU E  1 70  ? 125.396 -4.067  17.569  1.00 63.38  ? 69   LEU E CA    1 
ATOM   6269 C  C     . LEU E  1 70  ? 125.752 -4.865  18.811  1.00 62.30  ? 69   LEU E C     1 
ATOM   6270 O  O     . LEU E  1 70  ? 125.324 -6.000  18.963  1.00 59.96  ? 69   LEU E O     1 
ATOM   6271 C  CB    . LEU E  1 70  ? 123.894 -3.743  17.577  1.00 63.71  ? 69   LEU E CB    1 
ATOM   6272 C  CG    . LEU E  1 70  ? 123.312 -3.032  18.799  1.00 64.47  ? 69   LEU E CG    1 
ATOM   6273 C  CD1   . LEU E  1 70  ? 123.719 -1.584  18.828  1.00 70.42  ? 69   LEU E CD1   1 
ATOM   6274 C  CD2   . LEU E  1 70  ? 121.805 -3.154  18.789  1.00 66.14  ? 69   LEU E CD2   1 
ATOM   6275 N  N     . VAL E  1 71  ? 126.519 -4.238  19.697  1.00 63.99  ? 70   VAL E N     1 
ATOM   6276 C  CA    . VAL E  1 71  ? 126.752 -4.752  21.034  1.00 64.18  ? 70   VAL E CA    1 
ATOM   6277 C  C     . VAL E  1 71  ? 125.527 -4.428  21.884  1.00 63.76  ? 70   VAL E C     1 
ATOM   6278 O  O     . VAL E  1 71  ? 125.161 -3.258  21.994  1.00 61.51  ? 70   VAL E O     1 
ATOM   6279 C  CB    . VAL E  1 71  ? 127.981 -4.094  21.698  1.00 65.04  ? 70   VAL E CB    1 
ATOM   6280 C  CG1   . VAL E  1 71  ? 128.175 -4.660  23.114  1.00 65.77  ? 70   VAL E CG1   1 
ATOM   6281 C  CG2   . VAL E  1 71  ? 129.241 -4.295  20.830  1.00 58.01  ? 70   VAL E CG2   1 
ATOM   6282 N  N     . PRO E  1 72  ? 124.889 -5.455  22.485  1.00 60.27  ? 71   PRO E N     1 
ATOM   6283 C  CA    . PRO E  1 72  ? 123.672 -5.216  23.279  1.00 60.95  ? 71   PRO E CA    1 
ATOM   6284 C  C     . PRO E  1 72  ? 123.881 -4.235  24.420  1.00 60.12  ? 71   PRO E C     1 
ATOM   6285 O  O     . PRO E  1 72  ? 124.908 -4.276  25.087  1.00 61.57  ? 71   PRO E O     1 
ATOM   6286 C  CB    . PRO E  1 72  ? 123.319 -6.593  23.834  1.00 64.48  ? 71   PRO E CB    1 
ATOM   6287 C  CG    . PRO E  1 72  ? 124.028 -7.578  22.954  1.00 70.35  ? 71   PRO E CG    1 
ATOM   6288 C  CD    . PRO E  1 72  ? 125.255 -6.879  22.431  1.00 61.33  ? 71   PRO E CD    1 
ATOM   6289 N  N     . SER E  1 73  ? 122.903 -3.368  24.649  1.00 60.09  ? 72   SER E N     1 
ATOM   6290 C  CA    . SER E  1 73  ? 123.041 -2.346  25.686  1.00 64.00  ? 72   SER E CA    1 
ATOM   6291 C  C     . SER E  1 73  ? 123.195 -2.939  27.108  1.00 60.60  ? 72   SER E C     1 
ATOM   6292 O  O     . SER E  1 73  ? 123.810 -2.317  27.972  1.00 62.88  ? 72   SER E O     1 
ATOM   6293 C  CB    . SER E  1 73  ? 121.890 -1.317  25.609  1.00 62.27  ? 72   SER E CB    1 
ATOM   6294 O  OG    . SER E  1 73  ? 120.698 -1.801  26.198  1.00 69.48  ? 72   SER E OG    1 
ATOM   6295 N  N     . GLY E  1 74  ? 122.666 -4.134  27.343  1.00 56.80  ? 73   GLY E N     1 
ATOM   6296 C  CA    . GLY E  1 74  ? 122.826 -4.793  28.639  1.00 58.09  ? 73   GLY E CA    1 
ATOM   6297 C  C     . GLY E  1 74  ? 124.277 -5.101  28.986  1.00 58.01  ? 73   GLY E C     1 
ATOM   6298 O  O     . GLY E  1 74  ? 124.676 -5.036  30.156  1.00 58.89  ? 73   GLY E O     1 
ATOM   6299 N  N     . ILE E  1 75  ? 125.059 -5.434  27.960  1.00 57.00  ? 74   ILE E N     1 
ATOM   6300 C  CA    . ILE E  1 75  ? 126.486 -5.672  28.107  1.00 58.66  ? 74   ILE E CA    1 
ATOM   6301 C  C     . ILE E  1 75  ? 127.175 -4.349  28.422  1.00 57.76  ? 74   ILE E C     1 
ATOM   6302 O  O     . ILE E  1 75  ? 127.972 -4.275  29.346  1.00 59.22  ? 74   ILE E O     1 
ATOM   6303 C  CB    . ILE E  1 75  ? 127.126 -6.304  26.829  1.00 61.46  ? 74   ILE E CB    1 
ATOM   6304 C  CG1   . ILE E  1 75  ? 126.846 -7.801  26.704  1.00 58.79  ? 74   ILE E CG1   1 
ATOM   6305 C  CG2   . ILE E  1 75  ? 128.645 -6.162  26.855  1.00 69.04  ? 74   ILE E CG2   1 
ATOM   6306 C  CD1   . ILE E  1 75  ? 125.403 -8.214  26.865  1.00 84.92  ? 74   ILE E CD1   1 
ATOM   6307 N  N     . VAL E  1 76  ? 126.862 -3.298  27.663  1.00 61.10  ? 75   VAL E N     1 
ATOM   6308 C  CA    . VAL E  1 76  ? 127.464 -1.975  27.911  1.00 60.46  ? 75   VAL E CA    1 
ATOM   6309 C  C     . VAL E  1 76  ? 127.116 -1.487  29.315  1.00 59.19  ? 75   VAL E C     1 
ATOM   6310 O  O     . VAL E  1 76  ? 127.973 -0.946  30.010  1.00 60.48  ? 75   VAL E O     1 
ATOM   6311 C  CB    . VAL E  1 76  ? 127.042 -0.900  26.878  1.00 63.42  ? 75   VAL E CB    1 
ATOM   6312 C  CG1   . VAL E  1 76  ? 127.795 0.407   27.139  1.00 66.66  ? 75   VAL E CG1   1 
ATOM   6313 C  CG2   . VAL E  1 76  ? 127.279 -1.395  25.438  1.00 68.94  ? 75   VAL E CG2   1 
ATOM   6314 N  N     . LEU E  1 77  ? 125.877 -1.701  29.747  1.00 56.46  ? 76   LEU E N     1 
ATOM   6315 C  CA    . LEU E  1 77  ? 125.453 -1.239  31.076  1.00 59.21  ? 76   LEU E CA    1 
ATOM   6316 C  C     . LEU E  1 77  ? 126.196 -1.959  32.187  1.00 59.48  ? 76   LEU E C     1 
ATOM   6317 O  O     . LEU E  1 77  ? 126.518 -1.351  33.206  1.00 61.13  ? 76   LEU E O     1 
ATOM   6318 C  CB    . LEU E  1 77  ? 123.946 -1.436  31.279  1.00 62.40  ? 76   LEU E CB    1 
ATOM   6319 C  CG    . LEU E  1 77  ? 123.369 -0.882  32.592  1.00 64.65  ? 76   LEU E CG    1 
ATOM   6320 C  CD1   . LEU E  1 77  ? 123.614 0.630   32.734  1.00 66.28  ? 76   LEU E CD1   1 
ATOM   6321 C  CD2   . LEU E  1 77  ? 121.898 -1.181  32.652  1.00 59.90  ? 76   LEU E CD2   1 
ATOM   6322 N  N     . GLU E  1 78  ? 126.424 -3.258  31.995  1.00 58.25  ? 77   GLU E N     1 
ATOM   6323 C  CA    . GLU E  1 78  ? 127.175 -4.071  32.941  1.00 60.80  ? 77   GLU E CA    1 
ATOM   6324 C  C     . GLU E  1 78  ? 128.618 -3.589  33.075  1.00 56.29  ? 77   GLU E C     1 
ATOM   6325 O  O     . GLU E  1 78  ? 129.149 -3.502  34.182  1.00 57.26  ? 77   GLU E O     1 
ATOM   6326 C  CB    . GLU E  1 78  ? 127.137 -5.544  32.510  1.00 60.94  ? 77   GLU E CB    1 
ATOM   6327 C  CG    . GLU E  1 78  ? 127.804 -6.525  33.467  1.00 73.28  ? 77   GLU E CG    1 
ATOM   6328 C  CD    . GLU E  1 78  ? 127.339 -6.393  34.918  1.00 82.52  ? 77   GLU E CD    1 
ATOM   6329 O  OE1   . GLU E  1 78  ? 128.151 -6.676  35.828  1.00 86.28  ? 77   GLU E OE1   1 
ATOM   6330 O  OE2   . GLU E  1 78  ? 126.171 -6.015  35.153  1.00 83.59  ? 77   GLU E OE2   1 
ATOM   6331 N  N     . LEU E  1 79  ? 129.244 -3.279  31.943  1.00 55.16  ? 78   LEU E N     1 
ATOM   6332 C  CA    . LEU E  1 79  ? 130.598 -2.734  31.933  1.00 57.06  ? 78   LEU E CA    1 
ATOM   6333 C  C     . LEU E  1 79  ? 130.658 -1.422  32.711  1.00 57.07  ? 78   LEU E C     1 
ATOM   6334 O  O     . LEU E  1 79  ? 131.569 -1.191  33.515  1.00 57.35  ? 78   LEU E O     1 
ATOM   6335 C  CB    . LEU E  1 79  ? 131.053 -2.486  30.495  1.00 59.70  ? 78   LEU E CB    1 
ATOM   6336 C  CG    . LEU E  1 79  ? 131.316 -3.739  29.673  1.00 58.80  ? 78   LEU E CG    1 
ATOM   6337 C  CD1   . LEU E  1 79  ? 131.678 -3.327  28.270  1.00 57.07  ? 78   LEU E CD1   1 
ATOM   6338 C  CD2   . LEU E  1 79  ? 132.429 -4.577  30.318  1.00 58.43  ? 78   LEU E CD2   1 
ATOM   6339 N  N     . LEU E  1 80  ? 129.663 -0.582  32.452  1.00 55.78  ? 79   LEU E N     1 
ATOM   6340 C  CA    . LEU E  1 80  ? 129.496 0.675   33.155  1.00 58.53  ? 79   LEU E CA    1 
ATOM   6341 C  C     . LEU E  1 80  ? 129.300 0.488   34.668  1.00 55.64  ? 79   LEU E C     1 
ATOM   6342 O  O     . LEU E  1 80  ? 129.982 1.120   35.458  1.00 56.93  ? 79   LEU E O     1 
ATOM   6343 C  CB    . LEU E  1 80  ? 128.318 1.412   32.534  1.00 59.42  ? 79   LEU E CB    1 
ATOM   6344 C  CG    . LEU E  1 80  ? 127.954 2.824   32.968  1.00 67.53  ? 79   LEU E CG    1 
ATOM   6345 C  CD1   . LEU E  1 80  ? 129.140 3.766   32.891  1.00 79.38  ? 79   LEU E CD1   1 
ATOM   6346 C  CD2   . LEU E  1 80  ? 126.820 3.280   32.069  1.00 71.10  ? 79   LEU E CD2   1 
ATOM   6347 N  N     . LYS E  1 81  ? 128.381 -0.385  35.055  1.00 55.68  ? 80   LYS E N     1 
ATOM   6348 C  CA    . LYS E  1 81  ? 128.156 -0.719  36.467  1.00 56.65  ? 80   LYS E CA    1 
ATOM   6349 C  C     . LYS E  1 81  ? 129.451 -1.168  37.159  1.00 58.31  ? 80   LYS E C     1 
ATOM   6350 O  O     . LYS E  1 81  ? 129.752 -0.686  38.248  1.00 61.35  ? 80   LYS E O     1 
ATOM   6351 C  CB    . LYS E  1 81  ? 127.066 -1.797  36.602  1.00 55.13  ? 80   LYS E CB    1 
ATOM   6352 C  CG    . LYS E  1 81  ? 126.656 -2.166  38.047  1.00 57.57  ? 80   LYS E CG    1 
ATOM   6353 N  N     . GLU E  1 82  ? 130.218 -2.058  36.521  1.00 55.95  ? 81   GLU E N     1 
ATOM   6354 C  CA    . GLU E  1 82  ? 131.484 -2.558  37.090  1.00 56.48  ? 81   GLU E CA    1 
ATOM   6355 C  C     . GLU E  1 82  ? 132.497 -1.437  37.311  1.00 55.85  ? 81   GLU E C     1 
ATOM   6356 O  O     . GLU E  1 82  ? 133.148 -1.366  38.354  1.00 53.80  ? 81   GLU E O     1 
ATOM   6357 C  CB    . GLU E  1 82  ? 132.117 -3.630  36.181  1.00 56.86  ? 81   GLU E CB    1 
ATOM   6358 C  CG    . GLU E  1 82  ? 131.352 -4.945  36.109  1.00 53.10  ? 81   GLU E CG    1 
ATOM   6359 C  CD    . GLU E  1 82  ? 131.926 -5.939  35.090  1.00 61.85  ? 81   GLU E CD    1 
ATOM   6360 O  OE1   . GLU E  1 82  ? 132.722 -5.543  34.203  1.00 60.69  ? 81   GLU E OE1   1 
ATOM   6361 O  OE2   . GLU E  1 82  ? 131.573 -7.137  35.182  1.00 64.32  ? 81   GLU E OE2   1 
ATOM   6362 N  N     . ALA E  1 83  ? 132.628 -0.561  36.316  1.00 58.24  ? 82   ALA E N     1 
ATOM   6363 C  CA    . ALA E  1 83  ? 133.535 0.582   36.425  1.00 57.88  ? 82   ALA E CA    1 
ATOM   6364 C  C     . ALA E  1 83  ? 133.132 1.463   37.601  1.00 58.53  ? 82   ALA E C     1 
ATOM   6365 O  O     . ALA E  1 83  ? 133.981 1.990   38.325  1.00 58.45  ? 82   ALA E O     1 
ATOM   6366 C  CB    . ALA E  1 83  ? 133.547 1.382   35.143  1.00 55.82  ? 82   ALA E CB    1 
ATOM   6367 N  N     . MET E  1 84  ? 131.828 1.607   37.796  1.00 58.13  ? 83   MET E N     1 
ATOM   6368 C  CA    . MET E  1 84  ? 131.318 2.460   38.853  1.00 57.69  ? 83   MET E CA    1 
ATOM   6369 C  C     . MET E  1 84  ? 131.547 1.863   40.226  1.00 57.16  ? 83   MET E C     1 
ATOM   6370 O  O     . MET E  1 84  ? 131.916 2.583   41.136  1.00 58.09  ? 83   MET E O     1 
ATOM   6371 C  CB    . MET E  1 84  ? 129.848 2.776   38.610  1.00 58.14  ? 83   MET E CB    1 
ATOM   6372 C  CG    . MET E  1 84  ? 129.692 3.699   37.421  1.00 59.62  ? 83   MET E CG    1 
ATOM   6373 S  SD    . MET E  1 84  ? 128.004 4.052   36.958  1.00 62.73  ? 83   MET E SD    1 
ATOM   6374 C  CE    . MET E  1 84  ? 127.448 5.043   38.349  1.00 52.37  ? 83   MET E CE    1 
ATOM   6375 N  N     . VAL E  1 85  ? 131.376 0.548   40.364  1.00 60.83  ? 84   VAL E N     1 
ATOM   6376 C  CA    . VAL E  1 85  ? 131.587 -0.113  41.650  1.00 58.86  ? 84   VAL E CA    1 
ATOM   6377 C  C     . VAL E  1 85  ? 133.079 -0.168  41.989  1.00 60.50  ? 84   VAL E C     1 
ATOM   6378 O  O     . VAL E  1 85  ? 133.453 -0.079  43.163  1.00 60.66  ? 84   VAL E O     1 
ATOM   6379 C  CB    . VAL E  1 85  ? 130.949 -1.547  41.732  1.00 63.80  ? 84   VAL E CB    1 
ATOM   6380 C  CG1   . VAL E  1 85  ? 129.527 -1.558  41.151  1.00 52.82  ? 84   VAL E CG1   1 
ATOM   6381 C  CG2   . VAL E  1 85  ? 131.836 -2.631  41.074  1.00 65.48  ? 84   VAL E CG2   1 
ATOM   6382 N  N     . ALA E  1 86  ? 133.924 -0.304  40.968  1.00 60.29  ? 85   ALA E N     1 
ATOM   6383 C  CA    . ALA E  1 86  ? 135.374 -0.311  41.171  1.00 59.99  ? 85   ALA E CA    1 
ATOM   6384 C  C     . ALA E  1 86  ? 135.930 1.069   41.579  1.00 61.42  ? 85   ALA E C     1 
ATOM   6385 O  O     . ALA E  1 86  ? 136.963 1.144   42.245  1.00 62.73  ? 85   ALA E O     1 
ATOM   6386 C  CB    . ALA E  1 86  ? 136.078 -0.827  39.922  1.00 57.96  ? 85   ALA E CB    1 
ATOM   6387 N  N     . SER E  1 87  ? 135.248 2.152   41.201  1.00 62.71  ? 86   SER E N     1 
ATOM   6388 C  CA    . SER E  1 87  ? 135.708 3.513   41.529  1.00 63.73  ? 86   SER E CA    1 
ATOM   6389 C  C     . SER E  1 87  ? 135.044 4.100   42.783  1.00 63.13  ? 86   SER E C     1 
ATOM   6390 O  O     . SER E  1 87  ? 135.371 5.218   43.191  1.00 62.34  ? 86   SER E O     1 
ATOM   6391 C  CB    . SER E  1 87  ? 135.476 4.469   40.355  1.00 61.09  ? 86   SER E CB    1 
ATOM   6392 O  OG    . SER E  1 87  ? 135.568 3.812   39.103  1.00 68.47  ? 86   SER E OG    1 
ATOM   6393 N  N     . LEU E  1 88  ? 134.092 3.376   43.366  1.00 65.42  ? 87   LEU E N     1 
ATOM   6394 C  CA    . LEU E  1 88  ? 133.520 3.766   44.655  1.00 71.27  ? 87   LEU E CA    1 
ATOM   6395 C  C     . LEU E  1 88  ? 134.555 3.575   45.780  1.00 74.14  ? 87   LEU E C     1 
ATOM   6396 O  O     . LEU E  1 88  ? 135.339 2.611   45.776  1.00 73.36  ? 87   LEU E O     1 
ATOM   6397 C  CB    . LEU E  1 88  ? 132.269 2.943   44.984  1.00 72.96  ? 87   LEU E CB    1 
ATOM   6398 C  CG    . LEU E  1 88  ? 130.970 3.145   44.205  1.00 71.56  ? 87   LEU E CG    1 
ATOM   6399 C  CD1   . LEU E  1 88  ? 129.856 2.368   44.902  1.00 74.52  ? 87   LEU E CD1   1 
ATOM   6400 C  CD2   . LEU E  1 88  ? 130.601 4.609   44.076  1.00 65.65  ? 87   LEU E CD2   1 
ATOM   6401 N  N     . GLY E  1 89  ? 134.544 4.499   46.738  1.00 74.30  ? 88   GLY E N     1 
ATOM   6402 C  CA    . GLY E  1 89  ? 135.501 4.488   47.839  1.00 76.70  ? 88   GLY E CA    1 
ATOM   6403 C  C     . GLY E  1 89  ? 136.671 5.415   47.588  1.00 77.38  ? 88   GLY E C     1 
ATOM   6404 O  O     . GLY E  1 89  ? 137.484 5.645   48.484  1.00 79.28  ? 88   GLY E O     1 
ATOM   6405 N  N     . ASP E  1 90  ? 136.768 5.931   46.364  1.00 76.44  ? 89   ASP E N     1 
ATOM   6406 C  CA    . ASP E  1 90  ? 137.788 6.909   46.017  1.00 76.97  ? 89   ASP E CA    1 
ATOM   6407 C  C     . ASP E  1 90  ? 137.390 7.691   44.774  1.00 75.59  ? 89   ASP E C     1 
ATOM   6408 O  O     . ASP E  1 90  ? 138.171 7.796   43.831  1.00 79.73  ? 89   ASP E O     1 
ATOM   6409 C  CB    . ASP E  1 90  ? 139.144 6.225   45.798  1.00 76.84  ? 89   ASP E CB    1 
ATOM   6410 N  N     . THR E  1 91  ? 136.169 8.216   44.751  1.00 71.19  ? 90   THR E N     1 
ATOM   6411 C  CA    . THR E  1 91  ? 135.828 9.249   43.765  1.00 67.21  ? 90   THR E CA    1 
ATOM   6412 C  C     . THR E  1 91  ? 134.733 10.206  44.223  1.00 60.84  ? 90   THR E C     1 
ATOM   6413 O  O     . THR E  1 91  ? 133.952 9.904   45.130  1.00 57.06  ? 90   THR E O     1 
ATOM   6414 C  CB    . THR E  1 91  ? 135.488 8.686   42.357  1.00 72.04  ? 90   THR E CB    1 
ATOM   6415 O  OG1   . THR E  1 91  ? 135.682 9.727   41.380  1.00 68.38  ? 90   THR E OG1   1 
ATOM   6416 C  CG2   . THR E  1 91  ? 134.032 8.128   42.278  1.00 63.87  ? 90   THR E CG2   1 
ATOM   6417 N  N     . ARG E  1 92  ? 134.716 11.368  43.575  1.00 58.53  ? 91   ARG E N     1 
ATOM   6418 C  CA    . ARG E  1 92  ? 133.807 12.461  43.904  1.00 58.35  ? 91   ARG E CA    1 
ATOM   6419 C  C     . ARG E  1 92  ? 132.474 12.320  43.170  1.00 57.50  ? 91   ARG E C     1 
ATOM   6420 O  O     . ARG E  1 92  ? 131.467 12.937  43.535  1.00 58.75  ? 91   ARG E O     1 
ATOM   6421 C  CB    . ARG E  1 92  ? 134.455 13.799  43.531  1.00 61.88  ? 91   ARG E CB    1 
ATOM   6422 N  N     . GLY E  1 93  ? 132.469 11.510  42.124  1.00 56.64  ? 92   GLY E N     1 
ATOM   6423 C  CA    . GLY E  1 93  ? 131.293 11.365  41.309  1.00 55.32  ? 92   GLY E CA    1 
ATOM   6424 C  C     . GLY E  1 93  ? 131.673 10.911  39.920  1.00 56.70  ? 92   GLY E C     1 
ATOM   6425 O  O     . GLY E  1 93  ? 132.856 10.894  39.558  1.00 57.51  ? 92   GLY E O     1 
ATOM   6426 N  N     . PHE E  1 94  ? 130.650 10.549  39.153  1.00 55.21  ? 93   PHE E N     1 
ATOM   6427 C  CA    . PHE E  1 94  ? 130.830 9.991   37.839  1.00 57.41  ? 93   PHE E CA    1 
ATOM   6428 C  C     . PHE E  1 94  ? 130.408 11.018  36.822  1.00 57.51  ? 93   PHE E C     1 
ATOM   6429 O  O     . PHE E  1 94  ? 129.340 11.611  36.942  1.00 59.33  ? 93   PHE E O     1 
ATOM   6430 C  CB    . PHE E  1 94  ? 130.032 8.690   37.711  1.00 57.27  ? 93   PHE E CB    1 
ATOM   6431 C  CG    . PHE E  1 94  ? 130.482 7.650   38.684  1.00 47.52  ? 93   PHE E CG    1 
ATOM   6432 C  CD1   . PHE E  1 94  ? 129.801 7.440   39.866  1.00 55.00  ? 93   PHE E CD1   1 
ATOM   6433 C  CD2   . PHE E  1 94  ? 131.646 6.941   38.452  1.00 64.41  ? 93   PHE E CD2   1 
ATOM   6434 C  CE1   . PHE E  1 94  ? 130.249 6.512   40.785  1.00 55.12  ? 93   PHE E CE1   1 
ATOM   6435 C  CE2   . PHE E  1 94  ? 132.104 6.009   39.363  1.00 58.35  ? 93   PHE E CE2   1 
ATOM   6436 C  CZ    . PHE E  1 94  ? 131.402 5.791   40.532  1.00 59.85  ? 93   PHE E CZ    1 
ATOM   6437 N  N     . LEU E  1 95  ? 131.287 11.260  35.858  1.00 57.25  ? 94   LEU E N     1 
ATOM   6438 C  CA    . LEU E  1 95  ? 130.971 12.064  34.707  1.00 55.48  ? 94   LEU E CA    1 
ATOM   6439 C  C     . LEU E  1 95  ? 130.811 11.085  33.567  1.00 56.62  ? 94   LEU E C     1 
ATOM   6440 O  O     . LEU E  1 95  ? 131.794 10.497  33.096  1.00 53.18  ? 94   LEU E O     1 
ATOM   6441 C  CB    . LEU E  1 95  ? 132.094 13.050  34.413  1.00 52.85  ? 94   LEU E CB    1 
ATOM   6442 C  CG    . LEU E  1 95  ? 131.787 14.093  33.341  1.00 53.44  ? 94   LEU E CG    1 
ATOM   6443 C  CD1   . LEU E  1 95  ? 130.552 14.889  33.714  1.00 59.09  ? 94   LEU E CD1   1 
ATOM   6444 C  CD2   . LEU E  1 95  ? 132.981 15.021  33.146  1.00 56.82  ? 94   LEU E CD2   1 
ATOM   6445 N  N     . ILE E  1 96  ? 129.571 10.889  33.136  1.00 55.88  ? 95   ILE E N     1 
ATOM   6446 C  CA    . ILE E  1 96  ? 129.281 9.877   32.139  1.00 57.69  ? 95   ILE E CA    1 
ATOM   6447 C  C     . ILE E  1 96  ? 128.953 10.553  30.820  1.00 55.59  ? 95   ILE E C     1 
ATOM   6448 O  O     . ILE E  1 96  ? 127.975 11.274  30.697  1.00 53.46  ? 95   ILE E O     1 
ATOM   6449 C  CB    . ILE E  1 96  ? 128.198 8.911   32.633  1.00 59.21  ? 95   ILE E CB    1 
ATOM   6450 C  CG1   . ILE E  1 96  ? 128.703 8.230   33.909  1.00 59.20  ? 95   ILE E CG1   1 
ATOM   6451 C  CG2   . ILE E  1 96  ? 127.879 7.853   31.569  1.00 61.79  ? 95   ILE E CG2   1 
ATOM   6452 C  CD1   . ILE E  1 96  ? 127.714 7.361   34.590  1.00 66.69  ? 95   ILE E CD1   1 
ATOM   6453 N  N     . ASP E  1 97  ? 129.793 10.253  29.838  1.00 57.68  ? 96   ASP E N     1 
ATOM   6454 C  CA    . ASP E  1 97  ? 130.029 11.058  28.645  1.00 55.84  ? 96   ASP E CA    1 
ATOM   6455 C  C     . ASP E  1 97  ? 129.408 10.322  27.452  1.00 59.18  ? 96   ASP E C     1 
ATOM   6456 O  O     . ASP E  1 97  ? 129.716 9.155   27.212  1.00 59.55  ? 96   ASP E O     1 
ATOM   6457 C  CB    . ASP E  1 97  ? 131.556 11.199  28.528  1.00 57.19  ? 96   ASP E CB    1 
ATOM   6458 C  CG    . ASP E  1 97  ? 132.042 11.810  27.211  1.00 64.26  ? 96   ASP E CG    1 
ATOM   6459 O  OD1   . ASP E  1 97  ? 131.214 12.159  26.370  1.00 58.63  ? 96   ASP E OD1   1 
ATOM   6460 O  OD2   . ASP E  1 97  ? 133.286 11.940  27.029  1.00 66.17  ? 96   ASP E OD2   1 
ATOM   6461 N  N     . GLY E  1 98  ? 128.512 10.999  26.734  1.00 59.11  ? 97   GLY E N     1 
ATOM   6462 C  CA    . GLY E  1 98  ? 127.873 10.447  25.535  1.00 61.99  ? 97   GLY E CA    1 
ATOM   6463 C  C     . GLY E  1 98  ? 126.865 9.316   25.741  1.00 61.96  ? 97   GLY E C     1 
ATOM   6464 O  O     . GLY E  1 98  ? 126.506 8.605   24.796  1.00 64.13  ? 97   GLY E O     1 
ATOM   6465 N  N     . TYR E  1 99  ? 126.418 9.149   26.979  1.00 64.06  ? 98   TYR E N     1 
ATOM   6466 C  CA    . TYR E  1 99  ? 125.567 8.041   27.364  1.00 64.88  ? 98   TYR E CA    1 
ATOM   6467 C  C     . TYR E  1 99  ? 124.462 8.634   28.214  1.00 65.11  ? 98   TYR E C     1 
ATOM   6468 O  O     . TYR E  1 99  ? 124.715 9.598   28.965  1.00 67.21  ? 98   TYR E O     1 
ATOM   6469 C  CB    . TYR E  1 99  ? 126.350 7.005   28.172  1.00 66.26  ? 98   TYR E CB    1 
ATOM   6470 C  CG    . TYR E  1 99  ? 125.602 5.700   28.407  1.00 70.43  ? 98   TYR E CG    1 
ATOM   6471 C  CD1   . TYR E  1 99  ? 125.671 4.667   27.474  1.00 74.16  ? 98   TYR E CD1   1 
ATOM   6472 C  CD2   . TYR E  1 99  ? 124.803 5.509   29.546  1.00 56.73  ? 98   TYR E CD2   1 
ATOM   6473 C  CE1   . TYR E  1 99  ? 124.979 3.459   27.661  1.00 75.61  ? 98   TYR E CE1   1 
ATOM   6474 C  CE2   . TYR E  1 99  ? 124.104 4.297   29.751  1.00 56.82  ? 98   TYR E CE2   1 
ATOM   6475 C  CZ    . TYR E  1 99  ? 124.203 3.273   28.801  1.00 73.31  ? 98   TYR E CZ    1 
ATOM   6476 O  OH    . TYR E  1 99  ? 123.526 2.066   28.960  1.00 73.00  ? 98   TYR E OH    1 
ATOM   6477 N  N     . PRO E  1 100 ? 123.232 8.094   28.084  1.00 61.39  ? 99   PRO E N     1 
ATOM   6478 C  CA    . PRO E  1 100 ? 122.771 7.029   27.189  1.00 59.01  ? 99   PRO E CA    1 
ATOM   6479 C  C     . PRO E  1 100 ? 122.533 7.534   25.761  1.00 60.51  ? 99   PRO E C     1 
ATOM   6480 O  O     . PRO E  1 100 ? 122.465 8.741   25.548  1.00 58.65  ? 99   PRO E O     1 
ATOM   6481 C  CB    . PRO E  1 100 ? 121.443 6.638   27.811  1.00 61.12  ? 99   PRO E CB    1 
ATOM   6482 C  CG    . PRO E  1 100 ? 120.931 7.915   28.312  1.00 58.68  ? 99   PRO E CG    1 
ATOM   6483 C  CD    . PRO E  1 100 ? 122.123 8.591   28.909  1.00 63.28  ? 99   PRO E CD    1 
ATOM   6484 N  N     . ARG E  1 101 ? 122.408 6.622   24.800  1.00 61.02  ? 100  ARG E N     1 
ATOM   6485 C  CA    . ARG E  1 101 ? 122.166 6.994   23.399  1.00 61.63  ? 100  ARG E CA    1 
ATOM   6486 C  C     . ARG E  1 101 ? 120.694 6.814   23.005  1.00 56.61  ? 100  ARG E C     1 
ATOM   6487 O  O     . ARG E  1 101 ? 120.292 7.133   21.899  1.00 55.82  ? 100  ARG E O     1 
ATOM   6488 C  CB    . ARG E  1 101 ? 123.057 6.154   22.470  1.00 68.59  ? 100  ARG E CB    1 
ATOM   6489 C  CG    . ARG E  1 101 ? 124.541 6.495   22.520  1.00 67.32  ? 100  ARG E CG    1 
ATOM   6490 C  CD    . ARG E  1 101 ? 124.850 7.809   21.827  1.00 67.88  ? 100  ARG E CD    1 
ATOM   6491 N  N     . GLU E  1 102 ? 119.890 6.273   23.906  1.00 57.29  ? 101  GLU E N     1 
ATOM   6492 C  CA    . GLU E  1 102 ? 118.461 6.180   23.684  1.00 51.59  ? 101  GLU E CA    1 
ATOM   6493 C  C     . GLU E  1 102 ? 117.732 6.121   25.017  1.00 51.24  ? 101  GLU E C     1 
ATOM   6494 O  O     . GLU E  1 102 ? 118.347 5.881   26.033  1.00 55.89  ? 101  GLU E O     1 
ATOM   6495 C  CB    . GLU E  1 102 ? 118.122 4.991   22.775  1.00 53.96  ? 101  GLU E CB    1 
ATOM   6496 C  CG    . GLU E  1 102 ? 118.568 3.648   23.273  1.00 65.51  ? 101  GLU E CG    1 
ATOM   6497 C  CD    . GLU E  1 102 ? 118.385 2.585   22.227  1.00 82.45  ? 101  GLU E CD    1 
ATOM   6498 O  OE1   . GLU E  1 102 ? 118.817 2.809   21.079  1.00 83.29  ? 101  GLU E OE1   1 
ATOM   6499 O  OE2   . GLU E  1 102 ? 117.805 1.530   22.544  1.00 99.39  ? 101  GLU E OE2   1 
ATOM   6500 N  N     . VAL E  1 103 ? 116.428 6.364   25.000  1.00 54.15  ? 102  VAL E N     1 
ATOM   6501 C  CA    . VAL E  1 103 ? 115.641 6.462   26.221  1.00 55.67  ? 102  VAL E CA    1 
ATOM   6502 C  C     . VAL E  1 103 ? 115.650 5.142   26.981  1.00 57.71  ? 102  VAL E C     1 
ATOM   6503 O  O     . VAL E  1 103 ? 115.898 5.149   28.186  1.00 57.51  ? 102  VAL E O     1 
ATOM   6504 C  CB    . VAL E  1 103 ? 114.170 6.919   25.954  1.00 55.43  ? 102  VAL E CB    1 
ATOM   6505 C  CG1   . VAL E  1 103 ? 113.343 6.875   27.227  1.00 62.87  ? 102  VAL E CG1   1 
ATOM   6506 C  CG2   . VAL E  1 103 ? 114.131 8.326   25.365  1.00 49.13  ? 102  VAL E CG2   1 
ATOM   6507 N  N     . LYS E  1 104 ? 115.407 4.017   26.297  1.00 56.42  ? 103  LYS E N     1 
ATOM   6508 C  CA    . LYS E  1 104 ? 115.348 2.728   26.999  1.00 57.75  ? 103  LYS E CA    1 
ATOM   6509 C  C     . LYS E  1 104 ? 116.671 2.371   27.708  1.00 55.43  ? 103  LYS E C     1 
ATOM   6510 O  O     . LYS E  1 104 ? 116.649 1.692   28.732  1.00 52.95  ? 103  LYS E O     1 
ATOM   6511 C  CB    . LYS E  1 104 ? 114.837 1.583   26.098  1.00 62.58  ? 103  LYS E CB    1 
ATOM   6512 C  CG    . LYS E  1 104 ? 115.783 1.120   25.004  1.00 73.93  ? 103  LYS E CG    1 
ATOM   6513 N  N     . GLN E  1 105 ? 117.803 2.854   27.192  1.00 55.03  ? 104  GLN E N     1 
ATOM   6514 C  CA    . GLN E  1 105 ? 119.084 2.696   27.887  1.00 57.85  ? 104  GLN E CA    1 
ATOM   6515 C  C     . GLN E  1 105 ? 119.143 3.527   29.170  1.00 57.67  ? 104  GLN E C     1 
ATOM   6516 O  O     . GLN E  1 105 ? 119.726 3.096   30.168  1.00 62.41  ? 104  GLN E O     1 
ATOM   6517 C  CB    . GLN E  1 105 ? 120.259 3.146   27.024  1.00 56.27  ? 104  GLN E CB    1 
ATOM   6518 C  CG    . GLN E  1 105 ? 120.661 2.268   25.871  1.00 69.54  ? 104  GLN E CG    1 
ATOM   6519 C  CD    . GLN E  1 105 ? 121.824 2.888   25.085  1.00 72.99  ? 104  GLN E CD    1 
ATOM   6520 O  OE1   . GLN E  1 105 ? 122.572 3.731   25.608  1.00 74.33  ? 104  GLN E OE1   1 
ATOM   6521 N  NE2   . GLN E  1 105 ? 121.971 2.479   23.824  1.00 80.73  ? 104  GLN E NE2   1 
ATOM   6522 N  N     . GLY E  1 106 ? 118.601 4.740   29.112  1.00 56.77  ? 105  GLY E N     1 
ATOM   6523 C  CA    . GLY E  1 106 ? 118.525 5.622   30.268  1.00 59.14  ? 105  GLY E CA    1 
ATOM   6524 C  C     . GLY E  1 106 ? 117.593 5.072   31.323  1.00 59.89  ? 105  GLY E C     1 
ATOM   6525 O  O     . GLY E  1 106 ? 117.847 5.197   32.529  1.00 62.28  ? 105  GLY E O     1 
ATOM   6526 N  N     . GLU E  1 107 ? 116.511 4.453   30.862  1.00 57.46  ? 106  GLU E N     1 
ATOM   6527 C  CA    . GLU E  1 107 ? 115.551 3.810   31.756  1.00 58.18  ? 106  GLU E CA    1 
ATOM   6528 C  C     . GLU E  1 107 ? 116.167 2.629   32.509  1.00 55.53  ? 106  GLU E C     1 
ATOM   6529 O  O     . GLU E  1 107 ? 115.981 2.501   33.724  1.00 53.25  ? 106  GLU E O     1 
ATOM   6530 C  CB    . GLU E  1 107 ? 114.315 3.379   30.967  1.00 56.81  ? 106  GLU E CB    1 
ATOM   6531 C  CG    . GLU E  1 107 ? 113.534 4.570   30.503  1.00 62.97  ? 106  GLU E CG    1 
ATOM   6532 C  CD    . GLU E  1 107 ? 112.247 4.201   29.843  1.00 69.01  ? 106  GLU E CD    1 
ATOM   6533 O  OE1   . GLU E  1 107 ? 112.293 3.510   28.804  1.00 67.97  ? 106  GLU E OE1   1 
ATOM   6534 O  OE2   . GLU E  1 107 ? 111.191 4.626   30.356  1.00 84.12  ? 106  GLU E OE2   1 
ATOM   6535 N  N     . GLU E  1 108 ? 116.907 1.798   31.772  1.00 55.47  ? 107  GLU E N     1 
ATOM   6536 C  CA    . GLU E  1 108 ? 117.661 0.674   32.330  1.00 57.04  ? 107  GLU E CA    1 
ATOM   6537 C  C     . GLU E  1 108 ? 118.777 1.129   33.264  1.00 55.94  ? 107  GLU E C     1 
ATOM   6538 O  O     . GLU E  1 108 ? 119.053 0.486   34.278  1.00 55.92  ? 107  GLU E O     1 
ATOM   6539 C  CB    . GLU E  1 108 ? 118.262 -0.175  31.204  1.00 59.40  ? 107  GLU E CB    1 
ATOM   6540 C  CG    . GLU E  1 108 ? 117.290 -1.131  30.575  1.00 67.51  ? 107  GLU E CG    1 
ATOM   6541 C  CD    . GLU E  1 108 ? 116.877 -2.226  31.544  1.00 87.15  ? 107  GLU E CD    1 
ATOM   6542 O  OE1   . GLU E  1 108 ? 117.707 -3.124  31.814  1.00 83.05  ? 107  GLU E OE1   1 
ATOM   6543 O  OE2   . GLU E  1 108 ? 115.729 -2.175  32.042  1.00 80.13  ? 107  GLU E OE2   1 
ATOM   6544 N  N     . PHE E  1 109 ? 119.423 2.234   32.908  1.00 57.79  ? 108  PHE E N     1 
ATOM   6545 C  CA    . PHE E  1 109 ? 120.424 2.834   33.773  1.00 56.26  ? 108  PHE E CA    1 
ATOM   6546 C  C     . PHE E  1 109 ? 119.774 3.222   35.102  1.00 56.26  ? 108  PHE E C     1 
ATOM   6547 O  O     . PHE E  1 109 ? 120.314 2.923   36.166  1.00 53.60  ? 108  PHE E O     1 
ATOM   6548 C  CB    . PHE E  1 109 ? 121.086 4.047   33.100  1.00 57.77  ? 108  PHE E CB    1 
ATOM   6549 C  CG    . PHE E  1 109 ? 122.240 4.601   33.881  1.00 51.88  ? 108  PHE E CG    1 
ATOM   6550 C  CD1   . PHE E  1 109 ? 123.522 4.130   33.681  1.00 60.53  ? 108  PHE E CD1   1 
ATOM   6551 C  CD2   . PHE E  1 109 ? 122.032 5.562   34.854  1.00 63.74  ? 108  PHE E CD2   1 
ATOM   6552 C  CE1   . PHE E  1 109 ? 124.594 4.627   34.436  1.00 69.74  ? 108  PHE E CE1   1 
ATOM   6553 C  CE2   . PHE E  1 109 ? 123.095 6.077   35.598  1.00 59.01  ? 108  PHE E CE2   1 
ATOM   6554 C  CZ    . PHE E  1 109 ? 124.375 5.599   35.393  1.00 53.07  ? 108  PHE E CZ    1 
ATOM   6555 N  N     . GLY E  1 110 ? 118.607 3.861   35.030  1.00 57.10  ? 109  GLY E N     1 
ATOM   6556 C  CA    . GLY E  1 110 ? 117.849 4.239   36.230  1.00 58.93  ? 109  GLY E CA    1 
ATOM   6557 C  C     . GLY E  1 110 ? 117.506 3.070   37.146  1.00 59.59  ? 109  GLY E C     1 
ATOM   6558 O  O     . GLY E  1 110 ? 117.708 3.124   38.362  1.00 58.84  ? 109  GLY E O     1 
ATOM   6559 N  N     . ARG E  1 111 ? 116.984 2.017   36.532  1.00 58.35  ? 110  ARG E N     1 
ATOM   6560 C  CA    . ARG E  1 111 ? 116.581 0.806   37.216  1.00 59.58  ? 110  ARG E CA    1 
ATOM   6561 C  C     . ARG E  1 111 ? 117.732 0.096   37.923  1.00 58.96  ? 110  ARG E C     1 
ATOM   6562 O  O     . ARG E  1 111 ? 117.619 -0.271  39.087  1.00 59.39  ? 110  ARG E O     1 
ATOM   6563 C  CB    . ARG E  1 111 ? 116.020 -0.181  36.201  1.00 64.13  ? 110  ARG E CB    1 
ATOM   6564 C  CG    . ARG E  1 111 ? 114.508 -0.244  36.055  1.00 71.34  ? 110  ARG E CG    1 
ATOM   6565 C  CD    . ARG E  1 111 ? 114.094 -1.698  35.741  1.00 77.33  ? 110  ARG E CD    1 
ATOM   6566 N  NE    . ARG E  1 111 ? 115.154 -2.436  35.027  1.00 79.98  ? 110  ARG E NE    1 
ATOM   6567 C  CZ    . ARG E  1 111 ? 115.773 -3.549  35.446  1.00 78.60  ? 110  ARG E CZ    1 
ATOM   6568 N  NH1   . ARG E  1 111 ? 116.720 -4.083  34.679  1.00 65.09  ? 110  ARG E NH1   1 
ATOM   6569 N  NH2   . ARG E  1 111 ? 115.463 -4.149  36.601  1.00 72.16  ? 110  ARG E NH2   1 
ATOM   6570 N  N     . ARG E  1 112 ? 118.822 -0.116  37.190  1.00 58.10  ? 111  ARG E N     1 
ATOM   6571 C  CA    . ARG E  1 112 ? 119.931 -0.941  37.649  1.00 57.28  ? 111  ARG E CA    1 
ATOM   6572 C  C     . ARG E  1 112 ? 120.954 -0.151  38.449  1.00 55.97  ? 111  ARG E C     1 
ATOM   6573 O  O     . ARG E  1 112 ? 121.489 -0.656  39.422  1.00 59.54  ? 111  ARG E O     1 
ATOM   6574 C  CB    . ARG E  1 112 ? 120.642 -1.590  36.462  1.00 58.97  ? 111  ARG E CB    1 
ATOM   6575 C  CG    . ARG E  1 112 ? 119.727 -2.326  35.484  1.00 64.74  ? 111  ARG E CG    1 
ATOM   6576 C  CD    . ARG E  1 112 ? 119.847 -3.830  35.555  1.00 76.22  ? 111  ARG E CD    1 
ATOM   6577 N  NE    . ARG E  1 112 ? 121.224 -4.308  35.408  1.00 74.41  ? 111  ARG E NE    1 
ATOM   6578 C  CZ    . ARG E  1 112 ? 121.930 -4.941  36.350  1.00 87.74  ? 111  ARG E CZ    1 
ATOM   6579 N  NH1   . ARG E  1 112 ? 121.416 -5.204  37.553  1.00 89.39  ? 111  ARG E NH1   1 
ATOM   6580 N  NH2   . ARG E  1 112 ? 123.172 -5.324  36.080  1.00 92.17  ? 111  ARG E NH2   1 
ATOM   6581 N  N     . ILE E  1 113 ? 121.238 1.078   38.051  1.00 57.03  ? 112  ILE E N     1 
ATOM   6582 C  CA    . ILE E  1 113 ? 122.316 1.846   38.682  1.00 59.20  ? 112  ILE E CA    1 
ATOM   6583 C  C     . ILE E  1 113 ? 121.783 3.019   39.509  1.00 58.26  ? 112  ILE E C     1 
ATOM   6584 O  O     . ILE E  1 113 ? 121.996 3.100   40.712  1.00 58.05  ? 112  ILE E O     1 
ATOM   6585 C  CB    . ILE E  1 113 ? 123.334 2.326   37.614  1.00 55.91  ? 112  ILE E CB    1 
ATOM   6586 C  CG1   . ILE E  1 113 ? 124.085 1.111   37.061  1.00 57.63  ? 112  ILE E CG1   1 
ATOM   6587 C  CG2   . ILE E  1 113 ? 124.314 3.340   38.207  1.00 61.02  ? 112  ILE E CG2   1 
ATOM   6588 C  CD1   . ILE E  1 113 ? 125.004 1.423   35.904  1.00 67.26  ? 112  ILE E CD1   1 
ATOM   6589 N  N     . GLY E  1 114 ? 121.095 3.935   38.848  1.00 59.88  ? 113  GLY E N     1 
ATOM   6590 C  CA    . GLY E  1 114 ? 120.551 5.099   39.531  1.00 60.35  ? 113  GLY E CA    1 
ATOM   6591 C  C     . GLY E  1 114 ? 120.219 6.209   38.569  1.00 61.26  ? 113  GLY E C     1 
ATOM   6592 O  O     . GLY E  1 114 ? 120.456 6.103   37.365  1.00 63.72  ? 113  GLY E O     1 
ATOM   6593 N  N     . ASP E  1 115 ? 119.666 7.284   39.108  1.00 59.98  ? 114  ASP E N     1 
ATOM   6594 C  CA    . ASP E  1 115 ? 119.214 8.386   38.296  1.00 60.10  ? 114  ASP E CA    1 
ATOM   6595 C  C     . ASP E  1 115 ? 120.290 9.464   38.350  1.00 57.59  ? 114  ASP E C     1 
ATOM   6596 O  O     . ASP E  1 115 ? 120.852 9.710   39.398  1.00 56.88  ? 114  ASP E O     1 
ATOM   6597 C  CB    . ASP E  1 115 ? 117.872 8.902   38.824  1.00 64.33  ? 114  ASP E CB    1 
ATOM   6598 C  CG    . ASP E  1 115 ? 116.885 7.768   39.141  1.00 68.80  ? 114  ASP E CG    1 
ATOM   6599 O  OD1   . ASP E  1 115 ? 116.497 7.009   38.220  1.00 72.10  ? 114  ASP E OD1   1 
ATOM   6600 O  OD2   . ASP E  1 115 ? 116.490 7.645   40.321  1.00 71.90  ? 114  ASP E OD2   1 
ATOM   6601 N  N     . PRO E  1 116 ? 120.591 10.098  37.212  1.00 57.88  ? 115  PRO E N     1 
ATOM   6602 C  CA    . PRO E  1 116 ? 121.584 11.178  37.213  1.00 58.10  ? 115  PRO E CA    1 
ATOM   6603 C  C     . PRO E  1 116 ? 121.077 12.422  37.943  1.00 57.24  ? 115  PRO E C     1 
ATOM   6604 O  O     . PRO E  1 116 ? 119.915 12.801  37.760  1.00 55.09  ? 115  PRO E O     1 
ATOM   6605 C  CB    . PRO E  1 116 ? 121.760 11.494  35.727  1.00 55.06  ? 115  PRO E CB    1 
ATOM   6606 C  CG    . PRO E  1 116 ? 120.445 11.103  35.113  1.00 56.13  ? 115  PRO E CG    1 
ATOM   6607 C  CD    . PRO E  1 116 ? 120.019 9.875   35.871  1.00 59.79  ? 115  PRO E CD    1 
ATOM   6608 N  N     . GLN E  1 117 ? 121.954 13.063  38.722  1.00 55.72  ? 116  GLN E N     1 
ATOM   6609 C  CA    . GLN E  1 117 ? 121.591 14.287  39.436  1.00 56.39  ? 116  GLN E CA    1 
ATOM   6610 C  C     . GLN E  1 117 ? 121.450 15.459  38.480  1.00 58.01  ? 116  GLN E C     1 
ATOM   6611 O  O     . GLN E  1 117 ? 120.689 16.384  38.747  1.00 59.47  ? 116  GLN E O     1 
ATOM   6612 C  CB    . GLN E  1 117 ? 122.629 14.679  40.499  1.00 60.78  ? 116  GLN E CB    1 
ATOM   6613 C  CG    . GLN E  1 117 ? 123.439 13.566  41.167  1.00 56.72  ? 116  GLN E CG    1 
ATOM   6614 C  CD    . GLN E  1 117 ? 122.607 12.448  41.724  1.00 43.50  ? 116  GLN E CD    1 
ATOM   6615 O  OE1   . GLN E  1 117 ? 121.384 12.457  41.654  1.00 58.87  ? 116  GLN E OE1   1 
ATOM   6616 N  NE2   . GLN E  1 117 ? 123.273 11.470  42.287  1.00 53.92  ? 116  GLN E NE2   1 
ATOM   6617 N  N     . LEU E  1 118 ? 122.208 15.405  37.383  1.00 56.97  ? 117  LEU E N     1 
ATOM   6618 C  CA    . LEU E  1 118 ? 122.359 16.504  36.457  1.00 52.77  ? 117  LEU E CA    1 
ATOM   6619 C  C     . LEU E  1 118 ? 122.693 15.942  35.105  1.00 54.80  ? 117  LEU E C     1 
ATOM   6620 O  O     . LEU E  1 118 ? 123.440 14.981  35.005  1.00 51.96  ? 117  LEU E O     1 
ATOM   6621 C  CB    . LEU E  1 118 ? 123.503 17.413  36.903  1.00 58.17  ? 117  LEU E CB    1 
ATOM   6622 C  CG    . LEU E  1 118 ? 123.943 18.599  36.034  1.00 52.78  ? 117  LEU E CG    1 
ATOM   6623 C  CD1   . LEU E  1 118 ? 122.821 19.614  35.853  1.00 59.19  ? 117  LEU E CD1   1 
ATOM   6624 C  CD2   . LEU E  1 118 ? 125.176 19.261  36.664  1.00 53.44  ? 117  LEU E CD2   1 
ATOM   6625 N  N     . VAL E  1 119 ? 122.115 16.550  34.077  1.00 54.42  ? 118  VAL E N     1 
ATOM   6626 C  CA    . VAL E  1 119 ? 122.426 16.251  32.703  1.00 56.38  ? 118  VAL E CA    1 
ATOM   6627 C  C     . VAL E  1 119 ? 122.866 17.557  32.058  1.00 56.57  ? 118  VAL E C     1 
ATOM   6628 O  O     . VAL E  1 119 ? 122.087 18.494  31.976  1.00 56.74  ? 118  VAL E O     1 
ATOM   6629 C  CB    . VAL E  1 119 ? 121.193 15.701  31.947  1.00 55.53  ? 118  VAL E CB    1 
ATOM   6630 C  CG1   . VAL E  1 119 ? 121.524 15.511  30.477  1.00 61.02  ? 118  VAL E CG1   1 
ATOM   6631 C  CG2   . VAL E  1 119 ? 120.736 14.392  32.575  1.00 59.28  ? 118  VAL E CG2   1 
ATOM   6632 N  N     . ILE E  1 120 ? 124.120 17.614  31.627  1.00 59.34  ? 119  ILE E N     1 
ATOM   6633 C  CA    . ILE E  1 120 ? 124.664 18.775  30.918  1.00 60.37  ? 119  ILE E CA    1 
ATOM   6634 C  C     . ILE E  1 120 ? 124.640 18.576  29.402  1.00 63.33  ? 119  ILE E C     1 
ATOM   6635 O  O     . ILE E  1 120 ? 125.176 17.571  28.893  1.00 59.60  ? 119  ILE E O     1 
ATOM   6636 C  CB    . ILE E  1 120 ? 126.109 19.007  31.314  1.00 65.10  ? 119  ILE E CB    1 
ATOM   6637 C  CG1   . ILE E  1 120 ? 126.197 19.389  32.777  1.00 57.46  ? 119  ILE E CG1   1 
ATOM   6638 C  CG2   . ILE E  1 120 ? 126.740 20.078  30.450  1.00 74.86  ? 119  ILE E CG2   1 
ATOM   6639 C  CD1   . ILE E  1 120 ? 127.502 18.982  33.376  1.00 67.25  ? 119  ILE E CD1   1 
ATOM   6640 N  N     . CYS E  1 121 ? 124.023 19.539  28.700  1.00 63.74  ? 120  CYS E N     1 
ATOM   6641 C  CA    . CYS E  1 121 ? 123.996 19.577  27.223  1.00 64.47  ? 120  CYS E CA    1 
ATOM   6642 C  C     . CYS E  1 121 ? 124.857 20.668  26.639  1.00 62.48  ? 120  CYS E C     1 
ATOM   6643 O  O     . CYS E  1 121 ? 124.640 21.846  26.903  1.00 65.08  ? 120  CYS E O     1 
ATOM   6644 C  CB    . CYS E  1 121 ? 122.596 19.816  26.719  1.00 68.26  ? 120  CYS E CB    1 
ATOM   6645 S  SG    . CYS E  1 121 ? 121.555 18.619  27.357  1.00 83.89  ? 120  CYS E SG    1 
ATOM   6646 N  N     . MET E  1 122 ? 125.820 20.268  25.826  1.00 62.70  ? 121  MET E N     1 
ATOM   6647 C  CA    . MET E  1 122 ? 126.699 21.200  25.139  1.00 64.63  ? 121  MET E CA    1 
ATOM   6648 C  C     . MET E  1 122 ? 125.991 21.625  23.877  1.00 64.21  ? 121  MET E C     1 
ATOM   6649 O  O     . MET E  1 122 ? 126.084 20.978  22.833  1.00 69.80  ? 121  MET E O     1 
ATOM   6650 C  CB    . MET E  1 122 ? 128.010 20.517  24.804  1.00 69.45  ? 121  MET E CB    1 
ATOM   6651 C  CG    . MET E  1 122 ? 128.655 19.837  26.001  1.00 75.13  ? 121  MET E CG    1 
ATOM   6652 S  SD    . MET E  1 122 ? 130.114 20.664  26.529  1.00 72.92  ? 121  MET E SD    1 
ATOM   6653 C  CE    . MET E  1 122 ? 129.424 22.266  26.900  1.00 84.34  ? 121  MET E CE    1 
ATOM   6654 N  N     . ASP E  1 123 ? 125.251 22.710  23.998  1.00 63.83  ? 122  ASP E N     1 
ATOM   6655 C  CA    . ASP E  1 123 ? 124.402 23.193  22.940  1.00 65.75  ? 122  ASP E CA    1 
ATOM   6656 C  C     . ASP E  1 123 ? 125.243 23.986  21.934  1.00 63.40  ? 122  ASP E C     1 
ATOM   6657 O  O     . ASP E  1 123 ? 125.926 24.943  22.292  1.00 61.75  ? 122  ASP E O     1 
ATOM   6658 C  CB    . ASP E  1 123 ? 123.306 24.077  23.565  1.00 74.69  ? 122  ASP E CB    1 
ATOM   6659 C  CG    . ASP E  1 123 ? 122.084 24.221  22.684  1.00 76.81  ? 122  ASP E CG    1 
ATOM   6660 O  OD1   . ASP E  1 123 ? 121.762 23.274  21.927  1.00 89.01  ? 122  ASP E OD1   1 
ATOM   6661 O  OD2   . ASP E  1 123 ? 121.430 25.281  22.777  1.00 95.75  ? 122  ASP E OD2   1 
ATOM   6662 N  N     . CYS E  1 124 ? 125.169 23.590  20.671  1.00 65.32  ? 123  CYS E N     1 
ATOM   6663 C  CA    . CYS E  1 124 ? 126.030 24.136  19.623  1.00 63.14  ? 123  CYS E CA    1 
ATOM   6664 C  C     . CYS E  1 124 ? 125.333 24.059  18.260  1.00 59.01  ? 123  CYS E C     1 
ATOM   6665 O  O     . CYS E  1 124 ? 124.701 23.057  17.953  1.00 64.22  ? 123  CYS E O     1 
ATOM   6666 C  CB    . CYS E  1 124 ? 127.313 23.310  19.599  1.00 60.46  ? 123  CYS E CB    1 
ATOM   6667 S  SG    . CYS E  1 124 ? 128.642 24.178  18.866  1.00 77.39  ? 123  CYS E SG    1 
ATOM   6668 N  N     . SER E  1 125 ? 125.443 25.091  17.434  1.00 57.93  ? 124  SER E N     1 
ATOM   6669 C  CA    . SER E  1 125 ? 124.782 25.069  16.124  1.00 54.62  ? 124  SER E CA    1 
ATOM   6670 C  C     . SER E  1 125 ? 125.453 24.090  15.168  1.00 55.40  ? 124  SER E C     1 
ATOM   6671 O  O     . SER E  1 125 ? 126.619 23.730  15.329  1.00 59.58  ? 124  SER E O     1 
ATOM   6672 C  CB    . SER E  1 125 ? 124.711 26.460  15.497  1.00 54.15  ? 124  SER E CB    1 
ATOM   6673 O  OG    . SER E  1 125 ? 125.969 26.912  15.046  1.00 51.87  ? 124  SER E OG    1 
ATOM   6674 N  N     . ALA E  1 126 ? 124.681 23.628  14.189  1.00 59.22  ? 125  ALA E N     1 
ATOM   6675 C  CA    . ALA E  1 126 ? 125.178 22.767  13.126  1.00 57.54  ? 125  ALA E CA    1 
ATOM   6676 C  C     . ALA E  1 126 ? 126.342 23.431  12.382  1.00 58.22  ? 125  ALA E C     1 
ATOM   6677 O  O     . ALA E  1 126 ? 127.330 22.789  12.022  1.00 60.84  ? 125  ALA E O     1 
ATOM   6678 C  CB    . ALA E  1 126 ? 124.058 22.468  12.164  1.00 56.31  ? 125  ALA E CB    1 
ATOM   6679 N  N     . ASP E  1 127 ? 126.209 24.732  12.174  1.00 58.36  ? 126  ASP E N     1 
ATOM   6680 C  CA    . ASP E  1 127 ? 127.230 25.524  11.509  1.00 61.98  ? 126  ASP E CA    1 
ATOM   6681 C  C     . ASP E  1 127 ? 128.554 25.562  12.276  1.00 58.39  ? 126  ASP E C     1 
ATOM   6682 O  O     . ASP E  1 127 ? 129.634 25.376  11.699  1.00 58.03  ? 126  ASP E O     1 
ATOM   6683 C  CB    . ASP E  1 127 ? 126.726 26.940  11.314  1.00 62.15  ? 126  ASP E CB    1 
ATOM   6684 C  CG    . ASP E  1 127 ? 126.694 27.319  9.880   1.00 82.79  ? 126  ASP E CG    1 
ATOM   6685 O  OD1   . ASP E  1 127 ? 127.524 28.165  9.463   1.00 92.26  ? 126  ASP E OD1   1 
ATOM   6686 O  OD2   . ASP E  1 127 ? 125.853 26.723  9.171   1.00 93.26  ? 126  ASP E OD2   1 
ATOM   6687 N  N     . THR E  1 128 ? 128.466 25.800  13.578  1.00 57.42  ? 127  THR E N     1 
ATOM   6688 C  CA    . THR E  1 128 ? 129.649 25.799  14.426  1.00 58.94  ? 127  THR E CA    1 
ATOM   6689 C  C     . THR E  1 128 ? 130.355 24.436  14.413  1.00 58.06  ? 127  THR E C     1 
ATOM   6690 O  O     . THR E  1 128 ? 131.569 24.358  14.214  1.00 61.63  ? 127  THR E O     1 
ATOM   6691 C  CB    . THR E  1 128 ? 129.262 26.162  15.858  1.00 61.25  ? 127  THR E CB    1 
ATOM   6692 O  OG1   . THR E  1 128 ? 128.595 27.426  15.841  1.00 65.51  ? 127  THR E OG1   1 
ATOM   6693 C  CG2   . THR E  1 128 ? 130.486 26.238  16.755  1.00 64.47  ? 127  THR E CG2   1 
ATOM   6694 N  N     . MET E  1 129 ? 129.598 23.367  14.627  1.00 56.08  ? 128  MET E N     1 
ATOM   6695 C  CA    . MET E  1 129 ? 130.196 22.042  14.685  1.00 59.68  ? 128  MET E CA    1 
ATOM   6696 C  C     . MET E  1 129 ? 130.821 21.699  13.347  1.00 56.33  ? 128  MET E C     1 
ATOM   6697 O  O     . MET E  1 129 ? 131.944 21.188  13.285  1.00 55.77  ? 128  MET E O     1 
ATOM   6698 C  CB    . MET E  1 129 ? 129.158 20.994  15.077  1.00 58.97  ? 128  MET E CB    1 
ATOM   6699 C  CG    . MET E  1 129 ? 128.712 21.158  16.504  1.00 56.25  ? 128  MET E CG    1 
ATOM   6700 S  SD    . MET E  1 129 ? 127.767 19.782  17.146  1.00 66.06  ? 128  MET E SD    1 
ATOM   6701 C  CE    . MET E  1 129 ? 126.134 20.072  16.426  1.00 54.86  ? 128  MET E CE    1 
ATOM   6702 N  N     . THR E  1 130 ? 130.093 22.011  12.283  1.00 57.05  ? 129  THR E N     1 
ATOM   6703 C  CA    . THR E  1 130 ? 130.561 21.774  10.918  1.00 56.83  ? 129  THR E CA    1 
ATOM   6704 C  C     . THR E  1 130 ? 131.878 22.480  10.630  1.00 54.82  ? 129  THR E C     1 
ATOM   6705 O  O     . THR E  1 130 ? 132.814 21.869  10.133  1.00 57.33  ? 129  THR E O     1 
ATOM   6706 C  CB    . THR E  1 130 ? 129.462 22.145  9.896   1.00 56.60  ? 129  THR E CB    1 
ATOM   6707 O  OG1   . THR E  1 130 ? 128.350 21.241  10.076  1.00 56.12  ? 129  THR E OG1   1 
ATOM   6708 C  CG2   . THR E  1 130 ? 129.966 22.019  8.476   1.00 45.05  ? 129  THR E CG2   1 
ATOM   6709 N  N     . ASN E  1 131 ? 131.961 23.753  10.993  1.00 56.15  ? 130  ASN E N     1 
ATOM   6710 C  CA    . ASN E  1 131 ? 133.156 24.557  10.732  1.00 53.25  ? 130  ASN E CA    1 
ATOM   6711 C  C     . ASN E  1 131 ? 134.359 24.136  11.553  1.00 52.79  ? 130  ASN E C     1 
ATOM   6712 O  O     . ASN E  1 131 ? 135.473 24.085  11.040  1.00 53.63  ? 130  ASN E O     1 
ATOM   6713 C  CB    . ASN E  1 131 ? 132.866 26.037  10.976  1.00 50.78  ? 130  ASN E CB    1 
ATOM   6714 C  CG    . ASN E  1 131 ? 131.948 26.630  9.924   1.00 61.12  ? 130  ASN E CG    1 
ATOM   6715 O  OD1   . ASN E  1 131 ? 131.742 26.054  8.849   1.00 52.19  ? 130  ASN E OD1   1 
ATOM   6716 N  ND2   . ASN E  1 131 ? 131.392 27.794  10.230  1.00 54.79  ? 130  ASN E ND2   1 
ATOM   6717 N  N     . ARG E  1 132 ? 134.134 23.865  12.832  1.00 54.11  ? 131  ARG E N     1 
ATOM   6718 C  CA    . ARG E  1 132 ? 135.157 23.274  13.695  1.00 54.64  ? 131  ARG E CA    1 
ATOM   6719 C  C     . ARG E  1 132 ? 135.690 21.967  13.119  1.00 53.90  ? 131  ARG E C     1 
ATOM   6720 O  O     . ARG E  1 132 ? 136.899 21.767  12.998  1.00 57.33  ? 131  ARG E O     1 
ATOM   6721 C  CB    . ARG E  1 132 ? 134.582 23.029  15.084  1.00 58.94  ? 131  ARG E CB    1 
ATOM   6722 C  CG    . ARG E  1 132 ? 134.355 24.298  15.872  1.00 51.37  ? 131  ARG E CG    1 
ATOM   6723 C  CD    . ARG E  1 132 ? 133.639 24.007  17.192  1.00 61.29  ? 131  ARG E CD    1 
ATOM   6724 N  NE    . ARG E  1 132 ? 133.605 25.184  18.058  1.00 56.35  ? 131  ARG E NE    1 
ATOM   6725 C  CZ    . ARG E  1 132 ? 132.930 25.294  19.200  1.00 53.44  ? 131  ARG E CZ    1 
ATOM   6726 N  NH1   . ARG E  1 132 ? 132.216 24.287  19.680  1.00 60.10  ? 131  ARG E NH1   1 
ATOM   6727 N  NH2   . ARG E  1 132 ? 132.980 26.434  19.873  1.00 55.23  ? 131  ARG E NH2   1 
ATOM   6728 N  N     . LEU E  1 133 ? 134.781 21.094  12.727  1.00 55.73  ? 132  LEU E N     1 
ATOM   6729 C  CA    . LEU E  1 133 ? 135.158 19.786  12.222  1.00 54.20  ? 132  LEU E CA    1 
ATOM   6730 C  C     . LEU E  1 133 ? 135.932 19.904  10.920  1.00 54.99  ? 132  LEU E C     1 
ATOM   6731 O  O     . LEU E  1 133 ? 136.931 19.211  10.728  1.00 54.57  ? 132  LEU E O     1 
ATOM   6732 C  CB    . LEU E  1 133 ? 133.909 18.924  12.049  1.00 56.08  ? 132  LEU E CB    1 
ATOM   6733 C  CG    . LEU E  1 133 ? 133.282 18.503  13.385  1.00 57.28  ? 132  LEU E CG    1 
ATOM   6734 C  CD1   . LEU E  1 133 ? 131.966 17.720  13.158  1.00 56.09  ? 132  LEU E CD1   1 
ATOM   6735 C  CD2   . LEU E  1 133 ? 134.257 17.686  14.217  1.00 52.55  ? 132  LEU E CD2   1 
ATOM   6736 N  N     . LEU E  1 134 ? 135.473 20.785  10.033  1.00 53.01  ? 133  LEU E N     1 
ATOM   6737 C  CA    . LEU E  1 134 ? 136.240 21.134  8.836   1.00 54.30  ? 133  LEU E CA    1 
ATOM   6738 C  C     . LEU E  1 134 ? 137.621 21.711  9.157   1.00 52.73  ? 133  LEU E C     1 
ATOM   6739 O  O     . LEU E  1 134 ? 138.608 21.314  8.565   1.00 53.43  ? 133  LEU E O     1 
ATOM   6740 C  CB    . LEU E  1 134 ? 135.475 22.148  7.990   1.00 56.81  ? 133  LEU E CB    1 
ATOM   6741 C  CG    . LEU E  1 134 ? 134.415 21.600  7.038   1.00 63.13  ? 133  LEU E CG    1 
ATOM   6742 C  CD1   . LEU E  1 134 ? 133.612 22.764  6.440   1.00 53.76  ? 133  LEU E CD1   1 
ATOM   6743 C  CD2   . LEU E  1 134 ? 135.065 20.758  5.933   1.00 60.90  ? 133  LEU E CD2   1 
ATOM   6744 N  N     . GLN E  1 135 ? 137.686 22.637  10.102  1.00 52.37  ? 134  GLN E N     1 
ATOM   6745 C  CA    . GLN E  1 135 ? 138.936 23.278  10.442  1.00 55.76  ? 134  GLN E CA    1 
ATOM   6746 C  C     . GLN E  1 135 ? 139.991 22.295  10.962  1.00 56.77  ? 134  GLN E C     1 
ATOM   6747 O  O     . GLN E  1 135 ? 141.194 22.504  10.721  1.00 57.47  ? 134  GLN E O     1 
ATOM   6748 C  CB    . GLN E  1 135 ? 138.708 24.403  11.455  1.00 59.88  ? 134  GLN E CB    1 
ATOM   6749 N  N     . MET E  1 136 ? 139.554 21.243  11.661  1.00 56.95  ? 135  MET E N     1 
ATOM   6750 C  CA    . MET E  1 136 ? 140.495 20.233  12.177  1.00 63.27  ? 135  MET E CA    1 
ATOM   6751 C  C     . MET E  1 136 ? 140.705 19.077  11.205  1.00 58.93  ? 135  MET E C     1 
ATOM   6752 O  O     . MET E  1 136 ? 141.564 18.228  11.435  1.00 60.42  ? 135  MET E O     1 
ATOM   6753 C  CB    . MET E  1 136 ? 140.135 19.702  13.585  1.00 57.54  ? 135  MET E CB    1 
ATOM   6754 C  CG    . MET E  1 136 ? 138.708 19.797  14.029  1.00 66.14  ? 135  MET E CG    1 
ATOM   6755 S  SD    . MET E  1 136 ? 138.428 18.944  15.600  1.00 81.68  ? 135  MET E SD    1 
ATOM   6756 C  CE    . MET E  1 136 ? 136.866 19.649  16.144  1.00 75.48  ? 135  MET E CE    1 
ATOM   6757 N  N     . SER E  1 137 ? 139.948 19.076  10.112  1.00 57.56  ? 136  SER E N     1 
ATOM   6758 C  CA    . SER E  1 137 ? 140.065 18.058  9.088   1.00 58.12  ? 136  SER E CA    1 
ATOM   6759 C  C     . SER E  1 137 ? 141.453 18.068  8.491   1.00 56.78  ? 136  SER E C     1 
ATOM   6760 O  O     . SER E  1 137 ? 142.041 19.133  8.286   1.00 60.89  ? 136  SER E O     1 
ATOM   6761 C  CB    . SER E  1 137 ? 139.033 18.284  7.979   1.00 58.73  ? 136  SER E CB    1 
ATOM   6762 O  OG    . SER E  1 137 ? 139.234 17.387  6.901   1.00 65.31  ? 136  SER E OG    1 
ATOM   6763 N  N     . ARG E  1 138 ? 141.980 16.873  8.234   1.00 58.47  ? 137  ARG E N     1 
ATOM   6764 C  CA    . ARG E  1 138 ? 143.260 16.717  7.541   1.00 60.66  ? 137  ARG E CA    1 
ATOM   6765 C  C     . ARG E  1 138 ? 143.110 15.917  6.241   1.00 58.77  ? 137  ARG E C     1 
ATOM   6766 O  O     . ARG E  1 138 ? 144.111 15.523  5.643   1.00 63.27  ? 137  ARG E O     1 
ATOM   6767 C  CB    . ARG E  1 138 ? 144.278 16.022  8.448   1.00 61.92  ? 137  ARG E CB    1 
ATOM   6768 C  CG    . ARG E  1 138 ? 144.554 16.702  9.786   1.00 69.30  ? 137  ARG E CG    1 
ATOM   6769 C  CD    . ARG E  1 138 ? 145.397 17.988  9.668   1.00 64.12  ? 137  ARG E CD    1 
ATOM   6770 N  NE    . ARG E  1 138 ? 144.655 19.162  10.142  1.00 68.63  ? 137  ARG E NE    1 
ATOM   6771 C  CZ    . ARG E  1 138 ? 145.201 20.289  10.590  1.00 49.78  ? 137  ARG E CZ    1 
ATOM   6772 N  NH1   . ARG E  1 138 ? 146.518 20.444  10.628  1.00 69.21  ? 137  ARG E NH1   1 
ATOM   6773 N  NH2   . ARG E  1 138 ? 144.414 21.277  10.999  1.00 58.97  ? 137  ARG E NH2   1 
ATOM   6774 N  N     . SER E  1 139 ? 141.875 15.688  5.800   1.00 58.72  ? 138  SER E N     1 
ATOM   6775 C  CA    . SER E  1 139 ? 141.616 14.886  4.606   1.00 58.59  ? 138  SER E CA    1 
ATOM   6776 C  C     . SER E  1 139 ? 142.200 15.492  3.342   1.00 59.41  ? 138  SER E C     1 
ATOM   6777 O  O     . SER E  1 139 ? 142.330 16.718  3.219   1.00 60.57  ? 138  SER E O     1 
ATOM   6778 C  CB    . SER E  1 139 ? 140.117 14.697  4.377   1.00 62.31  ? 138  SER E CB    1 
ATOM   6779 O  OG    . SER E  1 139 ? 139.880 14.267  3.045   1.00 65.20  ? 138  SER E OG    1 
ATOM   6780 N  N     . SER E  1 140 ? 142.524 14.606  2.402   1.00 58.20  ? 139  SER E N     1 
ATOM   6781 C  CA    . SER E  1 140 ? 142.940 14.976  1.053   1.00 58.96  ? 139  SER E CA    1 
ATOM   6782 C  C     . SER E  1 140 ? 141.771 14.922  0.055   1.00 57.16  ? 139  SER E C     1 
ATOM   6783 O  O     . SER E  1 140 ? 141.865 15.449  -1.048  1.00 57.99  ? 139  SER E O     1 
ATOM   6784 C  CB    . SER E  1 140 ? 144.022 14.007  0.590   1.00 62.31  ? 139  SER E CB    1 
ATOM   6785 O  OG    . SER E  1 140 ? 143.577 12.671  0.770   1.00 66.69  ? 139  SER E OG    1 
ATOM   6786 N  N     . LEU E  1 141 ? 140.668 14.295  0.447   1.00 56.76  ? 140  LEU E N     1 
ATOM   6787 C  CA    . LEU E  1 141 ? 139.582 14.007  -0.484  1.00 57.63  ? 140  LEU E CA    1 
ATOM   6788 C  C     . LEU E  1 141 ? 138.837 15.292  -0.826  1.00 56.79  ? 140  LEU E C     1 
ATOM   6789 O  O     . LEU E  1 141 ? 138.917 16.258  -0.070  1.00 61.67  ? 140  LEU E O     1 
ATOM   6790 C  CB    . LEU E  1 141 ? 138.629 12.983  0.147   1.00 60.30  ? 140  LEU E CB    1 
ATOM   6791 C  CG    . LEU E  1 141 ? 139.300 11.667  0.578   1.00 65.66  ? 140  LEU E CG    1 
ATOM   6792 C  CD1   . LEU E  1 141 ? 138.631 11.080  1.823   1.00 64.19  ? 140  LEU E CD1   1 
ATOM   6793 C  CD2   . LEU E  1 141 ? 139.336 10.664  -0.578  1.00 61.63  ? 140  LEU E CD2   1 
ATOM   6794 N  N     . PRO E  1 142 ? 138.106 15.314  -1.958  1.00 56.84  ? 141  PRO E N     1 
ATOM   6795 C  CA    . PRO E  1 142 ? 137.227 16.448  -2.300  1.00 57.50  ? 141  PRO E CA    1 
ATOM   6796 C  C     . PRO E  1 142 ? 136.335 16.936  -1.150  1.00 57.33  ? 141  PRO E C     1 
ATOM   6797 O  O     . PRO E  1 142 ? 135.918 16.139  -0.300  1.00 58.86  ? 141  PRO E O     1 
ATOM   6798 C  CB    . PRO E  1 142 ? 136.349 15.879  -3.423  1.00 59.43  ? 141  PRO E CB    1 
ATOM   6799 C  CG    . PRO E  1 142 ? 137.193 14.859  -4.075  1.00 57.78  ? 141  PRO E CG    1 
ATOM   6800 C  CD    . PRO E  1 142 ? 138.071 14.268  -2.997  1.00 57.64  ? 141  PRO E CD    1 
ATOM   6801 N  N     . VAL E  1 143 ? 136.055 18.240  -1.132  1.00 57.75  ? 142  VAL E N     1 
ATOM   6802 C  CA    . VAL E  1 143 ? 135.146 18.818  -0.131  1.00 59.76  ? 142  VAL E CA    1 
ATOM   6803 C  C     . VAL E  1 143 ? 133.827 18.094  0.005   1.00 57.29  ? 142  VAL E C     1 
ATOM   6804 O  O     . VAL E  1 143 ? 133.410 17.814  1.120   1.00 61.86  ? 142  VAL E O     1 
ATOM   6805 C  CB    . VAL E  1 143 ? 134.755 20.286  -0.413  1.00 60.06  ? 142  VAL E CB    1 
ATOM   6806 C  CG1   . VAL E  1 143 ? 135.648 21.199  0.334   1.00 70.07  ? 142  VAL E CG1   1 
ATOM   6807 C  CG2   . VAL E  1 143 ? 134.745 20.599  -1.898  1.00 55.46  ? 142  VAL E CG2   1 
ATOM   6808 N  N     . ASP E  1 144 ? 133.157 17.839  -1.117  1.00 59.70  ? 143  ASP E N     1 
ATOM   6809 C  CA    . ASP E  1 144 ? 131.813 17.236  -1.091  1.00 64.80  ? 143  ASP E CA    1 
ATOM   6810 C  C     . ASP E  1 144 ? 131.823 15.950  -0.278  1.00 61.49  ? 143  ASP E C     1 
ATOM   6811 O  O     . ASP E  1 144 ? 130.905 15.694  0.508   1.00 60.15  ? 143  ASP E O     1 
ATOM   6812 C  CB    . ASP E  1 144 ? 131.289 16.947  -2.504  1.00 66.87  ? 143  ASP E CB    1 
ATOM   6813 C  CG    . ASP E  1 144 ? 130.765 18.194  -3.207  1.00 80.20  ? 143  ASP E CG    1 
ATOM   6814 O  OD1   . ASP E  1 144 ? 130.710 19.272  -2.573  1.00 84.04  ? 143  ASP E OD1   1 
ATOM   6815 O  OD2   . ASP E  1 144 ? 130.401 18.093  -4.399  1.00 88.46  ? 143  ASP E OD2   1 
ATOM   6816 N  N     . ASP E  1 145 ? 132.890 15.171  -0.463  1.00 60.50  ? 144  ASP E N     1 
ATOM   6817 C  CA    . ASP E  1 145 ? 133.112 13.954  0.305   1.00 60.11  ? 144  ASP E CA    1 
ATOM   6818 C  C     . ASP E  1 145 ? 133.327 14.258  1.798   1.00 58.60  ? 144  ASP E C     1 
ATOM   6819 O  O     . ASP E  1 145 ? 132.780 13.571  2.672   1.00 56.46  ? 144  ASP E O     1 
ATOM   6820 C  CB    . ASP E  1 145 ? 134.302 13.171  -0.275  1.00 60.52  ? 144  ASP E CB    1 
ATOM   6821 C  CG    . ASP E  1 145 ? 134.027 12.628  -1.687  1.00 73.40  ? 144  ASP E CG    1 
ATOM   6822 O  OD1   . ASP E  1 145 ? 132.879 12.195  -1.943  1.00 70.44  ? 144  ASP E OD1   1 
ATOM   6823 O  OD2   . ASP E  1 145 ? 134.956 12.622  -2.536  1.00 67.26  ? 144  ASP E OD2   1 
ATOM   6824 N  N     . THR E  1 146 ? 134.105 15.301  2.084   1.00 59.08  ? 145  THR E N     1 
ATOM   6825 C  CA    . THR E  1 146 ? 134.374 15.711  3.462   1.00 57.22  ? 145  THR E CA    1 
ATOM   6826 C  C     . THR E  1 146 ? 133.124 16.256  4.157   1.00 56.31  ? 145  THR E C     1 
ATOM   6827 O  O     . THR E  1 146 ? 132.858 15.917  5.308   1.00 55.36  ? 145  THR E O     1 
ATOM   6828 C  CB    . THR E  1 146 ? 135.474 16.774  3.529   1.00 58.78  ? 145  THR E CB    1 
ATOM   6829 O  OG1   . THR E  1 146 ? 136.597 16.354  2.738   1.00 66.88  ? 145  THR E OG1   1 
ATOM   6830 C  CG2   . THR E  1 146 ? 135.909 16.998  4.974   1.00 57.03  ? 145  THR E CG2   1 
ATOM   6831 N  N     . THR E  1 147 ? 132.363 17.095  3.461   1.00 55.96  ? 146  THR E N     1 
ATOM   6832 C  CA    . THR E  1 147 ? 131.190 17.727  4.061   1.00 58.24  ? 146  THR E CA    1 
ATOM   6833 C  C     . THR E  1 147 ? 130.068 16.713  4.232   1.00 58.94  ? 146  THR E C     1 
ATOM   6834 O  O     . THR E  1 147 ? 129.356 16.754  5.219   1.00 58.58  ? 146  THR E O     1 
ATOM   6835 C  CB    . THR E  1 147 ? 130.670 18.940  3.227   1.00 60.16  ? 146  THR E CB    1 
ATOM   6836 O  OG1   . THR E  1 147 ? 130.287 18.512  1.909   1.00 60.42  ? 146  THR E OG1   1 
ATOM   6837 C  CG2   . THR E  1 147 ? 131.739 20.035  3.139   1.00 63.20  ? 146  THR E CG2   1 
ATOM   6838 N  N     . LYS E  1 148 ? 129.920 15.813  3.262   1.00 60.08  ? 147  LYS E N     1 
ATOM   6839 C  CA    . LYS E  1 148 ? 128.893 14.785  3.328   1.00 60.47  ? 147  LYS E CA    1 
ATOM   6840 C  C     . LYS E  1 148 ? 129.044 13.976  4.616   1.00 58.99  ? 147  LYS E C     1 
ATOM   6841 O  O     . LYS E  1 148 ? 128.066 13.682  5.298   1.00 57.59  ? 147  LYS E O     1 
ATOM   6842 C  CB    . LYS E  1 148 ? 128.944 13.858  2.098   1.00 59.53  ? 147  LYS E CB    1 
ATOM   6843 C  CG    . LYS E  1 148 ? 128.209 14.394  0.864   1.00 58.59  ? 147  LYS E CG    1 
ATOM   6844 N  N     . THR E  1 149 ? 130.291 13.642  4.931   1.00 59.13  ? 148  THR E N     1 
ATOM   6845 C  CA    . THR E  1 149 ? 130.643 12.816  6.092   1.00 58.01  ? 148  THR E CA    1 
ATOM   6846 C  C     . THR E  1 149 ? 130.404 13.532  7.410   1.00 54.77  ? 148  THR E C     1 
ATOM   6847 O  O     . THR E  1 149 ? 129.933 12.929  8.365   1.00 56.33  ? 148  THR E O     1 
ATOM   6848 C  CB    . THR E  1 149 ? 132.141 12.401  6.016   1.00 56.75  ? 148  THR E CB    1 
ATOM   6849 O  OG1   . THR E  1 149 ? 132.376 11.748  4.771   1.00 60.86  ? 148  THR E OG1   1 
ATOM   6850 C  CG2   . THR E  1 149 ? 132.527 11.472  7.140   1.00 56.32  ? 148  THR E CG2   1 
ATOM   6851 N  N     . ILE E  1 150 ? 130.762 14.807  7.465   1.00 56.61  ? 149  ILE E N     1 
ATOM   6852 C  CA    . ILE E  1 150 ? 130.531 15.608  8.656   1.00 57.03  ? 149  ILE E CA    1 
ATOM   6853 C  C     . ILE E  1 150 ? 129.032 15.672  8.912   1.00 57.67  ? 149  ILE E C     1 
ATOM   6854 O  O     . ILE E  1 150 ? 128.579 15.531  10.053  1.00 56.89  ? 149  ILE E O     1 
ATOM   6855 C  CB    . ILE E  1 150 ? 131.131 17.024  8.500   1.00 60.23  ? 149  ILE E CB    1 
ATOM   6856 C  CG1   . ILE E  1 150 ? 132.666 16.946  8.543   1.00 59.29  ? 149  ILE E CG1   1 
ATOM   6857 C  CG2   . ILE E  1 150 ? 130.623 17.965  9.598   1.00 64.65  ? 149  ILE E CG2   1 
ATOM   6858 C  CD1   . ILE E  1 150 ? 133.366 18.215  8.086   1.00 60.02  ? 149  ILE E CD1   1 
ATOM   6859 N  N     . ALA E  1 151 ? 128.261 15.858  7.842   1.00 53.94  ? 150  ALA E N     1 
ATOM   6860 C  CA    . ALA E  1 151 ? 126.814 15.955  7.965   1.00 55.60  ? 150  ALA E CA    1 
ATOM   6861 C  C     . ALA E  1 151 ? 126.255 14.661  8.580   1.00 56.28  ? 150  ALA E C     1 
ATOM   6862 O  O     . ALA E  1 151 ? 125.432 14.703  9.481   1.00 59.64  ? 150  ALA E O     1 
ATOM   6863 C  CB    . ALA E  1 151 ? 126.190 16.269  6.607   1.00 47.89  ? 150  ALA E CB    1 
ATOM   6864 N  N     . LYS E  1 152 ? 126.764 13.517  8.142   1.00 55.91  ? 151  LYS E N     1 
ATOM   6865 C  CA    . LYS E  1 152 ? 126.373 12.224  8.703   1.00 57.82  ? 151  LYS E CA    1 
ATOM   6866 C  C     . LYS E  1 152 ? 126.715 12.077  10.188  1.00 54.70  ? 151  LYS E C     1 
ATOM   6867 O  O     . LYS E  1 152 ? 125.974 11.445  10.937  1.00 57.13  ? 151  LYS E O     1 
ATOM   6868 C  CB    . LYS E  1 152 ? 127.006 11.082  7.897   1.00 57.48  ? 151  LYS E CB    1 
ATOM   6869 C  CG    . LYS E  1 152 ? 126.251 10.741  6.612   1.00 65.31  ? 151  LYS E CG    1 
ATOM   6870 C  CD    . LYS E  1 152 ? 127.028 9.723   5.767   1.00 72.76  ? 151  LYS E CD    1 
ATOM   6871 C  CE    . LYS E  1 152 ? 126.164 9.072   4.676   1.00 78.31  ? 151  LYS E CE    1 
ATOM   6872 N  N     . ARG E  1 153 ? 127.822 12.679  10.612  1.00 55.71  ? 152  ARG E N     1 
ATOM   6873 C  CA    . ARG E  1 153 ? 128.195 12.723  12.036  1.00 58.30  ? 152  ARG E CA    1 
ATOM   6874 C  C     . ARG E  1 153 ? 127.215 13.571  12.855  1.00 55.87  ? 152  ARG E C     1 
ATOM   6875 O  O     . ARG E  1 153 ? 126.823 13.179  13.961  1.00 59.00  ? 152  ARG E O     1 
ATOM   6876 C  CB    . ARG E  1 153 ? 129.629 13.265  12.223  1.00 59.93  ? 152  ARG E CB    1 
ATOM   6877 C  CG    . ARG E  1 153 ? 130.748 12.377  11.662  1.00 58.05  ? 152  ARG E CG    1 
ATOM   6878 C  CD    . ARG E  1 153 ? 132.133 12.915  12.026  1.00 63.18  ? 152  ARG E CD    1 
ATOM   6879 N  NE    . ARG E  1 153 ? 132.435 12.688  13.445  1.00 77.47  ? 152  ARG E NE    1 
ATOM   6880 C  CZ    . ARG E  1 153 ? 133.377 13.330  14.147  1.00 72.81  ? 152  ARG E CZ    1 
ATOM   6881 N  NH1   . ARG E  1 153 ? 134.166 14.242  13.586  1.00 53.75  ? 152  ARG E NH1   1 
ATOM   6882 N  NH2   . ARG E  1 153 ? 133.547 13.040  15.429  1.00 63.40  ? 152  ARG E NH2   1 
ATOM   6883 N  N     . LEU E  1 154 ? 126.808 14.718  12.308  1.00 56.75  ? 153  LEU E N     1 
ATOM   6884 C  CA    . LEU E  1 154 ? 125.833 15.574  12.988  1.00 57.09  ? 153  LEU E CA    1 
ATOM   6885 C  C     . LEU E  1 154 ? 124.489 14.878  13.074  1.00 56.81  ? 153  LEU E C     1 
ATOM   6886 O  O     . LEU E  1 154 ? 123.863 14.882  14.131  1.00 56.92  ? 153  LEU E O     1 
ATOM   6887 C  CB    . LEU E  1 154 ? 125.664 16.915  12.284  1.00 63.63  ? 153  LEU E CB    1 
ATOM   6888 C  CG    . LEU E  1 154 ? 126.841 17.909  12.253  1.00 62.19  ? 153  LEU E CG    1 
ATOM   6889 C  CD1   . LEU E  1 154 ? 126.279 19.289  11.981  1.00 72.37  ? 153  LEU E CD1   1 
ATOM   6890 C  CD2   . LEU E  1 154 ? 127.633 17.911  13.514  1.00 73.29  ? 153  LEU E CD2   1 
ATOM   6891 N  N     . GLU E  1 155 ? 124.079 14.247  11.972  1.00 54.24  ? 154  GLU E N     1 
ATOM   6892 C  CA    . GLU E  1 155 ? 122.821 13.513  11.911  1.00 54.40  ? 154  GLU E CA    1 
ATOM   6893 C  C     . GLU E  1 155 ? 122.737 12.412  12.939  1.00 55.40  ? 154  GLU E C     1 
ATOM   6894 O  O     . GLU E  1 155 ? 121.729 12.282  13.605  1.00 55.19  ? 154  GLU E O     1 
ATOM   6895 C  CB    . GLU E  1 155 ? 122.615 12.912  10.531  1.00 51.91  ? 154  GLU E CB    1 
ATOM   6896 C  CG    . GLU E  1 155 ? 122.429 13.952  9.456   1.00 54.18  ? 154  GLU E CG    1 
ATOM   6897 C  CD    . GLU E  1 155 ? 122.470 13.384  8.048   1.00 69.29  ? 154  GLU E CD    1 
ATOM   6898 O  OE1   . GLU E  1 155 ? 122.660 12.156  7.864   1.00 78.62  ? 154  GLU E OE1   1 
ATOM   6899 O  OE2   . GLU E  1 155 ? 122.303 14.193  7.118   1.00 71.60  ? 154  GLU E OE2   1 
ATOM   6900 N  N     . ALA E  1 156 ? 123.796 11.611  13.056  1.00 56.47  ? 155  ALA E N     1 
ATOM   6901 C  CA    . ALA E  1 156 ? 123.840 10.580  14.065  1.00 53.89  ? 155  ALA E CA    1 
ATOM   6902 C  C     . ALA E  1 156 ? 123.735 11.201  15.447  1.00 53.19  ? 155  ALA E C     1 
ATOM   6903 O  O     . ALA E  1 156 ? 123.031 10.678  16.290  1.00 58.37  ? 155  ALA E O     1 
ATOM   6904 C  CB    . ALA E  1 156 ? 125.103 9.722   13.935  1.00 55.54  ? 155  ALA E CB    1 
ATOM   6905 N  N     . TYR E  1 157 ? 124.375 12.345  15.668  1.00 55.87  ? 156  TYR E N     1 
ATOM   6906 C  CA    . TYR E  1 157 ? 124.282 13.014  16.962  1.00 53.15  ? 156  TYR E CA    1 
ATOM   6907 C  C     . TYR E  1 157 ? 122.855 13.450  17.284  1.00 58.60  ? 156  TYR E C     1 
ATOM   6908 O  O     . TYR E  1 157 ? 122.385 13.267  18.409  1.00 61.20  ? 156  TYR E O     1 
ATOM   6909 C  CB    . TYR E  1 157 ? 125.225 14.225  17.072  1.00 55.13  ? 156  TYR E CB    1 
ATOM   6910 C  CG    . TYR E  1 157 ? 124.936 15.044  18.315  1.00 54.96  ? 156  TYR E CG    1 
ATOM   6911 C  CD1   . TYR E  1 157 ? 125.205 14.534  19.582  1.00 54.41  ? 156  TYR E CD1   1 
ATOM   6912 C  CD2   . TYR E  1 157 ? 124.345 16.298  18.227  1.00 62.24  ? 156  TYR E CD2   1 
ATOM   6913 C  CE1   . TYR E  1 157 ? 124.914 15.262  20.725  1.00 58.54  ? 156  TYR E CE1   1 
ATOM   6914 C  CE2   . TYR E  1 157 ? 124.057 17.031  19.362  1.00 61.40  ? 156  TYR E CE2   1 
ATOM   6915 C  CZ    . TYR E  1 157 ? 124.341 16.507  20.605  1.00 49.72  ? 156  TYR E CZ    1 
ATOM   6916 O  OH    . TYR E  1 157 ? 124.038 17.230  21.726  1.00 69.76  ? 156  TYR E OH    1 
ATOM   6917 N  N     . TYR E  1 158 ? 122.166 14.035  16.308  1.00 57.23  ? 157  TYR E N     1 
ATOM   6918 C  CA    . TYR E  1 158 ? 120.817 14.500  16.544  1.00 56.27  ? 157  TYR E CA    1 
ATOM   6919 C  C     . TYR E  1 158 ? 119.887 13.324  16.810  1.00 56.45  ? 157  TYR E C     1 
ATOM   6920 O  O     . TYR E  1 158 ? 119.027 13.409  17.649  1.00 53.48  ? 157  TYR E O     1 
ATOM   6921 C  CB    . TYR E  1 158 ? 120.323 15.341  15.371  1.00 58.55  ? 157  TYR E CB    1 
ATOM   6922 C  CG    . TYR E  1 158 ? 121.120 16.619  15.192  1.00 58.68  ? 157  TYR E CG    1 
ATOM   6923 C  CD1   . TYR E  1 158 ? 121.362 17.467  16.276  1.00 53.60  ? 157  TYR E CD1   1 
ATOM   6924 C  CD2   . TYR E  1 158 ? 121.599 16.997  13.938  1.00 63.04  ? 157  TYR E CD2   1 
ATOM   6925 C  CE1   . TYR E  1 158 ? 122.081 18.645  16.122  1.00 66.13  ? 157  TYR E CE1   1 
ATOM   6926 C  CE2   . TYR E  1 158 ? 122.307 18.187  13.766  1.00 58.17  ? 157  TYR E CE2   1 
ATOM   6927 C  CZ    . TYR E  1 158 ? 122.555 18.998  14.865  1.00 61.11  ? 157  TYR E CZ    1 
ATOM   6928 O  OH    . TYR E  1 158 ? 123.261 20.167  14.711  1.00 68.30  ? 157  TYR E OH    1 
ATOM   6929 N  N     . ARG E  1 159 ? 120.075 12.219  16.105  1.00 57.53  ? 158  ARG E N     1 
ATOM   6930 C  CA    . ARG E  1 159 ? 119.306 11.019  16.385  1.00 59.81  ? 158  ARG E CA    1 
ATOM   6931 C  C     . ARG E  1 159 ? 119.472 10.496  17.817  1.00 58.59  ? 158  ARG E C     1 
ATOM   6932 O  O     . ARG E  1 159 ? 118.494 10.112  18.444  1.00 62.57  ? 158  ARG E O     1 
ATOM   6933 C  CB    . ARG E  1 159 ? 119.623 9.930   15.368  1.00 56.45  ? 158  ARG E CB    1 
ATOM   6934 C  CG    . ARG E  1 159 ? 118.815 10.087  14.102  1.00 57.68  ? 158  ARG E CG    1 
ATOM   6935 C  CD    . ARG E  1 159 ? 118.977 8.912   13.148  1.00 58.01  ? 158  ARG E CD    1 
ATOM   6936 N  NE    . ARG E  1 159 ? 120.050 9.170   12.182  1.00 80.50  ? 158  ARG E NE    1 
ATOM   6937 C  CZ    . ARG E  1 159 ? 121.277 8.653   12.237  1.00 72.38  ? 158  ARG E CZ    1 
ATOM   6938 N  NH1   . ARG E  1 159 ? 121.649 7.805   13.198  1.00 94.12  ? 158  ARG E NH1   1 
ATOM   6939 N  NH2   . ARG E  1 159 ? 122.141 8.981   11.309  1.00 71.10  ? 158  ARG E NH2   1 
ATOM   6940 N  N     . ALA E  1 160 ? 120.697 10.494  18.324  1.00 60.93  ? 159  ALA E N     1 
ATOM   6941 C  CA    . ALA E  1 160 ? 120.993 10.028  19.689  1.00 61.28  ? 159  ALA E CA    1 
ATOM   6942 C  C     . ALA E  1 160 ? 120.529 10.980  20.773  1.00 62.26  ? 159  ALA E C     1 
ATOM   6943 O  O     . ALA E  1 160 ? 120.086 10.555  21.832  1.00 68.52  ? 159  ALA E O     1 
ATOM   6944 C  CB    . ALA E  1 160 ? 122.500 9.831   19.852  1.00 62.48  ? 159  ALA E CB    1 
ATOM   6945 N  N     . SER E  1 161 ? 120.682 12.277  20.523  1.00 59.89  ? 160  SER E N     1 
ATOM   6946 C  CA    . SER E  1 161 ? 120.623 13.257  21.569  1.00 55.98  ? 160  SER E CA    1 
ATOM   6947 C  C     . SER E  1 161 ? 119.206 13.772  21.802  1.00 57.46  ? 160  SER E C     1 
ATOM   6948 O  O     . SER E  1 161 ? 118.825 14.065  22.940  1.00 58.69  ? 160  SER E O     1 
ATOM   6949 C  CB    . SER E  1 161 ? 121.596 14.423  21.255  1.00 58.64  ? 160  SER E CB    1 
ATOM   6950 O  OG    . SER E  1 161 ? 121.199 15.177  20.110  1.00 58.06  ? 160  SER E OG    1 
ATOM   6951 N  N     . ILE E  1 162 ? 118.441 13.944  20.730  1.00 54.10  ? 161  ILE E N     1 
ATOM   6952 C  CA    . ILE E  1 162 ? 117.173 14.652  20.847  1.00 57.01  ? 161  ILE E CA    1 
ATOM   6953 C  C     . ILE E  1 162 ? 116.183 13.954  21.809  1.00 54.33  ? 161  ILE E C     1 
ATOM   6954 O  O     . ILE E  1 162 ? 115.660 14.607  22.704  1.00 52.52  ? 161  ILE E O     1 
ATOM   6955 C  CB    . ILE E  1 162 ? 116.544 14.976  19.463  1.00 53.67  ? 161  ILE E CB    1 
ATOM   6956 C  CG1   . ILE E  1 162 ? 117.308 16.143  18.799  1.00 49.53  ? 161  ILE E CG1   1 
ATOM   6957 C  CG2   . ILE E  1 162 ? 115.067 15.335  19.600  1.00 53.04  ? 161  ILE E CG2   1 
ATOM   6958 C  CD1   . ILE E  1 162 ? 116.761 16.521  17.420  1.00 53.55  ? 161  ILE E CD1   1 
ATOM   6959 N  N     . PRO E  1 163 ? 115.923 12.643  21.615  1.00 52.33  ? 162  PRO E N     1 
ATOM   6960 C  CA    . PRO E  1 163 ? 115.027 11.909  22.519  1.00 55.45  ? 162  PRO E CA    1 
ATOM   6961 C  C     . PRO E  1 163 ? 115.490 11.857  23.973  1.00 54.02  ? 162  PRO E C     1 
ATOM   6962 O  O     . PRO E  1 163 ? 114.675 11.938  24.901  1.00 54.29  ? 162  PRO E O     1 
ATOM   6963 C  CB    . PRO E  1 163 ? 115.006 10.485  21.927  1.00 57.57  ? 162  PRO E CB    1 
ATOM   6964 C  CG    . PRO E  1 163 ? 115.495 10.648  20.518  1.00 52.34  ? 162  PRO E CG    1 
ATOM   6965 C  CD    . PRO E  1 163 ? 116.442 11.780  20.544  1.00 55.06  ? 162  PRO E CD    1 
ATOM   6966 N  N     . VAL E  1 164 ? 116.795 11.711  24.151  1.00 55.05  ? 163  VAL E N     1 
ATOM   6967 C  CA    . VAL E  1 164 ? 117.395 11.563  25.452  1.00 55.88  ? 163  VAL E CA    1 
ATOM   6968 C  C     . VAL E  1 164 ? 117.327 12.875  26.246  1.00 52.74  ? 163  VAL E C     1 
ATOM   6969 O  O     . VAL E  1 164 ? 117.001 12.893  27.428  1.00 52.42  ? 163  VAL E O     1 
ATOM   6970 C  CB    . VAL E  1 164 ? 118.857 11.081  25.297  1.00 59.66  ? 163  VAL E CB    1 
ATOM   6971 C  CG1   . VAL E  1 164 ? 119.624 11.181  26.618  1.00 64.96  ? 163  VAL E CG1   1 
ATOM   6972 C  CG2   . VAL E  1 164 ? 118.866 9.653   24.737  1.00 52.95  ? 163  VAL E CG2   1 
ATOM   6973 N  N     . ILE E  1 165 ? 117.661 13.965  25.587  1.00 55.01  ? 164  ILE E N     1 
ATOM   6974 C  CA    . ILE E  1 165 ? 117.519 15.288  26.180  1.00 56.76  ? 164  ILE E CA    1 
ATOM   6975 C  C     . ILE E  1 165 ? 116.072 15.557  26.590  1.00 53.60  ? 164  ILE E C     1 
ATOM   6976 O  O     . ILE E  1 165 ? 115.827 15.998  27.718  1.00 53.10  ? 164  ILE E O     1 
ATOM   6977 C  CB    . ILE E  1 165 ? 118.084 16.371  25.228  1.00 60.65  ? 164  ILE E CB    1 
ATOM   6978 C  CG1   . ILE E  1 165 ? 119.619 16.279  25.231  1.00 58.28  ? 164  ILE E CG1   1 
ATOM   6979 C  CG2   . ILE E  1 165 ? 117.677 17.768  25.666  1.00 51.81  ? 164  ILE E CG2   1 
ATOM   6980 C  CD1   . ILE E  1 165 ? 120.304 17.156  24.191  1.00 62.14  ? 164  ILE E CD1   1 
ATOM   6981 N  N     . ALA E  1 166 ? 115.125 15.256  25.691  1.00 54.07  ? 165  ALA E N     1 
ATOM   6982 C  CA    . ALA E  1 166 ? 113.701 15.406  25.981  1.00 52.87  ? 165  ALA E CA    1 
ATOM   6983 C  C     . ALA E  1 166 ? 113.276 14.573  27.186  1.00 51.48  ? 165  ALA E C     1 
ATOM   6984 O  O     . ALA E  1 166 ? 112.469 15.024  28.000  1.00 50.97  ? 165  ALA E O     1 
ATOM   6985 C  CB    . ALA E  1 166 ? 112.837 15.081  24.737  1.00 50.86  ? 165  ALA E CB    1 
ATOM   6986 N  N     . TYR E  1 167 ? 113.839 13.373  27.298  1.00 54.96  ? 166  TYR E N     1 
ATOM   6987 C  CA    . TYR E  1 167 ? 113.527 12.451  28.385  1.00 54.51  ? 166  TYR E CA    1 
ATOM   6988 C  C     . TYR E  1 167 ? 113.941 13.027  29.731  1.00 52.86  ? 166  TYR E C     1 
ATOM   6989 O  O     . TYR E  1 167 ? 113.158 13.048  30.694  1.00 51.20  ? 166  TYR E O     1 
ATOM   6990 C  CB    . TYR E  1 167 ? 114.223 11.099  28.158  1.00 54.49  ? 166  TYR E CB    1 
ATOM   6991 C  CG    . TYR E  1 167 ? 113.999 10.107  29.280  1.00 51.19  ? 166  TYR E CG    1 
ATOM   6992 C  CD1   . TYR E  1 167 ? 112.751 9.548   29.483  1.00 50.40  ? 166  TYR E CD1   1 
ATOM   6993 C  CD2   . TYR E  1 167 ? 115.035 9.734   30.138  1.00 44.83  ? 166  TYR E CD2   1 
ATOM   6994 C  CE1   . TYR E  1 167 ? 112.523 8.657   30.510  1.00 52.25  ? 166  TYR E CE1   1 
ATOM   6995 C  CE2   . TYR E  1 167 ? 114.823 8.839   31.180  1.00 49.45  ? 166  TYR E CE2   1 
ATOM   6996 C  CZ    . TYR E  1 167 ? 113.559 8.298   31.359  1.00 59.31  ? 166  TYR E CZ    1 
ATOM   6997 O  OH    . TYR E  1 167 ? 113.301 7.403   32.375  1.00 60.20  ? 166  TYR E OH    1 
ATOM   6998 N  N     . TYR E  1 168 ? 115.172 13.500  29.798  1.00 51.61  ? 167  TYR E N     1 
ATOM   6999 C  CA    . TYR E  1 168 ? 115.703 13.957  31.065  1.00 55.31  ? 167  TYR E CA    1 
ATOM   7000 C  C     . TYR E  1 168 ? 115.201 15.318  31.504  1.00 58.17  ? 167  TYR E C     1 
ATOM   7001 O  O     . TYR E  1 168 ? 115.266 15.636  32.697  1.00 54.14  ? 167  TYR E O     1 
ATOM   7002 C  CB    . TYR E  1 168 ? 117.219 13.896  31.058  1.00 54.44  ? 167  TYR E CB    1 
ATOM   7003 C  CG    . TYR E  1 168 ? 117.715 12.471  31.206  1.00 53.47  ? 167  TYR E CG    1 
ATOM   7004 C  CD1   . TYR E  1 168 ? 118.420 11.851  30.182  1.00 57.92  ? 167  TYR E CD1   1 
ATOM   7005 C  CD2   . TYR E  1 168 ? 117.452 11.735  32.360  1.00 52.40  ? 167  TYR E CD2   1 
ATOM   7006 C  CE1   . TYR E  1 168 ? 118.852 10.550  30.292  1.00 59.48  ? 167  TYR E CE1   1 
ATOM   7007 C  CE2   . TYR E  1 168 ? 117.901 10.418  32.486  1.00 55.09  ? 167  TYR E CE2   1 
ATOM   7008 C  CZ    . TYR E  1 168 ? 118.595 9.836   31.435  1.00 59.19  ? 167  TYR E CZ    1 
ATOM   7009 O  OH    . TYR E  1 168 ? 119.045 8.546   31.507  1.00 57.77  ? 167  TYR E OH    1 
ATOM   7010 N  N     . GLU E  1 169 ? 114.710 16.119  30.558  1.00 57.45  ? 168  GLU E N     1 
ATOM   7011 C  CA    . GLU E  1 169 ? 114.111 17.409  30.896  1.00 61.18  ? 168  GLU E CA    1 
ATOM   7012 C  C     . GLU E  1 169 ? 112.983 17.213  31.872  1.00 58.79  ? 168  GLU E C     1 
ATOM   7013 O  O     . GLU E  1 169 ? 112.768 18.031  32.741  1.00 59.73  ? 168  GLU E O     1 
ATOM   7014 C  CB    . GLU E  1 169 ? 113.545 18.103  29.659  1.00 59.78  ? 168  GLU E CB    1 
ATOM   7015 C  CG    . GLU E  1 169 ? 114.508 19.013  28.970  1.00 77.61  ? 168  GLU E CG    1 
ATOM   7016 C  CD    . GLU E  1 169 ? 114.036 19.411  27.586  1.00 86.31  ? 168  GLU E CD    1 
ATOM   7017 O  OE1   . GLU E  1 169 ? 114.902 19.640  26.724  1.00 77.84  ? 168  GLU E OE1   1 
ATOM   7018 O  OE2   . GLU E  1 169 ? 112.806 19.477  27.360  1.00 103.28 ? 168  GLU E OE2   1 
ATOM   7019 N  N     . THR E  1 170 ? 112.252 16.129  31.690  1.00 62.08  ? 169  THR E N     1 
ATOM   7020 C  CA    . THR E  1 170 ? 111.106 15.790  32.523  1.00 65.58  ? 169  THR E CA    1 
ATOM   7021 C  C     . THR E  1 170 ? 111.529 15.190  33.877  1.00 64.43  ? 169  THR E C     1 
ATOM   7022 O  O     . THR E  1 170 ? 110.874 15.407  34.886  1.00 65.26  ? 169  THR E O     1 
ATOM   7023 C  CB    . THR E  1 170 ? 110.197 14.767  31.774  1.00 69.08  ? 169  THR E CB    1 
ATOM   7024 O  OG1   . THR E  1 170 ? 110.922 13.551  31.513  1.00 78.44  ? 169  THR E OG1   1 
ATOM   7025 C  CG2   . THR E  1 170 ? 109.740 15.324  30.451  1.00 66.46  ? 169  THR E CG2   1 
ATOM   7026 N  N     . LYS E  1 171 ? 112.630 14.440  33.885  1.00 65.15  ? 170  LYS E N     1 
ATOM   7027 C  CA    . LYS E  1 171 ? 113.012 13.597  35.019  1.00 64.06  ? 170  LYS E CA    1 
ATOM   7028 C  C     . LYS E  1 171 ? 113.958 14.277  36.025  1.00 65.65  ? 170  LYS E C     1 
ATOM   7029 O  O     . LYS E  1 171 ? 113.825 14.069  37.230  1.00 68.29  ? 170  LYS E O     1 
ATOM   7030 C  CB    . LYS E  1 171 ? 113.677 12.294  34.535  1.00 61.04  ? 170  LYS E CB    1 
ATOM   7031 C  CG    . LYS E  1 171 ? 112.940 11.485  33.461  1.00 71.35  ? 170  LYS E CG    1 
ATOM   7032 C  CD    . LYS E  1 171 ? 111.591 10.928  33.896  1.00 71.46  ? 170  LYS E CD    1 
ATOM   7033 N  N     . THR E  1 172 ? 114.918 15.068  35.551  1.00 67.25  ? 171  THR E N     1 
ATOM   7034 C  CA    . THR E  1 172 ? 115.993 15.564  36.434  1.00 63.98  ? 171  THR E CA    1 
ATOM   7035 C  C     . THR E  1 172 ? 116.433 16.985  36.090  1.00 62.04  ? 171  THR E C     1 
ATOM   7036 O  O     . THR E  1 172 ? 115.806 17.654  35.276  1.00 62.63  ? 171  THR E O     1 
ATOM   7037 C  CB    . THR E  1 172 ? 117.232 14.597  36.408  1.00 67.86  ? 171  THR E CB    1 
ATOM   7038 O  OG1   . THR E  1 172 ? 118.078 14.834  37.544  1.00 52.57  ? 171  THR E OG1   1 
ATOM   7039 C  CG2   . THR E  1 172 ? 118.049 14.750  35.124  1.00 60.21  ? 171  THR E CG2   1 
ATOM   7040 N  N     . GLN E  1 173 ? 117.510 17.441  36.723  1.00 59.12  ? 172  GLN E N     1 
ATOM   7041 C  CA    . GLN E  1 173 ? 118.081 18.758  36.429  1.00 59.33  ? 172  GLN E CA    1 
ATOM   7042 C  C     . GLN E  1 173 ? 118.856 18.715  35.118  1.00 57.56  ? 172  GLN E C     1 
ATOM   7043 O  O     . GLN E  1 173 ? 119.862 18.014  35.013  1.00 56.17  ? 172  GLN E O     1 
ATOM   7044 C  CB    . GLN E  1 173 ? 118.991 19.223  37.574  1.00 56.99  ? 172  GLN E CB    1 
ATOM   7045 C  CG    . GLN E  1 173 ? 118.291 20.035  38.653  1.00 69.87  ? 172  GLN E CG    1 
ATOM   7046 C  CD    . GLN E  1 173 ? 118.548 21.527  38.516  1.00 82.34  ? 172  GLN E CD    1 
ATOM   7047 O  OE1   . GLN E  1 173 ? 118.570 22.071  37.409  1.00 72.45  ? 172  GLN E OE1   1 
ATOM   7048 N  NE2   . GLN E  1 173 ? 118.754 22.194  39.646  1.00 88.79  ? 172  GLN E NE2   1 
ATOM   7049 N  N     . LEU E  1 174 ? 118.377 19.447  34.111  1.00 57.31  ? 173  LEU E N     1 
ATOM   7050 C  CA    . LEU E  1 174 ? 119.014 19.441  32.796  1.00 56.55  ? 173  LEU E CA    1 
ATOM   7051 C  C     . LEU E  1 174 ? 119.427 20.853  32.446  1.00 54.17  ? 173  LEU E C     1 
ATOM   7052 O  O     . LEU E  1 174 ? 118.607 21.740  32.435  1.00 58.08  ? 173  LEU E O     1 
ATOM   7053 C  CB    . LEU E  1 174 ? 118.076 18.874  31.717  1.00 56.73  ? 173  LEU E CB    1 
ATOM   7054 C  CG    . LEU E  1 174 ? 118.775 18.613  30.364  1.00 56.19  ? 173  LEU E CG    1 
ATOM   7055 C  CD1   . LEU E  1 174 ? 118.368 17.283  29.779  1.00 61.57  ? 173  LEU E CD1   1 
ATOM   7056 C  CD2   . LEU E  1 174 ? 118.568 19.725  29.347  1.00 49.80  ? 173  LEU E CD2   1 
ATOM   7057 N  N     . HIS E  1 175 ? 120.697 21.055  32.140  1.00 57.58  ? 174  HIS E N     1 
ATOM   7058 C  CA    . HIS E  1 175 ? 121.227 22.393  31.877  1.00 57.98  ? 174  HIS E CA    1 
ATOM   7059 C  C     . HIS E  1 175 ? 121.857 22.444  30.495  1.00 57.40  ? 174  HIS E C     1 
ATOM   7060 O  O     . HIS E  1 175 ? 122.819 21.720  30.216  1.00 57.77  ? 174  HIS E O     1 
ATOM   7061 C  CB    . HIS E  1 175 ? 122.288 22.749  32.936  1.00 63.52  ? 174  HIS E CB    1 
ATOM   7062 C  CG    . HIS E  1 175 ? 121.724 23.116  34.274  1.00 62.26  ? 174  HIS E CG    1 
ATOM   7063 N  ND1   . HIS E  1 175 ? 121.823 24.387  34.798  1.00 80.44  ? 174  HIS E ND1   1 
ATOM   7064 C  CD2   . HIS E  1 175 ? 121.069 22.377  35.200  1.00 69.02  ? 174  HIS E CD2   1 
ATOM   7065 C  CE1   . HIS E  1 175 ? 121.242 24.418  35.984  1.00 77.04  ? 174  HIS E CE1   1 
ATOM   7066 N  NE2   . HIS E  1 175 ? 120.774 23.211  36.250  1.00 67.09  ? 174  HIS E NE2   1 
ATOM   7067 N  N     . LYS E  1 176 ? 121.313 23.280  29.622  1.00 59.66  ? 175  LYS E N     1 
ATOM   7068 C  CA    . LYS E  1 176 ? 121.911 23.483  28.303  1.00 63.56  ? 175  LYS E CA    1 
ATOM   7069 C  C     . LYS E  1 176 ? 122.998 24.546  28.453  1.00 62.23  ? 175  LYS E C     1 
ATOM   7070 O  O     . LYS E  1 176 ? 122.736 25.629  28.967  1.00 65.54  ? 175  LYS E O     1 
ATOM   7071 C  CB    . LYS E  1 176 ? 120.864 23.915  27.270  1.00 62.75  ? 175  LYS E CB    1 
ATOM   7072 C  CG    . LYS E  1 176 ? 119.757 22.886  27.002  1.00 74.11  ? 175  LYS E CG    1 
ATOM   7073 C  CD    . LYS E  1 176 ? 118.681 23.426  26.052  1.00 72.47  ? 175  LYS E CD    1 
ATOM   7074 N  N     . ILE E  1 177 ? 124.221 24.201  28.062  1.00 62.74  ? 176  ILE E N     1 
ATOM   7075 C  CA    . ILE E  1 177 ? 125.343 25.127  28.047  1.00 62.30  ? 176  ILE E CA    1 
ATOM   7076 C  C     . ILE E  1 177 ? 125.561 25.546  26.599  1.00 61.82  ? 176  ILE E C     1 
ATOM   7077 O  O     . ILE E  1 177 ? 125.484 24.733  25.685  1.00 60.31  ? 176  ILE E O     1 
ATOM   7078 C  CB    . ILE E  1 177 ? 126.652 24.482  28.627  1.00 69.46  ? 176  ILE E CB    1 
ATOM   7079 C  CG1   . ILE E  1 177 ? 126.747 24.693  30.143  1.00 74.66  ? 176  ILE E CG1   1 
ATOM   7080 C  CG2   . ILE E  1 177 ? 127.919 25.061  27.969  1.00 70.87  ? 176  ILE E CG2   1 
ATOM   7081 C  CD1   . ILE E  1 177 ? 125.891 23.760  30.945  1.00 80.74  ? 176  ILE E CD1   1 
ATOM   7082 N  N     . ASN E  1 178 ? 125.840 26.824  26.399  1.00 61.76  ? 177  ASN E N     1 
ATOM   7083 C  CA    . ASN E  1 178 ? 126.138 27.332  25.081  1.00 60.71  ? 177  ASN E CA    1 
ATOM   7084 C  C     . ASN E  1 178 ? 127.585 27.020  24.725  1.00 58.23  ? 177  ASN E C     1 
ATOM   7085 O  O     . ASN E  1 178 ? 128.491 27.724  25.130  1.00 62.06  ? 177  ASN E O     1 
ATOM   7086 C  CB    . ASN E  1 178 ? 125.879 28.839  25.038  1.00 60.20  ? 177  ASN E CB    1 
ATOM   7087 C  CG    . ASN E  1 178 ? 126.094 29.422  23.669  1.00 59.03  ? 177  ASN E CG    1 
ATOM   7088 O  OD1   . ASN E  1 178 ? 126.778 28.834  22.843  1.00 62.54  ? 177  ASN E OD1   1 
ATOM   7089 N  ND2   . ASN E  1 178 ? 125.509 30.584  23.417  1.00 67.25  ? 177  ASN E ND2   1 
ATOM   7090 N  N     . ALA E  1 179 ? 127.797 25.956  23.962  1.00 59.79  ? 178  ALA E N     1 
ATOM   7091 C  CA    . ALA E  1 179 ? 129.156 25.539  23.584  1.00 58.69  ? 178  ALA E CA    1 
ATOM   7092 C  C     . ALA E  1 179 ? 129.726 26.319  22.389  1.00 58.51  ? 178  ALA E C     1 
ATOM   7093 O  O     . ALA E  1 179 ? 130.762 25.942  21.852  1.00 58.34  ? 178  ALA E O     1 
ATOM   7094 C  CB    . ALA E  1 179 ? 129.201 24.033  23.310  1.00 58.91  ? 178  ALA E CB    1 
ATOM   7095 N  N     . GLU E  1 180 ? 129.060 27.395  21.979  1.00 57.51  ? 179  GLU E N     1 
ATOM   7096 C  CA    . GLU E  1 180 ? 129.578 28.273  20.938  1.00 59.20  ? 179  GLU E CA    1 
ATOM   7097 C  C     . GLU E  1 180 ? 130.675 29.210  21.476  1.00 60.34  ? 179  GLU E C     1 
ATOM   7098 O  O     . GLU E  1 180 ? 131.512 29.687  20.712  1.00 61.38  ? 179  GLU E O     1 
ATOM   7099 C  CB    . GLU E  1 180 ? 128.452 29.139  20.379  1.00 62.40  ? 179  GLU E CB    1 
ATOM   7100 C  CG    . GLU E  1 180 ? 127.211 28.372  19.895  1.00 62.78  ? 179  GLU E CG    1 
ATOM   7101 C  CD    . GLU E  1 180 ? 127.130 28.265  18.403  1.00 52.57  ? 179  GLU E CD    1 
ATOM   7102 O  OE1   . GLU E  1 180 ? 128.009 28.812  17.719  1.00 72.77  ? 179  GLU E OE1   1 
ATOM   7103 O  OE2   . GLU E  1 180 ? 126.177 27.639  17.909  1.00 66.49  ? 179  GLU E OE2   1 
ATOM   7104 N  N     . GLY E  1 181 ? 130.653 29.482  22.783  1.00 58.72  ? 180  GLY E N     1 
ATOM   7105 C  CA    . GLY E  1 181 ? 131.571 30.430  23.402  1.00 57.05  ? 180  GLY E CA    1 
ATOM   7106 C  C     . GLY E  1 181 ? 133.006 29.955  23.440  1.00 56.58  ? 180  GLY E C     1 
ATOM   7107 O  O     . GLY E  1 181 ? 133.368 28.997  22.766  1.00 57.31  ? 180  GLY E O     1 
ATOM   7108 N  N     . THR E  1 182 ? 133.832 30.642  24.221  1.00 56.48  ? 181  THR E N     1 
ATOM   7109 C  CA    . THR E  1 182 ? 135.222 30.235  24.398  1.00 56.56  ? 181  THR E CA    1 
ATOM   7110 C  C     . THR E  1 182 ? 135.252 29.046  25.342  1.00 56.53  ? 181  THR E C     1 
ATOM   7111 O  O     . THR E  1 182 ? 134.329 28.878  26.144  1.00 55.30  ? 181  THR E O     1 
ATOM   7112 C  CB    . THR E  1 182 ? 136.103 31.356  25.003  1.00 56.61  ? 181  THR E CB    1 
ATOM   7113 O  OG1   . THR E  1 182 ? 135.709 31.611  26.358  1.00 54.25  ? 181  THR E OG1   1 
ATOM   7114 C  CG2   . THR E  1 182 ? 135.994 32.641  24.176  1.00 53.80  ? 181  THR E CG2   1 
ATOM   7115 N  N     . PRO E  1 183 ? 136.315 28.225  25.263  1.00 58.67  ? 182  PRO E N     1 
ATOM   7116 C  CA    . PRO E  1 183 ? 136.474 27.128  26.229  1.00 59.60  ? 182  PRO E CA    1 
ATOM   7117 C  C     . PRO E  1 183 ? 136.448 27.598  27.697  1.00 59.86  ? 182  PRO E C     1 
ATOM   7118 O  O     . PRO E  1 183 ? 135.907 26.900  28.554  1.00 61.09  ? 182  PRO E O     1 
ATOM   7119 C  CB    . PRO E  1 183 ? 137.842 26.525  25.869  1.00 58.74  ? 182  PRO E CB    1 
ATOM   7120 C  CG    . PRO E  1 183 ? 138.090 26.933  24.451  1.00 59.73  ? 182  PRO E CG    1 
ATOM   7121 C  CD    . PRO E  1 183 ? 137.415 28.265  24.277  1.00 61.68  ? 182  PRO E CD    1 
ATOM   7122 N  N     . GLU E  1 184 ? 137.006 28.773  27.979  1.00 60.09  ? 183  GLU E N     1 
ATOM   7123 C  CA    . GLU E  1 184 ? 137.044 29.264  29.359  1.00 62.22  ? 183  GLU E CA    1 
ATOM   7124 C  C     . GLU E  1 184 ? 135.657 29.705  29.812  1.00 60.37  ? 183  GLU E C     1 
ATOM   7125 O  O     . GLU E  1 184 ? 135.294 29.447  30.960  1.00 59.88  ? 183  GLU E O     1 
ATOM   7126 C  CB    . GLU E  1 184 ? 138.101 30.374  29.605  1.00 65.62  ? 183  GLU E CB    1 
ATOM   7127 C  CG    . GLU E  1 184 ? 138.658 31.089  28.372  1.00 74.60  ? 183  GLU E CG    1 
ATOM   7128 C  CD    . GLU E  1 184 ? 139.590 30.199  27.566  1.00 80.60  ? 183  GLU E CD    1 
ATOM   7129 O  OE1   . GLU E  1 184 ? 140.596 29.727  28.136  1.00 67.67  ? 183  GLU E OE1   1 
ATOM   7130 O  OE2   . GLU E  1 184 ? 139.303 29.959  26.371  1.00 81.45  ? 183  GLU E OE2   1 
ATOM   7131 N  N     . ASP E  1 185 ? 134.889 30.353  28.927  1.00 57.80  ? 184  ASP E N     1 
ATOM   7132 C  CA    A ASP E  1 185 ? 133.507 30.753  29.230  0.60 59.06  ? 184  ASP E CA    1 
ATOM   7133 C  CA    B ASP E  1 185 ? 133.529 30.752  29.273  0.40 55.79  ? 184  ASP E CA    1 
ATOM   7134 C  C     . ASP E  1 185 ? 132.604 29.535  29.293  1.00 57.42  ? 184  ASP E C     1 
ATOM   7135 O  O     . ASP E  1 185 ? 131.685 29.467  30.112  1.00 57.30  ? 184  ASP E O     1 
ATOM   7136 C  CB    A ASP E  1 185 ? 132.963 31.726  28.178  0.60 62.54  ? 184  ASP E CB    1 
ATOM   7137 C  CB    B ASP E  1 185 ? 133.002 31.826  28.319  0.40 56.37  ? 184  ASP E CB    1 
ATOM   7138 C  CG    A ASP E  1 185 ? 131.530 32.198  28.484  0.60 73.26  ? 184  ASP E CG    1 
ATOM   7139 C  CG    B ASP E  1 185 ? 133.672 33.190  28.521  0.40 46.48  ? 184  ASP E CG    1 
ATOM   7140 O  OD1   A ASP E  1 185 ? 131.192 32.381  29.678  0.60 72.03  ? 184  ASP E OD1   1 
ATOM   7141 O  OD1   B ASP E  1 185 ? 133.807 33.908  27.511  0.40 36.77  ? 184  ASP E OD1   1 
ATOM   7142 O  OD2   A ASP E  1 185 ? 130.746 32.397  27.524  0.60 65.36  ? 184  ASP E OD2   1 
ATOM   7143 O  OD2   B ASP E  1 185 ? 134.054 33.554  29.665  0.40 28.28  ? 184  ASP E OD2   1 
ATOM   7144 N  N     . VAL E  1 186 ? 132.856 28.568  28.414  1.00 57.30  ? 185  VAL E N     1 
ATOM   7145 C  CA    . VAL E  1 186 ? 132.068 27.336  28.411  1.00 54.14  ? 185  VAL E CA    1 
ATOM   7146 C  C     . VAL E  1 186 ? 132.290 26.599  29.726  1.00 54.34  ? 185  VAL E C     1 
ATOM   7147 O  O     . VAL E  1 186 ? 131.350 26.074  30.311  1.00 55.78  ? 185  VAL E O     1 
ATOM   7148 C  CB    . VAL E  1 186 ? 132.396 26.434  27.207  1.00 54.86  ? 185  VAL E CB    1 
ATOM   7149 C  CG1   . VAL E  1 186 ? 131.800 25.005  27.388  1.00 55.60  ? 185  VAL E CG1   1 
ATOM   7150 C  CG2   . VAL E  1 186 ? 131.848 27.054  25.922  1.00 63.29  ? 185  VAL E CG2   1 
ATOM   7151 N  N     . PHE E  1 187 ? 133.536 26.596  30.195  1.00 56.18  ? 186  PHE E N     1 
ATOM   7152 C  CA    . PHE E  1 187 ? 133.905 25.952  31.457  1.00 55.25  ? 186  PHE E CA    1 
ATOM   7153 C  C     . PHE E  1 187 ? 133.234 26.584  32.670  1.00 55.93  ? 186  PHE E C     1 
ATOM   7154 O  O     . PHE E  1 187 ? 132.712 25.884  33.533  1.00 57.91  ? 186  PHE E O     1 
ATOM   7155 C  CB    . PHE E  1 187 ? 135.414 25.988  31.655  1.00 51.31  ? 186  PHE E CB    1 
ATOM   7156 C  CG    . PHE E  1 187 ? 135.876 25.170  32.811  1.00 55.42  ? 186  PHE E CG    1 
ATOM   7157 C  CD1   . PHE E  1 187 ? 135.662 23.791  32.824  1.00 66.12  ? 186  PHE E CD1   1 
ATOM   7158 C  CD2   . PHE E  1 187 ? 136.509 25.757  33.890  1.00 59.54  ? 186  PHE E CD2   1 
ATOM   7159 C  CE1   . PHE E  1 187 ? 136.073 23.019  33.898  1.00 62.41  ? 186  PHE E CE1   1 
ATOM   7160 C  CE2   . PHE E  1 187 ? 136.939 24.987  34.968  1.00 66.46  ? 186  PHE E CE2   1 
ATOM   7161 C  CZ    . PHE E  1 187 ? 136.718 23.615  34.973  1.00 63.24  ? 186  PHE E CZ    1 
ATOM   7162 N  N     . LEU E  1 188 ? 133.265 27.907  32.740  1.00 55.72  ? 187  LEU E N     1 
ATOM   7163 C  CA    . LEU E  1 188 ? 132.566 28.620  33.801  1.00 58.16  ? 187  LEU E CA    1 
ATOM   7164 C  C     . LEU E  1 188 ? 131.097 28.197  33.824  1.00 57.93  ? 187  LEU E C     1 
ATOM   7165 O  O     . LEU E  1 188 ? 130.577 27.815  34.867  1.00 57.88  ? 187  LEU E O     1 
ATOM   7166 C  CB    . LEU E  1 188 ? 132.693 30.141  33.617  1.00 57.60  ? 187  LEU E CB    1 
ATOM   7167 C  CG    . LEU E  1 188 ? 133.919 30.859  34.207  1.00 68.03  ? 187  LEU E CG    1 
ATOM   7168 C  CD1   . LEU E  1 188 ? 135.194 29.996  34.231  1.00 74.08  ? 187  LEU E CD1   1 
ATOM   7169 C  CD2   . LEU E  1 188 ? 134.168 32.158  33.441  1.00 63.97  ? 187  LEU E CD2   1 
ATOM   7170 N  N     . GLN E  1 189 ? 130.441 28.256  32.669  1.00 60.97  ? 188  GLN E N     1 
ATOM   7171 C  CA    . GLN E  1 189 ? 129.035 27.834  32.555  1.00 63.29  ? 188  GLN E CA    1 
ATOM   7172 C  C     . GLN E  1 189 ? 128.827 26.404  33.066  1.00 60.81  ? 188  GLN E C     1 
ATOM   7173 O  O     . GLN E  1 189 ? 127.872 26.131  33.793  1.00 58.78  ? 188  GLN E O     1 
ATOM   7174 C  CB    . GLN E  1 189 ? 128.551 27.908  31.105  1.00 64.31  ? 188  GLN E CB    1 
ATOM   7175 C  CG    . GLN E  1 189 ? 128.437 29.297  30.501  1.00 66.53  ? 188  GLN E CG    1 
ATOM   7176 C  CD    . GLN E  1 189 ? 127.989 29.230  29.049  1.00 72.82  ? 188  GLN E CD    1 
ATOM   7177 O  OE1   . GLN E  1 189 ? 126.929 28.672  28.738  1.00 64.46  ? 188  GLN E OE1   1 
ATOM   7178 N  NE2   . GLN E  1 189 ? 128.798 29.789  28.150  1.00 87.83  ? 188  GLN E NE2   1 
ATOM   7179 N  N     . LEU E  1 190 ? 129.711 25.494  32.665  1.00 58.25  ? 189  LEU E N     1 
ATOM   7180 C  CA    . LEU E  1 190 ? 129.670 24.125  33.156  1.00 59.20  ? 189  LEU E CA    1 
ATOM   7181 C  C     . LEU E  1 190 ? 129.795 24.050  34.683  1.00 58.56  ? 189  LEU E C     1 
ATOM   7182 O  O     . LEU E  1 190 ? 129.098 23.268  35.326  1.00 57.93  ? 189  LEU E O     1 
ATOM   7183 C  CB    . LEU E  1 190 ? 130.790 23.307  32.534  1.00 61.02  ? 189  LEU E CB    1 
ATOM   7184 C  CG    . LEU E  1 190 ? 130.618 22.869  31.087  1.00 65.59  ? 189  LEU E CG    1 
ATOM   7185 C  CD1   . LEU E  1 190 ? 131.912 22.300  30.547  1.00 61.56  ? 189  LEU E CD1   1 
ATOM   7186 C  CD2   . LEU E  1 190 ? 129.504 21.839  30.992  1.00 68.87  ? 189  LEU E CD2   1 
ATOM   7187 N  N     . CYS E  1 191 ? 130.693 24.849  35.255  1.00 56.81  ? 190  CYS E N     1 
ATOM   7188 C  CA    . CYS E  1 191 ? 130.904 24.835  36.696  1.00 56.98  ? 190  CYS E CA    1 
ATOM   7189 C  C     . CYS E  1 191 ? 129.715 25.425  37.434  1.00 55.90  ? 190  CYS E C     1 
ATOM   7190 O  O     . CYS E  1 191 ? 129.294 24.888  38.446  1.00 59.69  ? 190  CYS E O     1 
ATOM   7191 C  CB    . CYS E  1 191 ? 132.194 25.559  37.073  1.00 55.34  ? 190  CYS E CB    1 
ATOM   7192 S  SG    . CYS E  1 191 ? 133.703 24.686  36.547  1.00 56.24  ? 190  CYS E SG    1 
ATOM   7193 N  N     . THR E  1 192 ? 129.164 26.516  36.918  1.00 56.83  ? 191  THR E N     1 
ATOM   7194 C  CA    . THR E  1 192 ? 127.945 27.100  37.483  1.00 59.98  ? 191  THR E CA    1 
ATOM   7195 C  C     . THR E  1 192 ? 126.816 26.059  37.619  1.00 59.99  ? 191  THR E C     1 
ATOM   7196 O  O     . THR E  1 192 ? 126.134 26.016  38.642  1.00 64.29  ? 191  THR E O     1 
ATOM   7197 C  CB    . THR E  1 192 ? 127.461 28.306  36.641  1.00 59.93  ? 191  THR E CB    1 
ATOM   7198 O  OG1   . THR E  1 192 ? 128.446 29.343  36.698  1.00 60.20  ? 191  THR E OG1   1 
ATOM   7199 C  CG2   . THR E  1 192 ? 126.129 28.846  37.155  1.00 55.70  ? 191  THR E CG2   1 
ATOM   7200 N  N     . ALA E  1 193 ? 126.628 25.221  36.608  1.00 57.41  ? 192  ALA E N     1 
ATOM   7201 C  CA    . ALA E  1 193 ? 125.606 24.178  36.671  1.00 59.49  ? 192  ALA E CA    1 
ATOM   7202 C  C     . ALA E  1 193 ? 125.977 23.068  37.675  1.00 59.86  ? 192  ALA E C     1 
ATOM   7203 O  O     . ALA E  1 193 ? 125.146 22.629  38.475  1.00 60.11  ? 192  ALA E O     1 
ATOM   7204 C  CB    . ALA E  1 193 ? 125.359 23.599  35.287  1.00 60.64  ? 192  ALA E CB    1 
ATOM   7205 N  N     . ILE E  1 194 ? 127.231 22.634  37.642  1.00 57.37  ? 193  ILE E N     1 
ATOM   7206 C  CA    . ILE E  1 194 ? 127.694 21.564  38.517  1.00 57.09  ? 193  ILE E CA    1 
ATOM   7207 C  C     . ILE E  1 194 ? 127.693 22.030  39.976  1.00 60.87  ? 193  ILE E C     1 
ATOM   7208 O  O     . ILE E  1 194 ? 127.336 21.271  40.874  1.00 59.69  ? 193  ILE E O     1 
ATOM   7209 C  CB    . ILE E  1 194 ? 129.100 21.069  38.093  1.00 58.49  ? 193  ILE E CB    1 
ATOM   7210 C  CG1   . ILE E  1 194 ? 128.994 20.279  36.783  1.00 63.20  ? 193  ILE E CG1   1 
ATOM   7211 C  CG2   . ILE E  1 194 ? 129.748 20.202  39.179  1.00 54.02  ? 193  ILE E CG2   1 
ATOM   7212 C  CD1   . ILE E  1 194 ? 130.320 20.047  36.088  1.00 68.01  ? 193  ILE E CD1   1 
ATOM   7213 N  N     . ASP E  1 195 ? 128.086 23.279  40.204  1.00 58.89  ? 194  ASP E N     1 
ATOM   7214 C  CA    . ASP E  1 195 ? 128.048 23.853  41.535  1.00 57.22  ? 194  ASP E CA    1 
ATOM   7215 C  C     . ASP E  1 195 ? 126.626 23.947  42.076  1.00 57.41  ? 194  ASP E C     1 
ATOM   7216 O  O     . ASP E  1 195 ? 126.428 23.855  43.278  1.00 60.53  ? 194  ASP E O     1 
ATOM   7217 C  CB    . ASP E  1 195 ? 128.727 25.226  41.545  1.00 57.08  ? 194  ASP E CB    1 
ATOM   7218 C  CG    . ASP E  1 195 ? 130.241 25.128  41.438  1.00 63.15  ? 194  ASP E CG    1 
ATOM   7219 O  OD1   . ASP E  1 195 ? 130.761 23.989  41.411  1.00 69.18  ? 194  ASP E OD1   1 
ATOM   7220 O  OD2   . ASP E  1 195 ? 130.914 26.185  41.389  1.00 60.72  ? 194  ASP E OD2   1 
ATOM   7221 N  N     . SER E  1 196 ? 125.641 24.100  41.198  1.00 59.77  ? 195  SER E N     1 
ATOM   7222 C  CA    . SER E  1 196 ? 124.242 24.210  41.622  1.00 62.15  ? 195  SER E CA    1 
ATOM   7223 C  C     . SER E  1 196 ? 123.687 22.932  42.273  1.00 61.64  ? 195  SER E C     1 
ATOM   7224 O  O     . SER E  1 196 ? 122.710 23.000  43.022  1.00 62.72  ? 195  SER E O     1 
ATOM   7225 C  CB    . SER E  1 196 ? 123.348 24.616  40.443  1.00 62.32  ? 195  SER E CB    1 
ATOM   7226 O  OG    . SER E  1 196 ? 123.138 23.532  39.559  1.00 66.59  ? 195  SER E OG    1 
ATOM   7227 N  N     . ILE E  1 197 ? 124.299 21.782  41.992  1.00 61.85  ? 196  ILE E N     1 
ATOM   7228 C  CA    . ILE E  1 197 ? 123.861 20.504  42.583  1.00 64.80  ? 196  ILE E CA    1 
ATOM   7229 C  C     . ILE E  1 197 ? 124.740 20.051  43.767  1.00 63.37  ? 196  ILE E C     1 
ATOM   7230 O  O     . ILE E  1 197 ? 124.685 18.892  44.172  1.00 61.51  ? 196  ILE E O     1 
ATOM   7231 C  CB    . ILE E  1 197 ? 123.727 19.358  41.502  1.00 66.24  ? 196  ILE E CB    1 
ATOM   7232 C  CG1   . ILE E  1 197 ? 125.099 18.868  41.000  1.00 71.05  ? 196  ILE E CG1   1 
ATOM   7233 C  CG2   . ILE E  1 197 ? 122.842 19.819  40.332  1.00 67.36  ? 196  ILE E CG2   1 
ATOM   7234 C  CD1   . ILE E  1 197 ? 125.569 17.544  41.603  1.00 78.60  ? 196  ILE E CD1   1 
ATOM   7235 N  N     . PHE E  1 198 ? 125.529 20.976  44.317  1.00 66.62  ? 197  PHE E N     1 
ATOM   7236 C  CA    . PHE E  1 198 ? 126.305 20.747  45.540  1.00 67.88  ? 197  PHE E CA    1 
ATOM   7237 C  C     . PHE E  1 198 ? 125.607 21.378  46.746  1.00 67.12  ? 197  PHE E C     1 
ATOM   7238 O  O     . PHE E  1 198 ? 125.357 22.583  46.766  1.00 65.79  ? 197  PHE E O     1 
ATOM   7239 C  CB    . PHE E  1 198 ? 127.714 21.333  45.398  1.00 70.65  ? 197  PHE E CB    1 
ATOM   7240 C  CG    . PHE E  1 198 ? 128.718 20.370  44.819  1.00 78.21  ? 197  PHE E CG    1 
ATOM   7241 C  CD1   . PHE E  1 198 ? 128.610 19.949  43.494  1.00 75.55  ? 197  PHE E CD1   1 
ATOM   7242 C  CD2   . PHE E  1 198 ? 129.773 19.886  45.601  1.00 81.53  ? 197  PHE E CD2   1 
ATOM   7243 C  CE1   . PHE E  1 198 ? 129.531 19.059  42.948  1.00 72.29  ? 197  PHE E CE1   1 
ATOM   7244 C  CE2   . PHE E  1 198 ? 130.703 18.993  45.069  1.00 80.91  ? 197  PHE E CE2   1 
ATOM   7245 C  CZ    . PHE E  1 198 ? 130.583 18.578  43.737  1.00 84.18  ? 197  PHE E CZ    1 
ATOM   7246 N  N     . MET F  1 6   ? 67.805  65.275  3.557   1.00 72.83  ? 5    MET F N     1 
ATOM   7247 C  CA    . MET F  1 6   ? 67.610  64.616  4.886   1.00 71.93  ? 5    MET F CA    1 
ATOM   7248 C  C     . MET F  1 6   ? 66.153  64.262  5.145   1.00 70.52  ? 5    MET F C     1 
ATOM   7249 O  O     . MET F  1 6   ? 65.863  63.158  5.594   1.00 66.52  ? 5    MET F O     1 
ATOM   7250 C  CB    . MET F  1 6   ? 68.132  65.508  6.026   1.00 72.89  ? 5    MET F CB    1 
ATOM   7251 C  CG    . MET F  1 6   ? 67.961  64.919  7.458   1.00 73.67  ? 5    MET F CG    1 
ATOM   7252 S  SD    . MET F  1 6   ? 69.140  65.585  8.687   1.00 72.82  ? 5    MET F SD    1 
ATOM   7253 C  CE    . MET F  1 6   ? 68.782  64.667  10.179  1.00 53.55  ? 5    MET F CE    1 
ATOM   7254 N  N     . GLU F  1 7   ? 65.242  65.193  4.850   1.00 72.56  ? 6    GLU F N     1 
ATOM   7255 C  CA    . GLU F  1 7   ? 63.815  65.048  5.204   1.00 69.17  ? 6    GLU F CA    1 
ATOM   7256 C  C     . GLU F  1 7   ? 63.159  63.822  4.554   1.00 65.03  ? 6    GLU F C     1 
ATOM   7257 O  O     . GLU F  1 7   ? 62.263  63.213  5.139   1.00 59.57  ? 6    GLU F O     1 
ATOM   7258 C  CB    . GLU F  1 7   ? 63.042  66.324  4.863   1.00 71.57  ? 6    GLU F CB    1 
ATOM   7259 C  CG    . GLU F  1 7   ? 61.661  66.413  5.506   1.00 79.30  ? 6    GLU F CG    1 
ATOM   7260 N  N     . ASP F  1 8   ? 63.625  63.462  3.357   1.00 64.50  ? 7    ASP F N     1 
ATOM   7261 C  CA    . ASP F  1 8   ? 63.245  62.197  2.716   1.00 64.98  ? 7    ASP F CA    1 
ATOM   7262 C  C     . ASP F  1 8   ? 63.727  61.023  3.577   1.00 65.33  ? 7    ASP F C     1 
ATOM   7263 O  O     . ASP F  1 8   ? 62.948  60.114  3.866   1.00 62.31  ? 7    ASP F O     1 
ATOM   7264 C  CB    . ASP F  1 8   ? 63.857  62.048  1.308   1.00 64.49  ? 7    ASP F CB    1 
ATOM   7265 C  CG    . ASP F  1 8   ? 63.691  63.284  0.436   1.00 68.16  ? 7    ASP F CG    1 
ATOM   7266 O  OD1   . ASP F  1 8   ? 62.620  63.930  0.474   1.00 69.13  ? 7    ASP F OD1   1 
ATOM   7267 O  OD2   . ASP F  1 8   ? 64.647  63.600  -0.307  1.00 63.43  ? 7    ASP F OD2   1 
ATOM   7268 N  N     . LEU F  1 9   ? 65.011  61.066  3.969   1.00 65.49  ? 8    LEU F N     1 
ATOM   7269 C  CA    . LEU F  1 9   ? 65.649  60.043  4.812   1.00 69.31  ? 8    LEU F CA    1 
ATOM   7270 C  C     . LEU F  1 9   ? 65.299  60.152  6.292   1.00 67.17  ? 8    LEU F C     1 
ATOM   7271 O  O     . LEU F  1 9   ? 65.857  59.423  7.117   1.00 64.85  ? 8    LEU F O     1 
ATOM   7272 C  CB    . LEU F  1 9   ? 67.187  60.102  4.686   1.00 76.04  ? 8    LEU F CB    1 
ATOM   7273 N  N     . ARG F  1 10  ? 64.438  61.106  6.624   1.00 66.26  ? 9    ARG F N     1 
ATOM   7274 C  CA    . ARG F  1 10  ? 63.833  61.195  7.942   1.00 69.09  ? 9    ARG F CA    1 
ATOM   7275 C  C     . ARG F  1 10  ? 62.448  60.532  7.930   1.00 68.91  ? 9    ARG F C     1 
ATOM   7276 O  O     . ARG F  1 10  ? 61.956  60.082  8.955   1.00 72.19  ? 9    ARG F O     1 
ATOM   7277 C  CB    . ARG F  1 10  ? 63.729  62.668  8.383   1.00 72.10  ? 9    ARG F CB    1 
ATOM   7278 C  CG    . ARG F  1 10  ? 65.093  63.336  8.670   1.00 83.48  ? 9    ARG F CG    1 
ATOM   7279 C  CD    . ARG F  1 10  ? 65.022  64.384  9.790   1.00 95.29  ? 9    ARG F CD    1 
ATOM   7280 N  NE    . ARG F  1 10  ? 64.433  63.821  11.008  1.00 102.97 ? 9    ARG F NE    1 
ATOM   7281 C  CZ    . ARG F  1 10  ? 65.100  63.344  12.064  1.00 103.64 ? 9    ARG F CZ    1 
ATOM   7282 N  NH1   . ARG F  1 10  ? 64.410  62.846  13.081  1.00 106.96 ? 9    ARG F NH1   1 
ATOM   7283 N  NH2   . ARG F  1 10  ? 66.428  63.371  12.141  1.00 91.22  ? 9    ARG F NH2   1 
ATOM   7284 N  N     . LYS F  1 11  ? 61.818  60.478  6.765   1.00 68.42  ? 10   LYS F N     1 
ATOM   7285 C  CA    . LYS F  1 11  ? 60.488  59.891  6.634   1.00 67.97  ? 10   LYS F CA    1 
ATOM   7286 C  C     . LYS F  1 11  ? 60.557  58.441  6.168   1.00 68.02  ? 10   LYS F C     1 
ATOM   7287 O  O     . LYS F  1 11  ? 59.655  57.971  5.487   1.00 69.15  ? 10   LYS F O     1 
ATOM   7288 C  CB    . LYS F  1 11  ? 59.628  60.717  5.653   1.00 68.16  ? 10   LYS F CB    1 
ATOM   7289 N  N     . CYS F  1 12  ? 61.624  57.727  6.513   1.00 70.05  ? 11   CYS F N     1 
ATOM   7290 C  CA    . CYS F  1 12  ? 61.680  56.301  6.185   1.00 68.48  ? 11   CYS F CA    1 
ATOM   7291 C  C     . CYS F  1 12  ? 62.325  55.487  7.291   1.00 61.93  ? 11   CYS F C     1 
ATOM   7292 O  O     . CYS F  1 12  ? 62.950  56.032  8.205   1.00 59.48  ? 11   CYS F O     1 
ATOM   7293 C  CB    . CYS F  1 12  ? 62.381  56.056  4.847   1.00 70.64  ? 11   CYS F CB    1 
ATOM   7294 S  SG    . CYS F  1 12  ? 64.122  56.334  4.889   1.00 85.13  ? 11   CYS F SG    1 
ATOM   7295 N  N     . LYS F  1 13  ? 62.143  54.175  7.194   1.00 57.75  ? 12   LYS F N     1 
ATOM   7296 C  CA    . LYS F  1 13  ? 62.463  53.258  8.278   1.00 57.07  ? 12   LYS F CA    1 
ATOM   7297 C  C     . LYS F  1 13  ? 63.972  53.052  8.440   1.00 55.68  ? 12   LYS F C     1 
ATOM   7298 O  O     . LYS F  1 13  ? 64.657  52.652  7.497   1.00 51.39  ? 12   LYS F O     1 
ATOM   7299 C  CB    . LYS F  1 13  ? 61.755  51.917  8.050   1.00 59.10  ? 12   LYS F CB    1 
ATOM   7300 N  N     . ILE F  1 14  ? 64.471  53.345  9.644   1.00 53.99  ? 13   ILE F N     1 
ATOM   7301 C  CA    . ILE F  1 14  ? 65.865  53.088  10.032  1.00 50.54  ? 13   ILE F CA    1 
ATOM   7302 C  C     . ILE F  1 14  ? 65.871  52.118  11.205  1.00 50.47  ? 13   ILE F C     1 
ATOM   7303 O  O     . ILE F  1 14  ? 65.289  52.402  12.245  1.00 51.42  ? 13   ILE F O     1 
ATOM   7304 C  CB    . ILE F  1 14  ? 66.590  54.403  10.426  1.00 43.21  ? 13   ILE F CB    1 
ATOM   7305 C  CG1   . ILE F  1 14  ? 66.704  55.329  9.204   1.00 46.25  ? 13   ILE F CG1   1 
ATOM   7306 C  CG2   . ILE F  1 14  ? 67.963  54.105  10.987  1.00 52.16  ? 13   ILE F CG2   1 
ATOM   7307 C  CD1   . ILE F  1 14  ? 67.260  56.715  9.488   1.00 46.86  ? 13   ILE F CD1   1 
ATOM   7308 N  N     . ILE F  1 15  ? 66.523  50.970  11.039  1.00 54.08  ? 14   ILE F N     1 
ATOM   7309 C  CA    . ILE F  1 15  ? 66.647  49.988  12.121  1.00 53.56  ? 14   ILE F CA    1 
ATOM   7310 C  C     . ILE F  1 15  ? 68.100  49.690  12.414  1.00 52.72  ? 14   ILE F C     1 
ATOM   7311 O  O     . ILE F  1 15  ? 68.859  49.318  11.519  1.00 49.93  ? 14   ILE F O     1 
ATOM   7312 C  CB    . ILE F  1 15  ? 65.952  48.648  11.793  1.00 51.02  ? 14   ILE F CB    1 
ATOM   7313 C  CG1   . ILE F  1 15  ? 64.469  48.866  11.458  1.00 57.63  ? 14   ILE F CG1   1 
ATOM   7314 C  CG2   . ILE F  1 15  ? 66.057  47.677  12.986  1.00 52.78  ? 14   ILE F CG2   1 
ATOM   7315 C  CD1   . ILE F  1 15  ? 63.905  47.835  10.507  1.00 58.75  ? 14   ILE F CD1   1 
ATOM   7316 N  N     . PHE F  1 16  ? 68.489  49.852  13.674  1.00 54.34  ? 15   PHE F N     1 
ATOM   7317 C  CA    . PHE F  1 16  ? 69.824  49.451  14.108  1.00 53.37  ? 15   PHE F CA    1 
ATOM   7318 C  C     . PHE F  1 16  ? 69.704  48.043  14.658  1.00 55.86  ? 15   PHE F C     1 
ATOM   7319 O  O     . PHE F  1 16  ? 68.772  47.746  15.448  1.00 54.17  ? 15   PHE F O     1 
ATOM   7320 C  CB    . PHE F  1 16  ? 70.369  50.343  15.212  1.00 48.83  ? 15   PHE F CB    1 
ATOM   7321 C  CG    . PHE F  1 16  ? 70.655  51.771  14.802  1.00 59.74  ? 15   PHE F CG    1 
ATOM   7322 C  CD1   . PHE F  1 16  ? 70.728  52.144  13.478  1.00 52.88  ? 15   PHE F CD1   1 
ATOM   7323 C  CD2   . PHE F  1 16  ? 70.897  52.743  15.781  1.00 43.24  ? 15   PHE F CD2   1 
ATOM   7324 C  CE1   . PHE F  1 16  ? 71.003  53.451  13.123  1.00 52.37  ? 15   PHE F CE1   1 
ATOM   7325 C  CE2   . PHE F  1 16  ? 71.191  54.035  15.422  1.00 61.87  ? 15   PHE F CE2   1 
ATOM   7326 C  CZ    . PHE F  1 16  ? 71.248  54.389  14.085  1.00 53.75  ? 15   PHE F CZ    1 
ATOM   7327 N  N     . ILE F  1 17  ? 70.628  47.178  14.245  1.00 56.43  ? 16   ILE F N     1 
ATOM   7328 C  CA    . ILE F  1 17  ? 70.709  45.827  14.804  1.00 56.86  ? 16   ILE F CA    1 
ATOM   7329 C  C     . ILE F  1 17  ? 72.114  45.588  15.362  1.00 57.67  ? 16   ILE F C     1 
ATOM   7330 O  O     . ILE F  1 17  ? 73.115  45.818  14.684  1.00 57.46  ? 16   ILE F O     1 
ATOM   7331 C  CB    . ILE F  1 17  ? 70.291  44.725  13.816  1.00 58.00  ? 16   ILE F CB    1 
ATOM   7332 C  CG1   . ILE F  1 17  ? 70.354  43.348  14.510  1.00 60.13  ? 16   ILE F CG1   1 
ATOM   7333 C  CG2   . ILE F  1 17  ? 71.132  44.753  12.535  1.00 61.98  ? 16   ILE F CG2   1 
ATOM   7334 C  CD1   . ILE F  1 17  ? 69.612  42.242  13.779  1.00 58.48  ? 16   ILE F CD1   1 
ATOM   7335 N  N     . ILE F  1 18  ? 72.135  45.136  16.618  1.00 57.26  ? 17   ILE F N     1 
ATOM   7336 C  CA    . ILE F  1 18  ? 73.310  45.061  17.479  1.00 62.00  ? 17   ILE F CA    1 
ATOM   7337 C  C     . ILE F  1 18  ? 73.369  43.623  18.053  1.00 60.16  ? 17   ILE F C     1 
ATOM   7338 O  O     . ILE F  1 18  ? 72.348  43.071  18.433  1.00 57.09  ? 17   ILE F O     1 
ATOM   7339 C  CB    . ILE F  1 18  ? 73.147  46.152  18.605  1.00 63.89  ? 17   ILE F CB    1 
ATOM   7340 C  CG1   . ILE F  1 18  ? 73.503  47.537  18.047  1.00 65.01  ? 17   ILE F CG1   1 
ATOM   7341 C  CG2   . ILE F  1 18  ? 73.905  45.829  19.878  1.00 72.23  ? 17   ILE F CG2   1 
ATOM   7342 C  CD1   . ILE F  1 18  ? 74.876  47.644  17.440  1.00 90.65  ? 17   ILE F CD1   1 
ATOM   7343 N  N     . GLY F  1 19  ? 74.550  43.014  18.084  1.00 57.11  ? 18   GLY F N     1 
ATOM   7344 C  CA    . GLY F  1 19  ? 74.716  41.697  18.711  1.00 55.52  ? 18   GLY F CA    1 
ATOM   7345 C  C     . GLY F  1 19  ? 76.163  41.236  18.732  1.00 56.11  ? 18   GLY F C     1 
ATOM   7346 O  O     . GLY F  1 19  ? 76.955  41.590  17.861  1.00 55.43  ? 18   GLY F O     1 
ATOM   7347 N  N     . GLY F  1 20  ? 76.518  40.470  19.759  1.00 56.13  ? 19   GLY F N     1 
ATOM   7348 C  CA    . GLY F  1 20  ? 77.859  39.944  19.899  1.00 55.82  ? 19   GLY F CA    1 
ATOM   7349 C  C     . GLY F  1 20  ? 78.244  38.949  18.810  1.00 54.35  ? 19   GLY F C     1 
ATOM   7350 O  O     . GLY F  1 20  ? 77.386  38.372  18.156  1.00 56.77  ? 19   GLY F O     1 
ATOM   7351 N  N     . PRO F  1 21  ? 79.545  38.756  18.605  1.00 56.63  ? 20   PRO F N     1 
ATOM   7352 C  CA    . PRO F  1 21  ? 79.999  37.813  17.591  1.00 56.10  ? 20   PRO F CA    1 
ATOM   7353 C  C     . PRO F  1 21  ? 79.571  36.417  18.004  1.00 52.44  ? 20   PRO F C     1 
ATOM   7354 O  O     . PRO F  1 21  ? 79.667  36.071  19.159  1.00 57.12  ? 20   PRO F O     1 
ATOM   7355 C  CB    . PRO F  1 21  ? 81.527  37.965  17.606  1.00 56.65  ? 20   PRO F CB    1 
ATOM   7356 C  CG    . PRO F  1 21  ? 81.847  38.549  18.928  1.00 59.44  ? 20   PRO F CG    1 
ATOM   7357 C  CD    . PRO F  1 21  ? 80.666  39.376  19.345  1.00 59.84  ? 20   PRO F CD    1 
ATOM   7358 N  N     . GLY F  1 22  ? 79.057  35.632  17.068  1.00 55.30  ? 21   GLY F N     1 
ATOM   7359 C  CA    . GLY F  1 22  ? 78.465  34.376  17.427  1.00 57.77  ? 21   GLY F CA    1 
ATOM   7360 C  C     . GLY F  1 22  ? 77.020  34.465  17.856  1.00 57.88  ? 21   GLY F C     1 
ATOM   7361 O  O     . GLY F  1 22  ? 76.418  33.450  18.118  1.00 59.49  ? 21   GLY F O     1 
ATOM   7362 N  N     . SER F  1 23  ? 76.428  35.654  17.872  1.00 60.21  ? 22   SER F N     1 
ATOM   7363 C  CA    . SER F  1 23  ? 74.997  35.762  18.249  1.00 58.33  ? 22   SER F CA    1 
ATOM   7364 C  C     . SER F  1 23  ? 74.049  35.320  17.133  1.00 56.61  ? 22   SER F C     1 
ATOM   7365 O  O     . SER F  1 23  ? 72.882  35.113  17.373  1.00 59.53  ? 22   SER F O     1 
ATOM   7366 C  CB    . SER F  1 23  ? 74.643  37.187  18.708  1.00 53.91  ? 22   SER F CB    1 
ATOM   7367 O  OG    . SER F  1 23  ? 74.692  38.098  17.628  1.00 55.59  ? 22   SER F OG    1 
ATOM   7368 N  N     . GLY F  1 24  ? 74.558  35.214  15.910  1.00 60.32  ? 23   GLY F N     1 
ATOM   7369 C  CA    . GLY F  1 24  ? 73.745  34.838  14.748  1.00 54.46  ? 23   GLY F CA    1 
ATOM   7370 C  C     . GLY F  1 24  ? 73.219  36.017  13.944  1.00 58.24  ? 23   GLY F C     1 
ATOM   7371 O  O     . GLY F  1 24  ? 72.352  35.838  13.118  1.00 61.04  ? 23   GLY F O     1 
ATOM   7372 N  N     . LYS F  1 25  ? 73.758  37.213  14.183  1.00 60.41  ? 24   LYS F N     1 
ATOM   7373 C  CA    . LYS F  1 25  ? 73.268  38.458  13.583  1.00 57.65  ? 24   LYS F CA    1 
ATOM   7374 C  C     . LYS F  1 25  ? 73.465  38.510  12.072  1.00 58.34  ? 24   LYS F C     1 
ATOM   7375 O  O     . LYS F  1 25  ? 72.613  39.040  11.367  1.00 62.10  ? 24   LYS F O     1 
ATOM   7376 C  CB    . LYS F  1 25  ? 73.942  39.662  14.260  1.00 60.10  ? 24   LYS F CB    1 
ATOM   7377 C  CG    . LYS F  1 25  ? 73.812  40.996  13.546  1.00 64.18  ? 24   LYS F CG    1 
ATOM   7378 C  CD    . LYS F  1 25  ? 74.068  42.208  14.447  1.00 59.47  ? 24   LYS F CD    1 
ATOM   7379 C  CE    . LYS F  1 25  ? 75.551  42.500  14.750  1.00 65.92  ? 24   LYS F CE    1 
ATOM   7380 N  NZ    . LYS F  1 25  ? 76.502  42.215  13.654  1.00 62.89  ? 24   LYS F NZ    1 
ATOM   7381 N  N     . GLY F  1 26  ? 74.585  37.980  11.584  1.00 60.21  ? 25   GLY F N     1 
ATOM   7382 C  CA    . GLY F  1 26  ? 74.882  37.939  10.146  1.00 59.58  ? 25   GLY F CA    1 
ATOM   7383 C  C     . GLY F  1 26  ? 73.813  37.206  9.338   1.00 61.24  ? 25   GLY F C     1 
ATOM   7384 O  O     . GLY F  1 26  ? 73.369  37.665  8.282   1.00 62.93  ? 25   GLY F O     1 
ATOM   7385 N  N     . THR F  1 27  ? 73.405  36.058  9.849   1.00 59.07  ? 26   THR F N     1 
ATOM   7386 C  CA    . THR F  1 27  ? 72.425  35.246  9.185   1.00 63.18  ? 26   THR F CA    1 
ATOM   7387 C  C     . THR F  1 27  ? 71.050  35.873  9.357   1.00 58.19  ? 26   THR F C     1 
ATOM   7388 O  O     . THR F  1 27  ? 70.283  35.892  8.421   1.00 56.73  ? 26   THR F O     1 
ATOM   7389 C  CB    . THR F  1 27  ? 72.475  33.782  9.679   1.00 66.31  ? 26   THR F CB    1 
ATOM   7390 O  OG1   . THR F  1 27  ? 72.197  33.729  11.082  1.00 93.48  ? 26   THR F OG1   1 
ATOM   7391 C  CG2   . THR F  1 27  ? 73.862  33.210  9.431   1.00 57.09  ? 26   THR F CG2   1 
ATOM   7392 N  N     . GLN F  1 28  ? 70.757  36.427  10.532  1.00 58.31  ? 27   GLN F N     1 
ATOM   7393 C  CA    . GLN F  1 28  ? 69.470  37.097  10.729  1.00 58.77  ? 27   GLN F CA    1 
ATOM   7394 C  C     . GLN F  1 28  ? 69.270  38.289  9.772   1.00 56.67  ? 27   GLN F C     1 
ATOM   7395 O  O     . GLN F  1 28  ? 68.164  38.493  9.271   1.00 55.97  ? 27   GLN F O     1 
ATOM   7396 C  CB    . GLN F  1 28  ? 69.273  37.500  12.193  1.00 62.34  ? 27   GLN F CB    1 
ATOM   7397 C  CG    . GLN F  1 28  ? 69.020  36.304  13.139  1.00 59.23  ? 27   GLN F CG    1 
ATOM   7398 C  CD    . GLN F  1 28  ? 67.837  35.457  12.715  1.00 61.21  ? 27   GLN F CD    1 
ATOM   7399 O  OE1   . GLN F  1 28  ? 66.818  35.984  12.300  1.00 67.97  ? 27   GLN F OE1   1 
ATOM   7400 N  NE2   . GLN F  1 28  ? 67.974  34.140  12.802  1.00 57.52  ? 27   GLN F NE2   1 
ATOM   7401 N  N     . CYS F  1 29  ? 70.348  39.028  9.489   1.00 58.20  ? 28   CYS F N     1 
ATOM   7402 C  CA    . CYS F  1 29  ? 70.304  40.184  8.576   1.00 58.78  ? 28   CYS F CA    1 
ATOM   7403 C  C     . CYS F  1 29  ? 70.013  39.765  7.161   1.00 59.23  ? 28   CYS F C     1 
ATOM   7404 O  O     . CYS F  1 29  ? 69.277  40.449  6.446   1.00 61.74  ? 28   CYS F O     1 
ATOM   7405 C  CB    . CYS F  1 29  ? 71.620  40.975  8.605   1.00 61.66  ? 28   CYS F CB    1 
ATOM   7406 S  SG    . CYS F  1 29  ? 71.830  41.972  10.100  1.00 62.97  ? 28   CYS F SG    1 
ATOM   7407 N  N     . GLU F  1 30  ? 70.599  38.641  6.754   1.00 60.42  ? 29   GLU F N     1 
ATOM   7408 C  CA    . GLU F  1 30  ? 70.272  38.035  5.471   1.00 61.08  ? 29   GLU F CA    1 
ATOM   7409 C  C     . GLU F  1 30  ? 68.782  37.731  5.351   1.00 59.90  ? 29   GLU F C     1 
ATOM   7410 O  O     . GLU F  1 30  ? 68.167  37.980  4.314   1.00 59.18  ? 29   GLU F O     1 
ATOM   7411 C  CB    . GLU F  1 30  ? 71.063  36.740  5.265   1.00 61.74  ? 29   GLU F CB    1 
ATOM   7412 C  CG    . GLU F  1 30  ? 72.484  36.950  4.785   1.00 72.98  ? 29   GLU F CG    1 
ATOM   7413 C  CD    . GLU F  1 30  ? 73.352  35.711  4.958   1.00 82.55  ? 29   GLU F CD    1 
ATOM   7414 O  OE1   . GLU F  1 30  ? 72.856  34.594  4.701   1.00 98.21  ? 29   GLU F OE1   1 
ATOM   7415 O  OE2   . GLU F  1 30  ? 74.525  35.855  5.357   1.00 93.18  ? 29   GLU F OE2   1 
ATOM   7416 N  N     . LYS F  1 31  ? 68.209  37.176  6.408   1.00 59.47  ? 30   LYS F N     1 
ATOM   7417 C  CA    . LYS F  1 31  ? 66.809  36.749  6.386   1.00 56.98  ? 30   LYS F CA    1 
ATOM   7418 C  C     . LYS F  1 31  ? 65.858  37.953  6.392   1.00 54.30  ? 30   LYS F C     1 
ATOM   7419 O  O     . LYS F  1 31  ? 64.818  37.945  5.738   1.00 59.55  ? 30   LYS F O     1 
ATOM   7420 C  CB    . LYS F  1 31  ? 66.504  35.866  7.593   1.00 58.94  ? 30   LYS F CB    1 
ATOM   7421 C  CG    . LYS F  1 31  ? 67.308  34.578  7.713   1.00 58.24  ? 30   LYS F CG    1 
ATOM   7422 C  CD    . LYS F  1 31  ? 66.758  33.732  8.892   1.00 65.30  ? 30   LYS F CD    1 
ATOM   7423 C  CE    . LYS F  1 31  ? 67.455  32.374  9.015   1.00 74.31  ? 30   LYS F CE    1 
ATOM   7424 N  NZ    . LYS F  1 31  ? 66.496  31.229  9.072   1.00 79.02  ? 30   LYS F NZ    1 
ATOM   7425 N  N     . LEU F  1 32  ? 66.220  38.990  7.132   1.00 58.85  ? 31   LEU F N     1 
ATOM   7426 C  CA    . LEU F  1 32  ? 65.417  40.218  7.177   1.00 58.11  ? 31   LEU F CA    1 
ATOM   7427 C  C     . LEU F  1 32  ? 65.420  40.908  5.823   1.00 57.12  ? 31   LEU F C     1 
ATOM   7428 O  O     . LEU F  1 32  ? 64.416  41.489  5.412   1.00 58.30  ? 31   LEU F O     1 
ATOM   7429 C  CB    . LEU F  1 32  ? 65.969  41.178  8.236   1.00 54.02  ? 31   LEU F CB    1 
ATOM   7430 C  CG    . LEU F  1 32  ? 65.850  40.683  9.679   1.00 61.00  ? 31   LEU F CG    1 
ATOM   7431 C  CD1   . LEU F  1 32  ? 66.635  41.603  10.599  1.00 64.63  ? 31   LEU F CD1   1 
ATOM   7432 C  CD2   . LEU F  1 32  ? 64.365  40.571  10.121  1.00 55.60  ? 31   LEU F CD2   1 
ATOM   7433 N  N     . VAL F  1 33  ? 66.563  40.845  5.146   1.00 55.69  ? 32   VAL F N     1 
ATOM   7434 C  CA    . VAL F  1 33  ? 66.706  41.423  3.826   1.00 56.35  ? 32   VAL F CA    1 
ATOM   7435 C  C     . VAL F  1 33  ? 65.796  40.657  2.867   1.00 57.50  ? 32   VAL F C     1 
ATOM   7436 O  O     . VAL F  1 33  ? 64.989  41.249  2.150   1.00 57.74  ? 32   VAL F O     1 
ATOM   7437 C  CB    . VAL F  1 33  ? 68.182  41.375  3.339   1.00 58.60  ? 32   VAL F CB    1 
ATOM   7438 C  CG1   . VAL F  1 33  ? 68.270  41.516  1.804   1.00 62.96  ? 32   VAL F CG1   1 
ATOM   7439 C  CG2   . VAL F  1 33  ? 69.020  42.449  4.035   1.00 53.09  ? 32   VAL F CG2   1 
ATOM   7440 N  N     . GLU F  1 34  ? 65.922  39.337  2.881   1.00 57.27  ? 33   GLU F N     1 
ATOM   7441 C  CA    . GLU F  1 34  ? 65.118  38.482  2.011   1.00 57.42  ? 33   GLU F CA    1 
ATOM   7442 C  C     . GLU F  1 34  ? 63.611  38.709  2.229   1.00 57.30  ? 33   GLU F C     1 
ATOM   7443 O  O     . GLU F  1 34  ? 62.868  38.800  1.280   1.00 55.02  ? 33   GLU F O     1 
ATOM   7444 C  CB    . GLU F  1 34  ? 65.485  37.006  2.221   1.00 61.01  ? 33   GLU F CB    1 
ATOM   7445 C  CG    . GLU F  1 34  ? 65.684  36.219  0.917   1.00 72.10  ? 33   GLU F CG    1 
ATOM   7446 C  CD    . GLU F  1 34  ? 64.389  35.868  0.208   1.00 93.17  ? 33   GLU F CD    1 
ATOM   7447 O  OE1   . GLU F  1 34  ? 63.516  35.245  0.846   1.00 114.26 ? 33   GLU F OE1   1 
ATOM   7448 O  OE2   . GLU F  1 34  ? 64.248  36.188  -0.997  1.00 96.56  ? 33   GLU F OE2   1 
ATOM   7449 N  N     . LYS F  1 35  ? 63.174  38.821  3.480   1.00 58.01  ? 34   LYS F N     1 
ATOM   7450 C  CA    . LYS F  1 35  ? 61.755  39.036  3.791   1.00 54.46  ? 34   LYS F CA    1 
ATOM   7451 C  C     . LYS F  1 35  ? 61.298  40.456  3.487   1.00 54.08  ? 34   LYS F C     1 
ATOM   7452 O  O     . LYS F  1 35  ? 60.374  40.655  2.696   1.00 54.42  ? 34   LYS F O     1 
ATOM   7453 C  CB    . LYS F  1 35  ? 61.480  38.750  5.274   1.00 57.77  ? 34   LYS F CB    1 
ATOM   7454 C  CG    . LYS F  1 35  ? 60.026  39.010  5.689   1.00 57.14  ? 34   LYS F CG    1 
ATOM   7455 C  CD    . LYS F  1 35  ? 59.753  38.477  7.076   1.00 59.49  ? 34   LYS F CD    1 
ATOM   7456 C  CE    . LYS F  1 35  ? 58.333  38.783  7.518   1.00 53.59  ? 34   LYS F CE    1 
ATOM   7457 N  NZ    . LYS F  1 35  ? 57.362  37.904  6.865   1.00 45.53  ? 34   LYS F NZ    1 
ATOM   7458 N  N     . TYR F  1 36  ? 61.933  41.434  4.145   1.00 53.90  ? 35   TYR F N     1 
ATOM   7459 C  CA    . TYR F  1 36  ? 61.486  42.837  4.116   1.00 50.20  ? 35   TYR F CA    1 
ATOM   7460 C  C     . TYR F  1 36  ? 62.056  43.698  2.985   1.00 52.12  ? 35   TYR F C     1 
ATOM   7461 O  O     . TYR F  1 36  ? 61.564  44.808  2.765   1.00 53.89  ? 35   TYR F O     1 
ATOM   7462 C  CB    . TYR F  1 36  ? 61.803  43.512  5.442   1.00 51.02  ? 35   TYR F CB    1 
ATOM   7463 C  CG    . TYR F  1 36  ? 61.073  42.931  6.632   1.00 44.12  ? 35   TYR F CG    1 
ATOM   7464 C  CD1   . TYR F  1 36  ? 59.710  43.147  6.811   1.00 46.66  ? 35   TYR F CD1   1 
ATOM   7465 C  CD2   . TYR F  1 36  ? 61.747  42.170  7.581   1.00 50.81  ? 35   TYR F CD2   1 
ATOM   7466 C  CE1   . TYR F  1 36  ? 59.029  42.608  7.915   1.00 51.28  ? 35   TYR F CE1   1 
ATOM   7467 C  CE2   . TYR F  1 36  ? 61.082  41.630  8.684   1.00 54.54  ? 35   TYR F CE2   1 
ATOM   7468 C  CZ    . TYR F  1 36  ? 59.730  41.856  8.853   1.00 53.05  ? 35   TYR F CZ    1 
ATOM   7469 O  OH    . TYR F  1 36  ? 59.084  41.323  9.951   1.00 51.29  ? 35   TYR F OH    1 
ATOM   7470 N  N     . GLY F  1 37  ? 63.064  43.201  2.266   1.00 49.91  ? 36   GLY F N     1 
ATOM   7471 C  CA    . GLY F  1 37  ? 63.740  44.000  1.240   1.00 53.64  ? 36   GLY F CA    1 
ATOM   7472 C  C     . GLY F  1 37  ? 64.545  45.187  1.769   1.00 56.57  ? 36   GLY F C     1 
ATOM   7473 O  O     . GLY F  1 37  ? 64.729  46.185  1.076   1.00 58.25  ? 36   GLY F O     1 
ATOM   7474 N  N     . PHE F  1 38  ? 65.052  45.091  2.993   1.00 58.04  ? 37   PHE F N     1 
ATOM   7475 C  CA    . PHE F  1 38  ? 65.823  46.196  3.575   1.00 54.12  ? 37   PHE F CA    1 
ATOM   7476 C  C     . PHE F  1 38  ? 67.165  46.342  2.903   1.00 54.92  ? 37   PHE F C     1 
ATOM   7477 O  O     . PHE F  1 38  ? 67.729  45.369  2.416   1.00 54.66  ? 37   PHE F O     1 
ATOM   7478 C  CB    . PHE F  1 38  ? 66.080  45.992  5.072   1.00 53.91  ? 37   PHE F CB    1 
ATOM   7479 C  CG    . PHE F  1 38  ? 64.848  46.015  5.923   1.00 53.17  ? 37   PHE F CG    1 
ATOM   7480 C  CD1   . PHE F  1 38  ? 63.775  46.855  5.622   1.00 63.55  ? 37   PHE F CD1   1 
ATOM   7481 C  CD2   . PHE F  1 38  ? 64.778  45.217  7.063   1.00 59.83  ? 37   PHE F CD2   1 
ATOM   7482 C  CE1   . PHE F  1 38  ? 62.650  46.876  6.419   1.00 53.64  ? 37   PHE F CE1   1 
ATOM   7483 C  CE2   . PHE F  1 38  ? 63.657  45.237  7.875   1.00 60.98  ? 37   PHE F CE2   1 
ATOM   7484 C  CZ    . PHE F  1 38  ? 62.584  46.071  7.551   1.00 56.26  ? 37   PHE F CZ    1 
ATOM   7485 N  N     . THR F  1 39  ? 67.667  47.578  2.916   1.00 54.32  ? 38   THR F N     1 
ATOM   7486 C  CA    . THR F  1 39  ? 69.002  47.887  2.495   1.00 56.72  ? 38   THR F CA    1 
ATOM   7487 C  C     . THR F  1 39  ? 69.922  47.714  3.719   1.00 57.45  ? 38   THR F C     1 
ATOM   7488 O  O     . THR F  1 39  ? 69.900  48.507  4.659   1.00 55.05  ? 38   THR F O     1 
ATOM   7489 C  CB    . THR F  1 39  ? 69.102  49.327  1.932   1.00 57.00  ? 38   THR F CB    1 
ATOM   7490 O  OG1   . THR F  1 39  ? 68.311  49.446  0.740   1.00 63.02  ? 38   THR F OG1   1 
ATOM   7491 C  CG2   . THR F  1 39  ? 70.565  49.678  1.601   1.00 59.89  ? 38   THR F CG2   1 
ATOM   7492 N  N     . HIS F  1 40  ? 70.731  46.662  3.662   1.00 58.99  ? 39   HIS F N     1 
ATOM   7493 C  CA    . HIS F  1 40  ? 71.642  46.266  4.729   1.00 56.02  ? 39   HIS F CA    1 
ATOM   7494 C  C     . HIS F  1 40  ? 72.977  47.018  4.638   1.00 57.91  ? 39   HIS F C     1 
ATOM   7495 O  O     . HIS F  1 40  ? 73.739  46.836  3.695   1.00 55.41  ? 39   HIS F O     1 
ATOM   7496 C  CB    . HIS F  1 40  ? 71.874  44.758  4.639   1.00 54.32  ? 39   HIS F CB    1 
ATOM   7497 C  CG    . HIS F  1 40  ? 72.712  44.207  5.744   1.00 59.45  ? 39   HIS F CG    1 
ATOM   7498 N  ND1   . HIS F  1 40  ? 73.312  42.975  5.667   1.00 63.14  ? 39   HIS F ND1   1 
ATOM   7499 C  CD2   . HIS F  1 40  ? 73.051  44.719  6.950   1.00 70.24  ? 39   HIS F CD2   1 
ATOM   7500 C  CE1   . HIS F  1 40  ? 73.999  42.756  6.771   1.00 66.77  ? 39   HIS F CE1   1 
ATOM   7501 N  NE2   . HIS F  1 40  ? 73.859  43.800  7.566   1.00 66.11  ? 39   HIS F NE2   1 
ATOM   7502 N  N     . LEU F  1 41  ? 73.255  47.854  5.638   1.00 58.72  ? 40   LEU F N     1 
ATOM   7503 C  CA    . LEU F  1 41  ? 74.495  48.608  5.681   1.00 56.32  ? 40   LEU F CA    1 
ATOM   7504 C  C     . LEU F  1 41  ? 75.338  48.252  6.886   1.00 55.91  ? 40   LEU F C     1 
ATOM   7505 O  O     . LEU F  1 41  ? 74.819  48.038  7.977   1.00 55.95  ? 40   LEU F O     1 
ATOM   7506 C  CB    . LEU F  1 41  ? 74.209  50.114  5.698   1.00 56.97  ? 40   LEU F CB    1 
ATOM   7507 C  CG    . LEU F  1 41  ? 73.421  50.653  4.506   1.00 52.62  ? 40   LEU F CG    1 
ATOM   7508 C  CD1   . LEU F  1 41  ? 73.022  52.114  4.758   1.00 53.58  ? 40   LEU F CD1   1 
ATOM   7509 C  CD2   . LEU F  1 41  ? 74.196  50.495  3.192   1.00 56.67  ? 40   LEU F CD2   1 
ATOM   7510 N  N     . SER F  1 42  ? 76.648  48.205  6.667   1.00 56.84  ? 41   SER F N     1 
ATOM   7511 C  CA    . SER F  1 42  ? 77.645  48.097  7.736   1.00 58.30  ? 41   SER F CA    1 
ATOM   7512 C  C     . SER F  1 42  ? 78.861  48.975  7.417   1.00 55.04  ? 41   SER F C     1 
ATOM   7513 O  O     . SER F  1 42  ? 79.197  49.191  6.263   1.00 54.28  ? 41   SER F O     1 
ATOM   7514 C  CB    . SER F  1 42  ? 78.060  46.617  7.984   1.00 59.34  ? 41   SER F CB    1 
ATOM   7515 O  OG    . SER F  1 42  ? 78.909  46.095  6.977   1.00 59.44  ? 41   SER F OG    1 
ATOM   7516 N  N     . THR F  1 43  ? 79.529  49.469  8.445   1.00 54.00  ? 42   THR F N     1 
ATOM   7517 C  CA    . THR F  1 43  ? 80.737  50.265  8.227   1.00 59.94  ? 42   THR F CA    1 
ATOM   7518 C  C     . THR F  1 43  ? 81.823  49.479  7.493   1.00 54.74  ? 42   THR F C     1 
ATOM   7519 O  O     . THR F  1 43  ? 82.561  50.045  6.715   1.00 58.84  ? 42   THR F O     1 
ATOM   7520 C  CB    . THR F  1 43  ? 81.310  50.891  9.552   1.00 59.34  ? 42   THR F CB    1 
ATOM   7521 O  OG1   . THR F  1 43  ? 81.612  49.871  10.487  1.00 62.71  ? 42   THR F OG1   1 
ATOM   7522 C  CG2   . THR F  1 43  ? 80.315  51.841  10.170  1.00 65.66  ? 42   THR F CG2   1 
ATOM   7523 N  N     . GLY F  1 44  ? 81.903  48.176  7.728   1.00 54.12  ? 43   GLY F N     1 
ATOM   7524 C  CA    . GLY F  1 44  ? 82.974  47.377  7.164   1.00 54.52  ? 43   GLY F CA    1 
ATOM   7525 C  C     . GLY F  1 44  ? 82.823  47.285  5.675   1.00 56.11  ? 43   GLY F C     1 
ATOM   7526 O  O     . GLY F  1 44  ? 83.772  47.426  4.930   1.00 56.34  ? 43   GLY F O     1 
ATOM   7527 N  N     . GLU F  1 45  ? 81.593  47.072  5.250   1.00 55.72  ? 44   GLU F N     1 
ATOM   7528 C  CA    . GLU F  1 45  ? 81.289  46.991  3.851   1.00 55.18  ? 44   GLU F CA    1 
ATOM   7529 C  C     . GLU F  1 45  ? 81.410  48.361  3.150   1.00 53.92  ? 44   GLU F C     1 
ATOM   7530 O  O     . GLU F  1 45  ? 81.821  48.450  2.003   1.00 53.76  ? 44   GLU F O     1 
ATOM   7531 C  CB    . GLU F  1 45  ? 79.887  46.356  3.704   1.00 55.57  ? 44   GLU F CB    1 
ATOM   7532 C  CG    . GLU F  1 45  ? 79.386  46.262  2.273   1.00 66.43  ? 44   GLU F CG    1 
ATOM   7533 C  CD    . GLU F  1 45  ? 80.306  45.456  1.366   1.00 80.86  ? 44   GLU F CD    1 
ATOM   7534 O  OE1   . GLU F  1 45  ? 80.969  44.506  1.850   1.00 77.57  ? 44   GLU F OE1   1 
ATOM   7535 O  OE2   . GLU F  1 45  ? 80.356  45.782  0.162   1.00 80.81  ? 44   GLU F OE2   1 
ATOM   7536 N  N     . LEU F  1 46  ? 81.025  49.426  3.838   1.00 55.90  ? 45   LEU F N     1 
ATOM   7537 C  CA    . LEU F  1 46  ? 81.158  50.772  3.302   1.00 56.72  ? 45   LEU F CA    1 
ATOM   7538 C  C     . LEU F  1 46  ? 82.625  51.149  3.164   1.00 56.49  ? 45   LEU F C     1 
ATOM   7539 O  O     . LEU F  1 46  ? 83.005  51.793  2.184   1.00 55.56  ? 45   LEU F O     1 
ATOM   7540 C  CB    . LEU F  1 46  ? 80.475  51.802  4.207   1.00 55.20  ? 45   LEU F CB    1 
ATOM   7541 C  CG    . LEU F  1 46  ? 78.941  51.727  4.323   1.00 56.35  ? 45   LEU F CG    1 
ATOM   7542 C  CD1   . LEU F  1 46  ? 78.515  52.563  5.516   1.00 60.83  ? 45   LEU F CD1   1 
ATOM   7543 C  CD2   . LEU F  1 46  ? 78.268  52.166  3.098   1.00 61.62  ? 45   LEU F CD2   1 
ATOM   7544 N  N     . LEU F  1 47  ? 83.439  50.777  4.148   1.00 54.11  ? 46   LEU F N     1 
ATOM   7545 C  CA    . LEU F  1 47  ? 84.890  50.996  4.021   1.00 57.27  ? 46   LEU F CA    1 
ATOM   7546 C  C     . LEU F  1 47  ? 85.482  50.187  2.874   1.00 56.01  ? 46   LEU F C     1 
ATOM   7547 O  O     . LEU F  1 47  ? 86.259  50.705  2.100   1.00 58.86  ? 46   LEU F O     1 
ATOM   7548 C  CB    . LEU F  1 47  ? 85.628  50.721  5.317   1.00 54.12  ? 46   LEU F CB    1 
ATOM   7549 C  CG    . LEU F  1 47  ? 85.449  51.805  6.382   1.00 56.91  ? 46   LEU F CG    1 
ATOM   7550 C  CD1   . LEU F  1 47  ? 85.951  51.320  7.730   1.00 60.86  ? 46   LEU F CD1   1 
ATOM   7551 C  CD2   . LEU F  1 47  ? 86.138  53.097  5.964   1.00 57.57  ? 46   LEU F CD2   1 
ATOM   7552 N  N     . ARG F  1 48  ? 85.068  48.940  2.738   1.00 57.17  ? 47   ARG F N     1 
ATOM   7553 C  CA    . ARG F  1 48  ? 85.588  48.064  1.697   1.00 56.84  ? 47   ARG F CA    1 
ATOM   7554 C  C     . ARG F  1 48  ? 85.266  48.630  0.313   1.00 57.49  ? 47   ARG F C     1 
ATOM   7555 O  O     . ARG F  1 48  ? 86.085  48.625  -0.608  1.00 61.11  ? 47   ARG F O     1 
ATOM   7556 C  CB    . ARG F  1 48  ? 84.972  46.667  1.858   1.00 59.76  ? 47   ARG F CB    1 
ATOM   7557 C  CG    . ARG F  1 48  ? 85.564  45.593  0.971   1.00 63.35  ? 47   ARG F CG    1 
ATOM   7558 C  CD    . ARG F  1 48  ? 84.530  44.539  0.536   1.00 81.01  ? 47   ARG F CD    1 
ATOM   7559 N  NE    . ARG F  1 48  ? 83.437  45.108  -0.264  1.00 95.41  ? 47   ARG F NE    1 
ATOM   7560 C  CZ    . ARG F  1 48  ? 83.552  45.588  -1.510  1.00 87.48  ? 47   ARG F CZ    1 
ATOM   7561 N  NH1   . ARG F  1 48  ? 82.482  46.089  -2.114  1.00 69.91  ? 47   ARG F NH1   1 
ATOM   7562 N  NH2   . ARG F  1 48  ? 84.713  45.579  -2.168  1.00 85.15  ? 47   ARG F NH2   1 
ATOM   7563 N  N     . GLU F  1 49  ? 84.056  49.126  0.171   1.00 58.29  ? 48   GLU F N     1 
ATOM   7564 C  CA    . GLU F  1 49  ? 83.592  49.609  -1.103  1.00 60.33  ? 48   GLU F CA    1 
ATOM   7565 C  C     . GLU F  1 49  ? 84.334  50.911  -1.440  1.00 58.88  ? 48   GLU F C     1 
ATOM   7566 O  O     . GLU F  1 49  ? 84.776  51.115  -2.562  1.00 55.25  ? 48   GLU F O     1 
ATOM   7567 C  CB    . GLU F  1 49  ? 82.080  49.805  -1.019  1.00 61.11  ? 48   GLU F CB    1 
ATOM   7568 C  CG    . GLU F  1 49  ? 81.402  50.039  -2.329  1.00 78.90  ? 48   GLU F CG    1 
ATOM   7569 C  CD    . GLU F  1 49  ? 80.003  50.642  -2.171  1.00 100.87 ? 48   GLU F CD    1 
ATOM   7570 O  OE1   . GLU F  1 49  ? 79.592  50.960  -1.019  1.00 91.73  ? 48   GLU F OE1   1 
ATOM   7571 O  OE2   . GLU F  1 49  ? 79.324  50.805  -3.216  1.00 101.75 ? 48   GLU F OE2   1 
ATOM   7572 N  N     . GLU F  1 50  ? 84.503  51.777  -0.454  1.00 59.56  ? 49   GLU F N     1 
ATOM   7573 C  CA    . GLU F  1 50  ? 85.256  53.006  -0.659  1.00 58.84  ? 49   GLU F CA    1 
ATOM   7574 C  C     . GLU F  1 50  ? 86.719  52.721  -1.047  1.00 59.19  ? 49   GLU F C     1 
ATOM   7575 O  O     . GLU F  1 50  ? 87.286  53.331  -1.985  1.00 54.71  ? 49   GLU F O     1 
ATOM   7576 C  CB    . GLU F  1 50  ? 85.186  53.851  0.607   1.00 59.06  ? 49   GLU F CB    1 
ATOM   7577 C  CG    . GLU F  1 50  ? 86.055  55.102  0.606   1.00 63.96  ? 49   GLU F CG    1 
ATOM   7578 C  CD    . GLU F  1 50  ? 85.648  56.157  -0.411  1.00 71.27  ? 49   GLU F CD    1 
ATOM   7579 O  OE1   . GLU F  1 50  ? 84.605  56.043  -1.119  1.00 71.82  ? 49   GLU F OE1   1 
ATOM   7580 O  OE2   . GLU F  1 50  ? 86.402  57.141  -0.484  1.00 77.48  ? 49   GLU F OE2   1 
ATOM   7581 N  N     . LEU F  1 51  ? 87.317  51.772  -0.339  1.00 57.95  ? 50   LEU F N     1 
ATOM   7582 C  CA    . LEU F  1 51  ? 88.717  51.409  -0.578  1.00 58.94  ? 50   LEU F CA    1 
ATOM   7583 C  C     . LEU F  1 51  ? 88.927  50.851  -1.940  1.00 56.83  ? 50   LEU F C     1 
ATOM   7584 O  O     . LEU F  1 51  ? 90.020  50.930  -2.457  1.00 65.47  ? 50   LEU F O     1 
ATOM   7585 C  CB    . LEU F  1 51  ? 89.247  50.424  0.473   1.00 55.36  ? 50   LEU F CB    1 
ATOM   7586 C  CG    . LEU F  1 51  ? 89.579  51.084  1.821   1.00 62.87  ? 50   LEU F CG    1 
ATOM   7587 C  CD1   . LEU F  1 51  ? 89.919  50.026  2.860   1.00 62.22  ? 50   LEU F CD1   1 
ATOM   7588 C  CD2   . LEU F  1 51  ? 90.734  52.081  1.665   1.00 65.84  ? 50   LEU F CD2   1 
ATOM   7589 N  N     . ALA F  1 52  ? 87.885  50.296  -2.537  1.00 55.15  ? 51   ALA F N     1 
ATOM   7590 C  CA    . ALA F  1 52  ? 87.975  49.802  -3.882  1.00 55.74  ? 51   ALA F CA    1 
ATOM   7591 C  C     . ALA F  1 52  ? 87.665  50.843  -4.943  1.00 57.61  ? 51   ALA F C     1 
ATOM   7592 O  O     . ALA F  1 52  ? 87.782  50.510  -6.108  1.00 57.84  ? 51   ALA F O     1 
ATOM   7593 C  CB    . ALA F  1 52  ? 87.064  48.605  -4.063  1.00 58.36  ? 51   ALA F CB    1 
ATOM   7594 N  N     . SER F  1 53  ? 87.331  52.083  -4.573  1.00 58.31  ? 52   SER F N     1 
ATOM   7595 C  CA    . SER F  1 53  ? 86.904  53.114  -5.566  1.00 58.51  ? 52   SER F CA    1 
ATOM   7596 C  C     . SER F  1 53  ? 88.023  53.916  -6.234  1.00 61.60  ? 52   SER F C     1 
ATOM   7597 O  O     . SER F  1 53  ? 87.766  54.624  -7.214  1.00 65.59  ? 52   SER F O     1 
ATOM   7598 C  CB    . SER F  1 53  ? 85.968  54.144  -4.916  1.00 59.58  ? 52   SER F CB    1 
ATOM   7599 O  OG    . SER F  1 53  ? 86.705  55.005  -4.062  1.00 56.21  ? 52   SER F OG    1 
ATOM   7600 N  N     . GLU F  1 54  ? 89.237  53.846  -5.693  1.00 61.45  ? 53   GLU F N     1 
ATOM   7601 C  CA    . GLU F  1 54  ? 90.368  54.664  -6.167  1.00 62.88  ? 53   GLU F CA    1 
ATOM   7602 C  C     . GLU F  1 54  ? 90.210  56.200  -6.014  1.00 56.61  ? 53   GLU F C     1 
ATOM   7603 O  O     . GLU F  1 54  ? 91.020  56.957  -6.555  1.00 54.95  ? 53   GLU F O     1 
ATOM   7604 C  CB    . GLU F  1 54  ? 90.696  54.381  -7.626  1.00 64.35  ? 53   GLU F CB    1 
ATOM   7605 C  CG    . GLU F  1 54  ? 90.561  52.960  -8.151  1.00 77.58  ? 53   GLU F CG    1 
ATOM   7606 C  CD    . GLU F  1 54  ? 90.999  52.898  -9.611  1.00 70.28  ? 53   GLU F CD    1 
ATOM   7607 O  OE1   . GLU F  1 54  ? 92.213  53.069  -9.858  1.00 93.32  ? 53   GLU F OE1   1 
ATOM   7608 O  OE2   . GLU F  1 54  ? 90.139  52.721  -10.506 1.00 93.07  ? 53   GLU F OE2   1 
ATOM   7609 N  N     . SER F  1 55  ? 89.183  56.653  -5.302  1.00 53.62  ? 54   SER F N     1 
ATOM   7610 C  CA    . SER F  1 55  ? 88.997  58.069  -5.019  1.00 53.61  ? 54   SER F CA    1 
ATOM   7611 C  C     . SER F  1 55  ? 90.167  58.642  -4.184  1.00 52.36  ? 54   SER F C     1 
ATOM   7612 O  O     . SER F  1 55  ? 90.841  57.903  -3.470  1.00 51.44  ? 54   SER F O     1 
ATOM   7613 C  CB    . SER F  1 55  ? 87.663  58.274  -4.286  1.00 52.51  ? 54   SER F CB    1 
ATOM   7614 O  OG    . SER F  1 55  ? 87.700  57.744  -2.973  1.00 48.88  ? 54   SER F OG    1 
ATOM   7615 N  N     . GLU F  1 56  ? 90.425  59.948  -4.260  1.00 49.53  ? 55   GLU F N     1 
ATOM   7616 C  CA    . GLU F  1 56  ? 91.435  60.513  -3.356  1.00 52.95  ? 55   GLU F CA    1 
ATOM   7617 C  C     . GLU F  1 56  ? 91.062  60.280  -1.894  1.00 49.56  ? 55   GLU F C     1 
ATOM   7618 O  O     . GLU F  1 56  ? 91.939  60.144  -1.050  1.00 53.32  ? 55   GLU F O     1 
ATOM   7619 C  CB    . GLU F  1 56  ? 91.676  62.021  -3.551  1.00 49.04  ? 55   GLU F CB    1 
ATOM   7620 C  CG    . GLU F  1 56  ? 92.641  62.418  -4.615  1.00 67.97  ? 55   GLU F CG    1 
ATOM   7621 C  CD    . GLU F  1 56  ? 93.857  61.536  -4.767  1.00 59.87  ? 55   GLU F CD    1 
ATOM   7622 O  OE1   . GLU F  1 56  ? 94.807  61.654  -3.971  1.00 52.96  ? 55   GLU F OE1   1 
ATOM   7623 O  OE2   . GLU F  1 56  ? 93.866  60.758  -5.741  1.00 67.60  ? 55   GLU F OE2   1 
ATOM   7624 N  N     . ARG F  1 57  ? 89.759  60.295  -1.594  1.00 54.68  ? 56   ARG F N     1 
ATOM   7625 C  CA    . ARG F  1 57  ? 89.297  60.045  -0.237  1.00 52.87  ? 56   ARG F CA    1 
ATOM   7626 C  C     . ARG F  1 57  ? 89.655  58.635  0.212   1.00 50.42  ? 56   ARG F C     1 
ATOM   7627 O  O     . ARG F  1 57  ? 90.025  58.424  1.358   1.00 53.21  ? 56   ARG F O     1 
ATOM   7628 C  CB    . ARG F  1 57  ? 87.795  60.271  -0.112  1.00 49.49  ? 56   ARG F CB    1 
ATOM   7629 C  CG    . ARG F  1 57  ? 87.273  59.987  1.308   1.00 54.71  ? 56   ARG F CG    1 
ATOM   7630 C  CD    . ARG F  1 57  ? 85.808  60.329  1.471   1.00 55.08  ? 56   ARG F CD    1 
ATOM   7631 N  NE    . ARG F  1 57  ? 84.962  59.520  0.605   1.00 58.92  ? 56   ARG F NE    1 
ATOM   7632 C  CZ    . ARG F  1 57  ? 83.662  59.710  0.428   1.00 54.76  ? 56   ARG F CZ    1 
ATOM   7633 N  NH1   . ARG F  1 57  ? 83.023  60.673  1.071   1.00 57.77  ? 56   ARG F NH1   1 
ATOM   7634 N  NH2   . ARG F  1 57  ? 83.001  58.924  -0.405  1.00 54.13  ? 56   ARG F NH2   1 
ATOM   7635 N  N     . SER F  1 58  ? 89.525  57.672  -0.687  1.00 49.49  ? 57   SER F N     1 
ATOM   7636 C  CA    . SER F  1 58  ? 89.860  56.303  -0.358  1.00 51.81  ? 57   SER F CA    1 
ATOM   7637 C  C     . SER F  1 58  ? 91.364  56.190  -0.028  1.00 55.08  ? 57   SER F C     1 
ATOM   7638 O  O     . SER F  1 58  ? 91.775  55.349  0.768   1.00 51.06  ? 57   SER F O     1 
ATOM   7639 C  CB    . SER F  1 58  ? 89.478  55.354  -1.501  1.00 49.84  ? 57   SER F CB    1 
ATOM   7640 O  OG    . SER F  1 58  ? 90.426  55.378  -2.567  1.00 52.83  ? 57   SER F OG    1 
ATOM   7641 N  N     . LYS F  1 59  ? 92.173  57.055  -0.637  1.00 55.55  ? 58   LYS F N     1 
ATOM   7642 C  CA    . LYS F  1 59  ? 93.621  57.040  -0.414  1.00 51.90  ? 58   LYS F CA    1 
ATOM   7643 C  C     . LYS F  1 59  ? 93.969  57.651  0.926   1.00 51.88  ? 58   LYS F C     1 
ATOM   7644 O  O     . LYS F  1 59  ? 94.896  57.216  1.591   1.00 53.34  ? 58   LYS F O     1 
ATOM   7645 C  CB    . LYS F  1 59  ? 94.340  57.727  -1.582  1.00 56.89  ? 58   LYS F CB    1 
ATOM   7646 C  CG    . LYS F  1 59  ? 94.462  56.800  -2.779  1.00 46.31  ? 58   LYS F CG    1 
ATOM   7647 C  CD    . LYS F  1 59  ? 94.956  57.490  -3.984  1.00 66.08  ? 58   LYS F CD    1 
ATOM   7648 C  CE    . LYS F  1 59  ? 94.950  56.534  -5.171  1.00 54.62  ? 58   LYS F CE    1 
ATOM   7649 N  NZ    . LYS F  1 59  ? 95.077  57.213  -6.505  1.00 65.31  ? 58   LYS F NZ    1 
ATOM   7650 N  N     . LEU F  1 60  ? 93.199  58.643  1.332   1.00 53.00  ? 59   LEU F N     1 
ATOM   7651 C  CA    . LEU F  1 60  ? 93.295  59.186  2.680   1.00 55.91  ? 59   LEU F CA    1 
ATOM   7652 C  C     . LEU F  1 60  ? 92.965  58.123  3.722   1.00 54.21  ? 59   LEU F C     1 
ATOM   7653 O  O     . LEU F  1 60  ? 93.731  57.923  4.655   1.00 57.32  ? 59   LEU F O     1 
ATOM   7654 C  CB    . LEU F  1 60  ? 92.353  60.392  2.834   1.00 54.47  ? 59   LEU F CB    1 
ATOM   7655 C  CG    . LEU F  1 60  ? 92.199  60.960  4.236   1.00 56.33  ? 59   LEU F CG    1 
ATOM   7656 C  CD1   . LEU F  1 60  ? 93.530  61.517  4.753   1.00 58.91  ? 59   LEU F CD1   1 
ATOM   7657 C  CD2   . LEU F  1 60  ? 91.109  62.016  4.211   1.00 58.95  ? 59   LEU F CD2   1 
ATOM   7658 N  N     . ILE F  1 61  ? 91.823  57.460  3.556   1.00 54.45  ? 60   ILE F N     1 
ATOM   7659 C  CA    . ILE F  1 61  ? 91.385  56.398  4.481   1.00 55.58  ? 60   ILE F CA    1 
ATOM   7660 C  C     . ILE F  1 61  ? 92.433  55.283  4.520   1.00 56.95  ? 60   ILE F C     1 
ATOM   7661 O  O     . ILE F  1 61  ? 92.774  54.755  5.575   1.00 56.08  ? 60   ILE F O     1 
ATOM   7662 C  CB    . ILE F  1 61  ? 90.005  55.847  4.043   1.00 54.03  ? 60   ILE F CB    1 
ATOM   7663 C  CG1   . ILE F  1 61  ? 88.928  56.921  4.207   1.00 54.03  ? 60   ILE F CG1   1 
ATOM   7664 C  CG2   . ILE F  1 61  ? 89.620  54.561  4.808   1.00 60.37  ? 60   ILE F CG2   1 
ATOM   7665 C  CD1   . ILE F  1 61  ? 87.605  56.631  3.470   1.00 62.52  ? 60   ILE F CD1   1 
ATOM   7666 N  N     . ARG F  1 62  ? 92.950  54.935  3.345   1.00 58.98  ? 61   ARG F N     1 
ATOM   7667 C  CA    . ARG F  1 62  ? 93.978  53.911  3.224   1.00 54.91  ? 61   ARG F CA    1 
ATOM   7668 C  C     . ARG F  1 62  ? 95.299  54.276  3.939   1.00 57.77  ? 61   ARG F C     1 
ATOM   7669 O  O     . ARG F  1 62  ? 95.866  53.423  4.611   1.00 56.73  ? 61   ARG F O     1 
ATOM   7670 C  CB    . ARG F  1 62  ? 94.231  53.610  1.749   1.00 50.08  ? 61   ARG F CB    1 
ATOM   7671 C  CG    . ARG F  1 62  ? 95.233  52.467  1.515   1.00 55.23  ? 61   ARG F CG    1 
ATOM   7672 C  CD    . ARG F  1 62  ? 95.490  52.216  0.054   1.00 60.26  ? 61   ARG F CD    1 
ATOM   7673 N  NE    . ARG F  1 62  ? 94.254  51.934  -0.688  1.00 79.19  ? 61   ARG F NE    1 
ATOM   7674 C  CZ    . ARG F  1 62  ? 93.625  50.752  -0.700  1.00 76.33  ? 61   ARG F CZ    1 
ATOM   7675 N  NH1   . ARG F  1 62  ? 94.078  49.701  -0.004  1.00 73.14  ? 61   ARG F NH1   1 
ATOM   7676 N  NH2   . ARG F  1 62  ? 92.528  50.613  -1.423  1.00 62.67  ? 61   ARG F NH2   1 
ATOM   7677 N  N     . ASP F  1 63  ? 95.773  55.523  3.765   1.00 56.00  ? 62   ASP F N     1 
ATOM   7678 C  CA    . ASP F  1 63  ? 96.962  56.045  4.453   1.00 59.19  ? 62   ASP F CA    1 
ATOM   7679 C  C     . ASP F  1 63  ? 96.800  55.829  5.951   1.00 57.53  ? 62   ASP F C     1 
ATOM   7680 O  O     . ASP F  1 63  ? 97.732  55.423  6.643   1.00 60.57  ? 62   ASP F O     1 
ATOM   7681 C  CB    . ASP F  1 63  ? 97.145  57.583  4.264   1.00 58.62  ? 62   ASP F CB    1 
ATOM   7682 C  CG    . ASP F  1 63  ? 97.610  58.005  2.850   1.00 68.60  ? 62   ASP F CG    1 
ATOM   7683 O  OD1   . ASP F  1 63  ? 98.114  57.159  2.074   1.00 78.40  ? 62   ASP F OD1   1 
ATOM   7684 O  OD2   . ASP F  1 63  ? 97.476  59.224  2.528   1.00 58.47  ? 62   ASP F OD2   1 
ATOM   7685 N  N     . ILE F  1 64  ? 95.620  56.182  6.446   1.00 56.15  ? 63   ILE F N     1 
ATOM   7686 C  CA    . ILE F  1 64  ? 95.303  56.097  7.867   1.00 59.46  ? 63   ILE F CA    1 
ATOM   7687 C  C     . ILE F  1 64  ? 95.297  54.635  8.339   1.00 59.36  ? 63   ILE F C     1 
ATOM   7688 O  O     . ILE F  1 64  ? 95.895  54.304  9.345   1.00 58.82  ? 63   ILE F O     1 
ATOM   7689 C  CB    . ILE F  1 64  ? 93.938  56.777  8.182   1.00 56.39  ? 63   ILE F CB    1 
ATOM   7690 C  CG1   . ILE F  1 64  ? 94.032  58.286  7.918   1.00 58.53  ? 63   ILE F CG1   1 
ATOM   7691 C  CG2   . ILE F  1 64  ? 93.520  56.512  9.643   1.00 55.65  ? 63   ILE F CG2   1 
ATOM   7692 C  CD1   . ILE F  1 64  ? 92.683  59.034  7.976   1.00 56.50  ? 63   ILE F CD1   1 
ATOM   7693 N  N     . MET F  1 65  ? 94.636  53.772  7.581   1.00 60.49  ? 64   MET F N     1 
ATOM   7694 C  CA    . MET F  1 65  ? 94.459  52.381  7.985   1.00 62.83  ? 64   MET F CA    1 
ATOM   7695 C  C     . MET F  1 65  ? 95.728  51.571  7.827   1.00 61.10  ? 64   MET F C     1 
ATOM   7696 O  O     . MET F  1 65  ? 95.927  50.590  8.537   1.00 61.97  ? 64   MET F O     1 
ATOM   7697 C  CB    . MET F  1 65  ? 93.328  51.744  7.194   1.00 59.16  ? 64   MET F CB    1 
ATOM   7698 C  CG    . MET F  1 65  ? 91.974  52.361  7.529   1.00 64.27  ? 64   MET F CG    1 
ATOM   7699 S  SD    . MET F  1 65  ? 90.682  51.459  6.696   1.00 70.45  ? 64   MET F SD    1 
ATOM   7700 C  CE    . MET F  1 65  ? 90.555  50.078  7.828   1.00 76.32  ? 64   MET F CE    1 
ATOM   7701 N  N     . GLU F  1 66  ? 96.588  51.994  6.906   1.00 58.71  ? 65   GLU F N     1 
ATOM   7702 C  CA    . GLU F  1 66  ? 97.899  51.386  6.746   1.00 63.03  ? 65   GLU F CA    1 
ATOM   7703 C  C     . GLU F  1 66  ? 98.807  51.618  7.950   1.00 62.81  ? 65   GLU F C     1 
ATOM   7704 O  O     . GLU F  1 66  ? 99.806  50.918  8.114   1.00 62.18  ? 65   GLU F O     1 
ATOM   7705 C  CB    . GLU F  1 66  ? 98.580  51.889  5.460   1.00 61.82  ? 65   GLU F CB    1 
ATOM   7706 C  CG    . GLU F  1 66  ? 98.071  51.124  4.213   1.00 73.16  ? 65   GLU F CG    1 
ATOM   7707 C  CD    . GLU F  1 66  ? 98.603  51.658  2.861   1.00 83.37  ? 65   GLU F CD    1 
ATOM   7708 O  OE1   . GLU F  1 66  ? 98.497  50.895  1.867   1.00 92.25  ? 65   GLU F OE1   1 
ATOM   7709 O  OE2   . GLU F  1 66  ? 99.108  52.815  2.785   1.00 92.39  ? 65   GLU F OE2   1 
ATOM   7710 N  N     . ARG F  1 67  ? 98.478  52.621  8.762   1.00 62.02  ? 66   ARG F N     1 
ATOM   7711 C  CA    . ARG F  1 67  ? 99.187  52.881  10.020  1.00 59.98  ? 66   ARG F CA    1 
ATOM   7712 C  C     . ARG F  1 67  ? 98.543  52.149  11.189  1.00 54.63  ? 66   ARG F C     1 
ATOM   7713 O  O     . ARG F  1 67  ? 99.087  52.145  12.254  1.00 59.11  ? 66   ARG F O     1 
ATOM   7714 C  CB    . ARG F  1 67  ? 99.217  54.389  10.322  1.00 56.66  ? 66   ARG F CB    1 
ATOM   7715 C  CG    . ARG F  1 67  ? 99.982  55.207  9.281   1.00 67.44  ? 66   ARG F CG    1 
ATOM   7716 C  CD    . ARG F  1 67  ? 100.155 56.669  9.670   1.00 66.20  ? 66   ARG F CD    1 
ATOM   7717 N  NE    . ARG F  1 67  ? 99.002  57.512  9.333   1.00 73.26  ? 66   ARG F NE    1 
ATOM   7718 C  CZ    . ARG F  1 67  ? 98.912  58.326  8.271   1.00 83.66  ? 66   ARG F CZ    1 
ATOM   7719 N  NH1   . ARG F  1 67  ? 99.892  58.429  7.380   1.00 71.66  ? 66   ARG F NH1   1 
ATOM   7720 N  NH2   . ARG F  1 67  ? 97.811  59.050  8.086   1.00 74.69  ? 66   ARG F NH2   1 
ATOM   7721 N  N     . GLY F  1 68  ? 97.382  51.550  10.986  1.00 54.09  ? 67   GLY F N     1 
ATOM   7722 C  CA    . GLY F  1 68  ? 96.570  51.067  12.085  1.00 55.80  ? 67   GLY F CA    1 
ATOM   7723 C  C     . GLY F  1 68  ? 95.885  52.206  12.827  1.00 61.74  ? 67   GLY F C     1 
ATOM   7724 O  O     . GLY F  1 68  ? 95.396  52.009  13.934  1.00 61.61  ? 67   GLY F O     1 
ATOM   7725 N  N     . ASP F  1 69  ? 95.824  53.399  12.223  1.00 62.68  ? 68   ASP F N     1 
ATOM   7726 C  CA    . ASP F  1 69  ? 95.226  54.562  12.908  1.00 60.56  ? 68   ASP F CA    1 
ATOM   7727 C  C     . ASP F  1 69  ? 93.704  54.637  12.769  1.00 59.00  ? 68   ASP F C     1 
ATOM   7728 O  O     . ASP F  1 69  ? 93.086  53.940  11.964  1.00 61.85  ? 68   ASP F O     1 
ATOM   7729 C  CB    . ASP F  1 69  ? 95.860  55.893  12.452  1.00 60.70  ? 68   ASP F CB    1 
ATOM   7730 C  CG    . ASP F  1 69  ? 97.211  56.145  13.081  1.00 70.96  ? 68   ASP F CG    1 
ATOM   7731 O  OD1   . ASP F  1 69  ? 97.450  55.717  14.238  1.00 76.37  ? 68   ASP F OD1   1 
ATOM   7732 O  OD2   . ASP F  1 69  ? 98.046  56.777  12.405  1.00 76.68  ? 68   ASP F OD2   1 
ATOM   7733 N  N     . LEU F  1 70  ? 93.130  55.489  13.601  1.00 58.10  ? 69   LEU F N     1 
ATOM   7734 C  CA    . LEU F  1 70  ? 91.706  55.771  13.645  1.00 63.41  ? 69   LEU F CA    1 
ATOM   7735 C  C     . LEU F  1 70  ? 91.278  56.612  12.448  1.00 62.65  ? 69   LEU F C     1 
ATOM   7736 O  O     . LEU F  1 70  ? 91.821  57.714  12.204  1.00 58.22  ? 69   LEU F O     1 
ATOM   7737 C  CB    . LEU F  1 70  ? 91.395  56.541  14.939  1.00 61.96  ? 69   LEU F CB    1 
ATOM   7738 C  CG    . LEU F  1 70  ? 89.953  56.962  15.160  1.00 74.24  ? 69   LEU F CG    1 
ATOM   7739 C  CD1   . LEU F  1 70  ? 89.052  55.726  15.243  1.00 59.41  ? 69   LEU F CD1   1 
ATOM   7740 C  CD2   . LEU F  1 70  ? 89.884  57.855  16.430  1.00 65.87  ? 69   LEU F CD2   1 
ATOM   7741 N  N     . VAL F  1 71  ? 90.314  56.069  11.713  1.00 60.60  ? 70   VAL F N     1 
ATOM   7742 C  CA    . VAL F  1 71  ? 89.619  56.780  10.652  1.00 63.74  ? 70   VAL F CA    1 
ATOM   7743 C  C     . VAL F  1 71  ? 88.549  57.621  11.322  1.00 63.25  ? 70   VAL F C     1 
ATOM   7744 O  O     . VAL F  1 71  ? 87.663  57.079  11.995  1.00 61.61  ? 70   VAL F O     1 
ATOM   7745 C  CB    . VAL F  1 71  ? 88.936  55.821  9.644   1.00 59.76  ? 70   VAL F CB    1 
ATOM   7746 C  CG1   . VAL F  1 71  ? 88.177  56.611  8.591   1.00 60.01  ? 70   VAL F CG1   1 
ATOM   7747 C  CG2   . VAL F  1 71  ? 89.990  54.924  8.977   1.00 59.58  ? 70   VAL F CG2   1 
ATOM   7748 N  N     . PRO F  1 72  ? 88.623  58.941  11.141  1.00 58.63  ? 71   PRO F N     1 
ATOM   7749 C  CA    . PRO F  1 72  ? 87.677  59.815  11.835  1.00 61.17  ? 71   PRO F CA    1 
ATOM   7750 C  C     . PRO F  1 72  ? 86.219  59.416  11.607  1.00 62.24  ? 71   PRO F C     1 
ATOM   7751 O  O     . PRO F  1 72  ? 85.822  59.026  10.503  1.00 61.45  ? 71   PRO F O     1 
ATOM   7752 C  CB    . PRO F  1 72  ? 87.964  61.195  11.267  1.00 61.14  ? 71   PRO F CB    1 
ATOM   7753 C  CG    . PRO F  1 72  ? 89.290  61.093  10.540  1.00 61.24  ? 71   PRO F CG    1 
ATOM   7754 C  CD    . PRO F  1 72  ? 89.595  59.666  10.303  1.00 60.78  ? 71   PRO F CD    1 
ATOM   7755 N  N     . SER F  1 73  ? 85.442  59.495  12.681  1.00 63.02  ? 72   SER F N     1 
ATOM   7756 C  CA    . SER F  1 73  ? 84.054  59.068  12.678  1.00 62.74  ? 72   SER F CA    1 
ATOM   7757 C  C     . SER F  1 73  ? 83.237  59.814  11.613  1.00 62.51  ? 72   SER F C     1 
ATOM   7758 O  O     . SER F  1 73  ? 82.308  59.253  11.022  1.00 61.34  ? 72   SER F O     1 
ATOM   7759 C  CB    . SER F  1 73  ? 83.479  59.326  14.068  1.00 62.54  ? 72   SER F CB    1 
ATOM   7760 O  OG    . SER F  1 73  ? 83.805  60.660  14.458  1.00 80.11  ? 72   SER F OG    1 
ATOM   7761 N  N     . GLY F  1 74  ? 83.594  61.080  11.374  1.00 60.28  ? 73   GLY F N     1 
ATOM   7762 C  CA    . GLY F  1 74  ? 82.955  61.889  10.346  1.00 56.47  ? 73   GLY F CA    1 
ATOM   7763 C  C     . GLY F  1 74  ? 83.063  61.311  8.951   1.00 57.56  ? 73   GLY F C     1 
ATOM   7764 O  O     . GLY F  1 74  ? 82.092  61.344  8.196   1.00 56.21  ? 73   GLY F O     1 
ATOM   7765 N  N     . ILE F  1 75  ? 84.230  60.753  8.615   1.00 57.02  ? 74   ILE F N     1 
ATOM   7766 C  CA    . ILE F  1 75  ? 84.418  60.120  7.300   1.00 57.78  ? 74   ILE F CA    1 
ATOM   7767 C  C     . ILE F  1 75  ? 83.476  58.914  7.184   1.00 55.95  ? 74   ILE F C     1 
ATOM   7768 O  O     . ILE F  1 75  ? 82.806  58.722  6.184   1.00 59.93  ? 74   ILE F O     1 
ATOM   7769 C  CB    . ILE F  1 75  ? 85.886  59.626  7.066   1.00 62.45  ? 74   ILE F CB    1 
ATOM   7770 C  CG1   . ILE F  1 75  ? 86.877  60.764  6.786   1.00 59.90  ? 74   ILE F CG1   1 
ATOM   7771 C  CG2   . ILE F  1 75  ? 85.947  58.688  5.857   1.00 65.30  ? 74   ILE F CG2   1 
ATOM   7772 C  CD1   . ILE F  1 75  ? 86.887  61.874  7.770   1.00 92.23  ? 74   ILE F CD1   1 
ATOM   7773 N  N     . VAL F  1 76  ? 83.457  58.077  8.214   1.00 60.60  ? 75   VAL F N     1 
ATOM   7774 C  CA    . VAL F  1 76  ? 82.590  56.895  8.222   1.00 62.44  ? 75   VAL F CA    1 
ATOM   7775 C  C     . VAL F  1 76  ? 81.124  57.300  8.090   1.00 60.09  ? 75   VAL F C     1 
ATOM   7776 O  O     . VAL F  1 76  ? 80.345  56.660  7.376   1.00 56.97  ? 75   VAL F O     1 
ATOM   7777 C  CB    . VAL F  1 76  ? 82.801  56.061  9.526   1.00 64.20  ? 75   VAL F CB    1 
ATOM   7778 C  CG1   . VAL F  1 76  ? 81.715  55.006  9.680   1.00 64.25  ? 75   VAL F CG1   1 
ATOM   7779 C  CG2   . VAL F  1 76  ? 84.170  55.401  9.491   1.00 72.06  ? 75   VAL F CG2   1 
ATOM   7780 N  N     . LEU F  1 77  ? 80.752  58.368  8.789   1.00 56.60  ? 76   LEU F N     1 
ATOM   7781 C  CA    . LEU F  1 77  ? 79.399  58.844  8.730   1.00 59.23  ? 76   LEU F CA    1 
ATOM   7782 C  C     . LEU F  1 77  ? 79.053  59.392  7.345   1.00 57.29  ? 76   LEU F C     1 
ATOM   7783 O  O     . LEU F  1 77  ? 77.935  59.215  6.911   1.00 60.25  ? 76   LEU F O     1 
ATOM   7784 C  CB    . LEU F  1 77  ? 79.128  59.866  9.836   1.00 58.83  ? 76   LEU F CB    1 
ATOM   7785 C  CG    . LEU F  1 77  ? 77.678  60.345  9.905   1.00 61.33  ? 76   LEU F CG    1 
ATOM   7786 C  CD1   . LEU F  1 77  ? 76.735  59.187  10.182  1.00 67.01  ? 76   LEU F CD1   1 
ATOM   7787 C  CD2   . LEU F  1 77  ? 77.518  61.414  10.965  1.00 67.71  ? 76   LEU F CD2   1 
ATOM   7788 N  N     . GLU F  1 78  ? 79.983  60.048  6.648   1.00 59.85  ? 77   GLU F N     1 
ATOM   7789 C  CA    . GLU F  1 78  ? 79.704  60.471  5.257   1.00 62.11  ? 77   GLU F CA    1 
ATOM   7790 C  C     . GLU F  1 78  ? 79.430  59.269  4.362   1.00 57.90  ? 77   GLU F C     1 
ATOM   7791 O  O     . GLU F  1 78  ? 78.511  59.309  3.565   1.00 58.48  ? 77   GLU F O     1 
ATOM   7792 C  CB    . GLU F  1 78  ? 80.823  61.310  4.624   1.00 63.87  ? 77   GLU F CB    1 
ATOM   7793 C  CG    . GLU F  1 78  ? 80.533  62.820  4.531   1.00 85.62  ? 77   GLU F CG    1 
ATOM   7794 C  CD    . GLU F  1 78  ? 79.161  63.189  3.899   1.00 95.80  ? 77   GLU F CD    1 
ATOM   7795 O  OE1   . GLU F  1 78  ? 78.969  63.067  2.659   1.00 97.04  ? 77   GLU F OE1   1 
ATOM   7796 O  OE2   . GLU F  1 78  ? 78.276  63.644  4.656   1.00 87.45  ? 77   GLU F OE2   1 
ATOM   7797 N  N     . LEU F  1 79  ? 80.215  58.207  4.498   1.00 54.03  ? 78   LEU F N     1 
ATOM   7798 C  CA    . LEU F  1 79  ? 80.001  57.017  3.673   1.00 55.72  ? 78   LEU F CA    1 
ATOM   7799 C  C     . LEU F  1 79  ? 78.611  56.423  3.876   1.00 56.31  ? 78   LEU F C     1 
ATOM   7800 O  O     . LEU F  1 79  ? 77.927  56.058  2.921   1.00 58.15  ? 78   LEU F O     1 
ATOM   7801 C  CB    . LEU F  1 79  ? 81.082  55.963  3.924   1.00 56.22  ? 78   LEU F CB    1 
ATOM   7802 C  CG    . LEU F  1 79  ? 82.508  56.405  3.582   1.00 56.67  ? 78   LEU F CG    1 
ATOM   7803 C  CD1   . LEU F  1 79  ? 83.532  55.341  4.025   1.00 59.24  ? 78   LEU F CD1   1 
ATOM   7804 C  CD2   . LEU F  1 79  ? 82.630  56.725  2.116   1.00 55.66  ? 78   LEU F CD2   1 
ATOM   7805 N  N     . LEU F  1 80  ? 78.183  56.377  5.127   1.00 57.00  ? 79   LEU F N     1 
ATOM   7806 C  CA    . LEU F  1 80  ? 76.865  55.885  5.489   1.00 58.32  ? 79   LEU F CA    1 
ATOM   7807 C  C     . LEU F  1 80  ? 75.741  56.729  4.897   1.00 56.88  ? 79   LEU F C     1 
ATOM   7808 O  O     . LEU F  1 80  ? 74.762  56.198  4.368   1.00 58.07  ? 79   LEU F O     1 
ATOM   7809 C  CB    . LEU F  1 80  ? 76.756  55.880  7.006   1.00 59.01  ? 79   LEU F CB    1 
ATOM   7810 C  CG    . LEU F  1 80  ? 75.619  55.133  7.675   1.00 71.48  ? 79   LEU F CG    1 
ATOM   7811 C  CD1   . LEU F  1 80  ? 75.528  53.719  7.162   1.00 73.17  ? 79   LEU F CD1   1 
ATOM   7812 C  CD2   . LEU F  1 80  ? 75.869  55.157  9.192   1.00 72.79  ? 79   LEU F CD2   1 
ATOM   7813 N  N     . LYS F  1 81  ? 75.888  58.042  5.002   1.00 52.91  ? 80   LYS F N     1 
ATOM   7814 C  CA    . LYS F  1 81  ? 74.962  58.974  4.415   1.00 53.70  ? 80   LYS F CA    1 
ATOM   7815 C  C     . LYS F  1 81  ? 74.859  58.794  2.898   1.00 58.81  ? 80   LYS F C     1 
ATOM   7816 O  O     . LYS F  1 81  ? 73.749  58.782  2.334   1.00 59.59  ? 80   LYS F O     1 
ATOM   7817 C  CB    . LYS F  1 81  ? 75.393  60.409  4.744   1.00 51.89  ? 80   LYS F CB    1 
ATOM   7818 C  CG    . LYS F  1 81  ? 74.353  61.422  4.380   1.00 54.72  ? 80   LYS F CG    1 
ATOM   7819 C  CD    . LYS F  1 81  ? 74.701  62.836  4.781   1.00 59.55  ? 80   LYS F CD    1 
ATOM   7820 C  CE    . LYS F  1 81  ? 73.494  63.747  4.540   1.00 62.89  ? 80   LYS F CE    1 
ATOM   7821 N  NZ    . LYS F  1 81  ? 73.909  65.150  4.214   1.00 59.77  ? 80   LYS F NZ    1 
ATOM   7822 N  N     . GLU F  1 82  ? 76.011  58.659  2.236   1.00 56.79  ? 81   GLU F N     1 
ATOM   7823 C  CA    . GLU F  1 82  ? 76.036  58.516  0.789   1.00 55.08  ? 81   GLU F CA    1 
ATOM   7824 C  C     . GLU F  1 82  ? 75.394  57.237  0.340   1.00 55.64  ? 81   GLU F C     1 
ATOM   7825 O  O     . GLU F  1 82  ? 74.690  57.216  -0.669  1.00 59.10  ? 81   GLU F O     1 
ATOM   7826 C  CB    . GLU F  1 82  ? 77.457  58.560  0.275   1.00 56.42  ? 81   GLU F CB    1 
ATOM   7827 C  CG    . GLU F  1 82  ? 78.060  59.955  0.338   1.00 64.19  ? 81   GLU F CG    1 
ATOM   7828 C  CD    . GLU F  1 82  ? 79.553  59.962  0.078   1.00 71.70  ? 81   GLU F CD    1 
ATOM   7829 O  OE1   . GLU F  1 82  ? 80.133  58.889  -0.192  1.00 67.87  ? 81   GLU F OE1   1 
ATOM   7830 O  OE2   . GLU F  1 82  ? 80.141  61.051  0.151   1.00 66.65  ? 81   GLU F OE2   1 
ATOM   7831 N  N     . ALA F  1 83  ? 75.627  56.171  1.093   1.00 58.03  ? 82   ALA F N     1 
ATOM   7832 C  CA    . ALA F  1 83  ? 75.026  54.865  0.798   1.00 59.61  ? 82   ALA F CA    1 
ATOM   7833 C  C     . ALA F  1 83  ? 73.503  54.943  0.926   1.00 60.28  ? 82   ALA F C     1 
ATOM   7834 O  O     . ALA F  1 83  ? 72.745  54.392  0.101   1.00 58.18  ? 82   ALA F O     1 
ATOM   7835 C  CB    . ALA F  1 83  ? 75.587  53.808  1.726   1.00 59.24  ? 82   ALA F CB    1 
ATOM   7836 N  N     . MET F  1 84  ? 73.072  55.665  1.955   1.00 58.67  ? 83   MET F N     1 
ATOM   7837 C  CA    . MET F  1 84  ? 71.657  55.868  2.213   1.00 56.59  ? 83   MET F CA    1 
ATOM   7838 C  C     . MET F  1 84  ? 71.007  56.817  1.216   1.00 57.75  ? 83   MET F C     1 
ATOM   7839 O  O     . MET F  1 84  ? 69.883  56.550  0.761   1.00 58.30  ? 83   MET F O     1 
ATOM   7840 C  CB    . MET F  1 84  ? 71.464  56.391  3.624   1.00 56.33  ? 83   MET F CB    1 
ATOM   7841 C  CG    . MET F  1 84  ? 71.829  55.366  4.660   1.00 56.86  ? 83   MET F CG    1 
ATOM   7842 S  SD    . MET F  1 84  ? 71.729  56.025  6.320   1.00 52.24  ? 83   MET F SD    1 
ATOM   7843 C  CE    . MET F  1 84  ? 69.930  56.011  6.567   1.00 51.32  ? 83   MET F CE    1 
ATOM   7844 N  N     . VAL F  1 85  ? 71.694  57.917  0.885   1.00 59.59  ? 84   VAL F N     1 
ATOM   7845 C  CA    . VAL F  1 85  ? 71.205  58.848  -0.142  1.00 58.13  ? 84   VAL F CA    1 
ATOM   7846 C  C     . VAL F  1 85  ? 71.059  58.130  -1.474  1.00 58.36  ? 84   VAL F C     1 
ATOM   7847 O  O     . VAL F  1 85  ? 70.090  58.338  -2.193  1.00 62.52  ? 84   VAL F O     1 
ATOM   7848 C  CB    . VAL F  1 85  ? 72.131  60.081  -0.346  1.00 57.68  ? 84   VAL F CB    1 
ATOM   7849 C  CG1   . VAL F  1 85  ? 71.721  60.873  -1.595  1.00 52.84  ? 84   VAL F CG1   1 
ATOM   7850 C  CG2   . VAL F  1 85  ? 72.093  60.994  0.863   1.00 55.46  ? 84   VAL F CG2   1 
ATOM   7851 N  N     . ALA F  1 86  ? 72.013  57.278  -1.797  1.00 59.04  ? 85   ALA F N     1 
ATOM   7852 C  CA    . ALA F  1 86  ? 72.018  56.599  -3.088  1.00 60.64  ? 85   ALA F CA    1 
ATOM   7853 C  C     . ALA F  1 86  ? 70.919  55.574  -3.191  1.00 61.25  ? 85   ALA F C     1 
ATOM   7854 O  O     . ALA F  1 86  ? 70.472  55.258  -4.280  1.00 61.78  ? 85   ALA F O     1 
ATOM   7855 C  CB    . ALA F  1 86  ? 73.357  55.924  -3.322  1.00 63.79  ? 85   ALA F CB    1 
ATOM   7856 N  N     . SER F  1 87  ? 70.500  55.045  -2.049  1.00 64.76  ? 86   SER F N     1 
ATOM   7857 C  CA    . SER F  1 87  ? 69.545  53.946  -2.008  1.00 64.49  ? 86   SER F CA    1 
ATOM   7858 C  C     . SER F  1 87  ? 68.135  54.440  -1.726  1.00 63.78  ? 86   SER F C     1 
ATOM   7859 O  O     . SER F  1 87  ? 67.195  53.647  -1.710  1.00 62.92  ? 86   SER F O     1 
ATOM   7860 C  CB    . SER F  1 87  ? 69.974  52.944  -0.936  1.00 62.32  ? 86   SER F CB    1 
ATOM   7861 O  OG    . SER F  1 87  ? 69.445  51.660  -1.211  1.00 78.25  ? 86   SER F OG    1 
ATOM   7862 N  N     . LEU F  1 88  ? 67.991  55.743  -1.486  1.00 67.05  ? 87   LEU F N     1 
ATOM   7863 C  CA    . LEU F  1 88  ? 66.670  56.358  -1.334  1.00 72.37  ? 87   LEU F CA    1 
ATOM   7864 C  C     . LEU F  1 88  ? 65.881  56.269  -2.640  1.00 74.00  ? 87   LEU F C     1 
ATOM   7865 O  O     . LEU F  1 88  ? 66.454  56.295  -3.736  1.00 74.15  ? 87   LEU F O     1 
ATOM   7866 C  CB    . LEU F  1 88  ? 66.777  57.832  -0.899  1.00 71.88  ? 87   LEU F CB    1 
ATOM   7867 C  CG    . LEU F  1 88  ? 66.641  58.158  0.590   1.00 72.42  ? 87   LEU F CG    1 
ATOM   7868 C  CD1   . LEU F  1 88  ? 66.415  59.653  0.754   1.00 64.71  ? 87   LEU F CD1   1 
ATOM   7869 C  CD2   . LEU F  1 88  ? 65.502  57.379  1.258   1.00 78.48  ? 87   LEU F CD2   1 
ATOM   7870 N  N     . GLY F  1 89  ? 64.563  56.177  -2.507  1.00 75.55  ? 88   GLY F N     1 
ATOM   7871 C  CA    . GLY F  1 89  ? 63.677  56.003  -3.655  1.00 76.40  ? 88   GLY F CA    1 
ATOM   7872 C  C     . GLY F  1 89  ? 63.332  54.535  -3.772  1.00 76.92  ? 88   GLY F C     1 
ATOM   7873 O  O     . GLY F  1 89  ? 62.183  54.143  -3.577  1.00 79.22  ? 88   GLY F O     1 
ATOM   7874 N  N     . ASP F  1 90  ? 64.345  53.721  -4.057  1.00 76.79  ? 89   ASP F N     1 
ATOM   7875 C  CA    . ASP F  1 90  ? 64.174  52.270  -4.161  1.00 78.21  ? 89   ASP F CA    1 
ATOM   7876 C  C     . ASP F  1 90  ? 64.323  51.504  -2.814  1.00 76.11  ? 89   ASP F C     1 
ATOM   7877 O  O     . ASP F  1 90  ? 64.443  50.276  -2.819  1.00 79.28  ? 89   ASP F O     1 
ATOM   7878 C  CB    . ASP F  1 90  ? 65.133  51.699  -5.237  1.00 79.75  ? 89   ASP F CB    1 
ATOM   7879 C  CG    . ASP F  1 90  ? 66.627  51.847  -4.865  1.00 94.48  ? 89   ASP F CG    1 
ATOM   7880 O  OD1   . ASP F  1 90  ? 67.069  51.338  -3.804  1.00 103.05 ? 89   ASP F OD1   1 
ATOM   7881 O  OD2   . ASP F  1 90  ? 67.372  52.464  -5.657  1.00 106.81 ? 89   ASP F OD2   1 
ATOM   7882 N  N     . THR F  1 91  ? 64.323  52.192  -1.669  1.00 71.28  ? 90   THR F N     1 
ATOM   7883 C  CA    . THR F  1 91  ? 64.505  51.476  -0.389  1.00 66.05  ? 90   THR F CA    1 
ATOM   7884 C  C     . THR F  1 91  ? 63.182  51.148  0.280   1.00 59.99  ? 90   THR F C     1 
ATOM   7885 O  O     . THR F  1 91  ? 62.205  51.884  0.161   1.00 57.03  ? 90   THR F O     1 
ATOM   7886 C  CB    . THR F  1 91  ? 65.435  52.218  0.647   1.00 64.88  ? 90   THR F CB    1 
ATOM   7887 O  OG1   . THR F  1 91  ? 65.939  51.274  1.599   1.00 58.18  ? 90   THR F OG1   1 
ATOM   7888 C  CG2   . THR F  1 91  ? 64.695  53.331  1.398   1.00 60.98  ? 90   THR F CG2   1 
ATOM   7889 N  N     . ARG F  1 92  ? 63.189  50.028  0.991   1.00 57.91  ? 91   ARG F N     1 
ATOM   7890 C  CA    . ARG F  1 92  ? 62.102  49.629  1.865   1.00 58.29  ? 91   ARG F CA    1 
ATOM   7891 C  C     . ARG F  1 92  ? 62.474  50.010  3.301   1.00 56.55  ? 91   ARG F C     1 
ATOM   7892 O  O     . ARG F  1 92  ? 61.671  49.891  4.208   1.00 59.82  ? 91   ARG F O     1 
ATOM   7893 C  CB    . ARG F  1 92  ? 61.865  48.113  1.774   1.00 61.94  ? 91   ARG F CB    1 
ATOM   7894 C  CG    . ARG F  1 92  ? 62.006  47.504  0.362   1.00 69.71  ? 91   ARG F CG    1 
ATOM   7895 C  CD    . ARG F  1 92  ? 60.706  47.427  -0.387  1.00 75.41  ? 91   ARG F CD    1 
ATOM   7896 N  NE    . ARG F  1 92  ? 59.869  46.337  0.114   1.00 86.46  ? 91   ARG F NE    1 
ATOM   7897 C  CZ    . ARG F  1 92  ? 58.626  46.465  0.584   1.00 99.48  ? 91   ARG F CZ    1 
ATOM   7898 N  NH1   . ARG F  1 92  ? 58.013  47.647  0.630   1.00 105.32 ? 91   ARG F NH1   1 
ATOM   7899 N  NH2   . ARG F  1 92  ? 57.976  45.387  1.010   1.00 98.94  ? 91   ARG F NH2   1 
ATOM   7900 N  N     . GLY F  1 93  ? 63.701  50.461  3.509   1.00 56.42  ? 92   GLY F N     1 
ATOM   7901 C  CA    . GLY F  1 93  ? 64.167  50.800  4.843   1.00 54.48  ? 92   GLY F CA    1 
ATOM   7902 C  C     . GLY F  1 93  ? 65.584  50.361  4.991   1.00 55.02  ? 92   GLY F C     1 
ATOM   7903 O  O     . GLY F  1 93  ? 66.074  49.565  4.196   1.00 55.96  ? 92   GLY F O     1 
ATOM   7904 N  N     . PHE F  1 94  ? 66.236  50.886  6.021   1.00 56.99  ? 93   PHE F N     1 
ATOM   7905 C  CA    . PHE F  1 94  ? 67.647  50.639  6.273   1.00 56.08  ? 93   PHE F CA    1 
ATOM   7906 C  C     . PHE F  1 94  ? 67.819  49.765  7.489   1.00 57.57  ? 93   PHE F C     1 
ATOM   7907 O  O     . PHE F  1 94  ? 67.212  49.998  8.525   1.00 58.08  ? 93   PHE F O     1 
ATOM   7908 C  CB    . PHE F  1 94  ? 68.385  51.962  6.439   1.00 54.14  ? 93   PHE F CB    1 
ATOM   7909 C  CG    . PHE F  1 94  ? 68.372  52.787  5.191   1.00 59.89  ? 93   PHE F CG    1 
ATOM   7910 C  CD1   . PHE F  1 94  ? 69.202  52.456  4.130   1.00 57.86  ? 93   PHE F CD1   1 
ATOM   7911 C  CD2   . PHE F  1 94  ? 67.484  53.844  5.047   1.00 53.74  ? 93   PHE F CD2   1 
ATOM   7912 C  CE1   . PHE F  1 94  ? 69.177  53.182  2.956   1.00 56.97  ? 93   PHE F CE1   1 
ATOM   7913 C  CE2   . PHE F  1 94  ? 67.443  54.580  3.858   1.00 56.10  ? 93   PHE F CE2   1 
ATOM   7914 C  CZ    . PHE F  1 94  ? 68.292  54.250  2.816   1.00 52.90  ? 93   PHE F CZ    1 
ATOM   7915 N  N     . LEU F  1 95  ? 68.618  48.723  7.311   1.00 58.01  ? 94   LEU F N     1 
ATOM   7916 C  CA    . LEU F  1 95  ? 69.020  47.822  8.375   1.00 57.10  ? 94   LEU F CA    1 
ATOM   7917 C  C     . LEU F  1 95  ? 70.500  48.101  8.585   1.00 56.77  ? 94   LEU F C     1 
ATOM   7918 O  O     . LEU F  1 95  ? 71.351  47.686  7.792   1.00 52.71  ? 94   LEU F O     1 
ATOM   7919 C  CB    . LEU F  1 95  ? 68.777  46.365  7.970   1.00 58.57  ? 94   LEU F CB    1 
ATOM   7920 C  CG    . LEU F  1 95  ? 69.149  45.293  8.993   1.00 55.77  ? 94   LEU F CG    1 
ATOM   7921 C  CD1   . LEU F  1 95  ? 68.348  45.476  10.273  1.00 58.74  ? 94   LEU F CD1   1 
ATOM   7922 C  CD2   . LEU F  1 95  ? 68.909  43.928  8.360   1.00 58.84  ? 94   LEU F CD2   1 
ATOM   7923 N  N     . ILE F  1 96  ? 70.792  48.866  9.625   1.00 58.17  ? 95   ILE F N     1 
ATOM   7924 C  CA    . ILE F  1 96  ? 72.152  49.275  9.907   1.00 58.67  ? 95   ILE F CA    1 
ATOM   7925 C  C     . ILE F  1 96  ? 72.728  48.388  11.012  1.00 56.61  ? 95   ILE F C     1 
ATOM   7926 O  O     . ILE F  1 96  ? 72.179  48.269  12.103  1.00 56.37  ? 95   ILE F O     1 
ATOM   7927 C  CB    . ILE F  1 96  ? 72.216  50.753  10.251  1.00 56.72  ? 95   ILE F CB    1 
ATOM   7928 C  CG1   . ILE F  1 96  ? 71.772  51.569  9.021   1.00 55.58  ? 95   ILE F CG1   1 
ATOM   7929 C  CG2   . ILE F  1 96  ? 73.637  51.108  10.690  1.00 59.28  ? 95   ILE F CG2   1 
ATOM   7930 C  CD1   . ILE F  1 96  ? 71.452  52.992  9.298   1.00 69.46  ? 95   ILE F CD1   1 
ATOM   7931 N  N     . ASP F  1 97  ? 73.855  47.775  10.700  1.00 57.50  ? 96   ASP F N     1 
ATOM   7932 C  CA    . ASP F  1 97  ? 74.303  46.590  11.371  1.00 56.63  ? 96   ASP F CA    1 
ATOM   7933 C  C     . ASP F  1 97  ? 75.616  46.886  12.103  1.00 60.92  ? 96   ASP F C     1 
ATOM   7934 O  O     . ASP F  1 97  ? 76.654  47.171  11.461  1.00 58.51  ? 96   ASP F O     1 
ATOM   7935 C  CB    . ASP F  1 97  ? 74.458  45.499  10.300  1.00 56.06  ? 96   ASP F CB    1 
ATOM   7936 C  CG    . ASP F  1 97  ? 75.162  44.242  10.792  1.00 60.20  ? 96   ASP F CG    1 
ATOM   7937 O  OD1   . ASP F  1 97  ? 75.205  44.019  12.020  1.00 67.37  ? 96   ASP F OD1   1 
ATOM   7938 O  OD2   . ASP F  1 97  ? 75.639  43.461  9.918   1.00 69.48  ? 96   ASP F OD2   1 
ATOM   7939 N  N     . GLY F  1 98  ? 75.544  46.805  13.439  1.00 58.86  ? 97   GLY F N     1 
ATOM   7940 C  CA    . GLY F  1 98  ? 76.701  46.890  14.317  1.00 60.25  ? 97   GLY F CA    1 
ATOM   7941 C  C     . GLY F  1 98  ? 77.161  48.310  14.572  1.00 60.88  ? 97   GLY F C     1 
ATOM   7942 O  O     . GLY F  1 98  ? 78.337  48.561  14.843  1.00 63.82  ? 97   GLY F O     1 
ATOM   7943 N  N     . TYR F  1 99  ? 76.212  49.225  14.497  1.00 60.74  ? 98   TYR F N     1 
ATOM   7944 C  CA    . TYR F  1 99  ? 76.482  50.656  14.490  1.00 66.25  ? 98   TYR F CA    1 
ATOM   7945 C  C     . TYR F  1 99  ? 75.302  51.297  15.175  1.00 62.54  ? 98   TYR F C     1 
ATOM   7946 O  O     . TYR F  1 99  ? 74.175  50.854  14.969  1.00 67.48  ? 98   TYR F O     1 
ATOM   7947 C  CB    . TYR F  1 99  ? 76.597  51.199  13.050  1.00 70.12  ? 98   TYR F CB    1 
ATOM   7948 C  CG    . TYR F  1 99  ? 77.009  52.655  12.955  1.00 57.63  ? 98   TYR F CG    1 
ATOM   7949 C  CD1   . TYR F  1 99  ? 78.354  53.012  12.936  1.00 66.06  ? 98   TYR F CD1   1 
ATOM   7950 C  CD2   . TYR F  1 99  ? 76.058  53.672  12.936  1.00 69.07  ? 98   TYR F CD2   1 
ATOM   7951 C  CE1   . TYR F  1 99  ? 78.749  54.350  12.872  1.00 75.20  ? 98   TYR F CE1   1 
ATOM   7952 C  CE2   . TYR F  1 99  ? 76.434  55.020  12.865  1.00 61.46  ? 98   TYR F CE2   1 
ATOM   7953 C  CZ    . TYR F  1 99  ? 77.782  55.351  12.821  1.00 76.17  ? 98   TYR F CZ    1 
ATOM   7954 O  OH    . TYR F  1 99  ? 78.171  56.678  12.755  1.00 78.09  ? 98   TYR F OH    1 
ATOM   7955 N  N     . PRO F  1 100 ? 75.548  52.315  16.008  1.00 60.55  ? 99   PRO F N     1 
ATOM   7956 C  CA    . PRO F  1 100 ? 76.859  52.868  16.350  1.00 59.06  ? 99   PRO F CA    1 
ATOM   7957 C  C     . PRO F  1 100 ? 77.499  52.074  17.482  1.00 59.95  ? 99   PRO F C     1 
ATOM   7958 O  O     . PRO F  1 100 ? 76.843  51.232  18.087  1.00 58.75  ? 99   PRO F O     1 
ATOM   7959 C  CB    . PRO F  1 100 ? 76.512  54.266  16.839  1.00 55.16  ? 99   PRO F CB    1 
ATOM   7960 C  CG    . PRO F  1 100 ? 75.238  54.072  17.524  1.00 60.74  ? 99   PRO F CG    1 
ATOM   7961 C  CD    . PRO F  1 100 ? 74.477  53.043  16.708  1.00 57.41  ? 99   PRO F CD    1 
ATOM   7962 N  N     . ARG F  1 101 ? 78.768  52.333  17.757  1.00 58.53  ? 100  ARG F N     1 
ATOM   7963 C  CA    . ARG F  1 101 ? 79.451  51.612  18.805  1.00 62.23  ? 100  ARG F CA    1 
ATOM   7964 C  C     . ARG F  1 101 ? 79.768  52.499  19.980  1.00 58.13  ? 100  ARG F C     1 
ATOM   7965 O  O     . ARG F  1 101 ? 80.379  52.043  20.920  1.00 59.53  ? 100  ARG F O     1 
ATOM   7966 C  CB    . ARG F  1 101 ? 80.752  51.027  18.304  1.00 64.46  ? 100  ARG F CB    1 
ATOM   7967 C  CG    . ARG F  1 101 ? 80.674  50.317  16.964  1.00 79.07  ? 100  ARG F CG    1 
ATOM   7968 C  CD    . ARG F  1 101 ? 80.706  48.807  17.030  1.00 77.18  ? 100  ARG F CD    1 
ATOM   7969 N  NE    . ARG F  1 101 ? 81.549  48.136  18.034  1.00 78.99  ? 100  ARG F NE    1 
ATOM   7970 C  CZ    . ARG F  1 101 ? 82.765  48.488  18.464  1.00 76.60  ? 100  ARG F CZ    1 
ATOM   7971 N  NH1   . ARG F  1 101 ? 83.357  47.728  19.379  1.00 61.77  ? 100  ARG F NH1   1 
ATOM   7972 N  NH2   . ARG F  1 101 ? 83.410  49.557  18.009  1.00 93.74  ? 100  ARG F NH2   1 
ATOM   7973 N  N     . GLU F  1 102 ? 79.378  53.762  19.903  1.00 56.73  ? 101  GLU F N     1 
ATOM   7974 C  CA    . GLU F  1 102 ? 79.509  54.685  20.995  1.00 61.46  ? 101  GLU F CA    1 
ATOM   7975 C  C     . GLU F  1 102 ? 78.386  55.693  20.894  1.00 53.81  ? 101  GLU F C     1 
ATOM   7976 O  O     . GLU F  1 102 ? 77.827  55.901  19.823  1.00 56.26  ? 101  GLU F O     1 
ATOM   7977 C  CB    . GLU F  1 102 ? 80.894  55.336  21.017  1.00 58.38  ? 101  GLU F CB    1 
ATOM   7978 C  CG    . GLU F  1 102 ? 81.169  56.293  19.895  1.00 80.90  ? 101  GLU F CG    1 
ATOM   7979 C  CD    . GLU F  1 102 ? 82.642  56.713  19.816  1.00 82.82  ? 101  GLU F CD    1 
ATOM   7980 O  OE1   . GLU F  1 102 ? 83.415  56.421  20.760  1.00 92.17  ? 101  GLU F OE1   1 
ATOM   7981 O  OE2   . GLU F  1 102 ? 83.016  57.349  18.802  1.00 110.86 ? 101  GLU F OE2   1 
ATOM   7982 N  N     . VAL F  1 103 ? 78.025  56.274  22.030  1.00 52.37  ? 102  VAL F N     1 
ATOM   7983 C  CA    . VAL F  1 103 ? 76.917  57.211  22.099  1.00 55.66  ? 102  VAL F CA    1 
ATOM   7984 C  C     . VAL F  1 103 ? 77.140  58.442  21.230  1.00 56.20  ? 102  VAL F C     1 
ATOM   7985 O  O     . VAL F  1 103 ? 76.180  58.915  20.615  1.00 58.45  ? 102  VAL F O     1 
ATOM   7986 C  CB    . VAL F  1 103 ? 76.612  57.649  23.565  1.00 53.74  ? 102  VAL F CB    1 
ATOM   7987 C  CG1   . VAL F  1 103 ? 75.603  58.783  23.597  1.00 55.49  ? 102  VAL F CG1   1 
ATOM   7988 C  CG2   . VAL F  1 103 ? 76.107  56.458  24.392  1.00 54.71  ? 102  VAL F CG2   1 
ATOM   7989 N  N     . LYS F  1 104 ? 78.370  58.974  21.179  1.00 52.92  ? 103  LYS F N     1 
ATOM   7990 C  CA    . LYS F  1 104 ? 78.618  60.166  20.350  1.00 57.59  ? 103  LYS F CA    1 
ATOM   7991 C  C     . LYS F  1 104 ? 78.408  59.916  18.837  1.00 54.16  ? 103  LYS F C     1 
ATOM   7992 O  O     . LYS F  1 104 ? 78.038  60.832  18.123  1.00 55.21  ? 103  LYS F O     1 
ATOM   7993 C  CB    . LYS F  1 104 ? 79.955  60.862  20.685  1.00 57.25  ? 103  LYS F CB    1 
ATOM   7994 C  CG    . LYS F  1 104 ? 81.216  60.097  20.319  1.00 79.57  ? 103  LYS F CG    1 
ATOM   7995 N  N     . GLN F  1 105 ? 78.563  58.671  18.382  1.00 57.19  ? 104  GLN F N     1 
ATOM   7996 C  CA    . GLN F  1 105 ? 78.333  58.274  16.978  1.00 59.25  ? 104  GLN F CA    1 
ATOM   7997 C  C     . GLN F  1 105 ? 76.841  58.275  16.660  1.00 58.16  ? 104  GLN F C     1 
ATOM   7998 O  O     . GLN F  1 105 ? 76.440  58.647  15.562  1.00 62.79  ? 104  GLN F O     1 
ATOM   7999 C  CB    . GLN F  1 105 ? 78.817  56.828  16.707  1.00 60.07  ? 104  GLN F CB    1 
ATOM   8000 C  CG    . GLN F  1 105 ? 80.274  56.570  16.423  1.00 70.09  ? 104  GLN F CG    1 
ATOM   8001 C  CD    . GLN F  1 105 ? 80.636  55.048  16.537  1.00 77.90  ? 104  GLN F CD    1 
ATOM   8002 O  OE1   . GLN F  1 105 ? 79.849  54.164  16.152  1.00 77.13  ? 104  GLN F OE1   1 
ATOM   8003 N  NE2   . GLN F  1 105 ? 81.825  54.759  17.091  1.00 89.32  ? 104  GLN F NE2   1 
ATOM   8004 N  N     . GLY F  1 106 ? 76.042  57.791  17.608  1.00 55.19  ? 105  GLY F N     1 
ATOM   8005 C  CA    . GLY F  1 106 ? 74.598  57.842  17.530  1.00 58.64  ? 105  GLY F CA    1 
ATOM   8006 C  C     . GLY F  1 106 ? 73.999  59.238  17.590  1.00 59.52  ? 105  GLY F C     1 
ATOM   8007 O  O     . GLY F  1 106 ? 72.998  59.530  16.933  1.00 62.13  ? 105  GLY F O     1 
ATOM   8008 N  N     . GLU F  1 107 ? 74.587  60.095  18.406  1.00 55.39  ? 106  GLU F N     1 
ATOM   8009 C  CA    . GLU F  1 107 ? 74.141  61.468  18.476  1.00 55.63  ? 106  GLU F CA    1 
ATOM   8010 C  C     . GLU F  1 107 ? 74.377  62.164  17.153  1.00 55.66  ? 106  GLU F C     1 
ATOM   8011 O  O     . GLU F  1 107 ? 73.484  62.818  16.618  1.00 55.77  ? 106  GLU F O     1 
ATOM   8012 C  CB    . GLU F  1 107 ? 74.862  62.208  19.597  1.00 51.64  ? 106  GLU F CB    1 
ATOM   8013 C  CG    . GLU F  1 107 ? 74.373  61.797  20.983  1.00 53.83  ? 106  GLU F CG    1 
ATOM   8014 C  CD    . GLU F  1 107 ? 75.230  62.323  22.120  1.00 62.86  ? 106  GLU F CD    1 
ATOM   8015 O  OE1   . GLU F  1 107 ? 76.382  62.779  21.892  1.00 72.08  ? 106  GLU F OE1   1 
ATOM   8016 O  OE2   . GLU F  1 107 ? 74.741  62.261  23.265  1.00 85.51  ? 106  GLU F OE2   1 
ATOM   8017 N  N     . GLU F  1 108 ? 75.586  62.004  16.630  1.00 56.53  ? 107  GLU F N     1 
ATOM   8018 C  CA    . GLU F  1 108 ? 75.963  62.575  15.340  1.00 57.88  ? 107  GLU F CA    1 
ATOM   8019 C  C     . GLU F  1 108 ? 75.124  62.005  14.173  1.00 55.72  ? 107  GLU F C     1 
ATOM   8020 O  O     . GLU F  1 108 ? 74.732  62.742  13.272  1.00 54.57  ? 107  GLU F O     1 
ATOM   8021 C  CB    . GLU F  1 108 ? 77.469  62.360  15.112  1.00 56.17  ? 107  GLU F CB    1 
ATOM   8022 C  CG    . GLU F  1 108 ? 78.105  63.300  14.097  1.00 65.05  ? 107  GLU F CG    1 
ATOM   8023 C  CD    . GLU F  1 108 ? 78.205  64.752  14.562  1.00 85.06  ? 107  GLU F CD    1 
ATOM   8024 O  OE1   . GLU F  1 108 ? 77.696  65.119  15.653  1.00 86.61  ? 107  GLU F OE1   1 
ATOM   8025 O  OE2   . GLU F  1 108 ? 78.801  65.543  13.802  1.00 92.38  ? 107  GLU F OE2   1 
ATOM   8026 N  N     . PHE F  1 109 ? 74.831  60.708  14.217  1.00 54.98  ? 108  PHE F N     1 
ATOM   8027 C  CA    . PHE F  1 109 ? 73.953  60.068  13.230  1.00 56.31  ? 108  PHE F CA    1 
ATOM   8028 C  C     . PHE F  1 109 ? 72.552  60.670  13.257  1.00 56.66  ? 108  PHE F C     1 
ATOM   8029 O  O     . PHE F  1 109 ? 71.976  60.931  12.209  1.00 55.66  ? 108  PHE F O     1 
ATOM   8030 C  CB    . PHE F  1 109 ? 73.867  58.540  13.464  1.00 57.94  ? 108  PHE F CB    1 
ATOM   8031 C  CG    . PHE F  1 109 ? 73.003  57.806  12.456  1.00 58.13  ? 108  PHE F CG    1 
ATOM   8032 C  CD1   . PHE F  1 109 ? 73.568  57.162  11.364  1.00 60.23  ? 108  PHE F CD1   1 
ATOM   8033 C  CD2   . PHE F  1 109 ? 71.619  57.758  12.607  1.00 68.01  ? 108  PHE F CD2   1 
ATOM   8034 C  CE1   . PHE F  1 109 ? 72.761  56.484  10.428  1.00 64.82  ? 108  PHE F CE1   1 
ATOM   8035 C  CE2   . PHE F  1 109 ? 70.810  57.079  11.685  1.00 59.84  ? 108  PHE F CE2   1 
ATOM   8036 C  CZ    . PHE F  1 109 ? 71.386  56.439  10.602  1.00 63.26  ? 108  PHE F CZ    1 
ATOM   8037 N  N     . GLY F  1 110 ? 71.998  60.864  14.451  1.00 57.83  ? 109  GLY F N     1 
ATOM   8038 C  CA    . GLY F  1 110 ? 70.671  61.481  14.603  1.00 57.39  ? 109  GLY F CA    1 
ATOM   8039 C  C     . GLY F  1 110 ? 70.637  62.925  14.127  1.00 61.17  ? 109  GLY F C     1 
ATOM   8040 O  O     . GLY F  1 110 ? 69.626  63.411  13.618  1.00 62.74  ? 109  GLY F O     1 
ATOM   8041 N  N     . ARG F  1 111 ? 71.763  63.603  14.302  1.00 58.15  ? 110  ARG F N     1 
ATOM   8042 C  CA    . ARG F  1 111 ? 71.914  64.985  13.955  1.00 58.46  ? 110  ARG F CA    1 
ATOM   8043 C  C     . ARG F  1 111 ? 72.007  65.140  12.434  1.00 57.37  ? 110  ARG F C     1 
ATOM   8044 O  O     . ARG F  1 111 ? 71.320  65.977  11.846  1.00 60.12  ? 110  ARG F O     1 
ATOM   8045 C  CB    . ARG F  1 111 ? 73.176  65.489  14.643  1.00 56.58  ? 110  ARG F CB    1 
ATOM   8046 C  CG    . ARG F  1 111 ? 73.394  66.991  14.643  1.00 75.89  ? 110  ARG F CG    1 
ATOM   8047 C  CD    . ARG F  1 111 ? 74.818  67.321  15.117  1.00 74.57  ? 110  ARG F CD    1 
ATOM   8048 N  NE    . ARG F  1 111 ? 75.825  67.013  14.093  1.00 81.97  ? 110  ARG F NE    1 
ATOM   8049 C  CZ    . ARG F  1 111 ? 76.156  67.822  13.086  1.00 79.36  ? 110  ARG F CZ    1 
ATOM   8050 N  NH1   . ARG F  1 111 ? 75.564  69.002  12.935  1.00 87.46  ? 110  ARG F NH1   1 
ATOM   8051 N  NH2   . ARG F  1 111 ? 77.082  67.444  12.210  1.00 89.23  ? 110  ARG F NH2   1 
ATOM   8052 N  N     . ARG F  1 112 ? 72.833  64.308  11.805  1.00 58.84  ? 111  ARG F N     1 
ATOM   8053 C  CA    . ARG F  1 112 ? 73.152  64.421  10.371  1.00 58.64  ? 111  ARG F CA    1 
ATOM   8054 C  C     . ARG F  1 112 ? 72.323  63.541  9.430   1.00 56.24  ? 111  ARG F C     1 
ATOM   8055 O  O     . ARG F  1 112 ? 72.254  63.825  8.248   1.00 54.63  ? 111  ARG F O     1 
ATOM   8056 C  CB    . ARG F  1 112 ? 74.631  64.089  10.130  1.00 58.94  ? 111  ARG F CB    1 
ATOM   8057 C  CG    . ARG F  1 112 ? 75.627  65.030  10.809  1.00 59.79  ? 111  ARG F CG    1 
ATOM   8058 C  CD    . ARG F  1 112 ? 76.997  64.975  10.123  1.00 66.57  ? 111  ARG F CD    1 
ATOM   8059 N  N     . ILE F  1 113 ? 71.737  62.457  9.929   1.00 56.33  ? 112  ILE F N     1 
ATOM   8060 C  CA    . ILE F  1 113 ? 71.020  61.530  9.058   1.00 58.06  ? 112  ILE F CA    1 
ATOM   8061 C  C     . ILE F  1 113 ? 69.558  61.402  9.478   1.00 58.89  ? 112  ILE F C     1 
ATOM   8062 O  O     . ILE F  1 113 ? 68.661  61.869  8.772   1.00 62.27  ? 112  ILE F O     1 
ATOM   8063 C  CB    . ILE F  1 113 ? 71.724  60.147  9.010   1.00 60.62  ? 112  ILE F CB    1 
ATOM   8064 C  CG1   . ILE F  1 113 ? 73.055  60.268  8.253   1.00 61.07  ? 112  ILE F CG1   1 
ATOM   8065 C  CG2   . ILE F  1 113 ? 70.818  59.097  8.352   1.00 68.55  ? 112  ILE F CG2   1 
ATOM   8066 C  CD1   . ILE F  1 113 ? 73.896  59.020  8.282   1.00 63.37  ? 112  ILE F CD1   1 
ATOM   8067 N  N     . GLY F  1 114 ? 69.331  60.785  10.633  1.00 59.70  ? 113  GLY F N     1 
ATOM   8068 C  CA    . GLY F  1 114 ? 67.989  60.542  11.140  1.00 59.73  ? 113  GLY F CA    1 
ATOM   8069 C  C     . GLY F  1 114 ? 68.045  59.786  12.451  1.00 61.07  ? 113  GLY F C     1 
ATOM   8070 O  O     . GLY F  1 114 ? 69.113  59.447  12.936  1.00 62.62  ? 113  GLY F O     1 
ATOM   8071 N  N     . ASP F  1 115 ? 66.883  59.539  13.027  1.00 59.69  ? 114  ASP F N     1 
ATOM   8072 C  CA    . ASP F  1 115 ? 66.759  58.787  14.243  1.00 57.54  ? 114  ASP F CA    1 
ATOM   8073 C  C     . ASP F  1 115 ? 66.231  57.393  13.900  1.00 57.18  ? 114  ASP F C     1 
ATOM   8074 O  O     . ASP F  1 115 ? 65.397  57.249  13.021  1.00 58.10  ? 114  ASP F O     1 
ATOM   8075 C  CB    . ASP F  1 115 ? 65.803  59.519  15.167  1.00 57.07  ? 114  ASP F CB    1 
ATOM   8076 C  CG    . ASP F  1 115 ? 66.294  60.926  15.526  1.00 66.51  ? 114  ASP F CG    1 
ATOM   8077 O  OD1   . ASP F  1 115 ? 67.472  61.090  15.921  1.00 69.78  ? 114  ASP F OD1   1 
ATOM   8078 O  OD2   . ASP F  1 115 ? 65.491  61.878  15.435  1.00 78.83  ? 114  ASP F OD2   1 
ATOM   8079 N  N     . PRO F  1 116 ? 66.745  56.348  14.569  1.00 58.02  ? 115  PRO F N     1 
ATOM   8080 C  CA    . PRO F  1 116 ? 66.205  55.014  14.301  1.00 57.99  ? 115  PRO F CA    1 
ATOM   8081 C  C     . PRO F  1 116 ? 64.832  54.797  14.950  1.00 55.16  ? 115  PRO F C     1 
ATOM   8082 O  O     . PRO F  1 116 ? 64.575  55.268  16.064  1.00 53.26  ? 115  PRO F O     1 
ATOM   8083 C  CB    . PRO F  1 116 ? 67.242  54.091  14.928  1.00 57.52  ? 115  PRO F CB    1 
ATOM   8084 C  CG    . PRO F  1 116 ? 67.769  54.910  16.078  1.00 60.46  ? 115  PRO F CG    1 
ATOM   8085 C  CD    . PRO F  1 116 ? 67.817  56.318  15.583  1.00 53.69  ? 115  PRO F CD    1 
ATOM   8086 N  N     . GLN F  1 117 ? 63.968  54.077  14.251  1.00 54.30  ? 116  GLN F N     1 
ATOM   8087 C  CA    . GLN F  1 117 ? 62.632  53.771  14.769  1.00 58.10  ? 116  GLN F CA    1 
ATOM   8088 C  C     . GLN F  1 117 ? 62.656  52.501  15.584  1.00 56.91  ? 116  GLN F C     1 
ATOM   8089 O  O     . GLN F  1 117 ? 61.775  52.274  16.394  1.00 57.66  ? 116  GLN F O     1 
ATOM   8090 C  CB    . GLN F  1 117 ? 61.610  53.631  13.629  1.00 57.09  ? 116  GLN F CB    1 
ATOM   8091 C  CG    . GLN F  1 117 ? 61.172  54.959  13.055  1.00 59.25  ? 116  GLN F CG    1 
ATOM   8092 C  CD    . GLN F  1 117 ? 62.257  55.617  12.234  1.00 72.53  ? 116  GLN F CD    1 
ATOM   8093 O  OE1   . GLN F  1 117 ? 62.679  55.089  11.203  1.00 59.14  ? 116  GLN F OE1   1 
ATOM   8094 N  NE2   . GLN F  1 117 ? 62.719  56.778  12.688  1.00 75.13  ? 116  GLN F NE2   1 
ATOM   8095 N  N     . LEU F  1 118 ? 63.665  51.668  15.345  1.00 57.15  ? 117  LEU F N     1 
ATOM   8096 C  CA    . LEU F  1 118 ? 63.850  50.453  16.108  1.00 54.12  ? 117  LEU F CA    1 
ATOM   8097 C  C     . LEU F  1 118 ? 65.334  50.127  16.315  1.00 55.78  ? 117  LEU F C     1 
ATOM   8098 O  O     . LEU F  1 118 ? 66.161  50.244  15.390  1.00 50.80  ? 117  LEU F O     1 
ATOM   8099 C  CB    . LEU F  1 118 ? 63.155  49.299  15.386  1.00 56.53  ? 117  LEU F CB    1 
ATOM   8100 C  CG    . LEU F  1 118 ? 63.205  47.930  16.052  1.00 59.09  ? 117  LEU F CG    1 
ATOM   8101 C  CD1   . LEU F  1 118 ? 62.642  47.986  17.486  1.00 64.79  ? 117  LEU F CD1   1 
ATOM   8102 C  CD2   . LEU F  1 118 ? 62.473  46.927  15.194  1.00 62.30  ? 117  LEU F CD2   1 
ATOM   8103 N  N     . VAL F  1 119 ? 65.645  49.716  17.541  1.00 55.45  ? 118  VAL F N     1 
ATOM   8104 C  CA    . VAL F  1 119 ? 66.923  49.122  17.877  1.00 55.79  ? 118  VAL F CA    1 
ATOM   8105 C  C     . VAL F  1 119 ? 66.707  47.685  18.351  1.00 54.97  ? 118  VAL F C     1 
ATOM   8106 O  O     . VAL F  1 119 ? 66.063  47.434  19.355  1.00 55.33  ? 118  VAL F O     1 
ATOM   8107 C  CB    . VAL F  1 119 ? 67.687  49.948  18.923  1.00 53.76  ? 118  VAL F CB    1 
ATOM   8108 C  CG1   . VAL F  1 119 ? 69.065  49.342  19.189  1.00 60.88  ? 118  VAL F CG1   1 
ATOM   8109 C  CG2   . VAL F  1 119 ? 67.851  51.376  18.446  1.00 57.41  ? 118  VAL F CG2   1 
ATOM   8110 N  N     . ILE F  1 120 ? 67.257  46.756  17.586  1.00 59.36  ? 119  ILE F N     1 
ATOM   8111 C  CA    . ILE F  1 120 ? 67.220  45.344  17.895  1.00 59.27  ? 119  ILE F CA    1 
ATOM   8112 C  C     . ILE F  1 120 ? 68.531  44.921  18.524  1.00 61.89  ? 119  ILE F C     1 
ATOM   8113 O  O     . ILE F  1 120 ? 69.592  45.110  17.928  1.00 59.32  ? 119  ILE F O     1 
ATOM   8114 C  CB    . ILE F  1 120 ? 67.079  44.537  16.633  1.00 62.48  ? 119  ILE F CB    1 
ATOM   8115 C  CG1   . ILE F  1 120 ? 65.723  44.799  15.970  1.00 63.19  ? 119  ILE F CG1   1 
ATOM   8116 C  CG2   . ILE F  1 120 ? 67.281  43.057  16.925  1.00 64.87  ? 119  ILE F CG2   1 
ATOM   8117 C  CD1   . ILE F  1 120 ? 65.705  44.400  14.505  1.00 67.45  ? 119  ILE F CD1   1 
ATOM   8118 N  N     . CYS F  1 121 ? 68.444  44.328  19.717  1.00 61.48  ? 120  CYS F N     1 
ATOM   8119 C  CA    . CYS F  1 121 ? 69.601  43.827  20.437  1.00 63.06  ? 120  CYS F CA    1 
ATOM   8120 C  C     . CYS F  1 121 ? 69.519  42.325  20.533  1.00 61.88  ? 120  CYS F C     1 
ATOM   8121 O  O     . CYS F  1 121 ? 68.619  41.784  21.144  1.00 64.06  ? 120  CYS F O     1 
ATOM   8122 C  CB    . CYS F  1 121 ? 69.645  44.408  21.847  1.00 65.01  ? 120  CYS F CB    1 
ATOM   8123 S  SG    . CYS F  1 121 ? 69.384  46.155  21.814  1.00 83.81  ? 120  CYS F SG    1 
ATOM   8124 N  N     . MET F  1 122 ? 70.484  41.649  19.946  1.00 62.87  ? 121  MET F N     1 
ATOM   8125 C  CA    . MET F  1 122 ? 70.509  40.204  19.983  1.00 65.41  ? 121  MET F CA    1 
ATOM   8126 C  C     . MET F  1 122 ? 71.294  39.732  21.176  1.00 64.02  ? 121  MET F C     1 
ATOM   8127 O  O     . MET F  1 122 ? 72.516  39.726  21.173  1.00 68.00  ? 121  MET F O     1 
ATOM   8128 C  CB    . MET F  1 122 ? 71.073  39.666  18.683  1.00 67.70  ? 121  MET F CB    1 
ATOM   8129 C  CG    . MET F  1 122 ? 70.091  39.916  17.570  1.00 63.57  ? 121  MET F CG    1 
ATOM   8130 S  SD    . MET F  1 122 ? 70.590  39.154  16.067  1.00 73.29  ? 121  MET F SD    1 
ATOM   8131 C  CE    . MET F  1 122 ? 70.647  37.423  16.515  1.00 68.38  ? 121  MET F CE    1 
ATOM   8132 N  N     . ASP F  1 123 ? 70.543  39.348  22.200  1.00 63.41  ? 122  ASP F N     1 
ATOM   8133 C  CA    . ASP F  1 123 ? 71.080  38.838  23.432  1.00 64.26  ? 122  ASP F CA    1 
ATOM   8134 C  C     . ASP F  1 123 ? 71.476  37.373  23.403  1.00 60.86  ? 122  ASP F C     1 
ATOM   8135 O  O     . ASP F  1 123 ? 70.719  36.504  23.016  1.00 61.89  ? 122  ASP F O     1 
ATOM   8136 C  CB    . ASP F  1 123 ? 70.089  39.069  24.571  1.00 64.05  ? 122  ASP F CB    1 
ATOM   8137 C  CG    . ASP F  1 123 ? 70.471  40.254  25.394  1.00 89.68  ? 122  ASP F CG    1 
ATOM   8138 O  OD1   . ASP F  1 123 ? 70.182  41.404  24.969  1.00 99.90  ? 122  ASP F OD1   1 
ATOM   8139 O  OD2   . ASP F  1 123 ? 71.119  40.024  26.439  1.00 106.51 ? 122  ASP F OD2   1 
ATOM   8140 N  N     . CYS F  1 124 ? 72.671  37.121  23.885  1.00 59.65  ? 123  CYS F N     1 
ATOM   8141 C  CA    . CYS F  1 124 ? 73.220  35.807  23.911  1.00 61.81  ? 123  CYS F CA    1 
ATOM   8142 C  C     . CYS F  1 124 ? 74.233  35.686  25.083  1.00 58.99  ? 123  CYS F C     1 
ATOM   8143 O  O     . CYS F  1 124 ? 74.908  36.636  25.444  1.00 61.36  ? 123  CYS F O     1 
ATOM   8144 C  CB    . CYS F  1 124 ? 73.895  35.555  22.551  1.00 60.95  ? 123  CYS F CB    1 
ATOM   8145 S  SG    . CYS F  1 124 ? 74.128  33.858  22.255  1.00 67.26  ? 123  CYS F SG    1 
ATOM   8146 N  N     . SER F  1 125 ? 74.311  34.519  25.690  1.00 56.27  ? 124  SER F N     1 
ATOM   8147 C  CA    . SER F  1 125 ? 75.266  34.301  26.733  1.00 55.70  ? 124  SER F CA    1 
ATOM   8148 C  C     . SER F  1 125 ? 76.656  34.206  26.097  1.00 56.31  ? 124  SER F C     1 
ATOM   8149 O  O     . SER F  1 125 ? 76.805  33.850  24.922  1.00 57.74  ? 124  SER F O     1 
ATOM   8150 C  CB    . SER F  1 125 ? 74.943  33.018  27.519  1.00 56.44  ? 124  SER F CB    1 
ATOM   8151 O  OG    . SER F  1 125 ? 75.237  31.830  26.771  1.00 63.02  ? 124  SER F OG    1 
ATOM   8152 N  N     . ALA F  1 126 ? 77.661  34.502  26.908  1.00 57.30  ? 125  ALA F N     1 
ATOM   8153 C  CA    . ALA F  1 126 ? 79.065  34.388  26.546  1.00 57.28  ? 125  ALA F CA    1 
ATOM   8154 C  C     . ALA F  1 126 ? 79.434  32.949  26.225  1.00 58.46  ? 125  ALA F C     1 
ATOM   8155 O  O     . ALA F  1 126 ? 80.182  32.685  25.275  1.00 61.11  ? 125  ALA F O     1 
ATOM   8156 C  CB    . ALA F  1 126 ? 79.933  34.893  27.713  1.00 57.15  ? 125  ALA F CB    1 
ATOM   8157 N  N     . ASP F  1 127 ? 78.933  32.017  27.030  1.00 56.82  ? 126  ASP F N     1 
ATOM   8158 C  CA    . ASP F  1 127 ? 79.185  30.588  26.790  1.00 61.67  ? 126  ASP F CA    1 
ATOM   8159 C  C     . ASP F  1 127 ? 78.677  30.133  25.426  1.00 57.32  ? 126  ASP F C     1 
ATOM   8160 O  O     . ASP F  1 127 ? 79.348  29.365  24.716  1.00 57.56  ? 126  ASP F O     1 
ATOM   8161 C  CB    . ASP F  1 127 ? 78.545  29.710  27.878  1.00 61.53  ? 126  ASP F CB    1 
ATOM   8162 C  CG    . ASP F  1 127 ? 79.161  29.924  29.260  1.00 85.19  ? 126  ASP F CG    1 
ATOM   8163 O  OD1   . ASP F  1 127 ? 80.276  30.492  29.345  1.00 98.07  ? 126  ASP F OD1   1 
ATOM   8164 O  OD2   . ASP F  1 127 ? 78.518  29.519  30.263  1.00 97.23  ? 126  ASP F OD2   1 
ATOM   8165 N  N     . THR F  1 128 ? 77.504  30.628  25.054  1.00 57.09  ? 127  THR F N     1 
ATOM   8166 C  CA    . THR F  1 128 ? 76.904  30.233  23.798  1.00 57.67  ? 127  THR F CA    1 
ATOM   8167 C  C     . THR F  1 128 ? 77.642  30.862  22.634  1.00 56.74  ? 127  THR F C     1 
ATOM   8168 O  O     . THR F  1 128 ? 77.935  30.181  21.661  1.00 62.89  ? 127  THR F O     1 
ATOM   8169 C  CB    . THR F  1 128 ? 75.399  30.557  23.749  1.00 57.27  ? 127  THR F CB    1 
ATOM   8170 O  OG1   . THR F  1 128 ? 74.716  29.790  24.750  1.00 56.69  ? 127  THR F OG1   1 
ATOM   8171 C  CG2   . THR F  1 128 ? 74.819  30.202  22.386  1.00 57.14  ? 127  THR F CG2   1 
ATOM   8172 N  N     . MET F  1 129 ? 77.923  32.154  22.720  1.00 55.51  ? 128  MET F N     1 
ATOM   8173 C  CA    . MET F  1 129 ? 78.736  32.823  21.697  1.00 58.67  ? 128  MET F CA    1 
ATOM   8174 C  C     . MET F  1 129 ? 80.136  32.191  21.525  1.00 53.81  ? 128  MET F C     1 
ATOM   8175 O  O     . MET F  1 129 ? 80.618  31.987  20.413  1.00 54.97  ? 128  MET F O     1 
ATOM   8176 C  CB    . MET F  1 129 ? 78.895  34.309  22.061  1.00 59.19  ? 128  MET F CB    1 
ATOM   8177 C  CG    . MET F  1 129 ? 77.614  35.136  21.860  1.00 58.69  ? 128  MET F CG    1 
ATOM   8178 S  SD    . MET F  1 129 ? 77.864  36.905  22.103  1.00 63.61  ? 128  MET F SD    1 
ATOM   8179 C  CE    . MET F  1 129 ? 78.025  37.026  23.862  1.00 60.22  ? 128  MET F CE    1 
ATOM   8180 N  N     . THR F  1 130 ? 80.790  31.897  22.633  1.00 56.27  ? 129  THR F N     1 
ATOM   8181 C  CA    . THR F  1 130 ? 82.113  31.235  22.610  1.00 57.28  ? 129  THR F CA    1 
ATOM   8182 C  C     . THR F  1 130 ? 82.064  29.874  21.931  1.00 55.86  ? 129  THR F C     1 
ATOM   8183 O  O     . THR F  1 130 ? 82.828  29.616  21.001  1.00 57.73  ? 129  THR F O     1 
ATOM   8184 C  CB    . THR F  1 130 ? 82.680  31.130  24.042  1.00 59.79  ? 129  THR F CB    1 
ATOM   8185 O  OG1   . THR F  1 130 ? 82.703  32.441  24.608  1.00 63.01  ? 129  THR F OG1   1 
ATOM   8186 C  CG2   . THR F  1 130 ? 84.085  30.550  24.054  1.00 61.88  ? 129  THR F CG2   1 
ATOM   8187 N  N     . ASN F  1 131 ? 81.116  29.025  22.330  1.00 54.50  ? 130  ASN F N     1 
ATOM   8188 C  CA    . ASN F  1 131 ? 80.986  27.710  21.672  1.00 53.08  ? 130  ASN F CA    1 
ATOM   8189 C  C     . ASN F  1 131 ? 80.704  27.817  20.177  1.00 52.54  ? 130  ASN F C     1 
ATOM   8190 O  O     . ASN F  1 131 ? 81.270  27.082  19.376  1.00 51.98  ? 130  ASN F O     1 
ATOM   8191 C  CB    . ASN F  1 131 ? 79.947  26.851  22.399  1.00 59.70  ? 130  ASN F CB    1 
ATOM   8192 C  CG    . ASN F  1 131 ? 79.644  25.545  21.684  1.00 52.10  ? 130  ASN F CG    1 
ATOM   8193 O  OD1   . ASN F  1 131 ? 78.865  25.515  20.740  1.00 56.31  ? 130  ASN F OD1   1 
ATOM   8194 N  ND2   . ASN F  1 131 ? 80.229  24.455  22.161  1.00 49.94  ? 130  ASN F ND2   1 
ATOM   8195 N  N     . ARG F  1 132 ? 79.837  28.744  19.789  1.00 53.62  ? 131  ARG F N     1 
ATOM   8196 C  CA    . ARG F  1 132 ? 79.505  28.916  18.373  1.00 55.54  ? 131  ARG F CA    1 
ATOM   8197 C  C     . ARG F  1 132 ? 80.714  29.390  17.591  1.00 52.30  ? 131  ARG F C     1 
ATOM   8198 O  O     . ARG F  1 132 ? 80.975  28.932  16.497  1.00 56.62  ? 131  ARG F O     1 
ATOM   8199 C  CB    . ARG F  1 132 ? 78.354  29.920  18.189  1.00 53.37  ? 131  ARG F CB    1 
ATOM   8200 C  CG    . ARG F  1 132 ? 76.993  29.339  18.507  1.00 54.67  ? 131  ARG F CG    1 
ATOM   8201 C  CD    . ARG F  1 132 ? 75.945  30.416  18.428  1.00 62.15  ? 131  ARG F CD    1 
ATOM   8202 N  NE    . ARG F  1 132 ? 74.633  29.975  18.869  1.00 54.47  ? 131  ARG F NE    1 
ATOM   8203 C  CZ    . ARG F  1 132 ? 73.599  30.792  19.042  1.00 54.77  ? 131  ARG F CZ    1 
ATOM   8204 N  NH1   . ARG F  1 132 ? 73.714  32.096  18.811  1.00 55.04  ? 131  ARG F NH1   1 
ATOM   8205 N  NH2   . ARG F  1 132 ? 72.442  30.301  19.456  1.00 55.44  ? 131  ARG F NH2   1 
ATOM   8206 N  N     . LEU F  1 133 ? 81.445  30.324  18.173  1.00 55.27  ? 132  LEU F N     1 
ATOM   8207 C  CA    . LEU F  1 133 ? 82.647  30.808  17.559  1.00 54.97  ? 132  LEU F CA    1 
ATOM   8208 C  C     . LEU F  1 133 ? 83.708  29.702  17.478  1.00 54.59  ? 132  LEU F C     1 
ATOM   8209 O  O     . LEU F  1 133 ? 84.441  29.655  16.516  1.00 56.20  ? 132  LEU F O     1 
ATOM   8210 C  CB    . LEU F  1 133 ? 83.173  32.046  18.297  1.00 50.60  ? 132  LEU F CB    1 
ATOM   8211 C  CG    . LEU F  1 133 ? 82.336  33.315  18.066  1.00 57.87  ? 132  LEU F CG    1 
ATOM   8212 C  CD1   . LEU F  1 133 ? 82.747  34.442  19.020  1.00 54.56  ? 132  LEU F CD1   1 
ATOM   8213 C  CD2   . LEU F  1 133 ? 82.398  33.775  16.599  1.00 61.49  ? 132  LEU F CD2   1 
ATOM   8214 N  N     . LEU F  1 134 ? 83.796  28.827  18.474  1.00 53.82  ? 133  LEU F N     1 
ATOM   8215 C  CA    . LEU F  1 134 ? 84.749  27.709  18.402  1.00 53.77  ? 133  LEU F CA    1 
ATOM   8216 C  C     . LEU F  1 134 ? 84.397  26.755  17.265  1.00 56.12  ? 133  LEU F C     1 
ATOM   8217 O  O     . LEU F  1 134 ? 85.285  26.269  16.558  1.00 57.55  ? 133  LEU F O     1 
ATOM   8218 C  CB    . LEU F  1 134 ? 84.830  26.978  19.735  1.00 60.14  ? 133  LEU F CB    1 
ATOM   8219 C  CG    . LEU F  1 134 ? 85.641  27.710  20.815  1.00 61.55  ? 133  LEU F CG    1 
ATOM   8220 C  CD1   . LEU F  1 134 ? 85.553  26.977  22.151  1.00 54.41  ? 133  LEU F CD1   1 
ATOM   8221 C  CD2   . LEU F  1 134 ? 87.084  27.861  20.416  1.00 58.58  ? 133  LEU F CD2   1 
ATOM   8222 N  N     . GLN F  1 135 ? 83.104  26.508  17.061  1.00 54.51  ? 134  GLN F N     1 
ATOM   8223 C  CA    . GLN F  1 135 ? 82.660  25.661  15.970  1.00 54.62  ? 134  GLN F CA    1 
ATOM   8224 C  C     . GLN F  1 135 ? 83.021  26.182  14.591  1.00 54.16  ? 134  GLN F C     1 
ATOM   8225 O  O     . GLN F  1 135 ? 83.114  25.404  13.659  1.00 60.46  ? 134  GLN F O     1 
ATOM   8226 C  CB    . GLN F  1 135 ? 81.150  25.458  16.030  1.00 56.64  ? 134  GLN F CB    1 
ATOM   8227 C  CG    . GLN F  1 135 ? 80.716  24.733  17.310  1.00 53.06  ? 134  GLN F CG    1 
ATOM   8228 C  CD    . GLN F  1 135 ? 79.276  24.292  17.261  1.00 50.23  ? 134  GLN F CD    1 
ATOM   8229 O  OE1   . GLN F  1 135 ? 78.807  23.821  16.241  1.00 54.55  ? 134  GLN F OE1   1 
ATOM   8230 N  NE2   . GLN F  1 135 ? 78.563  24.448  18.373  1.00 59.54  ? 134  GLN F NE2   1 
ATOM   8231 N  N     . MET F  1 136 ? 83.209  27.491  14.481  1.00 60.68  ? 135  MET F N     1 
ATOM   8232 C  CA    A MET F  1 136 ? 83.599  28.163  13.243  0.60 67.25  ? 135  MET F CA    1 
ATOM   8233 C  CA    B MET F  1 136 ? 83.605  28.121  13.224  0.40 62.51  ? 135  MET F CA    1 
ATOM   8234 C  C     . MET F  1 136 ? 85.104  28.405  13.182  1.00 60.70  ? 135  MET F C     1 
ATOM   8235 O  O     . MET F  1 136 ? 85.594  29.008  12.243  1.00 63.60  ? 135  MET F O     1 
ATOM   8236 C  CB    A MET F  1 136 ? 82.986  29.561  13.184  0.60 70.01  ? 135  MET F CB    1 
ATOM   8237 C  CB    B MET F  1 136 ? 82.856  29.444  13.051  0.40 65.45  ? 135  MET F CB    1 
ATOM   8238 C  CG    A MET F  1 136 ? 81.480  29.690  13.192  0.60 80.76  ? 135  MET F CG    1 
ATOM   8239 C  CG    B MET F  1 136 ? 81.348  29.318  13.053  0.40 68.61  ? 135  MET F CG    1 
ATOM   8240 S  SD    A MET F  1 136 ? 81.114  31.458  13.383  0.60 80.84  ? 135  MET F SD    1 
ATOM   8241 S  SD    B MET F  1 136 ? 80.801  28.243  11.740  0.40 66.47  ? 135  MET F SD    1 
ATOM   8242 C  CE    . MET F  1 136 ? 81.949  32.151  11.940  0.60 82.60  ? 135  MET F CE    1 
ATOM   8243 N  N     . SER F  1 137 ? 85.832  27.970  14.197  1.00 58.58  ? 136  SER F N     1 
ATOM   8244 C  CA    . SER F  1 137 ? 87.240  28.308  14.305  1.00 59.09  ? 136  SER F CA    1 
ATOM   8245 C  C     . SER F  1 137 ? 88.112  27.586  13.294  1.00 56.33  ? 136  SER F C     1 
ATOM   8246 O  O     . SER F  1 137 ? 87.901  26.438  12.970  1.00 59.56  ? 136  SER F O     1 
ATOM   8247 C  CB    . SER F  1 137 ? 87.747  28.028  15.722  1.00 62.15  ? 136  SER F CB    1 
ATOM   8248 O  OG    . SER F  1 137 ? 88.969  28.693  15.922  1.00 63.98  ? 136  SER F OG    1 
ATOM   8249 N  N     . ARG F  1 138 ? 89.095  28.297  12.797  1.00 56.52  ? 137  ARG F N     1 
ATOM   8250 C  CA    . ARG F  1 138 ? 90.156  27.720  11.994  1.00 59.26  ? 137  ARG F CA    1 
ATOM   8251 C  C     . ARG F  1 138 ? 91.483  27.952  12.718  1.00 56.72  ? 137  ARG F C     1 
ATOM   8252 O  O     . ARG F  1 138 ? 92.534  28.044  12.093  1.00 60.24  ? 137  ARG F O     1 
ATOM   8253 C  CB    . ARG F  1 138 ? 90.158  28.366  10.603  1.00 63.38  ? 137  ARG F CB    1 
ATOM   8254 C  CG    . ARG F  1 138 ? 88.877  28.053  9.804   1.00 71.64  ? 137  ARG F CG    1 
ATOM   8255 C  CD    . ARG F  1 138 ? 88.904  28.627  8.418   1.00 88.32  ? 137  ARG F CD    1 
ATOM   8256 N  NE    . ARG F  1 138 ? 87.643  28.408  7.710   1.00 110.42 ? 137  ARG F NE    1 
ATOM   8257 N  N     . SER F  1 139 ? 91.400  28.091  14.039  1.00 58.08  ? 138  SER F N     1 
ATOM   8258 C  CA    . SER F  1 139 ? 92.568  28.330  14.889  1.00 58.35  ? 138  SER F CA    1 
ATOM   8259 C  C     . SER F  1 139 ? 93.461  27.121  14.947  1.00 56.99  ? 138  SER F C     1 
ATOM   8260 O  O     . SER F  1 139 ? 92.984  25.998  15.070  1.00 60.37  ? 138  SER F O     1 
ATOM   8261 C  CB    . SER F  1 139 ? 92.150  28.705  16.296  1.00 54.98  ? 138  SER F CB    1 
ATOM   8262 O  OG    . SER F  1 139 ? 93.256  28.764  17.134  1.00 54.01  ? 138  SER F OG    1 
ATOM   8263 N  N     . SER F  1 140 ? 94.756  27.402  14.839  1.00 54.25  ? 139  SER F N     1 
ATOM   8264 C  CA    . SER F  1 140 ? 95.845  26.454  14.954  1.00 56.41  ? 139  SER F CA    1 
ATOM   8265 C  C     . SER F  1 140 ? 96.516  26.539  16.312  1.00 53.37  ? 139  SER F C     1 
ATOM   8266 O  O     . SER F  1 140 ? 97.596  26.010  16.501  1.00 52.86  ? 139  SER F O     1 
ATOM   8267 C  CB    . SER F  1 140 ? 96.902  26.796  13.906  1.00 51.51  ? 139  SER F CB    1 
ATOM   8268 O  OG    . SER F  1 140 ? 96.475  26.314  12.667  1.00 68.96  ? 139  SER F OG    1 
ATOM   8269 N  N     . LEU F  1 141 ? 95.903  27.270  17.226  1.00 52.53  ? 140  LEU F N     1 
ATOM   8270 C  CA    . LEU F  1 141 ? 96.373  27.371  18.602  1.00 55.06  ? 140  LEU F CA    1 
ATOM   8271 C  C     . LEU F  1 141 ? 95.467  26.553  19.511  1.00 53.10  ? 140  LEU F C     1 
ATOM   8272 O  O     . LEU F  1 141 ? 94.314  26.277  19.139  1.00 56.44  ? 140  LEU F O     1 
ATOM   8273 C  CB    . LEU F  1 141 ? 96.347  28.828  19.061  1.00 48.92  ? 140  LEU F CB    1 
ATOM   8274 C  CG    . LEU F  1 141 ? 97.116  29.863  18.241  1.00 58.88  ? 140  LEU F CG    1 
ATOM   8275 C  CD1   . LEU F  1 141 ? 96.867  31.204  18.858  1.00 47.15  ? 140  LEU F CD1   1 
ATOM   8276 C  CD2   . LEU F  1 141 ? 98.589  29.590  18.229  1.00 54.15  ? 140  LEU F CD2   1 
ATOM   8277 N  N     . PRO F  1 142 ? 95.976  26.161  20.703  1.00 52.97  ? 141  PRO F N     1 
ATOM   8278 C  CA    . PRO F  1 142 ? 95.172  25.416  21.681  1.00 55.19  ? 141  PRO F CA    1 
ATOM   8279 C  C     . PRO F  1 142 ? 93.861  26.104  22.027  1.00 56.24  ? 141  PRO F C     1 
ATOM   8280 O  O     . PRO F  1 142 ? 93.751  27.339  21.924  1.00 59.73  ? 141  PRO F O     1 
ATOM   8281 C  CB    . PRO F  1 142 ? 96.086  25.325  22.941  1.00 53.84  ? 141  PRO F CB    1 
ATOM   8282 C  CG    . PRO F  1 142 ? 97.454  25.446  22.428  1.00 50.22  ? 141  PRO F CG    1 
ATOM   8283 C  CD    . PRO F  1 142 ? 97.366  26.348  21.171  1.00 48.99  ? 141  PRO F CD    1 
ATOM   8284 N  N     . VAL F  1 143 ? 92.878  25.307  22.448  1.00 55.73  ? 142  VAL F N     1 
ATOM   8285 C  CA    . VAL F  1 143 ? 91.556  25.845  22.697  1.00 56.99  ? 142  VAL F CA    1 
ATOM   8286 C  C     . VAL F  1 143 ? 91.576  26.923  23.785  1.00 54.00  ? 142  VAL F C     1 
ATOM   8287 O  O     . VAL F  1 143 ? 90.853  27.908  23.691  1.00 60.10  ? 142  VAL F O     1 
ATOM   8288 C  CB    . VAL F  1 143 ? 90.510  24.748  22.987  1.00 55.50  ? 142  VAL F CB    1 
ATOM   8289 C  CG1   . VAL F  1 143 ? 90.697  24.113  24.392  1.00 57.25  ? 142  VAL F CG1   1 
ATOM   8290 C  CG2   . VAL F  1 143 ? 89.125  25.362  22.858  1.00 66.34  ? 142  VAL F CG2   1 
ATOM   8291 N  N     . ASP F  1 144 ? 92.435  26.771  24.784  1.00 61.64  ? 143  ASP F N     1 
ATOM   8292 C  CA    . ASP F  1 144 ? 92.557  27.793  25.828  1.00 63.55  ? 143  ASP F CA    1 
ATOM   8293 C  C     . ASP F  1 144 ? 93.028  29.156  25.291  1.00 60.64  ? 143  ASP F C     1 
ATOM   8294 O  O     . ASP F  1 144 ? 92.414  30.174  25.590  1.00 61.57  ? 143  ASP F O     1 
ATOM   8295 C  CB    . ASP F  1 144 ? 93.470  27.312  26.958  1.00 69.36  ? 143  ASP F CB    1 
ATOM   8296 C  CG    . ASP F  1 144 ? 92.794  26.269  27.886  1.00 86.62  ? 143  ASP F CG    1 
ATOM   8297 O  OD1   . ASP F  1 144 ? 91.649  25.818  27.626  1.00 93.90  ? 143  ASP F OD1   1 
ATOM   8298 O  OD2   . ASP F  1 144 ? 93.434  25.894  28.896  1.00 102.78 ? 143  ASP F OD2   1 
ATOM   8299 N  N     . ASP F  1 145 ? 94.095  29.172  24.491  1.00 58.00  ? 144  ASP F N     1 
ATOM   8300 C  CA    . ASP F  1 145 ? 94.566  30.405  23.859  1.00 58.90  ? 144  ASP F CA    1 
ATOM   8301 C  C     . ASP F  1 145 ? 93.503  30.920  22.885  1.00 58.51  ? 144  ASP F C     1 
ATOM   8302 O  O     . ASP F  1 145 ? 93.213  32.106  22.828  1.00 58.31  ? 144  ASP F O     1 
ATOM   8303 C  CB    . ASP F  1 145 ? 95.872  30.221  23.062  1.00 58.88  ? 144  ASP F CB    1 
ATOM   8304 C  CG    . ASP F  1 145 ? 96.991  29.478  23.829  1.00 81.22  ? 144  ASP F CG    1 
ATOM   8305 O  OD1   . ASP F  1 145 ? 96.753  28.936  24.930  1.00 98.89  ? 144  ASP F OD1   1 
ATOM   8306 O  OD2   . ASP F  1 145 ? 98.125  29.402  23.273  1.00 88.20  ? 144  ASP F OD2   1 
ATOM   8307 N  N     . THR F  1 146 ? 92.919  30.014  22.106  1.00 59.45  ? 145  THR F N     1 
ATOM   8308 C  CA    . THR F  1 146 ? 91.894  30.410  21.168  1.00 57.65  ? 145  THR F CA    1 
ATOM   8309 C  C     . THR F  1 146 ? 90.704  31.065  21.901  1.00 56.07  ? 145  THR F C     1 
ATOM   8310 O  O     . THR F  1 146 ? 90.138  32.045  21.432  1.00 54.67  ? 145  THR F O     1 
ATOM   8311 C  CB    . THR F  1 146 ? 91.410  29.211  20.351  1.00 53.03  ? 145  THR F CB    1 
ATOM   8312 O  OG1   . THR F  1 146 ? 92.514  28.636  19.633  1.00 60.47  ? 145  THR F OG1   1 
ATOM   8313 C  CG2   . THR F  1 146 ? 90.315  29.633  19.395  1.00 57.52  ? 145  THR F CG2   1 
ATOM   8314 N  N     . THR F  1 147 ? 90.309  30.483  23.023  1.00 58.66  ? 146  THR F N     1 
ATOM   8315 C  CA    . THR F  1 147 ? 89.178  30.982  23.804  1.00 59.55  ? 146  THR F CA    1 
ATOM   8316 C  C     . THR F  1 147 ? 89.448  32.340  24.448  1.00 58.83  ? 146  THR F C     1 
ATOM   8317 O  O     . THR F  1 147 ? 88.505  33.122  24.616  1.00 60.97  ? 146  THR F O     1 
ATOM   8318 C  CB    . THR F  1 147 ? 88.789  29.969  24.888  1.00 62.41  ? 146  THR F CB    1 
ATOM   8319 O  OG1   . THR F  1 147 ? 88.374  28.771  24.253  1.00 61.00  ? 146  THR F OG1   1 
ATOM   8320 C  CG2   . THR F  1 147 ? 87.652  30.481  25.762  1.00 66.80  ? 146  THR F CG2   1 
ATOM   8321 N  N     . LYS F  1 148 ? 90.698  32.610  24.847  1.00 62.02  ? 147  LYS F N     1 
ATOM   8322 C  CA    . LYS F  1 148 ? 91.055  33.947  25.410  1.00 61.13  ? 147  LYS F CA    1 
ATOM   8323 C  C     . LYS F  1 148 ? 90.942  35.044  24.365  1.00 59.00  ? 147  LYS F C     1 
ATOM   8324 O  O     . LYS F  1 148 ? 90.590  36.181  24.658  1.00 60.71  ? 147  LYS F O     1 
ATOM   8325 C  CB    . LYS F  1 148 ? 92.454  33.960  26.025  1.00 62.18  ? 147  LYS F CB    1 
ATOM   8326 C  CG    . LYS F  1 148 ? 92.536  33.169  27.330  1.00 69.71  ? 147  LYS F CG    1 
ATOM   8327 C  CD    . LYS F  1 148 ? 93.976  32.876  27.768  1.00 75.75  ? 147  LYS F CD    1 
ATOM   8328 C  CE    . LYS F  1 148 ? 93.980  32.096  29.103  1.00 85.74  ? 147  LYS F CE    1 
ATOM   8329 N  NZ    . LYS F  1 148 ? 94.853  30.884  29.065  1.00 105.79 ? 147  LYS F NZ    1 
ATOM   8330 N  N     . THR F  1 149 ? 91.177  34.700  23.119  1.00 56.53  ? 148  THR F N     1 
ATOM   8331 C  CA    . THR F  1 149 ? 91.012  35.692  22.066  1.00 58.81  ? 148  THR F CA    1 
ATOM   8332 C  C     . THR F  1 149 ? 89.542  35.960  21.760  1.00 56.66  ? 148  THR F C     1 
ATOM   8333 O  O     . THR F  1 149 ? 89.148  37.098  21.521  1.00 57.46  ? 148  THR F O     1 
ATOM   8334 C  CB    . THR F  1 149 ? 91.766  35.272  20.805  1.00 60.18  ? 148  THR F CB    1 
ATOM   8335 O  OG1   . THR F  1 149 ? 93.145  35.119  21.137  1.00 66.06  ? 148  THR F OG1   1 
ATOM   8336 C  CG2   . THR F  1 149 ? 91.628  36.308  19.711  1.00 52.92  ? 148  THR F CG2   1 
ATOM   8337 N  N     . ILE F  1 150 ? 88.741  34.904  21.764  1.00 57.66  ? 149  ILE F N     1 
ATOM   8338 C  CA    . ILE F  1 150 ? 87.299  35.030  21.653  1.00 56.73  ? 149  ILE F CA    1 
ATOM   8339 C  C     . ILE F  1 150 ? 86.748  35.909  22.803  1.00 56.62  ? 149  ILE F C     1 
ATOM   8340 O  O     . ILE F  1 150 ? 85.938  36.789  22.574  1.00 59.23  ? 149  ILE F O     1 
ATOM   8341 C  CB    . ILE F  1 150 ? 86.620  33.631  21.658  1.00 61.16  ? 149  ILE F CB    1 
ATOM   8342 C  CG1   . ILE F  1 150 ? 86.888  32.904  20.314  1.00 59.34  ? 149  ILE F CG1   1 
ATOM   8343 C  CG2   . ILE F  1 150 ? 85.088  33.782  21.940  1.00 59.63  ? 149  ILE F CG2   1 
ATOM   8344 C  CD1   . ILE F  1 150 ? 86.715  31.383  20.351  1.00 53.48  ? 149  ILE F CD1   1 
ATOM   8345 N  N     . ALA F  1 151 ? 87.206  35.656  24.026  1.00 57.02  ? 150  ALA F N     1 
ATOM   8346 C  CA    . ALA F  1 151 ? 86.817  36.457  25.178  1.00 60.48  ? 150  ALA F CA    1 
ATOM   8347 C  C     . ALA F  1 151 ? 87.090  37.951  24.981  1.00 60.45  ? 150  ALA F C     1 
ATOM   8348 O  O     . ALA F  1 151 ? 86.287  38.772  25.414  1.00 61.27  ? 150  ALA F O     1 
ATOM   8349 C  CB    . ALA F  1 151 ? 87.479  35.951  26.419  1.00 56.27  ? 150  ALA F CB    1 
ATOM   8350 N  N     . LYS F  1 152 ? 88.201  38.290  24.317  1.00 59.80  ? 151  LYS F N     1 
ATOM   8351 C  CA    . LYS F  1 152 ? 88.523  39.675  23.982  1.00 57.81  ? 151  LYS F CA    1 
ATOM   8352 C  C     . LYS F  1 152 ? 87.492  40.308  23.040  1.00 55.82  ? 151  LYS F C     1 
ATOM   8353 O  O     . LYS F  1 152 ? 87.175  41.476  23.155  1.00 60.44  ? 151  LYS F O     1 
ATOM   8354 C  CB    . LYS F  1 152 ? 89.904  39.782  23.333  1.00 59.24  ? 151  LYS F CB    1 
ATOM   8355 C  CG    . LYS F  1 152 ? 91.076  39.718  24.276  1.00 61.43  ? 151  LYS F CG    1 
ATOM   8356 C  CD    . LYS F  1 152 ? 92.378  39.806  23.488  1.00 80.74  ? 151  LYS F CD    1 
ATOM   8357 C  CE    . LYS F  1 152 ? 93.580  39.367  24.320  1.00 93.14  ? 151  LYS F CE    1 
ATOM   8358 N  NZ    . LYS F  1 152 ? 93.695  40.139  25.603  1.00 113.75 ? 151  LYS F NZ    1 
ATOM   8359 N  N     . ARG F  1 153 ? 86.972  39.546  22.098  1.00 55.77  ? 152  ARG F N     1 
ATOM   8360 C  CA    . ARG F  1 153 ? 85.959  40.069  21.211  1.00 58.53  ? 152  ARG F CA    1 
ATOM   8361 C  C     . ARG F  1 153 ? 84.668  40.264  21.931  1.00 56.38  ? 152  ARG F C     1 
ATOM   8362 O  O     . ARG F  1 153 ? 83.929  41.197  21.617  1.00 61.08  ? 152  ARG F O     1 
ATOM   8363 C  CB    . ARG F  1 153 ? 85.685  39.132  20.041  1.00 65.11  ? 152  ARG F CB    1 
ATOM   8364 C  CG    . ARG F  1 153 ? 86.797  39.014  19.050  1.00 65.27  ? 152  ARG F CG    1 
ATOM   8365 C  CD    . ARG F  1 153 ? 86.407  38.052  17.940  1.00 70.59  ? 152  ARG F CD    1 
ATOM   8366 N  NE    . ARG F  1 153 ? 85.564  38.692  16.929  1.00 68.55  ? 152  ARG F NE    1 
ATOM   8367 C  CZ    . ARG F  1 153 ? 84.849  38.008  16.032  1.00 69.27  ? 152  ARG F CZ    1 
ATOM   8368 N  NH1   . ARG F  1 153 ? 84.872  36.683  16.043  1.00 57.00  ? 152  ARG F NH1   1 
ATOM   8369 N  NH2   . ARG F  1 153 ? 84.096  38.643  15.125  1.00 62.16  ? 152  ARG F NH2   1 
ATOM   8370 N  N     . LEU F  1 154 ? 84.363  39.350  22.850  1.00 57.23  ? 153  LEU F N     1 
ATOM   8371 C  CA    . LEU F  1 154 ? 83.146  39.465  23.651  1.00 56.90  ? 153  LEU F CA    1 
ATOM   8372 C  C     . LEU F  1 154 ? 83.234  40.713  24.528  1.00 54.29  ? 153  LEU F C     1 
ATOM   8373 O  O     . LEU F  1 154 ? 82.314  41.495  24.580  1.00 56.21  ? 153  LEU F O     1 
ATOM   8374 C  CB    . LEU F  1 154 ? 82.904  38.193  24.479  1.00 55.94  ? 153  LEU F CB    1 
ATOM   8375 C  CG    . LEU F  1 154 ? 82.722  36.883  23.673  1.00 61.04  ? 153  LEU F CG    1 
ATOM   8376 C  CD1   . LEU F  1 154 ? 82.246  35.776  24.587  1.00 66.88  ? 153  LEU F CD1   1 
ATOM   8377 C  CD2   . LEU F  1 154 ? 81.764  37.044  22.512  1.00 66.50  ? 153  LEU F CD2   1 
ATOM   8378 N  N     . GLU F  1 155 ? 84.361  40.880  25.208  1.00 53.33  ? 154  GLU F N     1 
ATOM   8379 C  CA    . GLU F  1 155 ? 84.619  42.055  26.036  1.00 56.80  ? 154  GLU F CA    1 
ATOM   8380 C  C     . GLU F  1 155 ? 84.450  43.347  25.265  1.00 56.74  ? 154  GLU F C     1 
ATOM   8381 O  O     . GLU F  1 155 ? 83.858  44.300  25.771  1.00 54.92  ? 154  GLU F O     1 
ATOM   8382 C  CB    . GLU F  1 155 ? 86.038  41.972  26.595  1.00 55.08  ? 154  GLU F CB    1 
ATOM   8383 C  CG    . GLU F  1 155 ? 86.171  40.910  27.700  1.00 62.47  ? 154  GLU F CG    1 
ATOM   8384 C  CD    . GLU F  1 155 ? 87.618  40.530  28.023  1.00 66.98  ? 154  GLU F CD    1 
ATOM   8385 O  OE1   . GLU F  1 155 ? 88.538  41.308  27.702  1.00 71.25  ? 154  GLU F OE1   1 
ATOM   8386 O  OE2   . GLU F  1 155 ? 87.829  39.437  28.598  1.00 83.21  ? 154  GLU F OE2   1 
ATOM   8387 N  N     . ALA F  1 156 ? 84.967  43.377  24.035  1.00 56.92  ? 155  ALA F N     1 
ATOM   8388 C  CA    . ALA F  1 156 ? 84.816  44.555  23.158  1.00 58.26  ? 155  ALA F CA    1 
ATOM   8389 C  C     . ALA F  1 156 ? 83.355  44.812  22.804  1.00 55.80  ? 155  ALA F C     1 
ATOM   8390 O  O     . ALA F  1 156 ? 82.911  45.958  22.777  1.00 59.36  ? 155  ALA F O     1 
ATOM   8391 C  CB    . ALA F  1 156 ? 85.625  44.380  21.899  1.00 57.10  ? 155  ALA F CB    1 
ATOM   8392 N  N     . TYR F  1 157 ? 82.612  43.745  22.525  1.00 55.86  ? 156  TYR F N     1 
ATOM   8393 C  CA    . TYR F  1 157 ? 81.188  43.863  22.294  1.00 53.39  ? 156  TYR F CA    1 
ATOM   8394 C  C     . TYR F  1 157 ? 80.459  44.430  23.514  1.00 57.89  ? 156  TYR F C     1 
ATOM   8395 O  O     . TYR F  1 157 ? 79.537  45.246  23.343  1.00 58.03  ? 156  TYR F O     1 
ATOM   8396 C  CB    . TYR F  1 157 ? 80.545  42.514  21.917  1.00 56.04  ? 156  TYR F CB    1 
ATOM   8397 C  CG    . TYR F  1 157 ? 79.032  42.601  21.929  1.00 53.17  ? 156  TYR F CG    1 
ATOM   8398 C  CD1   . TYR F  1 157 ? 78.362  43.371  20.980  1.00 52.27  ? 156  TYR F CD1   1 
ATOM   8399 C  CD2   . TYR F  1 157 ? 78.277  41.969  22.910  1.00 58.53  ? 156  TYR F CD2   1 
ATOM   8400 C  CE1   . TYR F  1 157 ? 76.980  43.507  20.987  1.00 57.58  ? 156  TYR F CE1   1 
ATOM   8401 C  CE2   . TYR F  1 157 ? 76.885  42.109  22.931  1.00 59.57  ? 156  TYR F CE2   1 
ATOM   8402 C  CZ    . TYR F  1 157 ? 76.249  42.881  21.959  1.00 56.05  ? 156  TYR F CZ    1 
ATOM   8403 O  OH    . TYR F  1 157 ? 74.883  43.015  21.950  1.00 61.84  ? 156  TYR F OH    1 
ATOM   8404 N  N     . TYR F  1 158 ? 80.816  43.977  24.731  1.00 56.01  ? 157  TYR F N     1 
ATOM   8405 C  CA    . TYR F  1 158 ? 80.123  44.474  25.942  1.00 52.49  ? 157  TYR F CA    1 
ATOM   8406 C  C     . TYR F  1 158 ? 80.393  45.972  26.130  1.00 55.11  ? 157  TYR F C     1 
ATOM   8407 O  O     . TYR F  1 158 ? 79.490  46.746  26.424  1.00 52.99  ? 157  TYR F O     1 
ATOM   8408 C  CB    . TYR F  1 158 ? 80.477  43.684  27.206  1.00 54.58  ? 157  TYR F CB    1 
ATOM   8409 C  CG    . TYR F  1 158 ? 80.015  42.243  27.181  1.00 52.04  ? 157  TYR F CG    1 
ATOM   8410 C  CD1   . TYR F  1 158 ? 78.696  41.926  26.888  1.00 60.90  ? 157  TYR F CD1   1 
ATOM   8411 C  CD2   . TYR F  1 158 ? 80.902  41.190  27.425  1.00 66.49  ? 157  TYR F CD2   1 
ATOM   8412 C  CE1   . TYR F  1 158 ? 78.266  40.613  26.845  1.00 57.57  ? 157  TYR F CE1   1 
ATOM   8413 C  CE2   . TYR F  1 158 ? 80.470  39.836  27.380  1.00 59.34  ? 157  TYR F CE2   1 
ATOM   8414 C  CZ    . TYR F  1 158 ? 79.155  39.569  27.094  1.00 59.94  ? 157  TYR F CZ    1 
ATOM   8415 O  OH    . TYR F  1 158 ? 78.694  38.280  27.065  1.00 61.33  ? 157  TYR F OH    1 
ATOM   8416 N  N     . ARG F  1 159 ? 81.642  46.367  25.936  1.00 57.22  ? 158  ARG F N     1 
ATOM   8417 C  CA    . ARG F  1 159 ? 82.012  47.767  25.968  1.00 59.02  ? 158  ARG F CA    1 
ATOM   8418 C  C     . ARG F  1 159 ? 81.254  48.645  24.956  1.00 58.22  ? 158  ARG F C     1 
ATOM   8419 O  O     . ARG F  1 159 ? 80.849  49.736  25.279  1.00 60.32  ? 158  ARG F O     1 
ATOM   8420 C  CB    . ARG F  1 159 ? 83.518  47.905  25.767  1.00 52.88  ? 158  ARG F CB    1 
ATOM   8421 C  CG    . ARG F  1 159 ? 84.292  47.547  26.995  1.00 60.63  ? 158  ARG F CG    1 
ATOM   8422 C  CD    . ARG F  1 159 ? 85.686  48.085  26.930  1.00 61.77  ? 158  ARG F CD    1 
ATOM   8423 N  NE    . ARG F  1 159 ? 86.395  47.693  25.703  1.00 76.61  ? 158  ARG F NE    1 
ATOM   8424 C  CZ    . ARG F  1 159 ? 87.094  46.564  25.532  1.00 70.12  ? 158  ARG F CZ    1 
ATOM   8425 N  NH1   . ARG F  1 159 ? 87.726  46.365  24.386  1.00 61.84  ? 158  ARG F NH1   1 
ATOM   8426 N  NH2   . ARG F  1 159 ? 87.190  45.641  26.492  1.00 71.18  ? 158  ARG F NH2   1 
ATOM   8427 N  N     . ALA F  1 160 ? 81.033  48.149  23.751  1.00 61.34  ? 159  ALA F N     1 
ATOM   8428 C  CA    . ALA F  1 160 ? 80.350  48.920  22.707  1.00 61.33  ? 159  ALA F CA    1 
ATOM   8429 C  C     . ALA F  1 160 ? 78.841  48.922  22.863  1.00 61.10  ? 159  ALA F C     1 
ATOM   8430 O  O     . ALA F  1 160 ? 78.161  49.911  22.561  1.00 68.84  ? 159  ALA F O     1 
ATOM   8431 C  CB    . ALA F  1 160 ? 80.724  48.357  21.342  1.00 66.36  ? 159  ALA F CB    1 
ATOM   8432 N  N     . SER F  1 161 ? 78.304  47.809  23.334  1.00 60.60  ? 160  SER F N     1 
ATOM   8433 C  CA    . SER F  1 161 ? 76.878  47.614  23.345  1.00 54.45  ? 160  SER F CA    1 
ATOM   8434 C  C     . SER F  1 161 ? 76.205  48.231  24.562  1.00 57.48  ? 160  SER F C     1 
ATOM   8435 O  O     . SER F  1 161 ? 75.139  48.823  24.434  1.00 58.71  ? 160  SER F O     1 
ATOM   8436 C  CB    . SER F  1 161 ? 76.547  46.109  23.252  1.00 61.23  ? 160  SER F CB    1 
ATOM   8437 O  OG    . SER F  1 161 ? 77.034  45.329  24.344  1.00 57.63  ? 160  SER F OG    1 
ATOM   8438 N  N     . ILE F  1 162 ? 76.806  48.090  25.747  1.00 55.49  ? 161  ILE F N     1 
ATOM   8439 C  CA    . ILE F  1 162 ? 76.100  48.462  26.966  1.00 57.36  ? 161  ILE F CA    1 
ATOM   8440 C  C     . ILE F  1 162 ? 75.672  49.928  26.952  1.00 54.60  ? 161  ILE F C     1 
ATOM   8441 O  O     . ILE F  1 162 ? 74.502  50.214  27.208  1.00 56.82  ? 161  ILE F O     1 
ATOM   8442 C  CB    . ILE F  1 162 ? 76.879  48.072  28.241  1.00 59.39  ? 161  ILE F CB    1 
ATOM   8443 C  CG1   . ILE F  1 162 ? 76.821  46.547  28.414  1.00 62.60  ? 161  ILE F CG1   1 
ATOM   8444 C  CG2   . ILE F  1 162 ? 76.300  48.763  29.495  1.00 56.92  ? 161  ILE F CG2   1 
ATOM   8445 C  CD1   . ILE F  1 162 ? 77.735  46.003  29.491  1.00 60.69  ? 161  ILE F CD1   1 
ATOM   8446 N  N     . PRO F  1 163 ? 76.605  50.856  26.649  1.00 53.84  ? 162  PRO F N     1 
ATOM   8447 C  CA    . PRO F  1 163 ? 76.270  52.282  26.650  1.00 54.04  ? 162  PRO F CA    1 
ATOM   8448 C  C     . PRO F  1 163 ? 75.313  52.736  25.534  1.00 53.46  ? 162  PRO F C     1 
ATOM   8449 O  O     . PRO F  1 163 ? 74.493  53.627  25.746  1.00 51.80  ? 162  PRO F O     1 
ATOM   8450 C  CB    . PRO F  1 163 ? 77.643  52.959  26.537  1.00 57.04  ? 162  PRO F CB    1 
ATOM   8451 C  CG    . PRO F  1 163 ? 78.635  51.889  26.904  1.00 49.49  ? 162  PRO F CG    1 
ATOM   8452 C  CD    . PRO F  1 163 ? 78.037  50.655  26.368  1.00 51.68  ? 162  PRO F CD    1 
ATOM   8453 N  N     . VAL F  1 164 ? 75.434  52.131  24.358  1.00 58.46  ? 163  VAL F N     1 
ATOM   8454 C  CA    . VAL F  1 164 ? 74.508  52.375  23.243  1.00 56.26  ? 163  VAL F CA    1 
ATOM   8455 C  C     . VAL F  1 164 ? 73.082  51.882  23.539  1.00 53.57  ? 163  VAL F C     1 
ATOM   8456 O  O     . VAL F  1 164 ? 72.096  52.603  23.324  1.00 56.16  ? 163  VAL F O     1 
ATOM   8457 C  CB    . VAL F  1 164 ? 75.032  51.726  21.951  1.00 57.46  ? 163  VAL F CB    1 
ATOM   8458 C  CG1   . VAL F  1 164 ? 73.961  51.708  20.883  1.00 57.79  ? 163  VAL F CG1   1 
ATOM   8459 C  CG2   . VAL F  1 164 ? 76.290  52.484  21.469  1.00 48.37  ? 163  VAL F CG2   1 
ATOM   8460 N  N     . ILE F  1 165 ? 72.970  50.666  24.048  1.00 56.72  ? 164  ILE F N     1 
ATOM   8461 C  CA    . ILE F  1 165 ? 71.671  50.124  24.397  1.00 54.81  ? 164  ILE F CA    1 
ATOM   8462 C  C     . ILE F  1 165 ? 70.983  50.996  25.438  1.00 54.52  ? 164  ILE F C     1 
ATOM   8463 O  O     . ILE F  1 165 ? 69.810  51.331  25.290  1.00 58.26  ? 164  ILE F O     1 
ATOM   8464 C  CB    . ILE F  1 165 ? 71.772  48.669  24.868  1.00 59.32  ? 164  ILE F CB    1 
ATOM   8465 C  CG1   . ILE F  1 165 ? 72.099  47.777  23.674  1.00 60.41  ? 164  ILE F CG1   1 
ATOM   8466 C  CG2   . ILE F  1 165 ? 70.449  48.219  25.526  1.00 58.68  ? 164  ILE F CG2   1 
ATOM   8467 C  CD1   . ILE F  1 165 ? 72.505  46.359  24.040  1.00 81.96  ? 164  ILE F CD1   1 
ATOM   8468 N  N     . ALA F  1 166 ? 71.717  51.393  26.471  1.00 53.57  ? 165  ALA F N     1 
ATOM   8469 C  CA    . ALA F  1 166 ? 71.160  52.248  27.520  1.00 52.09  ? 165  ALA F CA    1 
ATOM   8470 C  C     . ALA F  1 166 ? 70.731  53.614  27.015  1.00 49.64  ? 165  ALA F C     1 
ATOM   8471 O  O     . ALA F  1 166 ? 69.799  54.231  27.562  1.00 52.68  ? 165  ALA F O     1 
ATOM   8472 C  CB    . ALA F  1 166 ? 72.166  52.414  28.642  1.00 56.04  ? 165  ALA F CB    1 
ATOM   8473 N  N     . TYR F  1 167 ? 71.456  54.117  26.027  1.00 51.78  ? 166  TYR F N     1 
ATOM   8474 C  CA    . TYR F  1 167 ? 71.155  55.417  25.407  1.00 53.32  ? 166  TYR F CA    1 
ATOM   8475 C  C     . TYR F  1 167 ? 69.825  55.332  24.645  1.00 51.84  ? 166  TYR F C     1 
ATOM   8476 O  O     . TYR F  1 167 ? 68.913  56.076  24.915  1.00 55.15  ? 166  TYR F O     1 
ATOM   8477 C  CB    . TYR F  1 167 ? 72.296  55.831  24.462  1.00 49.14  ? 166  TYR F CB    1 
ATOM   8478 C  CG    . TYR F  1 167 ? 71.996  57.069  23.656  1.00 49.82  ? 166  TYR F CG    1 
ATOM   8479 C  CD1   . TYR F  1 167 ? 72.030  58.326  24.252  1.00 52.72  ? 166  TYR F CD1   1 
ATOM   8480 C  CD2   . TYR F  1 167 ? 71.692  56.995  22.297  1.00 55.49  ? 166  TYR F CD2   1 
ATOM   8481 C  CE1   . TYR F  1 167 ? 71.748  59.446  23.543  1.00 57.08  ? 166  TYR F CE1   1 
ATOM   8482 C  CE2   . TYR F  1 167 ? 71.389  58.140  21.566  1.00 50.61  ? 166  TYR F CE2   1 
ATOM   8483 C  CZ    . TYR F  1 167 ? 71.423  59.357  22.196  1.00 53.10  ? 166  TYR F CZ    1 
ATOM   8484 O  OH    . TYR F  1 167 ? 71.159  60.517  21.512  1.00 60.62  ? 166  TYR F OH    1 
ATOM   8485 N  N     . TYR F  1 168 ? 69.715  54.389  23.720  1.00 53.45  ? 167  TYR F N     1 
ATOM   8486 C  CA    . TYR F  1 168 ? 68.508  54.253  22.896  1.00 56.09  ? 167  TYR F CA    1 
ATOM   8487 C  C     . TYR F  1 168 ? 67.263  53.767  23.632  1.00 58.55  ? 167  TYR F C     1 
ATOM   8488 O  O     . TYR F  1 168 ? 66.132  53.993  23.166  1.00 57.00  ? 167  TYR F O     1 
ATOM   8489 C  CB    . TYR F  1 168 ? 68.783  53.368  21.685  1.00 51.20  ? 167  TYR F CB    1 
ATOM   8490 C  CG    . TYR F  1 168 ? 69.649  54.078  20.691  1.00 45.65  ? 167  TYR F CG    1 
ATOM   8491 C  CD1   . TYR F  1 168 ? 70.935  53.643  20.423  1.00 54.71  ? 167  TYR F CD1   1 
ATOM   8492 C  CD2   . TYR F  1 168 ? 69.186  55.231  20.034  1.00 62.36  ? 167  TYR F CD2   1 
ATOM   8493 C  CE1   . TYR F  1 168 ? 71.751  54.312  19.502  1.00 61.56  ? 167  TYR F CE1   1 
ATOM   8494 C  CE2   . TYR F  1 168 ? 69.985  55.906  19.119  1.00 51.99  ? 167  TYR F CE2   1 
ATOM   8495 C  CZ    . TYR F  1 168 ? 71.273  55.435  18.863  1.00 52.74  ? 167  TYR F CZ    1 
ATOM   8496 O  OH    . TYR F  1 168 ? 72.082  56.087  17.978  1.00 63.40  ? 167  TYR F OH    1 
ATOM   8497 N  N     . GLU F  1 169 ? 67.471  53.108  24.770  1.00 59.65  ? 168  GLU F N     1 
ATOM   8498 C  CA    . GLU F  1 169 ? 66.375  52.735  25.662  1.00 64.14  ? 168  GLU F CA    1 
ATOM   8499 C  C     . GLU F  1 169 ? 65.583  53.971  26.063  1.00 61.17  ? 168  GLU F C     1 
ATOM   8500 O  O     . GLU F  1 169 ? 64.359  53.920  26.178  1.00 58.66  ? 168  GLU F O     1 
ATOM   8501 C  CB    . GLU F  1 169 ? 66.906  52.023  26.918  1.00 62.28  ? 168  GLU F CB    1 
ATOM   8502 C  CG    . GLU F  1 169 ? 67.064  50.517  26.737  1.00 84.04  ? 168  GLU F CG    1 
ATOM   8503 C  CD    . GLU F  1 169 ? 67.759  49.819  27.915  1.00 78.51  ? 168  GLU F CD    1 
ATOM   8504 O  OE1   . GLU F  1 169 ? 68.034  50.483  28.944  1.00 95.40  ? 168  GLU F OE1   1 
ATOM   8505 O  OE2   . GLU F  1 169 ? 68.025  48.597  27.801  1.00 102.71 ? 168  GLU F OE2   1 
ATOM   8506 N  N     . THR F  1 170 ? 66.299  55.072  26.277  1.00 63.57  ? 169  THR F N     1 
ATOM   8507 C  CA    . THR F  1 170 ? 65.688  56.346  26.678  1.00 65.80  ? 169  THR F CA    1 
ATOM   8508 C  C     . THR F  1 170 ? 65.075  57.093  25.472  1.00 66.62  ? 169  THR F C     1 
ATOM   8509 O  O     . THR F  1 170 ? 64.204  57.949  25.642  1.00 69.71  ? 169  THR F O     1 
ATOM   8510 C  CB    . THR F  1 170 ? 66.729  57.283  27.379  1.00 66.21  ? 169  THR F CB    1 
ATOM   8511 O  OG1   . THR F  1 170 ? 67.683  57.794  26.432  1.00 68.00  ? 169  THR F OG1   1 
ATOM   8512 C  CG2   . THR F  1 170 ? 67.488  56.546  28.454  1.00 66.72  ? 169  THR F CG2   1 
ATOM   8513 N  N     . LYS F  1 171 ? 65.520  56.751  24.263  1.00 67.03  ? 170  LYS F N     1 
ATOM   8514 C  CA    . LYS F  1 171 ? 65.267  57.555  23.057  1.00 65.87  ? 170  LYS F CA    1 
ATOM   8515 C  C     . LYS F  1 171 ? 64.220  56.959  22.094  1.00 65.46  ? 170  LYS F C     1 
ATOM   8516 O  O     . LYS F  1 171 ? 63.451  57.703  21.503  1.00 68.29  ? 170  LYS F O     1 
ATOM   8517 C  CB    . LYS F  1 171 ? 66.595  57.780  22.302  1.00 62.32  ? 170  LYS F CB    1 
ATOM   8518 C  CG    . LYS F  1 171 ? 67.234  59.163  22.501  1.00 73.18  ? 170  LYS F CG    1 
ATOM   8519 C  CD    . LYS F  1 171 ? 67.651  59.480  23.932  1.00 68.57  ? 170  LYS F CD    1 
ATOM   8520 N  N     . THR F  1 172 ? 64.200  55.637  21.924  1.00 67.39  ? 171  THR F N     1 
ATOM   8521 C  CA    . THR F  1 172 ? 63.399  54.990  20.853  1.00 63.70  ? 171  THR F CA    1 
ATOM   8522 C  C     . THR F  1 172 ? 62.879  53.610  21.286  1.00 61.13  ? 171  THR F C     1 
ATOM   8523 O  O     . THR F  1 172 ? 62.966  53.240  22.459  1.00 60.51  ? 171  THR F O     1 
ATOM   8524 C  CB    . THR F  1 172 ? 64.220  54.869  19.493  1.00 63.57  ? 171  THR F CB    1 
ATOM   8525 O  OG1   . THR F  1 172 ? 63.390  54.375  18.437  1.00 62.01  ? 171  THR F OG1   1 
ATOM   8526 C  CG2   . THR F  1 172 ? 65.405  53.924  19.609  1.00 57.71  ? 171  THR F CG2   1 
ATOM   8527 N  N     . GLN F  1 173 ? 62.344  52.863  20.327  1.00 58.32  ? 172  GLN F N     1 
ATOM   8528 C  CA    . GLN F  1 173 ? 61.851  51.510  20.552  1.00 58.38  ? 172  GLN F CA    1 
ATOM   8529 C  C     . GLN F  1 173 ? 63.053  50.592  20.517  1.00 56.53  ? 172  GLN F C     1 
ATOM   8530 O  O     . GLN F  1 173 ? 63.747  50.534  19.524  1.00 56.61  ? 172  GLN F O     1 
ATOM   8531 C  CB    . GLN F  1 173 ? 60.849  51.102  19.453  1.00 60.42  ? 172  GLN F CB    1 
ATOM   8532 C  CG    . GLN F  1 173 ? 59.611  50.343  19.928  1.00 71.18  ? 172  GLN F CG    1 
ATOM   8533 C  CD    . GLN F  1 173 ? 58.786  51.118  20.939  1.00 78.57  ? 172  GLN F CD    1 
ATOM   8534 O  OE1   . GLN F  1 173 ? 58.700  52.347  20.890  1.00 79.16  ? 172  GLN F OE1   1 
ATOM   8535 N  NE2   . GLN F  1 173 ? 58.180  50.398  21.868  1.00 81.94  ? 172  GLN F NE2   1 
ATOM   8536 N  N     . LEU F  1 174 ? 63.311  49.902  21.616  1.00 54.63  ? 173  LEU F N     1 
ATOM   8537 C  CA    . LEU F  1 174 ? 64.394  48.955  21.687  1.00 57.62  ? 173  LEU F CA    1 
ATOM   8538 C  C     . LEU F  1 174 ? 63.838  47.584  22.085  1.00 54.17  ? 173  LEU F C     1 
ATOM   8539 O  O     . LEU F  1 174 ? 63.108  47.482  23.046  1.00 56.68  ? 173  LEU F O     1 
ATOM   8540 C  CB    . LEU F  1 174 ? 65.461  49.467  22.672  1.00 62.68  ? 173  LEU F CB    1 
ATOM   8541 C  CG    . LEU F  1 174 ? 66.786  48.681  22.723  1.00 67.39  ? 173  LEU F CG    1 
ATOM   8542 C  CD1   . LEU F  1 174 ? 67.978  49.613  22.840  1.00 74.76  ? 173  LEU F CD1   1 
ATOM   8543 C  CD2   . LEU F  1 174 ? 66.776  47.666  23.871  1.00 70.95  ? 173  LEU F CD2   1 
ATOM   8544 N  N     . HIS F  1 175 ? 64.177  46.545  21.321  1.00 57.60  ? 174  HIS F N     1 
ATOM   8545 C  CA    . HIS F  1 175 ? 63.704  45.167  21.548  1.00 55.56  ? 174  HIS F CA    1 
ATOM   8546 C  C     . HIS F  1 175 ? 64.870  44.203  21.727  1.00 57.82  ? 174  HIS F C     1 
ATOM   8547 O  O     . HIS F  1 175 ? 65.731  44.093  20.846  1.00 56.52  ? 174  HIS F O     1 
ATOM   8548 C  CB    . HIS F  1 175 ? 62.913  44.678  20.337  1.00 58.83  ? 174  HIS F CB    1 
ATOM   8549 C  CG    . HIS F  1 175 ? 61.473  45.080  20.342  1.00 68.01  ? 174  HIS F CG    1 
ATOM   8550 N  ND1   . HIS F  1 175 ? 61.065  46.392  20.217  1.00 63.23  ? 174  HIS F ND1   1 
ATOM   8551 C  CD2   . HIS F  1 175 ? 60.343  44.337  20.420  1.00 64.64  ? 174  HIS F CD2   1 
ATOM   8552 C  CE1   . HIS F  1 175 ? 59.743  46.440  20.232  1.00 70.88  ? 174  HIS F CE1   1 
ATOM   8553 N  NE2   . HIS F  1 175 ? 59.282  45.207  20.354  1.00 71.70  ? 174  HIS F NE2   1 
ATOM   8554 N  N     . LYS F  1 176 ? 64.893  43.497  22.852  1.00 58.31  ? 175  LYS F N     1 
ATOM   8555 C  CA    . LYS F  1 176 ? 65.942  42.523  23.142  1.00 61.78  ? 175  LYS F CA    1 
ATOM   8556 C  C     . LYS F  1 176 ? 65.471  41.150  22.657  1.00 63.74  ? 175  LYS F C     1 
ATOM   8557 O  O     . LYS F  1 176 ? 64.436  40.657  23.088  1.00 67.47  ? 175  LYS F O     1 
ATOM   8558 C  CB    . LYS F  1 176 ? 66.254  42.528  24.636  1.00 62.29  ? 175  LYS F CB    1 
ATOM   8559 C  CG    . LYS F  1 176 ? 67.052  43.776  25.082  1.00 80.62  ? 175  LYS F CG    1 
ATOM   8560 C  CD    . LYS F  1 176 ? 66.805  44.182  26.554  1.00 79.89  ? 175  LYS F CD    1 
ATOM   8561 N  N     . ILE F  1 177 ? 66.196  40.554  21.724  1.00 62.29  ? 176  ILE F N     1 
ATOM   8562 C  CA    . ILE F  1 177 ? 65.820  39.256  21.186  1.00 63.05  ? 176  ILE F CA    1 
ATOM   8563 C  C     . ILE F  1 177 ? 66.676  38.211  21.880  1.00 62.21  ? 176  ILE F C     1 
ATOM   8564 O  O     . ILE F  1 177 ? 67.848  38.454  22.143  1.00 61.65  ? 176  ILE F O     1 
ATOM   8565 C  CB    . ILE F  1 177 ? 66.017  39.208  19.630  1.00 68.99  ? 176  ILE F CB    1 
ATOM   8566 C  CG1   . ILE F  1 177 ? 64.766  39.737  18.915  1.00 79.25  ? 176  ILE F CG1   1 
ATOM   8567 C  CG2   . ILE F  1 177 ? 66.298  37.780  19.121  1.00 64.07  ? 176  ILE F CG2   1 
ATOM   8568 C  CD1   . ILE F  1 177 ? 64.501  41.197  19.131  1.00 88.01  ? 176  ILE F CD1   1 
ATOM   8569 N  N     . ASN F  1 178 ? 66.096  37.057  22.190  1.00 61.40  ? 177  ASN F N     1 
ATOM   8570 C  CA    . ASN F  1 178 ? 66.866  35.959  22.759  1.00 60.17  ? 177  ASN F CA    1 
ATOM   8571 C  C     . ASN F  1 178 ? 67.505  35.129  21.658  1.00 59.30  ? 177  ASN F C     1 
ATOM   8572 O  O     . ASN F  1 178 ? 66.858  34.290  21.047  1.00 61.93  ? 177  ASN F O     1 
ATOM   8573 C  CB    . ASN F  1 178 ? 66.002  35.058  23.640  1.00 60.06  ? 177  ASN F CB    1 
ATOM   8574 C  CG    . ASN F  1 178 ? 66.811  33.969  24.318  1.00 61.65  ? 177  ASN F CG    1 
ATOM   8575 O  OD1   . ASN F  1 178 ? 68.037  33.946  24.228  1.00 52.29  ? 177  ASN F OD1   1 
ATOM   8576 N  ND2   . ASN F  1 178 ? 66.126  33.056  25.001  1.00 69.18  ? 177  ASN F ND2   1 
ATOM   8577 N  N     . ALA F  1 179 ? 68.796  35.346  21.449  1.00 59.74  ? 178  ALA F N     1 
ATOM   8578 C  CA    . ALA F  1 179 ? 69.529  34.696  20.390  1.00 57.78  ? 178  ALA F CA    1 
ATOM   8579 C  C     . ALA F  1 179 ? 70.103  33.334  20.790  1.00 57.80  ? 178  ALA F C     1 
ATOM   8580 O  O     . ALA F  1 179 ? 70.918  32.787  20.075  1.00 57.42  ? 178  ALA F O     1 
ATOM   8581 C  CB    . ALA F  1 179 ? 70.624  35.619  19.894  1.00 59.20  ? 178  ALA F CB    1 
ATOM   8582 N  N     . GLU F  1 180 ? 69.663  32.785  21.917  1.00 59.16  ? 179  GLU F N     1 
ATOM   8583 C  CA    . GLU F  1 180 ? 70.038  31.446  22.315  1.00 57.98  ? 179  GLU F CA    1 
ATOM   8584 C  C     . GLU F  1 180 ? 69.233  30.416  21.534  1.00 59.86  ? 179  GLU F C     1 
ATOM   8585 O  O     . GLU F  1 180 ? 69.622  29.248  21.452  1.00 61.68  ? 179  GLU F O     1 
ATOM   8586 C  CB    . GLU F  1 180 ? 69.783  31.244  23.806  1.00 56.87  ? 179  GLU F CB    1 
ATOM   8587 C  CG    . GLU F  1 180 ? 70.610  32.141  24.713  1.00 63.94  ? 179  GLU F CG    1 
ATOM   8588 C  CD    . GLU F  1 180 ? 72.011  31.628  24.960  1.00 70.70  ? 179  GLU F CD    1 
ATOM   8589 O  OE1   . GLU F  1 180 ? 72.786  32.364  25.593  1.00 79.26  ? 179  GLU F OE1   1 
ATOM   8590 O  OE2   . GLU F  1 180 ? 72.345  30.497  24.548  1.00 61.20  ? 179  GLU F OE2   1 
ATOM   8591 N  N     . GLY F  1 181 ? 68.098  30.837  20.983  1.00 58.22  ? 180  GLY F N     1 
ATOM   8592 C  CA    . GLY F  1 181 ? 67.207  29.921  20.307  1.00 56.49  ? 180  GLY F CA    1 
ATOM   8593 C  C     . GLY F  1 181 ? 67.707  29.477  18.944  1.00 56.57  ? 180  GLY F C     1 
ATOM   8594 O  O     . GLY F  1 181 ? 68.862  29.674  18.578  1.00 57.39  ? 180  GLY F O     1 
ATOM   8595 N  N     . THR F  1 182 ? 66.818  28.847  18.194  1.00 57.20  ? 181  THR F N     1 
ATOM   8596 C  CA    . THR F  1 182 ? 67.137  28.404  16.846  1.00 57.62  ? 181  THR F CA    1 
ATOM   8597 C  C     . THR F  1 182 ? 67.116  29.616  15.929  1.00 55.94  ? 181  THR F C     1 
ATOM   8598 O  O     . THR F  1 182 ? 66.436  30.601  16.214  1.00 57.46  ? 181  THR F O     1 
ATOM   8599 C  CB    . THR F  1 182 ? 66.118  27.383  16.342  1.00 55.03  ? 181  THR F CB    1 
ATOM   8600 O  OG1   . THR F  1 182 ? 64.810  27.945  16.454  1.00 61.57  ? 181  THR F OG1   1 
ATOM   8601 C  CG2   . THR F  1 182 ? 66.184  26.109  17.170  1.00 56.43  ? 181  THR F CG2   1 
ATOM   8602 N  N     . PRO F  1 183 ? 67.864  29.562  14.828  1.00 56.06  ? 182  PRO F N     1 
ATOM   8603 C  CA    . PRO F  1 183 ? 67.800  30.690  13.890  1.00 59.08  ? 182  PRO F CA    1 
ATOM   8604 C  C     . PRO F  1 183 ? 66.368  31.029  13.433  1.00 60.33  ? 182  PRO F C     1 
ATOM   8605 O  O     . PRO F  1 183 ? 66.061  32.196  13.162  1.00 62.09  ? 182  PRO F O     1 
ATOM   8606 C  CB    . PRO F  1 183 ? 68.663  30.217  12.715  1.00 62.39  ? 182  PRO F CB    1 
ATOM   8607 C  CG    . PRO F  1 183 ? 69.593  29.177  13.322  1.00 60.57  ? 182  PRO F CG    1 
ATOM   8608 C  CD    . PRO F  1 183 ? 68.800  28.509  14.392  1.00 54.73  ? 182  PRO F CD    1 
ATOM   8609 N  N     . GLU F  1 184 ? 65.509  30.013  13.376  1.00 60.26  ? 183  GLU F N     1 
ATOM   8610 C  CA    . GLU F  1 184 ? 64.135  30.167  12.931  1.00 61.73  ? 183  GLU F CA    1 
ATOM   8611 C  C     . GLU F  1 184 ? 63.245  30.734  14.038  1.00 59.65  ? 183  GLU F C     1 
ATOM   8612 O  O     . GLU F  1 184 ? 62.283  31.445  13.765  1.00 59.31  ? 183  GLU F O     1 
ATOM   8613 C  CB    . GLU F  1 184 ? 63.593  28.813  12.456  1.00 65.42  ? 183  GLU F CB    1 
ATOM   8614 C  CG    . GLU F  1 184 ? 64.421  28.137  11.329  1.00 73.61  ? 183  GLU F CG    1 
ATOM   8615 C  CD    . GLU F  1 184 ? 65.621  27.309  11.827  1.00 85.58  ? 183  GLU F CD    1 
ATOM   8616 O  OE1   . GLU F  1 184 ? 65.640  26.859  13.003  1.00 78.08  ? 183  GLU F OE1   1 
ATOM   8617 O  OE2   . GLU F  1 184 ? 66.557  27.109  11.022  1.00 86.97  ? 183  GLU F OE2   1 
ATOM   8618 N  N     . ASP F  1 185 ? 63.546  30.393  15.284  1.00 57.94  ? 184  ASP F N     1 
ATOM   8619 C  CA    . ASP F  1 185 ? 62.851  30.993  16.427  1.00 63.73  ? 184  ASP F CA    1 
ATOM   8620 C  C     . ASP F  1 185 ? 63.280  32.448  16.586  1.00 59.26  ? 184  ASP F C     1 
ATOM   8621 O  O     . ASP F  1 185 ? 62.469  33.324  16.874  1.00 60.27  ? 184  ASP F O     1 
ATOM   8622 C  CB    . ASP F  1 185 ? 63.162  30.234  17.722  1.00 69.74  ? 184  ASP F CB    1 
ATOM   8623 C  CG    . ASP F  1 185 ? 62.432  30.809  18.934  1.00 88.00  ? 184  ASP F CG    1 
ATOM   8624 O  OD1   . ASP F  1 185 ? 61.184  30.953  18.867  1.00 93.21  ? 184  ASP F OD1   1 
ATOM   8625 O  OD2   . ASP F  1 185 ? 63.108  31.104  19.951  1.00 89.92  ? 184  ASP F OD2   1 
ATOM   8626 N  N     . VAL F  1 186 ? 64.568  32.703  16.398  1.00 57.28  ? 185  VAL F N     1 
ATOM   8627 C  CA    . VAL F  1 186 ? 65.089  34.046  16.523  1.00 55.81  ? 185  VAL F CA    1 
ATOM   8628 C  C     . VAL F  1 186 ? 64.515  34.939  15.428  1.00 54.42  ? 185  VAL F C     1 
ATOM   8629 O  O     . VAL F  1 186 ? 64.136  36.066  15.692  1.00 57.75  ? 185  VAL F O     1 
ATOM   8630 C  CB    . VAL F  1 186 ? 66.631  34.044  16.463  1.00 56.45  ? 185  VAL F CB    1 
ATOM   8631 C  CG1   . VAL F  1 186 ? 67.158  35.459  16.447  1.00 54.68  ? 185  VAL F CG1   1 
ATOM   8632 C  CG2   . VAL F  1 186 ? 67.211  33.270  17.647  1.00 56.41  ? 185  VAL F CG2   1 
ATOM   8633 N  N     . PHE F  1 187 ? 64.456  34.435  14.198  1.00 55.26  ? 186  PHE F N     1 
ATOM   8634 C  CA    . PHE F  1 187 ? 63.878  35.200  13.087  1.00 54.35  ? 186  PHE F CA    1 
ATOM   8635 C  C     . PHE F  1 187 ? 62.428  35.588  13.360  1.00 55.09  ? 186  PHE F C     1 
ATOM   8636 O  O     . PHE F  1 187 ? 62.045  36.735  13.135  1.00 57.20  ? 186  PHE F O     1 
ATOM   8637 C  CB    . PHE F  1 187 ? 63.993  34.432  11.768  1.00 57.77  ? 186  PHE F CB    1 
ATOM   8638 C  CG    . PHE F  1 187 ? 63.500  35.206  10.565  1.00 64.18  ? 186  PHE F CG    1 
ATOM   8639 C  CD1   . PHE F  1 187 ? 64.094  36.406  10.193  1.00 65.39  ? 186  PHE F CD1   1 
ATOM   8640 C  CD2   . PHE F  1 187 ? 62.441  34.732  9.806   1.00 57.25  ? 186  PHE F CD2   1 
ATOM   8641 C  CE1   . PHE F  1 187 ? 63.631  37.115  9.086   1.00 59.84  ? 186  PHE F CE1   1 
ATOM   8642 C  CE2   . PHE F  1 187 ? 61.987  35.442  8.691   1.00 61.61  ? 186  PHE F CE2   1 
ATOM   8643 C  CZ    . PHE F  1 187 ? 62.586  36.630  8.340   1.00 56.29  ? 186  PHE F CZ    1 
ATOM   8644 N  N     . LEU F  1 188 ? 61.631  34.645  13.857  1.00 55.34  ? 187  LEU F N     1 
ATOM   8645 C  CA    . LEU F  1 188 ? 60.251  34.943  14.254  1.00 57.58  ? 187  LEU F CA    1 
ATOM   8646 C  C     . LEU F  1 188 ? 60.163  36.033  15.324  1.00 58.46  ? 187  LEU F C     1 
ATOM   8647 O  O     . LEU F  1 188 ? 59.248  36.852  15.298  1.00 60.15  ? 187  LEU F O     1 
ATOM   8648 C  CB    . LEU F  1 188 ? 59.545  33.687  14.765  1.00 61.23  ? 187  LEU F CB    1 
ATOM   8649 C  CG    . LEU F  1 188 ? 59.109  32.681  13.704  1.00 70.01  ? 187  LEU F CG    1 
ATOM   8650 C  CD1   . LEU F  1 188 ? 58.828  31.342  14.368  1.00 71.69  ? 187  LEU F CD1   1 
ATOM   8651 C  CD2   . LEU F  1 188 ? 57.882  33.176  12.928  1.00 69.13  ? 187  LEU F CD2   1 
ATOM   8652 N  N     . GLN F  1 189 ? 61.105  36.042  16.263  1.00 61.68  ? 188  GLN F N     1 
ATOM   8653 C  CA    . GLN F  1 189 ? 61.163  37.104  17.265  1.00 64.02  ? 188  GLN F CA    1 
ATOM   8654 C  C     . GLN F  1 189 ? 61.453  38.453  16.604  1.00 59.59  ? 188  GLN F C     1 
ATOM   8655 O  O     . GLN F  1 189 ? 60.786  39.443  16.877  1.00 58.09  ? 188  GLN F O     1 
ATOM   8656 C  CB    . GLN F  1 189 ? 62.224  36.802  18.317  1.00 63.60  ? 188  GLN F CB    1 
ATOM   8657 C  CG    . GLN F  1 189 ? 61.894  35.652  19.269  1.00 69.75  ? 188  GLN F CG    1 
ATOM   8658 C  CD    . GLN F  1 189 ? 63.007  35.439  20.296  1.00 79.82  ? 188  GLN F CD    1 
ATOM   8659 O  OE1   . GLN F  1 189 ? 63.277  36.320  21.129  1.00 77.89  ? 188  GLN F OE1   1 
ATOM   8660 N  NE2   . GLN F  1 189 ? 63.671  34.278  20.229  1.00 79.82  ? 188  GLN F NE2   1 
ATOM   8661 N  N     . LEU F  1 190 ? 62.450  38.471  15.727  1.00 59.22  ? 189  LEU F N     1 
ATOM   8662 C  CA    . LEU F  1 190 ? 62.843  39.685  15.006  1.00 60.36  ? 189  LEU F CA    1 
ATOM   8663 C  C     . LEU F  1 190 ? 61.708  40.266  14.164  1.00 58.78  ? 189  LEU F C     1 
ATOM   8664 O  O     . LEU F  1 190 ? 61.529  41.484  14.118  1.00 59.38  ? 189  LEU F O     1 
ATOM   8665 C  CB    . LEU F  1 190 ? 64.050  39.404  14.107  1.00 60.75  ? 189  LEU F CB    1 
ATOM   8666 C  CG    . LEU F  1 190 ? 65.405  39.285  14.814  1.00 66.58  ? 189  LEU F CG    1 
ATOM   8667 C  CD1   . LEU F  1 190 ? 66.464  38.774  13.880  1.00 69.68  ? 189  LEU F CD1   1 
ATOM   8668 C  CD2   . LEU F  1 190 ? 65.834  40.596  15.343  1.00 71.06  ? 189  LEU F CD2   1 
ATOM   8669 N  N     . CYS F  1 191 ? 60.956  39.395  13.500  1.00 55.01  ? 190  CYS F N     1 
ATOM   8670 C  CA    . CYS F  1 191 ? 59.808  39.822  12.704  1.00 58.38  ? 190  CYS F CA    1 
ATOM   8671 C  C     . CYS F  1 191 ? 58.679  40.393  13.546  1.00 56.56  ? 190  CYS F C     1 
ATOM   8672 O  O     . CYS F  1 191 ? 58.023  41.349  13.130  1.00 59.48  ? 190  CYS F O     1 
ATOM   8673 C  CB    . CYS F  1 191 ? 59.288  38.674  11.841  1.00 52.58  ? 190  CYS F CB    1 
ATOM   8674 S  SG    . CYS F  1 191 ? 60.497  38.215  10.611  1.00 55.95  ? 190  CYS F SG    1 
ATOM   8675 N  N     . THR F  1 192 ? 58.454  39.808  14.719  1.00 57.05  ? 191  THR F N     1 
ATOM   8676 C  CA    . THR F  1 192 ? 57.500  40.367  15.682  1.00 60.18  ? 191  THR F CA    1 
ATOM   8677 C  C     . THR F  1 192 ? 57.882  41.810  16.040  1.00 59.67  ? 191  THR F C     1 
ATOM   8678 O  O     . THR F  1 192 ? 57.034  42.703  16.008  1.00 61.23  ? 191  THR F O     1 
ATOM   8679 C  CB    . THR F  1 192 ? 57.385  39.491  16.969  1.00 62.92  ? 191  THR F CB    1 
ATOM   8680 O  OG1   . THR F  1 192 ? 56.717  38.259  16.657  1.00 57.34  ? 191  THR F OG1   1 
ATOM   8681 C  CG2   . THR F  1 192 ? 56.600  40.212  18.064  1.00 61.01  ? 191  THR F CG2   1 
ATOM   8682 N  N     . ALA F  1 193 ? 59.156  42.034  16.359  1.00 59.48  ? 192  ALA F N     1 
ATOM   8683 C  CA    . ALA F  1 193 ? 59.634  43.375  16.710  1.00 59.15  ? 192  ALA F CA    1 
ATOM   8684 C  C     . ALA F  1 193 ? 59.455  44.360  15.558  1.00 59.24  ? 192  ALA F C     1 
ATOM   8685 O  O     . ALA F  1 193 ? 59.032  45.491  15.775  1.00 60.39  ? 192  ALA F O     1 
ATOM   8686 C  CB    . ALA F  1 193 ? 61.081  43.326  17.121  1.00 60.31  ? 192  ALA F CB    1 
ATOM   8687 N  N     . ILE F  1 194 ? 59.769  43.921  14.342  1.00 56.35  ? 193  ILE F N     1 
ATOM   8688 C  CA    . ILE F  1 194 ? 59.757  44.805  13.184  1.00 56.98  ? 193  ILE F CA    1 
ATOM   8689 C  C     . ILE F  1 194 ? 58.338  45.103  12.720  1.00 59.57  ? 193  ILE F C     1 
ATOM   8690 O  O     . ILE F  1 194 ? 58.028  46.243  12.365  1.00 57.68  ? 193  ILE F O     1 
ATOM   8691 C  CB    . ILE F  1 194 ? 60.594  44.223  12.008  1.00 55.56  ? 193  ILE F CB    1 
ATOM   8692 C  CG1   . ILE F  1 194 ? 62.080  44.250  12.367  1.00 59.89  ? 193  ILE F CG1   1 
ATOM   8693 C  CG2   . ILE F  1 194 ? 60.373  45.022  10.722  1.00 45.47  ? 193  ILE F CG2   1 
ATOM   8694 C  CD1   . ILE F  1 194 ? 62.927  43.403  11.487  1.00 66.18  ? 193  ILE F CD1   1 
ATOM   8695 N  N     . ASP F  1 195 ? 57.491  44.073  12.703  1.00 59.88  ? 194  ASP F N     1 
ATOM   8696 C  CA    . ASP F  1 195 ? 56.078  44.238  12.381  1.00 57.27  ? 194  ASP F CA    1 
ATOM   8697 C  C     . ASP F  1 195 ? 55.419  45.225  13.358  1.00 57.94  ? 194  ASP F C     1 
ATOM   8698 O  O     . ASP F  1 195 ? 54.712  46.128  12.935  1.00 59.15  ? 194  ASP F O     1 
ATOM   8699 C  CB    . ASP F  1 195 ? 55.358  42.879  12.370  1.00 57.22  ? 194  ASP F CB    1 
ATOM   8700 C  CG    . ASP F  1 195 ? 55.846  41.955  11.239  1.00 61.87  ? 194  ASP F CG    1 
ATOM   8701 O  OD1   . ASP F  1 195 ? 56.496  42.446  10.291  1.00 48.79  ? 194  ASP F OD1   1 
ATOM   8702 O  OD2   . ASP F  1 195 ? 55.586  40.731  11.301  1.00 55.85  ? 194  ASP F OD2   1 
ATOM   8703 N  N     . SER F  1 196 ? 55.706  45.100  14.652  1.00 60.73  ? 195  SER F N     1 
ATOM   8704 C  CA    . SER F  1 196 ? 55.151  46.026  15.665  1.00 63.65  ? 195  SER F CA    1 
ATOM   8705 C  C     . SER F  1 196 ? 55.495  47.497  15.397  1.00 62.76  ? 195  SER F C     1 
ATOM   8706 O  O     . SER F  1 196 ? 54.845  48.390  15.930  1.00 63.86  ? 195  SER F O     1 
ATOM   8707 C  CB    . SER F  1 196 ? 55.626  45.655  17.080  1.00 64.76  ? 195  SER F CB    1 
ATOM   8708 O  OG    . SER F  1 196 ? 57.021  45.906  17.247  1.00 70.94  ? 195  SER F OG    1 
ATOM   8709 N  N     . ILE F  1 197 ? 56.530  47.735  14.600  1.00 63.06  ? 196  ILE F N     1 
ATOM   8710 C  CA    . ILE F  1 197 ? 56.908  49.082  14.183  1.00 65.61  ? 196  ILE F CA    1 
ATOM   8711 C  C     . ILE F  1 197 ? 56.368  49.351  12.787  1.00 64.32  ? 196  ILE F C     1 
ATOM   8712 O  O     . ILE F  1 197 ? 55.705  50.354  12.576  1.00 63.07  ? 196  ILE F O     1 
ATOM   8713 C  CB    . ILE F  1 197 ? 58.462  49.283  14.250  1.00 68.71  ? 196  ILE F CB    1 
ATOM   8714 C  CG1   . ILE F  1 197 ? 58.849  49.867  15.609  1.00 69.70  ? 196  ILE F CG1   1 
ATOM   8715 C  CG2   . ILE F  1 197 ? 59.002  50.187  13.105  1.00 75.88  ? 196  ILE F CG2   1 
ATOM   8716 C  CD1   . ILE F  1 197 ? 58.459  48.995  16.798  1.00 77.01  ? 196  ILE F CD1   1 
ATOM   8717 N  N     . PHE F  1 198 ? 56.645  48.446  11.848  1.00 73.28  ? 197  PHE F N     1 
ATOM   8718 C  CA    . PHE F  1 198 ? 56.196  48.585  10.454  1.00 76.76  ? 197  PHE F CA    1 
ATOM   8719 C  C     . PHE F  1 198 ? 54.679  48.573  10.320  1.00 75.64  ? 197  PHE F C     1 
ATOM   8720 O  O     . PHE F  1 198 ? 54.156  49.053  9.317   1.00 77.45  ? 197  PHE F O     1 
ATOM   8721 C  CB    . PHE F  1 198 ? 56.800  47.487  9.559   1.00 78.77  ? 197  PHE F CB    1 
ATOM   8722 N  N     . LEU F  1 199 ? 53.984  48.014  11.317  1.00 77.29  ? 198  LEU F N     1 
ATOM   8723 C  CA    . LEU F  1 199 ? 52.510  48.021  11.364  1.00 75.12  ? 198  LEU F CA    1 
ATOM   8724 C  C     . LEU F  1 199 ? 51.972  49.428  11.567  1.00 73.63  ? 198  LEU F C     1 
ATOM   8725 O  O     . LEU F  1 199 ? 50.882  49.762  11.100  1.00 70.33  ? 198  LEU F O     1 
ATOM   8726 C  CB    . LEU F  1 199 ? 51.982  47.125  12.493  1.00 74.65  ? 198  LEU F CB    1 
ATOM   8727 O  OXT   . LEU F  1 199 ? 52.621  50.252  12.210  1.00 72.81  ? 198  LEU F OXT   1 
HETATM 8728 S  S     . SO4 G  2 .   ? 99.377  8.968   19.935  1.00 52.99  ? 1199 SO4 A S     1 
HETATM 8729 O  O1    . SO4 G  2 .   ? 100.240 9.665   18.966  1.00 80.26  ? 1199 SO4 A O1    1 
HETATM 8730 O  O2    . SO4 G  2 .   ? 98.176  9.798   20.205  1.00 43.68  ? 1199 SO4 A O2    1 
HETATM 8731 O  O3    . SO4 G  2 .   ? 98.875  7.705   19.388  1.00 59.22  ? 1199 SO4 A O3    1 
HETATM 8732 O  O4    . SO4 G  2 .   ? 100.295 8.738   21.045  1.00 48.51  ? 1199 SO4 A O4    1 
HETATM 8733 S  S     . SO4 H  2 .   ? 87.008  -5.688  -7.209  1.00 82.92  ? 1200 SO4 A S     1 
HETATM 8734 O  O1    . SO4 H  2 .   ? 86.985  -4.484  -8.040  1.00 103.90 ? 1200 SO4 A O1    1 
HETATM 8735 O  O2    . SO4 H  2 .   ? 85.964  -6.603  -7.675  1.00 115.50 ? 1200 SO4 A O2    1 
HETATM 8736 O  O3    . SO4 H  2 .   ? 88.325  -6.345  -7.299  1.00 79.37  ? 1200 SO4 A O3    1 
HETATM 8737 O  O4    . SO4 H  2 .   ? 86.692  -5.310  -5.830  1.00 109.89 ? 1200 SO4 A O4    1 
HETATM 8738 CL CL    . CL  I  3 .   ? 98.233  23.927  26.107  1.00 73.85  ? 1201 CL  A CL    1 
HETATM 8739 S  S     . SO4 J  2 .   ? 98.514  4.952   -17.355 1.00 46.59  ? 1199 SO4 B S     1 
HETATM 8740 O  O1    . SO4 J  2 .   ? 99.782  4.791   -16.680 1.00 39.63  ? 1199 SO4 B O1    1 
HETATM 8741 O  O2    . SO4 J  2 .   ? 98.688  3.997   -18.455 1.00 49.78  ? 1199 SO4 B O2    1 
HETATM 8742 O  O3    . SO4 J  2 .   ? 97.290  4.603   -16.654 1.00 43.12  ? 1199 SO4 B O3    1 
HETATM 8743 O  O4    . SO4 J  2 .   ? 98.346  6.363   -17.684 1.00 47.37  ? 1199 SO4 B O4    1 
HETATM 8744 CL CL    . CL  K  3 .   ? 96.005  1.511   -12.664 1.00 74.77  ? 1200 CL  B CL    1 
HETATM 8745 P  P     . AMP L  4 .   ? 109.947 1.465   -12.403 1.00 157.37 ? 1201 AMP B P     1 
HETATM 8746 O  O1P   . AMP L  4 .   ? 110.332 1.088   -13.817 1.00 160.26 ? 1201 AMP B O1P   1 
HETATM 8747 O  O2P   . AMP L  4 .   ? 111.113 1.974   -11.591 1.00 155.89 ? 1201 AMP B O2P   1 
HETATM 8748 O  O3P   . AMP L  4 .   ? 109.126 0.434   -11.663 1.00 164.34 ? 1201 AMP B O3P   1 
HETATM 8749 O  "O5'" . AMP L  4 .   ? 108.917 2.705   -12.552 1.00 130.29 ? 1201 AMP B "O5'" 1 
HETATM 8750 C  "C5'" . AMP L  4 .   ? 108.642 3.384   -13.779 1.00 114.67 ? 1201 AMP B "C5'" 1 
HETATM 8751 C  "C4'" . AMP L  4 .   ? 109.400 4.709   -13.814 1.00 117.98 ? 1201 AMP B "C4'" 1 
HETATM 8752 O  "O4'" . AMP L  4 .   ? 108.920 5.632   -12.827 1.00 141.89 ? 1201 AMP B "O4'" 1 
HETATM 8753 C  "C3'" . AMP L  4 .   ? 110.867 4.578   -13.470 1.00 107.80 ? 1201 AMP B "C3'" 1 
HETATM 8754 O  "O3'" . AMP L  4 .   ? 111.546 5.447   -14.384 1.00 105.26 ? 1201 AMP B "O3'" 1 
HETATM 8755 C  "C2'" . AMP L  4 .   ? 110.976 4.938   -11.971 1.00 103.64 ? 1201 AMP B "C2'" 1 
HETATM 8756 O  "O2'" . AMP L  4 .   ? 112.024 5.882   -11.691 1.00 77.31  ? 1201 AMP B "O2'" 1 
HETATM 8757 C  "C1'" . AMP L  4 .   ? 109.618 5.528   -11.564 1.00 102.79 ? 1201 AMP B "C1'" 1 
HETATM 8758 N  N9    . AMP L  4 .   ? 108.660 4.756   -10.697 1.00 91.20  ? 1201 AMP B N9    1 
HETATM 8759 C  C8    . AMP L  4 .   ? 108.803 3.610   -9.983  1.00 93.82  ? 1201 AMP B C8    1 
HETATM 8760 N  N7    . AMP L  4 .   ? 107.626 3.249   -9.376  1.00 82.51  ? 1201 AMP B N7    1 
HETATM 8761 C  C5    . AMP L  4 .   ? 106.708 4.182   -9.704  1.00 76.37  ? 1201 AMP B C5    1 
HETATM 8762 C  C6    . AMP L  4 .   ? 105.279 4.443   -9.433  1.00 78.22  ? 1201 AMP B C6    1 
HETATM 8763 N  N6    . AMP L  4 .   ? 104.576 3.600   -8.649  1.00 82.18  ? 1201 AMP B N6    1 
HETATM 8764 N  N1    . AMP L  4 .   ? 104.695 5.540   -9.992  1.00 78.22  ? 1201 AMP B N1    1 
HETATM 8765 C  C2    . AMP L  4 .   ? 105.366 6.398   -10.774 1.00 81.20  ? 1201 AMP B C2    1 
HETATM 8766 N  N3    . AMP L  4 .   ? 106.673 6.223   -11.056 1.00 85.33  ? 1201 AMP B N3    1 
HETATM 8767 C  C4    . AMP L  4 .   ? 107.385 5.160   -10.571 1.00 87.85  ? 1201 AMP B C4    1 
HETATM 8768 S  S     . SO4 M  2 .   ? 105.160 57.256  -2.004  1.00 60.62  ? 1198 SO4 C S     1 
HETATM 8769 O  O1    . SO4 M  2 .   ? 105.659 57.719  -3.294  1.00 55.96  ? 1198 SO4 C O1    1 
HETATM 8770 O  O2    . SO4 M  2 .   ? 103.745 57.639  -1.934  1.00 67.49  ? 1198 SO4 C O2    1 
HETATM 8771 O  O3    . SO4 M  2 .   ? 105.333 55.807  -1.937  1.00 57.40  ? 1198 SO4 C O3    1 
HETATM 8772 O  O4    . SO4 M  2 .   ? 105.868 57.837  -0.861  1.00 76.94  ? 1198 SO4 C O4    1 
HETATM 8773 O  "O5'" . AMP N  4 .   ? 105.978 45.626  -2.871  1.00 100.41 ? 1199 AMP C "O5'" 1 
HETATM 8774 C  "C5'" . AMP N  4 .   ? 107.369 45.610  -2.560  1.00 117.03 ? 1199 AMP C "C5'" 1 
HETATM 8775 C  "C4'" . AMP N  4 .   ? 107.575 44.847  -1.257  1.00 129.73 ? 1199 AMP C "C4'" 1 
HETATM 8776 O  "O4'" . AMP N  4 .   ? 106.801 45.452  -0.217  1.00 144.27 ? 1199 AMP C "O4'" 1 
HETATM 8777 C  "C3'" . AMP N  4 .   ? 107.122 43.392  -1.339  1.00 138.85 ? 1199 AMP C "C3'" 1 
HETATM 8778 O  "O3'" . AMP N  4 .   ? 108.178 42.524  -0.912  1.00 146.01 ? 1199 AMP C "O3'" 1 
HETATM 8779 C  "C2'" . AMP N  4 .   ? 105.896 43.257  -0.441  1.00 140.58 ? 1199 AMP C "C2'" 1 
HETATM 8780 O  "O2'" . AMP N  4 .   ? 106.071 42.278  0.598   1.00 130.87 ? 1199 AMP C "O2'" 1 
HETATM 8781 C  "C1'" . AMP N  4 .   ? 105.688 44.634  0.185   1.00 129.91 ? 1199 AMP C "C1'" 1 
HETATM 8782 N  N9    . AMP N  4 .   ? 104.435 45.342  -0.207  1.00 125.02 ? 1199 AMP C N9    1 
HETATM 8783 C  C8    . AMP N  4 .   ? 103.419 44.935  -1.008  1.00 120.73 ? 1199 AMP C C8    1 
HETATM 8784 N  N7    . AMP N  4 .   ? 102.469 45.906  -1.102  1.00 116.79 ? 1199 AMP C N7    1 
HETATM 8785 C  C5    . AMP N  4 .   ? 102.874 46.955  -0.354  1.00 124.99 ? 1199 AMP C C5    1 
HETATM 8786 C  C6    . AMP N  4 .   ? 102.367 48.313  -0.004  1.00 126.57 ? 1199 AMP C C6    1 
HETATM 8787 N  N6    . AMP N  4 .   ? 101.183 48.760  -0.491  1.00 120.70 ? 1199 AMP C N6    1 
HETATM 8788 N  N1    . AMP N  4 .   ? 103.123 49.092  0.817   1.00 122.40 ? 1199 AMP C N1    1 
HETATM 8789 C  C2    . AMP N  4 .   ? 104.304 48.673  1.316   1.00 118.88 ? 1199 AMP C C2    1 
HETATM 8790 N  N3    . AMP N  4 .   ? 104.816 47.456  1.039   1.00 112.36 ? 1199 AMP C N3    1 
HETATM 8791 C  C4    . AMP N  4 .   ? 104.169 46.574  0.232   1.00 121.32 ? 1199 AMP C C4    1 
HETATM 8792 S  S     . SO4 O  2 .   ? 138.235 -20.242 14.786  1.00 96.08  ? 1197 SO4 D S     1 
HETATM 8793 O  O1    . SO4 O  2 .   ? 139.372 -19.578 14.148  1.00 86.48  ? 1197 SO4 D O1    1 
HETATM 8794 O  O2    . SO4 O  2 .   ? 137.138 -20.306 13.821  1.00 87.22  ? 1197 SO4 D O2    1 
HETATM 8795 O  O3    . SO4 O  2 .   ? 138.697 -21.566 15.219  1.00 99.46  ? 1197 SO4 D O3    1 
HETATM 8796 O  O4    . SO4 O  2 .   ? 137.732 -19.540 15.967  1.00 85.79  ? 1197 SO4 D O4    1 
HETATM 8797 S  S     . SO4 P  2 .   ? 134.183 17.206  20.865  1.00 66.37  ? 1198 SO4 E S     1 
HETATM 8798 O  O1    . SO4 P  2 .   ? 134.456 16.555  19.577  1.00 51.58  ? 1198 SO4 E O1    1 
HETATM 8799 O  O2    . SO4 P  2 .   ? 132.764 17.462  21.121  1.00 72.00  ? 1198 SO4 E O2    1 
HETATM 8800 O  O3    . SO4 P  2 .   ? 134.633 16.363  21.988  1.00 58.44  ? 1198 SO4 E O3    1 
HETATM 8801 O  O4    . SO4 P  2 .   ? 134.891 18.482  20.808  1.00 74.27  ? 1198 SO4 E O4    1 
HETATM 8802 CL CL    . CL  Q  3 .   ? 121.217 24.758  14.599  1.00 68.49  ? 1199 CL  E CL    1 
HETATM 8803 S  S     . SO4 R  2 .   ? 77.436  36.717  14.105  1.00 48.21  ? 1199 SO4 F S     1 
HETATM 8804 O  O1    . SO4 R  2 .   ? 78.879  36.537  14.200  1.00 45.71  ? 1199 SO4 F O1    1 
HETATM 8805 O  O2    . SO4 R  2 .   ? 77.164  37.420  12.857  1.00 43.86  ? 1199 SO4 F O2    1 
HETATM 8806 O  O3    . SO4 R  2 .   ? 76.862  35.375  14.129  1.00 45.74  ? 1199 SO4 F O3    1 
HETATM 8807 O  O4    . SO4 R  2 .   ? 76.863  37.578  15.173  1.00 48.72  ? 1199 SO4 F O4    1 
HETATM 8808 CL CL    . CL  S  3 .   ? 80.867  45.097  18.942  1.00 66.08  ? 1200 CL  F CL    1 
HETATM 8809 CL CL    . CL  T  3 .   ? 87.563  49.931  23.189  1.00 92.04  ? 1201 CL  F CL    1 
HETATM 8810 O  "O5'" . AMP U  4 .   ? 75.468  39.454  2.841   1.00 88.15  ? 1202 AMP F "O5'" 1 
HETATM 8811 C  "C5'" . AMP U  4 .   ? 74.047  39.654  2.813   1.00 125.20 ? 1202 AMP F "C5'" 1 
HETATM 8812 C  "C4'" . AMP U  4 .   ? 73.669  41.138  2.764   1.00 127.67 ? 1202 AMP F "C4'" 1 
HETATM 8813 O  "O4'" . AMP U  4 .   ? 74.610  41.887  3.531   1.00 140.58 ? 1202 AMP F "O4'" 1 
HETATM 8814 C  "C3'" . AMP U  4 .   ? 73.689  41.753  1.367   1.00 130.13 ? 1202 AMP F "C3'" 1 
HETATM 8815 O  "O3'" . AMP U  4 .   ? 72.514  42.556  1.169   1.00 121.42 ? 1202 AMP F "O3'" 1 
HETATM 8816 C  "C2'" . AMP U  4 .   ? 74.969  42.580  1.280   1.00 125.51 ? 1202 AMP F "C2'" 1 
HETATM 8817 O  "O2'" . AMP U  4 .   ? 74.728  43.910  0.793   1.00 111.25 ? 1202 AMP F "O2'" 1 
HETATM 8818 C  "C1'" . AMP U  4 .   ? 75.535  42.623  2.705   1.00 127.58 ? 1202 AMP F "C1'" 1 
HETATM 8819 N  N9    . AMP U  4 .   ? 76.924  42.071  2.911   1.00 124.56 ? 1202 AMP F N9    1 
HETATM 8820 C  C8    . AMP U  4 .   ? 77.737  41.469  2.010   1.00 124.68 ? 1202 AMP F C8    1 
HETATM 8821 N  N7    . AMP U  4 .   ? 78.915  41.102  2.581   1.00 121.41 ? 1202 AMP F N7    1 
HETATM 8822 C  C5    . AMP U  4 .   ? 78.879  41.468  3.873   1.00 120.46 ? 1202 AMP F C5    1 
HETATM 8823 C  C6    . AMP U  4 .   ? 79.789  41.381  5.040   1.00 118.41 ? 1202 AMP F C6    1 
HETATM 8824 N  N6    . AMP U  4 .   ? 81.010  40.808  4.919   1.00 120.15 ? 1202 AMP F N6    1 
HETATM 8825 N  N1    . AMP U  4 .   ? 79.364  41.887  6.223   1.00 119.03 ? 1202 AMP F N1    1 
HETATM 8826 C  C2    . AMP U  4 .   ? 78.155  42.453  6.369   1.00 117.52 ? 1202 AMP F C2    1 
HETATM 8827 N  N3    . AMP U  4 .   ? 77.288  42.562  5.345   1.00 120.63 ? 1202 AMP F N3    1 
HETATM 8828 C  C4    . AMP U  4 .   ? 77.572  42.103  4.091   1.00 122.78 ? 1202 AMP F C4    1 
HETATM 8829 O  O     . HOH V  5 .   ? 69.474  -2.445  6.774   1.00 70.92  ? 2001 HOH A O     1 
HETATM 8830 O  O     . HOH V  5 .   ? 72.025  6.747   16.610  1.00 54.24  ? 2002 HOH A O     1 
HETATM 8831 O  O     . HOH V  5 .   ? 97.984  11.477  16.242  1.00 55.70  ? 2003 HOH A O     1 
HETATM 8832 O  O     . HOH V  5 .   ? 71.604  2.263   21.671  1.00 70.81  ? 2004 HOH A O     1 
HETATM 8833 O  O     . HOH V  5 .   ? 101.979 8.537   27.544  1.00 52.95  ? 2005 HOH A O     1 
HETATM 8834 O  O     . HOH V  5 .   ? 77.327  -2.174  19.815  1.00 47.08  ? 2006 HOH A O     1 
HETATM 8835 O  O     . HOH V  5 .   ? 86.094  -9.202  24.956  1.00 62.67  ? 2007 HOH A O     1 
HETATM 8836 O  O     . HOH V  5 .   ? 96.093  13.559  16.363  1.00 51.79  ? 2008 HOH A O     1 
HETATM 8837 O  O     . HOH V  5 .   ? 92.055  12.875  17.036  1.00 36.83  ? 2009 HOH A O     1 
HETATM 8838 O  O     . HOH V  5 .   ? 101.859 9.161   24.925  1.00 55.98  ? 2010 HOH A O     1 
HETATM 8839 O  O     . HOH V  5 .   ? 97.970  8.573   27.598  1.00 55.54  ? 2011 HOH A O     1 
HETATM 8840 O  O     . HOH V  5 .   ? 85.059  -2.734  -3.613  1.00 63.36  ? 2012 HOH A O     1 
HETATM 8841 O  O     . HOH V  5 .   ? 100.947 6.090   26.198  1.00 52.97  ? 2013 HOH A O     1 
HETATM 8842 O  O     . HOH V  5 .   ? 101.648 5.803   23.637  1.00 52.93  ? 2014 HOH A O     1 
HETATM 8843 O  O     . HOH V  5 .   ? 98.495  6.373   26.727  1.00 52.17  ? 2015 HOH A O     1 
HETATM 8844 O  O     . HOH V  5 .   ? 96.261  1.857   -8.871  1.00 69.18  ? 2016 HOH A O     1 
HETATM 8845 O  O     . HOH V  5 .   ? 96.471  -1.236  15.911  1.00 78.32  ? 2017 HOH A O     1 
HETATM 8846 O  O     . HOH V  5 .   ? 93.427  -3.808  27.947  1.00 59.78  ? 2018 HOH A O     1 
HETATM 8847 O  O     . HOH V  5 .   ? 85.982  16.716  -1.111  1.00 65.21  ? 2019 HOH A O     1 
HETATM 8848 O  O     . HOH V  5 .   ? 82.112  11.308  -2.226  1.00 62.87  ? 2020 HOH A O     1 
HETATM 8849 O  O     . HOH V  5 .   ? 85.090  -7.650  27.262  1.00 50.39  ? 2021 HOH A O     1 
HETATM 8850 O  O     . HOH V  5 .   ? 87.783  -8.724  28.144  1.00 62.71  ? 2022 HOH A O     1 
HETATM 8851 O  O     . HOH V  5 .   ? 79.313  -7.119  5.475   1.00 55.27  ? 2023 HOH A O     1 
HETATM 8852 O  O     . HOH V  5 .   ? 78.508  -2.918  3.725   1.00 61.28  ? 2024 HOH A O     1 
HETATM 8853 O  O     . HOH V  5 .   ? 87.845  -6.518  19.966  1.00 60.94  ? 2025 HOH A O     1 
HETATM 8854 O  O     . HOH V  5 .   ? 89.478  -3.139  13.773  1.00 47.78  ? 2026 HOH A O     1 
HETATM 8855 O  O     . HOH V  5 .   ? 91.585  0.192   12.942  1.00 55.70  ? 2027 HOH A O     1 
HETATM 8856 O  O     . HOH V  5 .   ? 89.688  -3.712  16.473  1.00 47.00  ? 2028 HOH A O     1 
HETATM 8857 O  O     . HOH V  5 .   ? 93.098  1.915   13.517  1.00 58.49  ? 2029 HOH A O     1 
HETATM 8858 O  O     . HOH V  5 .   ? 90.177  1.068   10.957  1.00 44.99  ? 2030 HOH A O     1 
HETATM 8859 O  O     . HOH V  5 .   ? 88.776  11.384  8.335   1.00 51.16  ? 2031 HOH A O     1 
HETATM 8860 O  O     . HOH V  5 .   ? 96.535  6.504   5.010   1.00 64.35  ? 2032 HOH A O     1 
HETATM 8861 O  O     . HOH V  5 .   ? 97.469  2.678   8.356   1.00 74.40  ? 2033 HOH A O     1 
HETATM 8862 O  O     . HOH V  5 .   ? 88.547  -0.179  4.487   1.00 35.51  ? 2034 HOH A O     1 
HETATM 8863 O  O     . HOH V  5 .   ? 87.304  -2.342  -1.991  1.00 56.27  ? 2035 HOH A O     1 
HETATM 8864 O  O     . HOH V  5 .   ? 103.527 24.236  19.747  1.00 44.63  ? 2036 HOH A O     1 
HETATM 8865 O  O     . HOH V  5 .   ? 107.607 24.243  19.949  1.00 61.04  ? 2037 HOH A O     1 
HETATM 8866 O  O     . HOH V  5 .   ? 82.990  -1.382  -5.049  1.00 75.42  ? 2038 HOH A O     1 
HETATM 8867 O  O     . HOH V  5 .   ? 116.256 14.600  7.596   1.00 52.60  ? 2039 HOH A O     1 
HETATM 8868 O  O     . HOH V  5 .   ? 108.794 25.550  17.409  1.00 47.27  ? 2040 HOH A O     1 
HETATM 8869 O  O     . HOH V  5 .   ? 107.294 26.745  15.781  1.00 56.88  ? 2041 HOH A O     1 
HETATM 8870 O  O     . HOH V  5 .   ? 94.522  -1.019  -13.272 1.00 66.28  ? 2042 HOH A O     1 
HETATM 8871 O  O     . HOH V  5 .   ? 100.572 21.468  7.813   1.00 50.02  ? 2043 HOH A O     1 
HETATM 8872 O  O     . HOH V  5 .   ? 96.739  5.053   -8.967  1.00 62.52  ? 2044 HOH A O     1 
HETATM 8873 O  O     . HOH V  5 .   ? 96.943  10.531  -9.284  1.00 54.15  ? 2045 HOH A O     1 
HETATM 8874 O  O     . HOH V  5 .   ? 89.166  21.710  21.903  1.00 33.62  ? 2046 HOH A O     1 
HETATM 8875 O  O     . HOH V  5 .   ? 100.640 17.031  -6.113  1.00 44.97  ? 2047 HOH A O     1 
HETATM 8876 O  O     . HOH V  5 .   ? 94.251  19.942  -5.188  1.00 60.62  ? 2048 HOH A O     1 
HETATM 8877 O  O     . HOH V  5 .   ? 95.906  12.799  1.089   1.00 58.24  ? 2049 HOH A O     1 
HETATM 8878 O  O     . HOH V  5 .   ? 92.428  18.119  -2.781  1.00 48.69  ? 2050 HOH A O     1 
HETATM 8879 O  O     . HOH V  5 .   ? 99.156  8.162   38.911  1.00 53.60  ? 2051 HOH A O     1 
HETATM 8880 O  O     . HOH V  5 .   ? 85.029  16.129  1.501   1.00 42.10  ? 2052 HOH A O     1 
HETATM 8881 O  O     . HOH V  5 .   ? 80.405  12.402  4.422   1.00 59.53  ? 2053 HOH A O     1 
HETATM 8882 O  O     . HOH V  5 .   ? 82.260  13.450  -0.173  1.00 51.51  ? 2054 HOH A O     1 
HETATM 8883 O  O     . HOH V  5 .   ? 84.912  3.976   -0.398  1.00 58.07  ? 2055 HOH A O     1 
HETATM 8884 O  O     . HOH V  5 .   ? 84.623  5.390   -4.267  1.00 52.35  ? 2056 HOH A O     1 
HETATM 8885 O  O     . HOH V  5 .   ? 86.228  -0.439  5.036   1.00 39.04  ? 2057 HOH A O     1 
HETATM 8886 O  O     . HOH V  5 .   ? 85.064  -2.120  2.792   1.00 51.54  ? 2058 HOH A O     1 
HETATM 8887 O  O     . HOH V  5 .   ? 80.423  -4.638  4.957   1.00 52.81  ? 2059 HOH A O     1 
HETATM 8888 O  O     . HOH V  5 .   ? 79.610  -4.163  0.440   1.00 72.51  ? 2060 HOH A O     1 
HETATM 8889 O  O     . HOH V  5 .   ? 79.573  -9.647  20.371  1.00 66.30  ? 2061 HOH A O     1 
HETATM 8890 O  O     . HOH V  5 .   ? 90.128  8.599   12.072  1.00 56.74  ? 2062 HOH A O     1 
HETATM 8891 O  O     . HOH V  5 .   ? 89.746  11.483  10.764  1.00 62.60  ? 2063 HOH A O     1 
HETATM 8892 O  O     . HOH V  5 .   ? 83.536  10.494  6.730   1.00 67.59  ? 2064 HOH A O     1 
HETATM 8893 O  O     . HOH V  5 .   ? 81.108  11.624  7.124   1.00 59.95  ? 2065 HOH A O     1 
HETATM 8894 O  O     . HOH V  5 .   ? 88.845  15.926  15.188  1.00 53.20  ? 2066 HOH A O     1 
HETATM 8895 O  O     . HOH V  5 .   ? 87.694  20.737  11.981  1.00 48.42  ? 2067 HOH A O     1 
HETATM 8896 O  O     . HOH V  5 .   ? 84.446  22.110  11.092  1.00 59.01  ? 2068 HOH A O     1 
HETATM 8897 O  O     . HOH V  5 .   ? 82.324  21.599  8.774   1.00 48.57  ? 2069 HOH A O     1 
HETATM 8898 O  O     . HOH V  5 .   ? 74.668  12.909  4.713   1.00 69.25  ? 2070 HOH A O     1 
HETATM 8899 O  O     . HOH V  5 .   ? 72.033  3.534   10.305  1.00 62.04  ? 2071 HOH A O     1 
HETATM 8900 O  O     . HOH V  5 .   ? 75.927  12.754  15.828  1.00 51.33  ? 2072 HOH A O     1 
HETATM 8901 O  O     . HOH V  5 .   ? 75.054  10.235  25.153  1.00 61.76  ? 2073 HOH A O     1 
HETATM 8902 O  O     . HOH V  5 .   ? 95.609  15.998  22.920  1.00 39.76  ? 2074 HOH A O     1 
HETATM 8903 O  O     . HOH V  5 .   ? 95.074  18.585  23.540  1.00 43.46  ? 2075 HOH A O     1 
HETATM 8904 O  O     . HOH V  5 .   ? 96.777  21.295  23.995  1.00 42.44  ? 2076 HOH A O     1 
HETATM 8905 O  O     . HOH V  5 .   ? 102.269 23.220  29.743  1.00 70.53  ? 2077 HOH A O     1 
HETATM 8906 O  O     . HOH V  5 .   ? 108.268 20.623  25.412  1.00 54.85  ? 2078 HOH A O     1 
HETATM 8907 O  O     . HOH V  5 .   ? 101.680 23.866  26.777  1.00 41.47  ? 2079 HOH A O     1 
HETATM 8908 O  O     . HOH V  5 .   ? 105.601 22.373  19.556  1.00 48.10  ? 2080 HOH A O     1 
HETATM 8909 O  O     . HOH V  5 .   ? 106.696 9.758   24.168  1.00 52.97  ? 2081 HOH A O     1 
HETATM 8910 O  O     . HOH V  5 .   ? 104.546 13.014  30.122  1.00 64.82  ? 2082 HOH A O     1 
HETATM 8911 O  O     . HOH V  5 .   ? 108.147 12.185  16.877  1.00 35.84  ? 2083 HOH A O     1 
HETATM 8912 O  O     . HOH V  5 .   ? 113.157 8.006   19.574  1.00 50.82  ? 2084 HOH A O     1 
HETATM 8913 O  O     . HOH V  5 .   ? 116.143 8.974   17.544  1.00 50.12  ? 2085 HOH A O     1 
HETATM 8914 O  O     . HOH V  5 .   ? 115.336 10.993  9.942   1.00 59.92  ? 2086 HOH A O     1 
HETATM 8915 O  O     . HOH V  5 .   ? 113.415 15.134  10.835  1.00 39.95  ? 2087 HOH A O     1 
HETATM 8916 O  O     . HOH V  5 .   ? 116.191 12.446  16.886  1.00 45.16  ? 2088 HOH A O     1 
HETATM 8917 O  O     . HOH V  5 .   ? 121.090 17.312  10.104  1.00 48.44  ? 2089 HOH A O     1 
HETATM 8918 O  O     . HOH V  5 .   ? 115.246 13.618  9.752   1.00 37.84  ? 2090 HOH A O     1 
HETATM 8919 O  O     . HOH V  5 .   ? 119.829 19.683  18.410  1.00 47.95  ? 2091 HOH A O     1 
HETATM 8920 O  O     . HOH V  5 .   ? 111.772 25.419  17.371  1.00 52.54  ? 2092 HOH A O     1 
HETATM 8921 O  O     . HOH V  5 .   ? 118.690 23.404  17.468  1.00 54.51  ? 2093 HOH A O     1 
HETATM 8922 O  O     . HOH V  5 .   ? 106.650 25.567  13.298  1.00 44.29  ? 2094 HOH A O     1 
HETATM 8923 O  O     . HOH V  5 .   ? 111.966 18.869  10.626  1.00 53.53  ? 2095 HOH A O     1 
HETATM 8924 O  O     . HOH V  5 .   ? 101.979 24.440  17.555  1.00 39.44  ? 2096 HOH A O     1 
HETATM 8925 O  O     . HOH V  5 .   ? 100.188 22.422  10.142  1.00 43.65  ? 2097 HOH A O     1 
HETATM 8926 O  O     . HOH V  5 .   ? 98.851  16.606  13.181  1.00 39.85  ? 2098 HOH A O     1 
HETATM 8927 O  O     . HOH V  5 .   ? 94.241  20.045  10.163  1.00 46.23  ? 2099 HOH A O     1 
HETATM 8928 O  O     . HOH V  5 .   ? 92.476  18.529  22.500  1.00 46.65  ? 2100 HOH A O     1 
HETATM 8929 O  O     . HOH V  5 .   ? 91.357  20.615  20.780  1.00 42.88  ? 2101 HOH A O     1 
HETATM 8930 O  O     . HOH V  5 .   ? 87.001  22.885  21.276  1.00 33.94  ? 2102 HOH A O     1 
HETATM 8931 O  O     . HOH V  5 .   ? 78.103  12.260  14.522  1.00 40.66  ? 2103 HOH A O     1 
HETATM 8932 O  O     . HOH V  5 .   ? 85.279  23.197  23.394  1.00 47.01  ? 2104 HOH A O     1 
HETATM 8933 O  O     . HOH V  5 .   ? 89.056  20.568  24.377  1.00 44.73  ? 2105 HOH A O     1 
HETATM 8934 O  O     . HOH V  5 .   ? 84.669  16.137  30.891  1.00 51.33  ? 2106 HOH A O     1 
HETATM 8935 O  O     . HOH V  5 .   ? 93.357  14.790  36.258  1.00 55.18  ? 2107 HOH A O     1 
HETATM 8936 O  O     . HOH V  5 .   ? 103.070 14.826  31.853  1.00 55.47  ? 2108 HOH A O     1 
HETATM 8937 O  O     . HOH V  5 .   ? 100.029 9.034   29.253  1.00 48.12  ? 2109 HOH A O     1 
HETATM 8938 O  O     . HOH V  5 .   ? 98.913  9.926   36.513  1.00 46.30  ? 2110 HOH A O     1 
HETATM 8939 O  O     . HOH V  5 .   ? 95.648  6.441   39.098  1.00 50.59  ? 2111 HOH A O     1 
HETATM 8940 O  O     . HOH V  5 .   ? 88.497  2.516   35.942  1.00 41.01  ? 2112 HOH A O     1 
HETATM 8941 O  O     . HOH V  5 .   ? 86.780  9.527   33.366  1.00 42.19  ? 2113 HOH A O     1 
HETATM 8942 O  O     . HOH V  5 .   ? 82.244  4.704   35.995  1.00 50.34  ? 2114 HOH A O     1 
HETATM 8943 O  O     . HOH V  5 .   ? 86.247  3.138   37.107  1.00 40.66  ? 2115 HOH A O     1 
HETATM 8944 O  O     . HOH V  5 .   ? 86.061  -0.888  34.221  1.00 36.45  ? 2116 HOH A O     1 
HETATM 8945 O  O     . HOH V  5 .   ? 79.109  2.559   35.687  1.00 59.83  ? 2117 HOH A O     1 
HETATM 8946 O  O     . HOH V  5 .   ? 82.290  -1.334  35.320  1.00 54.03  ? 2118 HOH A O     1 
HETATM 8947 O  O     . HOH V  5 .   ? 84.020  2.206   36.338  1.00 42.01  ? 2119 HOH A O     1 
HETATM 8948 O  O     . HOH V  5 .   ? 99.978  6.055   21.665  1.00 51.66  ? 2120 HOH A O     1 
HETATM 8949 O  O     . HOH V  5 .   ? 96.838  11.110  18.451  1.00 47.08  ? 2121 HOH A O     1 
HETATM 8950 O  O     . HOH V  5 .   ? 96.921  7.690   17.659  1.00 46.91  ? 2122 HOH A O     1 
HETATM 8951 O  O     . HOH V  5 .   ? 100.071 9.949   16.169  1.00 59.57  ? 2123 HOH A O     1 
HETATM 8952 O  O     . HOH V  5 .   ? 102.780 9.768   17.975  1.00 70.43  ? 2124 HOH A O     1 
HETATM 8953 O  O     . HOH V  5 .   ? 85.587  -2.272  -6.853  1.00 58.52  ? 2125 HOH A O     1 
HETATM 8954 O  O     . HOH W  5 .   ? 115.006 28.560  -8.585  1.00 70.29  ? 2001 HOH B O     1 
HETATM 8955 O  O     . HOH W  5 .   ? 122.059 30.518  -7.442  1.00 65.70  ? 2002 HOH B O     1 
HETATM 8956 O  O     . HOH W  5 .   ? 113.388 30.514  -8.207  1.00 60.27  ? 2003 HOH B O     1 
HETATM 8957 O  O     . HOH W  5 .   ? 97.426  7.250   -13.272 1.00 52.42  ? 2004 HOH B O     1 
HETATM 8958 O  O     . HOH W  5 .   ? 116.448 21.602  -1.299  1.00 56.92  ? 2005 HOH B O     1 
HETATM 8959 O  O     . HOH W  5 .   ? 98.219  13.234  -14.793 1.00 39.78  ? 2006 HOH B O     1 
HETATM 8960 O  O     . HOH W  5 .   ? 96.275  10.143  -14.075 1.00 59.93  ? 2007 HOH B O     1 
HETATM 8961 O  O     . HOH W  5 .   ? 99.200  6.030   -25.017 1.00 42.89  ? 2008 HOH B O     1 
HETATM 8962 O  O     . HOH W  5 .   ? 100.961 6.844   -15.047 1.00 45.95  ? 2009 HOH B O     1 
HETATM 8963 O  O     . HOH W  5 .   ? 106.206 5.247   -15.352 1.00 48.23  ? 2010 HOH B O     1 
HETATM 8964 O  O     . HOH W  5 .   ? 100.871 4.470   -25.129 1.00 44.55  ? 2011 HOH B O     1 
HETATM 8965 O  O     . HOH W  5 .   ? 93.679  11.364  13.344  1.00 58.65  ? 2012 HOH B O     1 
HETATM 8966 O  O     . HOH W  5 .   ? 113.130 3.795   -18.646 1.00 55.18  ? 2013 HOH B O     1 
HETATM 8967 O  O     . HOH W  5 .   ? 103.827 1.623   -16.230 1.00 68.79  ? 2014 HOH B O     1 
HETATM 8968 O  O     . HOH W  5 .   ? 91.004  14.817  15.589  1.00 53.78  ? 2015 HOH B O     1 
HETATM 8969 O  O     . HOH W  5 .   ? 108.548 2.746   -29.983 1.00 54.32  ? 2016 HOH B O     1 
HETATM 8970 O  O     . HOH W  5 .   ? 112.582 4.330   -25.361 1.00 52.30  ? 2017 HOH B O     1 
HETATM 8971 O  O     . HOH W  5 .   ? 91.776  20.871  9.401   1.00 47.61  ? 2018 HOH B O     1 
HETATM 8972 O  O     . HOH W  5 .   ? 103.567 24.098  3.737   1.00 51.69  ? 2019 HOH B O     1 
HETATM 8973 O  O     . HOH W  5 .   ? 118.145 19.763  -1.001  1.00 49.90  ? 2020 HOH B O     1 
HETATM 8974 O  O     . HOH W  5 .   ? 109.985 8.603   -9.661  1.00 44.60  ? 2021 HOH B O     1 
HETATM 8975 O  O     . HOH W  5 .   ? 109.665 10.527  -7.686  1.00 36.94  ? 2022 HOH B O     1 
HETATM 8976 O  O     . HOH W  5 .   ? 103.244 8.309   -8.635  1.00 52.79  ? 2023 HOH B O     1 
HETATM 8977 O  O     . HOH W  5 .   ? 101.570 8.110   -1.927  1.00 57.64  ? 2024 HOH B O     1 
HETATM 8978 O  O     . HOH W  5 .   ? 101.983 10.655  -8.560  1.00 44.42  ? 2025 HOH B O     1 
HETATM 8979 O  O     . HOH W  5 .   ? 110.789 12.261  -1.130  1.00 39.86  ? 2026 HOH B O     1 
HETATM 8980 O  O     . HOH W  5 .   ? 106.477 4.781   2.238   1.00 46.56  ? 2027 HOH B O     1 
HETATM 8981 O  O     . HOH W  5 .   ? 111.806 10.173  -6.184  1.00 68.42  ? 2028 HOH B O     1 
HETATM 8982 O  O     . HOH W  5 .   ? 112.361 12.319  1.344   1.00 47.57  ? 2029 HOH B O     1 
HETATM 8983 O  O     . HOH W  5 .   ? 114.250 5.239   7.062   1.00 61.57  ? 2030 HOH B O     1 
HETATM 8984 O  O     . HOH W  5 .   ? 115.611 7.448   7.453   1.00 64.71  ? 2031 HOH B O     1 
HETATM 8985 O  O     . HOH W  5 .   ? 91.839  0.076   -25.755 1.00 39.53  ? 2032 HOH B O     1 
HETATM 8986 O  O     . HOH W  5 .   ? 111.133 11.337  13.653  1.00 49.51  ? 2033 HOH B O     1 
HETATM 8987 O  O     . HOH W  5 .   ? 112.657 17.228  6.878   1.00 53.62  ? 2034 HOH B O     1 
HETATM 8988 O  O     . HOH W  5 .   ? 111.816 16.664  9.189   1.00 30.70  ? 2035 HOH B O     1 
HETATM 8989 O  O     . HOH W  5 .   ? 106.139 10.481  16.682  1.00 59.77  ? 2036 HOH B O     1 
HETATM 8990 O  O     . HOH W  5 .   ? 102.442 10.218  12.269  1.00 49.63  ? 2037 HOH B O     1 
HETATM 8991 O  O     . HOH W  5 .   ? 95.956  12.026  12.069  1.00 48.25  ? 2038 HOH B O     1 
HETATM 8992 O  O     . HOH W  5 .   ? 95.127  10.381  2.666   1.00 61.77  ? 2039 HOH B O     1 
HETATM 8993 O  O     . HOH W  5 .   ? 98.466  5.400   13.492  1.00 69.13  ? 2040 HOH B O     1 
HETATM 8994 O  O     . HOH W  5 .   ? 93.041  8.277   11.346  1.00 51.48  ? 2041 HOH B O     1 
HETATM 8995 O  O     . HOH W  5 .   ? 92.940  14.011  13.888  1.00 56.63  ? 2042 HOH B O     1 
HETATM 8996 O  O     . HOH W  5 .   ? 95.419  17.858  8.738   1.00 43.71  ? 2043 HOH B O     1 
HETATM 8997 O  O     . HOH W  5 .   ? 90.842  18.367  9.195   1.00 55.47  ? 2044 HOH B O     1 
HETATM 8998 O  O     . HOH W  5 .   ? 95.921  19.365  6.108   1.00 55.62  ? 2045 HOH B O     1 
HETATM 8999 O  O     . HOH W  5 .   ? 92.269  18.999  3.982   1.00 45.41  ? 2046 HOH B O     1 
HETATM 9000 O  O     . HOH W  5 .   ? 97.936  23.532  -0.520  1.00 44.51  ? 2047 HOH B O     1 
HETATM 9001 O  O     . HOH W  5 .   ? 98.407  25.287  -4.184  1.00 55.76  ? 2048 HOH B O     1 
HETATM 9002 O  O     . HOH W  5 .   ? 101.560 25.086  1.447   1.00 57.20  ? 2049 HOH B O     1 
HETATM 9003 O  O     . HOH W  5 .   ? 107.655 24.714  0.132   1.00 53.46  ? 2050 HOH B O     1 
HETATM 9004 O  O     . HOH W  5 .   ? 106.248 23.343  3.672   1.00 69.30  ? 2051 HOH B O     1 
HETATM 9005 O  O     . HOH W  5 .   ? 112.294 14.421  -2.088  1.00 41.31  ? 2052 HOH B O     1 
HETATM 9006 O  O     . HOH W  5 .   ? 118.367 17.570  -1.880  1.00 51.78  ? 2053 HOH B O     1 
HETATM 9007 O  O     . HOH W  5 .   ? 113.763 14.659  0.097   1.00 51.22  ? 2054 HOH B O     1 
HETATM 9008 O  O     . HOH W  5 .   ? 103.092 14.062  -9.702  1.00 46.50  ? 2055 HOH B O     1 
HETATM 9009 O  O     . HOH W  5 .   ? 103.607 7.016   -14.300 1.00 53.47  ? 2056 HOH B O     1 
HETATM 9010 O  O     . HOH W  5 .   ? 100.427 15.773  -8.493  1.00 56.42  ? 2057 HOH B O     1 
HETATM 9011 O  O     . HOH W  5 .   ? 103.994 21.262  -5.115  1.00 49.93  ? 2058 HOH B O     1 
HETATM 9012 O  O     . HOH W  5 .   ? 92.967  23.934  -10.428 1.00 52.51  ? 2059 HOH B O     1 
HETATM 9013 O  O     . HOH W  5 .   ? 100.189 29.734  -5.907  1.00 64.79  ? 2060 HOH B O     1 
HETATM 9014 O  O     . HOH W  5 .   ? 95.505  31.175  -9.264  1.00 66.74  ? 2061 HOH B O     1 
HETATM 9015 O  O     . HOH W  5 .   ? 103.924 31.042  -11.703 1.00 58.95  ? 2062 HOH B O     1 
HETATM 9016 O  O     . HOH W  5 .   ? 103.602 24.046  -5.507  1.00 52.67  ? 2063 HOH B O     1 
HETATM 9017 O  O     . HOH W  5 .   ? 100.538 26.829  -3.569  1.00 68.21  ? 2064 HOH B O     1 
HETATM 9018 O  O     . HOH W  5 .   ? 110.191 31.763  -1.660  1.00 73.05  ? 2065 HOH B O     1 
HETATM 9019 O  O     . HOH W  5 .   ? 94.249  11.590  -20.423 1.00 44.26  ? 2066 HOH B O     1 
HETATM 9020 O  O     . HOH W  5 .   ? 92.096  12.011  -21.557 1.00 50.53  ? 2067 HOH B O     1 
HETATM 9021 O  O     . HOH W  5 .   ? 85.849  6.426   -28.732 1.00 67.33  ? 2068 HOH B O     1 
HETATM 9022 O  O     . HOH W  5 .   ? 85.772  10.793  -24.327 1.00 67.58  ? 2069 HOH B O     1 
HETATM 9023 O  O     . HOH W  5 .   ? 84.669  8.105   -24.986 1.00 45.61  ? 2070 HOH B O     1 
HETATM 9024 O  O     . HOH W  5 .   ? 88.578  2.772   -27.627 1.00 41.26  ? 2071 HOH B O     1 
HETATM 9025 O  O     . HOH W  5 .   ? 84.019  4.084   -18.028 1.00 68.24  ? 2072 HOH B O     1 
HETATM 9026 O  O     . HOH W  5 .   ? 89.547  0.473   -27.144 1.00 37.95  ? 2073 HOH B O     1 
HETATM 9027 O  O     . HOH W  5 .   ? 84.863  -0.808  -26.777 1.00 42.52  ? 2074 HOH B O     1 
HETATM 9028 O  O     . HOH W  5 .   ? 95.027  -2.890  -20.954 1.00 47.28  ? 2075 HOH B O     1 
HETATM 9029 O  O     . HOH W  5 .   ? 92.043  -1.526  -14.007 1.00 49.06  ? 2076 HOH B O     1 
HETATM 9030 O  O     . HOH W  5 .   ? 87.185  -9.597  -7.777  1.00 67.25  ? 2077 HOH B O     1 
HETATM 9031 O  O     . HOH W  5 .   ? 85.198  -7.328  -14.064 1.00 62.07  ? 2078 HOH B O     1 
HETATM 9032 O  O     . HOH W  5 .   ? 80.466  -10.211 -16.584 1.00 67.96  ? 2079 HOH B O     1 
HETATM 9033 O  O     . HOH W  5 .   ? 85.233  -3.909  -10.340 1.00 57.34  ? 2080 HOH B O     1 
HETATM 9034 O  O     . HOH W  5 .   ? 83.771  -2.410  -8.906  1.00 57.98  ? 2081 HOH B O     1 
HETATM 9035 O  O     . HOH W  5 .   ? 90.873  9.442   -10.730 1.00 45.71  ? 2082 HOH B O     1 
HETATM 9036 O  O     . HOH W  5 .   ? 94.560  14.758  -19.369 1.00 52.77  ? 2083 HOH B O     1 
HETATM 9037 O  O     . HOH W  5 .   ? 92.692  20.865  -10.340 1.00 52.12  ? 2084 HOH B O     1 
HETATM 9038 O  O     . HOH W  5 .   ? 90.501  22.188  -20.063 1.00 46.77  ? 2085 HOH B O     1 
HETATM 9039 O  O     . HOH W  5 .   ? 92.457  27.109  -15.170 1.00 52.22  ? 2086 HOH B O     1 
HETATM 9040 O  O     . HOH W  5 .   ? 103.943 25.938  -13.461 1.00 52.38  ? 2087 HOH B O     1 
HETATM 9041 O  O     . HOH W  5 .   ? 97.325  27.301  -26.541 1.00 45.87  ? 2088 HOH B O     1 
HETATM 9042 O  O     . HOH W  5 .   ? 99.089  25.530  -25.910 1.00 47.96  ? 2089 HOH B O     1 
HETATM 9043 O  O     . HOH W  5 .   ? 98.497  21.250  -28.262 1.00 55.21  ? 2090 HOH B O     1 
HETATM 9044 O  O     . HOH W  5 .   ? 97.436  11.839  -33.945 1.00 61.63  ? 2091 HOH B O     1 
HETATM 9045 O  O     . HOH W  5 .   ? 96.530  2.158   -28.140 1.00 43.27  ? 2092 HOH B O     1 
HETATM 9046 O  O     . HOH W  5 .   ? 99.182  3.248   -26.836 1.00 52.39  ? 2093 HOH B O     1 
HETATM 9047 O  O     . HOH W  5 .   ? 106.647 -1.641  -36.130 1.00 67.88  ? 2094 HOH B O     1 
HETATM 9048 O  O     . HOH W  5 .   ? 108.069 4.657   -31.649 1.00 54.22  ? 2095 HOH B O     1 
HETATM 9049 O  O     . HOH W  5 .   ? 105.514 1.595   -38.215 1.00 63.58  ? 2096 HOH B O     1 
HETATM 9050 O  O     . HOH W  5 .   ? 98.519  4.560   -34.223 1.00 38.07  ? 2097 HOH B O     1 
HETATM 9051 O  O     . HOH W  5 .   ? 111.376 10.882  -33.092 1.00 58.73  ? 2098 HOH B O     1 
HETATM 9052 O  O     . HOH W  5 .   ? 98.122  8.372   -15.731 1.00 47.15  ? 2099 HOH B O     1 
HETATM 9053 O  O     . HOH W  5 .   ? 100.895 3.329   -14.841 1.00 55.00  ? 2100 HOH B O     1 
HETATM 9054 O  O     . HOH W  5 .   ? 101.058 2.915   -19.117 1.00 42.85  ? 2101 HOH B O     1 
HETATM 9055 O  O     . HOH W  5 .   ? 107.563 8.353   -10.331 1.00 52.28  ? 2102 HOH B O     1 
HETATM 9056 O  O     . HOH X  5 .   ? 98.715  43.924  24.728  1.00 69.78  ? 2001 HOH C O     1 
HETATM 9057 O  O     . HOH X  5 .   ? 106.101 57.224  6.808   1.00 43.03  ? 2002 HOH C O     1 
HETATM 9058 O  O     . HOH X  5 .   ? 105.308 54.239  0.710   1.00 51.18  ? 2003 HOH C O     1 
HETATM 9059 O  O     . HOH X  5 .   ? 107.897 49.474  -1.429  1.00 61.21  ? 2004 HOH C O     1 
HETATM 9060 O  O     . HOH X  5 .   ? 107.139 55.542  -4.508  1.00 61.00  ? 2005 HOH C O     1 
HETATM 9061 O  O     . HOH X  5 .   ? 95.004  51.201  21.967  1.00 50.14  ? 2006 HOH C O     1 
HETATM 9062 O  O     . HOH X  5 .   ? 96.784  45.216  22.796  1.00 67.77  ? 2007 HOH C O     1 
HETATM 9063 O  O     . HOH X  5 .   ? 106.027 43.823  3.572   1.00 56.55  ? 2008 HOH C O     1 
HETATM 9064 O  O     . HOH X  5 .   ? 105.115 43.641  6.195   1.00 46.92  ? 2009 HOH C O     1 
HETATM 9065 O  O     . HOH X  5 .   ? 98.238  60.810  14.010  1.00 52.48  ? 2010 HOH C O     1 
HETATM 9066 O  O     . HOH X  5 .   ? 103.097 40.078  3.633   1.00 67.71  ? 2011 HOH C O     1 
HETATM 9067 O  O     . HOH X  5 .   ? 99.522  45.954  1.864   1.00 70.80  ? 2012 HOH C O     1 
HETATM 9068 O  O     . HOH X  5 .   ? 101.290 39.471  9.743   1.00 41.78  ? 2013 HOH C O     1 
HETATM 9069 O  O     . HOH X  5 .   ? 93.937  40.022  3.875   1.00 42.90  ? 2014 HOH C O     1 
HETATM 9070 O  O     . HOH X  5 .   ? 98.095  34.454  12.391  1.00 58.20  ? 2015 HOH C O     1 
HETATM 9071 O  O     . HOH X  5 .   ? 98.911  71.397  1.716   1.00 66.58  ? 2016 HOH C O     1 
HETATM 9072 O  O     . HOH X  5 .   ? 102.327 56.675  1.698   1.00 56.07  ? 2017 HOH C O     1 
HETATM 9073 O  O     . HOH X  5 .   ? 89.520  31.224  13.530  1.00 46.23  ? 2018 HOH C O     1 
HETATM 9074 O  O     . HOH X  5 .   ? 86.614  34.903  17.139  1.00 51.98  ? 2019 HOH C O     1 
HETATM 9075 O  O     . HOH X  5 .   ? 97.265  34.353  16.682  1.00 56.41  ? 2020 HOH C O     1 
HETATM 9076 O  O     . HOH X  5 .   ? 94.883  33.604  17.138  1.00 38.75  ? 2021 HOH C O     1 
HETATM 9077 O  O     . HOH X  5 .   ? 92.670  72.224  1.643   1.00 55.43  ? 2022 HOH C O     1 
HETATM 9078 O  O     . HOH X  5 .   ? 85.803  65.734  -2.197  1.00 50.14  ? 2023 HOH C O     1 
HETATM 9079 O  O     . HOH X  5 .   ? 85.855  39.348  12.338  1.00 57.30  ? 2024 HOH C O     1 
HETATM 9080 O  O     . HOH X  5 .   ? 85.655  31.643  15.212  1.00 37.85  ? 2025 HOH C O     1 
HETATM 9081 O  O     . HOH X  5 .   ? 92.921  67.793  7.784   1.00 63.00  ? 2026 HOH C O     1 
HETATM 9082 O  O     . HOH X  5 .   ? 95.599  63.013  11.661  1.00 44.61  ? 2027 HOH C O     1 
HETATM 9083 O  O     . HOH X  5 .   ? 89.550  37.343  9.695   1.00 54.03  ? 2028 HOH C O     1 
HETATM 9084 O  O     . HOH X  5 .   ? 91.436  39.027  4.123   1.00 52.27  ? 2029 HOH C O     1 
HETATM 9085 O  O     . HOH X  5 .   ? 82.317  41.344  16.871  1.00 59.77  ? 2030 HOH C O     1 
HETATM 9086 O  O     . HOH X  5 .   ? 83.549  46.010  12.739  1.00 60.59  ? 2031 HOH C O     1 
HETATM 9087 O  O     . HOH X  5 .   ? 87.172  49.404  17.708  1.00 60.69  ? 2032 HOH C O     1 
HETATM 9088 O  O     . HOH X  5 .   ? 92.308  51.259  11.031  1.00 48.31  ? 2033 HOH C O     1 
HETATM 9089 O  O     . HOH X  5 .   ? 101.231 53.172  21.415  1.00 62.44  ? 2034 HOH C O     1 
HETATM 9090 O  O     . HOH X  5 .   ? 103.023 48.885  21.903  1.00 50.69  ? 2035 HOH C O     1 
HETATM 9091 O  O     . HOH X  5 .   ? 97.342  51.467  21.163  1.00 49.99  ? 2036 HOH C O     1 
HETATM 9092 O  O     . HOH X  5 .   ? 98.210  48.063  23.110  1.00 47.42  ? 2037 HOH C O     1 
HETATM 9093 O  O     . HOH X  5 .   ? 103.347 38.848  11.270  1.00 42.31  ? 2038 HOH C O     1 
HETATM 9094 O  O     . HOH X  5 .   ? 106.402 51.985  1.003   1.00 47.53  ? 2039 HOH C O     1 
HETATM 9095 O  O     . HOH X  5 .   ? 104.012 51.906  4.856   1.00 60.88  ? 2040 HOH C O     1 
HETATM 9096 O  O     . HOH X  5 .   ? 104.314 50.722  8.911   1.00 50.08  ? 2041 HOH C O     1 
HETATM 9097 O  O     . HOH X  5 .   ? 102.994 52.636  11.037  1.00 60.53  ? 2042 HOH C O     1 
HETATM 9098 O  O     . HOH X  5 .   ? 103.552 48.458  17.238  1.00 53.62  ? 2043 HOH C O     1 
HETATM 9099 O  O     . HOH X  5 .   ? 105.206 58.477  11.855  1.00 52.33  ? 2044 HOH C O     1 
HETATM 9100 O  O     . HOH X  5 .   ? 102.450 60.771  15.878  1.00 48.57  ? 2045 HOH C O     1 
HETATM 9101 O  O     . HOH X  5 .   ? 99.567  58.589  14.023  1.00 54.77  ? 2046 HOH C O     1 
HETATM 9102 O  O     . HOH X  5 .   ? 102.349 58.581  21.661  1.00 58.09  ? 2047 HOH C O     1 
HETATM 9103 O  O     . HOH X  5 .   ? 103.465 60.490  19.313  1.00 55.19  ? 2048 HOH C O     1 
HETATM 9104 O  O     . HOH X  5 .   ? 104.456 49.203  19.896  1.00 49.47  ? 2049 HOH C O     1 
HETATM 9105 O  O     . HOH X  5 .   ? 111.996 52.399  19.001  1.00 53.38  ? 2050 HOH C O     1 
HETATM 9106 O  O     . HOH X  5 .   ? 102.708 48.884  26.897  1.00 64.65  ? 2051 HOH C O     1 
HETATM 9107 O  O     . HOH X  5 .   ? 107.965 47.242  27.745  1.00 75.53  ? 2052 HOH C O     1 
HETATM 9108 O  O     . HOH X  5 .   ? 115.185 44.418  23.666  1.00 71.89  ? 2053 HOH C O     1 
HETATM 9109 O  O     . HOH X  5 .   ? 113.922 42.343  23.573  1.00 65.02  ? 2054 HOH C O     1 
HETATM 9110 O  O     . HOH X  5 .   ? 114.790 52.735  19.972  1.00 69.67  ? 2055 HOH C O     1 
HETATM 9111 O  O     . HOH X  5 .   ? 107.905 63.413  3.089   1.00 48.72  ? 2056 HOH C O     1 
HETATM 9112 O  O     . HOH X  5 .   ? 106.463 72.683  2.619   1.00 56.39  ? 2057 HOH C O     1 
HETATM 9113 O  O     . HOH X  5 .   ? 105.264 73.762  0.130   1.00 62.34  ? 2058 HOH C O     1 
HETATM 9114 O  O     . HOH X  5 .   ? 97.974  69.947  -0.561  1.00 55.87  ? 2059 HOH C O     1 
HETATM 9115 O  O     . HOH X  5 .   ? 96.762  60.432  -5.698  1.00 40.58  ? 2060 HOH C O     1 
HETATM 9116 O  O     . HOH X  5 .   ? 100.364 59.548  -13.935 1.00 66.08  ? 2061 HOH C O     1 
HETATM 9117 O  O     . HOH X  5 .   ? 97.100  58.851  -12.610 1.00 53.46  ? 2062 HOH C O     1 
HETATM 9118 O  O     . HOH X  5 .   ? 88.448  61.389  -6.006  1.00 42.65  ? 2063 HOH C O     1 
HETATM 9119 O  O     . HOH X  5 .   ? 92.447  62.148  -11.763 1.00 48.83  ? 2064 HOH C O     1 
HETATM 9120 O  O     . HOH X  5 .   ? 86.901  59.797  -7.429  1.00 41.93  ? 2065 HOH C O     1 
HETATM 9121 O  O     . HOH X  5 .   ? 82.766  64.524  -10.851 1.00 47.93  ? 2066 HOH C O     1 
HETATM 9122 O  O     . HOH X  5 .   ? 89.090  69.591  -12.747 1.00 46.15  ? 2067 HOH C O     1 
HETATM 9123 O  O     . HOH X  5 .   ? 88.231  72.328  -9.771  1.00 45.59  ? 2068 HOH C O     1 
HETATM 9124 O  O     . HOH X  5 .   ? 85.933  70.349  -2.125  1.00 69.57  ? 2069 HOH C O     1 
HETATM 9125 O  O     . HOH X  5 .   ? 91.683  70.196  2.715   1.00 53.58  ? 2070 HOH C O     1 
HETATM 9126 O  O     . HOH X  5 .   ? 88.136  64.311  -2.990  1.00 48.78  ? 2071 HOH C O     1 
HETATM 9127 O  O     . HOH X  5 .   ? 88.099  64.340  1.573   1.00 54.56  ? 2072 HOH C O     1 
HETATM 9128 O  O     . HOH X  5 .   ? 98.281  70.083  3.928   1.00 56.63  ? 2073 HOH C O     1 
HETATM 9129 O  O     . HOH X  5 .   ? 93.939  65.059  7.714   1.00 55.61  ? 2074 HOH C O     1 
HETATM 9130 O  O     . HOH X  5 .   ? 97.953  60.518  4.948   1.00 51.92  ? 2075 HOH C O     1 
HETATM 9131 O  O     . HOH X  5 .   ? 97.457  61.462  11.492  1.00 41.88  ? 2076 HOH C O     1 
HETATM 9132 O  O     . HOH X  5 .   ? 108.694 64.571  6.768   1.00 55.20  ? 2077 HOH C O     1 
HETATM 9133 O  O     . HOH X  5 .   ? 95.011  65.215  10.403  1.00 46.86  ? 2078 HOH C O     1 
HETATM 9134 O  O     . HOH X  5 .   ? 107.464 63.948  20.225  1.00 48.20  ? 2079 HOH C O     1 
HETATM 9135 O  O     . HOH X  5 .   ? 113.684 66.784  18.763  1.00 53.59  ? 2080 HOH C O     1 
HETATM 9136 O  O     . HOH X  5 .   ? 113.334 53.605  21.336  1.00 55.25  ? 2081 HOH C O     1 
HETATM 9137 O  O     . HOH X  5 .   ? 122.024 54.406  16.853  1.00 68.45  ? 2082 HOH C O     1 
HETATM 9138 O  O     . HOH X  5 .   ? 121.014 62.430  14.036  1.00 68.59  ? 2083 HOH C O     1 
HETATM 9139 O  O     . HOH X  5 .   ? 104.848 57.512  1.768   1.00 51.32  ? 2084 HOH C O     1 
HETATM 9140 O  O     . HOH X  5 .   ? 100.945 48.428  2.966   1.00 60.79  ? 2085 HOH C O     1 
HETATM 9141 O  O     . HOH X  5 .   ? 105.410 46.319  3.058   1.00 50.54  ? 2086 HOH C O     1 
HETATM 9142 O  O     . HOH Y  5 .   ? 146.140 -11.995 7.497   1.00 70.95  ? 2001 HOH D O     1 
HETATM 9143 O  O     . HOH Y  5 .   ? 142.331 -11.560 9.690   1.00 71.94  ? 2002 HOH D O     1 
HETATM 9144 O  O     . HOH Y  5 .   ? 142.570 -11.335 12.258  1.00 68.49  ? 2003 HOH D O     1 
HETATM 9145 O  O     . HOH Y  5 .   ? 126.455 -30.408 13.366  1.00 72.67  ? 2004 HOH D O     1 
HETATM 9146 O  O     . HOH Y  5 .   ? 125.852 -27.196 15.467  1.00 72.67  ? 2005 HOH D O     1 
HETATM 9147 O  O     . HOH Y  5 .   ? 138.743 -13.516 32.378  1.00 65.60  ? 2006 HOH D O     1 
HETATM 9148 O  O     . HOH Y  5 .   ? 137.316 -21.674 32.661  1.00 57.10  ? 2007 HOH D O     1 
HETATM 9149 O  O     . HOH Y  5 .   ? 128.902 -31.655 12.018  1.00 75.31  ? 2008 HOH D O     1 
HETATM 9150 O  O     . HOH Z  5 .   ? 124.671 11.427  22.745  1.00 67.15  ? 2001 HOH E O     1 
HETATM 9151 O  O     . HOH Z  5 .   ? 126.915 11.390  47.805  1.00 85.22  ? 2002 HOH E O     1 
HETATM 9152 O  O     . HOH Z  5 .   ? 125.677 8.991   49.066  1.00 85.95  ? 2003 HOH E O     1 
HETATM 9153 O  O     . HOH Z  5 .   ? 126.882 13.149  23.388  1.00 50.78  ? 2004 HOH E O     1 
HETATM 9154 O  O     . HOH Z  5 .   ? 140.818 10.069  28.778  1.00 76.88  ? 2005 HOH E O     1 
HETATM 9155 O  O     . HOH Z  5 .   ? 129.496 11.871  22.562  1.00 65.37  ? 2006 HOH E O     1 
HETATM 9156 O  O     . HOH Z  5 .   ? 140.670 13.850  32.199  1.00 65.63  ? 2007 HOH E O     1 
HETATM 9157 O  O     . HOH Z  5 .   ? 137.810 9.721   26.420  1.00 64.08  ? 2008 HOH E O     1 
HETATM 9158 O  O     . HOH Z  5 .   ? 135.254 -1.964  30.827  1.00 58.98  ? 2009 HOH E O     1 
HETATM 9159 O  O     . HOH Z  5 .   ? 127.685 -8.875  31.138  1.00 72.24  ? 2010 HOH E O     1 
HETATM 9160 O  O     . HOH Z  5 .   ? 117.958 18.271  21.737  1.00 41.63  ? 2011 HOH E O     1 
HETATM 9161 O  O     . HOH Z  5 .   ? 129.508 7.060   26.189  1.00 62.75  ? 2012 HOH E O     1 
HETATM 9162 O  O     . HOH Z  5 .   ? 122.402 10.827  23.694  1.00 54.73  ? 2013 HOH E O     1 
HETATM 9163 O  O     . HOH Z  5 .   ? 118.076 8.178   21.010  1.00 51.47  ? 2014 HOH E O     1 
HETATM 9164 O  O     . HOH Z  5 .   ? 115.447 6.833   21.808  1.00 62.17  ? 2015 HOH E O     1 
HETATM 9165 O  O     . HOH Z  5 .   ? 114.708 4.175   23.278  1.00 66.21  ? 2016 HOH E O     1 
HETATM 9166 O  O     . HOH Z  5 .   ? 113.697 0.061   32.518  1.00 76.12  ? 2017 HOH E O     1 
HETATM 9167 O  O     . HOH Z  5 .   ? 118.702 -5.960  38.400  1.00 82.95  ? 2018 HOH E O     1 
HETATM 9168 O  O     . HOH Z  5 .   ? 116.821 7.901   35.487  1.00 57.14  ? 2019 HOH E O     1 
HETATM 9169 O  O     . HOH Z  5 .   ? 126.469 19.876  20.508  1.00 46.52  ? 2020 HOH E O     1 
HETATM 9170 O  O     . HOH Z  5 .   ? 122.496 27.469  25.209  1.00 69.88  ? 2021 HOH E O     1 
HETATM 9171 O  O     . HOH Z  5 .   ? 123.402 26.134  12.107  1.00 55.78  ? 2022 HOH E O     1 
HETATM 9172 O  O     . HOH Z  5 .   ? 127.378 19.266  8.528   1.00 56.74  ? 2023 HOH E O     1 
HETATM 9173 O  O     . HOH Z  5 .   ? 137.323 16.657  11.200  1.00 55.19  ? 2024 HOH E O     1 
HETATM 9174 O  O     . HOH Z  5 .   ? 148.851 19.360  11.891  1.00 79.94  ? 2025 HOH E O     1 
HETATM 9175 O  O     . HOH Z  5 .   ? 141.628 11.130  3.699   1.00 75.31  ? 2026 HOH E O     1 
HETATM 9176 O  O     . HOH Z  5 .   ? 124.487 9.402   9.916   1.00 46.49  ? 2027 HOH E O     1 
HETATM 9177 O  O     . HOH Z  5 .   ? 128.254 11.346  15.442  1.00 55.25  ? 2028 HOH E O     1 
HETATM 9178 O  O     . HOH Z  5 .   ? 122.558 8.130   16.167  1.00 49.98  ? 2029 HOH E O     1 
HETATM 9179 O  O     . HOH Z  5 .   ? 122.802 21.868  16.498  1.00 54.02  ? 2030 HOH E O     1 
HETATM 9180 O  O     . HOH Z  5 .   ? 120.996 5.114   14.282  1.00 69.16  ? 2031 HOH E O     1 
HETATM 9181 O  O     . HOH Z  5 .   ? 120.373 6.650   8.577   1.00 71.26  ? 2032 HOH E O     1 
HETATM 9182 O  O     . HOH Z  5 .   ? 120.052 17.615  20.387  1.00 46.30  ? 2033 HOH E O     1 
HETATM 9183 O  O     . HOH Z  5 .   ? 115.583 17.290  22.638  1.00 38.08  ? 2034 HOH E O     1 
HETATM 9184 O  O     . HOH Z  5 .   ? 118.850 7.328   33.954  1.00 57.43  ? 2035 HOH E O     1 
HETATM 9185 O  O     . HOH Z  5 .   ? 114.143 18.880  24.252  1.00 52.66  ? 2036 HOH E O     1 
HETATM 9186 O  O     . HOH Z  5 .   ? 110.713 19.083  25.597  1.00 51.30  ? 2037 HOH E O     1 
HETATM 9187 O  O     . HOH Z  5 .   ? 131.256 28.406  38.808  1.00 79.54  ? 2038 HOH E O     1 
HETATM 9188 O  O     . HOH Z  5 .   ? 133.821 13.973  23.052  1.00 52.45  ? 2039 HOH E O     1 
HETATM 9189 O  O     . HOH Z  5 .   ? 136.626 18.530  22.865  1.00 56.40  ? 2040 HOH E O     1 
HETATM 9190 O  O     . HOH AA 5 .   ? 70.038  62.086  4.274   1.00 69.92  ? 2001 HOH F O     1 
HETATM 9191 O  O     . HOH AA 5 .   ? 78.121  46.604  18.771  1.00 47.70  ? 2002 HOH F O     1 
HETATM 9192 O  O     . HOH AA 5 .   ? 80.304  40.673  15.106  1.00 47.98  ? 2003 HOH F O     1 
HETATM 9193 O  O     . HOH AA 5 .   ? 79.546  42.481  17.502  1.00 48.34  ? 2004 HOH F O     1 
HETATM 9194 O  O     . HOH AA 5 .   ? 76.731  44.775  17.175  1.00 34.06  ? 2005 HOH F O     1 
HETATM 9195 O  O     . HOH AA 5 .   ? 77.415  40.147  12.299  1.00 38.90  ? 2006 HOH F O     1 
HETATM 9196 O  O     . HOH AA 5 .   ? 78.627  43.585  15.222  1.00 51.50  ? 2007 HOH F O     1 
HETATM 9197 O  O     . HOH AA 5 .   ? 74.604  39.381  6.873   1.00 50.72  ? 2008 HOH F O     1 
HETATM 9198 O  O     . HOH AA 5 .   ? 91.510  25.653  8.050   1.00 61.52  ? 2009 HOH F O     1 
HETATM 9199 O  O     . HOH AA 5 .   ? 75.365  35.143  11.674  1.00 49.50  ? 2010 HOH F O     1 
HETATM 9200 O  O     . HOH AA 5 .   ? 85.089  60.868  -2.865  1.00 51.14  ? 2011 HOH F O     1 
HETATM 9201 O  O     . HOH AA 5 .   ? 102.489 54.481  6.710   1.00 53.08  ? 2012 HOH F O     1 
HETATM 9202 O  O     . HOH AA 5 .   ? 69.319  38.208  2.074   1.00 57.61  ? 2013 HOH F O     1 
HETATM 9203 O  O     . HOH AA 5 .   ? 95.137  59.625  14.393  1.00 52.37  ? 2014 HOH F O     1 
HETATM 9204 O  O     . HOH AA 5 .   ? 56.578  39.793  4.315   1.00 63.37  ? 2015 HOH F O     1 
HETATM 9205 O  O     . HOH AA 5 .   ? 76.269  46.167  3.506   1.00 50.31  ? 2016 HOH F O     1 
HETATM 9206 O  O     . HOH AA 5 .   ? 77.115  48.537  3.757   1.00 42.24  ? 2017 HOH F O     1 
HETATM 9207 O  O     . HOH AA 5 .   ? 86.806  47.178  5.803   1.00 61.83  ? 2018 HOH F O     1 
HETATM 9208 O  O     . HOH AA 5 .   ? 81.114  46.266  9.751   1.00 49.39  ? 2019 HOH F O     1 
HETATM 9209 O  O     . HOH AA 5 .   ? 81.222  53.095  0.527   1.00 47.55  ? 2020 HOH F O     1 
HETATM 9210 O  O     . HOH AA 5 .   ? 83.889  50.527  -4.903  1.00 59.86  ? 2021 HOH F O     1 
HETATM 9211 O  O     . HOH AA 5 .   ? 82.327  54.579  -1.400  1.00 50.71  ? 2022 HOH F O     1 
HETATM 9212 O  O     . HOH AA 5 .   ? 87.501  57.582  -8.023  1.00 54.87  ? 2023 HOH F O     1 
HETATM 9213 O  O     . HOH AA 5 .   ? 90.473  23.956  9.392   1.00 62.24  ? 2024 HOH F O     1 
HETATM 9214 O  O     . HOH AA 5 .   ? 92.805  58.860  -6.609  1.00 36.11  ? 2025 HOH F O     1 
HETATM 9215 O  O     . HOH AA 5 .   ? 97.923  30.904  14.647  1.00 45.39  ? 2026 HOH F O     1 
HETATM 9216 O  O     . HOH AA 5 .   ? 94.370  22.191  24.645  1.00 55.38  ? 2027 HOH F O     1 
HETATM 9217 O  O     . HOH AA 5 .   ? 87.628  61.802  -3.257  1.00 39.06  ? 2028 HOH F O     1 
HETATM 9218 O  O     . HOH AA 5 .   ? 83.899  62.488  3.621   1.00 68.20  ? 2029 HOH F O     1 
HETATM 9219 O  O     . HOH AA 5 .   ? 89.068  32.492  28.463  1.00 57.01  ? 2030 HOH F O     1 
HETATM 9220 O  O     . HOH AA 5 .   ? 92.289  53.603  -2.361  1.00 60.72  ? 2031 HOH F O     1 
HETATM 9221 O  O     . HOH AA 5 .   ? 100.130 55.142  5.474   1.00 50.38  ? 2032 HOH F O     1 
HETATM 9222 O  O     . HOH AA 5 .   ? 97.023  55.268  0.449   1.00 61.20  ? 2033 HOH F O     1 
HETATM 9223 O  O     . HOH AA 5 .   ? 73.244  46.073  27.249  1.00 46.62  ? 2034 HOH F O     1 
HETATM 9224 O  O     . HOH AA 5 .   ? 94.100  49.564  9.961   1.00 48.75  ? 2035 HOH F O     1 
HETATM 9225 O  O     . HOH AA 5 .   ? 101.916 50.855  6.259   1.00 58.82  ? 2036 HOH F O     1 
HETATM 9226 O  O     . HOH AA 5 .   ? 96.486  58.976  10.629  1.00 45.87  ? 2037 HOH F O     1 
HETATM 9227 O  O     . HOH AA 5 .   ? 101.695 51.448  12.884  1.00 51.97  ? 2038 HOH F O     1 
HETATM 9228 O  O     . HOH AA 5 .   ? 98.253  56.776  16.183  1.00 65.08  ? 2039 HOH F O     1 
HETATM 9229 O  O     . HOH AA 5 .   ? 90.528  60.198  13.870  1.00 64.36  ? 2040 HOH F O     1 
HETATM 9230 O  O     . HOH AA 5 .   ? 94.006  59.015  11.822  1.00 45.66  ? 2041 HOH F O     1 
HETATM 9231 O  O     . HOH AA 5 .   ? 94.964  57.108  15.363  1.00 54.08  ? 2042 HOH F O     1 
HETATM 9232 O  O     . HOH AA 5 .   ? 86.294  55.161  12.847  1.00 60.61  ? 2043 HOH F O     1 
HETATM 9233 O  O     . HOH AA 5 .   ? 80.540  60.957  13.682  1.00 63.52  ? 2044 HOH F O     1 
HETATM 9234 O  O     . HOH AA 5 .   ? 87.196  60.322  15.267  1.00 60.14  ? 2045 HOH F O     1 
HETATM 9235 O  O     . HOH AA 5 .   ? 85.177  63.482  12.644  1.00 54.54  ? 2046 HOH F O     1 
HETATM 9236 O  O     . HOH AA 5 .   ? 79.099  54.987  0.826   1.00 42.71  ? 2047 HOH F O     1 
HETATM 9237 O  O     . HOH AA 5 .   ? 75.359  60.262  -2.239  1.00 57.57  ? 2048 HOH F O     1 
HETATM 9238 O  O     . HOH AA 5 .   ? 80.026  56.616  -1.079  1.00 56.90  ? 2049 HOH F O     1 
HETATM 9239 O  O     . HOH AA 5 .   ? 78.713  48.680  11.228  1.00 46.19  ? 2050 HOH F O     1 
HETATM 9240 O  O     . HOH AA 5 .   ? 75.993  41.105  10.103  1.00 54.48  ? 2051 HOH F O     1 
HETATM 9241 O  O     . HOH AA 5 .   ? 78.662  44.879  11.220  1.00 61.91  ? 2052 HOH F O     1 
HETATM 9242 O  O     . HOH AA 5 .   ? 79.702  46.458  15.781  1.00 58.25  ? 2053 HOH F O     1 
HETATM 9243 O  O     . HOH AA 5 .   ? 80.477  49.731  13.393  1.00 42.95  ? 2054 HOH F O     1 
HETATM 9244 O  O     . HOH AA 5 .   ? 77.142  48.921  19.811  1.00 48.22  ? 2055 HOH F O     1 
HETATM 9245 O  O     . HOH AA 5 .   ? 80.067  52.226  23.697  1.00 54.51  ? 2056 HOH F O     1 
HETATM 9246 O  O     . HOH AA 5 .   ? 81.751  59.013  17.083  1.00 78.76  ? 2057 HOH F O     1 
HETATM 9247 O  O     . HOH AA 5 .   ? 79.413  55.931  24.336  1.00 57.25  ? 2058 HOH F O     1 
HETATM 9248 O  O     . HOH AA 5 .   ? 80.239  58.294  23.306  1.00 50.77  ? 2059 HOH F O     1 
HETATM 9249 O  O     . HOH AA 5 .   ? 81.475  51.802  14.380  1.00 54.09  ? 2060 HOH F O     1 
HETATM 9250 O  O     . HOH AA 5 .   ? 70.897  57.962  16.231  1.00 60.25  ? 2061 HOH F O     1 
HETATM 9251 O  O     . HOH AA 5 .   ? 70.408  68.797  13.624  1.00 66.35  ? 2062 HOH F O     1 
HETATM 9252 O  O     . HOH AA 5 .   ? 68.911  59.415  17.332  1.00 61.88  ? 2063 HOH F O     1 
HETATM 9253 O  O     . HOH AA 5 .   ? 74.932  39.152  21.853  1.00 41.11  ? 2064 HOH F O     1 
HETATM 9254 O  O     . HOH AA 5 .   ? 74.836  39.546  24.477  1.00 45.48  ? 2065 HOH F O     1 
HETATM 9255 O  O     . HOH AA 5 .   ? 76.908  35.649  29.665  1.00 54.08  ? 2066 HOH F O     1 
HETATM 9256 O  O     . HOH AA 5 .   ? 77.617  32.694  29.712  1.00 48.23  ? 2067 HOH F O     1 
HETATM 9257 O  O     . HOH AA 5 .   ? 85.016  33.499  25.909  1.00 61.03  ? 2068 HOH F O     1 
HETATM 9258 O  O     . HOH AA 5 .   ? 76.451  26.805  21.130  1.00 50.71  ? 2069 HOH F O     1 
HETATM 9259 O  O     . HOH AA 5 .   ? 74.424  26.659  19.235  1.00 64.95  ? 2070 HOH F O     1 
HETATM 9260 O  O     . HOH AA 5 .   ? 78.814  28.183  15.121  1.00 52.61  ? 2071 HOH F O     1 
HETATM 9261 O  O     . HOH AA 5 .   ? 85.703  25.482  11.660  1.00 62.98  ? 2072 HOH F O     1 
HETATM 9262 O  O     . HOH AA 5 .   ? 89.542  24.552  11.954  1.00 42.64  ? 2073 HOH F O     1 
HETATM 9263 O  O     . HOH AA 5 .   ? 94.759  29.794  11.544  1.00 55.30  ? 2074 HOH F O     1 
HETATM 9264 O  O     . HOH AA 5 .   ? 94.085  31.214  16.115  1.00 35.82  ? 2075 HOH F O     1 
HETATM 9265 O  O     . HOH AA 5 .   ? 90.304  25.202  14.874  1.00 49.59  ? 2076 HOH F O     1 
HETATM 9266 O  O     . HOH AA 5 .   ? 95.595  30.396  14.248  1.00 39.04  ? 2077 HOH F O     1 
HETATM 9267 O  O     . HOH AA 5 .   ? 99.559  25.714  18.084  1.00 44.09  ? 2078 HOH F O     1 
HETATM 9268 O  O     . HOH AA 5 .   ? 93.158  22.399  22.145  1.00 41.26  ? 2079 HOH F O     1 
HETATM 9269 O  O     . HOH AA 5 .   ? 90.714  30.172  28.171  1.00 54.51  ? 2080 HOH F O     1 
HETATM 9270 O  O     . HOH AA 5 .   ? 94.064  24.277  25.679  1.00 38.04  ? 2081 HOH F O     1 
HETATM 9271 O  O     . HOH AA 5 .   ? 95.268  33.690  23.742  1.00 60.26  ? 2082 HOH F O     1 
HETATM 9272 O  O     . HOH AA 5 .   ? 86.779  27.229  25.686  1.00 55.85  ? 2083 HOH F O     1 
HETATM 9273 O  O     . HOH AA 5 .   ? 90.906  36.987  27.262  1.00 54.90  ? 2084 HOH F O     1 
HETATM 9274 O  O     . HOH AA 5 .   ? 88.759  43.472  23.893  1.00 44.75  ? 2085 HOH F O     1 
HETATM 9275 O  O     . HOH AA 5 .   ? 83.640  42.514  19.375  1.00 55.51  ? 2086 HOH F O     1 
HETATM 9276 O  O     . HOH AA 5 .   ? 89.401  43.083  26.393  1.00 55.55  ? 2087 HOH F O     1 
HETATM 9277 O  O     . HOH AA 5 .   ? 84.175  48.283  22.294  1.00 57.81  ? 2088 HOH F O     1 
HETATM 9278 O  O     . HOH AA 5 .   ? 73.754  42.380  24.307  1.00 52.45  ? 2089 HOH F O     1 
HETATM 9279 O  O     . HOH AA 5 .   ? 82.200  51.167  26.975  1.00 42.92  ? 2090 HOH F O     1 
HETATM 9280 O  O     . HOH AA 5 .   ? 75.101  44.176  25.842  1.00 49.45  ? 2091 HOH F O     1 
HETATM 9281 O  O     . HOH AA 5 .   ? 72.987  48.450  28.351  1.00 45.82  ? 2092 HOH F O     1 
HETATM 9282 O  O     . HOH AA 5 .   ? 69.613  35.319  25.825  1.00 62.03  ? 2093 HOH F O     1 
HETATM 9283 O  O     . HOH AA 5 .   ? 64.507  28.191  20.185  1.00 66.57  ? 2094 HOH F O     1 
HETATM 9284 O  O     . HOH AA 5 .   ? 55.714  41.269  7.574   1.00 70.10  ? 2095 HOH F O     1 
HETATM 9285 O  O     . HOH AA 5 .   ? 77.811  40.131  15.535  1.00 44.94  ? 2096 HOH F O     1 
HETATM 9286 O  O     . HOH AA 5 .   ? 81.166  38.283  13.999  1.00 52.78  ? 2097 HOH F O     1 
HETATM 9287 O  O     . HOH AA 5 .   ? 77.060  44.875  5.506   1.00 65.32  ? 2098 HOH F O     1 
HETATM 9288 O  O     . HOH AA 5 .   ? 70.931  44.955  1.346   1.00 49.45  ? 2099 HOH F O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   ?   ?   ?   A . n 
A 1 3   GLY 3   2   ?   ?   ?   A . n 
A 1 4   GLY 4   3   3   GLY GLY A . n 
A 1 5   PHE 5   4   4   PHE PHE A . n 
A 1 6   MET 6   5   5   MET MET A . n 
A 1 7   GLU 7   6   6   GLU GLU A . n 
A 1 8   ASP 8   7   7   ASP ASP A . n 
A 1 9   LEU 9   8   8   LEU LEU A . n 
A 1 10  ARG 10  9   9   ARG ARG A . n 
A 1 11  LYS 11  10  10  LYS LYS A . n 
A 1 12  CYS 12  11  11  CYS CYS A . n 
A 1 13  LYS 13  12  12  LYS LYS A . n 
A 1 14  ILE 14  13  13  ILE ILE A . n 
A 1 15  ILE 15  14  14  ILE ILE A . n 
A 1 16  PHE 16  15  15  PHE PHE A . n 
A 1 17  ILE 17  16  16  ILE ILE A . n 
A 1 18  ILE 18  17  17  ILE ILE A . n 
A 1 19  GLY 19  18  18  GLY GLY A . n 
A 1 20  GLY 20  19  19  GLY GLY A . n 
A 1 21  PRO 21  20  20  PRO PRO A . n 
A 1 22  GLY 22  21  21  GLY GLY A . n 
A 1 23  SER 23  22  22  SER SER A . n 
A 1 24  GLY 24  23  23  GLY GLY A . n 
A 1 25  LYS 25  24  24  LYS LYS A . n 
A 1 26  GLY 26  25  25  GLY GLY A . n 
A 1 27  THR 27  26  26  THR THR A . n 
A 1 28  GLN 28  27  27  GLN GLN A . n 
A 1 29  CYS 29  28  28  CYS CYS A . n 
A 1 30  GLU 30  29  29  GLU GLU A . n 
A 1 31  LYS 31  30  30  LYS LYS A . n 
A 1 32  LEU 32  31  31  LEU LEU A . n 
A 1 33  VAL 33  32  32  VAL VAL A . n 
A 1 34  GLU 34  33  33  GLU GLU A . n 
A 1 35  LYS 35  34  34  LYS LYS A . n 
A 1 36  TYR 36  35  35  TYR TYR A . n 
A 1 37  GLY 37  36  36  GLY GLY A . n 
A 1 38  PHE 38  37  37  PHE PHE A . n 
A 1 39  THR 39  38  38  THR THR A . n 
A 1 40  HIS 40  39  39  HIS HIS A . n 
A 1 41  LEU 41  40  40  LEU LEU A . n 
A 1 42  SER 42  41  41  SER SER A . n 
A 1 43  THR 43  42  42  THR THR A . n 
A 1 44  GLY 44  43  43  GLY GLY A . n 
A 1 45  GLU 45  44  44  GLU GLU A . n 
A 1 46  LEU 46  45  45  LEU LEU A . n 
A 1 47  LEU 47  46  46  LEU LEU A . n 
A 1 48  ARG 48  47  47  ARG ARG A . n 
A 1 49  GLU 49  48  48  GLU GLU A . n 
A 1 50  GLU 50  49  49  GLU GLU A . n 
A 1 51  LEU 51  50  50  LEU LEU A . n 
A 1 52  ALA 52  51  51  ALA ALA A . n 
A 1 53  SER 53  52  52  SER SER A . n 
A 1 54  GLU 54  53  53  GLU GLU A . n 
A 1 55  SER 55  54  54  SER SER A . n 
A 1 56  GLU 56  55  55  GLU GLU A . n 
A 1 57  ARG 57  56  56  ARG ARG A . n 
A 1 58  SER 58  57  57  SER SER A . n 
A 1 59  LYS 59  58  58  LYS LYS A . n 
A 1 60  LEU 60  59  59  LEU LEU A . n 
A 1 61  ILE 61  60  60  ILE ILE A . n 
A 1 62  ARG 62  61  61  ARG ARG A . n 
A 1 63  ASP 63  62  62  ASP ASP A . n 
A 1 64  ILE 64  63  63  ILE ILE A . n 
A 1 65  MET 65  64  64  MET MET A . n 
A 1 66  GLU 66  65  65  GLU GLU A . n 
A 1 67  ARG 67  66  66  ARG ARG A . n 
A 1 68  GLY 68  67  67  GLY GLY A . n 
A 1 69  ASP 69  68  68  ASP ASP A . n 
A 1 70  LEU 70  69  69  LEU LEU A . n 
A 1 71  VAL 71  70  70  VAL VAL A . n 
A 1 72  PRO 72  71  71  PRO PRO A . n 
A 1 73  SER 73  72  72  SER SER A . n 
A 1 74  GLY 74  73  73  GLY GLY A . n 
A 1 75  ILE 75  74  74  ILE ILE A . n 
A 1 76  VAL 76  75  75  VAL VAL A . n 
A 1 77  LEU 77  76  76  LEU LEU A . n 
A 1 78  GLU 78  77  77  GLU GLU A . n 
A 1 79  LEU 79  78  78  LEU LEU A . n 
A 1 80  LEU 80  79  79  LEU LEU A . n 
A 1 81  LYS 81  80  80  LYS LYS A . n 
A 1 82  GLU 82  81  81  GLU GLU A . n 
A 1 83  ALA 83  82  82  ALA ALA A . n 
A 1 84  MET 84  83  83  MET MET A . n 
A 1 85  VAL 85  84  84  VAL VAL A . n 
A 1 86  ALA 86  85  85  ALA ALA A . n 
A 1 87  SER 87  86  86  SER SER A . n 
A 1 88  LEU 88  87  87  LEU LEU A . n 
A 1 89  GLY 89  88  88  GLY GLY A . n 
A 1 90  ASP 90  89  89  ASP ASP A . n 
A 1 91  THR 91  90  90  THR THR A . n 
A 1 92  ARG 92  91  91  ARG ARG A . n 
A 1 93  GLY 93  92  92  GLY GLY A . n 
A 1 94  PHE 94  93  93  PHE PHE A . n 
A 1 95  LEU 95  94  94  LEU LEU A . n 
A 1 96  ILE 96  95  95  ILE ILE A . n 
A 1 97  ASP 97  96  96  ASP ASP A . n 
A 1 98  GLY 98  97  97  GLY GLY A . n 
A 1 99  TYR 99  98  98  TYR TYR A . n 
A 1 100 PRO 100 99  99  PRO PRO A . n 
A 1 101 ARG 101 100 100 ARG ARG A . n 
A 1 102 GLU 102 101 101 GLU GLU A . n 
A 1 103 VAL 103 102 102 VAL VAL A . n 
A 1 104 LYS 104 103 103 LYS LYS A . n 
A 1 105 GLN 105 104 104 GLN GLN A . n 
A 1 106 GLY 106 105 105 GLY GLY A . n 
A 1 107 GLU 107 106 106 GLU GLU A . n 
A 1 108 GLU 108 107 107 GLU GLU A . n 
A 1 109 PHE 109 108 108 PHE PHE A . n 
A 1 110 GLY 110 109 109 GLY GLY A . n 
A 1 111 ARG 111 110 110 ARG ARG A . n 
A 1 112 ARG 112 111 111 ARG ARG A . n 
A 1 113 ILE 113 112 112 ILE ILE A . n 
A 1 114 GLY 114 113 113 GLY GLY A . n 
A 1 115 ASP 115 114 114 ASP ASP A . n 
A 1 116 PRO 116 115 115 PRO PRO A . n 
A 1 117 GLN 117 116 116 GLN GLN A . n 
A 1 118 LEU 118 117 117 LEU LEU A . n 
A 1 119 VAL 119 118 118 VAL VAL A . n 
A 1 120 ILE 120 119 119 ILE ILE A . n 
A 1 121 CYS 121 120 120 CYS CYS A . n 
A 1 122 MET 122 121 121 MET MET A . n 
A 1 123 ASP 123 122 122 ASP ASP A . n 
A 1 124 CYS 124 123 123 CYS CYS A . n 
A 1 125 SER 125 124 124 SER SER A . n 
A 1 126 ALA 126 125 125 ALA ALA A . n 
A 1 127 ASP 127 126 126 ASP ASP A . n 
A 1 128 THR 128 127 127 THR THR A . n 
A 1 129 MET 129 128 128 MET MET A . n 
A 1 130 THR 130 129 129 THR THR A . n 
A 1 131 ASN 131 130 130 ASN ASN A . n 
A 1 132 ARG 132 131 131 ARG ARG A . n 
A 1 133 LEU 133 132 132 LEU LEU A . n 
A 1 134 LEU 134 133 133 LEU LEU A . n 
A 1 135 GLN 135 134 134 GLN GLN A . n 
A 1 136 MET 136 135 135 MET MET A . n 
A 1 137 SER 137 136 136 SER SER A . n 
A 1 138 ARG 138 137 137 ARG ARG A . n 
A 1 139 SER 139 138 138 SER SER A . n 
A 1 140 SER 140 139 139 SER SER A . n 
A 1 141 LEU 141 140 140 LEU LEU A . n 
A 1 142 PRO 142 141 141 PRO PRO A . n 
A 1 143 VAL 143 142 142 VAL VAL A . n 
A 1 144 ASP 144 143 143 ASP ASP A . n 
A 1 145 ASP 145 144 144 ASP ASP A . n 
A 1 146 THR 146 145 145 THR THR A . n 
A 1 147 THR 147 146 146 THR THR A . n 
A 1 148 LYS 148 147 147 LYS LYS A . n 
A 1 149 THR 149 148 148 THR THR A . n 
A 1 150 ILE 150 149 149 ILE ILE A . n 
A 1 151 ALA 151 150 150 ALA ALA A . n 
A 1 152 LYS 152 151 151 LYS LYS A . n 
A 1 153 ARG 153 152 152 ARG ARG A . n 
A 1 154 LEU 154 153 153 LEU LEU A . n 
A 1 155 GLU 155 154 154 GLU GLU A . n 
A 1 156 ALA 156 155 155 ALA ALA A . n 
A 1 157 TYR 157 156 156 TYR TYR A . n 
A 1 158 TYR 158 157 157 TYR TYR A . n 
A 1 159 ARG 159 158 158 ARG ARG A . n 
A 1 160 ALA 160 159 159 ALA ALA A . n 
A 1 161 SER 161 160 160 SER SER A . n 
A 1 162 ILE 162 161 161 ILE ILE A . n 
A 1 163 PRO 163 162 162 PRO PRO A . n 
A 1 164 VAL 164 163 163 VAL VAL A . n 
A 1 165 ILE 165 164 164 ILE ILE A . n 
A 1 166 ALA 166 165 165 ALA ALA A . n 
A 1 167 TYR 167 166 166 TYR TYR A . n 
A 1 168 TYR 168 167 167 TYR TYR A . n 
A 1 169 GLU 169 168 168 GLU GLU A . n 
A 1 170 THR 170 169 169 THR THR A . n 
A 1 171 LYS 171 170 170 LYS LYS A . n 
A 1 172 THR 172 171 171 THR THR A . n 
A 1 173 GLN 173 172 172 GLN GLN A . n 
A 1 174 LEU 174 173 173 LEU LEU A . n 
A 1 175 HIS 175 174 174 HIS HIS A . n 
A 1 176 LYS 176 175 175 LYS LYS A . n 
A 1 177 ILE 177 176 176 ILE ILE A . n 
A 1 178 ASN 178 177 177 ASN ASN A . n 
A 1 179 ALA 179 178 178 ALA ALA A . n 
A 1 180 GLU 180 179 179 GLU GLU A . n 
A 1 181 GLY 181 180 180 GLY GLY A . n 
A 1 182 THR 182 181 181 THR THR A . n 
A 1 183 PRO 183 182 182 PRO PRO A . n 
A 1 184 GLU 184 183 183 GLU GLU A . n 
A 1 185 ASP 185 184 184 ASP ASP A . n 
A 1 186 VAL 186 185 185 VAL VAL A . n 
A 1 187 PHE 187 186 186 PHE PHE A . n 
A 1 188 LEU 188 187 187 LEU LEU A . n 
A 1 189 GLN 189 188 188 GLN GLN A . n 
A 1 190 LEU 190 189 189 LEU LEU A . n 
A 1 191 CYS 191 190 190 CYS CYS A . n 
A 1 192 THR 192 191 191 THR THR A . n 
A 1 193 ALA 193 192 192 ALA ALA A . n 
A 1 194 ILE 194 193 193 ILE ILE A . n 
A 1 195 ASP 195 194 194 ASP ASP A . n 
A 1 196 SER 196 195 195 SER SER A . n 
A 1 197 ILE 197 196 196 ILE ILE A . n 
A 1 198 PHE 198 197 197 PHE PHE A . n 
A 1 199 LEU 199 198 198 LEU LEU A . n 
B 1 1   SER 1   0   ?   ?   ?   B . n 
B 1 2   MET 2   1   ?   ?   ?   B . n 
B 1 3   GLY 3   2   ?   ?   ?   B . n 
B 1 4   GLY 4   3   ?   ?   ?   B . n 
B 1 5   PHE 5   4   4   PHE PHE B . n 
B 1 6   MET 6   5   5   MET MET B . n 
B 1 7   GLU 7   6   6   GLU GLU B . n 
B 1 8   ASP 8   7   7   ASP ASP B . n 
B 1 9   LEU 9   8   8   LEU LEU B . n 
B 1 10  ARG 10  9   9   ARG ARG B . n 
B 1 11  LYS 11  10  10  LYS LYS B . n 
B 1 12  CYS 12  11  11  CYS CYS B . n 
B 1 13  LYS 13  12  12  LYS LYS B . n 
B 1 14  ILE 14  13  13  ILE ILE B . n 
B 1 15  ILE 15  14  14  ILE ILE B . n 
B 1 16  PHE 16  15  15  PHE PHE B . n 
B 1 17  ILE 17  16  16  ILE ILE B . n 
B 1 18  ILE 18  17  17  ILE ILE B . n 
B 1 19  GLY 19  18  18  GLY GLY B . n 
B 1 20  GLY 20  19  19  GLY GLY B . n 
B 1 21  PRO 21  20  20  PRO PRO B . n 
B 1 22  GLY 22  21  21  GLY GLY B . n 
B 1 23  SER 23  22  22  SER SER B . n 
B 1 24  GLY 24  23  23  GLY GLY B . n 
B 1 25  LYS 25  24  24  LYS LYS B . n 
B 1 26  GLY 26  25  25  GLY GLY B . n 
B 1 27  THR 27  26  26  THR THR B . n 
B 1 28  GLN 28  27  27  GLN GLN B . n 
B 1 29  CYS 29  28  28  CYS CYS B . n 
B 1 30  GLU 30  29  29  GLU GLU B . n 
B 1 31  LYS 31  30  30  LYS LYS B . n 
B 1 32  LEU 32  31  31  LEU LEU B . n 
B 1 33  VAL 33  32  32  VAL VAL B . n 
B 1 34  GLU 34  33  33  GLU GLU B . n 
B 1 35  LYS 35  34  34  LYS LYS B . n 
B 1 36  TYR 36  35  35  TYR TYR B . n 
B 1 37  GLY 37  36  36  GLY GLY B . n 
B 1 38  PHE 38  37  37  PHE PHE B . n 
B 1 39  THR 39  38  38  THR THR B . n 
B 1 40  HIS 40  39  39  HIS HIS B . n 
B 1 41  LEU 41  40  40  LEU LEU B . n 
B 1 42  SER 42  41  41  SER SER B . n 
B 1 43  THR 43  42  42  THR THR B . n 
B 1 44  GLY 44  43  43  GLY GLY B . n 
B 1 45  GLU 45  44  44  GLU GLU B . n 
B 1 46  LEU 46  45  45  LEU LEU B . n 
B 1 47  LEU 47  46  46  LEU LEU B . n 
B 1 48  ARG 48  47  47  ARG ARG B . n 
B 1 49  GLU 49  48  48  GLU GLU B . n 
B 1 50  GLU 50  49  49  GLU GLU B . n 
B 1 51  LEU 51  50  50  LEU LEU B . n 
B 1 52  ALA 52  51  51  ALA ALA B . n 
B 1 53  SER 53  52  52  SER SER B . n 
B 1 54  GLU 54  53  53  GLU GLU B . n 
B 1 55  SER 55  54  54  SER SER B . n 
B 1 56  GLU 56  55  55  GLU GLU B . n 
B 1 57  ARG 57  56  56  ARG ARG B . n 
B 1 58  SER 58  57  57  SER SER B . n 
B 1 59  LYS 59  58  58  LYS LYS B . n 
B 1 60  LEU 60  59  59  LEU LEU B . n 
B 1 61  ILE 61  60  60  ILE ILE B . n 
B 1 62  ARG 62  61  61  ARG ARG B . n 
B 1 63  ASP 63  62  62  ASP ASP B . n 
B 1 64  ILE 64  63  63  ILE ILE B . n 
B 1 65  MET 65  64  64  MET MET B . n 
B 1 66  GLU 66  65  65  GLU GLU B . n 
B 1 67  ARG 67  66  66  ARG ARG B . n 
B 1 68  GLY 68  67  67  GLY GLY B . n 
B 1 69  ASP 69  68  68  ASP ASP B . n 
B 1 70  LEU 70  69  69  LEU LEU B . n 
B 1 71  VAL 71  70  70  VAL VAL B . n 
B 1 72  PRO 72  71  71  PRO PRO B . n 
B 1 73  SER 73  72  72  SER SER B . n 
B 1 74  GLY 74  73  73  GLY GLY B . n 
B 1 75  ILE 75  74  74  ILE ILE B . n 
B 1 76  VAL 76  75  75  VAL VAL B . n 
B 1 77  LEU 77  76  76  LEU LEU B . n 
B 1 78  GLU 78  77  77  GLU GLU B . n 
B 1 79  LEU 79  78  78  LEU LEU B . n 
B 1 80  LEU 80  79  79  LEU LEU B . n 
B 1 81  LYS 81  80  80  LYS LYS B . n 
B 1 82  GLU 82  81  81  GLU GLU B . n 
B 1 83  ALA 83  82  82  ALA ALA B . n 
B 1 84  MET 84  83  83  MET MET B . n 
B 1 85  VAL 85  84  84  VAL VAL B . n 
B 1 86  ALA 86  85  85  ALA ALA B . n 
B 1 87  SER 87  86  86  SER SER B . n 
B 1 88  LEU 88  87  87  LEU LEU B . n 
B 1 89  GLY 89  88  88  GLY GLY B . n 
B 1 90  ASP 90  89  89  ASP ASP B . n 
B 1 91  THR 91  90  90  THR THR B . n 
B 1 92  ARG 92  91  91  ARG ARG B . n 
B 1 93  GLY 93  92  92  GLY GLY B . n 
B 1 94  PHE 94  93  93  PHE PHE B . n 
B 1 95  LEU 95  94  94  LEU LEU B . n 
B 1 96  ILE 96  95  95  ILE ILE B . n 
B 1 97  ASP 97  96  96  ASP ASP B . n 
B 1 98  GLY 98  97  97  GLY GLY B . n 
B 1 99  TYR 99  98  98  TYR TYR B . n 
B 1 100 PRO 100 99  99  PRO PRO B . n 
B 1 101 ARG 101 100 100 ARG ARG B . n 
B 1 102 GLU 102 101 101 GLU GLU B . n 
B 1 103 VAL 103 102 102 VAL VAL B . n 
B 1 104 LYS 104 103 103 LYS LYS B . n 
B 1 105 GLN 105 104 104 GLN GLN B . n 
B 1 106 GLY 106 105 105 GLY GLY B . n 
B 1 107 GLU 107 106 106 GLU GLU B . n 
B 1 108 GLU 108 107 107 GLU GLU B . n 
B 1 109 PHE 109 108 108 PHE PHE B . n 
B 1 110 GLY 110 109 109 GLY GLY B . n 
B 1 111 ARG 111 110 110 ARG ARG B . n 
B 1 112 ARG 112 111 111 ARG ARG B . n 
B 1 113 ILE 113 112 112 ILE ILE B . n 
B 1 114 GLY 114 113 113 GLY GLY B . n 
B 1 115 ASP 115 114 114 ASP ASP B . n 
B 1 116 PRO 116 115 115 PRO PRO B . n 
B 1 117 GLN 117 116 116 GLN GLN B . n 
B 1 118 LEU 118 117 117 LEU LEU B . n 
B 1 119 VAL 119 118 118 VAL VAL B . n 
B 1 120 ILE 120 119 119 ILE ILE B . n 
B 1 121 CYS 121 120 120 CYS CYS B . n 
B 1 122 MET 122 121 121 MET MET B . n 
B 1 123 ASP 123 122 122 ASP ASP B . n 
B 1 124 CYS 124 123 123 CYS CYS B . n 
B 1 125 SER 125 124 124 SER SER B . n 
B 1 126 ALA 126 125 125 ALA ALA B . n 
B 1 127 ASP 127 126 126 ASP ASP B . n 
B 1 128 THR 128 127 127 THR THR B . n 
B 1 129 MET 129 128 128 MET MET B . n 
B 1 130 THR 130 129 129 THR THR B . n 
B 1 131 ASN 131 130 130 ASN ASN B . n 
B 1 132 ARG 132 131 131 ARG ARG B . n 
B 1 133 LEU 133 132 132 LEU LEU B . n 
B 1 134 LEU 134 133 133 LEU LEU B . n 
B 1 135 GLN 135 134 134 GLN GLN B . n 
B 1 136 MET 136 135 135 MET MET B . n 
B 1 137 SER 137 136 136 SER SER B . n 
B 1 138 ARG 138 137 137 ARG ARG B . n 
B 1 139 SER 139 138 138 SER SER B . n 
B 1 140 SER 140 139 139 SER SER B . n 
B 1 141 LEU 141 140 140 LEU LEU B . n 
B 1 142 PRO 142 141 141 PRO PRO B . n 
B 1 143 VAL 143 142 142 VAL VAL B . n 
B 1 144 ASP 144 143 143 ASP ASP B . n 
B 1 145 ASP 145 144 144 ASP ASP B . n 
B 1 146 THR 146 145 145 THR THR B . n 
B 1 147 THR 147 146 146 THR THR B . n 
B 1 148 LYS 148 147 147 LYS LYS B . n 
B 1 149 THR 149 148 148 THR THR B . n 
B 1 150 ILE 150 149 149 ILE ILE B . n 
B 1 151 ALA 151 150 150 ALA ALA B . n 
B 1 152 LYS 152 151 151 LYS LYS B . n 
B 1 153 ARG 153 152 152 ARG ARG B . n 
B 1 154 LEU 154 153 153 LEU LEU B . n 
B 1 155 GLU 155 154 154 GLU GLU B . n 
B 1 156 ALA 156 155 155 ALA ALA B . n 
B 1 157 TYR 157 156 156 TYR TYR B . n 
B 1 158 TYR 158 157 157 TYR TYR B . n 
B 1 159 ARG 159 158 158 ARG ARG B . n 
B 1 160 ALA 160 159 159 ALA ALA B . n 
B 1 161 SER 161 160 160 SER SER B . n 
B 1 162 ILE 162 161 161 ILE ILE B . n 
B 1 163 PRO 163 162 162 PRO PRO B . n 
B 1 164 VAL 164 163 163 VAL VAL B . n 
B 1 165 ILE 165 164 164 ILE ILE B . n 
B 1 166 ALA 166 165 165 ALA ALA B . n 
B 1 167 TYR 167 166 166 TYR TYR B . n 
B 1 168 TYR 168 167 167 TYR TYR B . n 
B 1 169 GLU 169 168 168 GLU GLU B . n 
B 1 170 THR 170 169 169 THR THR B . n 
B 1 171 LYS 171 170 170 LYS LYS B . n 
B 1 172 THR 172 171 171 THR THR B . n 
B 1 173 GLN 173 172 172 GLN GLN B . n 
B 1 174 LEU 174 173 173 LEU LEU B . n 
B 1 175 HIS 175 174 174 HIS HIS B . n 
B 1 176 LYS 176 175 175 LYS LYS B . n 
B 1 177 ILE 177 176 176 ILE ILE B . n 
B 1 178 ASN 178 177 177 ASN ASN B . n 
B 1 179 ALA 179 178 178 ALA ALA B . n 
B 1 180 GLU 180 179 179 GLU GLU B . n 
B 1 181 GLY 181 180 180 GLY GLY B . n 
B 1 182 THR 182 181 181 THR THR B . n 
B 1 183 PRO 183 182 182 PRO PRO B . n 
B 1 184 GLU 184 183 183 GLU GLU B . n 
B 1 185 ASP 185 184 184 ASP ASP B . n 
B 1 186 VAL 186 185 185 VAL VAL B . n 
B 1 187 PHE 187 186 186 PHE PHE B . n 
B 1 188 LEU 188 187 187 LEU LEU B . n 
B 1 189 GLN 189 188 188 GLN GLN B . n 
B 1 190 LEU 190 189 189 LEU LEU B . n 
B 1 191 CYS 191 190 190 CYS CYS B . n 
B 1 192 THR 192 191 191 THR THR B . n 
B 1 193 ALA 193 192 192 ALA ALA B . n 
B 1 194 ILE 194 193 193 ILE ILE B . n 
B 1 195 ASP 195 194 194 ASP ASP B . n 
B 1 196 SER 196 195 195 SER SER B . n 
B 1 197 ILE 197 196 196 ILE ILE B . n 
B 1 198 PHE 198 197 197 PHE PHE B . n 
B 1 199 LEU 199 198 198 LEU LEU B . n 
C 1 1   SER 1   0   ?   ?   ?   C . n 
C 1 2   MET 2   1   ?   ?   ?   C . n 
C 1 3   GLY 3   2   ?   ?   ?   C . n 
C 1 4   GLY 4   3   ?   ?   ?   C . n 
C 1 5   PHE 5   4   ?   ?   ?   C . n 
C 1 6   MET 6   5   5   MET MET C . n 
C 1 7   GLU 7   6   6   GLU GLU C . n 
C 1 8   ASP 8   7   7   ASP ASP C . n 
C 1 9   LEU 9   8   8   LEU LEU C . n 
C 1 10  ARG 10  9   9   ARG ARG C . n 
C 1 11  LYS 11  10  10  LYS LYS C . n 
C 1 12  CYS 12  11  11  CYS CYS C . n 
C 1 13  LYS 13  12  12  LYS LYS C . n 
C 1 14  ILE 14  13  13  ILE ILE C . n 
C 1 15  ILE 15  14  14  ILE ILE C . n 
C 1 16  PHE 16  15  15  PHE PHE C . n 
C 1 17  ILE 17  16  16  ILE ILE C . n 
C 1 18  ILE 18  17  17  ILE ILE C . n 
C 1 19  GLY 19  18  18  GLY GLY C . n 
C 1 20  GLY 20  19  19  GLY GLY C . n 
C 1 21  PRO 21  20  20  PRO PRO C . n 
C 1 22  GLY 22  21  21  GLY GLY C . n 
C 1 23  SER 23  22  22  SER SER C . n 
C 1 24  GLY 24  23  23  GLY GLY C . n 
C 1 25  LYS 25  24  24  LYS LYS C . n 
C 1 26  GLY 26  25  25  GLY GLY C . n 
C 1 27  THR 27  26  26  THR THR C . n 
C 1 28  GLN 28  27  27  GLN GLN C . n 
C 1 29  CYS 29  28  28  CYS CYS C . n 
C 1 30  GLU 30  29  29  GLU GLU C . n 
C 1 31  LYS 31  30  30  LYS LYS C . n 
C 1 32  LEU 32  31  31  LEU LEU C . n 
C 1 33  VAL 33  32  32  VAL VAL C . n 
C 1 34  GLU 34  33  33  GLU GLU C . n 
C 1 35  LYS 35  34  34  LYS LYS C . n 
C 1 36  TYR 36  35  35  TYR TYR C . n 
C 1 37  GLY 37  36  36  GLY GLY C . n 
C 1 38  PHE 38  37  37  PHE PHE C . n 
C 1 39  THR 39  38  38  THR THR C . n 
C 1 40  HIS 40  39  39  HIS HIS C . n 
C 1 41  LEU 41  40  40  LEU LEU C . n 
C 1 42  SER 42  41  41  SER SER C . n 
C 1 43  THR 43  42  42  THR THR C . n 
C 1 44  GLY 44  43  43  GLY GLY C . n 
C 1 45  GLU 45  44  44  GLU GLU C . n 
C 1 46  LEU 46  45  45  LEU LEU C . n 
C 1 47  LEU 47  46  46  LEU LEU C . n 
C 1 48  ARG 48  47  47  ARG ARG C . n 
C 1 49  GLU 49  48  48  GLU GLU C . n 
C 1 50  GLU 50  49  49  GLU GLU C . n 
C 1 51  LEU 51  50  50  LEU LEU C . n 
C 1 52  ALA 52  51  51  ALA ALA C . n 
C 1 53  SER 53  52  52  SER SER C . n 
C 1 54  GLU 54  53  53  GLU GLU C . n 
C 1 55  SER 55  54  54  SER SER C . n 
C 1 56  GLU 56  55  55  GLU GLU C . n 
C 1 57  ARG 57  56  56  ARG ARG C . n 
C 1 58  SER 58  57  57  SER SER C . n 
C 1 59  LYS 59  58  58  LYS LYS C . n 
C 1 60  LEU 60  59  59  LEU LEU C . n 
C 1 61  ILE 61  60  60  ILE ILE C . n 
C 1 62  ARG 62  61  61  ARG ARG C . n 
C 1 63  ASP 63  62  62  ASP ASP C . n 
C 1 64  ILE 64  63  63  ILE ILE C . n 
C 1 65  MET 65  64  64  MET MET C . n 
C 1 66  GLU 66  65  65  GLU GLU C . n 
C 1 67  ARG 67  66  66  ARG ARG C . n 
C 1 68  GLY 68  67  67  GLY GLY C . n 
C 1 69  ASP 69  68  68  ASP ASP C . n 
C 1 70  LEU 70  69  69  LEU LEU C . n 
C 1 71  VAL 71  70  70  VAL VAL C . n 
C 1 72  PRO 72  71  71  PRO PRO C . n 
C 1 73  SER 73  72  72  SER SER C . n 
C 1 74  GLY 74  73  73  GLY GLY C . n 
C 1 75  ILE 75  74  74  ILE ILE C . n 
C 1 76  VAL 76  75  75  VAL VAL C . n 
C 1 77  LEU 77  76  76  LEU LEU C . n 
C 1 78  GLU 78  77  77  GLU GLU C . n 
C 1 79  LEU 79  78  78  LEU LEU C . n 
C 1 80  LEU 80  79  79  LEU LEU C . n 
C 1 81  LYS 81  80  80  LYS LYS C . n 
C 1 82  GLU 82  81  81  GLU GLU C . n 
C 1 83  ALA 83  82  82  ALA ALA C . n 
C 1 84  MET 84  83  83  MET MET C . n 
C 1 85  VAL 85  84  84  VAL VAL C . n 
C 1 86  ALA 86  85  85  ALA ALA C . n 
C 1 87  SER 87  86  86  SER SER C . n 
C 1 88  LEU 88  87  87  LEU LEU C . n 
C 1 89  GLY 89  88  88  GLY GLY C . n 
C 1 90  ASP 90  89  89  ASP ASP C . n 
C 1 91  THR 91  90  90  THR THR C . n 
C 1 92  ARG 92  91  91  ARG ARG C . n 
C 1 93  GLY 93  92  92  GLY GLY C . n 
C 1 94  PHE 94  93  93  PHE PHE C . n 
C 1 95  LEU 95  94  94  LEU LEU C . n 
C 1 96  ILE 96  95  95  ILE ILE C . n 
C 1 97  ASP 97  96  96  ASP ASP C . n 
C 1 98  GLY 98  97  97  GLY GLY C . n 
C 1 99  TYR 99  98  98  TYR TYR C . n 
C 1 100 PRO 100 99  99  PRO PRO C . n 
C 1 101 ARG 101 100 100 ARG ARG C . n 
C 1 102 GLU 102 101 101 GLU GLU C . n 
C 1 103 VAL 103 102 102 VAL VAL C . n 
C 1 104 LYS 104 103 103 LYS LYS C . n 
C 1 105 GLN 105 104 104 GLN GLN C . n 
C 1 106 GLY 106 105 105 GLY GLY C . n 
C 1 107 GLU 107 106 106 GLU GLU C . n 
C 1 108 GLU 108 107 107 GLU GLU C . n 
C 1 109 PHE 109 108 108 PHE PHE C . n 
C 1 110 GLY 110 109 109 GLY GLY C . n 
C 1 111 ARG 111 110 110 ARG ARG C . n 
C 1 112 ARG 112 111 111 ARG ARG C . n 
C 1 113 ILE 113 112 112 ILE ILE C . n 
C 1 114 GLY 114 113 113 GLY GLY C . n 
C 1 115 ASP 115 114 114 ASP ASP C . n 
C 1 116 PRO 116 115 115 PRO PRO C . n 
C 1 117 GLN 117 116 116 GLN GLN C . n 
C 1 118 LEU 118 117 117 LEU LEU C . n 
C 1 119 VAL 119 118 118 VAL VAL C . n 
C 1 120 ILE 120 119 119 ILE ILE C . n 
C 1 121 CYS 121 120 120 CYS CYS C . n 
C 1 122 MET 122 121 121 MET MET C . n 
C 1 123 ASP 123 122 122 ASP ASP C . n 
C 1 124 CYS 124 123 123 CYS CYS C . n 
C 1 125 SER 125 124 124 SER SER C . n 
C 1 126 ALA 126 125 125 ALA ALA C . n 
C 1 127 ASP 127 126 126 ASP ASP C . n 
C 1 128 THR 128 127 127 THR THR C . n 
C 1 129 MET 129 128 128 MET MET C . n 
C 1 130 THR 130 129 129 THR THR C . n 
C 1 131 ASN 131 130 130 ASN ASN C . n 
C 1 132 ARG 132 131 131 ARG ARG C . n 
C 1 133 LEU 133 132 132 LEU LEU C . n 
C 1 134 LEU 134 133 133 LEU LEU C . n 
C 1 135 GLN 135 134 134 GLN GLN C . n 
C 1 136 MET 136 135 135 MET MET C . n 
C 1 137 SER 137 136 136 SER SER C . n 
C 1 138 ARG 138 137 137 ARG ARG C . n 
C 1 139 SER 139 138 138 SER SER C . n 
C 1 140 SER 140 139 139 SER SER C . n 
C 1 141 LEU 141 140 140 LEU LEU C . n 
C 1 142 PRO 142 141 141 PRO PRO C . n 
C 1 143 VAL 143 142 142 VAL VAL C . n 
C 1 144 ASP 144 143 143 ASP ASP C . n 
C 1 145 ASP 145 144 144 ASP ASP C . n 
C 1 146 THR 146 145 145 THR THR C . n 
C 1 147 THR 147 146 146 THR THR C . n 
C 1 148 LYS 148 147 147 LYS LYS C . n 
C 1 149 THR 149 148 148 THR THR C . n 
C 1 150 ILE 150 149 149 ILE ILE C . n 
C 1 151 ALA 151 150 150 ALA ALA C . n 
C 1 152 LYS 152 151 151 LYS LYS C . n 
C 1 153 ARG 153 152 152 ARG ARG C . n 
C 1 154 LEU 154 153 153 LEU LEU C . n 
C 1 155 GLU 155 154 154 GLU GLU C . n 
C 1 156 ALA 156 155 155 ALA ALA C . n 
C 1 157 TYR 157 156 156 TYR TYR C . n 
C 1 158 TYR 158 157 157 TYR TYR C . n 
C 1 159 ARG 159 158 158 ARG ARG C . n 
C 1 160 ALA 160 159 159 ALA ALA C . n 
C 1 161 SER 161 160 160 SER SER C . n 
C 1 162 ILE 162 161 161 ILE ILE C . n 
C 1 163 PRO 163 162 162 PRO PRO C . n 
C 1 164 VAL 164 163 163 VAL VAL C . n 
C 1 165 ILE 165 164 164 ILE ILE C . n 
C 1 166 ALA 166 165 165 ALA ALA C . n 
C 1 167 TYR 167 166 166 TYR TYR C . n 
C 1 168 TYR 168 167 167 TYR TYR C . n 
C 1 169 GLU 169 168 168 GLU GLU C . n 
C 1 170 THR 170 169 169 THR THR C . n 
C 1 171 LYS 171 170 170 LYS LYS C . n 
C 1 172 THR 172 171 171 THR THR C . n 
C 1 173 GLN 173 172 172 GLN GLN C . n 
C 1 174 LEU 174 173 173 LEU LEU C . n 
C 1 175 HIS 175 174 174 HIS HIS C . n 
C 1 176 LYS 176 175 175 LYS LYS C . n 
C 1 177 ILE 177 176 176 ILE ILE C . n 
C 1 178 ASN 178 177 177 ASN ASN C . n 
C 1 179 ALA 179 178 178 ALA ALA C . n 
C 1 180 GLU 180 179 179 GLU GLU C . n 
C 1 181 GLY 181 180 180 GLY GLY C . n 
C 1 182 THR 182 181 181 THR THR C . n 
C 1 183 PRO 183 182 182 PRO PRO C . n 
C 1 184 GLU 184 183 183 GLU GLU C . n 
C 1 185 ASP 185 184 184 ASP ASP C . n 
C 1 186 VAL 186 185 185 VAL VAL C . n 
C 1 187 PHE 187 186 186 PHE PHE C . n 
C 1 188 LEU 188 187 187 LEU LEU C . n 
C 1 189 GLN 189 188 188 GLN GLN C . n 
C 1 190 LEU 190 189 189 LEU LEU C . n 
C 1 191 CYS 191 190 190 CYS CYS C . n 
C 1 192 THR 192 191 191 THR THR C . n 
C 1 193 ALA 193 192 192 ALA ALA C . n 
C 1 194 ILE 194 193 193 ILE ILE C . n 
C 1 195 ASP 195 194 194 ASP ASP C . n 
C 1 196 SER 196 195 195 SER SER C . n 
C 1 197 ILE 197 196 196 ILE ILE C . n 
C 1 198 PHE 198 197 197 PHE PHE C . n 
C 1 199 LEU 199 198 ?   ?   ?   C . n 
D 1 1   SER 1   0   ?   ?   ?   D . n 
D 1 2   MET 2   1   ?   ?   ?   D . n 
D 1 3   GLY 3   2   ?   ?   ?   D . n 
D 1 4   GLY 4   3   ?   ?   ?   D . n 
D 1 5   PHE 5   4   ?   ?   ?   D . n 
D 1 6   MET 6   5   5   MET MET D . n 
D 1 7   GLU 7   6   6   GLU GLU D . n 
D 1 8   ASP 8   7   7   ASP ASP D . n 
D 1 9   LEU 9   8   8   LEU LEU D . n 
D 1 10  ARG 10  9   9   ARG ARG D . n 
D 1 11  LYS 11  10  10  LYS LYS D . n 
D 1 12  CYS 12  11  11  CYS CYS D . n 
D 1 13  LYS 13  12  12  LYS LYS D . n 
D 1 14  ILE 14  13  13  ILE ILE D . n 
D 1 15  ILE 15  14  14  ILE ILE D . n 
D 1 16  PHE 16  15  15  PHE PHE D . n 
D 1 17  ILE 17  16  16  ILE ILE D . n 
D 1 18  ILE 18  17  17  ILE ILE D . n 
D 1 19  GLY 19  18  18  GLY GLY D . n 
D 1 20  GLY 20  19  19  GLY GLY D . n 
D 1 21  PRO 21  20  20  PRO PRO D . n 
D 1 22  GLY 22  21  21  GLY GLY D . n 
D 1 23  SER 23  22  22  SER SER D . n 
D 1 24  GLY 24  23  23  GLY GLY D . n 
D 1 25  LYS 25  24  24  LYS LYS D . n 
D 1 26  GLY 26  25  25  GLY GLY D . n 
D 1 27  THR 27  26  26  THR THR D . n 
D 1 28  GLN 28  27  27  GLN GLN D . n 
D 1 29  CYS 29  28  28  CYS CYS D . n 
D 1 30  GLU 30  29  29  GLU GLU D . n 
D 1 31  LYS 31  30  30  LYS LYS D . n 
D 1 32  LEU 32  31  31  LEU LEU D . n 
D 1 33  VAL 33  32  32  VAL VAL D . n 
D 1 34  GLU 34  33  33  GLU GLU D . n 
D 1 35  LYS 35  34  34  LYS LYS D . n 
D 1 36  TYR 36  35  35  TYR TYR D . n 
D 1 37  GLY 37  36  36  GLY GLY D . n 
D 1 38  PHE 38  37  37  PHE PHE D . n 
D 1 39  THR 39  38  38  THR THR D . n 
D 1 40  HIS 40  39  39  HIS HIS D . n 
D 1 41  LEU 41  40  40  LEU LEU D . n 
D 1 42  SER 42  41  41  SER SER D . n 
D 1 43  THR 43  42  42  THR THR D . n 
D 1 44  GLY 44  43  43  GLY GLY D . n 
D 1 45  GLU 45  44  44  GLU GLU D . n 
D 1 46  LEU 46  45  45  LEU LEU D . n 
D 1 47  LEU 47  46  46  LEU LEU D . n 
D 1 48  ARG 48  47  47  ARG ARG D . n 
D 1 49  GLU 49  48  48  GLU GLU D . n 
D 1 50  GLU 50  49  49  GLU GLU D . n 
D 1 51  LEU 51  50  50  LEU LEU D . n 
D 1 52  ALA 52  51  51  ALA ALA D . n 
D 1 53  SER 53  52  52  SER SER D . n 
D 1 54  GLU 54  53  53  GLU GLU D . n 
D 1 55  SER 55  54  54  SER SER D . n 
D 1 56  GLU 56  55  55  GLU GLU D . n 
D 1 57  ARG 57  56  56  ARG ARG D . n 
D 1 58  SER 58  57  57  SER SER D . n 
D 1 59  LYS 59  58  58  LYS LYS D . n 
D 1 60  LEU 60  59  59  LEU LEU D . n 
D 1 61  ILE 61  60  60  ILE ILE D . n 
D 1 62  ARG 62  61  61  ARG ARG D . n 
D 1 63  ASP 63  62  62  ASP ASP D . n 
D 1 64  ILE 64  63  63  ILE ILE D . n 
D 1 65  MET 65  64  64  MET MET D . n 
D 1 66  GLU 66  65  65  GLU GLU D . n 
D 1 67  ARG 67  66  66  ARG ARG D . n 
D 1 68  GLY 68  67  67  GLY GLY D . n 
D 1 69  ASP 69  68  68  ASP ASP D . n 
D 1 70  LEU 70  69  69  LEU LEU D . n 
D 1 71  VAL 71  70  70  VAL VAL D . n 
D 1 72  PRO 72  71  71  PRO PRO D . n 
D 1 73  SER 73  72  72  SER SER D . n 
D 1 74  GLY 74  73  73  GLY GLY D . n 
D 1 75  ILE 75  74  74  ILE ILE D . n 
D 1 76  VAL 76  75  75  VAL VAL D . n 
D 1 77  LEU 77  76  76  LEU LEU D . n 
D 1 78  GLU 78  77  77  GLU GLU D . n 
D 1 79  LEU 79  78  78  LEU LEU D . n 
D 1 80  LEU 80  79  79  LEU LEU D . n 
D 1 81  LYS 81  80  80  LYS LYS D . n 
D 1 82  GLU 82  81  81  GLU GLU D . n 
D 1 83  ALA 83  82  82  ALA ALA D . n 
D 1 84  MET 84  83  83  MET MET D . n 
D 1 85  VAL 85  84  84  VAL VAL D . n 
D 1 86  ALA 86  85  85  ALA ALA D . n 
D 1 87  SER 87  86  86  SER SER D . n 
D 1 88  LEU 88  87  87  LEU LEU D . n 
D 1 89  GLY 89  88  88  GLY GLY D . n 
D 1 90  ASP 90  89  89  ASP ASP D . n 
D 1 91  THR 91  90  90  THR THR D . n 
D 1 92  ARG 92  91  91  ARG ARG D . n 
D 1 93  GLY 93  92  92  GLY GLY D . n 
D 1 94  PHE 94  93  93  PHE PHE D . n 
D 1 95  LEU 95  94  94  LEU LEU D . n 
D 1 96  ILE 96  95  95  ILE ILE D . n 
D 1 97  ASP 97  96  96  ASP ASP D . n 
D 1 98  GLY 98  97  97  GLY GLY D . n 
D 1 99  TYR 99  98  98  TYR TYR D . n 
D 1 100 PRO 100 99  99  PRO PRO D . n 
D 1 101 ARG 101 100 100 ARG ARG D . n 
D 1 102 GLU 102 101 101 GLU GLU D . n 
D 1 103 VAL 103 102 102 VAL VAL D . n 
D 1 104 LYS 104 103 103 LYS LYS D . n 
D 1 105 GLN 105 104 104 GLN GLN D . n 
D 1 106 GLY 106 105 105 GLY GLY D . n 
D 1 107 GLU 107 106 106 GLU GLU D . n 
D 1 108 GLU 108 107 107 GLU GLU D . n 
D 1 109 PHE 109 108 108 PHE PHE D . n 
D 1 110 GLY 110 109 109 GLY GLY D . n 
D 1 111 ARG 111 110 110 ARG ARG D . n 
D 1 112 ARG 112 111 111 ARG ARG D . n 
D 1 113 ILE 113 112 112 ILE ILE D . n 
D 1 114 GLY 114 113 113 GLY GLY D . n 
D 1 115 ASP 115 114 114 ASP ASP D . n 
D 1 116 PRO 116 115 115 PRO PRO D . n 
D 1 117 GLN 117 116 116 GLN GLN D . n 
D 1 118 LEU 118 117 117 LEU LEU D . n 
D 1 119 VAL 119 118 118 VAL VAL D . n 
D 1 120 ILE 120 119 119 ILE ILE D . n 
D 1 121 CYS 121 120 120 CYS CYS D . n 
D 1 122 MET 122 121 121 MET MET D . n 
D 1 123 ASP 123 122 122 ASP ASP D . n 
D 1 124 CYS 124 123 123 CYS CYS D . n 
D 1 125 SER 125 124 124 SER SER D . n 
D 1 126 ALA 126 125 125 ALA ALA D . n 
D 1 127 ASP 127 126 126 ASP ASP D . n 
D 1 128 THR 128 127 127 THR THR D . n 
D 1 129 MET 129 128 128 MET MET D . n 
D 1 130 THR 130 129 129 THR THR D . n 
D 1 131 ASN 131 130 130 ASN ASN D . n 
D 1 132 ARG 132 131 131 ARG ARG D . n 
D 1 133 LEU 133 132 132 LEU LEU D . n 
D 1 134 LEU 134 133 133 LEU LEU D . n 
D 1 135 GLN 135 134 134 GLN GLN D . n 
D 1 136 MET 136 135 135 MET MET D . n 
D 1 137 SER 137 136 136 SER SER D . n 
D 1 138 ARG 138 137 137 ARG ARG D . n 
D 1 139 SER 139 138 138 SER SER D . n 
D 1 140 SER 140 139 139 SER SER D . n 
D 1 141 LEU 141 140 140 LEU LEU D . n 
D 1 142 PRO 142 141 141 PRO PRO D . n 
D 1 143 VAL 143 142 142 VAL VAL D . n 
D 1 144 ASP 144 143 143 ASP ASP D . n 
D 1 145 ASP 145 144 144 ASP ASP D . n 
D 1 146 THR 146 145 145 THR THR D . n 
D 1 147 THR 147 146 146 THR THR D . n 
D 1 148 LYS 148 147 147 LYS LYS D . n 
D 1 149 THR 149 148 148 THR THR D . n 
D 1 150 ILE 150 149 149 ILE ILE D . n 
D 1 151 ALA 151 150 150 ALA ALA D . n 
D 1 152 LYS 152 151 151 LYS LYS D . n 
D 1 153 ARG 153 152 152 ARG ARG D . n 
D 1 154 LEU 154 153 153 LEU LEU D . n 
D 1 155 GLU 155 154 154 GLU GLU D . n 
D 1 156 ALA 156 155 155 ALA ALA D . n 
D 1 157 TYR 157 156 156 TYR TYR D . n 
D 1 158 TYR 158 157 157 TYR TYR D . n 
D 1 159 ARG 159 158 158 ARG ARG D . n 
D 1 160 ALA 160 159 159 ALA ALA D . n 
D 1 161 SER 161 160 160 SER SER D . n 
D 1 162 ILE 162 161 161 ILE ILE D . n 
D 1 163 PRO 163 162 162 PRO PRO D . n 
D 1 164 VAL 164 163 163 VAL VAL D . n 
D 1 165 ILE 165 164 164 ILE ILE D . n 
D 1 166 ALA 166 165 165 ALA ALA D . n 
D 1 167 TYR 167 166 166 TYR TYR D . n 
D 1 168 TYR 168 167 167 TYR TYR D . n 
D 1 169 GLU 169 168 168 GLU GLU D . n 
D 1 170 THR 170 169 169 THR THR D . n 
D 1 171 LYS 171 170 170 LYS LYS D . n 
D 1 172 THR 172 171 171 THR THR D . n 
D 1 173 GLN 173 172 172 GLN GLN D . n 
D 1 174 LEU 174 173 173 LEU LEU D . n 
D 1 175 HIS 175 174 174 HIS HIS D . n 
D 1 176 LYS 176 175 175 LYS LYS D . n 
D 1 177 ILE 177 176 176 ILE ILE D . n 
D 1 178 ASN 178 177 177 ASN ASN D . n 
D 1 179 ALA 179 178 178 ALA ALA D . n 
D 1 180 GLU 180 179 179 GLU GLU D . n 
D 1 181 GLY 181 180 180 GLY GLY D . n 
D 1 182 THR 182 181 181 THR THR D . n 
D 1 183 PRO 183 182 182 PRO PRO D . n 
D 1 184 GLU 184 183 183 GLU GLU D . n 
D 1 185 ASP 185 184 184 ASP ASP D . n 
D 1 186 VAL 186 185 185 VAL VAL D . n 
D 1 187 PHE 187 186 186 PHE PHE D . n 
D 1 188 LEU 188 187 187 LEU LEU D . n 
D 1 189 GLN 189 188 188 GLN GLN D . n 
D 1 190 LEU 190 189 189 LEU LEU D . n 
D 1 191 CYS 191 190 190 CYS CYS D . n 
D 1 192 THR 192 191 191 THR THR D . n 
D 1 193 ALA 193 192 192 ALA ALA D . n 
D 1 194 ILE 194 193 193 ILE ILE D . n 
D 1 195 ASP 195 194 194 ASP ASP D . n 
D 1 196 SER 196 195 195 SER SER D . n 
D 1 197 ILE 197 196 196 ILE ILE D . n 
D 1 198 PHE 198 197 ?   ?   ?   D . n 
D 1 199 LEU 199 198 ?   ?   ?   D . n 
E 1 1   SER 1   0   ?   ?   ?   E . n 
E 1 2   MET 2   1   ?   ?   ?   E . n 
E 1 3   GLY 3   2   ?   ?   ?   E . n 
E 1 4   GLY 4   3   ?   ?   ?   E . n 
E 1 5   PHE 5   4   ?   ?   ?   E . n 
E 1 6   MET 6   5   ?   ?   ?   E . n 
E 1 7   GLU 7   6   ?   ?   ?   E . n 
E 1 8   ASP 8   7   ?   ?   ?   E . n 
E 1 9   LEU 9   8   8   LEU LEU E . n 
E 1 10  ARG 10  9   9   ARG ARG E . n 
E 1 11  LYS 11  10  10  LYS LYS E . n 
E 1 12  CYS 12  11  11  CYS CYS E . n 
E 1 13  LYS 13  12  12  LYS LYS E . n 
E 1 14  ILE 14  13  13  ILE ILE E . n 
E 1 15  ILE 15  14  14  ILE ILE E . n 
E 1 16  PHE 16  15  15  PHE PHE E . n 
E 1 17  ILE 17  16  16  ILE ILE E . n 
E 1 18  ILE 18  17  17  ILE ILE E . n 
E 1 19  GLY 19  18  18  GLY GLY E . n 
E 1 20  GLY 20  19  19  GLY GLY E . n 
E 1 21  PRO 21  20  20  PRO PRO E . n 
E 1 22  GLY 22  21  21  GLY GLY E . n 
E 1 23  SER 23  22  22  SER SER E . n 
E 1 24  GLY 24  23  23  GLY GLY E . n 
E 1 25  LYS 25  24  24  LYS LYS E . n 
E 1 26  GLY 26  25  25  GLY GLY E . n 
E 1 27  THR 27  26  26  THR THR E . n 
E 1 28  GLN 28  27  27  GLN GLN E . n 
E 1 29  CYS 29  28  28  CYS CYS E . n 
E 1 30  GLU 30  29  29  GLU GLU E . n 
E 1 31  LYS 31  30  30  LYS LYS E . n 
E 1 32  LEU 32  31  31  LEU LEU E . n 
E 1 33  VAL 33  32  32  VAL VAL E . n 
E 1 34  GLU 34  33  33  GLU GLU E . n 
E 1 35  LYS 35  34  34  LYS LYS E . n 
E 1 36  TYR 36  35  35  TYR TYR E . n 
E 1 37  GLY 37  36  36  GLY GLY E . n 
E 1 38  PHE 38  37  37  PHE PHE E . n 
E 1 39  THR 39  38  38  THR THR E . n 
E 1 40  HIS 40  39  39  HIS HIS E . n 
E 1 41  LEU 41  40  40  LEU LEU E . n 
E 1 42  SER 42  41  41  SER SER E . n 
E 1 43  THR 43  42  42  THR THR E . n 
E 1 44  GLY 44  43  43  GLY GLY E . n 
E 1 45  GLU 45  44  44  GLU GLU E . n 
E 1 46  LEU 46  45  45  LEU LEU E . n 
E 1 47  LEU 47  46  46  LEU LEU E . n 
E 1 48  ARG 48  47  47  ARG ARG E . n 
E 1 49  GLU 49  48  48  GLU GLU E . n 
E 1 50  GLU 50  49  49  GLU GLU E . n 
E 1 51  LEU 51  50  50  LEU LEU E . n 
E 1 52  ALA 52  51  51  ALA ALA E . n 
E 1 53  SER 53  52  52  SER SER E . n 
E 1 54  GLU 54  53  53  GLU GLU E . n 
E 1 55  SER 55  54  54  SER SER E . n 
E 1 56  GLU 56  55  55  GLU GLU E . n 
E 1 57  ARG 57  56  56  ARG ARG E . n 
E 1 58  SER 58  57  57  SER SER E . n 
E 1 59  LYS 59  58  58  LYS LYS E . n 
E 1 60  LEU 60  59  59  LEU LEU E . n 
E 1 61  ILE 61  60  60  ILE ILE E . n 
E 1 62  ARG 62  61  61  ARG ARG E . n 
E 1 63  ASP 63  62  62  ASP ASP E . n 
E 1 64  ILE 64  63  63  ILE ILE E . n 
E 1 65  MET 65  64  64  MET MET E . n 
E 1 66  GLU 66  65  65  GLU GLU E . n 
E 1 67  ARG 67  66  66  ARG ARG E . n 
E 1 68  GLY 68  67  67  GLY GLY E . n 
E 1 69  ASP 69  68  68  ASP ASP E . n 
E 1 70  LEU 70  69  69  LEU LEU E . n 
E 1 71  VAL 71  70  70  VAL VAL E . n 
E 1 72  PRO 72  71  71  PRO PRO E . n 
E 1 73  SER 73  72  72  SER SER E . n 
E 1 74  GLY 74  73  73  GLY GLY E . n 
E 1 75  ILE 75  74  74  ILE ILE E . n 
E 1 76  VAL 76  75  75  VAL VAL E . n 
E 1 77  LEU 77  76  76  LEU LEU E . n 
E 1 78  GLU 78  77  77  GLU GLU E . n 
E 1 79  LEU 79  78  78  LEU LEU E . n 
E 1 80  LEU 80  79  79  LEU LEU E . n 
E 1 81  LYS 81  80  80  LYS LYS E . n 
E 1 82  GLU 82  81  81  GLU GLU E . n 
E 1 83  ALA 83  82  82  ALA ALA E . n 
E 1 84  MET 84  83  83  MET MET E . n 
E 1 85  VAL 85  84  84  VAL VAL E . n 
E 1 86  ALA 86  85  85  ALA ALA E . n 
E 1 87  SER 87  86  86  SER SER E . n 
E 1 88  LEU 88  87  87  LEU LEU E . n 
E 1 89  GLY 89  88  88  GLY GLY E . n 
E 1 90  ASP 90  89  89  ASP ASP E . n 
E 1 91  THR 91  90  90  THR THR E . n 
E 1 92  ARG 92  91  91  ARG ARG E . n 
E 1 93  GLY 93  92  92  GLY GLY E . n 
E 1 94  PHE 94  93  93  PHE PHE E . n 
E 1 95  LEU 95  94  94  LEU LEU E . n 
E 1 96  ILE 96  95  95  ILE ILE E . n 
E 1 97  ASP 97  96  96  ASP ASP E . n 
E 1 98  GLY 98  97  97  GLY GLY E . n 
E 1 99  TYR 99  98  98  TYR TYR E . n 
E 1 100 PRO 100 99  99  PRO PRO E . n 
E 1 101 ARG 101 100 100 ARG ARG E . n 
E 1 102 GLU 102 101 101 GLU GLU E . n 
E 1 103 VAL 103 102 102 VAL VAL E . n 
E 1 104 LYS 104 103 103 LYS LYS E . n 
E 1 105 GLN 105 104 104 GLN GLN E . n 
E 1 106 GLY 106 105 105 GLY GLY E . n 
E 1 107 GLU 107 106 106 GLU GLU E . n 
E 1 108 GLU 108 107 107 GLU GLU E . n 
E 1 109 PHE 109 108 108 PHE PHE E . n 
E 1 110 GLY 110 109 109 GLY GLY E . n 
E 1 111 ARG 111 110 110 ARG ARG E . n 
E 1 112 ARG 112 111 111 ARG ARG E . n 
E 1 113 ILE 113 112 112 ILE ILE E . n 
E 1 114 GLY 114 113 113 GLY GLY E . n 
E 1 115 ASP 115 114 114 ASP ASP E . n 
E 1 116 PRO 116 115 115 PRO PRO E . n 
E 1 117 GLN 117 116 116 GLN GLN E . n 
E 1 118 LEU 118 117 117 LEU LEU E . n 
E 1 119 VAL 119 118 118 VAL VAL E . n 
E 1 120 ILE 120 119 119 ILE ILE E . n 
E 1 121 CYS 121 120 120 CYS CYS E . n 
E 1 122 MET 122 121 121 MET MET E . n 
E 1 123 ASP 123 122 122 ASP ASP E . n 
E 1 124 CYS 124 123 123 CYS CYS E . n 
E 1 125 SER 125 124 124 SER SER E . n 
E 1 126 ALA 126 125 125 ALA ALA E . n 
E 1 127 ASP 127 126 126 ASP ASP E . n 
E 1 128 THR 128 127 127 THR THR E . n 
E 1 129 MET 129 128 128 MET MET E . n 
E 1 130 THR 130 129 129 THR THR E . n 
E 1 131 ASN 131 130 130 ASN ASN E . n 
E 1 132 ARG 132 131 131 ARG ARG E . n 
E 1 133 LEU 133 132 132 LEU LEU E . n 
E 1 134 LEU 134 133 133 LEU LEU E . n 
E 1 135 GLN 135 134 134 GLN GLN E . n 
E 1 136 MET 136 135 135 MET MET E . n 
E 1 137 SER 137 136 136 SER SER E . n 
E 1 138 ARG 138 137 137 ARG ARG E . n 
E 1 139 SER 139 138 138 SER SER E . n 
E 1 140 SER 140 139 139 SER SER E . n 
E 1 141 LEU 141 140 140 LEU LEU E . n 
E 1 142 PRO 142 141 141 PRO PRO E . n 
E 1 143 VAL 143 142 142 VAL VAL E . n 
E 1 144 ASP 144 143 143 ASP ASP E . n 
E 1 145 ASP 145 144 144 ASP ASP E . n 
E 1 146 THR 146 145 145 THR THR E . n 
E 1 147 THR 147 146 146 THR THR E . n 
E 1 148 LYS 148 147 147 LYS LYS E . n 
E 1 149 THR 149 148 148 THR THR E . n 
E 1 150 ILE 150 149 149 ILE ILE E . n 
E 1 151 ALA 151 150 150 ALA ALA E . n 
E 1 152 LYS 152 151 151 LYS LYS E . n 
E 1 153 ARG 153 152 152 ARG ARG E . n 
E 1 154 LEU 154 153 153 LEU LEU E . n 
E 1 155 GLU 155 154 154 GLU GLU E . n 
E 1 156 ALA 156 155 155 ALA ALA E . n 
E 1 157 TYR 157 156 156 TYR TYR E . n 
E 1 158 TYR 158 157 157 TYR TYR E . n 
E 1 159 ARG 159 158 158 ARG ARG E . n 
E 1 160 ALA 160 159 159 ALA ALA E . n 
E 1 161 SER 161 160 160 SER SER E . n 
E 1 162 ILE 162 161 161 ILE ILE E . n 
E 1 163 PRO 163 162 162 PRO PRO E . n 
E 1 164 VAL 164 163 163 VAL VAL E . n 
E 1 165 ILE 165 164 164 ILE ILE E . n 
E 1 166 ALA 166 165 165 ALA ALA E . n 
E 1 167 TYR 167 166 166 TYR TYR E . n 
E 1 168 TYR 168 167 167 TYR TYR E . n 
E 1 169 GLU 169 168 168 GLU GLU E . n 
E 1 170 THR 170 169 169 THR THR E . n 
E 1 171 LYS 171 170 170 LYS LYS E . n 
E 1 172 THR 172 171 171 THR THR E . n 
E 1 173 GLN 173 172 172 GLN GLN E . n 
E 1 174 LEU 174 173 173 LEU LEU E . n 
E 1 175 HIS 175 174 174 HIS HIS E . n 
E 1 176 LYS 176 175 175 LYS LYS E . n 
E 1 177 ILE 177 176 176 ILE ILE E . n 
E 1 178 ASN 178 177 177 ASN ASN E . n 
E 1 179 ALA 179 178 178 ALA ALA E . n 
E 1 180 GLU 180 179 179 GLU GLU E . n 
E 1 181 GLY 181 180 180 GLY GLY E . n 
E 1 182 THR 182 181 181 THR THR E . n 
E 1 183 PRO 183 182 182 PRO PRO E . n 
E 1 184 GLU 184 183 183 GLU GLU E . n 
E 1 185 ASP 185 184 184 ASP ASP E . n 
E 1 186 VAL 186 185 185 VAL VAL E . n 
E 1 187 PHE 187 186 186 PHE PHE E . n 
E 1 188 LEU 188 187 187 LEU LEU E . n 
E 1 189 GLN 189 188 188 GLN GLN E . n 
E 1 190 LEU 190 189 189 LEU LEU E . n 
E 1 191 CYS 191 190 190 CYS CYS E . n 
E 1 192 THR 192 191 191 THR THR E . n 
E 1 193 ALA 193 192 192 ALA ALA E . n 
E 1 194 ILE 194 193 193 ILE ILE E . n 
E 1 195 ASP 195 194 194 ASP ASP E . n 
E 1 196 SER 196 195 195 SER SER E . n 
E 1 197 ILE 197 196 196 ILE ILE E . n 
E 1 198 PHE 198 197 197 PHE PHE E . n 
E 1 199 LEU 199 198 ?   ?   ?   E . n 
F 1 1   SER 1   0   ?   ?   ?   F . n 
F 1 2   MET 2   1   ?   ?   ?   F . n 
F 1 3   GLY 3   2   ?   ?   ?   F . n 
F 1 4   GLY 4   3   ?   ?   ?   F . n 
F 1 5   PHE 5   4   ?   ?   ?   F . n 
F 1 6   MET 6   5   5   MET MET F . n 
F 1 7   GLU 7   6   6   GLU GLU F . n 
F 1 8   ASP 8   7   7   ASP ASP F . n 
F 1 9   LEU 9   8   8   LEU LEU F . n 
F 1 10  ARG 10  9   9   ARG ARG F . n 
F 1 11  LYS 11  10  10  LYS LYS F . n 
F 1 12  CYS 12  11  11  CYS CYS F . n 
F 1 13  LYS 13  12  12  LYS LYS F . n 
F 1 14  ILE 14  13  13  ILE ILE F . n 
F 1 15  ILE 15  14  14  ILE ILE F . n 
F 1 16  PHE 16  15  15  PHE PHE F . n 
F 1 17  ILE 17  16  16  ILE ILE F . n 
F 1 18  ILE 18  17  17  ILE ILE F . n 
F 1 19  GLY 19  18  18  GLY GLY F . n 
F 1 20  GLY 20  19  19  GLY GLY F . n 
F 1 21  PRO 21  20  20  PRO PRO F . n 
F 1 22  GLY 22  21  21  GLY GLY F . n 
F 1 23  SER 23  22  22  SER SER F . n 
F 1 24  GLY 24  23  23  GLY GLY F . n 
F 1 25  LYS 25  24  24  LYS LYS F . n 
F 1 26  GLY 26  25  25  GLY GLY F . n 
F 1 27  THR 27  26  26  THR THR F . n 
F 1 28  GLN 28  27  27  GLN GLN F . n 
F 1 29  CYS 29  28  28  CYS CYS F . n 
F 1 30  GLU 30  29  29  GLU GLU F . n 
F 1 31  LYS 31  30  30  LYS LYS F . n 
F 1 32  LEU 32  31  31  LEU LEU F . n 
F 1 33  VAL 33  32  32  VAL VAL F . n 
F 1 34  GLU 34  33  33  GLU GLU F . n 
F 1 35  LYS 35  34  34  LYS LYS F . n 
F 1 36  TYR 36  35  35  TYR TYR F . n 
F 1 37  GLY 37  36  36  GLY GLY F . n 
F 1 38  PHE 38  37  37  PHE PHE F . n 
F 1 39  THR 39  38  38  THR THR F . n 
F 1 40  HIS 40  39  39  HIS HIS F . n 
F 1 41  LEU 41  40  40  LEU LEU F . n 
F 1 42  SER 42  41  41  SER SER F . n 
F 1 43  THR 43  42  42  THR THR F . n 
F 1 44  GLY 44  43  43  GLY GLY F . n 
F 1 45  GLU 45  44  44  GLU GLU F . n 
F 1 46  LEU 46  45  45  LEU LEU F . n 
F 1 47  LEU 47  46  46  LEU LEU F . n 
F 1 48  ARG 48  47  47  ARG ARG F . n 
F 1 49  GLU 49  48  48  GLU GLU F . n 
F 1 50  GLU 50  49  49  GLU GLU F . n 
F 1 51  LEU 51  50  50  LEU LEU F . n 
F 1 52  ALA 52  51  51  ALA ALA F . n 
F 1 53  SER 53  52  52  SER SER F . n 
F 1 54  GLU 54  53  53  GLU GLU F . n 
F 1 55  SER 55  54  54  SER SER F . n 
F 1 56  GLU 56  55  55  GLU GLU F . n 
F 1 57  ARG 57  56  56  ARG ARG F . n 
F 1 58  SER 58  57  57  SER SER F . n 
F 1 59  LYS 59  58  58  LYS LYS F . n 
F 1 60  LEU 60  59  59  LEU LEU F . n 
F 1 61  ILE 61  60  60  ILE ILE F . n 
F 1 62  ARG 62  61  61  ARG ARG F . n 
F 1 63  ASP 63  62  62  ASP ASP F . n 
F 1 64  ILE 64  63  63  ILE ILE F . n 
F 1 65  MET 65  64  64  MET MET F . n 
F 1 66  GLU 66  65  65  GLU GLU F . n 
F 1 67  ARG 67  66  66  ARG ARG F . n 
F 1 68  GLY 68  67  67  GLY GLY F . n 
F 1 69  ASP 69  68  68  ASP ASP F . n 
F 1 70  LEU 70  69  69  LEU LEU F . n 
F 1 71  VAL 71  70  70  VAL VAL F . n 
F 1 72  PRO 72  71  71  PRO PRO F . n 
F 1 73  SER 73  72  72  SER SER F . n 
F 1 74  GLY 74  73  73  GLY GLY F . n 
F 1 75  ILE 75  74  74  ILE ILE F . n 
F 1 76  VAL 76  75  75  VAL VAL F . n 
F 1 77  LEU 77  76  76  LEU LEU F . n 
F 1 78  GLU 78  77  77  GLU GLU F . n 
F 1 79  LEU 79  78  78  LEU LEU F . n 
F 1 80  LEU 80  79  79  LEU LEU F . n 
F 1 81  LYS 81  80  80  LYS LYS F . n 
F 1 82  GLU 82  81  81  GLU GLU F . n 
F 1 83  ALA 83  82  82  ALA ALA F . n 
F 1 84  MET 84  83  83  MET MET F . n 
F 1 85  VAL 85  84  84  VAL VAL F . n 
F 1 86  ALA 86  85  85  ALA ALA F . n 
F 1 87  SER 87  86  86  SER SER F . n 
F 1 88  LEU 88  87  87  LEU LEU F . n 
F 1 89  GLY 89  88  88  GLY GLY F . n 
F 1 90  ASP 90  89  89  ASP ASP F . n 
F 1 91  THR 91  90  90  THR THR F . n 
F 1 92  ARG 92  91  91  ARG ARG F . n 
F 1 93  GLY 93  92  92  GLY GLY F . n 
F 1 94  PHE 94  93  93  PHE PHE F . n 
F 1 95  LEU 95  94  94  LEU LEU F . n 
F 1 96  ILE 96  95  95  ILE ILE F . n 
F 1 97  ASP 97  96  96  ASP ASP F . n 
F 1 98  GLY 98  97  97  GLY GLY F . n 
F 1 99  TYR 99  98  98  TYR TYR F . n 
F 1 100 PRO 100 99  99  PRO PRO F . n 
F 1 101 ARG 101 100 100 ARG ARG F . n 
F 1 102 GLU 102 101 101 GLU GLU F . n 
F 1 103 VAL 103 102 102 VAL VAL F . n 
F 1 104 LYS 104 103 103 LYS LYS F . n 
F 1 105 GLN 105 104 104 GLN GLN F . n 
F 1 106 GLY 106 105 105 GLY GLY F . n 
F 1 107 GLU 107 106 106 GLU GLU F . n 
F 1 108 GLU 108 107 107 GLU GLU F . n 
F 1 109 PHE 109 108 108 PHE PHE F . n 
F 1 110 GLY 110 109 109 GLY GLY F . n 
F 1 111 ARG 111 110 110 ARG ARG F . n 
F 1 112 ARG 112 111 111 ARG ARG F . n 
F 1 113 ILE 113 112 112 ILE ILE F . n 
F 1 114 GLY 114 113 113 GLY GLY F . n 
F 1 115 ASP 115 114 114 ASP ASP F . n 
F 1 116 PRO 116 115 115 PRO PRO F . n 
F 1 117 GLN 117 116 116 GLN GLN F . n 
F 1 118 LEU 118 117 117 LEU LEU F . n 
F 1 119 VAL 119 118 118 VAL VAL F . n 
F 1 120 ILE 120 119 119 ILE ILE F . n 
F 1 121 CYS 121 120 120 CYS CYS F . n 
F 1 122 MET 122 121 121 MET MET F . n 
F 1 123 ASP 123 122 122 ASP ASP F . n 
F 1 124 CYS 124 123 123 CYS CYS F . n 
F 1 125 SER 125 124 124 SER SER F . n 
F 1 126 ALA 126 125 125 ALA ALA F . n 
F 1 127 ASP 127 126 126 ASP ASP F . n 
F 1 128 THR 128 127 127 THR THR F . n 
F 1 129 MET 129 128 128 MET MET F . n 
F 1 130 THR 130 129 129 THR THR F . n 
F 1 131 ASN 131 130 130 ASN ASN F . n 
F 1 132 ARG 132 131 131 ARG ARG F . n 
F 1 133 LEU 133 132 132 LEU LEU F . n 
F 1 134 LEU 134 133 133 LEU LEU F . n 
F 1 135 GLN 135 134 134 GLN GLN F . n 
F 1 136 MET 136 135 135 MET MET F . n 
F 1 137 SER 137 136 136 SER SER F . n 
F 1 138 ARG 138 137 137 ARG ARG F . n 
F 1 139 SER 139 138 138 SER SER F . n 
F 1 140 SER 140 139 139 SER SER F . n 
F 1 141 LEU 141 140 140 LEU LEU F . n 
F 1 142 PRO 142 141 141 PRO PRO F . n 
F 1 143 VAL 143 142 142 VAL VAL F . n 
F 1 144 ASP 144 143 143 ASP ASP F . n 
F 1 145 ASP 145 144 144 ASP ASP F . n 
F 1 146 THR 146 145 145 THR THR F . n 
F 1 147 THR 147 146 146 THR THR F . n 
F 1 148 LYS 148 147 147 LYS LYS F . n 
F 1 149 THR 149 148 148 THR THR F . n 
F 1 150 ILE 150 149 149 ILE ILE F . n 
F 1 151 ALA 151 150 150 ALA ALA F . n 
F 1 152 LYS 152 151 151 LYS LYS F . n 
F 1 153 ARG 153 152 152 ARG ARG F . n 
F 1 154 LEU 154 153 153 LEU LEU F . n 
F 1 155 GLU 155 154 154 GLU GLU F . n 
F 1 156 ALA 156 155 155 ALA ALA F . n 
F 1 157 TYR 157 156 156 TYR TYR F . n 
F 1 158 TYR 158 157 157 TYR TYR F . n 
F 1 159 ARG 159 158 158 ARG ARG F . n 
F 1 160 ALA 160 159 159 ALA ALA F . n 
F 1 161 SER 161 160 160 SER SER F . n 
F 1 162 ILE 162 161 161 ILE ILE F . n 
F 1 163 PRO 163 162 162 PRO PRO F . n 
F 1 164 VAL 164 163 163 VAL VAL F . n 
F 1 165 ILE 165 164 164 ILE ILE F . n 
F 1 166 ALA 166 165 165 ALA ALA F . n 
F 1 167 TYR 167 166 166 TYR TYR F . n 
F 1 168 TYR 168 167 167 TYR TYR F . n 
F 1 169 GLU 169 168 168 GLU GLU F . n 
F 1 170 THR 170 169 169 THR THR F . n 
F 1 171 LYS 171 170 170 LYS LYS F . n 
F 1 172 THR 172 171 171 THR THR F . n 
F 1 173 GLN 173 172 172 GLN GLN F . n 
F 1 174 LEU 174 173 173 LEU LEU F . n 
F 1 175 HIS 175 174 174 HIS HIS F . n 
F 1 176 LYS 176 175 175 LYS LYS F . n 
F 1 177 ILE 177 176 176 ILE ILE F . n 
F 1 178 ASN 178 177 177 ASN ASN F . n 
F 1 179 ALA 179 178 178 ALA ALA F . n 
F 1 180 GLU 180 179 179 GLU GLU F . n 
F 1 181 GLY 181 180 180 GLY GLY F . n 
F 1 182 THR 182 181 181 THR THR F . n 
F 1 183 PRO 183 182 182 PRO PRO F . n 
F 1 184 GLU 184 183 183 GLU GLU F . n 
F 1 185 ASP 185 184 184 ASP ASP F . n 
F 1 186 VAL 186 185 185 VAL VAL F . n 
F 1 187 PHE 187 186 186 PHE PHE F . n 
F 1 188 LEU 188 187 187 LEU LEU F . n 
F 1 189 GLN 189 188 188 GLN GLN F . n 
F 1 190 LEU 190 189 189 LEU LEU F . n 
F 1 191 CYS 191 190 190 CYS CYS F . n 
F 1 192 THR 192 191 191 THR THR F . n 
F 1 193 ALA 193 192 192 ALA ALA F . n 
F 1 194 ILE 194 193 193 ILE ILE F . n 
F 1 195 ASP 195 194 194 ASP ASP F . n 
F 1 196 SER 196 195 195 SER SER F . n 
F 1 197 ILE 197 196 196 ILE ILE F . n 
F 1 198 PHE 198 197 197 PHE PHE F . n 
F 1 199 LEU 199 198 198 LEU LEU F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G  2 SO4 1   1199 1199 SO4 SO4 A . 
H  2 SO4 1   1200 1200 SO4 SO4 A . 
I  3 CL  1   1201 1201 CL  CL  A . 
J  2 SO4 1   1199 1199 SO4 SO4 B . 
K  3 CL  1   1200 1200 CL  CL  B . 
L  4 AMP 1   1201 1201 AMP AMP B . 
M  2 SO4 1   1198 1198 SO4 SO4 C . 
N  4 AMP 1   1199 1199 AMP AMP C . 
O  2 SO4 1   1197 1197 SO4 SO4 D . 
P  2 SO4 1   1198 1198 SO4 SO4 E . 
Q  3 CL  1   1199 1199 CL  CL  E . 
R  2 SO4 1   1199 1199 SO4 SO4 F . 
S  3 CL  1   1200 1200 CL  CL  F . 
T  3 CL  1   1201 1201 CL  CL  F . 
U  4 AMP 1   1202 1202 AMP AMP F . 
V  5 HOH 1   2001 2001 HOH HOH A . 
V  5 HOH 2   2002 2002 HOH HOH A . 
V  5 HOH 3   2003 2003 HOH HOH A . 
V  5 HOH 4   2004 2004 HOH HOH A . 
V  5 HOH 5   2005 2005 HOH HOH A . 
V  5 HOH 6   2006 2006 HOH HOH A . 
V  5 HOH 7   2007 2007 HOH HOH A . 
V  5 HOH 8   2008 2008 HOH HOH A . 
V  5 HOH 9   2009 2009 HOH HOH A . 
V  5 HOH 10  2010 2010 HOH HOH A . 
V  5 HOH 11  2011 2011 HOH HOH A . 
V  5 HOH 12  2012 2012 HOH HOH A . 
V  5 HOH 13  2013 2013 HOH HOH A . 
V  5 HOH 14  2014 2014 HOH HOH A . 
V  5 HOH 15  2015 2015 HOH HOH A . 
V  5 HOH 16  2016 2016 HOH HOH A . 
V  5 HOH 17  2017 2017 HOH HOH A . 
V  5 HOH 18  2018 2018 HOH HOH A . 
V  5 HOH 19  2019 2019 HOH HOH A . 
V  5 HOH 20  2020 2020 HOH HOH A . 
V  5 HOH 21  2021 2021 HOH HOH A . 
V  5 HOH 22  2022 2022 HOH HOH A . 
V  5 HOH 23  2023 2023 HOH HOH A . 
V  5 HOH 24  2024 2024 HOH HOH A . 
V  5 HOH 25  2025 2025 HOH HOH A . 
V  5 HOH 26  2026 2026 HOH HOH A . 
V  5 HOH 27  2027 2027 HOH HOH A . 
V  5 HOH 28  2028 2028 HOH HOH A . 
V  5 HOH 29  2029 2029 HOH HOH A . 
V  5 HOH 30  2030 2030 HOH HOH A . 
V  5 HOH 31  2031 2031 HOH HOH A . 
V  5 HOH 32  2032 2032 HOH HOH A . 
V  5 HOH 33  2033 2033 HOH HOH A . 
V  5 HOH 34  2034 2034 HOH HOH A . 
V  5 HOH 35  2035 2035 HOH HOH A . 
V  5 HOH 36  2036 2036 HOH HOH A . 
V  5 HOH 37  2037 2037 HOH HOH A . 
V  5 HOH 38  2038 2038 HOH HOH A . 
V  5 HOH 39  2039 2039 HOH HOH A . 
V  5 HOH 40  2040 2040 HOH HOH A . 
V  5 HOH 41  2041 2041 HOH HOH A . 
V  5 HOH 42  2042 2042 HOH HOH A . 
V  5 HOH 43  2043 2043 HOH HOH A . 
V  5 HOH 44  2044 2044 HOH HOH A . 
V  5 HOH 45  2045 2045 HOH HOH A . 
V  5 HOH 46  2046 2046 HOH HOH A . 
V  5 HOH 47  2047 2047 HOH HOH A . 
V  5 HOH 48  2048 2048 HOH HOH A . 
V  5 HOH 49  2049 2049 HOH HOH A . 
V  5 HOH 50  2050 2050 HOH HOH A . 
V  5 HOH 51  2051 2051 HOH HOH A . 
V  5 HOH 52  2052 2052 HOH HOH A . 
V  5 HOH 53  2053 2053 HOH HOH A . 
V  5 HOH 54  2054 2054 HOH HOH A . 
V  5 HOH 55  2055 2055 HOH HOH A . 
V  5 HOH 56  2056 2056 HOH HOH A . 
V  5 HOH 57  2057 2057 HOH HOH A . 
V  5 HOH 58  2058 2058 HOH HOH A . 
V  5 HOH 59  2059 2059 HOH HOH A . 
V  5 HOH 60  2060 2060 HOH HOH A . 
V  5 HOH 61  2061 2061 HOH HOH A . 
V  5 HOH 62  2062 2062 HOH HOH A . 
V  5 HOH 63  2063 2063 HOH HOH A . 
V  5 HOH 64  2064 2064 HOH HOH A . 
V  5 HOH 65  2065 2065 HOH HOH A . 
V  5 HOH 66  2066 2066 HOH HOH A . 
V  5 HOH 67  2067 2067 HOH HOH A . 
V  5 HOH 68  2068 2068 HOH HOH A . 
V  5 HOH 69  2069 2069 HOH HOH A . 
V  5 HOH 70  2070 2070 HOH HOH A . 
V  5 HOH 71  2071 2071 HOH HOH A . 
V  5 HOH 72  2072 2072 HOH HOH A . 
V  5 HOH 73  2073 2073 HOH HOH A . 
V  5 HOH 74  2074 2074 HOH HOH A . 
V  5 HOH 75  2075 2075 HOH HOH A . 
V  5 HOH 76  2076 2076 HOH HOH A . 
V  5 HOH 77  2077 2077 HOH HOH A . 
V  5 HOH 78  2078 2078 HOH HOH A . 
V  5 HOH 79  2079 2079 HOH HOH A . 
V  5 HOH 80  2080 2080 HOH HOH A . 
V  5 HOH 81  2081 2081 HOH HOH A . 
V  5 HOH 82  2082 2082 HOH HOH A . 
V  5 HOH 83  2083 2083 HOH HOH A . 
V  5 HOH 84  2084 2084 HOH HOH A . 
V  5 HOH 85  2085 2085 HOH HOH A . 
V  5 HOH 86  2086 2086 HOH HOH A . 
V  5 HOH 87  2087 2087 HOH HOH A . 
V  5 HOH 88  2088 2088 HOH HOH A . 
V  5 HOH 89  2089 2089 HOH HOH A . 
V  5 HOH 90  2090 2090 HOH HOH A . 
V  5 HOH 91  2091 2091 HOH HOH A . 
V  5 HOH 92  2092 2092 HOH HOH A . 
V  5 HOH 93  2093 2093 HOH HOH A . 
V  5 HOH 94  2094 2094 HOH HOH A . 
V  5 HOH 95  2095 2095 HOH HOH A . 
V  5 HOH 96  2096 2096 HOH HOH A . 
V  5 HOH 97  2097 2097 HOH HOH A . 
V  5 HOH 98  2098 2098 HOH HOH A . 
V  5 HOH 99  2099 2099 HOH HOH A . 
V  5 HOH 100 2100 2100 HOH HOH A . 
V  5 HOH 101 2101 2101 HOH HOH A . 
V  5 HOH 102 2102 2102 HOH HOH A . 
V  5 HOH 103 2103 2103 HOH HOH A . 
V  5 HOH 104 2104 2104 HOH HOH A . 
V  5 HOH 105 2105 2105 HOH HOH A . 
V  5 HOH 106 2106 2106 HOH HOH A . 
V  5 HOH 107 2107 2107 HOH HOH A . 
V  5 HOH 108 2108 2108 HOH HOH A . 
V  5 HOH 109 2109 2109 HOH HOH A . 
V  5 HOH 110 2110 2110 HOH HOH A . 
V  5 HOH 111 2111 2111 HOH HOH A . 
V  5 HOH 112 2112 2112 HOH HOH A . 
V  5 HOH 113 2113 2113 HOH HOH A . 
V  5 HOH 114 2114 2114 HOH HOH A . 
V  5 HOH 115 2115 2115 HOH HOH A . 
V  5 HOH 116 2116 2116 HOH HOH A . 
V  5 HOH 117 2117 2117 HOH HOH A . 
V  5 HOH 118 2118 2118 HOH HOH A . 
V  5 HOH 119 2119 2119 HOH HOH A . 
V  5 HOH 120 2120 2120 HOH HOH A . 
V  5 HOH 121 2121 2121 HOH HOH A . 
V  5 HOH 122 2122 2122 HOH HOH A . 
V  5 HOH 123 2123 2123 HOH HOH A . 
V  5 HOH 124 2124 2124 HOH HOH A . 
V  5 HOH 125 2125 2125 HOH HOH A . 
W  5 HOH 1   2001 2001 HOH HOH B . 
W  5 HOH 2   2002 2002 HOH HOH B . 
W  5 HOH 3   2003 2003 HOH HOH B . 
W  5 HOH 4   2004 2004 HOH HOH B . 
W  5 HOH 5   2005 2005 HOH HOH B . 
W  5 HOH 6   2006 2006 HOH HOH B . 
W  5 HOH 7   2007 2007 HOH HOH B . 
W  5 HOH 8   2008 2008 HOH HOH B . 
W  5 HOH 9   2009 2009 HOH HOH B . 
W  5 HOH 10  2010 2010 HOH HOH B . 
W  5 HOH 11  2011 2011 HOH HOH B . 
W  5 HOH 12  2012 2012 HOH HOH B . 
W  5 HOH 13  2013 2013 HOH HOH B . 
W  5 HOH 14  2014 2014 HOH HOH B . 
W  5 HOH 15  2015 2015 HOH HOH B . 
W  5 HOH 16  2016 2016 HOH HOH B . 
W  5 HOH 17  2017 2017 HOH HOH B . 
W  5 HOH 18  2018 2018 HOH HOH B . 
W  5 HOH 19  2019 2019 HOH HOH B . 
W  5 HOH 20  2020 2020 HOH HOH B . 
W  5 HOH 21  2021 2021 HOH HOH B . 
W  5 HOH 22  2022 2022 HOH HOH B . 
W  5 HOH 23  2023 2023 HOH HOH B . 
W  5 HOH 24  2024 2024 HOH HOH B . 
W  5 HOH 25  2025 2025 HOH HOH B . 
W  5 HOH 26  2026 2026 HOH HOH B . 
W  5 HOH 27  2027 2027 HOH HOH B . 
W  5 HOH 28  2028 2028 HOH HOH B . 
W  5 HOH 29  2029 2029 HOH HOH B . 
W  5 HOH 30  2030 2030 HOH HOH B . 
W  5 HOH 31  2031 2031 HOH HOH B . 
W  5 HOH 32  2032 2032 HOH HOH B . 
W  5 HOH 33  2033 2033 HOH HOH B . 
W  5 HOH 34  2034 2034 HOH HOH B . 
W  5 HOH 35  2035 2035 HOH HOH B . 
W  5 HOH 36  2036 2036 HOH HOH B . 
W  5 HOH 37  2037 2037 HOH HOH B . 
W  5 HOH 38  2038 2038 HOH HOH B . 
W  5 HOH 39  2039 2039 HOH HOH B . 
W  5 HOH 40  2040 2040 HOH HOH B . 
W  5 HOH 41  2041 2041 HOH HOH B . 
W  5 HOH 42  2042 2042 HOH HOH B . 
W  5 HOH 43  2043 2043 HOH HOH B . 
W  5 HOH 44  2044 2044 HOH HOH B . 
W  5 HOH 45  2045 2045 HOH HOH B . 
W  5 HOH 46  2046 2046 HOH HOH B . 
W  5 HOH 47  2047 2047 HOH HOH B . 
W  5 HOH 48  2048 2048 HOH HOH B . 
W  5 HOH 49  2049 2049 HOH HOH B . 
W  5 HOH 50  2050 2050 HOH HOH B . 
W  5 HOH 51  2051 2051 HOH HOH B . 
W  5 HOH 52  2052 2052 HOH HOH B . 
W  5 HOH 53  2053 2053 HOH HOH B . 
W  5 HOH 54  2054 2054 HOH HOH B . 
W  5 HOH 55  2055 2055 HOH HOH B . 
W  5 HOH 56  2056 2056 HOH HOH B . 
W  5 HOH 57  2057 2057 HOH HOH B . 
W  5 HOH 58  2058 2058 HOH HOH B . 
W  5 HOH 59  2059 2059 HOH HOH B . 
W  5 HOH 60  2060 2060 HOH HOH B . 
W  5 HOH 61  2061 2061 HOH HOH B . 
W  5 HOH 62  2062 2062 HOH HOH B . 
W  5 HOH 63  2063 2063 HOH HOH B . 
W  5 HOH 64  2064 2064 HOH HOH B . 
W  5 HOH 65  2065 2065 HOH HOH B . 
W  5 HOH 66  2066 2066 HOH HOH B . 
W  5 HOH 67  2067 2067 HOH HOH B . 
W  5 HOH 68  2068 2068 HOH HOH B . 
W  5 HOH 69  2069 2069 HOH HOH B . 
W  5 HOH 70  2070 2070 HOH HOH B . 
W  5 HOH 71  2071 2071 HOH HOH B . 
W  5 HOH 72  2072 2072 HOH HOH B . 
W  5 HOH 73  2073 2073 HOH HOH B . 
W  5 HOH 74  2074 2074 HOH HOH B . 
W  5 HOH 75  2075 2075 HOH HOH B . 
W  5 HOH 76  2076 2076 HOH HOH B . 
W  5 HOH 77  2077 2077 HOH HOH B . 
W  5 HOH 78  2078 2078 HOH HOH B . 
W  5 HOH 79  2079 2079 HOH HOH B . 
W  5 HOH 80  2080 2080 HOH HOH B . 
W  5 HOH 81  2081 2081 HOH HOH B . 
W  5 HOH 82  2082 2082 HOH HOH B . 
W  5 HOH 83  2083 2083 HOH HOH B . 
W  5 HOH 84  2084 2084 HOH HOH B . 
W  5 HOH 85  2085 2085 HOH HOH B . 
W  5 HOH 86  2086 2086 HOH HOH B . 
W  5 HOH 87  2087 2087 HOH HOH B . 
W  5 HOH 88  2088 2088 HOH HOH B . 
W  5 HOH 89  2089 2089 HOH HOH B . 
W  5 HOH 90  2090 2090 HOH HOH B . 
W  5 HOH 91  2091 2091 HOH HOH B . 
W  5 HOH 92  2092 2092 HOH HOH B . 
W  5 HOH 93  2093 2093 HOH HOH B . 
W  5 HOH 94  2094 2094 HOH HOH B . 
W  5 HOH 95  2095 2095 HOH HOH B . 
W  5 HOH 96  2096 2096 HOH HOH B . 
W  5 HOH 97  2097 2097 HOH HOH B . 
W  5 HOH 98  2098 2098 HOH HOH B . 
W  5 HOH 99  2099 2099 HOH HOH B . 
W  5 HOH 100 2100 2100 HOH HOH B . 
W  5 HOH 101 2101 2101 HOH HOH B . 
W  5 HOH 102 2102 2102 HOH HOH B . 
X  5 HOH 1   2001 2001 HOH HOH C . 
X  5 HOH 2   2002 2002 HOH HOH C . 
X  5 HOH 3   2003 2003 HOH HOH C . 
X  5 HOH 4   2004 2004 HOH HOH C . 
X  5 HOH 5   2005 2005 HOH HOH C . 
X  5 HOH 6   2006 2006 HOH HOH C . 
X  5 HOH 7   2007 2007 HOH HOH C . 
X  5 HOH 8   2008 2008 HOH HOH C . 
X  5 HOH 9   2009 2009 HOH HOH C . 
X  5 HOH 10  2010 2010 HOH HOH C . 
X  5 HOH 11  2011 2011 HOH HOH C . 
X  5 HOH 12  2012 2012 HOH HOH C . 
X  5 HOH 13  2013 2013 HOH HOH C . 
X  5 HOH 14  2014 2014 HOH HOH C . 
X  5 HOH 15  2015 2015 HOH HOH C . 
X  5 HOH 16  2016 2016 HOH HOH C . 
X  5 HOH 17  2017 2017 HOH HOH C . 
X  5 HOH 18  2018 2018 HOH HOH C . 
X  5 HOH 19  2019 2019 HOH HOH C . 
X  5 HOH 20  2020 2020 HOH HOH C . 
X  5 HOH 21  2021 2021 HOH HOH C . 
X  5 HOH 22  2022 2022 HOH HOH C . 
X  5 HOH 23  2023 2023 HOH HOH C . 
X  5 HOH 24  2024 2024 HOH HOH C . 
X  5 HOH 25  2025 2025 HOH HOH C . 
X  5 HOH 26  2026 2026 HOH HOH C . 
X  5 HOH 27  2027 2027 HOH HOH C . 
X  5 HOH 28  2028 2028 HOH HOH C . 
X  5 HOH 29  2029 2029 HOH HOH C . 
X  5 HOH 30  2030 2030 HOH HOH C . 
X  5 HOH 31  2031 2031 HOH HOH C . 
X  5 HOH 32  2032 2032 HOH HOH C . 
X  5 HOH 33  2033 2033 HOH HOH C . 
X  5 HOH 34  2034 2034 HOH HOH C . 
X  5 HOH 35  2035 2035 HOH HOH C . 
X  5 HOH 36  2036 2036 HOH HOH C . 
X  5 HOH 37  2037 2037 HOH HOH C . 
X  5 HOH 38  2038 2038 HOH HOH C . 
X  5 HOH 39  2039 2039 HOH HOH C . 
X  5 HOH 40  2040 2040 HOH HOH C . 
X  5 HOH 41  2041 2041 HOH HOH C . 
X  5 HOH 42  2042 2042 HOH HOH C . 
X  5 HOH 43  2043 2043 HOH HOH C . 
X  5 HOH 44  2044 2044 HOH HOH C . 
X  5 HOH 45  2045 2045 HOH HOH C . 
X  5 HOH 46  2046 2046 HOH HOH C . 
X  5 HOH 47  2047 2047 HOH HOH C . 
X  5 HOH 48  2048 2048 HOH HOH C . 
X  5 HOH 49  2049 2049 HOH HOH C . 
X  5 HOH 50  2050 2050 HOH HOH C . 
X  5 HOH 51  2051 2051 HOH HOH C . 
X  5 HOH 52  2052 2052 HOH HOH C . 
X  5 HOH 53  2053 2053 HOH HOH C . 
X  5 HOH 54  2054 2054 HOH HOH C . 
X  5 HOH 55  2055 2055 HOH HOH C . 
X  5 HOH 56  2056 2056 HOH HOH C . 
X  5 HOH 57  2057 2057 HOH HOH C . 
X  5 HOH 58  2058 2058 HOH HOH C . 
X  5 HOH 59  2059 2059 HOH HOH C . 
X  5 HOH 60  2060 2060 HOH HOH C . 
X  5 HOH 61  2061 2061 HOH HOH C . 
X  5 HOH 62  2062 2062 HOH HOH C . 
X  5 HOH 63  2063 2063 HOH HOH C . 
X  5 HOH 64  2064 2064 HOH HOH C . 
X  5 HOH 65  2065 2065 HOH HOH C . 
X  5 HOH 66  2066 2066 HOH HOH C . 
X  5 HOH 67  2067 2067 HOH HOH C . 
X  5 HOH 68  2068 2068 HOH HOH C . 
X  5 HOH 69  2069 2069 HOH HOH C . 
X  5 HOH 70  2070 2070 HOH HOH C . 
X  5 HOH 71  2071 2071 HOH HOH C . 
X  5 HOH 72  2072 2072 HOH HOH C . 
X  5 HOH 73  2073 2073 HOH HOH C . 
X  5 HOH 74  2074 2074 HOH HOH C . 
X  5 HOH 75  2075 2075 HOH HOH C . 
X  5 HOH 76  2076 2076 HOH HOH C . 
X  5 HOH 77  2077 2077 HOH HOH C . 
X  5 HOH 78  2078 2078 HOH HOH C . 
X  5 HOH 79  2079 2079 HOH HOH C . 
X  5 HOH 80  2080 2080 HOH HOH C . 
X  5 HOH 81  2081 2081 HOH HOH C . 
X  5 HOH 82  2082 2082 HOH HOH C . 
X  5 HOH 83  2083 2083 HOH HOH C . 
X  5 HOH 84  2084 2084 HOH HOH C . 
X  5 HOH 85  2085 2085 HOH HOH C . 
X  5 HOH 86  2086 2086 HOH HOH C . 
Y  5 HOH 1   2001 2001 HOH HOH D . 
Y  5 HOH 2   2002 2002 HOH HOH D . 
Y  5 HOH 3   2003 2003 HOH HOH D . 
Y  5 HOH 4   2004 2004 HOH HOH D . 
Y  5 HOH 5   2005 2005 HOH HOH D . 
Y  5 HOH 6   2006 2006 HOH HOH D . 
Y  5 HOH 7   2007 2007 HOH HOH D . 
Y  5 HOH 8   2008 2008 HOH HOH D . 
Z  5 HOH 1   2001 2001 HOH HOH E . 
Z  5 HOH 2   2002 2002 HOH HOH E . 
Z  5 HOH 3   2003 2003 HOH HOH E . 
Z  5 HOH 4   2004 2004 HOH HOH E . 
Z  5 HOH 5   2005 2005 HOH HOH E . 
Z  5 HOH 6   2006 2006 HOH HOH E . 
Z  5 HOH 7   2007 2007 HOH HOH E . 
Z  5 HOH 8   2008 2008 HOH HOH E . 
Z  5 HOH 9   2009 2009 HOH HOH E . 
Z  5 HOH 10  2010 2010 HOH HOH E . 
Z  5 HOH 11  2011 2011 HOH HOH E . 
Z  5 HOH 12  2012 2012 HOH HOH E . 
Z  5 HOH 13  2013 2013 HOH HOH E . 
Z  5 HOH 14  2014 2014 HOH HOH E . 
Z  5 HOH 15  2015 2015 HOH HOH E . 
Z  5 HOH 16  2016 2016 HOH HOH E . 
Z  5 HOH 17  2017 2017 HOH HOH E . 
Z  5 HOH 18  2018 2018 HOH HOH E . 
Z  5 HOH 19  2019 2019 HOH HOH E . 
Z  5 HOH 20  2020 2020 HOH HOH E . 
Z  5 HOH 21  2021 2021 HOH HOH E . 
Z  5 HOH 22  2022 2022 HOH HOH E . 
Z  5 HOH 23  2023 2023 HOH HOH E . 
Z  5 HOH 24  2024 2024 HOH HOH E . 
Z  5 HOH 25  2025 2025 HOH HOH E . 
Z  5 HOH 26  2026 2026 HOH HOH E . 
Z  5 HOH 27  2027 2027 HOH HOH E . 
Z  5 HOH 28  2028 2028 HOH HOH E . 
Z  5 HOH 29  2029 2029 HOH HOH E . 
Z  5 HOH 30  2030 2030 HOH HOH E . 
Z  5 HOH 31  2031 2031 HOH HOH E . 
Z  5 HOH 32  2032 2032 HOH HOH E . 
Z  5 HOH 33  2033 2033 HOH HOH E . 
Z  5 HOH 34  2034 2034 HOH HOH E . 
Z  5 HOH 35  2035 2035 HOH HOH E . 
Z  5 HOH 36  2036 2036 HOH HOH E . 
Z  5 HOH 37  2037 2037 HOH HOH E . 
Z  5 HOH 38  2038 2038 HOH HOH E . 
Z  5 HOH 39  2039 2039 HOH HOH E . 
Z  5 HOH 40  2040 2040 HOH HOH E . 
AA 5 HOH 1   2001 2001 HOH HOH F . 
AA 5 HOH 2   2002 2002 HOH HOH F . 
AA 5 HOH 3   2003 2003 HOH HOH F . 
AA 5 HOH 4   2004 2004 HOH HOH F . 
AA 5 HOH 5   2005 2005 HOH HOH F . 
AA 5 HOH 6   2006 2006 HOH HOH F . 
AA 5 HOH 7   2007 2007 HOH HOH F . 
AA 5 HOH 8   2008 2008 HOH HOH F . 
AA 5 HOH 9   2009 2009 HOH HOH F . 
AA 5 HOH 10  2010 2010 HOH HOH F . 
AA 5 HOH 11  2011 2011 HOH HOH F . 
AA 5 HOH 12  2012 2012 HOH HOH F . 
AA 5 HOH 13  2013 2013 HOH HOH F . 
AA 5 HOH 14  2014 2014 HOH HOH F . 
AA 5 HOH 15  2015 2015 HOH HOH F . 
AA 5 HOH 16  2016 2016 HOH HOH F . 
AA 5 HOH 17  2017 2017 HOH HOH F . 
AA 5 HOH 18  2018 2018 HOH HOH F . 
AA 5 HOH 19  2019 2019 HOH HOH F . 
AA 5 HOH 20  2020 2020 HOH HOH F . 
AA 5 HOH 21  2021 2021 HOH HOH F . 
AA 5 HOH 22  2022 2022 HOH HOH F . 
AA 5 HOH 23  2023 2023 HOH HOH F . 
AA 5 HOH 24  2024 2024 HOH HOH F . 
AA 5 HOH 25  2025 2025 HOH HOH F . 
AA 5 HOH 26  2026 2026 HOH HOH F . 
AA 5 HOH 27  2027 2027 HOH HOH F . 
AA 5 HOH 28  2028 2028 HOH HOH F . 
AA 5 HOH 29  2029 2029 HOH HOH F . 
AA 5 HOH 30  2030 2030 HOH HOH F . 
AA 5 HOH 31  2031 2031 HOH HOH F . 
AA 5 HOH 32  2032 2032 HOH HOH F . 
AA 5 HOH 33  2033 2033 HOH HOH F . 
AA 5 HOH 34  2034 2034 HOH HOH F . 
AA 5 HOH 35  2035 2035 HOH HOH F . 
AA 5 HOH 36  2036 2036 HOH HOH F . 
AA 5 HOH 37  2037 2037 HOH HOH F . 
AA 5 HOH 38  2038 2038 HOH HOH F . 
AA 5 HOH 39  2039 2039 HOH HOH F . 
AA 5 HOH 40  2040 2040 HOH HOH F . 
AA 5 HOH 41  2041 2041 HOH HOH F . 
AA 5 HOH 42  2042 2042 HOH HOH F . 
AA 5 HOH 43  2043 2043 HOH HOH F . 
AA 5 HOH 44  2044 2044 HOH HOH F . 
AA 5 HOH 45  2045 2045 HOH HOH F . 
AA 5 HOH 46  2046 2046 HOH HOH F . 
AA 5 HOH 47  2047 2047 HOH HOH F . 
AA 5 HOH 48  2048 2048 HOH HOH F . 
AA 5 HOH 49  2049 2049 HOH HOH F . 
AA 5 HOH 50  2050 2050 HOH HOH F . 
AA 5 HOH 51  2051 2051 HOH HOH F . 
AA 5 HOH 52  2052 2052 HOH HOH F . 
AA 5 HOH 53  2053 2053 HOH HOH F . 
AA 5 HOH 54  2054 2054 HOH HOH F . 
AA 5 HOH 55  2055 2055 HOH HOH F . 
AA 5 HOH 56  2056 2056 HOH HOH F . 
AA 5 HOH 57  2057 2057 HOH HOH F . 
AA 5 HOH 58  2058 2058 HOH HOH F . 
AA 5 HOH 59  2059 2059 HOH HOH F . 
AA 5 HOH 60  2060 2060 HOH HOH F . 
AA 5 HOH 61  2061 2061 HOH HOH F . 
AA 5 HOH 62  2062 2062 HOH HOH F . 
AA 5 HOH 63  2063 2063 HOH HOH F . 
AA 5 HOH 64  2064 2064 HOH HOH F . 
AA 5 HOH 65  2065 2065 HOH HOH F . 
AA 5 HOH 66  2066 2066 HOH HOH F . 
AA 5 HOH 67  2067 2067 HOH HOH F . 
AA 5 HOH 68  2068 2068 HOH HOH F . 
AA 5 HOH 69  2069 2069 HOH HOH F . 
AA 5 HOH 70  2070 2070 HOH HOH F . 
AA 5 HOH 71  2071 2071 HOH HOH F . 
AA 5 HOH 72  2072 2072 HOH HOH F . 
AA 5 HOH 73  2073 2073 HOH HOH F . 
AA 5 HOH 74  2074 2074 HOH HOH F . 
AA 5 HOH 75  2075 2075 HOH HOH F . 
AA 5 HOH 76  2076 2076 HOH HOH F . 
AA 5 HOH 77  2077 2077 HOH HOH F . 
AA 5 HOH 78  2078 2078 HOH HOH F . 
AA 5 HOH 79  2079 2079 HOH HOH F . 
AA 5 HOH 80  2080 2080 HOH HOH F . 
AA 5 HOH 81  2081 2081 HOH HOH F . 
AA 5 HOH 82  2082 2082 HOH HOH F . 
AA 5 HOH 83  2083 2083 HOH HOH F . 
AA 5 HOH 84  2084 2084 HOH HOH F . 
AA 5 HOH 85  2085 2085 HOH HOH F . 
AA 5 HOH 86  2086 2086 HOH HOH F . 
AA 5 HOH 87  2087 2087 HOH HOH F . 
AA 5 HOH 88  2088 2088 HOH HOH F . 
AA 5 HOH 89  2089 2089 HOH HOH F . 
AA 5 HOH 90  2090 2090 HOH HOH F . 
AA 5 HOH 91  2091 2091 HOH HOH F . 
AA 5 HOH 92  2092 2092 HOH HOH F . 
AA 5 HOH 93  2093 2093 HOH HOH F . 
AA 5 HOH 94  2094 2094 HOH HOH F . 
AA 5 HOH 95  2095 2095 HOH HOH F . 
AA 5 HOH 96  2096 2096 HOH HOH F . 
AA 5 HOH 97  2097 2097 HOH HOH F . 
AA 5 HOH 98  2098 2098 HOH HOH F . 
AA 5 HOH 99  2099 2099 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PQS dimeric 2 
2 author_and_software_defined_assembly PQS dimeric 2 
3 author_and_software_defined_assembly PQS dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,G,H,I,J,K,L,V,W  
2 1 C,F,M,N,R,S,T,U,X,AA 
3 1 D,E,O,P,Q,Y,Z        
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-21 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-01-24 
4 'Structure model' 1 3 2018-02-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' 'Structure summary'         
5 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' audit_author   
2 4 'Structure model' entity_src_gen 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_audit_author.name'                             
2 4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'        
3 4 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
4 4 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
5 4 'Structure model' '_entity_src_gen.pdbx_host_org_strain'           
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 85.2103  3.4950   19.4133  -0.0056 -0.2318 -0.4151 -0.1261 0.0168  -0.0102 4.0925  4.6562  2.7610 
1.9185  -0.9002 -2.0684 -0.2805 0.1237  -0.1498 -0.3223 0.1286  0.1495  0.5003  -0.1659 0.1519  
'X-RAY DIFFRACTION' 2  ? refined 88.3755  3.3077   3.7512   0.0976  -0.2118 -0.3584 -0.1571 -0.0175 -0.0093 1.5424  1.6874  4.8891 
-0.2022 -1.2530 -1.7813 -0.0818 0.1785  -0.0508 -0.4227 0.0424  -0.0690 0.7411  -0.2401 0.0394  
'X-RAY DIFFRACTION' 3  ? refined 81.4292  9.2846   12.5155  -0.0214 -0.1456 -0.2656 -0.1773 -0.0673 0.0388  0.9709  6.2276  4.6737 
-0.1554 0.1630  0.1327  -0.4306 0.0923  0.3079  -0.8962 0.2736  -0.0784 -0.0176 -0.2866 0.1570  
'X-RAY DIFFRACTION' 4  ? refined 97.7267  17.2650  18.9070  -0.0978 -0.3219 -0.4031 -0.0565 -0.0514 0.0019  3.7244  1.6335  0.9438 
0.4957  -0.2878 -0.3574 0.0495  -0.1370 0.0817  -0.0113 -0.0618 0.0039  -0.0377 -0.0269 0.0122  
'X-RAY DIFFRACTION' 5  ? refined 88.1953  7.8607   30.6773  -0.0640 -0.2205 -0.3912 -0.0907 0.0034  0.0193  5.1537  2.2617  2.1830 
0.9865  0.2366  -0.3235 0.2017  -0.4712 0.0495  0.2993  -0.2073 0.1185  0.0617  -0.0377 0.0056  
'X-RAY DIFFRACTION' 6  ? refined 109.1066 14.7966  -17.6554 0.0365  -0.1062 -0.3308 -0.1360 -0.0118 0.0143  9.7209  2.9199  6.1919 
1.8409  1.7277  0.9640  -0.2827 0.2779  0.5497  -0.0801 0.1863  -0.4916 -0.6814 0.7533  0.0963  
'X-RAY DIFFRACTION' 7  ? refined 107.5712 14.3896  -0.9282  -0.1233 -0.2496 -0.3114 -0.0722 -0.0551 -0.0142 2.0099  2.4374  7.2146 
-0.0068 -1.5046 0.3015  -0.1947 0.0551  -0.0643 0.0494  0.1486  -0.0605 0.2910  0.6038  0.0461  
'X-RAY DIFFRACTION' 8  ? refined 105.7202 22.2459  -10.5060 0.0063  -0.2185 -0.3320 -0.1734 -0.0271 0.0254  6.4725  3.7222  8.8600 
-0.4590 -1.7865 1.6727  -0.0606 -0.1485 0.4667  -0.1405 0.2410  -0.0693 -0.7975 0.3303  -0.1803 
'X-RAY DIFFRACTION' 9  ? refined 91.9257  9.9842   -17.4915 -0.0566 -0.1621 -0.3732 -0.0588 -0.0092 0.0065  2.6746  5.6232  4.1238 
1.8757  -0.7133 -0.3644 0.0043  0.0807  0.0357  0.1842  -0.0396 0.2661  0.0084  -0.4653 0.0353  
'X-RAY DIFFRACTION' 10 ? refined 104.6288 13.5056  -28.3399 0.0767  -0.1679 -0.3291 -0.1905 0.0569  0.0225  2.9246  5.6240  6.8125 
-0.4306 1.5832  4.3351  0.0006  0.4840  0.3955  -0.6586 0.2364  -0.3320 -0.7148 0.6085  -0.2370 
'X-RAY DIFFRACTION' 11 ? refined 113.5135 50.1654  5.7211   -0.2122 0.0991  0.1165  -0.0573 -0.1072 0.0830  4.2079  7.3867  4.6869 
0.1287  0.0472  -1.4418 0.0231  0.1962  -0.4942 0.2401  -0.3830 -1.3513 0.4023  0.7730  0.3599  
'X-RAY DIFFRACTION' 12 ? refined 99.9783  42.2982  11.6880  -0.1186 -0.2172 -0.1894 0.0307  -0.1154 -0.0385 3.0269  4.9841  4.4544 
1.2608  -0.8886 -1.3315 -0.3964 -0.0452 -0.3370 0.0309  -0.0151 -0.4064 0.2805  0.2731  0.4115  
'X-RAY DIFFRACTION' 13 ? refined 108.8640 49.9476  16.3234  -0.1174 -0.0528 -0.0393 -0.0804 -0.2439 0.0594  5.6556  5.8365  7.4299 
-1.4880 -2.5065 -0.1706 -0.1922 -0.3994 -0.3108 0.5652  -0.1645 -0.7425 -0.3312 0.6717  0.3567  
'X-RAY DIFFRACTION' 14 ? refined 102.9849 63.2848  3.4752   -0.1199 -0.1435 -0.1702 -0.0740 -0.1132 0.0183  4.5224  1.6519  5.1807 
-0.6105 2.8325  -0.9114 0.0021  -0.0307 0.1241  0.2473  -0.0730 -0.3863 -0.3526 0.2702  0.0709  
'X-RAY DIFFRACTION' 15 ? refined 119.6998 58.7267  1.6787   -0.1704 0.3363  0.3862  -0.1540 -0.0436 0.1557  7.9359  7.7309  3.5297 
0.1725  -0.5558 0.8903  -0.1379 0.4533  -0.1036 0.0303  -0.3918 -1.5662 -0.0442 1.1913  0.5297  
'X-RAY DIFFRACTION' 16 ? refined 137.8651 -17.0056 2.3528   1.0941  0.2502  0.4917  0.1360  0.0555  -0.0365 2.9387  3.0199  7.4368 
-0.4294 3.5697  -2.6210 0.0285  1.3015  -0.0944 -1.6108 0.2520  -0.6443 1.0170  0.7312  -0.2805 
'X-RAY DIFFRACTION' 17 ? refined 135.9537 -0.3967  6.7678   0.3327  0.0909  0.2775  -0.0207 -0.0613 0.1593  5.9935  13.1377 6.8238 
-3.5260 0.0507  3.0815  0.4277  0.0541  0.0707  -1.1573 -0.0078 -1.0828 0.6968  -0.0086 -0.4199 
'X-RAY DIFFRACTION' 18 ? refined 130.0518 -9.7219  0.3464   1.0643  0.4659  0.4148  -0.1012 -0.2814 0.0792  4.2292  8.9840  0.5966 
-0.0555 1.1667  1.5557  -0.4399 0.2953  0.9735  -2.0865 0.3621  0.3014  1.7922  -0.2209 0.0778  
'X-RAY DIFFRACTION' 19 ? refined 129.9095 -20.4941 16.4893  0.5017  -0.1642 0.4432  0.0287  -0.1828 0.0950  4.3490  4.5543  
12.2640 -0.2245 2.4498  -3.6060 -0.0272 0.2967  -0.2177 -0.8589 0.2862  0.3102  0.7877  -0.7238 -0.2590 
'X-RAY DIFFRACTION' 20 ? refined 136.9660 -28.5296 2.8423   1.3465  0.1309  0.6530  0.2126  -0.0668 -0.1167 6.4332  5.8166  7.9530 
1.7025  -5.2826 -3.5125 0.4322  0.6740  -0.5827 -1.2546 0.5339  0.0475  2.0909  0.3245  -0.9661 
'X-RAY DIFFRACTION' 21 ? refined 131.1464 14.9541  32.3223  0.0628  -0.0432 0.0902  -0.0673 -0.2761 -0.0098 4.8303  5.1145  5.7643 
-0.5308 1.1288  -0.9921 -0.0884 -0.9310 0.1378  0.9757  -0.0093 -0.6098 -0.4696 0.5345  0.0977  
'X-RAY DIFFRACTION' 22 ? refined 132.2819 -2.1970  28.5923  0.0926  -0.0786 0.1593  0.0807  -0.2036 0.1789  3.0286  11.4392 2.5396 
-0.1947 -0.3430 2.1744  -0.2127 -0.2368 -0.2846 0.4965  0.2072  -0.3720 0.6653  0.3558  0.0056  
'X-RAY DIFFRACTION' 23 ? refined 123.0878 5.2649   32.5229  0.1376  -0.0679 -0.0259 -0.0010 -0.1601 0.1146  11.0195 4.8861  5.5105 
-0.0073 3.4160  -0.1579 0.0426  -0.1559 -0.6563 0.8423  0.2541  -0.0926 0.5809  0.2019  -0.2967 
'X-RAY DIFFRACTION' 24 ? refined 126.7108 16.6071  17.0654  -0.1491 -0.2836 -0.0108 -0.0449 -0.0752 0.0663  5.5472  3.4875  6.0429 
0.7008  -0.9202 -0.7256 -0.2084 0.1069  0.0648  -0.0754 0.0269  -0.7438 -0.1252 0.2397  0.1815  
'X-RAY DIFFRACTION' 25 ? refined 128.4873 24.9929  32.4118  0.3462  -0.0945 0.1559  -0.0185 -0.2703 -0.1372 6.9558  5.2879  8.0757 
1.9191  1.2882  -2.1656 -0.1759 -0.7161 0.8103  1.0379  -0.0360 -0.7090 -1.0442 0.1531  0.2119  
'X-RAY DIFFRACTION' 26 ? refined 68.6911  46.4724  10.0677  -0.1845 0.1160  -0.1509 -0.0057 -0.0783 0.0145  7.1542  5.7859  5.1637 
-1.8537 2.3216  -1.3114 -0.1112 0.4522  0.4448  -0.3302 0.0280  0.6223  -0.2439 -0.9456 0.0833  
'X-RAY DIFFRACTION' 27 ? refined 82.7853  54.3001  3.7947   -0.1337 -0.0972 -0.2525 0.0534  -0.1146 0.0211  5.3171  2.9542  2.4491 
2.2985  -1.2984 -0.1684 -0.1751 0.4774  0.4080  -0.2129 0.2810  0.2432  -0.0383 -0.3606 -0.1059 
'X-RAY DIFFRACTION' 28 ? refined 73.3291  55.4404  12.5224  -0.1649 -0.0423 -0.0740 0.1200  -0.0875 0.0454  1.9817  3.4612  5.6605 
-0.3899 -3.1626 0.7366  0.1217  0.3474  0.6697  0.0369  0.1279  0.4490  -0.2995 -0.3297 -0.2497 
'X-RAY DIFFRACTION' 29 ? refined 79.5787  39.9434  21.5663  -0.1451 -0.1836 -0.2897 -0.0268 -0.0124 -0.0281 1.9070  3.7365  1.7298 
-1.8525 0.2373  0.0749  -0.0441 -0.0975 0.0446  0.1435  0.0868  0.1970  -0.0802 -0.3148 -0.0427 
'X-RAY DIFFRACTION' 30 ? refined 62.7682  39.3581  16.7969  -0.2029 0.2932  0.0979  -0.1375 -0.0271 -0.0003 2.9248  3.0290  6.5829 
0.1848  1.5785  -0.1884 -0.0201 0.0253  -0.3264 -0.1395 0.3200  1.1014  0.3520  -1.6004 -0.2999 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 3   ? ? A 34  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 35  ? ? A 89  ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 90  ? ? A 113 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 114 ? ? A 171 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 172 ? ? A 198 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  B 4   ? ? B 34  ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  B 35  ? ? B 89  ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  B 90  ? ? B 113 ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  B 114 ? ? B 171 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 B 172 ? ? B 198 ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 C 5   ? ? C 34  ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 C 35  ? ? C 89  ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 C 90  ? ? C 113 ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 C 114 ? ? C 171 ? ? ? ? 
'X-RAY DIFFRACTION' 15 15 C 172 ? ? C 197 ? ? ? ? 
'X-RAY DIFFRACTION' 16 16 D 5   ? ? D 34  ? ? ? ? 
'X-RAY DIFFRACTION' 17 17 D 35  ? ? D 89  ? ? ? ? 
'X-RAY DIFFRACTION' 18 18 D 90  ? ? D 113 ? ? ? ? 
'X-RAY DIFFRACTION' 19 19 D 114 ? ? D 171 ? ? ? ? 
'X-RAY DIFFRACTION' 20 20 D 172 ? ? D 196 ? ? ? ? 
'X-RAY DIFFRACTION' 21 21 E 8   ? ? E 34  ? ? ? ? 
'X-RAY DIFFRACTION' 22 22 E 35  ? ? E 89  ? ? ? ? 
'X-RAY DIFFRACTION' 23 23 E 90  ? ? E 113 ? ? ? ? 
'X-RAY DIFFRACTION' 24 24 E 114 ? ? E 171 ? ? ? ? 
'X-RAY DIFFRACTION' 25 25 E 172 ? ? E 197 ? ? ? ? 
'X-RAY DIFFRACTION' 26 26 F 5   ? ? F 34  ? ? ? ? 
'X-RAY DIFFRACTION' 27 27 F 35  ? ? F 89  ? ? ? ? 
'X-RAY DIFFRACTION' 28 28 F 90  ? ? F 113 ? ? ? ? 
'X-RAY DIFFRACTION' 29 29 F 114 ? ? F 171 ? ? ? ? 
'X-RAY DIFFRACTION' 30 30 F 172 ? ? F 198 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC   refinement       5.2.0005 ? 1 
HKL-2000 'data reduction' .        ? 2 
HKL-2000 'data scaling'   .        ? 3 
SHELX    phasing          .        ? 4 
# 
_pdbx_entry_details.entry_id             2BWJ 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN A, ARG 135 TO MET
ENGINEERED RESIDUE IN CHAIN B, ARG 135 TO MET
ENGINEERED RESIDUE IN CHAIN C, ARG 135 TO MET
ENGINEERED RESIDUE IN CHAIN D, ARG 135 TO MET
ENGINEERED RESIDUE IN CHAIN E, ARG 135 TO MET
ENGINEERED RESIDUE IN CHAIN F, ARG 135 TO MET
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'RESIDUE 1 REMAINS FROM HIS-TAG AFTER TEV CLEAVAGE' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O C HOH 2055 ? ? O   C HOH 2081 ? ? 2.18 
2 1 O D GLU 65   ? ? OG1 E THR 42   ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB E CYS 120 ? ? SG E CYS 120 ? ? 1.710 1.812 -0.102 0.016 N 
2 1 SD F MET 135 ? B CE F MET 135 ? ? 4.078 1.774 2.304  0.056 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 158 ? ? CZ A ARG 158 ? ? NH2 A ARG 158 ? ? 117.10 120.30 -3.20  0.50 N 
2 1 NE B ARG 100 ? ? CZ B ARG 100 ? ? NH1 B ARG 100 ? ? 124.24 120.30 3.94   0.50 N 
3 1 CG F MET 135 ? B SD F MET 135 ? B CE  F MET 135 ? ? 45.55  100.20 -54.65 1.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 112 ? ? -130.03 -67.01  
2  1 ILE B 112 ? ? -129.33 -65.47  
3  1 PHE B 197 ? ? -114.41 63.05   
4  1 LYS C 10  ? ? -96.78  40.38   
5  1 ILE C 112 ? ? -126.75 -63.06  
6  1 LYS D 10  ? ? -119.62 56.52   
7  1 TYR D 35  ? ? -146.78 12.63   
8  1 ILE D 112 ? ? -123.28 -67.07  
9  1 THR D 171 ? ? -165.53 -161.71 
10 1 ALA D 178 ? ? -101.06 59.56   
11 1 LYS E 10  ? ? -162.55 53.58   
12 1 ASP E 89  ? ? -159.47 49.68   
13 1 LYS F 10  ? ? -96.63  30.06   
14 1 ILE F 112 ? ? -120.76 -69.11  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A MET 5    ? SD  ? A MET 6   SD  
2   1 Y 1 A MET 5    ? CE  ? A MET 6   CE  
3   1 Y 1 A GLU 6    ? CD  ? A GLU 7   CD  
4   1 Y 1 A GLU 6    ? OE1 ? A GLU 7   OE1 
5   1 Y 1 A GLU 6    ? OE2 ? A GLU 7   OE2 
6   1 Y 1 A LYS 10   ? CD  ? A LYS 11  CD  
7   1 Y 1 A LYS 10   ? CE  ? A LYS 11  CE  
8   1 Y 1 A LYS 10   ? NZ  ? A LYS 11  NZ  
9   1 Y 1 A GLU 33   ? CD  ? A GLU 34  CD  
10  1 Y 1 A GLU 33   ? OE1 ? A GLU 34  OE1 
11  1 Y 1 A GLU 33   ? OE2 ? A GLU 34  OE2 
12  1 Y 1 A ARG 61   ? NE  ? A ARG 62  NE  
13  1 Y 1 A ARG 61   ? CZ  ? A ARG 62  CZ  
14  1 Y 1 A ARG 61   ? NH1 ? A ARG 62  NH1 
15  1 Y 1 A ARG 61   ? NH2 ? A ARG 62  NH2 
16  1 Y 1 A ASP 89   ? CG  ? A ASP 90  CG  
17  1 Y 1 A ASP 89   ? OD1 ? A ASP 90  OD1 
18  1 Y 1 A ASP 89   ? OD2 ? A ASP 90  OD2 
19  1 Y 1 A ARG 91   ? CZ  ? A ARG 92  CZ  
20  1 Y 1 A ARG 91   ? NH1 ? A ARG 92  NH1 
21  1 Y 1 A ARG 91   ? NH2 ? A ARG 92  NH2 
22  1 Y 1 A LYS 103  ? CD  ? A LYS 104 CD  
23  1 Y 1 A LYS 103  ? CE  ? A LYS 104 CE  
24  1 Y 1 A LYS 103  ? NZ  ? A LYS 104 NZ  
25  1 Y 1 A GLU 107  ? CD  ? A GLU 108 CD  
26  1 Y 1 A GLU 107  ? OE1 ? A GLU 108 OE1 
27  1 Y 1 A GLU 107  ? OE2 ? A GLU 108 OE2 
28  1 Y 1 A ARG 111  ? NE  ? A ARG 112 NE  
29  1 Y 1 A ARG 111  ? CZ  ? A ARG 112 CZ  
30  1 Y 1 A ARG 111  ? NH1 ? A ARG 112 NH1 
31  1 Y 1 A ARG 111  ? NH2 ? A ARG 112 NH2 
32  1 Y 1 A LYS 147  ? CE  ? A LYS 148 CE  
33  1 Y 1 A LYS 147  ? NZ  ? A LYS 148 NZ  
34  1 Y 1 A LYS 151  ? NZ  ? A LYS 152 NZ  
35  1 Y 1 A LYS 170  ? NZ  ? A LYS 171 NZ  
36  1 Y 1 B PHE 4    ? CG  ? B PHE 5   CG  
37  1 Y 1 B PHE 4    ? CD1 ? B PHE 5   CD1 
38  1 Y 1 B PHE 4    ? CD2 ? B PHE 5   CD2 
39  1 Y 1 B PHE 4    ? CE1 ? B PHE 5   CE1 
40  1 Y 1 B PHE 4    ? CE2 ? B PHE 5   CE2 
41  1 Y 1 B PHE 4    ? CZ  ? B PHE 5   CZ  
42  1 Y 1 B MET 5    ? CG  ? B MET 6   CG  
43  1 Y 1 B MET 5    ? SD  ? B MET 6   SD  
44  1 Y 1 B MET 5    ? CE  ? B MET 6   CE  
45  1 Y 1 B LYS 10   ? CG  ? B LYS 11  CG  
46  1 Y 1 B LYS 10   ? CD  ? B LYS 11  CD  
47  1 Y 1 B LYS 10   ? CE  ? B LYS 11  CE  
48  1 Y 1 B LYS 10   ? NZ  ? B LYS 11  NZ  
49  1 Y 1 B LYS 12   ? NZ  ? B LYS 13  NZ  
50  1 Y 1 B ARG 91   ? NE  ? B ARG 92  NE  
51  1 Y 1 B ARG 91   ? CZ  ? B ARG 92  CZ  
52  1 Y 1 B ARG 91   ? NH1 ? B ARG 92  NH1 
53  1 Y 1 B ARG 91   ? NH2 ? B ARG 92  NH2 
54  1 Y 1 B LYS 103  ? CE  ? B LYS 104 CE  
55  1 Y 1 B LYS 103  ? NZ  ? B LYS 104 NZ  
56  1 Y 1 B ARG 137  ? CD  ? B ARG 138 CD  
57  1 Y 1 B ARG 137  ? NE  ? B ARG 138 NE  
58  1 Y 1 B ARG 137  ? CZ  ? B ARG 138 CZ  
59  1 Y 1 B ARG 137  ? NH1 ? B ARG 138 NH1 
60  1 Y 1 B ARG 137  ? NH2 ? B ARG 138 NH2 
61  1 Y 1 B LYS 147  ? CD  ? B LYS 148 CD  
62  1 Y 1 B LYS 147  ? CE  ? B LYS 148 CE  
63  1 Y 1 B LYS 147  ? NZ  ? B LYS 148 NZ  
64  1 Y 1 B LYS 151  ? CD  ? B LYS 152 CD  
65  1 Y 1 B LYS 151  ? CE  ? B LYS 152 CE  
66  1 Y 1 B LYS 151  ? NZ  ? B LYS 152 NZ  
67  1 Y 1 B ARG 158  ? CD  ? B ARG 159 CD  
68  1 Y 1 B ARG 158  ? NE  ? B ARG 159 NE  
69  1 Y 1 B ARG 158  ? CZ  ? B ARG 159 CZ  
70  1 Y 1 B ARG 158  ? NH1 ? B ARG 159 NH1 
71  1 Y 1 B ARG 158  ? NH2 ? B ARG 159 NH2 
72  1 Y 1 B GLU 168  ? CD  ? B GLU 169 CD  
73  1 Y 1 B GLU 168  ? OE1 ? B GLU 169 OE1 
74  1 Y 1 B GLU 168  ? OE2 ? B GLU 169 OE2 
75  1 Y 1 B LYS 170  ? NZ  ? B LYS 171 NZ  
76  1 Y 1 B LYS 175  ? CE  ? B LYS 176 CE  
77  1 Y 1 B LYS 175  ? NZ  ? B LYS 176 NZ  
78  1 Y 1 B LEU 198  ? CG  ? B LEU 199 CG  
79  1 Y 1 B LEU 198  ? CD1 ? B LEU 199 CD1 
80  1 Y 1 B LEU 198  ? CD2 ? B LEU 199 CD2 
81  1 Y 1 C MET 5    ? CG  ? C MET 6   CG  
82  1 Y 1 C MET 5    ? SD  ? C MET 6   SD  
83  1 Y 1 C MET 5    ? CE  ? C MET 6   CE  
84  1 Y 1 C GLU 6    ? CG  ? C GLU 7   CG  
85  1 Y 1 C GLU 6    ? CD  ? C GLU 7   CD  
86  1 Y 1 C GLU 6    ? OE1 ? C GLU 7   OE1 
87  1 Y 1 C GLU 6    ? OE2 ? C GLU 7   OE2 
88  1 Y 1 C ARG 9    ? CD  ? C ARG 10  CD  
89  1 Y 1 C ARG 9    ? NE  ? C ARG 10  NE  
90  1 Y 1 C ARG 9    ? CZ  ? C ARG 10  CZ  
91  1 Y 1 C ARG 9    ? NH1 ? C ARG 10  NH1 
92  1 Y 1 C ARG 9    ? NH2 ? C ARG 10  NH2 
93  1 Y 1 C LYS 10   ? CG  ? C LYS 11  CG  
94  1 Y 1 C LYS 10   ? CD  ? C LYS 11  CD  
95  1 Y 1 C LYS 10   ? CE  ? C LYS 11  CE  
96  1 Y 1 C LYS 10   ? NZ  ? C LYS 11  NZ  
97  1 Y 1 C LYS 12   ? CG  ? C LYS 13  CG  
98  1 Y 1 C LYS 12   ? CD  ? C LYS 13  CD  
99  1 Y 1 C LYS 12   ? CE  ? C LYS 13  CE  
100 1 Y 1 C LYS 12   ? NZ  ? C LYS 13  NZ  
101 1 Y 1 C LYS 30   ? CE  ? C LYS 31  CE  
102 1 Y 1 C LYS 30   ? NZ  ? C LYS 31  NZ  
103 1 Y 1 C GLU 33   ? CD  ? C GLU 34  CD  
104 1 Y 1 C GLU 33   ? OE1 ? C GLU 34  OE1 
105 1 Y 1 C GLU 33   ? OE2 ? C GLU 34  OE2 
106 1 Y 1 C LYS 34   ? CD  ? C LYS 35  CD  
107 1 Y 1 C LYS 34   ? CE  ? C LYS 35  CE  
108 1 Y 1 C LYS 34   ? NZ  ? C LYS 35  NZ  
109 1 Y 1 C LYS 80   ? CE  ? C LYS 81  CE  
110 1 Y 1 C LYS 80   ? NZ  ? C LYS 81  NZ  
111 1 Y 1 C ARG 91   ? CG  ? C ARG 92  CG  
112 1 Y 1 C ARG 91   ? CD  ? C ARG 92  CD  
113 1 Y 1 C ARG 91   ? NE  ? C ARG 92  NE  
114 1 Y 1 C ARG 91   ? CZ  ? C ARG 92  CZ  
115 1 Y 1 C ARG 91   ? NH1 ? C ARG 92  NH1 
116 1 Y 1 C ARG 91   ? NH2 ? C ARG 92  NH2 
117 1 Y 1 C ARG 111  ? NE  ? C ARG 112 NE  
118 1 Y 1 C ARG 111  ? CZ  ? C ARG 112 CZ  
119 1 Y 1 C ARG 111  ? NH1 ? C ARG 112 NH1 
120 1 Y 1 C ARG 111  ? NH2 ? C ARG 112 NH2 
121 1 Y 1 C ARG 158  ? CZ  ? C ARG 159 CZ  
122 1 Y 1 C ARG 158  ? NH1 ? C ARG 159 NH1 
123 1 Y 1 C ARG 158  ? NH2 ? C ARG 159 NH2 
124 1 Y 1 C LYS 170  ? CD  ? C LYS 171 CD  
125 1 Y 1 C LYS 170  ? CE  ? C LYS 171 CE  
126 1 Y 1 C LYS 170  ? NZ  ? C LYS 171 NZ  
127 1 Y 1 D MET 5    ? CG  ? D MET 6   CG  
128 1 Y 1 D MET 5    ? SD  ? D MET 6   SD  
129 1 Y 1 D MET 5    ? CE  ? D MET 6   CE  
130 1 Y 1 D GLU 6    ? CG  ? D GLU 7   CG  
131 1 Y 1 D GLU 6    ? CD  ? D GLU 7   CD  
132 1 Y 1 D GLU 6    ? OE1 ? D GLU 7   OE1 
133 1 Y 1 D GLU 6    ? OE2 ? D GLU 7   OE2 
134 1 Y 1 D ASP 7    ? CG  ? D ASP 8   CG  
135 1 Y 1 D ASP 7    ? OD1 ? D ASP 8   OD1 
136 1 Y 1 D ASP 7    ? OD2 ? D ASP 8   OD2 
137 1 Y 1 D LEU 8    ? CG  ? D LEU 9   CG  
138 1 Y 1 D LEU 8    ? CD1 ? D LEU 9   CD1 
139 1 Y 1 D LEU 8    ? CD2 ? D LEU 9   CD2 
140 1 Y 1 D ARG 9    ? CG  ? D ARG 10  CG  
141 1 Y 1 D ARG 9    ? CD  ? D ARG 10  CD  
142 1 Y 1 D ARG 9    ? NE  ? D ARG 10  NE  
143 1 Y 1 D ARG 9    ? CZ  ? D ARG 10  CZ  
144 1 Y 1 D ARG 9    ? NH1 ? D ARG 10  NH1 
145 1 Y 1 D ARG 9    ? NH2 ? D ARG 10  NH2 
146 1 Y 1 D LYS 10   ? CG  ? D LYS 11  CG  
147 1 Y 1 D LYS 10   ? CD  ? D LYS 11  CD  
148 1 Y 1 D LYS 10   ? CE  ? D LYS 11  CE  
149 1 Y 1 D LYS 10   ? NZ  ? D LYS 11  NZ  
150 1 Y 1 D LYS 12   ? CG  ? D LYS 13  CG  
151 1 Y 1 D LYS 12   ? CD  ? D LYS 13  CD  
152 1 Y 1 D LYS 12   ? CE  ? D LYS 13  CE  
153 1 Y 1 D LYS 12   ? NZ  ? D LYS 13  NZ  
154 1 Y 1 D ILE 14   ? CG1 ? D ILE 15  CG1 
155 1 Y 1 D ILE 14   ? CG2 ? D ILE 15  CG2 
156 1 Y 1 D ILE 14   ? CD1 ? D ILE 15  CD1 
157 1 Y 1 D LYS 30   ? CG  ? D LYS 31  CG  
158 1 Y 1 D LYS 30   ? CD  ? D LYS 31  CD  
159 1 Y 1 D LYS 30   ? CE  ? D LYS 31  CE  
160 1 Y 1 D LYS 30   ? NZ  ? D LYS 31  NZ  
161 1 Y 1 D GLU 33   ? CD  ? D GLU 34  CD  
162 1 Y 1 D GLU 33   ? OE1 ? D GLU 34  OE1 
163 1 Y 1 D GLU 33   ? OE2 ? D GLU 34  OE2 
164 1 Y 1 D LYS 34   ? CG  ? D LYS 35  CG  
165 1 Y 1 D LYS 34   ? CD  ? D LYS 35  CD  
166 1 Y 1 D LYS 34   ? CE  ? D LYS 35  CE  
167 1 Y 1 D LYS 34   ? NZ  ? D LYS 35  NZ  
168 1 Y 1 D TYR 35   ? CG  ? D TYR 36  CG  
169 1 Y 1 D TYR 35   ? CD1 ? D TYR 36  CD1 
170 1 Y 1 D TYR 35   ? CD2 ? D TYR 36  CD2 
171 1 Y 1 D TYR 35   ? CE1 ? D TYR 36  CE1 
172 1 Y 1 D TYR 35   ? CE2 ? D TYR 36  CE2 
173 1 Y 1 D TYR 35   ? CZ  ? D TYR 36  CZ  
174 1 Y 1 D TYR 35   ? OH  ? D TYR 36  OH  
175 1 Y 1 D LEU 40   ? CG  ? D LEU 41  CG  
176 1 Y 1 D LEU 40   ? CD1 ? D LEU 41  CD1 
177 1 Y 1 D LEU 40   ? CD2 ? D LEU 41  CD2 
178 1 Y 1 D ARG 47   ? NE  ? D ARG 48  NE  
179 1 Y 1 D ARG 47   ? CZ  ? D ARG 48  CZ  
180 1 Y 1 D ARG 47   ? NH1 ? D ARG 48  NH1 
181 1 Y 1 D ARG 47   ? NH2 ? D ARG 48  NH2 
182 1 Y 1 D GLU 48   ? CG  ? D GLU 49  CG  
183 1 Y 1 D GLU 48   ? CD  ? D GLU 49  CD  
184 1 Y 1 D GLU 48   ? OE1 ? D GLU 49  OE1 
185 1 Y 1 D GLU 48   ? OE2 ? D GLU 49  OE2 
186 1 Y 1 D GLU 53   ? CG  ? D GLU 54  CG  
187 1 Y 1 D GLU 53   ? CD  ? D GLU 54  CD  
188 1 Y 1 D GLU 53   ? OE1 ? D GLU 54  OE1 
189 1 Y 1 D GLU 53   ? OE2 ? D GLU 54  OE2 
190 1 Y 1 D LYS 80   ? CD  ? D LYS 81  CD  
191 1 Y 1 D LYS 80   ? CE  ? D LYS 81  CE  
192 1 Y 1 D LYS 80   ? NZ  ? D LYS 81  NZ  
193 1 Y 1 D ASP 89   ? CG  ? D ASP 90  CG  
194 1 Y 1 D ASP 89   ? OD1 ? D ASP 90  OD1 
195 1 Y 1 D ASP 89   ? OD2 ? D ASP 90  OD2 
196 1 Y 1 D ARG 91   ? CD  ? D ARG 92  CD  
197 1 Y 1 D ARG 91   ? NE  ? D ARG 92  NE  
198 1 Y 1 D ARG 91   ? CZ  ? D ARG 92  CZ  
199 1 Y 1 D ARG 91   ? NH1 ? D ARG 92  NH1 
200 1 Y 1 D ARG 91   ? NH2 ? D ARG 92  NH2 
201 1 Y 1 D LYS 103  ? CD  ? D LYS 104 CD  
202 1 Y 1 D LYS 103  ? CE  ? D LYS 104 CE  
203 1 Y 1 D LYS 103  ? NZ  ? D LYS 104 NZ  
204 1 Y 1 D GLU 107  ? CG  ? D GLU 108 CG  
205 1 Y 1 D GLU 107  ? CD  ? D GLU 108 CD  
206 1 Y 1 D GLU 107  ? OE1 ? D GLU 108 OE1 
207 1 Y 1 D GLU 107  ? OE2 ? D GLU 108 OE2 
208 1 Y 1 D ARG 110  ? NE  ? D ARG 111 NE  
209 1 Y 1 D ARG 110  ? CZ  ? D ARG 111 CZ  
210 1 Y 1 D ARG 110  ? NH1 ? D ARG 111 NH1 
211 1 Y 1 D ARG 110  ? NH2 ? D ARG 111 NH2 
212 1 Y 1 D ARG 111  ? CD  ? D ARG 112 CD  
213 1 Y 1 D ARG 111  ? NE  ? D ARG 112 NE  
214 1 Y 1 D ARG 111  ? CZ  ? D ARG 112 CZ  
215 1 Y 1 D ARG 111  ? NH1 ? D ARG 112 NH1 
216 1 Y 1 D ARG 111  ? NH2 ? D ARG 112 NH2 
217 1 Y 1 D GLN 116  ? CG  ? D GLN 117 CG  
218 1 Y 1 D GLN 116  ? CD  ? D GLN 117 CD  
219 1 Y 1 D GLN 116  ? OE1 ? D GLN 117 OE1 
220 1 Y 1 D GLN 116  ? NE2 ? D GLN 117 NE2 
221 1 Y 1 D LEU 117  ? CG  ? D LEU 118 CG  
222 1 Y 1 D LEU 117  ? CD1 ? D LEU 118 CD1 
223 1 Y 1 D LEU 117  ? CD2 ? D LEU 118 CD2 
224 1 Y 1 D LYS 147  ? CD  ? D LYS 148 CD  
225 1 Y 1 D LYS 147  ? CE  ? D LYS 148 CE  
226 1 Y 1 D LYS 147  ? NZ  ? D LYS 148 NZ  
227 1 Y 1 D GLU 154  ? CD  ? D GLU 155 CD  
228 1 Y 1 D GLU 154  ? OE1 ? D GLU 155 OE1 
229 1 Y 1 D GLU 154  ? OE2 ? D GLU 155 OE2 
230 1 Y 1 D ILE 164  ? CG1 ? D ILE 165 CG1 
231 1 Y 1 D ILE 164  ? CG2 ? D ILE 165 CG2 
232 1 Y 1 D ILE 164  ? CD1 ? D ILE 165 CD1 
233 1 Y 1 D LYS 170  ? CG  ? D LYS 171 CG  
234 1 Y 1 D LYS 170  ? CD  ? D LYS 171 CD  
235 1 Y 1 D LYS 170  ? CE  ? D LYS 171 CE  
236 1 Y 1 D LYS 170  ? NZ  ? D LYS 171 NZ  
237 1 Y 1 D GLN 172  ? CG  ? D GLN 173 CG  
238 1 Y 1 D GLN 172  ? CD  ? D GLN 173 CD  
239 1 Y 1 D GLN 172  ? OE1 ? D GLN 173 OE1 
240 1 Y 1 D GLN 172  ? NE2 ? D GLN 173 NE2 
241 1 Y 1 D LEU 173  ? CG  ? D LEU 174 CG  
242 1 Y 1 D LEU 173  ? CD1 ? D LEU 174 CD1 
243 1 Y 1 D LEU 173  ? CD2 ? D LEU 174 CD2 
244 1 Y 1 D HIS 174  ? CG  ? D HIS 175 CG  
245 1 Y 1 D HIS 174  ? ND1 ? D HIS 175 ND1 
246 1 Y 1 D HIS 174  ? CD2 ? D HIS 175 CD2 
247 1 Y 1 D HIS 174  ? CE1 ? D HIS 175 CE1 
248 1 Y 1 D HIS 174  ? NE2 ? D HIS 175 NE2 
249 1 Y 1 D GLU 183  ? CG  ? D GLU 184 CG  
250 1 Y 1 D GLU 183  ? CD  ? D GLU 184 CD  
251 1 Y 1 D GLU 183  ? OE1 ? D GLU 184 OE1 
252 1 Y 1 D GLU 183  ? OE2 ? D GLU 184 OE2 
253 1 Y 1 D LEU 187  ? CG  ? D LEU 188 CG  
254 1 Y 1 D LEU 187  ? CD1 ? D LEU 188 CD1 
255 1 Y 1 D LEU 187  ? CD2 ? D LEU 188 CD2 
256 1 Y 1 E ARG 9    ? NE  ? E ARG 10  NE  
257 1 Y 1 E ARG 9    ? CZ  ? E ARG 10  CZ  
258 1 Y 1 E ARG 9    ? NH1 ? E ARG 10  NH1 
259 1 Y 1 E ARG 9    ? NH2 ? E ARG 10  NH2 
260 1 Y 1 E LYS 10   ? CG  ? E LYS 11  CG  
261 1 Y 1 E LYS 10   ? CD  ? E LYS 11  CD  
262 1 Y 1 E LYS 10   ? CE  ? E LYS 11  CE  
263 1 Y 1 E LYS 10   ? NZ  ? E LYS 11  NZ  
264 1 Y 1 E LYS 12   ? CG  ? E LYS 13  CG  
265 1 Y 1 E LYS 12   ? CD  ? E LYS 13  CD  
266 1 Y 1 E LYS 12   ? CE  ? E LYS 13  CE  
267 1 Y 1 E LYS 12   ? NZ  ? E LYS 13  NZ  
268 1 Y 1 E GLU 33   ? CD  ? E GLU 34  CD  
269 1 Y 1 E GLU 33   ? OE1 ? E GLU 34  OE1 
270 1 Y 1 E GLU 33   ? OE2 ? E GLU 34  OE2 
271 1 Y 1 E ARG 47   ? CD  ? E ARG 48  CD  
272 1 Y 1 E ARG 47   ? NE  ? E ARG 48  NE  
273 1 Y 1 E ARG 47   ? CZ  ? E ARG 48  CZ  
274 1 Y 1 E ARG 47   ? NH1 ? E ARG 48  NH1 
275 1 Y 1 E ARG 47   ? NH2 ? E ARG 48  NH2 
276 1 Y 1 E GLU 53   ? CD  ? E GLU 54  CD  
277 1 Y 1 E GLU 53   ? OE1 ? E GLU 54  OE1 
278 1 Y 1 E GLU 53   ? OE2 ? E GLU 54  OE2 
279 1 Y 1 E LYS 58   ? CE  ? E LYS 59  CE  
280 1 Y 1 E LYS 58   ? NZ  ? E LYS 59  NZ  
281 1 Y 1 E ARG 61   ? CZ  ? E ARG 62  CZ  
282 1 Y 1 E ARG 61   ? NH1 ? E ARG 62  NH1 
283 1 Y 1 E ARG 61   ? NH2 ? E ARG 62  NH2 
284 1 Y 1 E GLU 65   ? CD  ? E GLU 66  CD  
285 1 Y 1 E GLU 65   ? OE1 ? E GLU 66  OE1 
286 1 Y 1 E GLU 65   ? OE2 ? E GLU 66  OE2 
287 1 Y 1 E LYS 80   ? CD  ? E LYS 81  CD  
288 1 Y 1 E LYS 80   ? CE  ? E LYS 81  CE  
289 1 Y 1 E LYS 80   ? NZ  ? E LYS 81  NZ  
290 1 Y 1 E ASP 89   ? CG  ? E ASP 90  CG  
291 1 Y 1 E ASP 89   ? OD1 ? E ASP 90  OD1 
292 1 Y 1 E ASP 89   ? OD2 ? E ASP 90  OD2 
293 1 Y 1 E ARG 91   ? CG  ? E ARG 92  CG  
294 1 Y 1 E ARG 91   ? CD  ? E ARG 92  CD  
295 1 Y 1 E ARG 91   ? NE  ? E ARG 92  NE  
296 1 Y 1 E ARG 91   ? CZ  ? E ARG 92  CZ  
297 1 Y 1 E ARG 91   ? NH1 ? E ARG 92  NH1 
298 1 Y 1 E ARG 91   ? NH2 ? E ARG 92  NH2 
299 1 Y 1 E ARG 100  ? NE  ? E ARG 101 NE  
300 1 Y 1 E ARG 100  ? CZ  ? E ARG 101 CZ  
301 1 Y 1 E ARG 100  ? NH1 ? E ARG 101 NH1 
302 1 Y 1 E ARG 100  ? NH2 ? E ARG 101 NH2 
303 1 Y 1 E LYS 103  ? CD  ? E LYS 104 CD  
304 1 Y 1 E LYS 103  ? CE  ? E LYS 104 CE  
305 1 Y 1 E LYS 103  ? NZ  ? E LYS 104 NZ  
306 1 Y 1 E GLN 134  ? CG  ? E GLN 135 CG  
307 1 Y 1 E GLN 134  ? CD  ? E GLN 135 CD  
308 1 Y 1 E GLN 134  ? OE1 ? E GLN 135 OE1 
309 1 Y 1 E GLN 134  ? NE2 ? E GLN 135 NE2 
310 1 Y 1 E LYS 147  ? CD  ? E LYS 148 CD  
311 1 Y 1 E LYS 147  ? CE  ? E LYS 148 CE  
312 1 Y 1 E LYS 147  ? NZ  ? E LYS 148 NZ  
313 1 Y 1 E LYS 151  ? NZ  ? E LYS 152 NZ  
314 1 Y 1 E LYS 170  ? CE  ? E LYS 171 CE  
315 1 Y 1 E LYS 170  ? NZ  ? E LYS 171 NZ  
316 1 Y 1 E LYS 175  ? CE  ? E LYS 176 CE  
317 1 Y 1 E LYS 175  ? NZ  ? E LYS 176 NZ  
318 1 Y 1 F GLU 6    ? CD  ? F GLU 7   CD  
319 1 Y 1 F GLU 6    ? OE1 ? F GLU 7   OE1 
320 1 Y 1 F GLU 6    ? OE2 ? F GLU 7   OE2 
321 1 Y 1 F LEU 8    ? CG  ? F LEU 9   CG  
322 1 Y 1 F LEU 8    ? CD1 ? F LEU 9   CD1 
323 1 Y 1 F LEU 8    ? CD2 ? F LEU 9   CD2 
324 1 Y 1 F LYS 10   ? CG  ? F LYS 11  CG  
325 1 Y 1 F LYS 10   ? CD  ? F LYS 11  CD  
326 1 Y 1 F LYS 10   ? CE  ? F LYS 11  CE  
327 1 Y 1 F LYS 10   ? NZ  ? F LYS 11  NZ  
328 1 Y 1 F LYS 12   ? CG  ? F LYS 13  CG  
329 1 Y 1 F LYS 12   ? CD  ? F LYS 13  CD  
330 1 Y 1 F LYS 12   ? CE  ? F LYS 13  CE  
331 1 Y 1 F LYS 12   ? NZ  ? F LYS 13  NZ  
332 1 Y 1 F LYS 103  ? CD  ? F LYS 104 CD  
333 1 Y 1 F LYS 103  ? CE  ? F LYS 104 CE  
334 1 Y 1 F LYS 103  ? NZ  ? F LYS 104 NZ  
335 1 Y 1 F ARG 111  ? NE  ? F ARG 112 NE  
336 1 Y 1 F ARG 111  ? CZ  ? F ARG 112 CZ  
337 1 Y 1 F ARG 111  ? NH1 ? F ARG 112 NH1 
338 1 Y 1 F ARG 111  ? NH2 ? F ARG 112 NH2 
339 1 Y 1 F ARG 137  ? CZ  ? F ARG 138 CZ  
340 1 Y 1 F ARG 137  ? NH1 ? F ARG 138 NH1 
341 1 Y 1 F ARG 137  ? NH2 ? F ARG 138 NH2 
342 1 Y 1 F LYS 170  ? CE  ? F LYS 171 CE  
343 1 Y 1 F LYS 170  ? NZ  ? F LYS 171 NZ  
344 1 Y 1 F LYS 175  ? CE  ? F LYS 176 CE  
345 1 Y 1 F LYS 175  ? NZ  ? F LYS 176 NZ  
346 1 Y 1 F PHE 197  ? CG  ? F PHE 198 CG  
347 1 Y 1 F PHE 197  ? CD1 ? F PHE 198 CD1 
348 1 Y 1 F PHE 197  ? CD2 ? F PHE 198 CD2 
349 1 Y 1 F PHE 197  ? CE1 ? F PHE 198 CE1 
350 1 Y 1 F PHE 197  ? CE2 ? F PHE 198 CE2 
351 1 Y 1 F PHE 197  ? CZ  ? F PHE 198 CZ  
352 1 Y 1 F LEU 198  ? CG  ? F LEU 199 CG  
353 1 Y 1 F LEU 198  ? CD1 ? F LEU 199 CD1 
354 1 Y 1 F LEU 198  ? CD2 ? F LEU 199 CD2 
355 1 N 1 C AMP 1199 ? P   ? N AMP 1   P   
356 1 N 1 C AMP 1199 ? O1P ? N AMP 1   O1P 
357 1 N 1 C AMP 1199 ? O2P ? N AMP 1   O2P 
358 1 N 1 C AMP 1199 ? O3P ? N AMP 1   O3P 
359 1 N 1 F AMP 1202 ? P   ? U AMP 1   P   
360 1 N 1 F AMP 1202 ? O1P ? U AMP 1   O1P 
361 1 N 1 F AMP 1202 ? O2P ? U AMP 1   O2P 
362 1 N 1 F AMP 1202 ? O3P ? U AMP 1   O3P 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 0   ? A SER 1   
2  1 Y 1 A MET 1   ? A MET 2   
3  1 Y 1 A GLY 2   ? A GLY 3   
4  1 Y 1 B SER 0   ? B SER 1   
5  1 Y 1 B MET 1   ? B MET 2   
6  1 Y 1 B GLY 2   ? B GLY 3   
7  1 Y 1 B GLY 3   ? B GLY 4   
8  1 Y 1 C SER 0   ? C SER 1   
9  1 Y 1 C MET 1   ? C MET 2   
10 1 Y 1 C GLY 2   ? C GLY 3   
11 1 Y 1 C GLY 3   ? C GLY 4   
12 1 Y 1 C PHE 4   ? C PHE 5   
13 1 Y 1 C LEU 198 ? C LEU 199 
14 1 Y 1 D SER 0   ? D SER 1   
15 1 Y 1 D MET 1   ? D MET 2   
16 1 Y 1 D GLY 2   ? D GLY 3   
17 1 Y 1 D GLY 3   ? D GLY 4   
18 1 Y 1 D PHE 4   ? D PHE 5   
19 1 Y 1 D PHE 197 ? D PHE 198 
20 1 Y 1 D LEU 198 ? D LEU 199 
21 1 Y 1 E SER 0   ? E SER 1   
22 1 Y 1 E MET 1   ? E MET 2   
23 1 Y 1 E GLY 2   ? E GLY 3   
24 1 Y 1 E GLY 3   ? E GLY 4   
25 1 Y 1 E PHE 4   ? E PHE 5   
26 1 Y 1 E MET 5   ? E MET 6   
27 1 Y 1 E GLU 6   ? E GLU 7   
28 1 Y 1 E ASP 7   ? E ASP 8   
29 1 Y 1 E LEU 198 ? E LEU 199 
30 1 Y 1 F SER 0   ? F SER 1   
31 1 Y 1 F MET 1   ? F MET 2   
32 1 Y 1 F GLY 2   ? F GLY 3   
33 1 Y 1 F GLY 3   ? F GLY 4   
34 1 Y 1 F PHE 4   ? F PHE 5   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'             SO4 
3 'CHLORIDE ION'            CL  
4 'ADENOSINE MONOPHOSPHATE' AMP 
5 water                     HOH 
#