data_2BX5
# 
_entry.id   2BX5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.382 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2BX5         pdb_00002bx5 10.2210/pdb2bx5/pdb 
PDBE  EBI-25015    ?            ?                   
WWPDB D_1290025015 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2BX5 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
_audit_author.name           'James, L.C.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Beta-Edge Interactions in a Pentadecameric Human Antibody Vkappa Domain.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            367 
_citation.page_first                603 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17292396 
_citation.pdbx_database_id_DOI      10.1016/J.JMB.2006.10.093 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'James, L.C.'   1 ? 
primary 'Jones, P.C.'   2 ? 
primary 'Mccoy, A.'     3 ? 
primary 'Tennent, G.A.' 4 ? 
primary 'Pepys, M.B.'   5 ? 
primary 'Famm, K.'      6 ? 
primary 'Winter, G.'    7 ? 
# 
_cell.entry_id           2BX5 
_cell.length_a           191.928 
_cell.length_b           191.928 
_cell.length_c           197.439 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              180 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2BX5 
_symmetry.space_group_name_H-M             'P 64 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                181 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'VD9 VKI LIGHT-CHAIN' 11540.733 15   ? ? 'LIGHT-CHAIN VARIABLE DOMAIN, RESIDUES 1-107' ? 
2 water   nat water                 18.015    1048 ? ? ?                                             ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQSYSTPNTFGQGTKVEIK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQP
EDFATYYCQQSYSTPNTFGQGTKVEIK
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ILE n 
1 3   GLN n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   SER n 
1 10  SER n 
1 11  LEU n 
1 12  SER n 
1 13  ALA n 
1 14  SER n 
1 15  VAL n 
1 16  GLY n 
1 17  ASP n 
1 18  ARG n 
1 19  VAL n 
1 20  THR n 
1 21  ILE n 
1 22  THR n 
1 23  CYS n 
1 24  ARG n 
1 25  ALA n 
1 26  SER n 
1 27  GLN n 
1 28  SER n 
1 29  ILE n 
1 30  SER n 
1 31  SER n 
1 32  TYR n 
1 33  LEU n 
1 34  ASN n 
1 35  TRP n 
1 36  TYR n 
1 37  GLN n 
1 38  GLN n 
1 39  LYS n 
1 40  PRO n 
1 41  GLY n 
1 42  LYS n 
1 43  ALA n 
1 44  PRO n 
1 45  LYS n 
1 46  LEU n 
1 47  LEU n 
1 48  ILE n 
1 49  TYR n 
1 50  ALA n 
1 51  ALA n 
1 52  SER n 
1 53  SER n 
1 54  LEU n 
1 55  GLN n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  PRO n 
1 60  SER n 
1 61  ARG n 
1 62  PHE n 
1 63  SER n 
1 64  GLY n 
1 65  SER n 
1 66  GLY n 
1 67  SER n 
1 68  GLY n 
1 69  THR n 
1 70  ASP n 
1 71  PHE n 
1 72  THR n 
1 73  LEU n 
1 74  THR n 
1 75  ILE n 
1 76  SER n 
1 77  SER n 
1 78  LEU n 
1 79  GLN n 
1 80  PRO n 
1 81  GLU n 
1 82  ASP n 
1 83  PHE n 
1 84  ALA n 
1 85  THR n 
1 86  TYR n 
1 87  TYR n 
1 88  CYS n 
1 89  GLN n 
1 90  GLN n 
1 91  SER n 
1 92  TYR n 
1 93  SER n 
1 94  THR n 
1 95  PRO n 
1 96  ASN n 
1 97  THR n 
1 98  PHE n 
1 99  GLY n 
1 100 GLN n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 VAL n 
1 105 GLU n 
1 106 ILE n 
1 107 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    2BX5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          2BX5 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2BX5 A 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
2  1 2BX5 B 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
3  1 2BX5 C 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
4  1 2BX5 D 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
5  1 2BX5 E 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
6  1 2BX5 F 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
7  1 2BX5 G 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
8  1 2BX5 H 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
9  1 2BX5 I 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
10 1 2BX5 J 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
11 1 2BX5 K 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
12 1 2BX5 L 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
13 1 2BX5 M 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
14 1 2BX5 N 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
15 1 2BX5 O 1 ? 107 ? 2BX5 1 ? 107 ? 1 107 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2BX5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   49 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2BX5 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             166.000 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   59210 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.4 
_reflns.pdbx_Rmerge_I_obs            0.09000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.5000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.300 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.80 
_reflns_shell.percent_possible_all   89.7 
_reflns_shell.Rmerge_I_obs           0.42000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.000 
_reflns_shell.pdbx_redundancy        1.90 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2BX5 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     59210 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             166.00 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    91.0 
_refine.ls_R_factor_obs                          0.250 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.250 
_refine.ls_R_factor_R_free                       0.290 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1HEZ' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11941 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             1048 
_refine_hist.number_atoms_total               12989 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        166.00 
# 
_struct.entry_id                  2BX5 
_struct.title                     
;Is FR1 the antibody's Achillies heel
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2BX5 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'IMMUNE SYSTEM, AMYLOID, LCDD, ANTIBODY, AGGREGATION, FR1' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 2 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 2 ? 
X  N N 2 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 2 ? 
BA N N 2 ? 
CA N N 2 ? 
DA N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ALA A 50 ? SER A 52 ? ALA A 50 SER A 52 5 ? 3 
HELX_P HELX_P2  2  GLN B 79 ? PHE B 83 ? GLN B 79 PHE B 83 5 ? 5 
HELX_P HELX_P3  3  GLN C 79 ? PHE C 83 ? GLN C 79 PHE C 83 5 ? 5 
HELX_P HELX_P4  4  GLN D 79 ? PHE D 83 ? GLN D 79 PHE D 83 5 ? 5 
HELX_P HELX_P5  5  GLN E 79 ? PHE E 83 ? GLN E 79 PHE E 83 5 ? 5 
HELX_P HELX_P6  6  ALA F 50 ? SER F 52 ? ALA F 50 SER F 52 5 ? 3 
HELX_P HELX_P7  7  GLN F 79 ? PHE F 83 ? GLN F 79 PHE F 83 5 ? 5 
HELX_P HELX_P8  8  GLN K 79 ? PHE K 83 ? GLN K 79 PHE K 83 5 ? 5 
HELX_P HELX_P9  9  GLN L 79 ? PHE L 83 ? GLN L 79 PHE L 83 5 ? 5 
HELX_P HELX_P10 10 GLN M 79 ? PHE M 83 ? GLN M 79 PHE M 83 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 88 SG ? ? A CYS 23 A CYS 88 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
disulf2  disulf ? ? B CYS 23 SG ? ? ? 1_555 B CYS 88 SG ? ? B CYS 23 B CYS 88 1_555 ? ? ? ? ? ? ? 2.048 ? ? 
disulf3  disulf ? ? C CYS 23 SG ? ? ? 1_555 C CYS 88 SG ? ? C CYS 23 C CYS 88 1_555 ? ? ? ? ? ? ? 2.076 ? ? 
disulf4  disulf ? ? D CYS 23 SG ? ? ? 1_555 D CYS 88 SG ? ? D CYS 23 D CYS 88 1_555 ? ? ? ? ? ? ? 2.047 ? ? 
disulf5  disulf ? ? E CYS 23 SG ? ? ? 1_555 E CYS 88 SG ? ? E CYS 23 E CYS 88 1_555 ? ? ? ? ? ? ? 2.053 ? ? 
disulf6  disulf ? ? F CYS 23 SG ? ? ? 1_555 F CYS 88 SG ? ? F CYS 23 F CYS 88 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf7  disulf ? ? G CYS 23 SG ? ? ? 1_555 G CYS 88 SG ? ? G CYS 23 G CYS 88 1_555 ? ? ? ? ? ? ? 2.042 ? ? 
disulf8  disulf ? ? I CYS 23 SG ? ? ? 1_555 I CYS 88 SG ? ? I CYS 23 I CYS 88 1_555 ? ? ? ? ? ? ? 2.061 ? ? 
disulf9  disulf ? ? J CYS 23 SG ? ? ? 1_555 J CYS 88 SG ? ? J CYS 23 J CYS 88 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf10 disulf ? ? K CYS 23 SG ? ? ? 1_555 K CYS 88 SG ? ? K CYS 23 K CYS 88 1_555 ? ? ? ? ? ? ? 2.044 ? ? 
disulf11 disulf ? ? L CYS 23 SG ? ? ? 1_555 L CYS 88 SG ? ? L CYS 23 L CYS 88 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf12 disulf ? ? M CYS 23 SG ? ? ? 1_555 M CYS 88 SG ? ? M CYS 23 M CYS 88 1_555 ? ? ? ? ? ? ? 2.055 ? ? 
disulf13 disulf ? ? N CYS 23 SG ? ? ? 1_555 N CYS 88 SG ? ? N CYS 23 N CYS 88 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf14 disulf ? ? O CYS 23 SG ? ? ? 1_555 O CYS 88 SG ? ? O CYS 23 O CYS 88 1_555 ? ? ? ? ? ? ? 2.046 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  SER 7  A . ? SER 7  A PRO 8  A ? PRO 8  A 1 -7.51 
2  THR 94 A . ? THR 94 A PRO 95 A ? PRO 95 A 1 -6.55 
3  SER 7  B . ? SER 7  B PRO 8  B ? PRO 8  B 1 -3.88 
4  THR 94 B . ? THR 94 B PRO 95 B ? PRO 95 B 1 -4.83 
5  SER 7  C . ? SER 7  C PRO 8  C ? PRO 8  C 1 3.97  
6  THR 94 C . ? THR 94 C PRO 95 C ? PRO 95 C 1 6.17  
7  SER 7  D . ? SER 7  D PRO 8  D ? PRO 8  D 1 5.19  
8  THR 94 D . ? THR 94 D PRO 95 D ? PRO 95 D 1 -5.94 
9  SER 7  E . ? SER 7  E PRO 8  E ? PRO 8  E 1 12.73 
10 THR 94 E . ? THR 94 E PRO 95 E ? PRO 95 E 1 2.37  
11 SER 7  F . ? SER 7  F PRO 8  F ? PRO 8  F 1 -6.73 
12 THR 94 F . ? THR 94 F PRO 95 F ? PRO 95 F 1 -1.85 
13 SER 7  G . ? SER 7  G PRO 8  G ? PRO 8  G 1 7.31  
14 THR 94 G . ? THR 94 G PRO 95 G ? PRO 95 G 1 12.11 
15 SER 7  I . ? SER 7  I PRO 8  I ? PRO 8  I 1 -7.99 
16 THR 94 I . ? THR 94 I PRO 95 I ? PRO 95 I 1 13.30 
17 SER 7  J . ? SER 7  J PRO 8  J ? PRO 8  J 1 3.42  
18 THR 94 J . ? THR 94 J PRO 95 J ? PRO 95 J 1 4.96  
19 SER 7  K . ? SER 7  K PRO 8  K ? PRO 8  K 1 -0.04 
20 THR 94 K . ? THR 94 K PRO 95 K ? PRO 95 K 1 -0.57 
21 SER 7  L . ? SER 7  L PRO 8  L ? PRO 8  L 1 7.55  
22 THR 94 L . ? THR 94 L PRO 95 L ? PRO 95 L 1 -7.28 
23 SER 7  M . ? SER 7  M PRO 8  M ? PRO 8  M 1 0.89  
24 ILE 48 M . ? ILE 48 M TYR 49 M ? TYR 49 M 1 7.44  
25 THR 94 M . ? THR 94 M PRO 95 M ? PRO 95 M 1 3.15  
26 SER 7  N . ? SER 7  N PRO 8  N ? PRO 8  N 1 0.61  
27 THR 94 N . ? THR 94 N PRO 95 N ? PRO 95 N 1 3.07  
28 SER 7  O . ? SER 7  O PRO 8  O ? PRO 8  O 1 -7.86 
29 THR 94 O . ? THR 94 O PRO 95 O ? PRO 95 O 1 -8.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4  ? 
AB ? 4  ? 
BA ? 4  ? 
BB ? 9  ? 
BC ? 5  ? 
CA ? 4  ? 
DA ? 12 ? 
DB ? 3  ? 
EA ? 4  ? 
FA ? 4  ? 
FB ? 4  ? 
FC ? 2  ? 
GA ? 4  ? 
GB ? 4  ? 
HA ? 7  ? 
HB ? 2  ? 
HC ? 4  ? 
IA ? 4  ? 
JA ? 4  ? 
JB ? 7  ? 
KA ? 3  ? 
KB ? 4  ? 
LA ? 4  ? 
LB ? 9  ? 
LC ? 8  ? 
LD ? 2  ? 
MA ? 3  ? 
NA ? 3  ? 
NB ? 2  ? 
OA ? 3  ? 
OB ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? anti-parallel 
AA 3  4  ? anti-parallel 
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
BA 1  2  ? anti-parallel 
BA 2  3  ? anti-parallel 
BA 3  4  ? anti-parallel 
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? anti-parallel 
BB 5  6  ? parallel      
BB 6  7  ? anti-parallel 
BB 7  8  ? parallel      
BB 8  9  ? anti-parallel 
BC 1  2  ? anti-parallel 
BC 2  3  ? anti-parallel 
BC 3  4  ? anti-parallel 
BC 4  5  ? anti-parallel 
CA 1  2  ? anti-parallel 
CA 2  3  ? anti-parallel 
CA 3  4  ? anti-parallel 
DA 1  2  ? anti-parallel 
DA 2  3  ? anti-parallel 
DA 3  4  ? anti-parallel 
DA 4  5  ? anti-parallel 
DA 5  6  ? parallel      
DA 6  7  ? anti-parallel 
DA 7  8  ? parallel      
DA 8  9  ? anti-parallel 
DA 9  10 ? anti-parallel 
DA 10 11 ? anti-parallel 
DA 11 12 ? anti-parallel 
DB 1  2  ? anti-parallel 
DB 2  3  ? anti-parallel 
EA 1  2  ? anti-parallel 
EA 2  3  ? anti-parallel 
EA 3  4  ? anti-parallel 
FA 1  2  ? anti-parallel 
FA 2  3  ? anti-parallel 
FA 3  4  ? anti-parallel 
FB 1  2  ? anti-parallel 
FB 2  3  ? parallel      
FB 3  4  ? anti-parallel 
FC 1  2  ? anti-parallel 
GA 1  2  ? anti-parallel 
GA 2  3  ? anti-parallel 
GA 3  4  ? anti-parallel 
GB 1  2  ? anti-parallel 
GB 2  3  ? anti-parallel 
GB 3  4  ? anti-parallel 
HA 1  2  ? anti-parallel 
HA 2  3  ? parallel      
HA 3  4  ? anti-parallel 
HA 4  5  ? anti-parallel 
HA 5  6  ? anti-parallel 
HA 6  7  ? anti-parallel 
HB 1  2  ? anti-parallel 
HC 1  2  ? anti-parallel 
HC 2  3  ? anti-parallel 
HC 3  4  ? anti-parallel 
IA 1  2  ? anti-parallel 
IA 2  3  ? anti-parallel 
IA 3  4  ? anti-parallel 
JA 1  2  ? anti-parallel 
JA 2  3  ? anti-parallel 
JA 3  4  ? anti-parallel 
JB 1  2  ? anti-parallel 
JB 2  3  ? anti-parallel 
JB 3  4  ? anti-parallel 
JB 4  5  ? anti-parallel 
JB 5  6  ? parallel      
JB 6  7  ? anti-parallel 
KA 1  2  ? anti-parallel 
KA 2  3  ? anti-parallel 
KB 1  2  ? anti-parallel 
KB 2  3  ? anti-parallel 
KB 3  4  ? anti-parallel 
LA 1  2  ? anti-parallel 
LA 2  3  ? anti-parallel 
LA 3  4  ? anti-parallel 
LB 1  2  ? anti-parallel 
LB 2  3  ? anti-parallel 
LB 3  4  ? parallel      
LB 4  5  ? anti-parallel 
LB 5  6  ? parallel      
LB 6  7  ? anti-parallel 
LB 7  8  ? anti-parallel 
LB 8  9  ? anti-parallel 
LC 1  2  ? anti-parallel 
LC 2  3  ? anti-parallel 
LC 3  4  ? parallel      
LC 4  5  ? anti-parallel 
LC 5  6  ? parallel      
LC 6  7  ? anti-parallel 
LC 7  8  ? anti-parallel 
LD 1  2  ? anti-parallel 
MA 1  2  ? anti-parallel 
MA 2  3  ? anti-parallel 
NA 1  2  ? anti-parallel 
NA 2  3  ? anti-parallel 
NB 1  2  ? anti-parallel 
OA 1  2  ? anti-parallel 
OA 2  3  ? anti-parallel 
OB 1  2  ? anti-parallel 
OB 2  3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  MET A 4   ? THR A 5   ? MET A 4   THR A 5   
AA 2  VAL A 19  ? ALA A 25  ? VAL A 19  ALA A 25  
AA 3  ASP A 70  ? ILE A 75  ? ASP A 70  ILE A 75  
AA 4  PHE A 62  ? SER A 67  ? PHE A 62  SER A 67  
AB 1  LYS A 45  ? ILE A 48  ? LYS A 45  ILE A 48  
AB 2  LEU A 33  ? GLN A 38  ? LEU A 33  GLN A 38  
AB 3  THR A 85  ? GLN A 90  ? THR A 85  GLN A 90  
AB 4  THR A 102 ? LYS A 103 ? THR A 102 LYS A 103 
BA 1  MET B 4   ? SER B 7   ? MET B 4   SER B 7   
BA 2  VAL B 19  ? ALA B 25  ? VAL B 19  ALA B 25  
BA 3  ASP B 70  ? ILE B 75  ? ASP B 70  ILE B 75  
BA 4  PHE B 62  ? SER B 65  ? PHE B 62  SER B 65  
BB 1  SER B 53  ? LEU B 54  ? SER B 53  LEU B 54  
BB 2  LYS B 45  ? TYR B 49  ? LYS B 45  TYR B 49  
BB 3  LEU B 33  ? GLN B 38  ? LEU B 33  GLN B 38  
BB 4  ALA B 84  ? GLN B 90  ? ALA B 84  GLN B 90  
BB 5  THR B 102 ? GLU B 105 ? THR B 102 GLU B 105 
BB 6  SER B 10  ? SER B 12  ? SER B 10  SER B 12  
BB 7  SER C 10  ? SER C 12  ? SER C 10  SER C 12  
BB 8  THR C 102 ? GLU C 105 ? THR C 102 GLU C 105 
BB 9  ALA C 84  ? GLN C 90  ? ALA C 84  GLN C 90  
BC 1  SER B 53  ? LEU B 54  ? SER B 53  LEU B 54  
BC 2  LYS B 45  ? TYR B 49  ? LYS B 45  TYR B 49  
BC 3  LEU B 33  ? GLN B 38  ? LEU B 33  GLN B 38  
BC 4  ALA B 84  ? GLN B 90  ? ALA B 84  GLN B 90  
BC 5  THR B 97  ? PHE B 98  ? THR B 97  PHE B 98  
CA 1  THR C 5   ? SER C 7   ? THR C 5   SER C 7   
CA 2  VAL C 19  ? ARG C 24  ? VAL C 19  ARG C 24  
CA 3  PHE C 71  ? ILE C 75  ? PHE C 71  ILE C 75  
CA 4  PHE C 62  ? SER C 65  ? PHE C 62  SER C 65  
DA 1  SER D 53  ? LEU D 54  ? SER D 53  LEU D 54  
DA 2  PRO D 44  ? TYR D 49  ? PRO D 44  TYR D 49  
DA 3  LEU D 33  ? GLN D 38  ? LEU D 33  GLN D 38  
DA 4  ALA D 84  ? GLN D 90  ? ALA D 84  GLN D 90  
DA 5  THR D 102 ? GLU D 105 ? THR D 102 GLU D 105 
DA 6  SER D 10  ? SER D 12  ? SER D 10  SER D 12  
DA 7  SER E 10  ? SER E 12  ? SER E 10  SER E 12  
DA 8  THR E 102 ? GLU E 105 ? THR E 102 GLU E 105 
DA 9  ALA E 84  ? GLN E 90  ? ALA E 84  GLN E 90  
DA 10 LEU E 33  ? GLN E 38  ? LEU E 33  GLN E 38  
DA 11 LYS E 45  ? TYR E 49  ? LYS E 45  TYR E 49  
DA 12 SER E 53  ? LEU E 54  ? SER E 53  LEU E 54  
DB 1  VAL D 19  ? ARG D 24  ? VAL D 19  ARG D 24  
DB 2  ASP D 70  ? ILE D 75  ? ASP D 70  ILE D 75  
DB 3  PHE D 62  ? GLY D 66  ? PHE D 62  GLY D 66  
EA 1  MET E 4   ? SER E 7   ? MET E 4   SER E 7   
EA 2  VAL E 19  ? ALA E 25  ? VAL E 19  ALA E 25  
EA 3  ASP E 70  ? ILE E 75  ? ASP E 70  ILE E 75  
EA 4  PHE E 62  ? SER E 65  ? PHE E 62  SER E 65  
FA 1  MET F 4   ? SER F 7   ? MET F 4   SER F 7   
FA 2  VAL F 19  ? ALA F 25  ? VAL F 19  ALA F 25  
FA 3  ASP F 70  ? ILE F 75  ? ASP F 70  ILE F 75  
FA 4  PHE F 62  ? SER F 63  ? PHE F 62  SER F 63  
FB 1  ALA F 84  ? THR F 85  ? ALA F 84  THR F 85  
FB 2  LYS F 103 ? GLU F 105 ? LYS F 103 GLU F 105 
FB 3  SER F 10  ? SER F 12  ? SER F 10  SER F 12  
FB 4  SER G 10  ? SER G 12  ? SER G 10  SER G 12  
FC 1  LEU F 33  ? TRP F 35  ? LEU F 33  TRP F 35  
FC 2  CYS F 88  ? GLN F 90  ? CYS F 88  GLN F 90  
GA 1  THR G 5   ? SER G 7   ? THR G 5   SER G 7   
GA 2  VAL G 19  ? ARG G 24  ? VAL G 19  ARG G 24  
GA 3  PHE G 71  ? ILE G 75  ? PHE G 71  ILE G 75  
GA 4  PHE G 62  ? GLY G 66  ? PHE G 62  GLY G 66  
GB 1  LYS G 45  ? LEU G 46  ? LYS G 45  LEU G 46  
GB 2  LEU G 33  ? GLN G 38  ? LEU G 33  GLN G 38  
GB 3  ALA G 84  ? GLN G 90  ? ALA G 84  GLN G 90  
GB 4  THR G 102 ? VAL G 104 ? THR G 102 VAL G 104 
HA 1  LEU H 11  ? SER H 12  ? LEU H 11  SER H 12  
HA 2  SER I 10  ? SER I 12  ? SER I 10  SER I 12  
HA 3  THR I 102 ? GLU I 105 ? THR I 102 GLU I 105 
HA 4  ALA I 84  ? GLN I 90  ? ALA I 84  GLN I 90  
HA 5  LEU I 33  ? GLN I 38  ? LEU I 33  GLN I 38  
HA 6  LYS I 45  ? TYR I 49  ? LYS I 45  TYR I 49  
HA 7  SER I 53  ? LEU I 54  ? SER I 53  LEU I 54  
HB 1  ILE H 21  ? CYS H 23  ? ILE H 21  CYS H 23  
HB 2  PHE H 71  ? LEU H 73  ? PHE H 71  LEU H 73  
HC 1  SER H 53  ? LEU H 54  ? SER H 53  LEU H 54  
HC 2  LYS H 45  ? TYR H 49  ? LYS H 45  TYR H 49  
HC 3  TRP H 35  ? GLN H 38  ? TRP H 35  GLN H 38  
HC 4  THR H 85  ? TYR H 86  ? THR H 85  TYR H 86  
IA 1  MET I 4   ? SER I 7   ? MET I 4   SER I 7   
IA 2  VAL I 19  ? ALA I 25  ? VAL I 19  ALA I 25  
IA 3  ASP I 70  ? ILE I 75  ? ASP I 70  ILE I 75  
IA 4  PHE I 62  ? SER I 63  ? PHE I 62  SER I 63  
JA 1  MET J 4   ? SER J 7   ? MET J 4   SER J 7   
JA 2  VAL J 19  ? ALA J 25  ? VAL J 19  ALA J 25  
JA 3  ASP J 70  ? ILE J 75  ? ASP J 70  ILE J 75  
JA 4  PHE J 62  ? SER J 63  ? PHE J 62  SER J 63  
JB 1  SER J 53  ? LEU J 54  ? SER J 53  LEU J 54  
JB 2  LYS J 45  ? TYR J 49  ? LYS J 45  TYR J 49  
JB 3  LEU J 33  ? GLN J 38  ? LEU J 33  GLN J 38  
JB 4  ALA J 84  ? GLN J 90  ? ALA J 84  GLN J 90  
JB 5  THR J 102 ? GLU J 105 ? THR J 102 GLU J 105 
JB 6  SER J 10  ? SER J 12  ? SER J 10  SER J 12  
JB 7  SER K 10  ? SER K 12  ? SER K 10  SER K 12  
KA 1  VAL K 19  ? ARG K 24  ? VAL K 19  ARG K 24  
KA 2  ASP K 70  ? ILE K 75  ? ASP K 70  ILE K 75  
KA 3  SER K 63  ? GLY K 66  ? SER K 63  GLY K 66  
KB 1  LYS K 45  ? ILE K 48  ? LYS K 45  ILE K 48  
KB 2  TRP K 35  ? GLN K 38  ? TRP K 35  GLN K 38  
KB 3  ALA K 84  ? TYR K 87  ? ALA K 84  TYR K 87  
KB 4  LYS K 103 ? VAL K 104 ? LYS K 103 VAL K 104 
LA 1  MET L 4   ? SER L 7   ? MET L 4   SER L 7   
LA 2  VAL L 19  ? ALA L 25  ? VAL L 19  ALA L 25  
LA 3  ASP L 70  ? ILE L 75  ? ASP L 70  ILE L 75  
LA 4  PHE L 62  ? SER L 65  ? PHE L 62  SER L 65  
LB 1  LEU L 33  ? GLN L 38  ? LEU L 33  GLN L 38  
LB 2  ALA L 84  ? GLN L 90  ? ALA L 84  GLN L 90  
LB 3  THR L 102 ? GLU L 105 ? THR L 102 GLU L 105 
LB 4  SER L 10  ? SER L 12  ? SER L 10  SER L 12  
LB 5  SER M 10  ? SER M 12  ? SER M 10  SER M 12  
LB 6  THR M 102 ? GLU M 105 ? THR M 102 GLU M 105 
LB 7  ALA M 84  ? GLN M 90  ? ALA M 84  GLN M 90  
LB 8  LEU M 33  ? GLN M 38  ? LEU M 33  GLN M 38  
LB 9  LYS M 45  ? TYR M 49  ? LYS M 45  TYR M 49  
LC 1  LEU L 33  ? GLN L 38  ? LEU L 33  GLN L 38  
LC 2  ALA L 84  ? GLN L 90  ? ALA L 84  GLN L 90  
LC 3  THR L 102 ? GLU L 105 ? THR L 102 GLU L 105 
LC 4  SER L 10  ? SER L 12  ? SER L 10  SER L 12  
LC 5  SER M 10  ? SER M 12  ? SER M 10  SER M 12  
LC 6  THR M 102 ? GLU M 105 ? THR M 102 GLU M 105 
LC 7  ALA M 84  ? GLN M 90  ? ALA M 84  GLN M 90  
LC 8  THR M 97  ? PHE M 98  ? THR M 97  PHE M 98  
LD 1  ILE L 48  ? TYR L 49  ? ILE L 48  TYR L 49  
LD 2  SER L 53  ? LEU L 54  ? SER L 53  LEU L 54  
MA 1  MET M 4   ? SER M 7   ? MET M 4   SER M 7   
MA 2  VAL M 19  ? ALA M 25  ? VAL M 19  ALA M 25  
MA 3  LEU M 73  ? ILE M 75  ? LEU M 73  ILE M 75  
NA 1  THR N 5   ? SER N 7   ? THR N 5   SER N 7   
NA 2  ILE N 21  ? ARG N 24  ? ILE N 21  ARG N 24  
NA 3  ASP N 70  ? LEU N 73  ? ASP N 70  LEU N 73  
NB 1  ASN N 34  ? GLN N 37  ? ASN N 34  GLN N 37  
NB 2  LYS N 45  ? TYR N 49  ? LYS N 45  TYR N 49  
OA 1  THR O 20  ? ILE O 21  ? THR O 20  ILE O 21  
OA 2  PHE O 71  ? THR O 74  ? PHE O 71  THR O 74  
OA 3  SER O 65  ? GLY O 66  ? SER O 65  GLY O 66  
OB 1  LYS O 45  ? TYR O 49  ? LYS O 45  TYR O 49  
OB 2  LEU O 33  ? GLN O 38  ? LEU O 33  GLN O 38  
OB 3  THR O 85  ? GLN O 90  ? THR O 85  GLN O 90  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 5   ? N THR A 5   O ARG A 24  ? O ARG A 24  
AA 2  3  N CYS A 23  ? N CYS A 23  O PHE A 71  ? O PHE A 71  
AA 3  4  N THR A 74  ? N THR A 74  O SER A 63  ? O SER A 63  
AB 1  2  N LEU A 47  ? N LEU A 47  O TRP A 35  ? O TRP A 35  
AB 2  3  N GLN A 38  ? N GLN A 38  O THR A 85  ? O THR A 85  
AB 3  4  N TYR A 86  ? N TYR A 86  O THR A 102 ? O THR A 102 
BA 1  2  N SER B 7   ? N SER B 7   O THR B 22  ? O THR B 22  
BA 2  3  N CYS B 23  ? N CYS B 23  O PHE B 71  ? O PHE B 71  
BA 3  4  N THR B 74  ? N THR B 74  O SER B 63  ? O SER B 63  
BB 1  2  N SER B 53  ? N SER B 53  O TYR B 49  ? O TYR B 49  
BB 2  3  N LEU B 47  ? N LEU B 47  O TRP B 35  ? O TRP B 35  
BB 3  4  N GLN B 38  ? N GLN B 38  O THR B 85  ? O THR B 85  
BB 4  5  N TYR B 86  ? N TYR B 86  O THR B 102 ? O THR B 102 
BB 5  6  N GLU B 105 ? N GLU B 105 O LEU B 11  ? O LEU B 11  
BB 6  7  N SER B 12  ? N SER B 12  O SER C 10  ? O SER C 10  
BB 7  8  N LEU C 11  ? N LEU C 11  O LYS C 103 ? O LYS C 103 
BB 8  9  N VAL C 104 ? N VAL C 104 O ALA C 84  ? O ALA C 84  
BC 1  2  N SER B 53  ? N SER B 53  O TYR B 49  ? O TYR B 49  
BC 2  3  N LEU B 47  ? N LEU B 47  O TRP B 35  ? O TRP B 35  
BC 3  4  N GLN B 38  ? N GLN B 38  O THR B 85  ? O THR B 85  
BC 4  5  N GLN B 90  ? N GLN B 90  O THR B 97  ? O THR B 97  
CA 1  2  N SER C 7   ? N SER C 7   O THR C 22  ? O THR C 22  
CA 2  3  N CYS C 23  ? N CYS C 23  O PHE C 71  ? O PHE C 71  
CA 3  4  N THR C 74  ? N THR C 74  O SER C 63  ? O SER C 63  
DA 1  2  N SER D 53  ? N SER D 53  O TYR D 49  ? O TYR D 49  
DA 2  3  N LEU D 47  ? N LEU D 47  O TRP D 35  ? O TRP D 35  
DA 3  4  N GLN D 38  ? N GLN D 38  O THR D 85  ? O THR D 85  
DA 4  5  N TYR D 86  ? N TYR D 86  O THR D 102 ? O THR D 102 
DA 5  6  N GLU D 105 ? N GLU D 105 O LEU D 11  ? O LEU D 11  
DA 6  7  N SER D 12  ? N SER D 12  O SER E 10  ? O SER E 10  
DA 7  8  N LEU E 11  ? N LEU E 11  O LYS E 103 ? O LYS E 103 
DA 8  9  N VAL E 104 ? N VAL E 104 O ALA E 84  ? O ALA E 84  
DA 9  10 N GLN E 89  ? N GLN E 89  O ASN E 34  ? O ASN E 34  
DA 10 11 N GLN E 37  ? N GLN E 37  O LYS E 45  ? O LYS E 45  
DA 11 12 N TYR E 49  ? N TYR E 49  O SER E 53  ? O SER E 53  
DB 1  2  N CYS D 23  ? N CYS D 23  O PHE D 71  ? O PHE D 71  
DB 2  3  N THR D 74  ? N THR D 74  O SER D 63  ? O SER D 63  
EA 1  2  N SER E 7   ? N SER E 7   O THR E 22  ? O THR E 22  
EA 2  3  N CYS E 23  ? N CYS E 23  O PHE E 71  ? O PHE E 71  
EA 3  4  N THR E 74  ? N THR E 74  O SER E 63  ? O SER E 63  
FA 1  2  N SER F 7   ? N SER F 7   O THR F 22  ? O THR F 22  
FA 2  3  N CYS F 23  ? N CYS F 23  O PHE F 71  ? O PHE F 71  
FA 3  4  N THR F 74  ? N THR F 74  O SER F 63  ? O SER F 63  
FB 1  2  N ALA F 84  ? N ALA F 84  O VAL F 104 ? O VAL F 104 
FB 2  3  N GLU F 105 ? N GLU F 105 O LEU F 11  ? O LEU F 11  
FB 3  4  N SER F 12  ? N SER F 12  O SER G 10  ? O SER G 10  
FC 1  2  N ASN F 34  ? N ASN F 34  O GLN F 89  ? O GLN F 89  
GA 1  2  N SER G 7   ? N SER G 7   O THR G 22  ? O THR G 22  
GA 2  3  N CYS G 23  ? N CYS G 23  O PHE G 71  ? O PHE G 71  
GA 3  4  N THR G 74  ? N THR G 74  O SER G 63  ? O SER G 63  
GB 1  2  N LYS G 45  ? N LYS G 45  O GLN G 37  ? O GLN G 37  
GB 2  3  N GLN G 38  ? N GLN G 38  O THR G 85  ? O THR G 85  
GB 3  4  O TYR G 86  ? O TYR G 86  N THR G 102 ? N THR G 102 
HA 1  2  N SER H 12  ? N SER H 12  O SER I 10  ? O SER I 10  
HA 2  3  N LEU I 11  ? N LEU I 11  O LYS I 103 ? O LYS I 103 
HA 3  4  N VAL I 104 ? N VAL I 104 O ALA I 84  ? O ALA I 84  
HA 4  5  N GLN I 89  ? N GLN I 89  O ASN I 34  ? O ASN I 34  
HA 5  6  N GLN I 37  ? N GLN I 37  O LYS I 45  ? O LYS I 45  
HA 6  7  N TYR I 49  ? N TYR I 49  O SER I 53  ? O SER I 53  
HB 1  2  N CYS H 23  ? N CYS H 23  O PHE H 71  ? O PHE H 71  
HC 1  2  N SER H 53  ? N SER H 53  O TYR H 49  ? O TYR H 49  
HC 2  3  N LEU H 47  ? N LEU H 47  O TRP H 35  ? O TRP H 35  
HC 3  4  N GLN H 38  ? N GLN H 38  O THR H 85  ? O THR H 85  
IA 1  2  N SER I 7   ? N SER I 7   O THR I 22  ? O THR I 22  
IA 2  3  N CYS I 23  ? N CYS I 23  O PHE I 71  ? O PHE I 71  
IA 3  4  N THR I 74  ? N THR I 74  O SER I 63  ? O SER I 63  
JA 1  2  N SER J 7   ? N SER J 7   O THR J 22  ? O THR J 22  
JA 2  3  N CYS J 23  ? N CYS J 23  O PHE J 71  ? O PHE J 71  
JA 3  4  N THR J 74  ? N THR J 74  O SER J 63  ? O SER J 63  
JB 1  2  N SER J 53  ? N SER J 53  O TYR J 49  ? O TYR J 49  
JB 2  3  N LEU J 47  ? N LEU J 47  O TRP J 35  ? O TRP J 35  
JB 3  4  N GLN J 38  ? N GLN J 38  O THR J 85  ? O THR J 85  
JB 4  5  N TYR J 86  ? N TYR J 86  O THR J 102 ? O THR J 102 
JB 5  6  N GLU J 105 ? N GLU J 105 O LEU J 11  ? O LEU J 11  
JB 6  7  N SER J 12  ? N SER J 12  O SER K 10  ? O SER K 10  
KA 1  2  N CYS K 23  ? N CYS K 23  O PHE K 71  ? O PHE K 71  
KA 2  3  N THR K 74  ? N THR K 74  O SER K 63  ? O SER K 63  
KB 1  2  N LEU K 47  ? N LEU K 47  O TRP K 35  ? O TRP K 35  
KB 2  3  N GLN K 38  ? N GLN K 38  O THR K 85  ? O THR K 85  
KB 3  4  N ALA K 84  ? N ALA K 84  O VAL K 104 ? O VAL K 104 
LA 1  2  N SER L 7   ? N SER L 7   O THR L 22  ? O THR L 22  
LA 2  3  N CYS L 23  ? N CYS L 23  O PHE L 71  ? O PHE L 71  
LA 3  4  N THR L 74  ? N THR L 74  O SER L 63  ? O SER L 63  
LB 1  2  N GLN L 38  ? N GLN L 38  O THR L 85  ? O THR L 85  
LB 2  3  N TYR L 86  ? N TYR L 86  O THR L 102 ? O THR L 102 
LB 3  4  N GLU L 105 ? N GLU L 105 O LEU L 11  ? O LEU L 11  
LB 4  5  N SER L 12  ? N SER L 12  O SER M 10  ? O SER M 10  
LB 5  6  O LEU M 11  ? O LEU M 11  N GLU M 105 ? N GLU M 105 
LB 6  7  N VAL M 104 ? N VAL M 104 O ALA M 84  ? O ALA M 84  
LB 7  8  N GLN M 89  ? N GLN M 89  O ASN M 34  ? O ASN M 34  
LB 8  9  N GLN M 37  ? N GLN M 37  O LYS M 45  ? O LYS M 45  
LC 1  2  N GLN L 38  ? N GLN L 38  O THR L 85  ? O THR L 85  
LC 2  3  N TYR L 86  ? N TYR L 86  O THR L 102 ? O THR L 102 
LC 3  4  N GLU L 105 ? N GLU L 105 O LEU L 11  ? O LEU L 11  
LC 4  5  N SER L 12  ? N SER L 12  O SER M 10  ? O SER M 10  
LC 5  6  O LEU M 11  ? O LEU M 11  N GLU M 105 ? N GLU M 105 
LC 6  7  N VAL M 104 ? N VAL M 104 O ALA M 84  ? O ALA M 84  
LC 7  8  N GLN M 90  ? N GLN M 90  O THR M 97  ? O THR M 97  
LD 1  2  N TYR L 49  ? N TYR L 49  O SER L 53  ? O SER L 53  
MA 1  2  N SER M 7   ? N SER M 7   O THR M 22  ? O THR M 22  
MA 2  3  N ILE M 21  ? N ILE M 21  O LEU M 73  ? O LEU M 73  
NA 1  2  N SER N 7   ? N SER N 7   O THR N 22  ? O THR N 22  
NA 2  3  N CYS N 23  ? N CYS N 23  O PHE N 71  ? O PHE N 71  
NB 1  2  N GLN N 37  ? N GLN N 37  O LYS N 45  ? O LYS N 45  
OA 1  2  N ILE O 21  ? N ILE O 21  O LEU O 73  ? O LEU O 73  
OA 2  3  N THR O 72  ? N THR O 72  O SER O 65  ? O SER O 65  
OB 1  2  N LEU O 47  ? N LEU O 47  O TRP O 35  ? O TRP O 35  
OB 2  3  N GLN O 38  ? N GLN O 38  O THR O 85  ? O THR O 85  
# 
_database_PDB_matrix.entry_id          2BX5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2BX5 
_atom_sites.fract_transf_matrix[1][1]   0.005210 
_atom_sites.fract_transf_matrix[1][2]   0.003008 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006016 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005065 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ASP A  1 1   ? 93.305  117.622 173.201 1.00 47.58  ? 1    ASP A N   1 
ATOM   2     C CA  . ASP A  1 1   ? 93.352  119.126 173.243 1.00 47.44  ? 1    ASP A CA  1 
ATOM   3     C C   . ASP A  1 1   ? 94.765  119.666 172.920 1.00 48.08  ? 1    ASP A C   1 
ATOM   4     O O   . ASP A  1 1   ? 95.444  120.203 173.801 1.00 47.86  ? 1    ASP A O   1 
ATOM   5     C CB  . ASP A  1 1   ? 92.833  119.646 174.604 1.00 46.74  ? 1    ASP A CB  1 
ATOM   6     C CG  . ASP A  1 1   ? 91.319  119.905 174.600 1.00 51.11  ? 1    ASP A CG  1 
ATOM   7     O OD1 . ASP A  1 1   ? 90.564  119.162 173.931 1.00 55.83  ? 1    ASP A OD1 1 
ATOM   8     O OD2 . ASP A  1 1   ? 90.885  120.862 175.277 1.00 43.73  ? 1    ASP A OD2 1 
ATOM   9     N N   . ILE A  1 2   ? 95.194  119.526 171.654 1.00 46.54  ? 2    ILE A N   1 
ATOM   10    C CA  . ILE A  1 2   ? 96.582  119.870 171.241 1.00 46.93  ? 2    ILE A CA  1 
ATOM   11    C C   . ILE A  1 2   ? 96.843  121.361 171.046 1.00 47.47  ? 2    ILE A C   1 
ATOM   12    O O   . ILE A  1 2   ? 96.026  122.068 170.438 1.00 48.93  ? 2    ILE A O   1 
ATOM   13    C CB  . ILE A  1 2   ? 97.035  119.112 169.952 1.00 47.31  ? 2    ILE A CB  1 
ATOM   14    C CG1 . ILE A  1 2   ? 97.275  117.629 170.268 1.00 46.54  ? 2    ILE A CG1 1 
ATOM   15    C CG2 . ILE A  1 2   ? 98.305  119.749 169.340 1.00 44.04  ? 2    ILE A CG2 1 
ATOM   16    C CD1 . ILE A  1 2   ? 98.031  116.825 169.170 1.00 45.93  ? 2    ILE A CD1 1 
ATOM   17    N N   . GLN A  1 3   ? 97.992  121.832 171.538 1.00 45.97  ? 3    GLN A N   1 
ATOM   18    C CA  . GLN A  1 3   ? 98.246  123.266 171.506 1.00 47.03  ? 3    GLN A CA  1 
ATOM   19    C C   . GLN A  1 3   ? 99.661  123.698 171.122 1.00 45.40  ? 3    GLN A C   1 
ATOM   20    O O   . GLN A  1 3   ? 100.663 123.174 171.620 1.00 44.85  ? 3    GLN A O   1 
ATOM   21    C CB  . GLN A  1 3   ? 97.751  123.931 172.801 1.00 47.06  ? 3    GLN A CB  1 
ATOM   22    C CG  . GLN A  1 3   ? 96.235  123.743 173.008 1.00 47.32  ? 3    GLN A CG  1 
ATOM   23    C CD  . GLN A  1 3   ? 95.653  124.574 174.125 1.00 51.10  ? 3    GLN A CD  1 
ATOM   24    O OE1 . GLN A  1 3   ? 96.036  125.727 174.325 1.00 53.32  ? 3    GLN A OE1 1 
ATOM   25    N NE2 . GLN A  1 3   ? 94.707  123.996 174.856 1.00 56.21  ? 3    GLN A NE2 1 
ATOM   26    N N   . MET A  1 4   ? 99.703  124.678 170.223 1.00 45.52  ? 4    MET A N   1 
ATOM   27    C CA  . MET A  1 4   ? 100.940 125.189 169.659 1.00 45.16  ? 4    MET A CA  1 
ATOM   28    C C   . MET A  1 4   ? 101.210 126.624 170.090 1.00 42.63  ? 4    MET A C   1 
ATOM   29    O O   . MET A  1 4   ? 100.520 127.541 169.625 1.00 42.58  ? 4    MET A O   1 
ATOM   30    C CB  . MET A  1 4   ? 100.866 125.193 168.127 1.00 45.15  ? 4    MET A CB  1 
ATOM   31    C CG  . MET A  1 4   ? 100.011 124.115 167.506 1.00 45.44  ? 4    MET A CG  1 
ATOM   32    S SD  . MET A  1 4   ? 101.016 122.685 167.082 1.00 51.96  ? 4    MET A SD  1 
ATOM   33    C CE  . MET A  1 4   ? 99.748  121.612 166.443 1.00 43.97  ? 4    MET A CE  1 
ATOM   34    N N   . THR A  1 5   ? 102.195 126.831 170.980 1.00 41.37  ? 5    THR A N   1 
ATOM   35    C CA  . THR A  1 5   ? 102.871 128.127 170.971 1.00 40.71  ? 5    THR A CA  1 
ATOM   36    C C   . THR A  1 5   ? 103.699 128.162 169.676 1.00 38.89  ? 5    THR A C   1 
ATOM   37    O O   . THR A  1 5   ? 104.364 127.170 169.343 1.00 38.80  ? 5    THR A O   1 
ATOM   38    C CB  . THR A  1 5   ? 103.837 128.298 172.180 1.00 40.54  ? 5    THR A CB  1 
ATOM   39    O OG1 . THR A  1 5   ? 103.083 128.350 173.411 1.00 42.33  ? 5    THR A OG1 1 
ATOM   40    C CG2 . THR A  1 5   ? 104.675 129.588 172.058 1.00 41.42  ? 5    THR A CG2 1 
ATOM   41    N N   . GLN A  1 6   ? 103.632 129.280 168.938 1.00 36.62  ? 6    GLN A N   1 
ATOM   42    C CA  . GLN A  1 6   ? 104.661 129.597 167.920 1.00 36.94  ? 6    GLN A CA  1 
ATOM   43    C C   . GLN A  1 6   ? 105.251 131.006 168.120 1.00 34.66  ? 6    GLN A C   1 
ATOM   44    O O   . GLN A  1 6   ? 104.507 132.018 168.122 1.00 32.77  ? 6    GLN A O   1 
ATOM   45    C CB  . GLN A  1 6   ? 104.137 129.411 166.475 1.00 36.91  ? 6    GLN A CB  1 
ATOM   46    C CG  . GLN A  1 6   ? 103.415 130.622 165.890 1.00 37.85  ? 6    GLN A CG  1 
ATOM   47    C CD  . GLN A  1 6   ? 103.024 130.427 164.437 1.00 37.76  ? 6    GLN A CD  1 
ATOM   48    O OE1 . GLN A  1 6   ? 101.845 130.228 164.126 1.00 34.68  ? 6    GLN A OE1 1 
ATOM   49    N NE2 . GLN A  1 6   ? 104.005 130.477 163.536 1.00 34.96  ? 6    GLN A NE2 1 
ATOM   50    N N   . SER A  1 7   ? 106.580 131.055 168.296 1.00 33.15  ? 7    SER A N   1 
ATOM   51    C CA  . SER A  1 7   ? 107.328 132.308 168.424 1.00 30.41  ? 7    SER A CA  1 
ATOM   52    C C   . SER A  1 7   ? 108.328 132.445 167.259 1.00 29.47  ? 7    SER A C   1 
ATOM   53    O O   . SER A  1 7   ? 108.641 131.436 166.600 1.00 26.03  ? 7    SER A O   1 
ATOM   54    C CB  . SER A  1 7   ? 108.082 132.318 169.761 1.00 31.14  ? 7    SER A CB  1 
ATOM   55    O OG  . SER A  1 7   ? 109.135 131.351 169.761 1.00 32.13  ? 7    SER A OG  1 
ATOM   56    N N   . PRO A  1 8   ? 108.815 133.678 166.965 1.00 27.12  ? 8    PRO A N   1 
ATOM   57    C CA  . PRO A  1 8   ? 108.388 134.953 167.535 1.00 25.72  ? 8    PRO A CA  1 
ATOM   58    C C   . PRO A  1 8   ? 107.067 135.321 166.864 1.00 26.78  ? 8    PRO A C   1 
ATOM   59    O O   . PRO A  1 8   ? 106.628 134.597 165.975 1.00 24.76  ? 8    PRO A O   1 
ATOM   60    C CB  . PRO A  1 8   ? 109.521 135.910 167.170 1.00 22.75  ? 8    PRO A CB  1 
ATOM   61    C CG  . PRO A  1 8   ? 110.198 135.304 165.997 1.00 23.51  ? 8    PRO A CG  1 
ATOM   62    C CD  . PRO A  1 8   ? 109.862 133.853 165.932 1.00 26.95  ? 8    PRO A CD  1 
ATOM   63    N N   . SER A  1 9   ? 106.416 136.400 167.292 1.00 28.25  ? 9    SER A N   1 
ATOM   64    C CA  . SER A  1 9   ? 104.993 136.558 166.946 1.00 29.57  ? 9    SER A CA  1 
ATOM   65    C C   . SER A  1 9   ? 104.718 137.521 165.795 1.00 31.93  ? 9    SER A C   1 
ATOM   66    O O   . SER A  1 9   ? 103.631 137.524 165.211 1.00 30.40  ? 9    SER A O   1 
ATOM   67    C CB  . SER A  1 9   ? 104.208 136.993 168.189 1.00 28.45  ? 9    SER A CB  1 
ATOM   68    O OG  . SER A  1 9   ? 104.698 138.237 168.683 1.00 25.91  ? 9    SER A OG  1 
ATOM   69    N N   . SER A  1 10  ? 105.730 138.325 165.481 1.00 35.18  ? 10   SER A N   1 
ATOM   70    C CA  . SER A  1 10  ? 105.571 139.507 164.648 1.00 37.93  ? 10   SER A CA  1 
ATOM   71    C C   . SER A  1 10  ? 106.969 140.072 164.429 1.00 38.13  ? 10   SER A C   1 
ATOM   72    O O   . SER A  1 10  ? 107.621 140.527 165.376 1.00 36.22  ? 10   SER A O   1 
ATOM   73    C CB  . SER A  1 10  ? 104.688 140.551 165.364 1.00 37.37  ? 10   SER A CB  1 
ATOM   74    O OG  . SER A  1 10  ? 105.556 141.432 166.229 1.00 41.72  ? 10   SER A OG  1 
ATOM   75    N N   . LEU A  1 11  ? 107.424 140.035 163.178 1.00 40.61  ? 11   LEU A N   1 
ATOM   76    C CA  . LEU A  1 11  ? 108.825 140.303 162.824 1.00 42.26  ? 11   LEU A CA  1 
ATOM   77    C C   . LEU A  1 11  ? 109.029 141.513 161.901 1.00 41.76  ? 11   LEU A C   1 
ATOM   78    O O   . LEU A  1 11  ? 108.057 142.129 161.441 1.00 43.03  ? 11   LEU A O   1 
ATOM   79    C CB  . LEU A  1 11  ? 109.414 139.055 162.147 1.00 42.45  ? 11   LEU A CB  1 
ATOM   80    C CG  . LEU A  1 11  ? 110.310 138.140 162.985 1.00 43.89  ? 11   LEU A CG  1 
ATOM   81    C CD1 . LEU A  1 11  ? 109.737 137.906 164.360 1.00 40.71  ? 11   LEU A CD1 1 
ATOM   82    C CD2 . LEU A  1 11  ? 110.568 136.814 162.276 1.00 41.96  ? 11   LEU A CD2 1 
ATOM   83    N N   . SER A  1 12  ? 110.305 141.856 161.668 1.00 41.34  ? 12   SER A N   1 
ATOM   84    C CA  . SER A  1 12  ? 110.731 142.635 160.474 1.00 41.26  ? 12   SER A CA  1 
ATOM   85    C C   . SER A  1 12  ? 112.246 142.528 160.166 1.00 41.89  ? 12   SER A C   1 
ATOM   86    O O   . SER A  1 12  ? 113.073 142.549 161.082 1.00 40.01  ? 12   SER A O   1 
ATOM   87    C CB  . SER A  1 12  ? 110.259 144.114 160.527 1.00 42.20  ? 12   SER A CB  1 
ATOM   88    O OG  . SER A  1 12  ? 111.089 144.936 161.377 1.00 43.99  ? 12   SER A OG  1 
ATOM   89    N N   . ALA A  1 13  ? 112.588 142.410 158.874 1.00 43.34  ? 13   ALA A N   1 
ATOM   90    C CA  . ALA A  1 13  ? 113.987 142.218 158.404 1.00 44.05  ? 13   ALA A CA  1 
ATOM   91    C C   . ALA A  1 13  ? 114.293 142.823 157.011 1.00 45.82  ? 13   ALA A C   1 
ATOM   92    O O   . ALA A  1 13  ? 113.527 143.653 156.513 1.00 47.29  ? 13   ALA A O   1 
ATOM   93    C CB  . ALA A  1 13  ? 114.366 140.734 158.448 1.00 43.83  ? 13   ALA A CB  1 
ATOM   94    N N   . SER A  1 14  ? 115.406 142.410 156.397 1.00 45.05  ? 14   SER A N   1 
ATOM   95    C CA  . SER A  1 14  ? 115.841 142.991 155.124 1.00 45.55  ? 14   SER A CA  1 
ATOM   96    C C   . SER A  1 14  ? 116.012 141.957 154.018 1.00 46.22  ? 14   SER A C   1 
ATOM   97    O O   . SER A  1 14  ? 116.500 140.847 154.253 1.00 45.33  ? 14   SER A O   1 
ATOM   98    C CB  . SER A  1 14  ? 117.137 143.789 155.306 1.00 45.17  ? 14   SER A CB  1 
ATOM   99    O OG  . SER A  1 14  ? 116.884 145.035 155.941 1.00 46.73  ? 14   SER A OG  1 
ATOM   100   N N   . VAL A  1 15  ? 115.590 142.348 152.812 1.00 45.52  ? 15   VAL A N   1 
ATOM   101   C CA  . VAL A  1 15  ? 115.700 141.547 151.585 1.00 45.44  ? 15   VAL A CA  1 
ATOM   102   C C   . VAL A  1 15  ? 116.940 140.656 151.571 1.00 45.79  ? 15   VAL A C   1 
ATOM   103   O O   . VAL A  1 15  ? 118.073 141.135 151.722 1.00 46.83  ? 15   VAL A O   1 
ATOM   104   C CB  . VAL A  1 15  ? 115.647 142.462 150.315 1.00 44.70  ? 15   VAL A CB  1 
ATOM   105   C CG1 . VAL A  1 15  ? 116.282 141.796 149.088 1.00 43.01  ? 15   VAL A CG1 1 
ATOM   106   C CG2 . VAL A  1 15  ? 114.216 142.891 150.020 1.00 45.13  ? 15   VAL A CG2 1 
ATOM   107   N N   . GLY A  1 16  ? 116.704 139.357 151.408 1.00 44.90  ? 16   GLY A N   1 
ATOM   108   C CA  . GLY A  1 16  ? 117.771 138.366 151.351 1.00 46.02  ? 16   GLY A CA  1 
ATOM   109   C C   . GLY A  1 16  ? 118.317 137.975 152.710 1.00 46.18  ? 16   GLY A C   1 
ATOM   110   O O   . GLY A  1 16  ? 119.403 137.393 152.790 1.00 46.49  ? 16   GLY A O   1 
ATOM   111   N N   . ASP A  1 17  ? 117.592 138.284 153.781 1.00 44.94  ? 17   ASP A N   1 
ATOM   112   C CA  . ASP A  1 17  ? 118.131 137.976 155.095 1.00 44.67  ? 17   ASP A CA  1 
ATOM   113   C C   . ASP A  1 17  ? 117.439 136.825 155.795 1.00 43.80  ? 17   ASP A C   1 
ATOM   114   O O   . ASP A  1 17  ? 116.222 136.632 155.667 1.00 45.03  ? 17   ASP A O   1 
ATOM   115   C CB  . ASP A  1 17  ? 118.241 139.227 155.977 1.00 44.07  ? 17   ASP A CB  1 
ATOM   116   C CG  . ASP A  1 17  ? 119.284 140.222 155.458 1.00 46.61  ? 17   ASP A CG  1 
ATOM   117   O OD1 . ASP A  1 17  ? 119.920 139.959 154.407 1.00 39.39  ? 17   ASP A OD1 1 
ATOM   118   O OD2 . ASP A  1 17  ? 119.469 141.278 156.101 1.00 41.16  ? 17   ASP A OD2 1 
ATOM   119   N N   . ARG A  1 18  ? 118.244 136.047 156.508 1.00 42.71  ? 18   ARG A N   1 
ATOM   120   C CA  . ARG A  1 18  ? 117.756 134.880 157.202 1.00 41.78  ? 18   ARG A CA  1 
ATOM   121   C C   . ARG A  1 18  ? 116.686 135.276 158.213 1.00 42.18  ? 18   ARG A C   1 
ATOM   122   O O   . ARG A  1 18  ? 116.870 136.218 158.989 1.00 43.04  ? 18   ARG A O   1 
ATOM   123   C CB  . ARG A  1 18  ? 118.914 134.184 157.897 1.00 39.80  ? 18   ARG A CB  1 
ATOM   124   C CG  . ARG A  1 18  ? 118.731 132.701 157.994 1.00 34.86  ? 18   ARG A CG  1 
ATOM   125   C CD  . ARG A  1 18  ? 120.051 132.033 157.753 1.00 33.21  ? 18   ARG A CD  1 
ATOM   126   N NE  . ARG A  1 18  ? 119.983 130.632 158.128 1.00 32.52  ? 18   ARG A NE  1 
ATOM   127   C CZ  . ARG A  1 18  ? 121.047 129.865 158.348 1.00 16.62  ? 18   ARG A CZ  1 
ATOM   128   N NH1 . ARG A  1 18  ? 122.278 130.353 158.222 1.00 20.00  ? 18   ARG A NH1 1 
ATOM   129   N NH2 . ARG A  1 18  ? 120.878 128.596 158.691 1.00 11.83  ? 18   ARG A NH2 1 
ATOM   130   N N   . VAL A  1 19  ? 115.562 134.569 158.177 1.00 42.03  ? 19   VAL A N   1 
ATOM   131   C CA  . VAL A  1 19  ? 114.473 134.789 159.131 1.00 42.54  ? 19   VAL A CA  1 
ATOM   132   C C   . VAL A  1 19  ? 114.000 133.458 159.703 1.00 43.13  ? 19   VAL A C   1 
ATOM   133   O O   . VAL A  1 19  ? 113.748 132.511 158.950 1.00 44.43  ? 19   VAL A O   1 
ATOM   134   C CB  . VAL A  1 19  ? 113.282 135.576 158.509 1.00 41.95  ? 19   VAL A CB  1 
ATOM   135   C CG1 . VAL A  1 19  ? 113.548 137.075 158.556 1.00 41.59  ? 19   VAL A CG1 1 
ATOM   136   C CG2 . VAL A  1 19  ? 112.988 135.125 157.086 1.00 41.26  ? 19   VAL A CG2 1 
ATOM   137   N N   . THR A  1 20  ? 113.886 133.374 161.026 1.00 43.84  ? 20   THR A N   1 
ATOM   138   C CA  . THR A  1 20  ? 113.674 132.070 161.650 1.00 44.06  ? 20   THR A CA  1 
ATOM   139   C C   . THR A  1 20  ? 112.524 132.010 162.665 1.00 44.47  ? 20   THR A C   1 
ATOM   140   O O   . THR A  1 20  ? 112.349 132.913 163.488 1.00 46.54  ? 20   THR A O   1 
ATOM   141   C CB  . THR A  1 20  ? 114.994 131.504 162.227 1.00 43.80  ? 20   THR A CB  1 
ATOM   142   O OG1 . THR A  1 20  ? 116.043 131.674 161.262 1.00 41.84  ? 20   THR A OG1 1 
ATOM   143   C CG2 . THR A  1 20  ? 114.869 130.016 162.548 1.00 45.01  ? 20   THR A CG2 1 
ATOM   144   N N   . ILE A  1 21  ? 111.758 130.917 162.580 1.00 43.86  ? 21   ILE A N   1 
ATOM   145   C CA  . ILE A  1 21  ? 110.471 130.735 163.272 1.00 42.74  ? 21   ILE A CA  1 
ATOM   146   C C   . ILE A  1 21  ? 110.372 129.399 164.036 1.00 43.40  ? 21   ILE A C   1 
ATOM   147   O O   . ILE A  1 21  ? 110.815 128.355 163.538 1.00 43.81  ? 21   ILE A O   1 
ATOM   148   C CB  . ILE A  1 21  ? 109.289 130.824 162.259 1.00 41.62  ? 21   ILE A CB  1 
ATOM   149   C CG1 . ILE A  1 21  ? 108.913 132.279 161.979 1.00 40.09  ? 21   ILE A CG1 1 
ATOM   150   C CG2 . ILE A  1 21  ? 108.050 130.128 162.785 1.00 40.59  ? 21   ILE A CG2 1 
ATOM   151   C CD1 . ILE A  1 21  ? 109.626 132.869 160.772 1.00 35.99  ? 21   ILE A CD1 1 
ATOM   152   N N   . THR A  1 22  ? 109.781 129.433 165.231 1.00 41.91  ? 22   THR A N   1 
ATOM   153   C CA  . THR A  1 22  ? 109.602 128.223 166.046 1.00 40.31  ? 22   THR A CA  1 
ATOM   154   C C   . THR A  1 22  ? 108.141 127.883 166.368 1.00 40.38  ? 22   THR A C   1 
ATOM   155   O O   . THR A  1 22  ? 107.250 128.720 166.222 1.00 39.94  ? 22   THR A O   1 
ATOM   156   C CB  . THR A  1 22  ? 110.428 128.282 167.363 1.00 41.39  ? 22   THR A CB  1 
ATOM   157   O OG1 . THR A  1 22  ? 110.638 129.653 167.742 1.00 42.86  ? 22   THR A OG1 1 
ATOM   158   C CG2 . THR A  1 22  ? 111.796 127.622 167.143 1.00 41.82  ? 22   THR A CG2 1 
ATOM   159   N N   . CYS A  1 23  ? 107.928 126.634 166.789 1.00 40.37  ? 23   CYS A N   1 
ATOM   160   C CA  . CYS A  1 23  ? 106.640 126.118 167.260 1.00 40.15  ? 23   CYS A CA  1 
ATOM   161   C C   . CYS A  1 23  ? 106.968 124.954 168.204 1.00 40.25  ? 23   CYS A C   1 
ATOM   162   O O   . CYS A  1 23  ? 107.753 124.073 167.846 1.00 39.07  ? 23   CYS A O   1 
ATOM   163   C CB  . CYS A  1 23  ? 105.767 125.609 166.092 1.00 41.07  ? 23   CYS A CB  1 
ATOM   164   S SG  . CYS A  1 23  ? 104.967 126.860 165.025 1.00 47.91  ? 23   CYS A SG  1 
ATOM   165   N N   . ARG A  1 24  ? 106.381 124.953 169.400 1.00 39.48  ? 24   ARG A N   1 
ATOM   166   C CA  . ARG A  1 24  ? 106.648 123.924 170.416 1.00 39.85  ? 24   ARG A CA  1 
ATOM   167   C C   . ARG A  1 24  ? 105.361 123.105 170.579 1.00 39.56  ? 24   ARG A C   1 
ATOM   168   O O   . ARG A  1 24  ? 104.279 123.689 170.805 1.00 39.05  ? 24   ARG A O   1 
ATOM   169   C CB  . ARG A  1 24  ? 107.052 124.611 171.739 1.00 39.04  ? 24   ARG A CB  1 
ATOM   170   C CG  . ARG A  1 24  ? 108.300 124.031 172.461 1.00 41.21  ? 24   ARG A CG  1 
ATOM   171   C CD  . ARG A  1 24  ? 109.202 125.134 173.096 1.00 41.47  ? 24   ARG A CD  1 
ATOM   172   N NE  . ARG A  1 24  ? 110.038 124.600 174.180 1.00 50.89  ? 24   ARG A NE  1 
ATOM   173   C CZ  . ARG A  1 24  ? 111.194 125.118 174.613 1.00 47.34  ? 24   ARG A CZ  1 
ATOM   174   N NH1 . ARG A  1 24  ? 111.710 126.218 174.060 1.00 43.12  ? 24   ARG A NH1 1 
ATOM   175   N NH2 . ARG A  1 24  ? 111.846 124.517 175.613 1.00 38.30  ? 24   ARG A NH2 1 
ATOM   176   N N   . ALA A  1 25  ? 105.443 121.782 170.463 1.00 39.51  ? 25   ALA A N   1 
ATOM   177   C CA  . ALA A  1 25  ? 104.226 120.976 170.502 1.00 40.14  ? 25   ALA A CA  1 
ATOM   178   C C   . ALA A  1 25  ? 103.892 120.425 171.891 1.00 41.19  ? 25   ALA A C   1 
ATOM   179   O O   . ALA A  1 25  ? 104.554 119.501 172.380 1.00 38.04  ? 25   ALA A O   1 
ATOM   180   C CB  . ALA A  1 25  ? 104.284 119.862 169.458 1.00 40.18  ? 25   ALA A CB  1 
ATOM   181   N N   . SER A  1 26  ? 102.865 121.017 172.517 1.00 42.27  ? 26   SER A N   1 
ATOM   182   C CA  . SER A  1 26  ? 102.267 120.484 173.748 1.00 44.70  ? 26   SER A CA  1 
ATOM   183   C C   . SER A  1 26  ? 102.286 118.962 173.710 1.00 46.02  ? 26   SER A C   1 
ATOM   184   O O   . SER A  1 26  ? 102.404 118.294 174.749 1.00 48.18  ? 26   SER A O   1 
ATOM   185   C CB  . SER A  1 26  ? 100.817 120.959 173.903 1.00 44.07  ? 26   SER A CB  1 
ATOM   186   O OG  . SER A  1 26  ? 99.941  120.210 173.054 1.00 40.54  ? 26   SER A OG  1 
ATOM   187   N N   . GLN A  1 27  ? 102.185 118.431 172.496 1.00 45.22  ? 27   GLN A N   1 
ATOM   188   C CA  . GLN A  1 27  ? 102.112 117.001 172.265 1.00 46.40  ? 27   GLN A CA  1 
ATOM   189   C C   . GLN A  1 27  ? 103.106 116.566 171.209 1.00 46.44  ? 27   GLN A C   1 
ATOM   190   O O   . GLN A  1 27  ? 103.275 117.256 170.206 1.00 46.14  ? 27   GLN A O   1 
ATOM   191   C CB  . GLN A  1 27  ? 100.728 116.679 171.758 1.00 46.36  ? 27   GLN A CB  1 
ATOM   192   C CG  . GLN A  1 27  ? 99.691  116.785 172.814 1.00 44.82  ? 27   GLN A CG  1 
ATOM   193   C CD  . GLN A  1 27  ? 99.089  115.450 173.033 1.00 44.81  ? 27   GLN A CD  1 
ATOM   194   O OE1 . GLN A  1 27  ? 99.491  114.464 172.398 1.00 38.57  ? 27   GLN A OE1 1 
ATOM   195   N NE2 . GLN A  1 27  ? 98.123  115.373 173.940 1.00 45.79  ? 27   GLN A NE2 1 
ATOM   196   N N   . SER A  1 28  ? 103.759 115.423 171.411 1.00 44.34  ? 28   SER A N   1 
ATOM   197   C CA  . SER A  1 28  ? 104.649 114.913 170.370 1.00 45.72  ? 28   SER A CA  1 
ATOM   198   C C   . SER A  1 28  ? 103.842 114.652 169.107 1.00 46.30  ? 28   SER A C   1 
ATOM   199   O O   . SER A  1 28  ? 102.833 113.941 169.141 1.00 45.73  ? 28   SER A O   1 
ATOM   200   C CB  . SER A  1 28  ? 105.377 113.628 170.809 1.00 45.33  ? 28   SER A CB  1 
ATOM   201   O OG  . SER A  1 28  ? 106.079 113.061 169.633 1.00 43.38  ? 28   SER A OG  1 
ATOM   202   N N   . ILE A  1 29  ? 104.272 115.241 167.997 1.00 45.40  ? 29   ILE A N   1 
ATOM   203   C CA  . ILE A  1 29  ? 103.586 114.969 166.740 1.00 46.96  ? 29   ILE A CA  1 
ATOM   204   C C   . ILE A  1 29  ? 104.451 114.254 165.684 1.00 47.76  ? 29   ILE A C   1 
ATOM   205   O O   . ILE A  1 29  ? 104.149 114.302 164.493 1.00 46.87  ? 29   ILE A O   1 
ATOM   206   C CB  . ILE A  1 29  ? 102.779 116.197 166.192 1.00 47.41  ? 29   ILE A CB  1 
ATOM   207   C CG1 . ILE A  1 29  ? 103.696 117.332 165.728 1.00 46.03  ? 29   ILE A CG1 1 
ATOM   208   C CG2 . ILE A  1 29  ? 101.750 116.679 167.231 1.00 46.80  ? 29   ILE A CG2 1 
ATOM   209   C CD1 . ILE A  1 29  ? 102.979 118.434 164.959 1.00 43.69  ? 29   ILE A CD1 1 
ATOM   210   N N   . SER A  1 30  ? 105.507 113.583 166.148 1.00 49.06  ? 30   SER A N   1 
ATOM   211   C CA  . SER A  1 30  ? 106.444 112.874 165.277 1.00 50.96  ? 30   SER A CA  1 
ATOM   212   C C   . SER A  1 30  ? 107.127 113.856 164.331 1.00 50.63  ? 30   SER A C   1 
ATOM   213   O O   . SER A  1 30  ? 108.177 114.398 164.649 1.00 51.07  ? 30   SER A O   1 
ATOM   214   C CB  . SER A  1 30  ? 105.731 111.757 164.503 1.00 51.44  ? 30   SER A CB  1 
ATOM   215   O OG  . SER A  1 30  ? 105.285 110.717 165.390 1.00 55.69  ? 30   SER A OG  1 
ATOM   216   N N   . SER A  1 31  ? 106.506 114.076 163.177 1.00 50.51  ? 31   SER A N   1 
ATOM   217   C CA  . SER A  1 31  ? 106.947 115.041 162.181 1.00 49.40  ? 31   SER A CA  1 
ATOM   218   C C   . SER A  1 31  ? 105.686 115.566 161.513 1.00 48.87  ? 31   SER A C   1 
ATOM   219   O O   . SER A  1 31  ? 105.744 116.294 160.516 1.00 49.32  ? 31   SER A O   1 
ATOM   220   C CB  . SER A  1 31  ? 107.832 114.353 161.142 1.00 48.37  ? 31   SER A CB  1 
ATOM   221   O OG  . SER A  1 31  ? 107.078 113.394 160.396 1.00 47.95  ? 31   SER A OG  1 
ATOM   222   N N   . TYR A  1 32  ? 104.547 115.193 162.089 1.00 48.59  ? 32   TYR A N   1 
ATOM   223   C CA  . TYR A  1 32  ? 103.236 115.438 161.503 1.00 47.44  ? 32   TYR A CA  1 
ATOM   224   C C   . TYR A  1 32  ? 102.769 116.907 161.624 1.00 47.13  ? 32   TYR A C   1 
ATOM   225   O O   . TYR A  1 32  ? 101.662 117.175 162.127 1.00 47.36  ? 32   TYR A O   1 
ATOM   226   C CB  . TYR A  1 32  ? 102.215 114.486 162.150 1.00 48.62  ? 32   TYR A CB  1 
ATOM   227   C CG  . TYR A  1 32  ? 101.622 113.422 161.248 1.00 48.33  ? 32   TYR A CG  1 
ATOM   228   C CD1 . TYR A  1 32  ? 101.636 112.075 161.620 1.00 47.52  ? 32   TYR A CD1 1 
ATOM   229   C CD2 . TYR A  1 32  ? 101.000 113.765 160.050 1.00 47.42  ? 32   TYR A CD2 1 
ATOM   230   C CE1 . TYR A  1 32  ? 101.067 111.099 160.809 1.00 45.95  ? 32   TYR A CE1 1 
ATOM   231   C CE2 . TYR A  1 32  ? 100.430 112.800 159.236 1.00 47.89  ? 32   TYR A CE2 1 
ATOM   232   C CZ  . TYR A  1 32  ? 100.466 111.469 159.618 1.00 49.53  ? 32   TYR A CZ  1 
ATOM   233   O OH  . TYR A  1 32  ? 99.907  110.512 158.802 1.00 52.89  ? 32   TYR A OH  1 
ATOM   234   N N   . LEU A  1 33  ? 103.606 117.845 161.141 1.00 46.13  ? 33   LEU A N   1 
ATOM   235   C CA  . LEU A  1 33  ? 103.349 119.317 161.178 1.00 45.30  ? 33   LEU A CA  1 
ATOM   236   C C   . LEU A  1 33  ? 103.428 120.033 159.815 1.00 45.68  ? 33   LEU A C   1 
ATOM   237   O O   . LEU A  1 33  ? 104.310 119.732 159.000 1.00 46.61  ? 33   LEU A O   1 
ATOM   238   C CB  . LEU A  1 33  ? 104.335 120.039 162.118 1.00 46.66  ? 33   LEU A CB  1 
ATOM   239   C CG  . LEU A  1 33  ? 104.286 121.575 161.983 1.00 45.49  ? 33   LEU A CG  1 
ATOM   240   C CD1 . LEU A  1 33  ? 103.188 122.144 162.882 1.00 43.82  ? 33   LEU A CD1 1 
ATOM   241   C CD2 . LEU A  1 33  ? 105.613 122.257 162.255 1.00 42.70  ? 33   LEU A CD2 1 
ATOM   242   N N   . ASN A  1 34  ? 102.535 121.008 159.605 1.00 45.02  ? 34   ASN A N   1 
ATOM   243   C CA  . ASN A  1 34  ? 102.529 121.859 158.404 1.00 42.17  ? 34   ASN A CA  1 
ATOM   244   C C   . ASN A  1 34  ? 102.865 123.330 158.706 1.00 42.13  ? 34   ASN A C   1 
ATOM   245   O O   . ASN A  1 34  ? 102.651 123.806 159.824 1.00 38.27  ? 34   ASN A O   1 
ATOM   246   C CB  . ASN A  1 34  ? 101.173 121.814 157.676 1.00 40.03  ? 34   ASN A CB  1 
ATOM   247   C CG  . ASN A  1 34  ? 100.474 120.461 157.768 1.00 35.73  ? 34   ASN A CG  1 
ATOM   248   O OD1 . ASN A  1 34  ? 100.111 119.872 156.744 1.00 30.79  ? 34   ASN A OD1 1 
ATOM   249   N ND2 . ASN A  1 34  ? 100.258 119.978 158.987 1.00 33.14  ? 34   ASN A ND2 1 
ATOM   250   N N   . TRP A  1 35  ? 103.375 124.034 157.692 1.00 43.36  ? 35   TRP A N   1 
ATOM   251   C CA  . TRP A  1 35  ? 103.670 125.471 157.756 1.00 43.85  ? 35   TRP A CA  1 
ATOM   252   C C   . TRP A  1 35  ? 102.873 126.208 156.656 1.00 44.62  ? 35   TRP A C   1 
ATOM   253   O O   . TRP A  1 35  ? 103.064 125.918 155.469 1.00 47.44  ? 35   TRP A O   1 
ATOM   254   C CB  . TRP A  1 35  ? 105.184 125.717 157.570 1.00 42.99  ? 35   TRP A CB  1 
ATOM   255   C CG  . TRP A  1 35  ? 106.106 125.222 158.697 1.00 40.06  ? 35   TRP A CG  1 
ATOM   256   C CD1 . TRP A  1 35  ? 106.881 124.090 158.698 1.00 40.65  ? 35   TRP A CD1 1 
ATOM   257   C CD2 . TRP A  1 35  ? 106.351 125.869 159.954 1.00 40.79  ? 35   TRP A CD2 1 
ATOM   258   N NE1 . TRP A  1 35  ? 107.582 123.992 159.881 1.00 36.88  ? 35   TRP A NE1 1 
ATOM   259   C CE2 . TRP A  1 35  ? 107.275 125.069 160.670 1.00 40.27  ? 35   TRP A CE2 1 
ATOM   260   C CE3 . TRP A  1 35  ? 105.872 127.043 160.549 1.00 43.56  ? 35   TRP A CE3 1 
ATOM   261   C CZ2 . TRP A  1 35  ? 107.729 125.411 161.949 1.00 42.10  ? 35   TRP A CZ2 1 
ATOM   262   C CZ3 . TRP A  1 35  ? 106.324 127.381 161.816 1.00 41.66  ? 35   TRP A CZ3 1 
ATOM   263   C CH2 . TRP A  1 35  ? 107.244 126.568 162.502 1.00 42.42  ? 35   TRP A CH2 1 
ATOM   264   N N   . TYR A  1 36  ? 101.996 127.147 157.023 1.00 44.51  ? 36   TYR A N   1 
ATOM   265   C CA  . TYR A  1 36  ? 101.199 127.869 156.012 1.00 42.95  ? 36   TYR A CA  1 
ATOM   266   C C   . TYR A  1 36  ? 101.626 129.322 155.821 1.00 41.47  ? 36   TYR A C   1 
ATOM   267   O O   . TYR A  1 36  ? 102.100 129.977 156.771 1.00 39.11  ? 36   TYR A O   1 
ATOM   268   C CB  . TYR A  1 36  ? 99.687  127.765 156.290 1.00 43.32  ? 36   TYR A CB  1 
ATOM   269   C CG  . TYR A  1 36  ? 99.103  126.373 156.090 1.00 43.19  ? 36   TYR A CG  1 
ATOM   270   C CD1 . TYR A  1 36  ? 99.266  125.385 157.062 1.00 44.83  ? 36   TYR A CD1 1 
ATOM   271   C CD2 . TYR A  1 36  ? 98.390  126.040 154.934 1.00 42.73  ? 36   TYR A CD2 1 
ATOM   272   C CE1 . TYR A  1 36  ? 98.731  124.105 156.898 1.00 43.28  ? 36   TYR A CE1 1 
ATOM   273   C CE2 . TYR A  1 36  ? 97.854  124.754 154.759 1.00 39.17  ? 36   TYR A CE2 1 
ATOM   274   C CZ  . TYR A  1 36  ? 98.028  123.795 155.750 1.00 43.07  ? 36   TYR A CZ  1 
ATOM   275   O OH  . TYR A  1 36  ? 97.513  122.528 155.601 1.00 45.30  ? 36   TYR A OH  1 
ATOM   276   N N   . GLN A  1 37  ? 101.497 129.797 154.582 1.00 41.24  ? 37   GLN A N   1 
ATOM   277   C CA  . GLN A  1 37  ? 101.752 131.191 154.271 1.00 39.85  ? 37   GLN A CA  1 
ATOM   278   C C   . GLN A  1 37  ? 100.586 131.760 153.511 1.00 41.22  ? 37   GLN A C   1 
ATOM   279   O O   . GLN A  1 37  ? 99.997  131.128 152.628 1.00 40.69  ? 37   GLN A O   1 
ATOM   280   C CB  . GLN A  1 37  ? 103.013 131.387 153.450 1.00 40.42  ? 37   GLN A CB  1 
ATOM   281   C CG  . GLN A  1 37  ? 103.282 132.849 153.152 1.00 33.99  ? 37   GLN A CG  1 
ATOM   282   C CD  . GLN A  1 37  ? 103.912 133.040 151.802 1.00 41.06  ? 37   GLN A CD  1 
ATOM   283   O OE1 . GLN A  1 37  ? 103.236 132.982 150.772 1.00 39.41  ? 37   GLN A OE1 1 
ATOM   284   N NE2 . GLN A  1 37  ? 105.240 133.284 151.783 1.00 51.39  ? 37   GLN A NE2 1 
ATOM   285   N N   . GLN A  1 38  ? 100.307 132.999 153.862 1.00 42.33  ? 38   GLN A N   1 
ATOM   286   C CA  . GLN A  1 38  ? 99.083  133.639 153.535 1.00 42.69  ? 38   GLN A CA  1 
ATOM   287   C C   . GLN A  1 38  ? 99.361  135.123 153.776 1.00 42.95  ? 38   GLN A C   1 
ATOM   288   O O   . GLN A  1 38  ? 99.425  135.623 154.918 1.00 43.22  ? 38   GLN A O   1 
ATOM   289   C CB  . GLN A  1 38  ? 97.981  133.049 154.421 1.00 42.02  ? 38   GLN A CB  1 
ATOM   290   C CG  . GLN A  1 38  ? 96.819  133.934 154.767 1.00 40.80  ? 38   GLN A CG  1 
ATOM   291   C CD  . GLN A  1 38  ? 96.895  134.401 156.200 1.00 39.77  ? 38   GLN A CD  1 
ATOM   292   O OE1 . GLN A  1 38  ? 96.946  135.601 156.466 1.00 44.45  ? 38   GLN A OE1 1 
ATOM   293   N NE2 . GLN A  1 38  ? 96.909  133.455 157.142 1.00 33.60  ? 38   GLN A NE2 1 
ATOM   294   N N   . LYS A  1 39  ? 99.640  135.781 152.657 1.00 42.89  ? 39   LYS A N   1 
ATOM   295   C CA  . LYS A  1 39  ? 99.640  137.238 152.523 1.00 44.12  ? 39   LYS A CA  1 
ATOM   296   C C   . LYS A  1 39  ? 98.235  137.800 152.778 1.00 45.24  ? 39   LYS A C   1 
ATOM   297   O O   . LYS A  1 39  ? 97.245  137.054 152.718 1.00 45.05  ? 39   LYS A O   1 
ATOM   298   C CB  . LYS A  1 39  ? 100.144 137.613 151.122 1.00 43.28  ? 39   LYS A CB  1 
ATOM   299   C CG  . LYS A  1 39  ? 99.809  136.561 150.050 1.00 39.87  ? 39   LYS A CG  1 
ATOM   300   C CD  . LYS A  1 39  ? 100.759 136.647 148.857 1.00 43.99  ? 39   LYS A CD  1 
ATOM   301   C CE  . LYS A  1 39  ? 102.130 136.004 149.157 1.00 43.79  ? 39   LYS A CE  1 
ATOM   302   N NZ  . LYS A  1 39  ? 102.816 135.657 147.791 1.00 41.86  ? 39   LYS A NZ  1 
ATOM   303   N N   . PRO A  1 40  ? 98.134  139.120 153.041 1.00 45.75  ? 40   PRO A N   1 
ATOM   304   C CA  . PRO A  1 40  ? 96.899  139.648 153.605 1.00 45.66  ? 40   PRO A CA  1 
ATOM   305   C C   . PRO A  1 40  ? 95.874  139.824 152.501 1.00 46.62  ? 40   PRO A C   1 
ATOM   306   O O   . PRO A  1 40  ? 96.192  140.389 151.429 1.00 47.86  ? 40   PRO A O   1 
ATOM   307   C CB  . PRO A  1 40  ? 97.319  140.995 154.205 1.00 45.43  ? 40   PRO A CB  1 
ATOM   308   C CG  . PRO A  1 40  ? 98.623  141.352 153.562 1.00 45.73  ? 40   PRO A CG  1 
ATOM   309   C CD  . PRO A  1 40  ? 99.110  140.192 152.741 1.00 45.15  ? 40   PRO A CD  1 
ATOM   310   N N   . GLY A  1 41  ? 94.665  139.322 152.748 1.00 47.31  ? 41   GLY A N   1 
ATOM   311   C CA  . GLY A  1 41  ? 93.665  139.233 151.695 1.00 46.45  ? 41   GLY A CA  1 
ATOM   312   C C   . GLY A  1 41  ? 93.734  137.914 150.941 1.00 45.27  ? 41   GLY A C   1 
ATOM   313   O O   . GLY A  1 41  ? 92.988  137.716 149.982 1.00 45.32  ? 41   GLY A O   1 
ATOM   314   N N   . LYS A  1 42  ? 94.620  137.009 151.364 1.00 43.83  ? 42   LYS A N   1 
ATOM   315   C CA  . LYS A  1 42  ? 94.715  135.676 150.746 1.00 42.58  ? 42   LYS A CA  1 
ATOM   316   C C   . LYS A  1 42  ? 94.500  134.524 151.742 1.00 41.88  ? 42   LYS A C   1 
ATOM   317   O O   . LYS A  1 42  ? 94.306  134.768 152.935 1.00 41.07  ? 42   LYS A O   1 
ATOM   318   C CB  . LYS A  1 42  ? 96.022  135.520 149.957 1.00 42.32  ? 42   LYS A CB  1 
ATOM   319   C CG  . LYS A  1 42  ? 96.081  136.358 148.678 1.00 42.77  ? 42   LYS A CG  1 
ATOM   320   C CD  . LYS A  1 42  ? 94.924  136.030 147.711 1.00 38.20  ? 42   LYS A CD  1 
ATOM   321   C CE  . LYS A  1 42  ? 95.141  136.793 146.384 1.00 32.30  ? 42   LYS A CE  1 
ATOM   322   N NZ  . LYS A  1 42  ? 94.185  136.358 145.307 1.00 22.66  ? 42   LYS A NZ  1 
ATOM   323   N N   . ALA A  1 43  ? 94.512  133.284 151.259 1.00 41.84  ? 43   ALA A N   1 
ATOM   324   C CA  . ALA A  1 43  ? 94.214  132.134 152.120 1.00 41.77  ? 43   ALA A CA  1 
ATOM   325   C C   . ALA A  1 43  ? 95.479  131.384 152.533 1.00 41.24  ? 43   ALA A C   1 
ATOM   326   O O   . ALA A  1 43  ? 96.528  131.569 151.900 1.00 41.87  ? 43   ALA A O   1 
ATOM   327   C CB  . ALA A  1 43  ? 93.233  131.173 151.406 1.00 41.42  ? 43   ALA A CB  1 
ATOM   328   N N   . PRO A  1 44  ? 95.408  130.570 153.611 1.00 39.78  ? 44   PRO A N   1 
ATOM   329   C CA  . PRO A  1 44  ? 96.613  129.778 153.811 1.00 38.42  ? 44   PRO A CA  1 
ATOM   330   C C   . PRO A  1 44  ? 96.963  128.971 152.565 1.00 36.41  ? 44   PRO A C   1 
ATOM   331   O O   . PRO A  1 44  ? 96.215  128.066 152.159 1.00 33.14  ? 44   PRO A O   1 
ATOM   332   C CB  . PRO A  1 44  ? 96.255  128.873 155.004 1.00 37.85  ? 44   PRO A CB  1 
ATOM   333   C CG  . PRO A  1 44  ? 95.271  129.664 155.792 1.00 38.11  ? 44   PRO A CG  1 
ATOM   334   C CD  . PRO A  1 44  ? 94.408  130.331 154.678 1.00 39.06  ? 44   PRO A CD  1 
ATOM   335   N N   . LYS A  1 45  ? 98.077  129.359 151.950 1.00 37.06  ? 45   LYS A N   1 
ATOM   336   C CA  . LYS A  1 45  ? 98.587  128.682 150.778 1.00 36.48  ? 45   LYS A CA  1 
ATOM   337   C C   . LYS A  1 45  ? 99.894  128.019 151.185 1.00 37.51  ? 45   LYS A C   1 
ATOM   338   O O   . LYS A  1 45  ? 100.924 128.670 151.400 1.00 37.05  ? 45   LYS A O   1 
ATOM   339   C CB  . LYS A  1 45  ? 98.744  129.649 149.601 1.00 34.89  ? 45   LYS A CB  1 
ATOM   340   C CG  . LYS A  1 45  ? 97.407  130.187 149.086 1.00 31.89  ? 45   LYS A CG  1 
ATOM   341   C CD  . LYS A  1 45  ? 97.355  130.146 147.560 1.00 37.14  ? 45   LYS A CD  1 
ATOM   342   C CE  . LYS A  1 45  ? 96.357  131.269 147.063 1.00 36.53  ? 45   LYS A CE  1 
ATOM   343   N NZ  . LYS A  1 45  ? 96.357  131.420 145.558 1.00 42.41  ? 45   LYS A NZ  1 
ATOM   344   N N   . LEU A  1 46  ? 99.799  126.697 151.299 1.00 38.03  ? 46   LEU A N   1 
ATOM   345   C CA  . LEU A  1 46  ? 100.744 125.820 151.999 1.00 37.19  ? 46   LEU A CA  1 
ATOM   346   C C   . LEU A  1 46  ? 102.185 125.846 151.493 1.00 37.58  ? 46   LEU A C   1 
ATOM   347   O O   . LEU A  1 46  ? 102.432 125.867 150.266 1.00 39.31  ? 46   LEU A O   1 
ATOM   348   C CB  . LEU A  1 46  ? 100.199 124.381 151.960 1.00 36.65  ? 46   LEU A CB  1 
ATOM   349   C CG  . LEU A  1 46  ? 100.755 123.257 152.852 1.00 33.56  ? 46   LEU A CG  1 
ATOM   350   C CD1 . LEU A  1 46  ? 101.231 123.719 154.225 1.00 31.91  ? 46   LEU A CD1 1 
ATOM   351   C CD2 . LEU A  1 46  ? 99.704  122.163 153.004 1.00 32.35  ? 46   LEU A CD2 1 
ATOM   352   N N   . LEU A  1 47  ? 103.131 125.827 152.431 1.00 36.63  ? 47   LEU A N   1 
ATOM   353   C CA  . LEU A  1 47  ? 104.540 125.810 152.070 1.00 37.07  ? 47   LEU A CA  1 
ATOM   354   C C   . LEU A  1 47  ? 105.175 124.438 152.236 1.00 37.29  ? 47   LEU A C   1 
ATOM   355   O O   . LEU A  1 47  ? 106.017 124.043 151.421 1.00 37.37  ? 47   LEU A O   1 
ATOM   356   C CB  . LEU A  1 47  ? 105.324 126.838 152.884 1.00 35.81  ? 47   LEU A CB  1 
ATOM   357   C CG  . LEU A  1 47  ? 104.964 128.304 152.641 1.00 37.46  ? 47   LEU A CG  1 
ATOM   358   C CD1 . LEU A  1 47  ? 105.530 129.136 153.809 1.00 32.95  ? 47   LEU A CD1 1 
ATOM   359   C CD2 . LEU A  1 47  ? 105.440 128.814 151.258 1.00 30.88  ? 47   LEU A CD2 1 
ATOM   360   N N   . ILE A  1 48  ? 104.776 123.714 153.285 1.00 38.01  ? 48   ILE A N   1 
ATOM   361   C CA  . ILE A  1 48  ? 105.514 122.528 153.729 1.00 39.59  ? 48   ILE A CA  1 
ATOM   362   C C   . ILE A  1 48  ? 104.656 121.509 154.503 1.00 42.07  ? 48   ILE A C   1 
ATOM   363   O O   . ILE A  1 48  ? 104.048 121.866 155.521 1.00 42.36  ? 48   ILE A O   1 
ATOM   364   C CB  . ILE A  1 48  ? 106.687 122.943 154.679 1.00 39.27  ? 48   ILE A CB  1 
ATOM   365   C CG1 . ILE A  1 48  ? 107.249 124.343 154.347 1.00 35.52  ? 48   ILE A CG1 1 
ATOM   366   C CG2 . ILE A  1 48  ? 107.754 121.888 154.681 1.00 39.67  ? 48   ILE A CG2 1 
ATOM   367   C CD1 . ILE A  1 48  ? 108.720 124.772 154.710 1.00 33.69  ? 48   ILE A CD1 1 
ATOM   368   N N   . TYR A  1 49  ? 104.601 120.254 154.054 1.00 45.99  ? 49   TYR A N   1 
ATOM   369   C CA  . TYR A  1 49  ? 104.082 119.229 154.968 1.00 48.37  ? 49   TYR A CA  1 
ATOM   370   C C   . TYR A  1 49  ? 105.118 118.276 155.495 1.00 48.22  ? 49   TYR A C   1 
ATOM   371   O O   . TYR A  1 49  ? 106.309 118.359 155.144 1.00 48.98  ? 49   TYR A O   1 
ATOM   372   C CB  . TYR A  1 49  ? 102.861 118.450 154.460 1.00 50.03  ? 49   TYR A CB  1 
ATOM   373   C CG  . TYR A  1 49  ? 102.951 117.833 153.093 1.00 54.42  ? 49   TYR A CG  1 
ATOM   374   C CD1 . TYR A  1 49  ? 104.161 117.414 152.538 1.00 55.84  ? 49   TYR A CD1 1 
ATOM   375   C CD2 . TYR A  1 49  ? 101.793 117.646 152.348 1.00 57.36  ? 49   TYR A CD2 1 
ATOM   376   C CE1 . TYR A  1 49  ? 104.202 116.855 151.259 1.00 60.05  ? 49   TYR A CE1 1 
ATOM   377   C CE2 . TYR A  1 49  ? 101.823 117.079 151.086 1.00 58.52  ? 49   TYR A CE2 1 
ATOM   378   C CZ  . TYR A  1 49  ? 103.026 116.681 150.545 1.00 55.57  ? 49   TYR A CZ  1 
ATOM   379   O OH  . TYR A  1 49  ? 103.060 116.122 149.283 1.00 55.22  ? 49   TYR A OH  1 
ATOM   380   N N   . ALA A  1 50  ? 104.624 117.355 156.325 1.00 47.25  ? 50   ALA A N   1 
ATOM   381   C CA  . ALA A  1 50  ? 105.460 116.586 157.215 1.00 46.87  ? 50   ALA A CA  1 
ATOM   382   C C   . ALA A  1 50  ? 106.734 117.380 157.432 1.00 46.07  ? 50   ALA A C   1 
ATOM   383   O O   . ALA A  1 50  ? 107.796 117.036 156.874 1.00 46.13  ? 50   ALA A O   1 
ATOM   384   C CB  . ALA A  1 50  ? 105.753 115.213 156.634 1.00 46.59  ? 50   ALA A CB  1 
ATOM   385   N N   . ALA A  1 51  ? 106.620 118.474 158.185 1.00 44.76  ? 51   ALA A N   1 
ATOM   386   C CA  . ALA A  1 51  ? 107.779 119.212 158.699 1.00 44.05  ? 51   ALA A CA  1 
ATOM   387   C C   . ALA A  1 51  ? 108.722 119.890 157.690 1.00 43.66  ? 51   ALA A C   1 
ATOM   388   O O   . ALA A  1 51  ? 109.272 120.943 158.022 1.00 43.26  ? 51   ALA A O   1 
ATOM   389   C CB  . ALA A  1 51  ? 108.588 118.337 159.684 1.00 41.70  ? 51   ALA A CB  1 
ATOM   390   N N   . SER A  1 52  ? 108.917 119.320 156.486 1.00 42.64  ? 52   SER A N   1 
ATOM   391   C CA  . SER A  1 52  ? 110.102 119.705 155.694 1.00 41.15  ? 52   SER A CA  1 
ATOM   392   C C   . SER A  1 52  ? 109.998 119.677 154.164 1.00 40.13  ? 52   SER A C   1 
ATOM   393   O O   . SER A  1 52  ? 110.401 120.630 153.491 1.00 40.50  ? 52   SER A O   1 
ATOM   394   C CB  . SER A  1 52  ? 111.293 118.843 156.123 1.00 41.58  ? 52   SER A CB  1 
ATOM   395   O OG  . SER A  1 52  ? 111.074 117.485 155.772 1.00 44.91  ? 52   SER A OG  1 
ATOM   396   N N   . SER A  1 53  ? 109.511 118.557 153.630 1.00 37.66  ? 53   SER A N   1 
ATOM   397   C CA  . SER A  1 53  ? 109.301 118.385 152.195 1.00 33.47  ? 53   SER A CA  1 
ATOM   398   C C   . SER A  1 53  ? 108.369 119.489 151.709 1.00 34.82  ? 53   SER A C   1 
ATOM   399   O O   . SER A  1 53  ? 107.260 119.650 152.237 1.00 35.78  ? 53   SER A O   1 
ATOM   400   C CB  . SER A  1 53  ? 108.720 116.993 151.897 1.00 35.59  ? 53   SER A CB  1 
ATOM   401   O OG  . SER A  1 53  ? 107.508 116.790 152.624 1.00 23.13  ? 53   SER A OG  1 
ATOM   402   N N   . LEU A  1 54  ? 108.835 120.257 150.715 1.00 34.96  ? 54   LEU A N   1 
ATOM   403   C CA  . LEU A  1 54  ? 108.157 121.500 150.294 1.00 37.03  ? 54   LEU A CA  1 
ATOM   404   C C   . LEU A  1 54  ? 106.948 121.153 149.426 1.00 38.49  ? 54   LEU A C   1 
ATOM   405   O O   . LEU A  1 54  ? 106.470 120.018 149.474 1.00 41.53  ? 54   LEU A O   1 
ATOM   406   C CB  . LEU A  1 54  ? 109.138 122.346 149.479 1.00 36.33  ? 54   LEU A CB  1 
ATOM   407   C CG  . LEU A  1 54  ? 110.350 123.140 149.996 1.00 38.19  ? 54   LEU A CG  1 
ATOM   408   C CD1 . LEU A  1 54  ? 110.882 122.691 151.375 1.00 36.58  ? 54   LEU A CD1 1 
ATOM   409   C CD2 . LEU A  1 54  ? 111.437 123.028 148.939 1.00 36.13  ? 54   LEU A CD2 1 
ATOM   410   N N   . GLN A  1 55  ? 106.442 122.110 148.646 1.00 37.56  ? 55   GLN A N   1 
ATOM   411   C CA  . GLN A  1 55  ? 105.641 121.757 147.457 1.00 40.26  ? 55   GLN A CA  1 
ATOM   412   C C   . GLN A  1 55  ? 105.612 122.807 146.387 1.00 41.46  ? 55   GLN A C   1 
ATOM   413   O O   . GLN A  1 55  ? 105.545 124.008 146.658 1.00 42.02  ? 55   GLN A O   1 
ATOM   414   C CB  . GLN A  1 55  ? 104.216 121.290 147.747 1.00 39.78  ? 55   GLN A CB  1 
ATOM   415   C CG  . GLN A  1 55  ? 103.771 121.377 149.157 1.00 42.22  ? 55   GLN A CG  1 
ATOM   416   C CD  . GLN A  1 55  ? 103.412 120.014 149.658 1.00 47.18  ? 55   GLN A CD  1 
ATOM   417   O OE1 . GLN A  1 55  ? 103.860 119.607 150.721 1.00 48.60  ? 55   GLN A OE1 1 
ATOM   418   N NE2 . GLN A  1 55  ? 102.598 119.289 148.891 1.00 46.53  ? 55   GLN A NE2 1 
ATOM   419   N N   . SER A  1 56  ? 105.532 122.298 145.166 1.00 42.30  ? 56   SER A N   1 
ATOM   420   C CA  . SER A  1 56  ? 106.151 122.922 144.001 1.00 43.66  ? 56   SER A CA  1 
ATOM   421   C C   . SER A  1 56  ? 105.898 124.411 143.855 1.00 45.19  ? 56   SER A C   1 
ATOM   422   O O   . SER A  1 56  ? 104.832 124.919 144.214 1.00 47.79  ? 56   SER A O   1 
ATOM   423   C CB  . SER A  1 56  ? 105.733 122.187 142.712 1.00 42.95  ? 56   SER A CB  1 
ATOM   424   O OG  . SER A  1 56  ? 105.430 120.795 143.061 1.00 40.51  ? 56   SER A OG  1 
ATOM   425   N N   . GLY A  1 57  ? 106.885 125.102 143.301 1.00 44.35  ? 57   GLY A N   1 
ATOM   426   C CA  . GLY A  1 57  ? 106.818 126.541 143.236 1.00 45.13  ? 57   GLY A CA  1 
ATOM   427   C C   . GLY A  1 57  ? 107.421 127.120 144.496 1.00 45.50  ? 57   GLY A C   1 
ATOM   428   O O   . GLY A  1 57  ? 108.268 128.004 144.400 1.00 46.36  ? 57   GLY A O   1 
ATOM   429   N N   . VAL A  1 58  ? 106.990 126.622 145.664 1.00 46.02  ? 58   VAL A N   1 
ATOM   430   C CA  . VAL A  1 58  ? 107.514 127.069 146.964 1.00 46.92  ? 58   VAL A CA  1 
ATOM   431   C C   . VAL A  1 58  ? 108.976 127.445 146.779 1.00 47.31  ? 58   VAL A C   1 
ATOM   432   O O   . VAL A  1 58  ? 109.839 126.554 146.644 1.00 46.53  ? 58   VAL A O   1 
ATOM   433   C CB  . VAL A  1 58  ? 107.368 125.991 148.078 1.00 47.23  ? 58   VAL A CB  1 
ATOM   434   C CG1 . VAL A  1 58  ? 108.177 124.756 147.732 1.00 46.84  ? 58   VAL A CG1 1 
ATOM   435   C CG2 . VAL A  1 58  ? 107.813 126.541 149.439 1.00 47.42  ? 58   VAL A CG2 1 
ATOM   436   N N   . PRO A  1 59  ? 109.259 128.761 146.708 1.00 47.43  ? 59   PRO A N   1 
ATOM   437   C CA  . PRO A  1 59  ? 110.607 129.141 146.313 1.00 48.59  ? 59   PRO A CA  1 
ATOM   438   C C   . PRO A  1 59  ? 111.672 128.490 147.187 1.00 49.63  ? 59   PRO A C   1 
ATOM   439   O O   . PRO A  1 59  ? 111.335 127.785 148.161 1.00 50.26  ? 59   PRO A O   1 
ATOM   440   C CB  . PRO A  1 59  ? 110.596 130.665 146.460 1.00 47.93  ? 59   PRO A CB  1 
ATOM   441   C CG  . PRO A  1 59  ? 109.175 131.046 146.268 1.00 48.11  ? 59   PRO A CG  1 
ATOM   442   C CD  . PRO A  1 59  ? 108.411 129.950 146.952 1.00 47.62  ? 59   PRO A CD  1 
ATOM   443   N N   . SER A  1 60  ? 112.942 128.729 146.851 1.00 50.94  ? 60   SER A N   1 
ATOM   444   C CA  . SER A  1 60  ? 113.995 127.836 147.332 1.00 51.47  ? 60   SER A CA  1 
ATOM   445   C C   . SER A  1 60  ? 114.349 127.975 148.812 1.00 50.39  ? 60   SER A C   1 
ATOM   446   O O   . SER A  1 60  ? 114.936 127.066 149.406 1.00 50.86  ? 60   SER A O   1 
ATOM   447   C CB  . SER A  1 60  ? 115.247 127.996 146.469 1.00 51.62  ? 60   SER A CB  1 
ATOM   448   O OG  . SER A  1 60  ? 116.181 126.964 146.739 1.00 54.04  ? 60   SER A OG  1 
ATOM   449   N N   . ARG A  1 61  ? 113.963 129.101 149.396 1.00 50.57  ? 61   ARG A N   1 
ATOM   450   C CA  . ARG A  1 61  ? 114.502 129.553 150.676 1.00 50.05  ? 61   ARG A CA  1 
ATOM   451   C C   . ARG A  1 61  ? 113.747 129.027 151.896 1.00 49.34  ? 61   ARG A C   1 
ATOM   452   O O   . ARG A  1 61  ? 114.233 129.122 153.037 1.00 48.92  ? 61   ARG A O   1 
ATOM   453   C CB  . ARG A  1 61  ? 114.591 131.089 150.686 1.00 50.20  ? 61   ARG A CB  1 
ATOM   454   C CG  . ARG A  1 61  ? 113.344 131.875 150.209 1.00 50.72  ? 61   ARG A CG  1 
ATOM   455   C CD  . ARG A  1 61  ? 113.010 131.668 148.707 1.00 50.84  ? 61   ARG A CD  1 
ATOM   456   N NE  . ARG A  1 61  ? 112.399 132.860 148.098 1.00 49.60  ? 61   ARG A NE  1 
ATOM   457   C CZ  . ARG A  1 61  ? 112.915 133.540 147.072 1.00 52.74  ? 61   ARG A CZ  1 
ATOM   458   N NH1 . ARG A  1 61  ? 114.060 133.156 146.517 1.00 43.80  ? 61   ARG A NH1 1 
ATOM   459   N NH2 . ARG A  1 61  ? 112.282 134.607 146.597 1.00 58.18  ? 61   ARG A NH2 1 
ATOM   460   N N   . PHE A  1 62  ? 112.572 128.461 151.629 1.00 48.29  ? 62   PHE A N   1 
ATOM   461   C CA  . PHE A  1 62  ? 111.731 127.848 152.648 1.00 47.66  ? 62   PHE A CA  1 
ATOM   462   C C   . PHE A  1 62  ? 112.251 126.453 153.005 1.00 47.75  ? 62   PHE A C   1 
ATOM   463   O O   . PHE A  1 62  ? 112.430 125.595 152.135 1.00 47.01  ? 62   PHE A O   1 
ATOM   464   C CB  . PHE A  1 62  ? 110.282 127.841 152.148 1.00 47.93  ? 62   PHE A CB  1 
ATOM   465   C CG  . PHE A  1 62  ? 109.739 129.228 151.866 1.00 49.99  ? 62   PHE A CG  1 
ATOM   466   C CD1 . PHE A  1 62  ? 110.399 130.095 150.989 1.00 48.89  ? 62   PHE A CD1 1 
ATOM   467   C CD2 . PHE A  1 62  ? 108.585 129.677 152.491 1.00 49.94  ? 62   PHE A CD2 1 
ATOM   468   C CE1 . PHE A  1 62  ? 109.914 131.378 150.742 1.00 48.23  ? 62   PHE A CE1 1 
ATOM   469   C CE2 . PHE A  1 62  ? 108.091 130.961 152.243 1.00 50.03  ? 62   PHE A CE2 1 
ATOM   470   C CZ  . PHE A  1 62  ? 108.756 131.810 151.367 1.00 51.81  ? 62   PHE A CZ  1 
ATOM   471   N N   . SER A  1 63  ? 112.503 126.256 154.297 1.00 46.73  ? 63   SER A N   1 
ATOM   472   C CA  . SER A  1 63  ? 113.195 125.079 154.806 1.00 43.87  ? 63   SER A CA  1 
ATOM   473   C C   . SER A  1 63  ? 112.649 124.722 156.186 1.00 43.38  ? 63   SER A C   1 
ATOM   474   O O   . SER A  1 63  ? 113.043 125.320 157.194 1.00 41.03  ? 63   SER A O   1 
ATOM   475   C CB  . SER A  1 63  ? 114.705 125.369 154.875 1.00 43.42  ? 63   SER A CB  1 
ATOM   476   O OG  . SER A  1 63  ? 115.382 124.467 155.741 1.00 49.08  ? 63   SER A OG  1 
ATOM   477   N N   . GLY A  1 64  ? 111.729 123.764 156.229 1.00 41.24  ? 64   GLY A N   1 
ATOM   478   C CA  . GLY A  1 64  ? 111.138 123.342 157.495 1.00 40.62  ? 64   GLY A CA  1 
ATOM   479   C C   . GLY A  1 64  ? 111.923 122.204 158.123 1.00 40.86  ? 64   GLY A C   1 
ATOM   480   O O   . GLY A  1 64  ? 112.215 121.204 157.455 1.00 40.13  ? 64   GLY A O   1 
ATOM   481   N N   . SER A  1 65  ? 112.278 122.360 159.407 1.00 40.85  ? 65   SER A N   1 
ATOM   482   C CA  . SER A  1 65  ? 112.997 121.295 160.134 1.00 41.78  ? 65   SER A CA  1 
ATOM   483   C C   . SER A  1 65  ? 112.344 120.889 161.468 1.00 41.56  ? 65   SER A C   1 
ATOM   484   O O   . SER A  1 65  ? 111.256 121.367 161.809 1.00 41.63  ? 65   SER A O   1 
ATOM   485   C CB  . SER A  1 65  ? 114.476 121.660 160.341 1.00 41.99  ? 65   SER A CB  1 
ATOM   486   O OG  . SER A  1 65  ? 114.653 122.511 161.465 1.00 46.24  ? 65   SER A OG  1 
ATOM   487   N N   . GLY A  1 66  ? 113.024 120.000 162.198 1.00 39.86  ? 66   GLY A N   1 
ATOM   488   C CA  . GLY A  1 66  ? 112.503 119.474 163.465 1.00 39.04  ? 66   GLY A CA  1 
ATOM   489   C C   . GLY A  1 66  ? 111.508 118.325 163.381 1.00 38.89  ? 66   GLY A C   1 
ATOM   490   O O   . GLY A  1 66  ? 111.152 117.847 162.296 1.00 38.18  ? 66   GLY A O   1 
ATOM   491   N N   . SER A  1 67  ? 111.068 117.915 164.576 1.00 38.80  ? 67   SER A N   1 
ATOM   492   C CA  . SER A  1 67  ? 110.156 116.789 164.834 1.00 37.17  ? 67   SER A CA  1 
ATOM   493   C C   . SER A  1 67  ? 109.775 116.717 166.331 1.00 35.73  ? 67   SER A C   1 
ATOM   494   O O   . SER A  1 67  ? 110.393 117.381 167.170 1.00 33.12  ? 67   SER A O   1 
ATOM   495   C CB  . SER A  1 67  ? 110.782 115.462 164.379 1.00 36.37  ? 67   SER A CB  1 
ATOM   496   O OG  . SER A  1 67  ? 111.863 115.084 165.212 1.00 41.78  ? 67   SER A OG  1 
ATOM   497   N N   . GLY A  1 68  ? 108.762 115.907 166.648 1.00 35.92  ? 68   GLY A N   1 
ATOM   498   C CA  . GLY A  1 68  ? 108.350 115.627 168.032 1.00 35.28  ? 68   GLY A CA  1 
ATOM   499   C C   . GLY A  1 68  ? 107.659 116.806 168.695 1.00 35.25  ? 68   GLY A C   1 
ATOM   500   O O   . GLY A  1 68  ? 106.421 116.874 168.761 1.00 34.87  ? 68   GLY A O   1 
ATOM   501   N N   . THR A  1 69  ? 108.459 117.748 169.178 1.00 35.82  ? 69   THR A N   1 
ATOM   502   C CA  . THR A  1 69  ? 107.883 118.932 169.779 1.00 36.29  ? 69   THR A CA  1 
ATOM   503   C C   . THR A  1 69  ? 108.340 120.208 169.082 1.00 34.62  ? 69   THR A C   1 
ATOM   504   O O   . THR A  1 69  ? 107.520 121.083 168.793 1.00 34.49  ? 69   THR A O   1 
ATOM   505   C CB  . THR A  1 69  ? 108.136 118.958 171.300 1.00 37.27  ? 69   THR A CB  1 
ATOM   506   O OG1 . THR A  1 69  ? 107.439 117.854 171.906 1.00 37.41  ? 69   THR A OG1 1 
ATOM   507   C CG2 . THR A  1 69  ? 107.653 120.270 171.943 1.00 37.33  ? 69   THR A CG2 1 
ATOM   508   N N   . ASP A  1 70  ? 109.631 120.298 168.775 1.00 32.27  ? 70   ASP A N   1 
ATOM   509   C CA  . ASP A  1 70  ? 110.192 121.552 168.286 1.00 30.47  ? 70   ASP A CA  1 
ATOM   510   C C   . ASP A  1 70  ? 110.561 121.596 166.807 1.00 29.03  ? 70   ASP A C   1 
ATOM   511   O O   . ASP A  1 70  ? 111.436 120.866 166.330 1.00 30.36  ? 70   ASP A O   1 
ATOM   512   C CB  . ASP A  1 70  ? 111.342 122.001 169.180 1.00 31.40  ? 70   ASP A CB  1 
ATOM   513   C CG  . ASP A  1 70  ? 110.851 122.700 170.421 1.00 32.94  ? 70   ASP A CG  1 
ATOM   514   O OD1 . ASP A  1 70  ? 110.110 123.695 170.272 1.00 33.28  ? 70   ASP A OD1 1 
ATOM   515   O OD2 . ASP A  1 70  ? 111.198 122.266 171.540 1.00 26.67  ? 70   ASP A OD2 1 
ATOM   516   N N   . PHE A  1 71  ? 109.854 122.486 166.105 1.00 26.55  ? 71   PHE A N   1 
ATOM   517   C CA  . PHE A  1 71  ? 109.953 122.679 164.661 1.00 25.83  ? 71   PHE A CA  1 
ATOM   518   C C   . PHE A  1 71  ? 110.627 124.022 164.359 1.00 25.45  ? 71   PHE A C   1 
ATOM   519   O O   . PHE A  1 71  ? 110.682 124.904 165.261 1.00 27.46  ? 71   PHE A O   1 
ATOM   520   C CB  . PHE A  1 71  ? 108.542 122.605 164.085 1.00 24.47  ? 71   PHE A CB  1 
ATOM   521   C CG  . PHE A  1 71  ? 107.852 121.310 164.398 1.00 26.28  ? 71   PHE A CG  1 
ATOM   522   C CD1 . PHE A  1 71  ? 106.993 121.193 165.488 1.00 27.01  ? 71   PHE A CD1 1 
ATOM   523   C CD2 . PHE A  1 71  ? 108.095 120.188 163.612 1.00 30.46  ? 71   PHE A CD2 1 
ATOM   524   C CE1 . PHE A  1 71  ? 106.375 119.977 165.768 1.00 28.65  ? 71   PHE A CE1 1 
ATOM   525   C CE2 . PHE A  1 71  ? 107.482 118.980 163.882 1.00 18.38  ? 71   PHE A CE2 1 
ATOM   526   C CZ  . PHE A  1 71  ? 106.625 118.875 164.960 1.00 25.32  ? 71   PHE A CZ  1 
ATOM   527   N N   . THR A  1 72  ? 111.151 124.212 163.147 1.00 23.52  ? 72   THR A N   1 
ATOM   528   C CA  . THR A  1 72  ? 111.912 125.444 162.902 1.00 24.52  ? 72   THR A CA  1 
ATOM   529   C C   . THR A  1 72  ? 111.738 125.885 161.461 1.00 24.87  ? 72   THR A C   1 
ATOM   530   O O   . THR A  1 72  ? 112.175 125.192 160.533 1.00 23.90  ? 72   THR A O   1 
ATOM   531   C CB  . THR A  1 72  ? 113.414 125.275 163.304 1.00 22.20  ? 72   THR A CB  1 
ATOM   532   O OG1 . THR A  1 72  ? 113.512 125.036 164.715 1.00 24.48  ? 72   THR A OG1 1 
ATOM   533   C CG2 . THR A  1 72  ? 114.223 126.515 162.957 1.00 22.34  ? 72   THR A CG2 1 
ATOM   534   N N   . LEU A  1 73  ? 111.074 127.028 161.283 1.00 25.95  ? 73   LEU A N   1 
ATOM   535   C CA  . LEU A  1 73  ? 110.766 127.533 159.951 1.00 27.85  ? 73   LEU A CA  1 
ATOM   536   C C   . LEU A  1 73  ? 111.690 128.666 159.515 1.00 29.81  ? 73   LEU A C   1 
ATOM   537   O O   . LEU A  1 73  ? 111.451 129.850 159.785 1.00 30.03  ? 73   LEU A O   1 
ATOM   538   C CB  . LEU A  1 73  ? 109.258 127.893 159.801 1.00 26.34  ? 73   LEU A CB  1 
ATOM   539   C CG  . LEU A  1 73  ? 108.816 128.569 158.467 1.00 26.90  ? 73   LEU A CG  1 
ATOM   540   C CD1 . LEU A  1 73  ? 109.289 127.781 157.197 1.00 31.66  ? 73   LEU A CD1 1 
ATOM   541   C CD2 . LEU A  1 73  ? 107.294 128.821 158.433 1.00 26.26  ? 73   LEU A CD2 1 
ATOM   542   N N   . THR A  1 74  ? 112.765 128.250 158.854 1.00 31.25  ? 74   THR A N   1 
ATOM   543   C CA  . THR A  1 74  ? 113.734 129.132 158.240 1.00 34.30  ? 74   THR A CA  1 
ATOM   544   C C   . THR A  1 74  ? 113.184 129.591 156.910 1.00 37.01  ? 74   THR A C   1 
ATOM   545   O O   . THR A  1 74  ? 112.857 128.772 156.041 1.00 38.65  ? 74   THR A O   1 
ATOM   546   C CB  . THR A  1 74  ? 115.061 128.380 157.940 1.00 33.17  ? 74   THR A CB  1 
ATOM   547   O OG1 . THR A  1 74  ? 115.769 128.113 159.162 1.00 31.06  ? 74   THR A OG1 1 
ATOM   548   C CG2 . THR A  1 74  ? 115.958 129.197 157.036 1.00 33.10  ? 74   THR A CG2 1 
ATOM   549   N N   . ILE A  1 75  ? 113.052 130.895 156.748 1.00 39.55  ? 75   ILE A N   1 
ATOM   550   C CA  . ILE A  1 75  ? 113.050 131.439 155.411 1.00 42.40  ? 75   ILE A CA  1 
ATOM   551   C C   . ILE A  1 75  ? 114.378 132.168 155.391 1.00 42.95  ? 75   ILE A C   1 
ATOM   552   O O   . ILE A  1 75  ? 114.571 133.147 156.125 1.00 43.57  ? 75   ILE A O   1 
ATOM   553   C CB  . ILE A  1 75  ? 111.826 132.333 155.126 1.00 43.06  ? 75   ILE A CB  1 
ATOM   554   C CG1 . ILE A  1 75  ? 110.525 131.531 155.285 1.00 44.78  ? 75   ILE A CG1 1 
ATOM   555   C CG2 . ILE A  1 75  ? 111.891 132.909 153.716 1.00 42.70  ? 75   ILE A CG2 1 
ATOM   556   C CD1 . ILE A  1 75  ? 109.919 131.564 156.715 1.00 47.41  ? 75   ILE A CD1 1 
ATOM   557   N N   . SER A  1 76  ? 115.319 131.638 154.605 1.00 44.25  ? 76   SER A N   1 
ATOM   558   C CA  . SER A  1 76  ? 116.711 132.086 154.707 1.00 45.07  ? 76   SER A CA  1 
ATOM   559   C C   . SER A  1 76  ? 117.168 132.841 153.462 1.00 46.69  ? 76   SER A C   1 
ATOM   560   O O   . SER A  1 76  ? 118.336 133.229 153.346 1.00 45.74  ? 76   SER A O   1 
ATOM   561   C CB  . SER A  1 76  ? 117.645 130.909 155.015 1.00 45.17  ? 76   SER A CB  1 
ATOM   562   O OG  . SER A  1 76  ? 118.224 130.375 153.815 1.00 47.53  ? 76   SER A OG  1 
ATOM   563   N N   . SER A  1 77  ? 116.241 133.013 152.523 1.00 45.30  ? 77   SER A N   1 
ATOM   564   C CA  . SER A  1 77  ? 116.303 134.182 151.649 1.00 45.30  ? 77   SER A CA  1 
ATOM   565   C C   . SER A  1 77  ? 114.935 134.851 151.482 1.00 45.58  ? 77   SER A C   1 
ATOM   566   O O   . SER A  1 77  ? 114.220 134.623 150.497 1.00 44.96  ? 77   SER A O   1 
ATOM   567   C CB  . SER A  1 77  ? 116.955 133.859 150.274 1.00 45.46  ? 77   SER A CB  1 
ATOM   568   O OG  . SER A  1 77  ? 116.943 135.066 149.466 1.00 46.89  ? 77   SER A OG  1 
ATOM   569   N N   . LEU A  1 78  ? 114.585 135.675 152.463 1.00 44.66  ? 78   LEU A N   1 
ATOM   570   C CA  . LEU A  1 78  ? 113.432 136.551 152.352 1.00 44.41  ? 78   LEU A CA  1 
ATOM   571   C C   . LEU A  1 78  ? 113.584 137.455 151.133 1.00 45.19  ? 78   LEU A C   1 
ATOM   572   O O   . LEU A  1 78  ? 114.663 137.977 150.865 1.00 45.32  ? 78   LEU A O   1 
ATOM   573   C CB  . LEU A  1 78  ? 113.317 137.404 153.611 1.00 43.44  ? 78   LEU A CB  1 
ATOM   574   C CG  . LEU A  1 78  ? 111.998 138.102 153.914 1.00 38.41  ? 78   LEU A CG  1 
ATOM   575   C CD1 . LEU A  1 78  ? 110.997 137.079 154.608 1.00 25.82  ? 78   LEU A CD1 1 
ATOM   576   C CD2 . LEU A  1 78  ? 112.312 139.331 154.844 1.00 33.87  ? 78   LEU A CD2 1 
ATOM   577   N N   . GLN A  1 79  ? 112.486 137.613 150.394 1.00 45.73  ? 79   GLN A N   1 
ATOM   578   C CA  . GLN A  1 79  ? 112.426 138.519 149.257 1.00 44.04  ? 79   GLN A CA  1 
ATOM   579   C C   . GLN A  1 79  ? 111.059 139.164 149.362 1.00 43.99  ? 79   GLN A C   1 
ATOM   580   O O   . GLN A  1 79  ? 110.224 138.686 150.136 1.00 42.64  ? 79   GLN A O   1 
ATOM   581   C CB  . GLN A  1 79  ? 112.603 137.772 147.930 1.00 45.25  ? 79   GLN A CB  1 
ATOM   582   C CG  . GLN A  1 79  ? 114.069 137.572 147.475 1.00 42.93  ? 79   GLN A CG  1 
ATOM   583   C CD  . GLN A  1 79  ? 114.938 138.823 147.625 1.00 41.87  ? 79   GLN A CD  1 
ATOM   584   O OE1 . GLN A  1 79  ? 115.331 139.454 146.637 1.00 39.90  ? 79   GLN A OE1 1 
ATOM   585   N NE2 . GLN A  1 79  ? 115.255 139.168 148.865 1.00 44.70  ? 79   GLN A NE2 1 
ATOM   586   N N   . PRO A  1 80  ? 110.818 140.254 148.612 1.00 44.40  ? 80   PRO A N   1 
ATOM   587   C CA  . PRO A  1 80  ? 109.679 141.089 149.000 1.00 44.53  ? 80   PRO A CA  1 
ATOM   588   C C   . PRO A  1 80  ? 108.324 140.491 148.651 1.00 45.04  ? 80   PRO A C   1 
ATOM   589   O O   . PRO A  1 80  ? 107.285 141.016 149.061 1.00 45.11  ? 80   PRO A O   1 
ATOM   590   C CB  . PRO A  1 80  ? 109.910 142.391 148.211 1.00 44.30  ? 80   PRO A CB  1 
ATOM   591   C CG  . PRO A  1 80  ? 111.319 142.303 147.663 1.00 43.65  ? 80   PRO A CG  1 
ATOM   592   C CD  . PRO A  1 80  ? 111.520 140.818 147.447 1.00 43.48  ? 80   PRO A CD  1 
ATOM   593   N N   . GLU A  1 81  ? 108.350 139.396 147.900 1.00 44.97  ? 81   GLU A N   1 
ATOM   594   C CA  . GLU A  1 81  ? 107.143 138.668 147.539 1.00 44.52  ? 81   GLU A CA  1 
ATOM   595   C C   . GLU A  1 81  ? 106.759 137.774 148.716 1.00 44.72  ? 81   GLU A C   1 
ATOM   596   O O   . GLU A  1 81  ? 105.611 137.324 148.849 1.00 43.76  ? 81   GLU A O   1 
ATOM   597   C CB  . GLU A  1 81  ? 107.410 137.832 146.281 1.00 43.95  ? 81   GLU A CB  1 
ATOM   598   C CG  . GLU A  1 81  ? 108.904 137.579 145.977 1.00 43.43  ? 81   GLU A CG  1 
ATOM   599   C CD  . GLU A  1 81  ? 109.581 138.736 145.240 1.00 50.10  ? 81   GLU A CD  1 
ATOM   600   O OE1 . GLU A  1 81  ? 108.870 139.505 144.536 1.00 50.90  ? 81   GLU A OE1 1 
ATOM   601   O OE2 . GLU A  1 81  ? 110.830 138.861 145.348 1.00 48.54  ? 81   GLU A OE2 1 
ATOM   602   N N   . ASP A  1 82  ? 107.746 137.569 149.586 1.00 44.21  ? 82   ASP A N   1 
ATOM   603   C CA  . ASP A  1 82  ? 107.714 136.558 150.638 1.00 42.08  ? 82   ASP A CA  1 
ATOM   604   C C   . ASP A  1 82  ? 107.128 137.101 151.939 1.00 41.88  ? 82   ASP A C   1 
ATOM   605   O O   . ASP A  1 82  ? 106.871 136.334 152.869 1.00 41.73  ? 82   ASP A O   1 
ATOM   606   C CB  . ASP A  1 82  ? 109.140 136.027 150.895 1.00 41.87  ? 82   ASP A CB  1 
ATOM   607   C CG  . ASP A  1 82  ? 109.526 134.887 149.949 1.00 44.37  ? 82   ASP A CG  1 
ATOM   608   O OD1 . ASP A  1 82  ? 108.724 134.527 149.060 1.00 41.23  ? 82   ASP A OD1 1 
ATOM   609   O OD2 . ASP A  1 82  ? 110.644 134.345 150.102 1.00 45.87  ? 82   ASP A OD2 1 
ATOM   610   N N   . PHE A  1 83  ? 106.929 138.425 152.008 1.00 40.18  ? 83   PHE A N   1 
ATOM   611   C CA  . PHE A  1 83  ? 106.319 139.028 153.211 1.00 37.80  ? 83   PHE A CA  1 
ATOM   612   C C   . PHE A  1 83  ? 104.894 138.547 153.372 1.00 36.67  ? 83   PHE A C   1 
ATOM   613   O O   . PHE A  1 83  ? 104.097 138.585 152.423 1.00 37.37  ? 83   PHE A O   1 
ATOM   614   C CB  . PHE A  1 83  ? 106.352 140.568 153.157 1.00 37.67  ? 83   PHE A CB  1 
ATOM   615   C CG  . PHE A  1 83  ? 105.037 141.235 153.535 1.00 35.12  ? 83   PHE A CG  1 
ATOM   616   C CD1 . PHE A  1 83  ? 104.734 141.550 154.860 1.00 37.47  ? 83   PHE A CD1 1 
ATOM   617   C CD2 . PHE A  1 83  ? 104.110 141.572 152.545 1.00 35.39  ? 83   PHE A CD2 1 
ATOM   618   C CE1 . PHE A  1 83  ? 103.519 142.165 155.197 1.00 38.42  ? 83   PHE A CE1 1 
ATOM   619   C CE2 . PHE A  1 83  ? 102.896 142.185 152.871 1.00 37.65  ? 83   PHE A CE2 1 
ATOM   620   C CZ  . PHE A  1 83  ? 102.600 142.484 154.199 1.00 39.11  ? 83   PHE A CZ  1 
ATOM   621   N N   . ALA A  1 84  ? 104.592 138.084 154.579 1.00 36.33  ? 84   ALA A N   1 
ATOM   622   C CA  . ALA A  1 84  ? 103.250 137.645 154.932 1.00 33.71  ? 84   ALA A CA  1 
ATOM   623   C C   . ALA A  1 84  ? 103.307 137.045 156.316 1.00 32.84  ? 84   ALA A C   1 
ATOM   624   O O   . ALA A  1 84  ? 104.340 137.133 157.008 1.00 30.95  ? 84   ALA A O   1 
ATOM   625   C CB  . ALA A  1 84  ? 102.741 136.603 153.938 1.00 32.43  ? 84   ALA A CB  1 
ATOM   626   N N   . THR A  1 85  ? 102.208 136.414 156.710 1.00 33.33  ? 85   THR A N   1 
ATOM   627   C CA  . THR A  1 85  ? 102.181 135.658 157.946 1.00 32.92  ? 85   THR A CA  1 
ATOM   628   C C   . THR A  1 85  ? 102.373 134.167 157.689 1.00 33.79  ? 85   THR A C   1 
ATOM   629   O O   . THR A  1 85  ? 101.785 133.589 156.769 1.00 33.20  ? 85   THR A O   1 
ATOM   630   C CB  . THR A  1 85  ? 100.895 135.925 158.729 1.00 32.21  ? 85   THR A CB  1 
ATOM   631   O OG1 . THR A  1 85  ? 100.618 137.343 158.714 1.00 32.29  ? 85   THR A OG1 1 
ATOM   632   C CG2 . THR A  1 85  ? 101.060 135.460 160.181 1.00 31.77  ? 85   THR A CG2 1 
ATOM   633   N N   . TYR A  1 86  ? 103.216 133.570 158.523 1.00 34.82  ? 86   TYR A N   1 
ATOM   634   C CA  . TYR A  1 86  ? 103.641 132.187 158.394 1.00 35.43  ? 86   TYR A CA  1 
ATOM   635   C C   . TYR A  1 86  ? 103.147 131.405 159.632 1.00 34.25  ? 86   TYR A C   1 
ATOM   636   O O   . TYR A  1 86  ? 103.191 131.936 160.747 1.00 36.32  ? 86   TYR A O   1 
ATOM   637   C CB  . TYR A  1 86  ? 105.169 132.159 158.252 1.00 37.46  ? 86   TYR A CB  1 
ATOM   638   C CG  . TYR A  1 86  ? 105.708 132.807 156.974 1.00 39.84  ? 86   TYR A CG  1 
ATOM   639   C CD1 . TYR A  1 86  ? 106.112 134.144 156.942 1.00 39.55  ? 86   TYR A CD1 1 
ATOM   640   C CD2 . TYR A  1 86  ? 105.832 132.061 155.809 1.00 45.05  ? 86   TYR A CD2 1 
ATOM   641   C CE1 . TYR A  1 86  ? 106.616 134.711 155.766 1.00 41.25  ? 86   TYR A CE1 1 
ATOM   642   C CE2 . TYR A  1 86  ? 106.332 132.613 154.649 1.00 41.27  ? 86   TYR A CE2 1 
ATOM   643   C CZ  . TYR A  1 86  ? 106.718 133.930 154.627 1.00 42.26  ? 86   TYR A CZ  1 
ATOM   644   O OH  . TYR A  1 86  ? 107.207 134.435 153.450 1.00 41.96  ? 86   TYR A OH  1 
ATOM   645   N N   . TYR A  1 87  ? 102.683 130.158 159.442 1.00 32.58  ? 87   TYR A N   1 
ATOM   646   C CA  . TYR A  1 87  ? 101.898 129.415 160.469 1.00 35.01  ? 87   TYR A CA  1 
ATOM   647   C C   . TYR A  1 87  ? 102.221 127.905 160.629 1.00 35.34  ? 87   TYR A C   1 
ATOM   648   O O   . TYR A  1 87  ? 102.738 127.284 159.701 1.00 34.43  ? 87   TYR A O   1 
ATOM   649   C CB  . TYR A  1 87  ? 100.410 129.505 160.126 1.00 34.79  ? 87   TYR A CB  1 
ATOM   650   C CG  . TYR A  1 87  ? 99.718  130.796 160.492 1.00 34.43  ? 87   TYR A CG  1 
ATOM   651   C CD1 . TYR A  1 87  ? 99.721  131.889 159.625 1.00 37.96  ? 87   TYR A CD1 1 
ATOM   652   C CD2 . TYR A  1 87  ? 99.016  130.908 161.688 1.00 38.19  ? 87   TYR A CD2 1 
ATOM   653   C CE1 . TYR A  1 87  ? 99.059  133.068 159.959 1.00 40.21  ? 87   TYR A CE1 1 
ATOM   654   C CE2 . TYR A  1 87  ? 98.355  132.077 162.029 1.00 40.74  ? 87   TYR A CE2 1 
ATOM   655   C CZ  . TYR A  1 87  ? 98.386  133.157 161.167 1.00 37.48  ? 87   TYR A CZ  1 
ATOM   656   O OH  . TYR A  1 87  ? 97.725  134.324 161.520 1.00 30.49  ? 87   TYR A OH  1 
ATOM   657   N N   . CYS A  1 88  ? 101.885 127.322 161.788 1.00 35.97  ? 88   CYS A N   1 
ATOM   658   C CA  . CYS A  1 88  ? 101.981 125.854 161.981 1.00 36.11  ? 88   CYS A CA  1 
ATOM   659   C C   . CYS A  1 88  ? 100.610 125.143 162.184 1.00 35.81  ? 88   CYS A C   1 
ATOM   660   O O   . CYS A  1 88  ? 99.720  125.699 162.818 1.00 38.62  ? 88   CYS A O   1 
ATOM   661   C CB  . CYS A  1 88  ? 103.049 125.464 163.043 1.00 37.99  ? 88   CYS A CB  1 
ATOM   662   S SG  . CYS A  1 88  ? 102.996 126.204 164.757 1.00 39.80  ? 88   CYS A SG  1 
ATOM   663   N N   . GLN A  1 89  ? 100.433 123.948 161.606 1.00 34.60  ? 89   GLN A N   1 
ATOM   664   C CA  . GLN A  1 89  ? 99.213  123.121 161.805 1.00 34.63  ? 89   GLN A CA  1 
ATOM   665   C C   . GLN A  1 89  ? 99.607  121.660 161.975 1.00 35.61  ? 89   GLN A C   1 
ATOM   666   O O   . GLN A  1 89  ? 100.398 121.144 161.162 1.00 35.24  ? 89   GLN A O   1 
ATOM   667   C CB  . GLN A  1 89  ? 98.223  123.227 160.608 1.00 35.64  ? 89   GLN A CB  1 
ATOM   668   C CG  . GLN A  1 89  ? 96.816  122.527 160.806 1.00 32.36  ? 89   GLN A CG  1 
ATOM   669   C CD  . GLN A  1 89  ? 95.984  122.330 159.504 1.00 30.97  ? 89   GLN A CD  1 
ATOM   670   O OE1 . GLN A  1 89  ? 96.452  121.730 158.534 1.00 30.21  ? 89   GLN A OE1 1 
ATOM   671   N NE2 . GLN A  1 89  ? 94.741  122.808 159.513 1.00 32.67  ? 89   GLN A NE2 1 
ATOM   672   N N   . GLN A  1 90  ? 99.067  120.986 163.015 1.00 36.33  ? 90   GLN A N   1 
ATOM   673   C CA  . GLN A  1 90  ? 99.184  119.513 163.017 1.00 38.26  ? 90   GLN A CA  1 
ATOM   674   C C   . GLN A  1 90  ? 98.086  118.924 162.134 1.00 38.13  ? 90   GLN A C   1 
ATOM   675   O O   . GLN A  1 90  ? 96.931  119.364 162.192 1.00 37.82  ? 90   GLN A O   1 
ATOM   676   C CB  . GLN A  1 90  ? 99.040  118.919 164.423 1.00 38.28  ? 90   GLN A CB  1 
ATOM   677   C CG  . GLN A  1 90  ? 97.745  119.332 165.132 1.00 40.32  ? 90   GLN A CG  1 
ATOM   678   C CD  . GLN A  1 90  ? 96.921  118.170 165.653 1.00 42.59  ? 90   GLN A CD  1 
ATOM   679   O OE1 . GLN A  1 90  ? 97.433  117.083 165.918 1.00 43.06  ? 90   GLN A OE1 1 
ATOM   680   N NE2 . GLN A  1 90  ? 95.631  118.410 165.828 1.00 40.06  ? 90   GLN A NE2 1 
ATOM   681   N N   . SER A  1 91  ? 98.458  117.949 161.301 1.00 38.76  ? 91   SER A N   1 
ATOM   682   C CA  . SER A  1 91  ? 97.492  117.016 160.719 1.00 38.63  ? 91   SER A CA  1 
ATOM   683   C C   . SER A  1 91  ? 97.359  115.833 161.680 1.00 41.21  ? 91   SER A C   1 
ATOM   684   O O   . SER A  1 91  ? 96.549  114.925 161.456 1.00 40.45  ? 91   SER A O   1 
ATOM   685   C CB  . SER A  1 91  ? 97.990  116.517 159.353 1.00 40.15  ? 91   SER A CB  1 
ATOM   686   O OG  . SER A  1 91  ? 97.232  115.392 158.896 1.00 35.75  ? 91   SER A OG  1 
ATOM   687   N N   . TYR A  1 92  ? 98.161  115.869 162.748 1.00 42.92  ? 92   TYR A N   1 
ATOM   688   C CA  . TYR A  1 92  ? 98.384  114.714 163.623 1.00 43.68  ? 92   TYR A CA  1 
ATOM   689   C C   . TYR A  1 92  ? 97.074  114.113 164.099 1.00 44.75  ? 92   TYR A C   1 
ATOM   690   O O   . TYR A  1 92  ? 96.755  112.957 163.813 1.00 45.03  ? 92   TYR A O   1 
ATOM   691   C CB  . TYR A  1 92  ? 99.235  115.125 164.835 1.00 43.35  ? 92   TYR A CB  1 
ATOM   692   C CG  . TYR A  1 92  ? 99.705  113.962 165.684 1.00 43.95  ? 92   TYR A CG  1 
ATOM   693   C CD1 . TYR A  1 92  ? 101.010 113.483 165.568 1.00 45.42  ? 92   TYR A CD1 1 
ATOM   694   C CD2 . TYR A  1 92  ? 98.842  113.330 166.599 1.00 44.97  ? 92   TYR A CD2 1 
ATOM   695   C CE1 . TYR A  1 92  ? 101.460 112.417 166.347 1.00 42.94  ? 92   TYR A CE1 1 
ATOM   696   C CE2 . TYR A  1 92  ? 99.285  112.258 167.373 1.00 44.57  ? 92   TYR A CE2 1 
ATOM   697   C CZ  . TYR A  1 92  ? 100.591 111.808 167.244 1.00 43.08  ? 92   TYR A CZ  1 
ATOM   698   O OH  . TYR A  1 92  ? 101.030 110.756 168.022 1.00 44.84  ? 92   TYR A OH  1 
ATOM   699   N N   . SER A  1 93  ? 96.328  114.933 164.824 1.00 45.56  ? 93   SER A N   1 
ATOM   700   C CA  . SER A  1 93  ? 95.094  114.534 165.451 1.00 44.50  ? 93   SER A CA  1 
ATOM   701   C C   . SER A  1 93  ? 94.022  115.537 165.067 1.00 43.56  ? 93   SER A C   1 
ATOM   702   O O   . SER A  1 93  ? 94.324  116.627 164.573 1.00 43.62  ? 93   SER A O   1 
ATOM   703   C CB  . SER A  1 93  ? 95.282  114.503 166.968 1.00 43.45  ? 93   SER A CB  1 
ATOM   704   O OG  . SER A  1 93  ? 94.124  114.014 167.620 1.00 49.10  ? 93   SER A OG  1 
ATOM   705   N N   . THR A  1 94  ? 92.767  115.150 165.276 1.00 41.48  ? 94   THR A N   1 
ATOM   706   C CA  . THR A  1 94  ? 91.662  116.046 165.002 1.00 40.83  ? 94   THR A CA  1 
ATOM   707   C C   . THR A  1 94  ? 90.930  116.162 166.319 1.00 41.23  ? 94   THR A C   1 
ATOM   708   O O   . THR A  1 94  ? 90.757  115.159 167.026 1.00 41.57  ? 94   THR A O   1 
ATOM   709   C CB  . THR A  1 94  ? 90.687  115.466 163.965 1.00 40.27  ? 94   THR A CB  1 
ATOM   710   O OG1 . THR A  1 94  ? 89.919  114.413 164.568 1.00 40.27  ? 94   THR A OG1 1 
ATOM   711   C CG2 . THR A  1 94  ? 91.431  114.913 162.737 1.00 37.55  ? 94   THR A CG2 1 
ATOM   712   N N   . PRO A  1 95  ? 90.514  117.386 166.681 1.00 40.28  ? 95   PRO A N   1 
ATOM   713   C CA  . PRO A  1 95  ? 90.793  118.669 166.018 1.00 40.87  ? 95   PRO A CA  1 
ATOM   714   C C   . PRO A  1 95  ? 92.267  118.937 165.646 1.00 41.43  ? 95   PRO A C   1 
ATOM   715   O O   . PRO A  1 95  ? 93.172  118.637 166.438 1.00 39.95  ? 95   PRO A O   1 
ATOM   716   C CB  . PRO A  1 95  ? 90.327  119.705 167.058 1.00 41.83  ? 95   PRO A CB  1 
ATOM   717   C CG  . PRO A  1 95  ? 90.047  118.928 168.333 1.00 40.42  ? 95   PRO A CG  1 
ATOM   718   C CD  . PRO A  1 95  ? 89.627  117.569 167.843 1.00 36.85  ? 95   PRO A CD  1 
ATOM   719   N N   . ASN A  1 96  ? 92.479  119.482 164.442 1.00 41.80  ? 96   ASN A N   1 
ATOM   720   C CA  . ASN A  1 96  ? 93.764  120.062 164.027 1.00 41.79  ? 96   ASN A CA  1 
ATOM   721   C C   . ASN A  1 96  ? 93.775  121.528 164.452 1.00 41.87  ? 96   ASN A C   1 
ATOM   722   O O   . ASN A  1 96  ? 92.718  122.166 164.506 1.00 42.06  ? 96   ASN A O   1 
ATOM   723   C CB  . ASN A  1 96  ? 93.980  119.954 162.508 1.00 41.84  ? 96   ASN A CB  1 
ATOM   724   C CG  . ASN A  1 96  ? 93.404  118.673 161.915 1.00 44.37  ? 96   ASN A CG  1 
ATOM   725   O OD1 . ASN A  1 96  ? 93.981  117.591 162.040 1.00 47.18  ? 96   ASN A OD1 1 
ATOM   726   N ND2 . ASN A  1 96  ? 92.265  118.801 161.244 1.00 46.30  ? 96   ASN A ND2 1 
ATOM   727   N N   . THR A  1 97  ? 94.950  122.069 164.751 1.00 40.96  ? 97   THR A N   1 
ATOM   728   C CA  . THR A  1 97  ? 94.992  123.320 165.495 1.00 40.15  ? 97   THR A CA  1 
ATOM   729   C C   . THR A  1 97  ? 96.104  124.170 164.913 1.00 39.48  ? 97   THR A C   1 
ATOM   730   O O   . THR A  1 97  ? 97.279  123.727 164.942 1.00 36.48  ? 97   THR A O   1 
ATOM   731   C CB  . THR A  1 97  ? 95.253  123.028 166.994 1.00 40.82  ? 97   THR A CB  1 
ATOM   732   O OG1 . THR A  1 97  ? 96.416  122.196 167.127 1.00 41.11  ? 97   THR A OG1 1 
ATOM   733   C CG2 . THR A  1 97  ? 94.068  122.298 167.644 1.00 38.89  ? 97   THR A CG2 1 
ATOM   734   N N   . PHE A  1 98  ? 95.766  125.351 164.357 1.00 38.56  ? 98   PHE A N   1 
ATOM   735   C CA  . PHE A  1 98  ? 96.847  126.144 163.739 1.00 38.88  ? 98   PHE A CA  1 
ATOM   736   C C   . PHE A  1 98  ? 97.783  126.714 164.783 1.00 37.82  ? 98   PHE A C   1 
ATOM   737   O O   . PHE A  1 98  ? 97.444  126.769 165.984 1.00 37.78  ? 98   PHE A O   1 
ATOM   738   C CB  . PHE A  1 98  ? 96.322  127.227 162.780 1.00 38.64  ? 98   PHE A CB  1 
ATOM   739   C CG  . PHE A  1 98  ? 96.307  126.778 161.352 1.00 42.90  ? 98   PHE A CG  1 
ATOM   740   C CD1 . PHE A  1 98  ? 95.111  126.469 160.719 1.00 42.14  ? 98   PHE A CD1 1 
ATOM   741   C CD2 . PHE A  1 98  ? 97.502  126.597 160.655 1.00 42.06  ? 98   PHE A CD2 1 
ATOM   742   C CE1 . PHE A  1 98  ? 95.100  126.021 159.404 1.00 38.41  ? 98   PHE A CE1 1 
ATOM   743   C CE2 . PHE A  1 98  ? 97.498  126.148 159.347 1.00 42.13  ? 98   PHE A CE2 1 
ATOM   744   C CZ  . PHE A  1 98  ? 96.295  125.854 158.720 1.00 36.22  ? 98   PHE A CZ  1 
ATOM   745   N N   . GLY A  1 99  ? 98.973  127.110 164.336 1.00 36.49  ? 99   GLY A N   1 
ATOM   746   C CA  . GLY A  1 99  ? 99.848  127.907 165.188 1.00 37.40  ? 99   GLY A CA  1 
ATOM   747   C C   . GLY A  1 99  ? 99.132  129.231 165.339 1.00 38.31  ? 99   GLY A C   1 
ATOM   748   O O   . GLY A  1 99  ? 98.020  129.406 164.828 1.00 38.01  ? 99   GLY A O   1 
ATOM   749   N N   . GLN A  1 100 ? 99.748  130.183 166.021 1.00 37.78  ? 100  GLN A N   1 
ATOM   750   C CA  . GLN A  1 100 ? 99.072  131.460 166.190 1.00 38.26  ? 100  GLN A CA  1 
ATOM   751   C C   . GLN A  1 100 ? 99.804  132.651 165.556 1.00 41.29  ? 100  GLN A C   1 
ATOM   752   O O   . GLN A  1 100 ? 99.579  133.813 165.940 1.00 42.44  ? 100  GLN A O   1 
ATOM   753   C CB  . GLN A  1 100 ? 98.732  131.708 167.664 1.00 36.32  ? 100  GLN A CB  1 
ATOM   754   C CG  . GLN A  1 100 ? 99.811  132.448 168.427 1.00 33.74  ? 100  GLN A CG  1 
ATOM   755   C CD  . GLN A  1 100 ? 99.948  131.995 169.861 1.00 30.44  ? 100  GLN A CD  1 
ATOM   756   O OE1 . GLN A  1 100 ? 101.022 131.548 170.275 1.00 32.44  ? 100  GLN A OE1 1 
ATOM   757   N NE2 . GLN A  1 100 ? 98.868  132.107 170.635 1.00 15.75  ? 100  GLN A NE2 1 
ATOM   758   N N   . GLY A  1 101 ? 100.682 132.375 164.594 1.00 43.66  ? 101  GLY A N   1 
ATOM   759   C CA  . GLY A  1 101 ? 101.096 133.382 163.607 1.00 46.35  ? 101  GLY A CA  1 
ATOM   760   C C   . GLY A  1 101 ? 102.276 134.309 163.852 1.00 47.88  ? 101  GLY A C   1 
ATOM   761   O O   . GLY A  1 101 ? 102.183 135.248 164.651 1.00 47.42  ? 101  GLY A O   1 
ATOM   762   N N   . THR A  1 102 ? 103.379 134.053 163.144 1.00 48.83  ? 102  THR A N   1 
ATOM   763   C CA  . THR A  1 102 ? 104.488 135.008 163.014 1.00 50.30  ? 102  THR A CA  1 
ATOM   764   C C   . THR A  1 102 ? 104.342 135.752 161.693 1.00 49.61  ? 102  THR A C   1 
ATOM   765   O O   . THR A  1 102 ? 104.312 135.121 160.610 1.00 50.77  ? 102  THR A O   1 
ATOM   766   C CB  . THR A  1 102 ? 105.862 134.312 162.950 1.00 50.03  ? 102  THR A CB  1 
ATOM   767   O OG1 . THR A  1 102 ? 106.000 133.395 164.042 1.00 55.16  ? 102  THR A OG1 1 
ATOM   768   C CG2 . THR A  1 102 ? 106.996 135.350 162.986 1.00 48.51  ? 102  THR A CG2 1 
ATOM   769   N N   . LYS A  1 103 ? 104.260 137.080 161.759 1.00 48.34  ? 103  LYS A N   1 
ATOM   770   C CA  . LYS A  1 103 ? 104.065 137.883 160.551 1.00 48.22  ? 103  LYS A CA  1 
ATOM   771   C C   . LYS A  1 103 ? 105.349 138.565 160.088 1.00 46.49  ? 103  LYS A C   1 
ATOM   772   O O   . LYS A  1 103 ? 105.856 139.466 160.767 1.00 46.14  ? 103  LYS A O   1 
ATOM   773   C CB  . LYS A  1 103 ? 102.988 138.949 160.777 1.00 48.45  ? 103  LYS A CB  1 
ATOM   774   C CG  . LYS A  1 103 ? 101.660 138.448 161.330 1.00 52.33  ? 103  LYS A CG  1 
ATOM   775   C CD  . LYS A  1 103 ? 100.648 139.587 161.347 1.00 58.64  ? 103  LYS A CD  1 
ATOM   776   C CE  . LYS A  1 103 ? 99.325  139.160 160.670 1.00 58.82  ? 103  LYS A CE  1 
ATOM   777   N NZ  . LYS A  1 103 ? 98.520  140.358 160.221 1.00 59.56  ? 103  LYS A NZ  1 
ATOM   778   N N   . VAL A  1 104 ? 105.883 138.149 158.941 1.00 45.50  ? 104  VAL A N   1 
ATOM   779   C CA  . VAL A  1 104 ? 107.074 138.818 158.439 1.00 44.82  ? 104  VAL A CA  1 
ATOM   780   C C   . VAL A  1 104 ? 106.726 140.113 157.748 1.00 45.92  ? 104  VAL A C   1 
ATOM   781   O O   . VAL A  1 104 ? 105.706 140.243 157.067 1.00 45.12  ? 104  VAL A O   1 
ATOM   782   C CB  . VAL A  1 104 ? 107.976 137.952 157.519 1.00 43.89  ? 104  VAL A CB  1 
ATOM   783   C CG1 . VAL A  1 104 ? 109.298 138.726 157.190 1.00 42.90  ? 104  VAL A CG1 1 
ATOM   784   C CG2 . VAL A  1 104 ? 108.289 136.616 158.201 1.00 40.70  ? 104  VAL A CG2 1 
ATOM   785   N N   . GLU A  1 105 ? 107.619 141.062 157.973 1.00 47.68  ? 105  GLU A N   1 
ATOM   786   C CA  . GLU A  1 105 ? 107.595 142.353 157.354 1.00 48.49  ? 105  GLU A CA  1 
ATOM   787   C C   . GLU A  1 105 ? 108.681 142.470 156.305 1.00 48.72  ? 105  GLU A C   1 
ATOM   788   O O   . GLU A  1 105 ? 109.833 142.054 156.559 1.00 48.59  ? 105  GLU A O   1 
ATOM   789   C CB  . GLU A  1 105 ? 107.848 143.427 158.418 1.00 48.37  ? 105  GLU A CB  1 
ATOM   790   C CG  . GLU A  1 105 ? 107.337 144.755 157.994 1.00 51.25  ? 105  GLU A CG  1 
ATOM   791   C CD  . GLU A  1 105 ? 105.974 144.610 157.350 1.00 55.54  ? 105  GLU A CD  1 
ATOM   792   O OE1 . GLU A  1 105 ? 105.892 144.341 156.115 1.00 47.23  ? 105  GLU A OE1 1 
ATOM   793   O OE2 . GLU A  1 105 ? 104.972 144.746 158.079 1.00 58.33  ? 105  GLU A OE2 1 
ATOM   794   N N   . ILE A  1 106 ? 108.339 143.022 155.136 1.00 49.61  ? 106  ILE A N   1 
ATOM   795   C CA  . ILE A  1 106 ? 109.401 143.600 154.312 1.00 51.75  ? 106  ILE A CA  1 
ATOM   796   C C   . ILE A  1 106 ? 109.240 145.113 154.274 1.00 52.20  ? 106  ILE A C   1 
ATOM   797   O O   . ILE A  1 106 ? 110.215 145.849 154.469 1.00 52.67  ? 106  ILE A O   1 
ATOM   798   C CB  . ILE A  1 106 ? 109.461 143.070 152.847 1.00 52.55  ? 106  ILE A CB  1 
ATOM   799   C CG1 . ILE A  1 106 ? 109.120 141.577 152.778 1.00 50.78  ? 106  ILE A CG1 1 
ATOM   800   C CG2 . ILE A  1 106 ? 110.880 143.365 152.217 1.00 51.14  ? 106  ILE A CG2 1 
ATOM   801   C CD1 . ILE A  1 106 ? 110.301 140.668 152.699 1.00 52.11  ? 106  ILE A CD1 1 
ATOM   802   N N   . ASP B  1 1   ? 93.891  108.318 144.349 1.00 38.59  ? 1    ASP B N   1 
ATOM   803   C CA  . ASP B  1 1   ? 93.880  106.821 144.508 1.00 38.47  ? 1    ASP B CA  1 
ATOM   804   C C   . ASP B  1 1   ? 95.243  106.225 144.129 1.00 38.27  ? 1    ASP B C   1 
ATOM   805   O O   . ASP B  1 1   ? 95.668  106.333 142.973 1.00 39.67  ? 1    ASP B O   1 
ATOM   806   C CB  . ASP B  1 1   ? 92.750  106.201 143.668 1.00 38.49  ? 1    ASP B CB  1 
ATOM   807   C CG  . ASP B  1 1   ? 92.751  104.677 143.702 1.00 37.19  ? 1    ASP B CG  1 
ATOM   808   O OD1 . ASP B  1 1   ? 92.562  104.093 144.792 1.00 32.13  ? 1    ASP B OD1 1 
ATOM   809   O OD2 . ASP B  1 1   ? 92.932  104.058 142.624 1.00 35.72  ? 1    ASP B OD2 1 
ATOM   810   N N   . ILE B  1 2   ? 95.923  105.595 145.099 1.00 37.22  ? 2    ILE B N   1 
ATOM   811   C CA  . ILE B  1 2   ? 97.341  105.212 144.896 1.00 36.02  ? 2    ILE B CA  1 
ATOM   812   C C   . ILE B  1 2   ? 97.769  103.746 145.099 1.00 35.22  ? 2    ILE B C   1 
ATOM   813   O O   . ILE B  1 2   ? 97.668  103.170 146.187 1.00 34.87  ? 2    ILE B O   1 
ATOM   814   C CB  . ILE B  1 2   ? 98.322  106.138 145.675 1.00 35.80  ? 2    ILE B CB  1 
ATOM   815   C CG1 . ILE B  1 2   ? 98.208  107.576 145.170 1.00 33.75  ? 2    ILE B CG1 1 
ATOM   816   C CG2 . ILE B  1 2   ? 99.782  105.669 145.505 1.00 35.06  ? 2    ILE B CG2 1 
ATOM   817   C CD1 . ILE B  1 2   ? 98.664  108.628 146.218 1.00 24.91  ? 2    ILE B CD1 1 
ATOM   818   N N   . GLN B  1 3   ? 98.256  103.195 143.988 1.00 34.10  ? 3    GLN B N   1 
ATOM   819   C CA  . GLN B  1 3   ? 99.076  101.989 143.894 1.00 34.04  ? 3    GLN B CA  1 
ATOM   820   C C   . GLN B  1 3   ? 100.198 101.890 144.932 1.00 34.23  ? 3    GLN B C   1 
ATOM   821   O O   . GLN B  1 3   ? 100.998 102.817 145.060 1.00 33.91  ? 3    GLN B O   1 
ATOM   822   C CB  . GLN B  1 3   ? 99.735  102.018 142.506 1.00 35.95  ? 3    GLN B CB  1 
ATOM   823   C CG  . GLN B  1 3   ? 99.972  100.672 141.852 1.00 36.06  ? 3    GLN B CG  1 
ATOM   824   C CD  . GLN B  1 3   ? 98.737  100.160 141.130 1.00 41.96  ? 3    GLN B CD  1 
ATOM   825   O OE1 . GLN B  1 3   ? 98.836  99.592  140.039 1.00 45.99  ? 3    GLN B OE1 1 
ATOM   826   N NE2 . GLN B  1 3   ? 97.565  100.358 141.733 1.00 40.14  ? 3    GLN B NE2 1 
ATOM   827   N N   . MET B  1 4   ? 100.275 100.770 145.650 1.00 34.13  ? 4    MET B N   1 
ATOM   828   C CA  . MET B  1 4   ? 101.461 100.464 146.463 1.00 33.58  ? 4    MET B CA  1 
ATOM   829   C C   . MET B  1 4   ? 102.135 99.178  145.990 1.00 33.88  ? 4    MET B C   1 
ATOM   830   O O   . MET B  1 4   ? 101.449 98.185  145.683 1.00 33.95  ? 4    MET B O   1 
ATOM   831   C CB  . MET B  1 4   ? 101.124 100.393 147.958 1.00 31.85  ? 4    MET B CB  1 
ATOM   832   C CG  . MET B  1 4   ? 100.998 101.756 148.628 1.00 35.20  ? 4    MET B CG  1 
ATOM   833   S SD  . MET B  1 4   ? 102.073 103.008 147.866 1.00 40.66  ? 4    MET B SD  1 
ATOM   834   C CE  . MET B  1 4   ? 102.473 104.003 149.311 1.00 30.25  ? 4    MET B CE  1 
ATOM   835   N N   . THR B  1 5   ? 103.466 99.204  145.911 1.00 32.20  ? 5    THR B N   1 
ATOM   836   C CA  . THR B  1 5   ? 104.221 98.003  145.568 1.00 30.54  ? 5    THR B CA  1 
ATOM   837   C C   . THR B  1 5   ? 105.189 97.752  146.693 1.00 28.85  ? 5    THR B C   1 
ATOM   838   O O   . THR B  1 5   ? 106.116 98.539  146.900 1.00 27.80  ? 5    THR B O   1 
ATOM   839   C CB  . THR B  1 5   ? 105.022 98.188  144.267 1.00 30.37  ? 5    THR B CB  1 
ATOM   840   O OG1 . THR B  1 5   ? 105.453 99.555  144.150 1.00 32.69  ? 5    THR B OG1 1 
ATOM   841   C CG2 . THR B  1 5   ? 104.183 97.807  143.057 1.00 24.14  ? 5    THR B CG2 1 
ATOM   842   N N   . GLN B  1 6   ? 104.960 96.675  147.432 1.00 28.20  ? 6    GLN B N   1 
ATOM   843   C CA  . GLN B  1 6   ? 105.846 96.256  148.506 1.00 28.69  ? 6    GLN B CA  1 
ATOM   844   C C   . GLN B  1 6   ? 106.602 95.033  147.973 1.00 29.56  ? 6    GLN B C   1 
ATOM   845   O O   . GLN B  1 6   ? 106.062 94.285  147.124 1.00 27.46  ? 6    GLN B O   1 
ATOM   846   C CB  . GLN B  1 6   ? 104.986 95.930  149.725 1.00 28.82  ? 6    GLN B CB  1 
ATOM   847   C CG  . GLN B  1 6   ? 105.688 95.523  150.996 1.00 27.58  ? 6    GLN B CG  1 
ATOM   848   C CD  . GLN B  1 6   ? 104.704 95.404  152.153 1.00 28.75  ? 6    GLN B CD  1 
ATOM   849   O OE1 . GLN B  1 6   ? 103.490 95.632  151.997 1.00 24.64  ? 6    GLN B OE1 1 
ATOM   850   N NE2 . GLN B  1 6   ? 105.226 95.061  153.326 1.00 25.64  ? 6    GLN B NE2 1 
ATOM   851   N N   . SER B  1 7   ? 107.846 94.834  148.430 1.00 29.75  ? 7    SER B N   1 
ATOM   852   C CA  . SER B  1 7   ? 108.714 93.726  147.980 1.00 30.02  ? 7    SER B CA  1 
ATOM   853   C C   . SER B  1 7   ? 109.679 93.295  149.091 1.00 30.74  ? 7    SER B C   1 
ATOM   854   O O   . SER B  1 7   ? 110.219 94.155  149.796 1.00 33.37  ? 7    SER B O   1 
ATOM   855   C CB  . SER B  1 7   ? 109.543 94.155  146.760 1.00 31.24  ? 7    SER B CB  1 
ATOM   856   O OG  . SER B  1 7   ? 110.562 95.082  147.135 1.00 29.99  ? 7    SER B OG  1 
ATOM   857   N N   . PRO B  1 8   ? 109.911 91.975  149.260 1.00 29.58  ? 8    PRO B N   1 
ATOM   858   C CA  . PRO B  1 8   ? 109.289 90.860  148.553 1.00 30.87  ? 8    PRO B CA  1 
ATOM   859   C C   . PRO B  1 8   ? 107.921 90.542  149.159 1.00 30.55  ? 8    PRO B C   1 
ATOM   860   O O   . PRO B  1 8   ? 107.432 91.294  150.009 1.00 27.97  ? 8    PRO B O   1 
ATOM   861   C CB  . PRO B  1 8   ? 110.266 89.710  148.810 1.00 31.16  ? 8    PRO B CB  1 
ATOM   862   C CG  . PRO B  1 8   ? 110.837 90.004  150.146 1.00 27.79  ? 8    PRO B CG  1 
ATOM   863   C CD  . PRO B  1 8   ? 110.888 91.507  150.266 1.00 28.97  ? 8    PRO B CD  1 
ATOM   864   N N   . SER B  1 9   ? 107.316 89.439  148.721 1.00 31.93  ? 9    SER B N   1 
ATOM   865   C CA  . SER B  1 9   ? 106.036 88.991  149.269 1.00 32.89  ? 9    SER B CA  1 
ATOM   866   C C   . SER B  1 9   ? 106.258 88.100  150.500 1.00 36.36  ? 9    SER B C   1 
ATOM   867   O O   . SER B  1 9   ? 105.518 88.221  151.492 1.00 38.23  ? 9    SER B O   1 
ATOM   868   C CB  . SER B  1 9   ? 105.199 88.275  148.197 1.00 33.10  ? 9    SER B CB  1 
ATOM   869   O OG  . SER B  1 9   ? 104.670 89.223  147.266 1.00 34.30  ? 9    SER B OG  1 
ATOM   870   N N   . SER B  1 10  ? 107.270 87.223  150.446 1.00 35.99  ? 10   SER B N   1 
ATOM   871   C CA  . SER B  1 10  ? 107.622 86.354  151.598 1.00 35.74  ? 10   SER B CA  1 
ATOM   872   C C   . SER B  1 10  ? 109.137 86.313  151.919 1.00 34.95  ? 10   SER B C   1 
ATOM   873   O O   . SER B  1 10  ? 109.980 86.761  151.085 1.00 35.39  ? 10   SER B O   1 
ATOM   874   C CB  . SER B  1 10  ? 107.088 84.932  151.391 1.00 36.74  ? 10   SER B CB  1 
ATOM   875   O OG  . SER B  1 10  ? 108.069 84.087  150.815 1.00 39.45  ? 10   SER B OG  1 
ATOM   876   N N   . LEU B  1 11  ? 109.492 85.770  153.092 1.00 33.56  ? 11   LEU B N   1 
ATOM   877   C CA  . LEU B  1 11  ? 110.851 85.939  153.622 1.00 32.61  ? 11   LEU B CA  1 
ATOM   878   C C   . LEU B  1 11  ? 111.306 84.885  154.636 1.00 33.41  ? 11   LEU B C   1 
ATOM   879   O O   . LEU B  1 11  ? 110.490 84.375  155.408 1.00 34.11  ? 11   LEU B O   1 
ATOM   880   C CB  . LEU B  1 11  ? 110.940 87.314  154.281 1.00 30.74  ? 11   LEU B CB  1 
ATOM   881   C CG  . LEU B  1 11  ? 112.304 87.954  154.523 1.00 27.98  ? 11   LEU B CG  1 
ATOM   882   C CD1 . LEU B  1 11  ? 112.683 88.895  153.345 1.00 20.05  ? 11   LEU B CD1 1 
ATOM   883   C CD2 . LEU B  1 11  ? 112.247 88.724  155.811 1.00 14.33  ? 11   LEU B CD2 1 
ATOM   884   N N   . SER B  1 12  ? 112.603 84.580  154.646 1.00 31.73  ? 12   SER B N   1 
ATOM   885   C CA  . SER B  1 12  ? 113.174 83.803  155.749 1.00 31.76  ? 12   SER B CA  1 
ATOM   886   C C   . SER B  1 12  ? 114.433 84.438  156.339 1.00 32.06  ? 12   SER B C   1 
ATOM   887   O O   . SER B  1 12  ? 115.115 85.226  155.675 1.00 32.66  ? 12   SER B O   1 
ATOM   888   C CB  . SER B  1 12  ? 113.404 82.334  155.350 1.00 32.00  ? 12   SER B CB  1 
ATOM   889   O OG  . SER B  1 12  ? 112.158 81.683  155.133 1.00 33.51  ? 12   SER B OG  1 
ATOM   890   N N   . ALA B  1 13  ? 114.707 84.109  157.596 1.00 30.43  ? 13   ALA B N   1 
ATOM   891   C CA  . ALA B  1 13  ? 115.804 84.695  158.353 1.00 28.33  ? 13   ALA B CA  1 
ATOM   892   C C   . ALA B  1 13  ? 115.775 84.034  159.719 1.00 28.95  ? 13   ALA B C   1 
ATOM   893   O O   . ALA B  1 13  ? 115.140 82.985  159.888 1.00 27.20  ? 13   ALA B O   1 
ATOM   894   C CB  . ALA B  1 13  ? 115.636 86.206  158.472 1.00 27.37  ? 13   ALA B CB  1 
ATOM   895   N N   . SER B  1 14  ? 116.440 84.644  160.697 1.00 28.47  ? 14   SER B N   1 
ATOM   896   C CA  . SER B  1 14  ? 116.641 84.000  161.989 1.00 28.59  ? 14   SER B CA  1 
ATOM   897   C C   . SER B  1 14  ? 117.286 84.942  162.989 1.00 28.78  ? 14   SER B C   1 
ATOM   898   O O   . SER B  1 14  ? 118.020 85.856  162.620 1.00 30.58  ? 14   SER B O   1 
ATOM   899   C CB  . SER B  1 14  ? 117.532 82.765  161.812 1.00 30.56  ? 14   SER B CB  1 
ATOM   900   O OG  . SER B  1 14  ? 118.603 83.041  160.917 1.00 31.98  ? 14   SER B OG  1 
ATOM   901   N N   . VAL B  1 15  ? 117.021 84.683  164.262 1.00 27.18  ? 15   VAL B N   1 
ATOM   902   C CA  . VAL B  1 15  ? 117.360 85.622  165.326 1.00 24.95  ? 15   VAL B CA  1 
ATOM   903   C C   . VAL B  1 15  ? 118.748 86.246  165.123 1.00 27.64  ? 15   VAL B C   1 
ATOM   904   O O   . VAL B  1 15  ? 119.764 85.550  165.178 1.00 29.66  ? 15   VAL B O   1 
ATOM   905   C CB  . VAL B  1 15  ? 117.246 84.910  166.687 1.00 22.32  ? 15   VAL B CB  1 
ATOM   906   C CG1 . VAL B  1 15  ? 116.830 85.906  167.775 1.00 22.13  ? 15   VAL B CG1 1 
ATOM   907   C CG2 . VAL B  1 15  ? 116.205 83.769  166.586 1.00 20.15  ? 15   VAL B CG2 1 
ATOM   908   N N   . GLY B  1 16  ? 118.770 87.554  164.859 1.00 29.32  ? 16   GLY B N   1 
ATOM   909   C CA  . GLY B  1 16  ? 120.003 88.291  164.549 1.00 29.53  ? 16   GLY B CA  1 
ATOM   910   C C   . GLY B  1 16  ? 120.005 88.842  163.132 1.00 30.87  ? 16   GLY B C   1 
ATOM   911   O O   . GLY B  1 16  ? 120.459 89.969  162.884 1.00 28.67  ? 16   GLY B O   1 
ATOM   912   N N   . ASP B  1 17  ? 119.481 88.029  162.213 1.00 30.23  ? 17   ASP B N   1 
ATOM   913   C CA  . ASP B  1 17  ? 119.401 88.364  160.786 1.00 33.09  ? 17   ASP B CA  1 
ATOM   914   C C   . ASP B  1 17  ? 118.635 89.660  160.478 1.00 34.37  ? 17   ASP B C   1 
ATOM   915   O O   . ASP B  1 17  ? 117.777 90.103  161.247 1.00 33.36  ? 17   ASP B O   1 
ATOM   916   C CB  . ASP B  1 17  ? 118.838 87.171  159.996 1.00 33.90  ? 17   ASP B CB  1 
ATOM   917   C CG  . ASP B  1 17  ? 119.843 86.015  159.869 1.00 37.08  ? 17   ASP B CG  1 
ATOM   918   O OD1 . ASP B  1 17  ? 120.796 85.943  160.682 1.00 32.43  ? 17   ASP B OD1 1 
ATOM   919   O OD2 . ASP B  1 17  ? 119.672 85.172  158.949 1.00 41.28  ? 17   ASP B OD2 1 
ATOM   920   N N   . ARG B  1 18  ? 118.994 90.259  159.346 1.00 34.73  ? 18   ARG B N   1 
ATOM   921   C CA  . ARG B  1 18  ? 118.485 91.550  158.908 1.00 37.42  ? 18   ARG B CA  1 
ATOM   922   C C   . ARG B  1 18  ? 117.371 91.433  157.895 1.00 37.35  ? 18   ARG B C   1 
ATOM   923   O O   . ARG B  1 18  ? 117.313 90.463  157.132 1.00 40.36  ? 18   ARG B O   1 
ATOM   924   C CB  . ARG B  1 18  ? 119.618 92.348  158.277 1.00 37.73  ? 18   ARG B CB  1 
ATOM   925   C CG  . ARG B  1 18  ? 120.088 93.481  159.129 1.00 38.98  ? 18   ARG B CG  1 
ATOM   926   C CD  . ARG B  1 18  ? 119.132 94.640  158.981 1.00 41.14  ? 18   ARG B CD  1 
ATOM   927   N NE  . ARG B  1 18  ? 119.797 95.898  159.277 1.00 44.75  ? 18   ARG B NE  1 
ATOM   928   C CZ  . ARG B  1 18  ? 120.688 96.478  158.479 1.00 44.05  ? 18   ARG B CZ  1 
ATOM   929   N NH1 . ARG B  1 18  ? 121.035 95.921  157.322 1.00 31.92  ? 18   ARG B NH1 1 
ATOM   930   N NH2 . ARG B  1 18  ? 121.242 97.627  158.838 1.00 40.00  ? 18   ARG B NH2 1 
ATOM   931   N N   . VAL B  1 19  ? 116.491 92.428  157.885 1.00 36.80  ? 19   VAL B N   1 
ATOM   932   C CA  . VAL B  1 19  ? 115.421 92.490  156.905 1.00 33.94  ? 19   VAL B CA  1 
ATOM   933   C C   . VAL B  1 19  ? 115.319 93.913  156.395 1.00 32.08  ? 19   VAL B C   1 
ATOM   934   O O   . VAL B  1 19  ? 115.446 94.878  157.153 1.00 33.94  ? 19   VAL B O   1 
ATOM   935   C CB  . VAL B  1 19  ? 114.049 92.022  157.484 1.00 33.37  ? 19   VAL B CB  1 
ATOM   936   C CG1 . VAL B  1 19  ? 112.933 92.169  156.442 1.00 32.18  ? 19   VAL B CG1 1 
ATOM   937   C CG2 . VAL B  1 19  ? 114.138 90.570  157.983 1.00 30.92  ? 19   VAL B CG2 1 
ATOM   938   N N   . THR B  1 20  ? 115.101 94.002  155.088 1.00 33.02  ? 20   THR B N   1 
ATOM   939   C CA  . THR B  1 20  ? 114.947 95.236  154.370 1.00 31.24  ? 20   THR B CA  1 
ATOM   940   C C   . THR B  1 20  ? 113.680 94.944  153.610 1.00 29.96  ? 20   THR B C   1 
ATOM   941   O O   . THR B  1 20  ? 113.695 94.142  152.653 1.00 27.64  ? 20   THR B O   1 
ATOM   942   C CB  . THR B  1 20  ? 116.045 95.381  153.300 1.00 30.92  ? 20   THR B CB  1 
ATOM   943   O OG1 . THR B  1 20  ? 117.227 94.682  153.709 1.00 30.72  ? 20   THR B OG1 1 
ATOM   944   C CG2 . THR B  1 20  ? 116.383 96.850  153.043 1.00 31.01  ? 20   THR B CG2 1 
ATOM   945   N N   . ILE B  1 21  ? 112.563 95.521  154.043 1.00 30.26  ? 21   ILE B N   1 
ATOM   946   C CA  . ILE B  1 21  ? 111.401 95.573  153.174 1.00 28.24  ? 21   ILE B CA  1 
ATOM   947   C C   . ILE B  1 21  ? 111.436 96.925  152.498 1.00 26.11  ? 21   ILE B C   1 
ATOM   948   O O   . ILE B  1 21  ? 111.677 97.950  153.146 1.00 20.62  ? 21   ILE B O   1 
ATOM   949   C CB  . ILE B  1 21  ? 110.060 95.390  153.910 1.00 28.46  ? 21   ILE B CB  1 
ATOM   950   C CG1 . ILE B  1 21  ? 109.998 94.001  154.566 1.00 29.63  ? 21   ILE B CG1 1 
ATOM   951   C CG2 . ILE B  1 21  ? 108.877 95.514  152.927 1.00 29.90  ? 21   ILE B CG2 1 
ATOM   952   C CD1 . ILE B  1 21  ? 109.090 93.953  155.782 1.00 31.82  ? 21   ILE B CD1 1 
ATOM   953   N N   . THR B  1 22  ? 111.231 96.897  151.177 1.00 26.77  ? 22   THR B N   1 
ATOM   954   C CA  . THR B  1 22  ? 111.171 98.107  150.374 1.00 26.42  ? 22   THR B CA  1 
ATOM   955   C C   . THR B  1 22  ? 109.784 98.123  149.759 1.00 27.35  ? 22   THR B C   1 
ATOM   956   O O   . THR B  1 22  ? 109.256 97.081  149.356 1.00 30.89  ? 22   THR B O   1 
ATOM   957   C CB  . THR B  1 22  ? 112.270 98.167  149.257 1.00 26.45  ? 22   THR B CB  1 
ATOM   958   O OG1 . THR B  1 22  ? 111.891 97.337  148.142 1.00 21.13  ? 22   THR B OG1 1 
ATOM   959   C CG2 . THR B  1 22  ? 113.639 97.736  149.790 1.00 20.66  ? 22   THR B CG2 1 
ATOM   960   N N   . CYS B  1 23  ? 109.198 99.309  149.696 1.00 28.79  ? 23   CYS B N   1 
ATOM   961   C CA  . CYS B  1 23  ? 107.846 99.485  149.200 1.00 27.54  ? 23   CYS B CA  1 
ATOM   962   C C   . CYS B  1 23  ? 107.869 100.765 148.380 1.00 25.69  ? 23   CYS B C   1 
ATOM   963   O O   . CYS B  1 23  ? 108.337 101.805 148.861 1.00 25.19  ? 23   CYS B O   1 
ATOM   964   C CB  . CYS B  1 23  ? 106.895 99.522  150.411 1.00 30.45  ? 23   CYS B CB  1 
ATOM   965   S SG  . CYS B  1 23  ? 105.387 100.539 150.410 1.00 39.10  ? 23   CYS B SG  1 
ATOM   966   N N   . ARG B  1 24  ? 107.412 100.683 147.132 1.00 24.50  ? 24   ARG B N   1 
ATOM   967   C CA  . ARG B  1 24  ? 107.468 101.825 146.218 1.00 26.70  ? 24   ARG B CA  1 
ATOM   968   C C   . ARG B  1 24  ? 106.098 102.444 145.946 1.00 26.51  ? 24   ARG B C   1 
ATOM   969   O O   . ARG B  1 24  ? 105.160 101.762 145.518 1.00 24.77  ? 24   ARG B O   1 
ATOM   970   C CB  . ARG B  1 24  ? 108.185 101.454 144.910 1.00 28.46  ? 24   ARG B CB  1 
ATOM   971   C CG  . ARG B  1 24  ? 107.948 102.433 143.756 1.00 29.21  ? 24   ARG B CG  1 
ATOM   972   C CD  . ARG B  1 24  ? 109.226 102.747 142.998 1.00 33.56  ? 24   ARG B CD  1 
ATOM   973   N NE  . ARG B  1 24  ? 110.009 103.789 143.666 1.00 41.48  ? 24   ARG B NE  1 
ATOM   974   C CZ  . ARG B  1 24  ? 111.030 104.437 143.111 1.00 46.04  ? 24   ARG B CZ  1 
ATOM   975   N NH1 . ARG B  1 24  ? 111.407 104.161 141.867 1.00 43.47  ? 24   ARG B NH1 1 
ATOM   976   N NH2 . ARG B  1 24  ? 111.675 105.373 143.791 1.00 43.71  ? 24   ARG B NH2 1 
ATOM   977   N N   . ALA B  1 25  ? 106.004 103.746 146.201 1.00 27.97  ? 25   ALA B N   1 
ATOM   978   C CA  . ALA B  1 25  ? 104.795 104.519 145.942 1.00 31.91  ? 25   ALA B CA  1 
ATOM   979   C C   . ALA B  1 25  ? 104.759 104.999 144.500 1.00 34.27  ? 25   ALA B C   1 
ATOM   980   O O   . ALA B  1 25  ? 105.796 105.344 143.925 1.00 36.87  ? 25   ALA B O   1 
ATOM   981   C CB  . ALA B  1 25  ? 104.721 105.696 146.887 1.00 29.86  ? 25   ALA B CB  1 
ATOM   982   N N   . SER B  1 26  ? 103.564 105.030 143.920 1.00 34.38  ? 26   SER B N   1 
ATOM   983   C CA  . SER B  1 26  ? 103.424 105.422 142.528 1.00 35.49  ? 26   SER B CA  1 
ATOM   984   C C   . SER B  1 26  ? 103.520 106.938 142.325 1.00 34.85  ? 26   SER B C   1 
ATOM   985   O O   . SER B  1 26  ? 103.215 107.423 141.233 1.00 36.39  ? 26   SER B O   1 
ATOM   986   C CB  . SER B  1 26  ? 102.113 104.889 141.947 1.00 34.40  ? 26   SER B CB  1 
ATOM   987   O OG  . SER B  1 26  ? 101.002 105.615 142.459 1.00 38.28  ? 26   SER B OG  1 
ATOM   988   N N   . GLN B  1 27  ? 103.957 107.688 143.347 1.00 34.72  ? 27   GLN B N   1 
ATOM   989   C CA  . GLN B  1 27  ? 104.047 109.162 143.214 1.00 34.27  ? 27   GLN B CA  1 
ATOM   990   C C   . GLN B  1 27  ? 104.502 109.870 144.490 1.00 34.42  ? 27   GLN B C   1 
ATOM   991   O O   . GLN B  1 27  ? 104.265 109.375 145.599 1.00 30.33  ? 27   GLN B O   1 
ATOM   992   C CB  . GLN B  1 27  ? 102.709 109.745 142.768 1.00 34.39  ? 27   GLN B CB  1 
ATOM   993   C CG  . GLN B  1 27  ? 101.552 109.098 143.492 1.00 33.98  ? 27   GLN B CG  1 
ATOM   994   C CD  . GLN B  1 27  ? 100.458 110.063 143.769 1.00 37.84  ? 27   GLN B CD  1 
ATOM   995   O OE1 . GLN B  1 27  ? 99.387  109.986 143.170 1.00 39.41  ? 27   GLN B OE1 1 
ATOM   996   N NE2 . GLN B  1 27  ? 100.704 110.996 144.683 1.00 37.10  ? 27   GLN B NE2 1 
ATOM   997   N N   . SER B  1 28  ? 105.132 111.037 144.314 1.00 34.46  ? 28   SER B N   1 
ATOM   998   C CA  . SER B  1 28  ? 105.783 111.800 145.394 1.00 35.11  ? 28   SER B CA  1 
ATOM   999   C C   . SER B  1 28  ? 104.878 112.089 146.611 1.00 35.67  ? 28   SER B C   1 
ATOM   1000  O O   . SER B  1 28  ? 104.533 113.244 146.895 1.00 36.60  ? 28   SER B O   1 
ATOM   1001  C CB  . SER B  1 28  ? 106.394 113.093 144.824 1.00 36.37  ? 28   SER B CB  1 
ATOM   1002  O OG  . SER B  1 28  ? 107.055 113.849 145.830 1.00 37.15  ? 28   SER B OG  1 
ATOM   1003  N N   . ILE B  1 29  ? 104.518 111.013 147.321 1.00 35.43  ? 29   ILE B N   1 
ATOM   1004  C CA  . ILE B  1 29  ? 103.646 111.056 148.509 1.00 34.89  ? 29   ILE B CA  1 
ATOM   1005  C C   . ILE B  1 29  ? 104.394 111.612 149.711 1.00 35.18  ? 29   ILE B C   1 
ATOM   1006  O O   . ILE B  1 29  ? 103.999 111.407 150.865 1.00 37.14  ? 29   ILE B O   1 
ATOM   1007  C CB  . ILE B  1 29  ? 103.050 109.664 148.889 1.00 34.90  ? 29   ILE B CB  1 
ATOM   1008  C CG1 . ILE B  1 29  ? 104.151 108.604 149.038 1.00 33.00  ? 29   ILE B CG1 1 
ATOM   1009  C CG2 . ILE B  1 29  ? 101.976 109.237 147.892 1.00 32.14  ? 29   ILE B CG2 1 
ATOM   1010  C CD1 . ILE B  1 29  ? 103.809 107.467 150.033 1.00 36.66  ? 29   ILE B CD1 1 
ATOM   1011  N N   . SER B  1 30  ? 105.501 112.288 149.413 1.00 36.08  ? 30   SER B N   1 
ATOM   1012  C CA  . SER B  1 30  ? 106.159 113.160 150.368 1.00 37.75  ? 30   SER B CA  1 
ATOM   1013  C C   . SER B  1 30  ? 106.856 112.355 151.443 1.00 38.89  ? 30   SER B C   1 
ATOM   1014  O O   . SER B  1 30  ? 107.910 111.769 151.205 1.00 40.06  ? 30   SER B O   1 
ATOM   1015  C CB  . SER B  1 30  ? 105.145 114.111 151.004 1.00 36.91  ? 30   SER B CB  1 
ATOM   1016  O OG  . SER B  1 30  ? 105.755 114.850 152.055 1.00 38.63  ? 30   SER B OG  1 
ATOM   1017  N N   . SER B  1 31  ? 106.253 112.323 152.622 1.00 38.97  ? 31   SER B N   1 
ATOM   1018  C CA  . SER B  1 31  ? 106.840 111.628 153.741 1.00 40.73  ? 31   SER B CA  1 
ATOM   1019  C C   . SER B  1 31  ? 105.781 110.755 154.413 1.00 41.13  ? 31   SER B C   1 
ATOM   1020  O O   . SER B  1 31  ? 106.054 110.088 155.412 1.00 38.70  ? 31   SER B O   1 
ATOM   1021  C CB  . SER B  1 31  ? 107.432 112.638 154.722 1.00 40.14  ? 31   SER B CB  1 
ATOM   1022  O OG  . SER B  1 31  ? 108.308 111.998 155.634 1.00 46.02  ? 31   SER B OG  1 
ATOM   1023  N N   . TYR B  1 32  ? 104.584 110.748 153.816 1.00 42.27  ? 32   TYR B N   1 
ATOM   1024  C CA  . TYR B  1 32  ? 103.371 110.182 154.433 1.00 41.79  ? 32   TYR B CA  1 
ATOM   1025  C C   . TYR B  1 32  ? 103.265 108.674 154.285 1.00 40.24  ? 32   TYR B C   1 
ATOM   1026  O O   . TYR B  1 32  ? 102.315 108.181 153.669 1.00 42.10  ? 32   TYR B O   1 
ATOM   1027  C CB  . TYR B  1 32  ? 102.129 110.747 153.745 1.00 43.40  ? 32   TYR B CB  1 
ATOM   1028  C CG  . TYR B  1 32  ? 101.512 111.988 154.329 1.00 43.45  ? 32   TYR B CG  1 
ATOM   1029  C CD1 . TYR B  1 32  ? 101.609 113.201 153.657 1.00 41.53  ? 32   TYR B CD1 1 
ATOM   1030  C CD2 . TYR B  1 32  ? 100.782 111.946 155.517 1.00 48.30  ? 32   TYR B CD2 1 
ATOM   1031  C CE1 . TYR B  1 32  ? 101.023 114.344 154.158 1.00 42.86  ? 32   TYR B CE1 1 
ATOM   1032  C CE2 . TYR B  1 32  ? 100.191 113.092 156.030 1.00 45.31  ? 32   TYR B CE2 1 
ATOM   1033  C CZ  . TYR B  1 32  ? 100.315 114.287 155.345 1.00 44.64  ? 32   TYR B CZ  1 
ATOM   1034  O OH  . TYR B  1 32  ? 99.739  115.431 155.850 1.00 47.88  ? 32   TYR B OH  1 
ATOM   1035  N N   . LEU B  1 33  ? 104.215 107.931 154.840 1.00 37.53  ? 33   LEU B N   1 
ATOM   1036  C CA  . LEU B  1 33  ? 104.100 106.475 154.813 1.00 35.29  ? 33   LEU B CA  1 
ATOM   1037  C C   . LEU B  1 33  ? 104.139 105.860 156.202 1.00 35.19  ? 33   LEU B C   1 
ATOM   1038  O O   . LEU B  1 33  ? 104.908 106.289 157.061 1.00 35.78  ? 33   LEU B O   1 
ATOM   1039  C CB  . LEU B  1 33  ? 105.173 105.831 153.931 1.00 34.16  ? 33   LEU B CB  1 
ATOM   1040  C CG  . LEU B  1 33  ? 104.942 104.325 153.721 1.00 31.01  ? 33   LEU B CG  1 
ATOM   1041  C CD1 . LEU B  1 33  ? 104.071 104.054 152.497 1.00 22.57  ? 33   LEU B CD1 1 
ATOM   1042  C CD2 . LEU B  1 33  ? 106.249 103.556 153.635 1.00 31.45  ? 33   LEU B CD2 1 
ATOM   1043  N N   . ASN B  1 34  ? 103.320 104.831 156.403 1.00 33.57  ? 34   ASN B N   1 
ATOM   1044  C CA  . ASN B  1 34  ? 103.247 104.175 157.695 1.00 31.84  ? 34   ASN B CA  1 
ATOM   1045  C C   . ASN B  1 34  ? 103.353 102.646 157.608 1.00 31.32  ? 34   ASN B C   1 
ATOM   1046  O O   . ASN B  1 34  ? 102.772 102.005 156.695 1.00 33.57  ? 34   ASN B O   1 
ATOM   1047  C CB  . ASN B  1 34  ? 102.006 104.661 158.467 1.00 31.18  ? 34   ASN B CB  1 
ATOM   1048  C CG  . ASN B  1 34  ? 101.958 106.193 158.614 1.00 37.33  ? 34   ASN B CG  1 
ATOM   1049  O OD1 . ASN B  1 34  ? 102.952 106.828 158.952 1.00 28.90  ? 34   ASN B OD1 1 
ATOM   1050  N ND2 . ASN B  1 34  ? 100.789 106.775 158.374 1.00 35.63  ? 34   ASN B ND2 1 
ATOM   1051  N N   . TRP B  1 35  ? 104.119 102.078 158.545 1.00 27.89  ? 35   TRP B N   1 
ATOM   1052  C CA  . TRP B  1 35  ? 104.408 100.653 158.523 1.00 26.57  ? 35   TRP B CA  1 
ATOM   1053  C C   . TRP B  1 35  ? 103.634 99.989  159.655 1.00 26.70  ? 35   TRP B C   1 
ATOM   1054  O O   . TRP B  1 35  ? 103.636 100.478 160.784 1.00 26.08  ? 35   TRP B O   1 
ATOM   1055  C CB  . TRP B  1 35  ? 105.918 100.417 158.681 1.00 21.96  ? 35   TRP B CB  1 
ATOM   1056  C CG  . TRP B  1 35  ? 106.773 100.775 157.463 1.00 22.30  ? 35   TRP B CG  1 
ATOM   1057  C CD1 . TRP B  1 35  ? 107.493 101.924 157.267 1.00 18.71  ? 35   TRP B CD1 1 
ATOM   1058  C CD2 . TRP B  1 35  ? 107.004 99.959  156.305 1.00 16.34  ? 35   TRP B CD2 1 
ATOM   1059  N NE1 . TRP B  1 35  ? 108.154 101.874 156.056 1.00 11.89  ? 35   TRP B NE1 1 
ATOM   1060  C CE2 . TRP B  1 35  ? 107.859 100.681 155.439 1.00 12.73  ? 35   TRP B CE2 1 
ATOM   1061  C CE3 . TRP B  1 35  ? 106.556 98.690  155.910 1.00 10.55  ? 35   TRP B CE3 1 
ATOM   1062  C CZ2 . TRP B  1 35  ? 108.289 100.169 154.209 1.00 18.87  ? 35   TRP B CZ2 1 
ATOM   1063  C CZ3 . TRP B  1 35  ? 106.983 98.181  154.685 1.00 11.01  ? 35   TRP B CZ3 1 
ATOM   1064  C CH2 . TRP B  1 35  ? 107.838 98.924  153.851 1.00 16.56  ? 35   TRP B CH2 1 
ATOM   1065  N N   . TYR B  1 36  ? 102.972 98.879  159.347 1.00 25.85  ? 36   TYR B N   1 
ATOM   1066  C CA  . TYR B  1 36  ? 102.198 98.139  160.336 1.00 28.54  ? 36   TYR B CA  1 
ATOM   1067  C C   . TYR B  1 36  ? 102.721 96.708  160.458 1.00 30.23  ? 36   TYR B C   1 
ATOM   1068  O O   . TYR B  1 36  ? 103.238 96.137  159.445 1.00 31.25  ? 36   TYR B O   1 
ATOM   1069  C CB  . TYR B  1 36  ? 100.748 98.031  159.887 1.00 27.89  ? 36   TYR B CB  1 
ATOM   1070  C CG  . TYR B  1 36  ? 99.911  99.288  159.833 1.00 28.06  ? 36   TYR B CG  1 
ATOM   1071  C CD1 . TYR B  1 36  ? 100.199 100.321 158.942 1.00 34.01  ? 36   TYR B CD1 1 
ATOM   1072  C CD2 . TYR B  1 36  ? 98.763  99.394  160.611 1.00 32.12  ? 36   TYR B CD2 1 
ATOM   1073  C CE1 . TYR B  1 36  ? 99.393  101.450 158.875 1.00 31.31  ? 36   TYR B CE1 1 
ATOM   1074  C CE2 . TYR B  1 36  ? 97.951  100.511 160.540 1.00 29.96  ? 36   TYR B CE2 1 
ATOM   1075  C CZ  . TYR B  1 36  ? 98.268  101.537 159.669 1.00 32.73  ? 36   TYR B CZ  1 
ATOM   1076  O OH  . TYR B  1 36  ? 97.470  102.658 159.609 1.00 29.55  ? 36   TYR B OH  1 
ATOM   1077  N N   . GLN B  1 37  ? 102.597 96.131  161.678 1.00 27.85  ? 37   GLN B N   1 
ATOM   1078  C CA  . GLN B  1 37  ? 102.874 94.689  161.853 1.00 28.05  ? 37   GLN B CA  1 
ATOM   1079  C C   . GLN B  1 37  ? 101.531 93.993  162.033 1.00 29.63  ? 37   GLN B C   1 
ATOM   1080  O O   . GLN B  1 37  ? 100.806 94.315  162.986 1.00 30.06  ? 37   GLN B O   1 
ATOM   1081  C CB  . GLN B  1 37  ? 103.685 94.488  163.143 1.00 28.17  ? 37   GLN B CB  1 
ATOM   1082  C CG  . GLN B  1 37  ? 104.625 93.254  163.116 1.00 28.73  ? 37   GLN B CG  1 
ATOM   1083  C CD  . GLN B  1 37  ? 105.214 93.019  164.500 1.00 33.18  ? 37   GLN B CD  1 
ATOM   1084  O OE1 . GLN B  1 37  ? 104.541 93.238  165.515 1.00 45.46  ? 37   GLN B OE1 1 
ATOM   1085  N NE2 . GLN B  1 37  ? 106.465 92.568  164.550 1.00 33.74  ? 37   GLN B NE2 1 
ATOM   1086  N N   . GLN B  1 38  ? 101.161 93.075  161.152 1.00 28.74  ? 38   GLN B N   1 
ATOM   1087  C CA  . GLN B  1 38  ? 99.965  92.278  161.426 1.00 26.26  ? 38   GLN B CA  1 
ATOM   1088  C C   . GLN B  1 38  ? 100.406 90.918  161.949 1.00 26.60  ? 38   GLN B C   1 
ATOM   1089  O O   . GLN B  1 38  ? 100.663 89.994  161.168 1.00 27.80  ? 38   GLN B O   1 
ATOM   1090  C CB  . GLN B  1 38  ? 99.060  92.203  160.189 1.00 26.70  ? 38   GLN B CB  1 
ATOM   1091  C CG  . GLN B  1 38  ? 97.994  91.080  160.217 1.00 26.42  ? 38   GLN B CG  1 
ATOM   1092  C CD  . GLN B  1 38  ? 97.032  91.256  159.049 1.00 29.45  ? 38   GLN B CD  1 
ATOM   1093  O OE1 . GLN B  1 38  ? 97.440  91.433  157.900 1.00 35.75  ? 38   GLN B OE1 1 
ATOM   1094  N NE2 . GLN B  1 38  ? 95.723  91.208  159.328 1.00 22.22  ? 38   GLN B NE2 1 
ATOM   1095  N N   . LYS B  1 39  ? 100.541 90.813  163.276 1.00 25.59  ? 39   LYS B N   1 
ATOM   1096  C CA  . LYS B  1 39  ? 100.790 89.517  163.896 1.00 25.44  ? 39   LYS B CA  1 
ATOM   1097  C C   . LYS B  1 39  ? 99.661  88.568  163.474 1.00 26.18  ? 39   LYS B C   1 
ATOM   1098  O O   . LYS B  1 39  ? 98.591  89.040  163.016 1.00 25.02  ? 39   LYS B O   1 
ATOM   1099  C CB  . LYS B  1 39  ? 100.906 89.632  165.431 1.00 25.09  ? 39   LYS B CB  1 
ATOM   1100  C CG  . LYS B  1 39  ? 102.346 89.793  165.969 1.00 21.44  ? 39   LYS B CG  1 
ATOM   1101  C CD  . LYS B  1 39  ? 103.008 88.428  166.262 1.00 22.89  ? 39   LYS B CD  1 
ATOM   1102  C CE  . LYS B  1 39  ? 103.958 88.542  167.526 1.00 30.34  ? 39   LYS B CE  1 
ATOM   1103  N NZ  . LYS B  1 39  ? 103.094 88.950  168.748 1.00 28.28  ? 39   LYS B NZ  1 
ATOM   1104  N N   . PRO B  1 40  ? 99.873  87.247  163.615 1.00 26.06  ? 40   PRO B N   1 
ATOM   1105  C CA  . PRO B  1 40  ? 98.979  86.363  162.876 1.00 26.89  ? 40   PRO B CA  1 
ATOM   1106  C C   . PRO B  1 40  ? 97.621  86.124  163.537 1.00 24.82  ? 40   PRO B C   1 
ATOM   1107  O O   . PRO B  1 40  ? 97.560  85.697  164.698 1.00 23.37  ? 40   PRO B O   1 
ATOM   1108  C CB  . PRO B  1 40  ? 99.782  85.048  162.766 1.00 26.04  ? 40   PRO B CB  1 
ATOM   1109  C CG  . PRO B  1 40  ? 101.074 85.280  163.543 1.00 26.90  ? 40   PRO B CG  1 
ATOM   1110  C CD  . PRO B  1 40  ? 100.862 86.483  164.392 1.00 27.65  ? 40   PRO B CD  1 
ATOM   1111  N N   . GLY B  1 41  ? 96.544  86.409  162.793 1.00 27.22  ? 41   GLY B N   1 
ATOM   1112  C CA  . GLY B  1 41  ? 95.190  86.281  163.373 1.00 29.43  ? 41   GLY B CA  1 
ATOM   1113  C C   . GLY B  1 41  ? 94.835  87.457  164.281 1.00 29.61  ? 41   GLY B C   1 
ATOM   1114  O O   . GLY B  1 41  ? 93.648  87.732  164.519 1.00 31.60  ? 41   GLY B O   1 
ATOM   1115  N N   . LYS B  1 42  ? 95.854  88.138  164.813 1.00 29.59  ? 42   LYS B N   1 
ATOM   1116  C CA  . LYS B  1 42  ? 95.658  89.428  165.486 1.00 27.36  ? 42   LYS B CA  1 
ATOM   1117  C C   . LYS B  1 42  ? 95.422  90.489  164.407 1.00 28.55  ? 42   LYS B C   1 
ATOM   1118  O O   . LYS B  1 42  ? 95.271  90.154  163.227 1.00 27.92  ? 42   LYS B O   1 
ATOM   1119  C CB  . LYS B  1 42  ? 96.848  89.791  166.393 1.00 26.74  ? 42   LYS B CB  1 
ATOM   1120  C CG  . LYS B  1 42  ? 96.687  89.366  167.869 1.00 26.43  ? 42   LYS B CG  1 
ATOM   1121  C CD  . LYS B  1 42  ? 96.023  90.447  168.747 1.00 28.86  ? 42   LYS B CD  1 
ATOM   1122  C CE  . LYS B  1 42  ? 95.633  89.846  170.137 1.00 33.57  ? 42   LYS B CE  1 
ATOM   1123  N NZ  . LYS B  1 42  ? 95.728  90.833  171.396 1.00 27.02  ? 42   LYS B NZ  1 
ATOM   1124  N N   . ALA B  1 43  ? 95.387  91.761  164.797 1.00 29.41  ? 43   ALA B N   1 
ATOM   1125  C CA  . ALA B  1 43  ? 95.085  92.846  163.861 1.00 28.28  ? 43   ALA B CA  1 
ATOM   1126  C C   . ALA B  1 43  ? 96.281  93.775  163.649 1.00 27.40  ? 43   ALA B C   1 
ATOM   1127  O O   . ALA B  1 43  ? 97.024  94.038  164.597 1.00 28.23  ? 43   ALA B O   1 
ATOM   1128  C CB  . ALA B  1 43  ? 93.887  93.639  164.352 1.00 27.25  ? 43   ALA B CB  1 
ATOM   1129  N N   . PRO B  1 44  ? 96.483  94.264  162.405 1.00 25.99  ? 44   PRO B N   1 
ATOM   1130  C CA  . PRO B  1 44  ? 97.538  95.236  162.100 1.00 26.91  ? 44   PRO B CA  1 
ATOM   1131  C C   . PRO B  1 44  ? 97.784  96.288  163.199 1.00 26.24  ? 44   PRO B C   1 
ATOM   1132  O O   . PRO B  1 44  ? 96.832  96.899  163.706 1.00 25.08  ? 44   PRO B O   1 
ATOM   1133  C CB  . PRO B  1 44  ? 97.042  95.909  160.805 1.00 26.06  ? 44   PRO B CB  1 
ATOM   1134  C CG  . PRO B  1 44  ? 95.866  95.088  160.315 1.00 25.63  ? 44   PRO B CG  1 
ATOM   1135  C CD  . PRO B  1 44  ? 95.744  93.873  161.182 1.00 26.91  ? 44   PRO B CD  1 
ATOM   1136  N N   . LYS B  1 45  ? 99.061  96.463  163.560 1.00 27.86  ? 45   LYS B N   1 
ATOM   1137  C CA  . LYS B  1 45  ? 99.523  97.468  164.546 1.00 28.00  ? 45   LYS B CA  1 
ATOM   1138  C C   . LYS B  1 45  ? 100.583 98.408  163.967 1.00 27.44  ? 45   LYS B C   1 
ATOM   1139  O O   . LYS B  1 45  ? 101.560 97.953  163.369 1.00 29.21  ? 45   LYS B O   1 
ATOM   1140  C CB  . LYS B  1 45  ? 100.110 96.791  165.794 1.00 27.91  ? 45   LYS B CB  1 
ATOM   1141  C CG  . LYS B  1 45  ? 99.090  96.438  166.870 1.00 33.79  ? 45   LYS B CG  1 
ATOM   1142  C CD  . LYS B  1 45  ? 99.757  96.054  168.197 1.00 31.28  ? 45   LYS B CD  1 
ATOM   1143  C CE  . LYS B  1 45  ? 100.148 94.573  168.245 1.00 38.93  ? 45   LYS B CE  1 
ATOM   1144  N NZ  . LYS B  1 45  ? 100.689 94.196  169.583 1.00 45.22  ? 45   LYS B NZ  1 
ATOM   1145  N N   . LEU B  1 46  ? 100.397 99.709  164.177 1.00 24.18  ? 46   LEU B N   1 
ATOM   1146  C CA  . LEU B  1 46  ? 101.327 100.691 163.647 1.00 22.65  ? 46   LEU B CA  1 
ATOM   1147  C C   . LEU B  1 46  ? 102.679 100.573 164.319 1.00 27.95  ? 46   LEU B C   1 
ATOM   1148  O O   . LEU B  1 46  ? 102.790 100.406 165.567 1.00 29.22  ? 46   LEU B O   1 
ATOM   1149  C CB  . LEU B  1 46  ? 100.800 102.105 163.861 1.00 23.21  ? 46   LEU B CB  1 
ATOM   1150  C CG  . LEU B  1 46  ? 101.489 103.228 163.089 1.00 13.74  ? 46   LEU B CG  1 
ATOM   1151  C CD1 . LEU B  1 46  ? 101.705 102.907 161.620 1.00 5.52   ? 46   LEU B CD1 1 
ATOM   1152  C CD2 . LEU B  1 46  ? 100.599 104.433 163.241 1.00 11.98  ? 46   LEU B CD2 1 
ATOM   1153  N N   . LEU B  1 47  ? 103.715 100.677 163.489 1.00 29.79  ? 47   LEU B N   1 
ATOM   1154  C CA  . LEU B  1 47  ? 105.116 100.581 163.900 1.00 30.63  ? 47   LEU B CA  1 
ATOM   1155  C C   . LEU B  1 47  ? 105.845 101.911 163.697 1.00 29.93  ? 47   LEU B C   1 
ATOM   1156  O O   . LEU B  1 47  ? 106.420 102.459 164.644 1.00 32.10  ? 47   LEU B O   1 
ATOM   1157  C CB  . LEU B  1 47  ? 105.844 99.494  163.094 1.00 30.80  ? 47   LEU B CB  1 
ATOM   1158  C CG  . LEU B  1 47  ? 105.447 98.012  163.169 1.00 34.10  ? 47   LEU B CG  1 
ATOM   1159  C CD1 . LEU B  1 47  ? 105.936 97.274  161.919 1.00 34.89  ? 47   LEU B CD1 1 
ATOM   1160  C CD2 . LEU B  1 47  ? 105.991 97.342  164.426 1.00 36.97  ? 47   LEU B CD2 1 
ATOM   1161  N N   . ILE B  1 48  ? 105.842 102.403 162.459 1.00 30.32  ? 48   ILE B N   1 
ATOM   1162  C CA  . ILE B  1 48  ? 106.540 103.641 162.108 1.00 30.62  ? 48   ILE B CA  1 
ATOM   1163  C C   . ILE B  1 48  ? 105.521 104.595 161.540 1.00 31.02  ? 48   ILE B C   1 
ATOM   1164  O O   . ILE B  1 48  ? 104.643 104.190 160.757 1.00 30.36  ? 48   ILE B O   1 
ATOM   1165  C CB  . ILE B  1 48  ? 107.579 103.443 160.960 1.00 31.04  ? 48   ILE B CB  1 
ATOM   1166  C CG1 . ILE B  1 48  ? 108.429 102.157 161.122 1.00 28.20  ? 48   ILE B CG1 1 
ATOM   1167  C CG2 . ILE B  1 48  ? 108.445 104.692 160.764 1.00 35.69  ? 48   ILE B CG2 1 
ATOM   1168  C CD1 . ILE B  1 48  ? 109.301 102.126 162.395 1.00 29.76  ? 48   ILE B CD1 1 
ATOM   1169  N N   . TYR B  1 49  ? 105.650 105.868 161.910 1.00 33.35  ? 49   TYR B N   1 
ATOM   1170  C CA  . TYR B  1 49  ? 104.906 106.946 161.266 1.00 35.23  ? 49   TYR B CA  1 
ATOM   1171  C C   . TYR B  1 49  ? 105.677 107.630 160.204 1.00 33.07  ? 49   TYR B C   1 
ATOM   1172  O O   . TYR B  1 49  ? 106.908 107.814 160.344 1.00 32.18  ? 49   TYR B O   1 
ATOM   1173  C CB  . TYR B  1 49  ? 104.622 108.085 162.220 1.00 38.12  ? 49   TYR B CB  1 
ATOM   1174  C CG  . TYR B  1 49  ? 103.387 107.878 162.960 1.00 43.36  ? 49   TYR B CG  1 
ATOM   1175  C CD1 . TYR B  1 49  ? 103.401 107.917 164.345 1.00 46.82  ? 49   TYR B CD1 1 
ATOM   1176  C CD2 . TYR B  1 49  ? 102.192 107.607 162.284 1.00 50.75  ? 49   TYR B CD2 1 
ATOM   1177  C CE1 . TYR B  1 49  ? 102.260 107.700 165.056 1.00 49.97  ? 49   TYR B CE1 1 
ATOM   1178  C CE2 . TYR B  1 49  ? 101.050 107.385 162.980 1.00 51.54  ? 49   TYR B CE2 1 
ATOM   1179  C CZ  . TYR B  1 49  ? 101.100 107.421 164.370 1.00 49.95  ? 49   TYR B CZ  1 
ATOM   1180  O OH  . TYR B  1 49  ? 99.977  107.191 165.086 1.00 48.59  ? 49   TYR B OH  1 
ATOM   1181  N N   . ALA B  1 50  ? 104.951 108.089 159.181 1.00 33.64  ? 50   ALA B N   1 
ATOM   1182  C CA  . ALA B  1 50  ? 105.514 109.084 158.288 1.00 33.28  ? 50   ALA B CA  1 
ATOM   1183  C C   . ALA B  1 50  ? 107.010 108.832 158.126 1.00 32.82  ? 50   ALA B C   1 
ATOM   1184  O O   . ALA B  1 50  ? 107.843 109.637 158.562 1.00 32.70  ? 50   ALA B O   1 
ATOM   1185  C CB  . ALA B  1 50  ? 105.253 110.503 158.830 1.00 33.27  ? 50   ALA B CB  1 
ATOM   1186  N N   . ALA B  1 51  ? 107.325 107.687 157.502 1.00 31.72  ? 51   ALA B N   1 
ATOM   1187  C CA  . ALA B  1 51  ? 108.703 107.242 157.217 1.00 32.47  ? 51   ALA B CA  1 
ATOM   1188  C C   . ALA B  1 51  ? 109.649 106.992 158.399 1.00 34.45  ? 51   ALA B C   1 
ATOM   1189  O O   . ALA B  1 51  ? 110.337 105.960 158.417 1.00 34.65  ? 51   ALA B O   1 
ATOM   1190  C CB  . ALA B  1 51  ? 109.381 108.167 156.176 1.00 30.67  ? 51   ALA B CB  1 
ATOM   1191  N N   . SER B  1 52  ? 109.696 107.914 159.364 1.00 35.74  ? 52   SER B N   1 
ATOM   1192  C CA  . SER B  1 52  ? 110.757 107.889 160.373 1.00 37.01  ? 52   SER B CA  1 
ATOM   1193  C C   . SER B  1 52  ? 110.454 108.717 161.619 1.00 39.61  ? 52   SER B C   1 
ATOM   1194  O O   . SER B  1 52  ? 111.061 109.762 161.875 1.00 39.75  ? 52   SER B O   1 
ATOM   1195  C CB  . SER B  1 52  ? 112.099 108.310 159.756 1.00 36.96  ? 52   SER B CB  1 
ATOM   1196  O OG  . SER B  1 52  ? 111.985 109.569 159.115 1.00 31.34  ? 52   SER B OG  1 
ATOM   1197  N N   . SER B  1 53  ? 109.475 108.229 162.365 1.00 39.44  ? 53   SER B N   1 
ATOM   1198  C CA  . SER B  1 53  ? 109.237 108.598 163.747 1.00 40.42  ? 53   SER B CA  1 
ATOM   1199  C C   . SER B  1 53  ? 108.707 107.274 164.266 1.00 42.79  ? 53   SER B C   1 
ATOM   1200  O O   . SER B  1 53  ? 108.108 106.510 163.500 1.00 45.43  ? 53   SER B O   1 
ATOM   1201  C CB  . SER B  1 53  ? 108.166 109.676 163.854 1.00 40.57  ? 53   SER B CB  1 
ATOM   1202  O OG  . SER B  1 53  ? 108.171 110.522 162.661 1.00 40.90  ? 53   SER B OG  1 
ATOM   1203  N N   . LEU B  1 54  ? 108.906 106.988 165.549 1.00 42.49  ? 54   LEU B N   1 
ATOM   1204  C CA  . LEU B  1 54  ? 108.653 105.629 166.015 1.00 42.81  ? 54   LEU B CA  1 
ATOM   1205  C C   . LEU B  1 54  ? 107.460 105.585 166.965 1.00 44.60  ? 54   LEU B C   1 
ATOM   1206  O O   . LEU B  1 54  ? 107.324 106.469 167.817 1.00 45.12  ? 54   LEU B O   1 
ATOM   1207  C CB  . LEU B  1 54  ? 109.919 105.087 166.701 1.00 44.59  ? 54   LEU B CB  1 
ATOM   1208  C CG  . LEU B  1 54  ? 110.555 103.776 166.194 1.00 41.47  ? 54   LEU B CG  1 
ATOM   1209  C CD1 . LEU B  1 54  ? 111.722 103.383 167.139 1.00 42.81  ? 54   LEU B CD1 1 
ATOM   1210  C CD2 . LEU B  1 54  ? 109.567 102.610 166.112 1.00 39.65  ? 54   LEU B CD2 1 
ATOM   1211  N N   . GLN B  1 55  ? 106.599 104.574 166.816 1.00 43.79  ? 55   GLN B N   1 
ATOM   1212  C CA  . GLN B  1 55  ? 105.393 104.512 167.651 1.00 43.08  ? 55   GLN B CA  1 
ATOM   1213  C C   . GLN B  1 55  ? 105.762 104.267 169.090 1.00 42.70  ? 55   GLN B C   1 
ATOM   1214  O O   . GLN B  1 55  ? 106.375 103.247 169.413 1.00 42.26  ? 55   GLN B O   1 
ATOM   1215  C CB  . GLN B  1 55  ? 104.395 103.443 167.187 1.00 43.36  ? 55   GLN B CB  1 
ATOM   1216  C CG  . GLN B  1 55  ? 103.777 103.672 165.824 1.00 43.20  ? 55   GLN B CG  1 
ATOM   1217  C CD  . GLN B  1 55  ? 103.673 105.126 165.421 1.00 45.11  ? 55   GLN B CD  1 
ATOM   1218  O OE1 . GLN B  1 55  ? 103.605 105.417 164.212 1.00 44.28  ? 55   GLN B OE1 1 
ATOM   1219  N NE2 . GLN B  1 55  ? 103.676 106.040 166.414 1.00 50.41  ? 55   GLN B NE2 1 
ATOM   1220  N N   . SER B  1 56  ? 105.422 105.216 169.949 1.00 41.46  ? 56   SER B N   1 
ATOM   1221  C CA  . SER B  1 56  ? 105.718 105.023 171.359 1.00 39.55  ? 56   SER B CA  1 
ATOM   1222  C C   . SER B  1 56  ? 105.363 103.586 171.716 1.00 40.36  ? 56   SER B C   1 
ATOM   1223  O O   . SER B  1 56  ? 104.217 103.146 171.542 1.00 38.10  ? 56   SER B O   1 
ATOM   1224  C CB  . SER B  1 56  ? 104.926 106.006 172.256 1.00 39.37  ? 56   SER B CB  1 
ATOM   1225  O OG  . SER B  1 56  ? 104.887 105.474 173.597 1.00 37.45  ? 56   SER B OG  1 
ATOM   1226  N N   . GLY B  1 57  ? 106.363 102.859 172.195 1.00 41.08  ? 57   GLY B N   1 
ATOM   1227  C CA  . GLY B  1 57  ? 106.153 101.510 172.684 1.00 40.91  ? 57   GLY B CA  1 
ATOM   1228  C C   . GLY B  1 57  ? 106.837 100.426 171.876 1.00 41.40  ? 57   GLY B C   1 
ATOM   1229  O O   . GLY B  1 57  ? 107.047 99.323  172.388 1.00 40.75  ? 57   GLY B O   1 
ATOM   1230  N N   . VAL B  1 58  ? 107.185 100.725 170.624 1.00 44.08  ? 58   VAL B N   1 
ATOM   1231  C CA  . VAL B  1 58  ? 107.762 99.696  169.747 1.00 45.16  ? 58   VAL B CA  1 
ATOM   1232  C C   . VAL B  1 58  ? 109.301 99.785  169.737 1.00 46.01  ? 58   VAL B C   1 
ATOM   1233  O O   . VAL B  1 58  ? 109.848 100.903 169.685 1.00 44.12  ? 58   VAL B O   1 
ATOM   1234  C CB  . VAL B  1 58  ? 107.099 99.717  168.315 1.00 45.11  ? 58   VAL B CB  1 
ATOM   1235  C CG1 . VAL B  1 58  ? 107.102 101.109 167.703 1.00 42.98  ? 58   VAL B CG1 1 
ATOM   1236  C CG2 . VAL B  1 58  ? 107.750 98.717  167.362 1.00 46.17  ? 58   VAL B CG2 1 
ATOM   1237  N N   . PRO B  1 59  ? 110.002 98.625  169.834 1.00 46.76  ? 59   PRO B N   1 
ATOM   1238  C CA  . PRO B  1 59  ? 111.474 98.570  169.858 1.00 46.74  ? 59   PRO B CA  1 
ATOM   1239  C C   . PRO B  1 59  ? 112.171 99.566  168.916 1.00 48.42  ? 59   PRO B C   1 
ATOM   1240  O O   . PRO B  1 59  ? 111.565 100.031 167.931 1.00 50.15  ? 59   PRO B O   1 
ATOM   1241  C CB  . PRO B  1 59  ? 111.766 97.135  169.417 1.00 45.61  ? 59   PRO B CB  1 
ATOM   1242  C CG  . PRO B  1 59  ? 110.618 96.354  169.947 1.00 47.19  ? 59   PRO B CG  1 
ATOM   1243  C CD  . PRO B  1 59  ? 109.412 97.273  169.952 1.00 45.71  ? 59   PRO B CD  1 
ATOM   1244  N N   . SER B  1 60  ? 113.439 99.880  169.219 1.00 48.33  ? 60   SER B N   1 
ATOM   1245  C CA  . SER B  1 60  ? 114.255 100.801 168.408 1.00 46.33  ? 60   SER B CA  1 
ATOM   1246  C C   . SER B  1 60  ? 115.022 100.080 167.300 1.00 45.19  ? 60   SER B C   1 
ATOM   1247  O O   . SER B  1 60  ? 115.831 100.693 166.591 1.00 43.68  ? 60   SER B O   1 
ATOM   1248  C CB  . SER B  1 60  ? 115.231 101.604 169.288 1.00 48.28  ? 60   SER B CB  1 
ATOM   1249  O OG  . SER B  1 60  ? 116.397 100.856 169.602 1.00 46.03  ? 60   SER B OG  1 
ATOM   1250  N N   . ARG B  1 61  ? 114.776 98.780  167.160 1.00 44.05  ? 61   ARG B N   1 
ATOM   1251  C CA  . ARG B  1 61  ? 115.384 98.026  166.073 1.00 41.48  ? 61   ARG B CA  1 
ATOM   1252  C C   . ARG B  1 61  ? 114.631 98.281  164.769 1.00 41.06  ? 61   ARG B C   1 
ATOM   1253  O O   . ARG B  1 61  ? 115.213 98.159  163.678 1.00 42.23  ? 61   ARG B O   1 
ATOM   1254  C CB  . ARG B  1 61  ? 115.470 96.532  166.408 1.00 40.27  ? 61   ARG B CB  1 
ATOM   1255  C CG  . ARG B  1 61  ? 114.137 95.801  166.501 1.00 41.63  ? 61   ARG B CG  1 
ATOM   1256  C CD  . ARG B  1 61  ? 114.408 94.319  166.690 1.00 40.00  ? 61   ARG B CD  1 
ATOM   1257  N NE  . ARG B  1 61  ? 113.181 93.534  166.815 1.00 45.62  ? 61   ARG B NE  1 
ATOM   1258  C CZ  . ARG B  1 61  ? 112.524 93.340  167.956 1.00 55.29  ? 61   ARG B CZ  1 
ATOM   1259  N NH1 . ARG B  1 61  ? 112.964 93.872  169.090 1.00 59.10  ? 61   ARG B NH1 1 
ATOM   1260  N NH2 . ARG B  1 61  ? 111.420 92.607  167.966 1.00 54.97  ? 61   ARG B NH2 1 
ATOM   1261  N N   . PHE B  1 62  ? 113.347 98.643  164.893 1.00 39.09  ? 62   PHE B N   1 
ATOM   1262  C CA  . PHE B  1 62  ? 112.538 99.017  163.734 1.00 37.55  ? 62   PHE B CA  1 
ATOM   1263  C C   . PHE B  1 62  ? 112.869 100.406 163.221 1.00 37.34  ? 62   PHE B C   1 
ATOM   1264  O O   . PHE B  1 62  ? 112.818 101.383 163.974 1.00 37.05  ? 62   PHE B O   1 
ATOM   1265  C CB  . PHE B  1 62  ? 111.051 98.931  164.066 1.00 35.29  ? 62   PHE B CB  1 
ATOM   1266  C CG  . PHE B  1 62  ? 110.542 97.537  164.122 1.00 32.36  ? 62   PHE B CG  1 
ATOM   1267  C CD1 . PHE B  1 62  ? 110.175 96.965  165.329 1.00 34.60  ? 62   PHE B CD1 1 
ATOM   1268  C CD2 . PHE B  1 62  ? 110.458 96.777  162.965 1.00 31.91  ? 62   PHE B CD2 1 
ATOM   1269  C CE1 . PHE B  1 62  ? 109.711 95.660  165.381 1.00 30.83  ? 62   PHE B CE1 1 
ATOM   1270  C CE2 . PHE B  1 62  ? 109.999 95.474  163.006 1.00 33.03  ? 62   PHE B CE2 1 
ATOM   1271  C CZ  . PHE B  1 62  ? 109.625 94.913  164.217 1.00 28.88  ? 62   PHE B CZ  1 
ATOM   1272  N N   . SER B  1 63  ? 113.209 100.487 161.937 1.00 35.84  ? 63   SER B N   1 
ATOM   1273  C CA  . SER B  1 63  ? 113.469 101.777 161.311 1.00 33.15  ? 63   SER B CA  1 
ATOM   1274  C C   . SER B  1 63  ? 113.203 101.820 159.813 1.00 33.64  ? 63   SER B C   1 
ATOM   1275  O O   . SER B  1 63  ? 113.241 100.803 159.115 1.00 33.30  ? 63   SER B O   1 
ATOM   1276  C CB  . SER B  1 63  ? 114.888 102.275 161.617 1.00 32.83  ? 63   SER B CB  1 
ATOM   1277  O OG  . SER B  1 63  ? 115.866 101.283 161.179 1.00 29.25  ? 63   SER B OG  1 
ATOM   1278  N N   . GLY B  1 64  ? 112.948 103.042 159.352 1.00 35.06  ? 64   GLY B N   1 
ATOM   1279  C CA  . GLY B  1 64  ? 112.442 103.282 158.011 1.00 35.76  ? 64   GLY B CA  1 
ATOM   1280  C C   . GLY B  1 64  ? 113.021 104.584 157.490 1.00 36.21  ? 64   GLY B C   1 
ATOM   1281  O O   . GLY B  1 64  ? 113.168 105.576 158.238 1.00 36.63  ? 64   GLY B O   1 
ATOM   1282  N N   . SER B  1 65  ? 113.351 104.594 156.201 1.00 37.30  ? 65   SER B N   1 
ATOM   1283  C CA  . SER B  1 65  ? 114.059 105.720 155.575 1.00 37.28  ? 65   SER B CA  1 
ATOM   1284  C C   . SER B  1 65  ? 113.381 106.219 154.282 1.00 38.87  ? 65   SER B C   1 
ATOM   1285  O O   . SER B  1 65  ? 112.316 105.720 153.902 1.00 40.37  ? 65   SER B O   1 
ATOM   1286  C CB  . SER B  1 65  ? 115.513 105.318 155.291 1.00 36.25  ? 65   SER B CB  1 
ATOM   1287  O OG  . SER B  1 65  ? 115.579 104.113 154.544 1.00 31.75  ? 65   SER B OG  1 
ATOM   1288  N N   . GLY B  1 66  ? 113.998 107.206 153.626 1.00 40.05  ? 66   GLY B N   1 
ATOM   1289  C CA  . GLY B  1 66  ? 113.556 107.674 152.297 1.00 41.62  ? 66   GLY B CA  1 
ATOM   1290  C C   . GLY B  1 66  ? 112.235 108.443 152.259 1.00 42.58  ? 66   GLY B C   1 
ATOM   1291  O O   . GLY B  1 66  ? 111.391 108.295 153.147 1.00 42.63  ? 66   GLY B O   1 
ATOM   1292  N N   . SER B  1 67  ? 112.047 109.253 151.215 1.00 43.63  ? 67   SER B N   1 
ATOM   1293  C CA  . SER B  1 67  ? 110.922 110.190 151.167 1.00 45.16  ? 67   SER B CA  1 
ATOM   1294  C C   . SER B  1 67  ? 110.554 110.574 149.737 1.00 44.47  ? 67   SER B C   1 
ATOM   1295  O O   . SER B  1 67  ? 111.386 111.095 148.990 1.00 45.30  ? 67   SER B O   1 
ATOM   1296  C CB  . SER B  1 67  ? 111.255 111.442 151.992 1.00 47.03  ? 67   SER B CB  1 
ATOM   1297  O OG  . SER B  1 67  ? 110.215 112.410 151.933 1.00 51.94  ? 67   SER B OG  1 
ATOM   1298  N N   . GLY B  1 68  ? 109.305 110.308 149.364 1.00 42.61  ? 68   GLY B N   1 
ATOM   1299  C CA  . GLY B  1 68  ? 108.851 110.601 148.012 1.00 40.91  ? 68   GLY B CA  1 
ATOM   1300  C C   . GLY B  1 68  ? 108.165 109.429 147.346 1.00 40.19  ? 68   GLY B C   1 
ATOM   1301  O O   . GLY B  1 68  ? 106.937 109.362 147.322 1.00 38.83  ? 68   GLY B O   1 
ATOM   1302  N N   . THR B  1 69  ? 108.951 108.498 146.814 1.00 39.46  ? 69   THR B N   1 
ATOM   1303  C CA  . THR B  1 69  ? 108.402 107.444 145.957 1.00 38.83  ? 69   THR B CA  1 
ATOM   1304  C C   . THR B  1 69  ? 108.982 106.057 146.265 1.00 37.50  ? 69   THR B C   1 
ATOM   1305  O O   . THR B  1 69  ? 108.492 105.038 145.764 1.00 38.79  ? 69   THR B O   1 
ATOM   1306  C CB  . THR B  1 69  ? 108.586 107.806 144.452 1.00 39.46  ? 69   THR B CB  1 
ATOM   1307  O OG1 . THR B  1 69  ? 108.174 106.707 143.628 1.00 40.33  ? 69   THR B OG1 1 
ATOM   1308  C CG2 . THR B  1 69  ? 110.038 108.172 144.136 1.00 38.36  ? 69   THR B CG2 1 
ATOM   1309  N N   . ASP B  1 70  ? 110.006 106.042 147.121 1.00 35.49  ? 70   ASP B N   1 
ATOM   1310  C CA  . ASP B  1 70  ? 110.840 104.867 147.393 1.00 33.67  ? 70   ASP B CA  1 
ATOM   1311  C C   . ASP B  1 70  ? 111.047 104.714 148.902 1.00 30.58  ? 70   ASP B C   1 
ATOM   1312  O O   . ASP B  1 70  ? 111.648 105.587 149.546 1.00 27.53  ? 70   ASP B O   1 
ATOM   1313  C CB  . ASP B  1 70  ? 112.204 105.041 146.714 1.00 34.84  ? 70   ASP B CB  1 
ATOM   1314  C CG  . ASP B  1 70  ? 112.776 103.734 146.176 1.00 39.49  ? 70   ASP B CG  1 
ATOM   1315  O OD1 . ASP B  1 70  ? 112.636 102.685 146.845 1.00 43.57  ? 70   ASP B OD1 1 
ATOM   1316  O OD2 . ASP B  1 70  ? 113.383 103.760 145.079 1.00 42.54  ? 70   ASP B OD2 1 
ATOM   1317  N N   . PHE B  1 71  ? 110.564 103.600 149.455 1.00 31.02  ? 71   PHE B N   1 
ATOM   1318  C CA  . PHE B  1 71  ? 110.523 103.391 150.910 1.00 30.46  ? 71   PHE B CA  1 
ATOM   1319  C C   . PHE B  1 71  ? 111.182 102.083 151.395 1.00 28.36  ? 71   PHE B C   1 
ATOM   1320  O O   . PHE B  1 71  ? 111.366 101.146 150.612 1.00 22.31  ? 71   PHE B O   1 
ATOM   1321  C CB  . PHE B  1 71  ? 109.086 103.591 151.427 1.00 30.88  ? 71   PHE B CB  1 
ATOM   1322  C CG  . PHE B  1 71  ? 108.637 105.032 151.379 1.00 35.01  ? 71   PHE B CG  1 
ATOM   1323  C CD1 . PHE B  1 71  ? 108.179 105.605 150.186 1.00 37.02  ? 71   PHE B CD1 1 
ATOM   1324  C CD2 . PHE B  1 71  ? 108.721 105.835 152.513 1.00 41.84  ? 71   PHE B CD2 1 
ATOM   1325  C CE1 . PHE B  1 71  ? 107.793 106.951 150.131 1.00 41.15  ? 71   PHE B CE1 1 
ATOM   1326  C CE2 . PHE B  1 71  ? 108.332 107.180 152.471 1.00 38.02  ? 71   PHE B CE2 1 
ATOM   1327  C CZ  . PHE B  1 71  ? 107.869 107.737 151.279 1.00 38.03  ? 71   PHE B CZ  1 
ATOM   1328  N N   . THR B  1 72  ? 111.547 102.055 152.688 1.00 27.20  ? 72   THR B N   1 
ATOM   1329  C CA  . THR B  1 72  ? 112.377 100.985 153.282 1.00 28.76  ? 72   THR B CA  1 
ATOM   1330  C C   . THR B  1 72  ? 111.975 100.690 154.729 1.00 28.09  ? 72   THR B C   1 
ATOM   1331  O O   . THR B  1 72  ? 111.916 101.602 155.557 1.00 29.49  ? 72   THR B O   1 
ATOM   1332  C CB  . THR B  1 72  ? 113.883 101.378 153.335 1.00 28.84  ? 72   THR B CB  1 
ATOM   1333  O OG1 . THR B  1 72  ? 114.185 102.342 152.310 1.00 31.36  ? 72   THR B OG1 1 
ATOM   1334  C CG2 . THR B  1 72  ? 114.777 100.156 153.179 1.00 30.55  ? 72   THR B CG2 1 
ATOM   1335  N N   . LEU B  1 73  ? 111.693 99.419  155.025 1.00 26.06  ? 73   LEU B N   1 
ATOM   1336  C CA  . LEU B  1 73  ? 111.615 98.958  156.410 1.00 23.03  ? 73   LEU B CA  1 
ATOM   1337  C C   . LEU B  1 73  ? 112.730 97.973  156.711 1.00 26.03  ? 73   LEU B C   1 
ATOM   1338  O O   . LEU B  1 73  ? 112.772 96.855  156.193 1.00 23.66  ? 73   LEU B O   1 
ATOM   1339  C CB  . LEU B  1 73  ? 110.254 98.355  156.764 1.00 20.91  ? 73   LEU B CB  1 
ATOM   1340  C CG  . LEU B  1 73  ? 110.168 97.830  158.210 1.00 6.73   ? 73   LEU B CG  1 
ATOM   1341  C CD1 . LEU B  1 73  ? 110.381 98.969  159.223 1.00 2.00   ? 73   LEU B CD1 1 
ATOM   1342  C CD2 . LEU B  1 73  ? 108.823 97.144  158.452 1.00 4.16   ? 73   LEU B CD2 1 
ATOM   1343  N N   . THR B  1 74  ? 113.616 98.422  157.585 1.00 28.26  ? 74   THR B N   1 
ATOM   1344  C CA  . THR B  1 74  ? 114.826 97.711  157.888 1.00 29.72  ? 74   THR B CA  1 
ATOM   1345  C C   . THR B  1 74  ? 114.719 97.296  159.335 1.00 30.92  ? 74   THR B C   1 
ATOM   1346  O O   . THR B  1 74  ? 114.872 98.122  160.239 1.00 33.67  ? 74   THR B O   1 
ATOM   1347  C CB  . THR B  1 74  ? 116.042 98.640  157.718 1.00 30.07  ? 74   THR B CB  1 
ATOM   1348  O OG1 . THR B  1 74  ? 116.039 99.179  156.388 1.00 30.43  ? 74   THR B OG1 1 
ATOM   1349  C CG2 . THR B  1 74  ? 117.348 97.881  157.950 1.00 34.31  ? 74   THR B CG2 1 
ATOM   1350  N N   . ILE B  1 75  ? 114.419 96.021  159.557 1.00 31.05  ? 75   ILE B N   1 
ATOM   1351  C CA  . ILE B  1 75  ? 114.478 95.453  160.897 1.00 30.90  ? 75   ILE B CA  1 
ATOM   1352  C C   . ILE B  1 75  ? 115.954 95.233  161.227 1.00 30.87  ? 75   ILE B C   1 
ATOM   1353  O O   . ILE B  1 75  ? 116.596 94.364  160.609 1.00 29.67  ? 75   ILE B O   1 
ATOM   1354  C CB  . ILE B  1 75  ? 113.700 94.111  160.987 1.00 30.09  ? 75   ILE B CB  1 
ATOM   1355  C CG1 . ILE B  1 75  ? 112.209 94.332  160.627 1.00 35.78  ? 75   ILE B CG1 1 
ATOM   1356  C CG2 . ILE B  1 75  ? 113.867 93.479  162.392 1.00 27.63  ? 75   ILE B CG2 1 
ATOM   1357  C CD1 . ILE B  1 75  ? 111.397 93.066  160.278 1.00 30.37  ? 75   ILE B CD1 1 
ATOM   1358  N N   . SER B  1 76  ? 116.506 95.980  162.184 1.00 31.84  ? 76   SER B N   1 
ATOM   1359  C CA  . SER B  1 76  ? 117.957 95.829  162.399 1.00 33.46  ? 76   SER B CA  1 
ATOM   1360  C C   . SER B  1 76  ? 118.395 94.766  163.427 1.00 33.95  ? 76   SER B C   1 
ATOM   1361  O O   . SER B  1 76  ? 119.472 94.909  164.021 1.00 35.01  ? 76   SER B O   1 
ATOM   1362  C CB  . SER B  1 76  ? 118.638 97.186  162.691 1.00 32.77  ? 76   SER B CB  1 
ATOM   1363  O OG  . SER B  1 76  ? 118.584 97.534  164.111 1.00 34.11  ? 76   SER B OG  1 
ATOM   1364  N N   . SER B  1 77  ? 117.581 93.718  163.630 1.00 35.37  ? 77   SER B N   1 
ATOM   1365  C CA  . SER B  1 77  ? 117.959 92.514  164.429 1.00 33.79  ? 77   SER B CA  1 
ATOM   1366  C C   . SER B  1 77  ? 116.744 91.643  164.788 1.00 33.97  ? 77   SER B C   1 
ATOM   1367  O O   . SER B  1 77  ? 116.267 91.651  165.936 1.00 34.21  ? 77   SER B O   1 
ATOM   1368  C CB  . SER B  1 77  ? 118.788 92.870  165.684 1.00 33.59  ? 77   SER B CB  1 
ATOM   1369  O OG  . SER B  1 77  ? 118.806 91.750  166.621 1.00 35.14  ? 77   SER B OG  1 
ATOM   1370  N N   . LEU B  1 78  ? 116.272 90.891  163.790 1.00 31.75  ? 78   LEU B N   1 
ATOM   1371  C CA  . LEU B  1 78  ? 115.008 90.133  163.829 1.00 29.55  ? 78   LEU B CA  1 
ATOM   1372  C C   . LEU B  1 78  ? 114.805 89.337  165.111 1.00 31.26  ? 78   LEU B C   1 
ATOM   1373  O O   . LEU B  1 78  ? 115.771 88.822  165.694 1.00 33.03  ? 78   LEU B O   1 
ATOM   1374  C CB  . LEU B  1 78  ? 114.959 89.171  162.622 1.00 29.29  ? 78   LEU B CB  1 
ATOM   1375  C CG  . LEU B  1 78  ? 113.586 88.793  162.003 1.00 26.03  ? 78   LEU B CG  1 
ATOM   1376  C CD1 . LEU B  1 78  ? 112.697 90.007  161.760 1.00 19.36  ? 78   LEU B CD1 1 
ATOM   1377  C CD2 . LEU B  1 78  ? 113.763 88.000  160.723 1.00 26.05  ? 78   LEU B CD2 1 
ATOM   1378  N N   . GLN B  1 79  ? 113.545 89.220  165.538 1.00 31.12  ? 79   GLN B N   1 
ATOM   1379  C CA  . GLN B  1 79  ? 113.195 88.423  166.730 1.00 31.51  ? 79   GLN B CA  1 
ATOM   1380  C C   . GLN B  1 79  ? 112.039 87.417  166.477 1.00 32.46  ? 79   GLN B C   1 
ATOM   1381  O O   . GLN B  1 79  ? 111.273 87.597  165.514 1.00 30.92  ? 79   GLN B O   1 
ATOM   1382  C CB  . GLN B  1 79  ? 112.894 89.344  167.927 1.00 32.26  ? 79   GLN B CB  1 
ATOM   1383  C CG  . GLN B  1 79  ? 114.018 90.335  168.290 1.00 31.33  ? 79   GLN B CG  1 
ATOM   1384  C CD  . GLN B  1 79  ? 115.108 89.755  169.188 1.00 39.74  ? 79   GLN B CD  1 
ATOM   1385  O OE1 . GLN B  1 79  ? 115.972 90.486  169.672 1.00 43.88  ? 79   GLN B OE1 1 
ATOM   1386  N NE2 . GLN B  1 79  ? 115.070 88.446  169.417 1.00 32.16  ? 79   GLN B NE2 1 
ATOM   1387  N N   . PRO B  1 80  ? 111.902 86.362  167.327 1.00 32.82  ? 80   PRO B N   1 
ATOM   1388  C CA  . PRO B  1 80  ? 110.845 85.366  167.046 1.00 32.22  ? 80   PRO B CA  1 
ATOM   1389  C C   . PRO B  1 80  ? 109.453 85.961  167.252 1.00 34.30  ? 80   PRO B C   1 
ATOM   1390  O O   . PRO B  1 80  ? 108.468 85.487  166.686 1.00 36.82  ? 80   PRO B O   1 
ATOM   1391  C CB  . PRO B  1 80  ? 111.118 84.255  168.066 1.00 32.73  ? 80   PRO B CB  1 
ATOM   1392  C CG  . PRO B  1 80  ? 111.850 84.923  169.181 1.00 30.70  ? 80   PRO B CG  1 
ATOM   1393  C CD  . PRO B  1 80  ? 112.658 86.032  168.554 1.00 30.49  ? 80   PRO B CD  1 
ATOM   1394  N N   . GLU B  1 81  ? 109.411 86.992  168.097 1.00 33.06  ? 81   GLU B N   1 
ATOM   1395  C CA  . GLU B  1 81  ? 108.260 87.892  168.249 1.00 33.33  ? 81   GLU B CA  1 
ATOM   1396  C C   . GLU B  1 81  ? 107.944 88.847  167.078 1.00 35.43  ? 81   GLU B C   1 
ATOM   1397  O O   . GLU B  1 81  ? 107.072 89.726  167.235 1.00 36.26  ? 81   GLU B O   1 
ATOM   1398  C CB  . GLU B  1 81  ? 108.484 88.740  169.505 1.00 32.75  ? 81   GLU B CB  1 
ATOM   1399  C CG  . GLU B  1 81  ? 109.884 89.364  169.571 1.00 27.41  ? 81   GLU B CG  1 
ATOM   1400  C CD  . GLU B  1 81  ? 110.144 90.086  170.875 1.00 27.78  ? 81   GLU B CD  1 
ATOM   1401  O OE1 . GLU B  1 81  ? 109.191 90.685  171.427 1.00 36.48  ? 81   GLU B OE1 1 
ATOM   1402  O OE2 . GLU B  1 81  ? 111.309 90.065  171.353 1.00 35.22  ? 81   GLU B OE2 1 
ATOM   1403  N N   . ASP B  1 82  ? 108.632 88.726  165.940 1.00 35.78  ? 82   ASP B N   1 
ATOM   1404  C CA  . ASP B  1 82  ? 108.235 89.540  164.785 1.00 35.33  ? 82   ASP B CA  1 
ATOM   1405  C C   . ASP B  1 82  ? 107.765 88.612  163.692 1.00 35.11  ? 82   ASP B C   1 
ATOM   1406  O O   . ASP B  1 82  ? 107.626 89.012  162.535 1.00 36.72  ? 82   ASP B O   1 
ATOM   1407  C CB  . ASP B  1 82  ? 109.375 90.436  164.270 1.00 35.46  ? 82   ASP B CB  1 
ATOM   1408  C CG  . ASP B  1 82  ? 110.287 90.911  165.394 1.00 35.57  ? 82   ASP B CG  1 
ATOM   1409  O OD1 . ASP B  1 82  ? 109.815 91.105  166.545 1.00 37.89  ? 82   ASP B OD1 1 
ATOM   1410  O OD2 . ASP B  1 82  ? 111.488 91.109  165.115 1.00 41.46  ? 82   ASP B OD2 1 
ATOM   1411  N N   . PHE B  1 83  ? 107.562 87.352  164.083 1.00 36.81  ? 83   PHE B N   1 
ATOM   1412  C CA  . PHE B  1 83  ? 106.941 86.337  163.243 1.00 37.01  ? 83   PHE B CA  1 
ATOM   1413  C C   . PHE B  1 83  ? 105.622 86.944  162.782 1.00 36.15  ? 83   PHE B C   1 
ATOM   1414  O O   . PHE B  1 83  ? 104.611 86.866  163.517 1.00 36.29  ? 83   PHE B O   1 
ATOM   1415  C CB  . PHE B  1 83  ? 106.763 85.033  164.054 1.00 37.77  ? 83   PHE B CB  1 
ATOM   1416  C CG  . PHE B  1 83  ? 105.659 84.121  163.556 1.00 42.18  ? 83   PHE B CG  1 
ATOM   1417  C CD1 . PHE B  1 83  ? 105.541 83.808  162.202 1.00 43.81  ? 83   PHE B CD1 1 
ATOM   1418  C CD2 . PHE B  1 83  ? 104.753 83.552  164.450 1.00 43.60  ? 83   PHE B CD2 1 
ATOM   1419  C CE1 . PHE B  1 83  ? 104.526 82.965  161.746 1.00 42.33  ? 83   PHE B CE1 1 
ATOM   1420  C CE2 . PHE B  1 83  ? 103.736 82.705  164.004 1.00 43.47  ? 83   PHE B CE2 1 
ATOM   1421  C CZ  . PHE B  1 83  ? 103.624 82.412  162.649 1.00 40.62  ? 83   PHE B CZ  1 
ATOM   1422  N N   . ALA B  1 84  ? 105.643 87.579  161.590 1.00 35.01  ? 84   ALA B N   1 
ATOM   1423  C CA  . ALA B  1 84  ? 104.535 88.504  161.251 1.00 31.37  ? 84   ALA B CA  1 
ATOM   1424  C C   . ALA B  1 84  ? 104.547 89.131  159.856 1.00 30.86  ? 84   ALA B C   1 
ATOM   1425  O O   . ALA B  1 84  ? 105.614 89.590  159.345 1.00 29.96  ? 84   ALA B O   1 
ATOM   1426  C CB  . ALA B  1 84  ? 104.420 89.636  162.323 1.00 32.44  ? 84   ALA B CB  1 
ATOM   1427  N N   . THR B  1 85  ? 103.354 89.210  159.253 1.00 29.88  ? 85   THR B N   1 
ATOM   1428  C CA  . THR B  1 85  ? 103.166 89.940  157.989 1.00 27.44  ? 85   THR B CA  1 
ATOM   1429  C C   . THR B  1 85  ? 103.195 91.452  158.204 1.00 26.26  ? 85   THR B C   1 
ATOM   1430  O O   . THR B  1 85  ? 102.271 92.045  158.776 1.00 29.38  ? 85   THR B O   1 
ATOM   1431  C CB  . THR B  1 85  ? 101.870 89.532  157.224 1.00 28.84  ? 85   THR B CB  1 
ATOM   1432  O OG1 . THR B  1 85  ? 101.577 88.143  157.465 1.00 27.13  ? 85   THR B OG1 1 
ATOM   1433  C CG2 . THR B  1 85  ? 102.054 89.783  155.707 1.00 25.09  ? 85   THR B CG2 1 
ATOM   1434  N N   . TYR B  1 86  ? 104.302 92.052  157.745 1.00 24.16  ? 86   TYR B N   1 
ATOM   1435  C CA  . TYR B  1 86  ? 104.551 93.510  157.813 1.00 22.69  ? 86   TYR B CA  1 
ATOM   1436  C C   . TYR B  1 86  ? 103.963 94.255  156.584 1.00 25.78  ? 86   TYR B C   1 
ATOM   1437  O O   . TYR B  1 86  ? 104.186 93.819  155.449 1.00 22.23  ? 86   TYR B O   1 
ATOM   1438  C CB  . TYR B  1 86  ? 106.069 93.803  157.934 1.00 24.86  ? 86   TYR B CB  1 
ATOM   1439  C CG  . TYR B  1 86  ? 106.743 93.255  159.182 1.00 20.70  ? 86   TYR B CG  1 
ATOM   1440  C CD1 . TYR B  1 86  ? 107.208 91.946  159.220 1.00 19.67  ? 86   TYR B CD1 1 
ATOM   1441  C CD2 . TYR B  1 86  ? 106.914 94.046  160.321 1.00 28.75  ? 86   TYR B CD2 1 
ATOM   1442  C CE1 . TYR B  1 86  ? 107.820 91.431  160.358 1.00 19.87  ? 86   TYR B CE1 1 
ATOM   1443  C CE2 . TYR B  1 86  ? 107.524 93.538  161.465 1.00 20.07  ? 86   TYR B CE2 1 
ATOM   1444  C CZ  . TYR B  1 86  ? 107.972 92.227  161.470 1.00 28.68  ? 86   TYR B CZ  1 
ATOM   1445  O OH  . TYR B  1 86  ? 108.583 91.708  162.576 1.00 24.67  ? 86   TYR B OH  1 
ATOM   1446  N N   . TYR B  1 87  ? 103.233 95.357  156.816 1.00 25.31  ? 87   TYR B N   1 
ATOM   1447  C CA  . TYR B  1 87  ? 102.643 96.198  155.731 1.00 25.49  ? 87   TYR B CA  1 
ATOM   1448  C C   . TYR B  1 87  ? 103.124 97.660  155.716 1.00 28.36  ? 87   TYR B C   1 
ATOM   1449  O O   . TYR B  1 87  ? 103.546 98.194  156.744 1.00 30.41  ? 87   TYR B O   1 
ATOM   1450  C CB  . TYR B  1 87  ? 101.100 96.214  155.788 1.00 20.63  ? 87   TYR B CB  1 
ATOM   1451  C CG  . TYR B  1 87  ? 100.417 94.899  155.482 1.00 17.93  ? 87   TYR B CG  1 
ATOM   1452  C CD1 . TYR B  1 87  ? 100.119 94.011  156.507 1.00 9.15   ? 87   TYR B CD1 1 
ATOM   1453  C CD2 . TYR B  1 87  ? 100.053 94.547  154.176 1.00 19.42  ? 87   TYR B CD2 1 
ATOM   1454  C CE1 . TYR B  1 87  ? 99.491  92.796  156.253 1.00 12.08  ? 87   TYR B CE1 1 
ATOM   1455  C CE2 . TYR B  1 87  ? 99.422  93.320  153.907 1.00 6.67   ? 87   TYR B CE2 1 
ATOM   1456  C CZ  . TYR B  1 87  ? 99.139  92.454  154.956 1.00 12.07  ? 87   TYR B CZ  1 
ATOM   1457  O OH  . TYR B  1 87  ? 98.510  91.242  154.710 1.00 14.53  ? 87   TYR B OH  1 
ATOM   1458  N N   . CYS B  1 88  ? 103.043 98.280  154.532 1.00 30.52  ? 88   CYS B N   1 
ATOM   1459  C CA  . CYS B  1 88  ? 103.274 99.717  154.323 1.00 32.02  ? 88   CYS B CA  1 
ATOM   1460  C C   . CYS B  1 88  ? 101.990 100.334 153.788 1.00 31.02  ? 88   CYS B C   1 
ATOM   1461  O O   . CYS B  1 88  ? 101.442 99.861  152.791 1.00 28.18  ? 88   CYS B O   1 
ATOM   1462  C CB  . CYS B  1 88  ? 104.416 99.972  153.317 1.00 32.93  ? 88   CYS B CB  1 
ATOM   1463  S SG  . CYS B  1 88  ? 104.106 99.444  151.574 1.00 41.81  ? 88   CYS B SG  1 
ATOM   1464  N N   . GLN B  1 89  ? 101.500 101.368 154.457 1.00 33.47  ? 89   GLN B N   1 
ATOM   1465  C CA  . GLN B  1 89  ? 100.334 102.076 153.979 1.00 35.86  ? 89   GLN B CA  1 
ATOM   1466  C C   . GLN B  1 89  ? 100.710 103.536 153.899 1.00 39.31  ? 89   GLN B C   1 
ATOM   1467  O O   . GLN B  1 89  ? 101.353 104.082 154.802 1.00 39.77  ? 89   GLN B O   1 
ATOM   1468  C CB  . GLN B  1 89  ? 99.144  101.884 154.935 1.00 36.06  ? 89   GLN B CB  1 
ATOM   1469  C CG  . GLN B  1 89  ? 97.849  102.479 154.370 1.00 33.07  ? 89   GLN B CG  1 
ATOM   1470  C CD  . GLN B  1 89  ? 96.845  102.842 155.439 1.00 32.49  ? 89   GLN B CD  1 
ATOM   1471  O OE1 . GLN B  1 89  ? 97.206  103.192 156.564 1.00 33.29  ? 89   GLN B OE1 1 
ATOM   1472  N NE2 . GLN B  1 89  ? 95.565  102.771 155.090 1.00 33.14  ? 89   GLN B NE2 1 
ATOM   1473  N N   . GLN B  1 90  ? 100.317 104.161 152.797 1.00 41.03  ? 90   GLN B N   1 
ATOM   1474  C CA  . GLN B  1 90  ? 100.479 105.589 152.630 1.00 41.81  ? 90   GLN B CA  1 
ATOM   1475  C C   . GLN B  1 90  ? 99.312  106.289 153.295 1.00 44.17  ? 90   GLN B C   1 
ATOM   1476  O O   . GLN B  1 90  ? 98.143  105.961 153.059 1.00 45.92  ? 90   GLN B O   1 
ATOM   1477  C CB  . GLN B  1 90  ? 100.552 105.953 151.148 1.00 42.04  ? 90   GLN B CB  1 
ATOM   1478  C CG  . GLN B  1 90  ? 99.446  105.338 150.290 1.00 33.46  ? 90   GLN B CG  1 
ATOM   1479  C CD  . GLN B  1 90  ? 98.313  106.304 150.028 1.00 26.85  ? 90   GLN B CD  1 
ATOM   1480  O OE1 . GLN B  1 90  ? 98.543  107.475 149.731 1.00 29.18  ? 90   GLN B OE1 1 
ATOM   1481  N NE2 . GLN B  1 90  ? 97.087  105.822 150.114 1.00 19.87  ? 90   GLN B NE2 1 
ATOM   1482  N N   . SER B  1 91  ? 99.644  107.247 154.146 1.00 45.41  ? 91   SER B N   1 
ATOM   1483  C CA  . SER B  1 91  ? 98.659  108.031 154.857 1.00 44.22  ? 91   SER B CA  1 
ATOM   1484  C C   . SER B  1 91  ? 98.333  109.306 154.082 1.00 44.14  ? 91   SER B C   1 
ATOM   1485  O O   . SER B  1 91  ? 98.008  110.332 154.699 1.00 44.41  ? 91   SER B O   1 
ATOM   1486  C CB  . SER B  1 91  ? 99.254  108.416 156.219 1.00 43.22  ? 91   SER B CB  1 
ATOM   1487  O OG  . SER B  1 91  ? 98.284  109.078 157.034 1.00 48.02  ? 91   SER B OG  1 
ATOM   1488  N N   . TYR B  1 92  ? 98.382  109.264 152.752 1.00 42.06  ? 92   TYR B N   1 
ATOM   1489  C CA  . TYR B  1 92  ? 98.598  110.511 152.010 1.00 41.84  ? 92   TYR B CA  1 
ATOM   1490  C C   . TYR B  1 92  ? 97.354  111.171 151.366 1.00 40.73  ? 92   TYR B C   1 
ATOM   1491  O O   . TYR B  1 92  ? 96.958  112.295 151.724 1.00 39.01  ? 92   TYR B O   1 
ATOM   1492  C CB  . TYR B  1 92  ? 99.699  110.280 150.972 1.00 42.35  ? 92   TYR B CB  1 
ATOM   1493  C CG  . TYR B  1 92  ? 100.067 111.490 150.172 1.00 39.66  ? 92   TYR B CG  1 
ATOM   1494  C CD1 . TYR B  1 92  ? 101.009 112.396 150.643 1.00 43.55  ? 92   TYR B CD1 1 
ATOM   1495  C CD2 . TYR B  1 92  ? 99.499  111.713 148.922 1.00 41.94  ? 92   TYR B CD2 1 
ATOM   1496  C CE1 . TYR B  1 92  ? 101.363 113.507 149.900 1.00 43.48  ? 92   TYR B CE1 1 
ATOM   1497  C CE2 . TYR B  1 92  ? 99.844  112.819 148.169 1.00 41.26  ? 92   TYR B CE2 1 
ATOM   1498  C CZ  . TYR B  1 92  ? 100.778 113.712 148.662 1.00 43.91  ? 92   TYR B CZ  1 
ATOM   1499  O OH  . TYR B  1 92  ? 101.124 114.814 147.917 1.00 45.95  ? 92   TYR B OH  1 
ATOM   1500  N N   . SER B  1 93  ? 96.791  110.474 150.383 1.00 40.27  ? 93   SER B N   1 
ATOM   1501  C CA  . SER B  1 93  ? 95.433  110.712 149.914 1.00 40.22  ? 93   SER B CA  1 
ATOM   1502  C C   . SER B  1 93  ? 94.572  109.598 150.475 1.00 40.51  ? 93   SER B C   1 
ATOM   1503  O O   . SER B  1 93  ? 95.079  108.569 150.936 1.00 39.18  ? 93   SER B O   1 
ATOM   1504  C CB  . SER B  1 93  ? 95.368  110.675 148.378 1.00 40.71  ? 93   SER B CB  1 
ATOM   1505  O OG  . SER B  1 93  ? 94.062  110.355 147.915 1.00 35.75  ? 93   SER B OG  1 
ATOM   1506  N N   . THR B  1 94  ? 93.268  109.808 150.428 1.00 42.02  ? 94   THR B N   1 
ATOM   1507  C CA  . THR B  1 94  ? 92.305  108.762 150.690 1.00 42.82  ? 94   THR B CA  1 
ATOM   1508  C C   . THR B  1 94  ? 91.685  108.471 149.317 1.00 42.88  ? 94   THR B C   1 
ATOM   1509  O O   . THR B  1 94  ? 91.532  109.412 148.525 1.00 43.24  ? 94   THR B O   1 
ATOM   1510  C CB  . THR B  1 94  ? 91.238  109.281 151.663 1.00 42.78  ? 94   THR B CB  1 
ATOM   1511  O OG1 . THR B  1 94  ? 90.541  110.381 151.065 1.00 43.97  ? 94   THR B OG1 1 
ATOM   1512  C CG2 . THR B  1 94  ? 91.870  109.761 152.965 1.00 43.24  ? 94   THR B CG2 1 
ATOM   1513  N N   . PRO B  1 95  ? 91.328  107.198 148.997 1.00 44.24  ? 95   PRO B N   1 
ATOM   1514  C CA  . PRO B  1 95  ? 91.437  105.857 149.607 1.00 43.89  ? 95   PRO B CA  1 
ATOM   1515  C C   . PRO B  1 95  ? 92.847  105.479 150.066 1.00 45.46  ? 95   PRO B C   1 
ATOM   1516  O O   . PRO B  1 95  ? 93.643  105.016 149.246 1.00 45.21  ? 95   PRO B O   1 
ATOM   1517  C CB  . PRO B  1 95  ? 90.962  104.908 148.473 1.00 44.02  ? 95   PRO B CB  1 
ATOM   1518  C CG  . PRO B  1 95  ? 90.926  105.774 147.225 1.00 43.68  ? 95   PRO B CG  1 
ATOM   1519  C CD  . PRO B  1 95  ? 90.588  107.132 147.722 1.00 44.07  ? 95   PRO B CD  1 
ATOM   1520  N N   . ASN B  1 96  ? 93.154  105.678 151.354 1.00 45.48  ? 96   ASN B N   1 
ATOM   1521  C CA  . ASN B  1 96  ? 94.488  105.352 151.900 1.00 45.30  ? 96   ASN B CA  1 
ATOM   1522  C C   . ASN B  1 96  ? 94.861  103.908 151.537 1.00 45.39  ? 96   ASN B C   1 
ATOM   1523  O O   . ASN B  1 96  ? 93.986  103.033 151.540 1.00 46.69  ? 96   ASN B O   1 
ATOM   1524  C CB  . ASN B  1 96  ? 94.555  105.563 153.423 1.00 46.29  ? 96   ASN B CB  1 
ATOM   1525  C CG  . ASN B  1 96  ? 94.076  106.949 153.858 1.00 45.77  ? 96   ASN B CG  1 
ATOM   1526  O OD1 . ASN B  1 96  ? 94.861  107.899 153.944 1.00 42.52  ? 96   ASN B OD1 1 
ATOM   1527  N ND2 . ASN B  1 96  ? 92.784  107.058 154.147 1.00 46.35  ? 96   ASN B ND2 1 
ATOM   1528  N N   . THR B  1 97  ? 96.136  103.645 151.228 1.00 44.16  ? 97   THR B N   1 
ATOM   1529  C CA  . THR B  1 97  ? 96.486  102.375 150.567 1.00 43.40  ? 97   THR B CA  1 
ATOM   1530  C C   . THR B  1 97  ? 97.666  101.562 151.105 1.00 43.05  ? 97   THR B C   1 
ATOM   1531  O O   . THR B  1 97  ? 98.795  102.053 151.213 1.00 44.31  ? 97   THR B O   1 
ATOM   1532  C CB  . THR B  1 97  ? 96.664  102.549 149.036 1.00 44.83  ? 97   THR B CB  1 
ATOM   1533  O OG1 . THR B  1 97  ? 97.304  103.799 148.752 1.00 46.36  ? 97   THR B OG1 1 
ATOM   1534  C CG2 . THR B  1 97  ? 95.312  102.503 148.331 1.00 44.00  ? 97   THR B CG2 1 
ATOM   1535  N N   . PHE B  1 98  ? 97.384  100.298 151.404 1.00 43.05  ? 98   PHE B N   1 
ATOM   1536  C CA  . PHE B  1 98  ? 98.388  99.351  151.861 1.00 40.71  ? 98   PHE B CA  1 
ATOM   1537  C C   . PHE B  1 98  ? 99.236  98.831  150.733 1.00 40.62  ? 98   PHE B C   1 
ATOM   1538  O O   . PHE B  1 98  ? 98.832  98.891  149.553 1.00 41.47  ? 98   PHE B O   1 
ATOM   1539  C CB  . PHE B  1 98  ? 97.706  98.147  152.487 1.00 39.57  ? 98   PHE B CB  1 
ATOM   1540  C CG  . PHE B  1 98  ? 97.304  98.364  153.891 1.00 35.42  ? 98   PHE B CG  1 
ATOM   1541  C CD1 . PHE B  1 98  ? 96.265  99.239  154.200 1.00 18.78  ? 98   PHE B CD1 1 
ATOM   1542  C CD2 . PHE B  1 98  ? 97.961  97.703  154.920 1.00 28.72  ? 98   PHE B CD2 1 
ATOM   1543  C CE1 . PHE B  1 98  ? 95.882  99.450  155.516 1.00 22.90  ? 98   PHE B CE1 1 
ATOM   1544  C CE2 . PHE B  1 98  ? 97.587  97.902  156.239 1.00 31.38  ? 98   PHE B CE2 1 
ATOM   1545  C CZ  . PHE B  1 98  ? 96.544  98.779  156.539 1.00 30.75  ? 98   PHE B CZ  1 
ATOM   1546  N N   . GLY B  1 99  ? 100.399 98.294  151.097 1.00 39.63  ? 99   GLY B N   1 
ATOM   1547  C CA  . GLY B  1 99  ? 101.170 97.462  150.189 1.00 39.26  ? 99   GLY B CA  1 
ATOM   1548  C C   . GLY B  1 99  ? 100.371 96.192  149.970 1.00 38.62  ? 99   GLY B C   1 
ATOM   1549  O O   . GLY B  1 99  ? 99.178  96.241  149.658 1.00 40.43  ? 99   GLY B O   1 
ATOM   1550  N N   . GLN B  1 100 ? 101.032 95.048  150.119 1.00 39.45  ? 100  GLN B N   1 
ATOM   1551  C CA  . GLN B  1 100 ? 100.372 93.744  150.077 1.00 38.51  ? 100  GLN B CA  1 
ATOM   1552  C C   . GLN B  1 100 ? 101.236 92.772  150.861 1.00 37.88  ? 100  GLN B C   1 
ATOM   1553  O O   . GLN B  1 100 ? 101.014 91.557  150.852 1.00 37.79  ? 100  GLN B O   1 
ATOM   1554  C CB  . GLN B  1 100 ? 100.141 93.252  148.646 1.00 38.74  ? 100  GLN B CB  1 
ATOM   1555  C CG  . GLN B  1 100 ? 101.390 93.167  147.801 1.00 38.45  ? 100  GLN B CG  1 
ATOM   1556  C CD  . GLN B  1 100 ? 101.831 94.525  147.303 1.00 37.93  ? 100  GLN B CD  1 
ATOM   1557  O OE1 . GLN B  1 100 ? 102.396 95.339  148.052 1.00 44.58  ? 100  GLN B OE1 1 
ATOM   1558  N NE2 . GLN B  1 100 ? 101.596 94.782  146.024 1.00 36.96  ? 100  GLN B NE2 1 
ATOM   1559  N N   . GLY B  1 101 ? 102.244 93.327  151.520 1.00 38.13  ? 101  GLY B N   1 
ATOM   1560  C CA  . GLY B  1 101 ? 102.822 92.682  152.675 1.00 37.67  ? 101  GLY B CA  1 
ATOM   1561  C C   . GLY B  1 101 ? 104.054 91.842  152.482 1.00 36.69  ? 101  GLY B C   1 
ATOM   1562  O O   . GLY B  1 101 ? 104.367 91.381  151.378 1.00 35.49  ? 101  GLY B O   1 
ATOM   1563  N N   . THR B  1 102 ? 104.746 91.649  153.598 1.00 35.45  ? 102  THR B N   1 
ATOM   1564  C CA  . THR B  1 102 ? 105.851 90.728  153.669 1.00 35.43  ? 102  THR B CA  1 
ATOM   1565  C C   . THR B  1 102 ? 105.622 89.806  154.854 1.00 34.88  ? 102  THR B C   1 
ATOM   1566  O O   . THR B  1 102 ? 105.631 90.240  156.007 1.00 34.07  ? 102  THR B O   1 
ATOM   1567  C CB  . THR B  1 102 ? 107.197 91.470  153.781 1.00 35.52  ? 102  THR B CB  1 
ATOM   1568  O OG1 . THR B  1 102 ? 107.483 92.127  152.531 1.00 33.41  ? 102  THR B OG1 1 
ATOM   1569  C CG2 . THR B  1 102 ? 108.341 90.488  154.102 1.00 35.37  ? 102  THR B CG2 1 
ATOM   1570  N N   . LYS B  1 103 ? 105.384 88.533  154.545 1.00 36.25  ? 103  LYS B N   1 
ATOM   1571  C CA  . LYS B  1 103 ? 105.275 87.482  155.544 1.00 38.38  ? 103  LYS B CA  1 
ATOM   1572  C C   . LYS B  1 103 ? 106.688 87.218  156.053 1.00 36.40  ? 103  LYS B C   1 
ATOM   1573  O O   . LYS B  1 103 ? 107.519 86.686  155.309 1.00 36.41  ? 103  LYS B O   1 
ATOM   1574  C CB  . LYS B  1 103 ? 104.717 86.208  154.893 1.00 38.19  ? 103  LYS B CB  1 
ATOM   1575  C CG  . LYS B  1 103 ? 103.700 85.426  155.757 1.00 40.57  ? 103  LYS B CG  1 
ATOM   1576  C CD  . LYS B  1 103 ? 103.602 83.980  155.206 1.00 43.61  ? 103  LYS B CD  1 
ATOM   1577  C CE  . LYS B  1 103 ? 102.315 83.297  155.640 1.00 44.70  ? 103  LYS B CE  1 
ATOM   1578  N NZ  . LYS B  1 103 ? 101.157 83.687  154.752 1.00 50.98  ? 103  LYS B NZ  1 
ATOM   1579  N N   . VAL B  1 104 ? 106.989 87.596  157.291 1.00 36.82  ? 104  VAL B N   1 
ATOM   1580  C CA  . VAL B  1 104 ? 108.316 87.276  157.816 1.00 36.26  ? 104  VAL B CA  1 
ATOM   1581  C C   . VAL B  1 104 ? 108.295 85.932  158.542 1.00 38.56  ? 104  VAL B C   1 
ATOM   1582  O O   . VAL B  1 104 ? 107.576 85.749  159.537 1.00 40.02  ? 104  VAL B O   1 
ATOM   1583  C CB  . VAL B  1 104 ? 108.957 88.433  158.637 1.00 34.53  ? 104  VAL B CB  1 
ATOM   1584  C CG1 . VAL B  1 104 ? 110.278 87.989  159.269 1.00 33.47  ? 104  VAL B CG1 1 
ATOM   1585  C CG2 . VAL B  1 104 ? 109.215 89.628  157.726 1.00 29.87  ? 104  VAL B CG2 1 
ATOM   1586  N N   . GLU B  1 105 ? 109.068 84.990  157.998 1.00 41.69  ? 105  GLU B N   1 
ATOM   1587  C CA  . GLU B  1 105 ? 109.085 83.619  158.486 1.00 44.15  ? 105  GLU B CA  1 
ATOM   1588  C C   . GLU B  1 105 ? 110.417 83.341  159.151 1.00 44.55  ? 105  GLU B C   1 
ATOM   1589  O O   . GLU B  1 105 ? 111.449 83.128  158.492 1.00 44.23  ? 105  GLU B O   1 
ATOM   1590  C CB  . GLU B  1 105 ? 108.851 82.628  157.349 1.00 44.61  ? 105  GLU B CB  1 
ATOM   1591  C CG  . GLU B  1 105 ? 107.891 81.527  157.722 1.00 43.83  ? 105  GLU B CG  1 
ATOM   1592  C CD  . GLU B  1 105 ? 106.509 82.072  158.018 1.00 36.67  ? 105  GLU B CD  1 
ATOM   1593  O OE1 . GLU B  1 105 ? 105.987 82.869  157.186 1.00 30.87  ? 105  GLU B OE1 1 
ATOM   1594  O OE2 . GLU B  1 105 ? 105.938 81.718  159.074 1.00 36.49  ? 105  GLU B OE2 1 
ATOM   1595  N N   . ILE B  1 106 ? 110.352 83.327  160.476 1.00 45.44  ? 106  ILE B N   1 
ATOM   1596  C CA  . ILE B  1 106 ? 111.501 83.363  161.368 1.00 45.86  ? 106  ILE B CA  1 
ATOM   1597  C C   . ILE B  1 106 ? 112.242 82.028  161.454 1.00 47.74  ? 106  ILE B C   1 
ATOM   1598  O O   . ILE B  1 106 ? 112.316 81.274  160.486 1.00 50.43  ? 106  ILE B O   1 
ATOM   1599  C CB  . ILE B  1 106 ? 111.021 83.817  162.781 1.00 46.02  ? 106  ILE B CB  1 
ATOM   1600  C CG1 . ILE B  1 106 ? 111.244 85.323  162.978 1.00 45.98  ? 106  ILE B CG1 1 
ATOM   1601  C CG2 . ILE B  1 106 ? 111.669 82.975  163.902 1.00 43.41  ? 106  ILE B CG2 1 
ATOM   1602  C CD1 . ILE B  1 106 ? 112.690 85.687  163.429 1.00 45.32  ? 106  ILE B CD1 1 
ATOM   1603  N N   . ASP C  1 1   ? 139.001 79.611  160.465 1.00 42.42  ? 1    ASP C N   1 
ATOM   1604  C CA  . ASP C  1 1   ? 137.781 79.639  159.607 1.00 43.70  ? 1    ASP C CA  1 
ATOM   1605  C C   . ASP C  1 1   ? 136.984 80.919  159.764 1.00 43.66  ? 1    ASP C C   1 
ATOM   1606  O O   . ASP C  1 1   ? 136.311 81.111  160.791 1.00 44.49  ? 1    ASP C O   1 
ATOM   1607  C CB  . ASP C  1 1   ? 136.849 78.469  159.951 1.00 43.47  ? 1    ASP C CB  1 
ATOM   1608  C CG  . ASP C  1 1   ? 136.918 77.339  158.944 1.00 44.89  ? 1    ASP C CG  1 
ATOM   1609  O OD1 . ASP C  1 1   ? 137.895 77.272  158.168 1.00 38.98  ? 1    ASP C OD1 1 
ATOM   1610  O OD2 . ASP C  1 1   ? 135.983 76.504  158.932 1.00 47.57  ? 1    ASP C OD2 1 
ATOM   1611  N N   . ILE C  1 2   ? 137.064 81.800  158.758 1.00 43.13  ? 2    ILE C N   1 
ATOM   1612  C CA  . ILE C  1 2   ? 135.993 82.763  158.561 1.00 42.67  ? 2    ILE C CA  1 
ATOM   1613  C C   . ILE C  1 2   ? 134.726 81.912  158.512 1.00 42.92  ? 2    ILE C C   1 
ATOM   1614  O O   . ILE C  1 2   ? 134.619 80.996  157.679 1.00 43.60  ? 2    ILE C O   1 
ATOM   1615  C CB  . ILE C  1 2   ? 136.105 83.506  157.197 1.00 42.10  ? 2    ILE C CB  1 
ATOM   1616  C CG1 . ILE C  1 2   ? 137.527 84.038  156.950 1.00 39.05  ? 2    ILE C CG1 1 
ATOM   1617  C CG2 . ILE C  1 2   ? 135.029 84.599  157.073 1.00 42.07  ? 2    ILE C CG2 1 
ATOM   1618  C CD1 . ILE C  1 2   ? 137.895 85.276  157.714 1.00 38.59  ? 2    ILE C CD1 1 
ATOM   1619  N N   . GLN C  1 3   ? 133.788 82.175  159.418 1.00 42.16  ? 3    GLN C N   1 
ATOM   1620  C CA  . GLN C  1 3   ? 132.444 81.604  159.323 1.00 41.53  ? 3    GLN C CA  1 
ATOM   1621  C C   . GLN C  1 3   ? 131.512 82.722  158.833 1.00 39.95  ? 3    GLN C C   1 
ATOM   1622  O O   . GLN C  1 3   ? 131.469 83.802  159.438 1.00 40.33  ? 3    GLN C O   1 
ATOM   1623  C CB  . GLN C  1 3   ? 131.990 81.017  160.675 1.00 42.42  ? 3    GLN C CB  1 
ATOM   1624  C CG  . GLN C  1 3   ? 132.592 79.630  161.017 1.00 42.66  ? 3    GLN C CG  1 
ATOM   1625  C CD  . GLN C  1 3   ? 132.324 79.159  162.457 1.00 45.93  ? 3    GLN C CD  1 
ATOM   1626  O OE1 . GLN C  1 3   ? 131.487 79.718  163.169 1.00 46.31  ? 3    GLN C OE1 1 
ATOM   1627  N NE2 . GLN C  1 3   ? 133.042 78.123  162.880 1.00 51.77  ? 3    GLN C NE2 1 
ATOM   1628  N N   . MET C  1 4   ? 130.788 82.477  157.735 1.00 39.91  ? 4    MET C N   1 
ATOM   1629  C CA  . MET C  1 4   ? 129.951 83.505  157.081 1.00 38.32  ? 4    MET C CA  1 
ATOM   1630  C C   . MET C  1 4   ? 128.478 83.385  157.475 1.00 35.80  ? 4    MET C C   1 
ATOM   1631  O O   . MET C  1 4   ? 128.000 82.287  157.823 1.00 35.90  ? 4    MET C O   1 
ATOM   1632  C CB  . MET C  1 4   ? 130.041 83.382  155.553 1.00 38.45  ? 4    MET C CB  1 
ATOM   1633  C CG  . MET C  1 4   ? 131.405 83.654  154.934 1.00 36.53  ? 4    MET C CG  1 
ATOM   1634  S SD  . MET C  1 4   ? 131.886 85.398  155.049 1.00 36.99  ? 4    MET C SD  1 
ATOM   1635  C CE  . MET C  1 4   ? 132.560 85.687  153.413 1.00 40.19  ? 4    MET C CE  1 
ATOM   1636  N N   . THR C  1 5   ? 127.738 84.491  157.408 1.00 33.13  ? 5    THR C N   1 
ATOM   1637  C CA  . THR C  1 5   ? 126.298 84.458  157.658 1.00 28.93  ? 5    THR C CA  1 
ATOM   1638  C C   . THR C  1 5   ? 125.549 85.392  156.734 1.00 27.34  ? 5    THR C C   1 
ATOM   1639  O O   . THR C  1 5   ? 125.814 86.606  156.694 1.00 27.27  ? 5    THR C O   1 
ATOM   1640  C CB  . THR C  1 5   ? 125.950 84.857  159.094 1.00 28.80  ? 5    THR C CB  1 
ATOM   1641  O OG1 . THR C  1 5   ? 126.721 84.067  160.011 1.00 23.65  ? 5    THR C OG1 1 
ATOM   1642  C CG2 . THR C  1 5   ? 124.455 84.650  159.381 1.00 19.96  ? 5    THR C CG2 1 
ATOM   1643  N N   . GLN C  1 6   ? 124.599 84.819  156.007 1.00 25.33  ? 6    GLN C N   1 
ATOM   1644  C CA  . GLN C  1 6   ? 123.731 85.609  155.161 1.00 23.82  ? 6    GLN C CA  1 
ATOM   1645  C C   . GLN C  1 6   ? 122.251 85.493  155.520 1.00 23.48  ? 6    GLN C C   1 
ATOM   1646  O O   . GLN C  1 6   ? 121.846 84.646  156.324 1.00 20.47  ? 6    GLN C O   1 
ATOM   1647  C CB  . GLN C  1 6   ? 123.995 85.345  153.669 1.00 25.10  ? 6    GLN C CB  1 
ATOM   1648  C CG  . GLN C  1 6   ? 124.029 83.892  153.200 1.00 21.03  ? 6    GLN C CG  1 
ATOM   1649  C CD  . GLN C  1 6   ? 124.131 83.819  151.678 1.00 22.69  ? 6    GLN C CD  1 
ATOM   1650  O OE1 . GLN C  1 6   ? 125.046 83.208  151.125 1.00 12.20  ? 6    GLN C OE1 1 
ATOM   1651  N NE2 . GLN C  1 6   ? 123.198 84.471  150.987 1.00 31.53  ? 6    GLN C NE2 1 
ATOM   1652  N N   . SER C  1 7   ? 121.466 86.363  154.887 1.00 25.16  ? 7    SER C N   1 
ATOM   1653  C CA  . SER C  1 7   ? 120.093 86.680  155.252 1.00 25.36  ? 7    SER C CA  1 
ATOM   1654  C C   . SER C  1 7   ? 119.693 87.872  154.403 1.00 26.68  ? 7    SER C C   1 
ATOM   1655  O O   . SER C  1 7   ? 120.515 88.776  154.204 1.00 27.76  ? 7    SER C O   1 
ATOM   1656  C CB  . SER C  1 7   ? 120.033 87.130  156.707 1.00 25.90  ? 7    SER C CB  1 
ATOM   1657  O OG  . SER C  1 7   ? 119.164 88.260  156.877 1.00 27.93  ? 7    SER C OG  1 
ATOM   1658  N N   . PRO C  1 8   ? 118.442 87.941  153.921 1.00 27.59  ? 8    PRO C N   1 
ATOM   1659  C CA  . PRO C  1 8   ? 117.257 87.127  154.074 1.00 26.30  ? 8    PRO C CA  1 
ATOM   1660  C C   . PRO C  1 8   ? 117.626 85.781  153.529 1.00 27.32  ? 8    PRO C C   1 
ATOM   1661  O O   . PRO C  1 8   ? 118.525 85.659  152.673 1.00 28.68  ? 8    PRO C O   1 
ATOM   1662  C CB  . PRO C  1 8   ? 116.266 87.798  153.120 1.00 24.35  ? 8    PRO C CB  1 
ATOM   1663  C CG  . PRO C  1 8   ? 117.118 88.499  152.101 1.00 26.25  ? 8    PRO C CG  1 
ATOM   1664  C CD  . PRO C  1 8   ? 118.202 89.049  152.984 1.00 28.27  ? 8    PRO C CD  1 
ATOM   1665  N N   . SER C  1 9   ? 116.940 84.764  154.017 1.00 26.15  ? 9    SER C N   1 
ATOM   1666  C CA  . SER C  1 9   ? 117.404 83.416  153.819 1.00 26.80  ? 9    SER C CA  1 
ATOM   1667  C C   . SER C  1 9   ? 116.584 82.699  152.751 1.00 28.83  ? 9    SER C C   1 
ATOM   1668  O O   . SER C  1 9   ? 116.997 81.650  152.219 1.00 29.15  ? 9    SER C O   1 
ATOM   1669  C CB  . SER C  1 9   ? 117.362 82.673  155.151 1.00 27.46  ? 9    SER C CB  1 
ATOM   1670  O OG  . SER C  1 9   ? 117.676 81.236  154.921 1.00 22.19  ? 9    SER C OG  1 
ATOM   1671  N N   . SER C  1 10  ? 115.405 83.258  152.456 1.00 28.99  ? 10   SER C N   1 
ATOM   1672  C CA  . SER C  1 10  ? 114.647 82.924  151.243 1.00 28.59  ? 10   SER C CA  1 
ATOM   1673  C C   . SER C  1 10  ? 113.651 84.049  150.906 1.00 28.74  ? 10   SER C C   1 
ATOM   1674  O O   . SER C  1 10  ? 112.866 84.454  151.761 1.00 29.01  ? 10   SER C O   1 
ATOM   1675  C CB  . SER C  1 10  ? 113.911 81.587  151.407 1.00 30.64  ? 10   SER C CB  1 
ATOM   1676  O OG  . SER C  1 10  ? 112.841 81.693  152.331 1.00 30.22  ? 10   SER C OG  1 
ATOM   1677  N N   . LEU C  1 11  ? 113.691 84.555  149.668 1.00 28.28  ? 11   LEU C N   1 
ATOM   1678  C CA  . LEU C  1 11  ? 112.750 85.591  149.202 1.00 28.75  ? 11   LEU C CA  1 
ATOM   1679  C C   . LEU C  1 11  ? 111.643 85.000  148.334 1.00 31.79  ? 11   LEU C C   1 
ATOM   1680  O O   . LEU C  1 11  ? 111.815 83.931  147.746 1.00 29.37  ? 11   LEU C O   1 
ATOM   1681  C CB  . LEU C  1 11  ? 113.492 86.654  148.380 1.00 28.46  ? 11   LEU C CB  1 
ATOM   1682  C CG  . LEU C  1 11  ? 114.262 87.798  149.074 1.00 28.35  ? 11   LEU C CG  1 
ATOM   1683  C CD1 . LEU C  1 11  ? 114.544 87.477  150.527 1.00 28.79  ? 11   LEU C CD1 1 
ATOM   1684  C CD2 . LEU C  1 11  ? 115.588 88.076  148.327 1.00 19.35  ? 11   LEU C CD2 1 
ATOM   1685  N N   . SER C  1 12  ? 110.507 85.695  148.269 1.00 31.84  ? 12   SER C N   1 
ATOM   1686  C CA  . SER C  1 12  ? 109.483 85.458  147.251 1.00 34.05  ? 12   SER C CA  1 
ATOM   1687  C C   . SER C  1 12  ? 109.060 86.813  146.751 1.00 34.18  ? 12   SER C C   1 
ATOM   1688  O O   . SER C  1 12  ? 108.279 87.504  147.412 1.00 36.62  ? 12   SER C O   1 
ATOM   1689  C CB  . SER C  1 12  ? 108.252 84.746  147.828 1.00 32.66  ? 12   SER C CB  1 
ATOM   1690  O OG  . SER C  1 12  ? 108.240 83.365  147.499 1.00 34.33  ? 12   SER C OG  1 
ATOM   1691  N N   . ALA C  1 13  ? 109.592 87.217  145.608 1.00 35.53  ? 13   ALA C N   1 
ATOM   1692  C CA  . ALA C  1 13  ? 109.166 88.458  144.993 1.00 36.81  ? 13   ALA C CA  1 
ATOM   1693  C C   . ALA C  1 13  ? 108.697 88.189  143.570 1.00 37.56  ? 13   ALA C C   1 
ATOM   1694  O O   . ALA C  1 13  ? 109.001 87.147  142.975 1.00 37.86  ? 13   ALA C O   1 
ATOM   1695  C CB  . ALA C  1 13  ? 110.296 89.487  145.017 1.00 36.24  ? 13   ALA C CB  1 
ATOM   1696  N N   . SER C  1 14  ? 107.962 89.164  143.039 1.00 37.60  ? 14   SER C N   1 
ATOM   1697  C CA  . SER C  1 14  ? 107.380 89.125  141.705 1.00 37.08  ? 14   SER C CA  1 
ATOM   1698  C C   . SER C  1 14  ? 108.159 89.983  140.702 1.00 37.30  ? 14   SER C C   1 
ATOM   1699  O O   . SER C  1 14  ? 108.908 90.887  141.082 1.00 38.08  ? 14   SER C O   1 
ATOM   1700  C CB  . SER C  1 14  ? 105.906 89.572  141.760 1.00 36.97  ? 14   SER C CB  1 
ATOM   1701  O OG  . SER C  1 14  ? 105.916 91.098  142.108 1.00 32.16  ? 14   SER C OG  1 
ATOM   1702  N N   . VAL C  1 15  ? 107.925 89.708  139.421 1.00 36.22  ? 15   VAL C N   1 
ATOM   1703  C CA  . VAL C  1 15  ? 108.767 90.143  138.297 1.00 36.73  ? 15   VAL C CA  1 
ATOM   1704  C C   . VAL C  1 15  ? 109.109 91.657  138.214 1.00 37.38  ? 15   VAL C C   1 
ATOM   1705  O O   . VAL C  1 15  ? 108.232 92.505  137.952 1.00 37.08  ? 15   VAL C O   1 
ATOM   1706  C CB  . VAL C  1 15  ? 108.172 89.606  136.942 1.00 37.34  ? 15   VAL C CB  1 
ATOM   1707  C CG1 . VAL C  1 15  ? 109.019 90.026  135.732 1.00 33.52  ? 15   VAL C CG1 1 
ATOM   1708  C CG2 . VAL C  1 15  ? 108.001 88.072  136.988 1.00 37.94  ? 15   VAL C CG2 1 
ATOM   1709  N N   . GLY C  1 16  ? 110.382 91.988  138.436 1.00 37.89  ? 16   GLY C N   1 
ATOM   1710  C CA  . GLY C  1 16  ? 110.876 93.364  138.264 1.00 36.57  ? 16   GLY C CA  1 
ATOM   1711  C C   . GLY C  1 16  ? 110.960 94.190  139.540 1.00 37.01  ? 16   GLY C C   1 
ATOM   1712  O O   . GLY C  1 16  ? 111.174 95.408  139.491 1.00 36.65  ? 16   GLY C O   1 
ATOM   1713  N N   . ASP C  1 17  ? 110.783 93.528  140.683 1.00 38.44  ? 17   ASP C N   1 
ATOM   1714  C CA  . ASP C  1 17  ? 110.991 94.165  141.969 1.00 38.19  ? 17   ASP C CA  1 
ATOM   1715  C C   . ASP C  1 17  ? 112.474 94.407  142.225 1.00 38.92  ? 17   ASP C C   1 
ATOM   1716  O O   . ASP C  1 17  ? 113.356 94.054  141.432 1.00 38.31  ? 17   ASP C O   1 
ATOM   1717  C CB  . ASP C  1 17  ? 110.410 93.321  143.119 1.00 37.53  ? 17   ASP C CB  1 
ATOM   1718  C CG  . ASP C  1 17  ? 108.888 93.303  143.129 1.00 37.81  ? 17   ASP C CG  1 
ATOM   1719  O OD1 . ASP C  1 17  ? 108.313 92.582  143.973 1.00 40.84  ? 17   ASP C OD1 1 
ATOM   1720  O OD2 . ASP C  1 17  ? 108.261 93.999  142.298 1.00 33.37  ? 17   ASP C OD2 1 
ATOM   1721  N N   . ARG C  1 18  ? 112.700 95.008  143.381 1.00 39.82  ? 18   ARG C N   1 
ATOM   1722  C CA  . ARG C  1 18  ? 113.985 95.364  143.905 1.00 40.89  ? 18   ARG C CA  1 
ATOM   1723  C C   . ARG C  1 18  ? 114.250 94.319  144.949 1.00 41.35  ? 18   ARG C C   1 
ATOM   1724  O O   . ARG C  1 18  ? 113.341 93.954  145.702 1.00 42.31  ? 18   ARG C O   1 
ATOM   1725  C CB  . ARG C  1 18  ? 113.833 96.716  144.584 1.00 42.82  ? 18   ARG C CB  1 
ATOM   1726  C CG  . ARG C  1 18  ? 113.357 97.805  143.632 1.00 41.42  ? 18   ARG C CG  1 
ATOM   1727  C CD  . ARG C  1 18  ? 114.466 98.060  142.669 1.00 34.51  ? 18   ARG C CD  1 
ATOM   1728  N NE  . ARG C  1 18  ? 115.703 98.020  143.441 1.00 35.26  ? 18   ARG C NE  1 
ATOM   1729  C CZ  . ARG C  1 18  ? 116.521 99.051  143.577 1.00 41.63  ? 18   ARG C CZ  1 
ATOM   1730  N NH1 . ARG C  1 18  ? 116.264 100.203 142.933 1.00 45.17  ? 18   ARG C NH1 1 
ATOM   1731  N NH2 . ARG C  1 18  ? 117.614 98.930  144.329 1.00 35.49  ? 18   ARG C NH2 1 
ATOM   1732  N N   . VAL C  1 19  ? 115.485 93.826  145.013 1.00 42.54  ? 19   VAL C N   1 
ATOM   1733  C CA  . VAL C  1 19  ? 115.732 92.678  145.861 1.00 41.96  ? 19   VAL C CA  1 
ATOM   1734  C C   . VAL C  1 19  ? 117.085 92.789  146.538 1.00 41.84  ? 19   VAL C C   1 
ATOM   1735  O O   . VAL C  1 19  ? 118.120 92.936  145.887 1.00 44.63  ? 19   VAL C O   1 
ATOM   1736  C CB  . VAL C  1 19  ? 115.549 91.345  145.066 1.00 41.20  ? 19   VAL C CB  1 
ATOM   1737  C CG1 . VAL C  1 19  ? 116.451 90.224  145.608 1.00 41.21  ? 19   VAL C CG1 1 
ATOM   1738  C CG2 . VAL C  1 19  ? 114.070 90.917  145.073 1.00 43.14  ? 19   VAL C CG2 1 
ATOM   1739  N N   . THR C  1 20  ? 117.040 92.699  147.864 1.00 39.40  ? 20   THR C N   1 
ATOM   1740  C CA  . THR C  1 20  ? 118.149 93.042  148.733 1.00 37.08  ? 20   THR C CA  1 
ATOM   1741  C C   . THR C  1 20  ? 118.561 91.821  149.541 1.00 35.52  ? 20   THR C C   1 
ATOM   1742  O O   . THR C  1 20  ? 117.770 91.272  150.315 1.00 36.68  ? 20   THR C O   1 
ATOM   1743  C CB  . THR C  1 20  ? 117.724 94.153  149.704 1.00 37.51  ? 20   THR C CB  1 
ATOM   1744  O OG1 . THR C  1 20  ? 116.754 94.999  149.068 1.00 40.80  ? 20   THR C OG1 1 
ATOM   1745  C CG2 . THR C  1 20  ? 118.925 94.981  150.142 1.00 36.30  ? 20   THR C CG2 1 
ATOM   1746  N N   . ILE C  1 21  ? 119.808 91.407  149.342 1.00 33.94  ? 21   ILE C N   1 
ATOM   1747  C CA  . ILE C  1 21  ? 120.375 90.233  149.990 1.00 30.59  ? 21   ILE C CA  1 
ATOM   1748  C C   . ILE C  1 21  ? 121.620 90.683  150.731 1.00 33.19  ? 21   ILE C C   1 
ATOM   1749  O O   . ILE C  1 21  ? 122.494 91.334  150.147 1.00 33.01  ? 21   ILE C O   1 
ATOM   1750  C CB  . ILE C  1 21  ? 120.754 89.160  148.949 1.00 29.44  ? 21   ILE C CB  1 
ATOM   1751  C CG1 . ILE C  1 21  ? 119.496 88.621  148.252 1.00 17.92  ? 21   ILE C CG1 1 
ATOM   1752  C CG2 . ILE C  1 21  ? 121.586 88.040  149.592 1.00 26.43  ? 21   ILE C CG2 1 
ATOM   1753  C CD1 . ILE C  1 21  ? 119.791 87.852  146.967 1.00 9.11   ? 21   ILE C CD1 1 
ATOM   1754  N N   . THR C  1 22  ? 121.698 90.350  152.012 1.00 34.35  ? 22   THR C N   1 
ATOM   1755  C CA  . THR C  1 22  ? 122.820 90.792  152.819 1.00 34.53  ? 22   THR C CA  1 
ATOM   1756  C C   . THR C  1 22  ? 123.667 89.619  153.287 1.00 33.05  ? 22   THR C C   1 
ATOM   1757  O O   . THR C  1 22  ? 123.156 88.537  153.589 1.00 31.19  ? 22   THR C O   1 
ATOM   1758  C CB  . THR C  1 22  ? 122.369 91.687  154.003 1.00 35.18  ? 22   THR C CB  1 
ATOM   1759  O OG1 . THR C  1 22  ? 121.317 91.041  154.731 1.00 36.84  ? 22   THR C OG1 1 
ATOM   1760  C CG2 . THR C  1 22  ? 121.861 93.042  153.486 1.00 38.57  ? 22   THR C CG2 1 
ATOM   1761  N N   . CYS C  1 23  ? 124.974 89.846  153.314 1.00 33.71  ? 23   CYS C N   1 
ATOM   1762  C CA  . CYS C  1 23  ? 125.937 88.835  153.710 1.00 35.02  ? 23   CYS C CA  1 
ATOM   1763  C C   . CYS C  1 23  ? 126.953 89.507  154.629 1.00 35.98  ? 23   CYS C C   1 
ATOM   1764  O O   . CYS C  1 23  ? 127.211 90.705  154.491 1.00 36.38  ? 23   CYS C O   1 
ATOM   1765  C CB  . CYS C  1 23  ? 126.621 88.257  152.466 1.00 33.60  ? 23   CYS C CB  1 
ATOM   1766  S SG  . CYS C  1 23  ? 128.016 87.139  152.781 1.00 33.49  ? 23   CYS C SG  1 
ATOM   1767  N N   . ARG C  1 24  ? 127.531 88.750  155.564 1.00 38.09  ? 24   ARG C N   1 
ATOM   1768  C CA  . ARG C  1 24  ? 128.529 89.329  156.479 1.00 41.12  ? 24   ARG C CA  1 
ATOM   1769  C C   . ARG C  1 24  ? 129.586 88.314  156.927 1.00 41.07  ? 24   ARG C C   1 
ATOM   1770  O O   . ARG C  1 24  ? 129.296 87.128  157.089 1.00 43.27  ? 24   ARG C O   1 
ATOM   1771  C CB  . ARG C  1 24  ? 127.828 89.955  157.694 1.00 42.55  ? 24   ARG C CB  1 
ATOM   1772  C CG  . ARG C  1 24  ? 128.543 91.138  158.312 1.00 43.18  ? 24   ARG C CG  1 
ATOM   1773  C CD  . ARG C  1 24  ? 127.636 91.749  159.366 1.00 43.05  ? 24   ARG C CD  1 
ATOM   1774  N NE  . ARG C  1 24  ? 128.280 92.767  160.214 1.00 46.92  ? 24   ARG C NE  1 
ATOM   1775  C CZ  . ARG C  1 24  ? 129.104 92.504  161.228 1.00 51.55  ? 24   ARG C CZ  1 
ATOM   1776  N NH1 . ARG C  1 24  ? 129.436 91.226  161.535 1.00 51.29  ? 24   ARG C NH1 1 
ATOM   1777  N NH2 . ARG C  1 24  ? 129.617 93.526  161.933 1.00 51.05  ? 24   ARG C NH2 1 
ATOM   1778  N N   . ALA C  1 25  ? 130.810 88.805  157.131 1.00 41.45  ? 25   ALA C N   1 
ATOM   1779  C CA  . ALA C  1 25  ? 131.971 87.958  157.430 1.00 41.50  ? 25   ALA C CA  1 
ATOM   1780  C C   . ALA C  1 25  ? 132.387 88.057  158.894 1.00 40.98  ? 25   ALA C C   1 
ATOM   1781  O O   . ALA C  1 25  ? 132.131 89.069  159.551 1.00 41.22  ? 25   ALA C O   1 
ATOM   1782  C CB  . ALA C  1 25  ? 133.137 88.345  156.530 1.00 41.66  ? 25   ALA C CB  1 
ATOM   1783  N N   . SER C  1 26  ? 133.053 87.023  159.399 1.00 40.11  ? 26   SER C N   1 
ATOM   1784  C CA  . SER C  1 26  ? 133.393 86.946  160.827 1.00 40.64  ? 26   SER C CA  1 
ATOM   1785  C C   . SER C  1 26  ? 134.526 87.872  161.305 1.00 41.16  ? 26   SER C C   1 
ATOM   1786  O O   . SER C  1 26  ? 134.809 87.938  162.504 1.00 40.05  ? 26   SER C O   1 
ATOM   1787  C CB  . SER C  1 26  ? 133.711 85.499  161.208 1.00 40.51  ? 26   SER C CB  1 
ATOM   1788  O OG  . SER C  1 26  ? 134.838 85.026  160.494 1.00 39.58  ? 26   SER C OG  1 
ATOM   1789  N N   . GLN C  1 27  ? 135.154 88.587  160.373 1.00 41.53  ? 27   GLN C N   1 
ATOM   1790  C CA  . GLN C  1 27  ? 136.297 89.470  160.639 1.00 43.31  ? 27   GLN C CA  1 
ATOM   1791  C C   . GLN C  1 27  ? 136.505 90.212  159.325 1.00 42.88  ? 27   GLN C C   1 
ATOM   1792  O O   . GLN C  1 27  ? 136.050 89.715  158.275 1.00 44.59  ? 27   GLN C O   1 
ATOM   1793  C CB  . GLN C  1 27  ? 137.550 88.642  160.944 1.00 43.06  ? 27   GLN C CB  1 
ATOM   1794  C CG  . GLN C  1 27  ? 138.241 88.132  159.678 1.00 47.41  ? 27   GLN C CG  1 
ATOM   1795  C CD  . GLN C  1 27  ? 139.376 87.170  159.934 1.00 50.20  ? 27   GLN C CD  1 
ATOM   1796  O OE1 . GLN C  1 27  ? 139.211 86.155  160.614 1.00 49.67  ? 27   GLN C OE1 1 
ATOM   1797  N NE2 . GLN C  1 27  ? 140.539 87.470  159.368 1.00 50.22  ? 27   GLN C NE2 1 
ATOM   1798  N N   . SER C  1 28  ? 137.163 91.378  159.337 1.00 42.00  ? 28   SER C N   1 
ATOM   1799  C CA  . SER C  1 28  ? 137.435 92.050  158.055 1.00 41.98  ? 28   SER C CA  1 
ATOM   1800  C C   . SER C  1 28  ? 138.098 91.075  157.074 1.00 40.86  ? 28   SER C C   1 
ATOM   1801  O O   . SER C  1 28  ? 138.946 90.250  157.467 1.00 40.93  ? 28   SER C O   1 
ATOM   1802  C CB  . SER C  1 28  ? 138.302 93.305  158.228 1.00 41.81  ? 28   SER C CB  1 
ATOM   1803  O OG  . SER C  1 28  ? 138.586 93.891  156.935 1.00 41.52  ? 28   SER C OG  1 
ATOM   1804  N N   . ILE C  1 29  ? 137.690 91.173  155.803 1.00 39.76  ? 29   ILE C N   1 
ATOM   1805  C CA  . ILE C  1 29  ? 138.224 90.326  154.735 1.00 38.18  ? 29   ILE C CA  1 
ATOM   1806  C C   . ILE C  1 29  ? 138.439 91.175  153.483 1.00 39.11  ? 29   ILE C C   1 
ATOM   1807  O O   . ILE C  1 29  ? 138.686 90.660  152.387 1.00 38.59  ? 29   ILE C O   1 
ATOM   1808  C CB  . ILE C  1 29  ? 137.283 89.135  154.391 1.00 39.37  ? 29   ILE C CB  1 
ATOM   1809  C CG1 . ILE C  1 29  ? 135.885 89.631  153.993 1.00 32.24  ? 29   ILE C CG1 1 
ATOM   1810  C CG2 . ILE C  1 29  ? 137.233 88.123  155.533 1.00 34.32  ? 29   ILE C CG2 1 
ATOM   1811  C CD1 . ILE C  1 29  ? 135.141 88.714  153.026 1.00 23.01  ? 29   ILE C CD1 1 
ATOM   1812  N N   . SER C  1 30  ? 138.332 92.490  153.684 1.00 41.13  ? 30   SER C N   1 
ATOM   1813  C CA  . SER C  1 30  ? 138.413 93.513  152.638 1.00 42.79  ? 30   SER C CA  1 
ATOM   1814  C C   . SER C  1 30  ? 137.432 93.306  151.498 1.00 43.70  ? 30   SER C C   1 
ATOM   1815  O O   . SER C  1 30  ? 136.248 93.616  151.625 1.00 46.07  ? 30   SER C O   1 
ATOM   1816  C CB  . SER C  1 30  ? 139.842 93.679  152.105 1.00 43.69  ? 30   SER C CB  1 
ATOM   1817  O OG  . SER C  1 30  ? 139.863 94.473  150.925 1.00 39.29  ? 30   SER C OG  1 
ATOM   1818  N N   . SER C  1 31  ? 137.931 92.780  150.387 1.00 43.49  ? 31   SER C N   1 
ATOM   1819  C CA  . SER C  1 31  ? 137.144 92.732  149.175 1.00 44.10  ? 31   SER C CA  1 
ATOM   1820  C C   . SER C  1 31  ? 137.168 91.358  148.514 1.00 44.83  ? 31   SER C C   1 
ATOM   1821  O O   . SER C  1 31  ? 136.377 91.110  147.608 1.00 45.28  ? 31   SER C O   1 
ATOM   1822  C CB  . SER C  1 31  ? 137.593 93.834  148.207 1.00 43.78  ? 31   SER C CB  1 
ATOM   1823  O OG  . SER C  1 31  ? 136.534 94.196  147.334 1.00 38.36  ? 31   SER C OG  1 
ATOM   1824  N N   . TYR C  1 32  ? 138.050 90.467  148.975 1.00 45.86  ? 32   TYR C N   1 
ATOM   1825  C CA  . TYR C  1 32  ? 137.993 89.061  148.552 1.00 46.64  ? 32   TYR C CA  1 
ATOM   1826  C C   . TYR C  1 32  ? 136.607 88.461  148.906 1.00 45.61  ? 32   TYR C C   1 
ATOM   1827  O O   . TYR C  1 32  ? 136.456 87.774  149.923 1.00 43.52  ? 32   TYR C O   1 
ATOM   1828  C CB  . TYR C  1 32  ? 139.158 88.248  149.172 1.00 48.93  ? 32   TYR C CB  1 
ATOM   1829  C CG  . TYR C  1 32  ? 140.548 88.683  148.709 1.00 52.10  ? 32   TYR C CG  1 
ATOM   1830  C CD1 . TYR C  1 32  ? 141.068 89.922  149.082 1.00 53.99  ? 32   TYR C CD1 1 
ATOM   1831  C CD2 . TYR C  1 32  ? 141.341 87.858  147.904 1.00 53.33  ? 32   TYR C CD2 1 
ATOM   1832  C CE1 . TYR C  1 32  ? 142.327 90.343  148.663 1.00 55.05  ? 32   TYR C CE1 1 
ATOM   1833  C CE2 . TYR C  1 32  ? 142.616 88.271  147.482 1.00 53.06  ? 32   TYR C CE2 1 
ATOM   1834  C CZ  . TYR C  1 32  ? 143.096 89.519  147.867 1.00 54.38  ? 32   TYR C CZ  1 
ATOM   1835  O OH  . TYR C  1 32  ? 144.353 89.946  147.469 1.00 56.45  ? 32   TYR C OH  1 
ATOM   1836  N N   . LEU C  1 33  ? 135.601 88.756  148.070 1.00 43.17  ? 33   LEU C N   1 
ATOM   1837  C CA  . LEU C  1 33  ? 134.236 88.207  148.215 1.00 39.79  ? 33   LEU C CA  1 
ATOM   1838  C C   . LEU C  1 33  ? 133.426 88.151  146.906 1.00 38.67  ? 33   LEU C C   1 
ATOM   1839  O O   . LEU C  1 33  ? 133.280 89.162  146.202 1.00 35.75  ? 33   LEU C O   1 
ATOM   1840  C CB  . LEU C  1 33  ? 133.434 88.943  149.297 1.00 38.62  ? 33   LEU C CB  1 
ATOM   1841  C CG  . LEU C  1 33  ? 132.116 88.223  149.695 1.00 37.59  ? 33   LEU C CG  1 
ATOM   1842  C CD1 . LEU C  1 33  ? 131.750 88.477  151.161 1.00 36.25  ? 33   LEU C CD1 1 
ATOM   1843  C CD2 . LEU C  1 33  ? 130.921 88.608  148.798 1.00 36.25  ? 33   LEU C CD2 1 
ATOM   1844  N N   . ASN C  1 34  ? 132.872 86.964  146.623 1.00 37.94  ? 34   ASN C N   1 
ATOM   1845  C CA  . ASN C  1 34  ? 132.197 86.664  145.348 1.00 37.33  ? 34   ASN C CA  1 
ATOM   1846  C C   . ASN C  1 34  ? 130.701 86.305  145.431 1.00 36.25  ? 34   ASN C C   1 
ATOM   1847  O O   . ASN C  1 34  ? 130.214 85.871  146.482 1.00 37.42  ? 34   ASN C O   1 
ATOM   1848  C CB  . ASN C  1 34  ? 132.935 85.536  144.593 1.00 36.95  ? 34   ASN C CB  1 
ATOM   1849  C CG  . ASN C  1 34  ? 134.353 85.290  145.110 1.00 37.68  ? 34   ASN C CG  1 
ATOM   1850  O OD1 . ASN C  1 34  ? 135.153 86.215  145.259 1.00 43.28  ? 34   ASN C OD1 1 
ATOM   1851  N ND2 . ASN C  1 34  ? 134.671 84.027  145.359 1.00 35.85  ? 34   ASN C ND2 1 
ATOM   1852  N N   . TRP C  1 35  ? 129.990 86.469  144.313 1.00 34.36  ? 35   TRP C N   1 
ATOM   1853  C CA  . TRP C  1 35  ? 128.588 86.085  144.268 1.00 32.37  ? 35   TRP C CA  1 
ATOM   1854  C C   . TRP C  1 35  ? 128.329 84.996  143.270 1.00 31.95  ? 35   TRP C C   1 
ATOM   1855  O O   . TRP C  1 35  ? 128.593 85.152  142.072 1.00 32.93  ? 35   TRP C O   1 
ATOM   1856  C CB  . TRP C  1 35  ? 127.702 87.293  144.023 1.00 32.37  ? 35   TRP C CB  1 
ATOM   1857  C CG  . TRP C  1 35  ? 127.764 88.149  145.197 1.00 30.90  ? 35   TRP C CG  1 
ATOM   1858  C CD1 . TRP C  1 35  ? 128.579 89.222  145.379 1.00 29.85  ? 35   TRP C CD1 1 
ATOM   1859  C CD2 . TRP C  1 35  ? 127.043 87.973  146.416 1.00 27.03  ? 35   TRP C CD2 1 
ATOM   1860  N NE1 . TRP C  1 35  ? 128.387 89.751  146.628 1.00 25.83  ? 35   TRP C NE1 1 
ATOM   1861  C CE2 . TRP C  1 35  ? 127.449 89.001  147.287 1.00 27.40  ? 35   TRP C CE2 1 
ATOM   1862  C CE3 . TRP C  1 35  ? 126.072 87.060  146.848 1.00 28.39  ? 35   TRP C CE3 1 
ATOM   1863  C CZ2 . TRP C  1 35  ? 126.917 89.148  148.569 1.00 30.42  ? 35   TRP C CZ2 1 
ATOM   1864  C CZ3 . TRP C  1 35  ? 125.548 87.198  148.123 1.00 29.01  ? 35   TRP C CZ3 1 
ATOM   1865  C CH2 . TRP C  1 35  ? 125.970 88.240  148.968 1.00 34.75  ? 35   TRP C CH2 1 
ATOM   1866  N N   . TYR C  1 36  ? 127.827 83.877  143.762 1.00 28.04  ? 36   TYR C N   1 
ATOM   1867  C CA  . TYR C  1 36  ? 127.524 82.784  142.871 1.00 24.41  ? 36   TYR C CA  1 
ATOM   1868  C C   . TYR C  1 36  ? 126.002 82.662  142.678 1.00 21.76  ? 36   TYR C C   1 
ATOM   1869  O O   . TYR C  1 36  ? 125.222 83.028  143.563 1.00 18.57  ? 36   TYR C O   1 
ATOM   1870  C CB  . TYR C  1 36  ? 128.177 81.487  143.368 1.00 27.06  ? 36   TYR C CB  1 
ATOM   1871  C CG  . TYR C  1 36  ? 129.708 81.499  143.329 1.00 26.66  ? 36   TYR C CG  1 
ATOM   1872  C CD1 . TYR C  1 36  ? 130.458 81.897  144.439 1.00 30.08  ? 36   TYR C CD1 1 
ATOM   1873  C CD2 . TYR C  1 36  ? 130.403 81.100  142.183 1.00 18.22  ? 36   TYR C CD2 1 
ATOM   1874  C CE1 . TYR C  1 36  ? 131.854 81.904  144.408 1.00 27.53  ? 36   TYR C CE1 1 
ATOM   1875  C CE2 . TYR C  1 36  ? 131.806 81.105  142.145 1.00 19.59  ? 36   TYR C CE2 1 
ATOM   1876  C CZ  . TYR C  1 36  ? 132.523 81.505  143.262 1.00 27.21  ? 36   TYR C CZ  1 
ATOM   1877  O OH  . TYR C  1 36  ? 133.908 81.512  143.231 1.00 33.69  ? 36   TYR C OH  1 
ATOM   1878  N N   . GLN C  1 37  ? 125.583 82.185  141.509 1.00 20.76  ? 37   GLN C N   1 
ATOM   1879  C CA  . GLN C  1 37  ? 124.158 81.952  141.232 1.00 21.15  ? 37   GLN C CA  1 
ATOM   1880  C C   . GLN C  1 37  ? 123.914 80.465  140.959 1.00 20.68  ? 37   GLN C C   1 
ATOM   1881  O O   . GLN C  1 37  ? 124.517 79.887  140.052 1.00 19.72  ? 37   GLN C O   1 
ATOM   1882  C CB  . GLN C  1 37  ? 123.656 82.898  140.082 1.00 18.64  ? 37   GLN C CB  1 
ATOM   1883  C CG  . GLN C  1 37  ? 122.498 82.376  139.181 1.00 20.11  ? 37   GLN C CG  1 
ATOM   1884  C CD  . GLN C  1 37  ? 122.301 83.208  137.891 1.00 18.97  ? 37   GLN C CD  1 
ATOM   1885  O OE1 . GLN C  1 37  ? 122.245 82.650  136.793 1.00 20.96  ? 37   GLN C OE1 1 
ATOM   1886  N NE2 . GLN C  1 37  ? 122.211 84.542  138.032 1.00 15.67  ? 37   GLN C NE2 1 
ATOM   1887  N N   . GLN C  1 38  ? 123.043 79.850  141.764 1.00 19.41  ? 38   GLN C N   1 
ATOM   1888  C CA  . GLN C  1 38  ? 122.708 78.449  141.513 1.00 21.59  ? 38   GLN C CA  1 
ATOM   1889  C C   . GLN C  1 38  ? 121.248 78.267  141.107 1.00 23.34  ? 38   GLN C C   1 
ATOM   1890  O O   . GLN C  1 38  ? 120.362 78.315  141.962 1.00 22.41  ? 38   GLN C O   1 
ATOM   1891  C CB  . GLN C  1 38  ? 122.969 77.629  142.771 1.00 21.37  ? 38   GLN C CB  1 
ATOM   1892  C CG  . GLN C  1 38  ? 123.637 76.319  142.466 1.00 24.44  ? 38   GLN C CG  1 
ATOM   1893  C CD  . GLN C  1 38  ? 124.015 75.607  143.737 1.00 31.81  ? 38   GLN C CD  1 
ATOM   1894  O OE1 . GLN C  1 38  ? 124.044 76.198  144.818 1.00 27.08  ? 38   GLN C OE1 1 
ATOM   1895  N NE2 . GLN C  1 38  ? 124.310 74.322  143.619 1.00 28.10  ? 38   GLN C NE2 1 
ATOM   1896  N N   . LYS C  1 39  ? 120.987 78.045  139.824 1.00 24.86  ? 39   LYS C N   1 
ATOM   1897  C CA  . LYS C  1 39  ? 119.627 77.683  139.403 1.00 27.58  ? 39   LYS C CA  1 
ATOM   1898  C C   . LYS C  1 39  ? 119.422 76.169  139.552 1.00 28.35  ? 39   LYS C C   1 
ATOM   1899  O O   . LYS C  1 39  ? 120.375 75.410  139.367 1.00 25.87  ? 39   LYS C O   1 
ATOM   1900  C CB  . LYS C  1 39  ? 119.356 78.141  137.973 1.00 27.10  ? 39   LYS C CB  1 
ATOM   1901  C CG  . LYS C  1 39  ? 120.563 78.053  137.057 1.00 28.73  ? 39   LYS C CG  1 
ATOM   1902  C CD  . LYS C  1 39  ? 120.418 79.000  135.883 1.00 32.52  ? 39   LYS C CD  1 
ATOM   1903  C CE  . LYS C  1 39  ? 120.272 80.444  136.348 1.00 32.88  ? 39   LYS C CE  1 
ATOM   1904  N NZ  . LYS C  1 39  ? 119.933 81.357  135.201 1.00 42.44  ? 39   LYS C NZ  1 
ATOM   1905  N N   . PRO C  1 40  ? 118.183 75.725  139.880 1.00 30.76  ? 40   PRO C N   1 
ATOM   1906  C CA  . PRO C  1 40  ? 117.879 74.337  140.285 1.00 30.87  ? 40   PRO C CA  1 
ATOM   1907  C C   . PRO C  1 40  ? 118.643 73.272  139.498 1.00 30.91  ? 40   PRO C C   1 
ATOM   1908  O O   . PRO C  1 40  ? 118.574 73.261  138.252 1.00 32.53  ? 40   PRO C O   1 
ATOM   1909  C CB  . PRO C  1 40  ? 116.362 74.211  140.040 1.00 31.20  ? 40   PRO C CB  1 
ATOM   1910  C CG  . PRO C  1 40  ? 115.922 75.527  139.454 1.00 31.35  ? 40   PRO C CG  1 
ATOM   1911  C CD  . PRO C  1 40  ? 116.951 76.533  139.851 1.00 30.52  ? 40   PRO C CD  1 
ATOM   1912  N N   . GLY C  1 41  ? 119.377 72.410  140.207 1.00 31.23  ? 41   GLY C N   1 
ATOM   1913  C CA  . GLY C  1 41  ? 120.230 71.375  139.570 1.00 28.74  ? 41   GLY C CA  1 
ATOM   1914  C C   . GLY C  1 41  ? 121.213 71.846  138.502 1.00 26.55  ? 41   GLY C C   1 
ATOM   1915  O O   . GLY C  1 41  ? 121.176 71.373  137.363 1.00 26.06  ? 41   GLY C O   1 
ATOM   1916  N N   . LYS C  1 42  ? 122.111 72.762  138.876 1.00 25.09  ? 42   LYS C N   1 
ATOM   1917  C CA  . LYS C  1 42  ? 123.088 73.370  137.970 1.00 22.82  ? 42   LYS C CA  1 
ATOM   1918  C C   . LYS C  1 42  ? 124.097 74.006  138.908 1.00 20.82  ? 42   LYS C C   1 
ATOM   1919  O O   . LYS C  1 42  ? 123.919 73.939  140.125 1.00 18.66  ? 42   LYS C O   1 
ATOM   1920  C CB  . LYS C  1 42  ? 122.440 74.445  137.079 1.00 22.07  ? 42   LYS C CB  1 
ATOM   1921  C CG  . LYS C  1 42  ? 122.103 73.966  135.604 1.00 27.77  ? 42   LYS C CG  1 
ATOM   1922  C CD  . LYS C  1 42  ? 123.406 73.817  134.784 1.00 32.26  ? 42   LYS C CD  1 
ATOM   1923  C CE  . LYS C  1 42  ? 123.069 73.911  133.271 1.00 31.37  ? 42   LYS C CE  1 
ATOM   1924  N NZ  . LYS C  1 42  ? 124.345 73.496  132.470 1.00 38.41  ? 42   LYS C NZ  1 
ATOM   1925  N N   . ALA C  1 43  ? 125.146 74.629  138.382 1.00 21.38  ? 43   ALA C N   1 
ATOM   1926  C CA  . ALA C  1 43  ? 126.275 74.971  139.246 1.00 23.43  ? 43   ALA C CA  1 
ATOM   1927  C C   . ALA C  1 43  ? 126.300 76.417  139.731 1.00 25.12  ? 43   ALA C C   1 
ATOM   1928  O O   . ALA C  1 43  ? 125.681 77.292  139.118 1.00 27.37  ? 43   ALA C O   1 
ATOM   1929  C CB  . ALA C  1 43  ? 127.599 74.608  138.555 1.00 24.03  ? 43   ALA C CB  1 
ATOM   1930  N N   . PRO C  1 44  ? 127.009 76.663  140.851 1.00 24.50  ? 44   PRO C N   1 
ATOM   1931  C CA  . PRO C  1 44  ? 127.298 78.019  141.257 1.00 24.55  ? 44   PRO C CA  1 
ATOM   1932  C C   . PRO C  1 44  ? 128.054 78.713  140.140 1.00 23.84  ? 44   PRO C C   1 
ATOM   1933  O O   . PRO C  1 44  ? 129.236 78.440  139.915 1.00 23.39  ? 44   PRO C O   1 
ATOM   1934  C CB  . PRO C  1 44  ? 128.194 77.830  142.487 1.00 24.95  ? 44   PRO C CB  1 
ATOM   1935  C CG  . PRO C  1 44  ? 127.748 76.526  143.064 1.00 23.64  ? 44   PRO C CG  1 
ATOM   1936  C CD  . PRO C  1 44  ? 127.556 75.687  141.812 1.00 26.13  ? 44   PRO C CD  1 
ATOM   1937  N N   . LYS C  1 45  ? 127.339 79.564  139.411 1.00 24.66  ? 45   LYS C N   1 
ATOM   1938  C CA  . LYS C  1 45  ? 127.945 80.427  138.409 1.00 24.13  ? 45   LYS C CA  1 
ATOM   1939  C C   . LYS C  1 45  ? 128.189 81.785  139.044 1.00 24.54  ? 45   LYS C C   1 
ATOM   1940  O O   . LYS C  1 45  ? 127.346 82.292  139.799 1.00 26.43  ? 45   LYS C O   1 
ATOM   1941  C CB  . LYS C  1 45  ? 127.045 80.562  137.176 1.00 22.01  ? 45   LYS C CB  1 
ATOM   1942  C CG  . LYS C  1 45  ? 127.062 79.328  136.290 1.00 21.90  ? 45   LYS C CG  1 
ATOM   1943  C CD  . LYS C  1 45  ? 126.842 79.669  134.822 1.00 25.30  ? 45   LYS C CD  1 
ATOM   1944  C CE  . LYS C  1 45  ? 127.256 78.456  133.939 1.00 27.08  ? 45   LYS C CE  1 
ATOM   1945  N NZ  . LYS C  1 45  ? 127.195 78.930  132.436 1.00 26.52  ? 45   LYS C NZ  1 
ATOM   1946  N N   . LEU C  1 46  ? 129.338 82.379  138.707 1.00 23.11  ? 46   LEU C N   1 
ATOM   1947  C CA  . LEU C  1 46  ? 129.877 83.544  139.426 1.00 22.96  ? 46   LEU C CA  1 
ATOM   1948  C C   . LEU C  1 46  ? 129.428 84.876  138.828 1.00 25.85  ? 46   LEU C C   1 
ATOM   1949  O O   . LEU C  1 46  ? 129.689 85.157  137.653 1.00 26.70  ? 46   LEU C O   1 
ATOM   1950  C CB  . LEU C  1 46  ? 131.416 83.464  139.465 1.00 20.49  ? 46   LEU C CB  1 
ATOM   1951  C CG  . LEU C  1 46  ? 132.197 84.553  140.220 1.00 18.99  ? 46   LEU C CG  1 
ATOM   1952  C CD1 . LEU C  1 46  ? 131.670 84.701  141.639 1.00 7.47   ? 46   LEU C CD1 1 
ATOM   1953  C CD2 . LEU C  1 46  ? 133.734 84.226  140.243 1.00 19.27  ? 46   LEU C CD2 1 
ATOM   1954  N N   . LEU C  1 47  ? 128.760 85.691  139.650 1.00 27.54  ? 47   LEU C N   1 
ATOM   1955  C CA  . LEU C  1 47  ? 128.204 86.978  139.213 1.00 27.57  ? 47   LEU C CA  1 
ATOM   1956  C C   . LEU C  1 47  ? 129.151 88.161  139.432 1.00 30.27  ? 47   LEU C C   1 
ATOM   1957  O O   . LEU C  1 47  ? 129.327 88.987  138.541 1.00 33.01  ? 47   LEU C O   1 
ATOM   1958  C CB  . LEU C  1 47  ? 126.850 87.238  139.888 1.00 25.30  ? 47   LEU C CB  1 
ATOM   1959  C CG  . LEU C  1 47  ? 125.712 86.249  139.594 1.00 24.35  ? 47   LEU C CG  1 
ATOM   1960  C CD1 . LEU C  1 47  ? 124.537 86.514  140.522 1.00 19.05  ? 47   LEU C CD1 1 
ATOM   1961  C CD2 . LEU C  1 47  ? 125.233 86.361  138.115 1.00 9.54   ? 47   LEU C CD2 1 
ATOM   1962  N N   . ILE C  1 48  ? 129.768 88.231  140.610 1.00 32.54  ? 48   ILE C N   1 
ATOM   1963  C CA  . ILE C  1 48  ? 130.606 89.372  140.993 1.00 33.31  ? 48   ILE C CA  1 
ATOM   1964  C C   . ILE C  1 48  ? 131.754 88.899  141.885 1.00 34.23  ? 48   ILE C C   1 
ATOM   1965  O O   . ILE C  1 48  ? 131.512 88.197  142.863 1.00 35.89  ? 48   ILE C O   1 
ATOM   1966  C CB  . ILE C  1 48  ? 129.770 90.404  141.795 1.00 33.53  ? 48   ILE C CB  1 
ATOM   1967  C CG1 . ILE C  1 48  ? 128.663 91.054  140.913 1.00 26.61  ? 48   ILE C CG1 1 
ATOM   1968  C CG2 . ILE C  1 48  ? 130.653 91.473  142.456 1.00 35.12  ? 48   ILE C CG2 1 
ATOM   1969  C CD1 . ILE C  1 48  ? 127.498 91.593  141.761 1.00 21.43  ? 48   ILE C CD1 1 
ATOM   1970  N N   . TYR C  1 49  ? 132.994 89.277  141.563 1.00 35.07  ? 49   TYR C N   1 
ATOM   1971  C CA  . TYR C  1 49  ? 134.151 88.997  142.440 1.00 36.93  ? 49   TYR C CA  1 
ATOM   1972  C C   . TYR C  1 49  ? 134.562 90.277  143.168 1.00 36.48  ? 49   TYR C C   1 
ATOM   1973  O O   . TYR C  1 49  ? 134.063 91.367  142.846 1.00 35.15  ? 49   TYR C O   1 
ATOM   1974  C CB  . TYR C  1 49  ? 135.342 88.478  141.621 1.00 38.79  ? 49   TYR C CB  1 
ATOM   1975  C CG  . TYR C  1 49  ? 135.549 89.310  140.392 1.00 41.88  ? 49   TYR C CG  1 
ATOM   1976  C CD1 . TYR C  1 49  ? 135.971 90.619  140.488 1.00 51.26  ? 49   TYR C CD1 1 
ATOM   1977  C CD2 . TYR C  1 49  ? 135.261 88.823  139.135 1.00 47.83  ? 49   TYR C CD2 1 
ATOM   1978  C CE1 . TYR C  1 49  ? 136.130 91.419  139.356 1.00 52.83  ? 49   TYR C CE1 1 
ATOM   1979  C CE2 . TYR C  1 49  ? 135.430 89.632  137.987 1.00 48.75  ? 49   TYR C CE2 1 
ATOM   1980  C CZ  . TYR C  1 49  ? 135.861 90.930  138.113 1.00 51.52  ? 49   TYR C CZ  1 
ATOM   1981  O OH  . TYR C  1 49  ? 136.022 91.728  136.997 1.00 48.12  ? 49   TYR C OH  1 
ATOM   1982  N N   . ALA C  1 50  ? 135.473 90.146  144.133 1.00 37.53  ? 50   ALA C N   1 
ATOM   1983  C CA  . ALA C  1 50  ? 135.973 91.303  144.865 1.00 37.64  ? 50   ALA C CA  1 
ATOM   1984  C C   . ALA C  1 50  ? 134.848 92.314  145.145 1.00 38.07  ? 50   ALA C C   1 
ATOM   1985  O O   . ALA C  1 50  ? 134.963 93.514  144.830 1.00 39.64  ? 50   ALA C O   1 
ATOM   1986  C CB  . ALA C  1 50  ? 137.132 91.958  144.105 1.00 36.67  ? 50   ALA C CB  1 
ATOM   1987  N N   . ALA C  1 51  ? 133.753 91.791  145.706 1.00 38.84  ? 51   ALA C N   1 
ATOM   1988  C CA  . ALA C  1 51  ? 132.586 92.574  146.173 1.00 38.73  ? 51   ALA C CA  1 
ATOM   1989  C C   . ALA C  1 51  ? 131.835 93.535  145.228 1.00 39.85  ? 51   ALA C C   1 
ATOM   1990  O O   . ALA C  1 51  ? 130.682 93.856  145.506 1.00 42.50  ? 51   ALA C O   1 
ATOM   1991  C CB  . ALA C  1 51  ? 132.952 93.324  147.475 1.00 39.26  ? 51   ALA C CB  1 
ATOM   1992  N N   . SER C  1 52  ? 132.455 94.001  144.143 1.00 39.51  ? 52   SER C N   1 
ATOM   1993  C CA  . SER C  1 52  ? 131.819 95.030  143.297 1.00 39.45  ? 52   SER C CA  1 
ATOM   1994  C C   . SER C  1 52  ? 131.808 94.771  141.783 1.00 41.95  ? 52   SER C C   1 
ATOM   1995  O O   . SER C  1 52  ? 130.966 95.331  141.070 1.00 43.23  ? 52   SER C O   1 
ATOM   1996  C CB  . SER C  1 52  ? 132.437 96.412  143.572 1.00 39.57  ? 52   SER C CB  1 
ATOM   1997  O OG  . SER C  1 52  ? 131.991 97.368  142.517 1.00 36.92  ? 52   SER C OG  1 
ATOM   1998  N N   . SER C  1 53  ? 132.720 93.947  141.285 1.00 41.95  ? 53   SER C N   1 
ATOM   1999  C CA  . SER C  1 53  ? 132.884 93.854  139.833 1.00 42.21  ? 53   SER C CA  1 
ATOM   2000  C C   . SER C  1 53  ? 132.124 92.716  139.169 1.00 42.44  ? 53   SER C C   1 
ATOM   2001  O O   . SER C  1 53  ? 132.068 91.602  139.687 1.00 41.68  ? 53   SER C O   1 
ATOM   2002  C CB  . SER C  1 53  ? 134.359 93.819  139.457 1.00 42.74  ? 53   SER C CB  1 
ATOM   2003  O OG  . SER C  1 53  ? 135.110 93.147  140.490 1.00 39.03  ? 53   SER C OG  1 
ATOM   2004  N N   . LEU C  1 54  ? 131.569 93.017  137.997 1.00 43.14  ? 54   LEU C N   1 
ATOM   2005  C CA  . LEU C  1 54  ? 130.729 92.089  137.259 1.00 45.29  ? 54   LEU C CA  1 
ATOM   2006  C C   . LEU C  1 54  ? 131.545 91.289  136.249 1.00 48.13  ? 54   LEU C C   1 
ATOM   2007  O O   . LEU C  1 54  ? 132.463 91.831  135.612 1.00 48.87  ? 54   LEU C O   1 
ATOM   2008  C CB  . LEU C  1 54  ? 129.605 92.848  136.537 1.00 45.01  ? 54   LEU C CB  1 
ATOM   2009  C CG  . LEU C  1 54  ? 128.478 93.563  137.302 1.00 44.33  ? 54   LEU C CG  1 
ATOM   2010  C CD1 . LEU C  1 54  ? 128.926 94.881  137.936 1.00 39.88  ? 54   LEU C CD1 1 
ATOM   2011  C CD2 . LEU C  1 54  ? 127.331 93.817  136.338 1.00 39.69  ? 54   LEU C CD2 1 
ATOM   2012  N N   . GLN C  1 55  ? 131.217 90.000  136.128 1.00 49.94  ? 55   GLN C N   1 
ATOM   2013  C CA  . GLN C  1 55  ? 131.850 89.148  135.116 1.00 50.43  ? 55   GLN C CA  1 
ATOM   2014  C C   . GLN C  1 55  ? 131.170 89.442  133.804 1.00 51.66  ? 55   GLN C C   1 
ATOM   2015  O O   . GLN C  1 55  ? 129.936 89.440  133.732 1.00 52.11  ? 55   GLN C O   1 
ATOM   2016  C CB  . GLN C  1 55  ? 131.668 87.659  135.440 1.00 49.80  ? 55   GLN C CB  1 
ATOM   2017  C CG  . GLN C  1 55  ? 132.565 87.104  136.534 1.00 49.81  ? 55   GLN C CG  1 
ATOM   2018  C CD  . GLN C  1 55  ? 133.912 87.774  136.565 1.00 49.47  ? 55   GLN C CD  1 
ATOM   2019  O OE1 . GLN C  1 55  ? 134.101 88.707  137.319 1.00 46.07  ? 55   GLN C OE1 1 
ATOM   2020  N NE2 . GLN C  1 55  ? 134.834 87.340  135.718 1.00 46.79  ? 55   GLN C NE2 1 
ATOM   2021  N N   . SER C  1 56  ? 131.970 89.718  132.772 1.00 52.00  ? 56   SER C N   1 
ATOM   2022  C CA  . SER C  1 56  ? 131.463 89.955  131.418 1.00 52.03  ? 56   SER C CA  1 
ATOM   2023  C C   . SER C  1 56  ? 130.451 88.871  131.042 1.00 53.75  ? 56   SER C C   1 
ATOM   2024  O O   . SER C  1 56  ? 130.775 87.914  130.336 1.00 55.25  ? 56   SER C O   1 
ATOM   2025  C CB  . SER C  1 56  ? 132.626 89.981  130.419 1.00 52.93  ? 56   SER C CB  1 
ATOM   2026  O OG  . SER C  1 56  ? 133.284 88.705  130.375 1.00 49.54  ? 56   SER C OG  1 
ATOM   2027  N N   . GLY C  1 57  ? 129.223 89.033  131.525 1.00 52.49  ? 57   GLY C N   1 
ATOM   2028  C CA  . GLY C  1 57  ? 128.242 87.947  131.517 1.00 51.50  ? 57   GLY C CA  1 
ATOM   2029  C C   . GLY C  1 57  ? 127.047 88.384  132.334 1.00 50.73  ? 57   GLY C C   1 
ATOM   2030  O O   . GLY C  1 57  ? 125.940 88.519  131.783 1.00 51.42  ? 57   GLY C O   1 
ATOM   2031  N N   . VAL C  1 58  ? 127.262 88.608  133.637 1.00 48.00  ? 58   VAL C N   1 
ATOM   2032  C CA  . VAL C  1 58  ? 126.231 89.249  134.460 1.00 45.30  ? 58   VAL C CA  1 
ATOM   2033  C C   . VAL C  1 58  ? 125.820 90.582  133.824 1.00 44.73  ? 58   VAL C C   1 
ATOM   2034  O O   . VAL C  1 58  ? 126.669 91.445  133.575 1.00 45.70  ? 58   VAL C O   1 
ATOM   2035  C CB  . VAL C  1 58  ? 126.667 89.425  135.946 1.00 45.39  ? 58   VAL C CB  1 
ATOM   2036  C CG1 . VAL C  1 58  ? 128.101 89.846  136.045 1.00 44.11  ? 58   VAL C CG1 1 
ATOM   2037  C CG2 . VAL C  1 58  ? 125.781 90.416  136.669 1.00 45.56  ? 58   VAL C CG2 1 
ATOM   2038  N N   . PRO C  1 59  ? 124.513 90.736  133.544 1.00 42.68  ? 59   PRO C N   1 
ATOM   2039  C CA  . PRO C  1 59  ? 124.026 91.986  132.976 1.00 41.12  ? 59   PRO C CA  1 
ATOM   2040  C C   . PRO C  1 59  ? 123.925 92.985  134.120 1.00 39.51  ? 59   PRO C C   1 
ATOM   2041  O O   . PRO C  1 59  ? 123.562 92.590  135.228 1.00 40.39  ? 59   PRO C O   1 
ATOM   2042  C CB  . PRO C  1 59  ? 122.635 91.624  132.436 1.00 42.68  ? 59   PRO C CB  1 
ATOM   2043  C CG  . PRO C  1 59  ? 122.346 90.214  132.880 1.00 41.09  ? 59   PRO C CG  1 
ATOM   2044  C CD  . PRO C  1 59  ? 123.423 89.774  133.811 1.00 41.64  ? 59   PRO C CD  1 
ATOM   2045  N N   . SER C  1 60  ? 124.242 94.255  133.861 1.00 39.47  ? 60   SER C N   1 
ATOM   2046  C CA  . SER C  1 60  ? 124.468 95.285  134.914 1.00 40.17  ? 60   SER C CA  1 
ATOM   2047  C C   . SER C  1 60  ? 123.466 95.411  136.086 1.00 40.62  ? 60   SER C C   1 
ATOM   2048  O O   . SER C  1 60  ? 123.601 96.298  136.935 1.00 39.51  ? 60   SER C O   1 
ATOM   2049  C CB  . SER C  1 60  ? 124.649 96.659  134.256 1.00 42.28  ? 60   SER C CB  1 
ATOM   2050  O OG  . SER C  1 60  ? 123.415 97.138  133.716 1.00 42.05  ? 60   SER C OG  1 
ATOM   2051  N N   . ARG C  1 61  ? 122.486 94.518  136.131 1.00 40.76  ? 61   ARG C N   1 
ATOM   2052  C CA  . ARG C  1 61  ? 121.398 94.554  137.101 1.00 40.50  ? 61   ARG C CA  1 
ATOM   2053  C C   . ARG C  1 61  ? 121.847 94.051  138.483 1.00 40.82  ? 61   ARG C C   1 
ATOM   2054  O O   . ARG C  1 61  ? 121.444 94.592  139.520 1.00 41.94  ? 61   ARG C O   1 
ATOM   2055  C CB  . ARG C  1 61  ? 120.255 93.722  136.537 1.00 41.03  ? 61   ARG C CB  1 
ATOM   2056  C CG  . ARG C  1 61  ? 120.394 93.494  135.010 1.00 42.51  ? 61   ARG C CG  1 
ATOM   2057  C CD  . ARG C  1 61  ? 119.127 92.934  134.426 1.00 41.38  ? 61   ARG C CD  1 
ATOM   2058  N NE  . ARG C  1 61  ? 118.331 92.373  135.511 1.00 43.90  ? 61   ARG C NE  1 
ATOM   2059  C CZ  . ARG C  1 61  ? 118.064 91.079  135.675 1.00 44.60  ? 61   ARG C CZ  1 
ATOM   2060  N NH1 . ARG C  1 61  ? 118.505 90.158  134.792 1.00 46.85  ? 61   ARG C NH1 1 
ATOM   2061  N NH2 . ARG C  1 61  ? 117.329 90.709  136.722 1.00 43.31  ? 61   ARG C NH2 1 
ATOM   2062  N N   . PHE C  1 62  ? 122.681 93.012  138.471 1.00 37.57  ? 62   PHE C N   1 
ATOM   2063  C CA  . PHE C  1 62  ? 123.461 92.595  139.637 1.00 36.18  ? 62   PHE C CA  1 
ATOM   2064  C C   . PHE C  1 62  ? 124.584 93.613  139.881 1.00 34.96  ? 62   PHE C C   1 
ATOM   2065  O O   . PHE C  1 62  ? 125.267 94.026  138.935 1.00 35.86  ? 62   PHE C O   1 
ATOM   2066  C CB  . PHE C  1 62  ? 124.030 91.186  139.406 1.00 35.70  ? 62   PHE C CB  1 
ATOM   2067  C CG  . PHE C  1 62  ? 122.980 90.177  139.015 1.00 32.65  ? 62   PHE C CG  1 
ATOM   2068  C CD1 . PHE C  1 62  ? 122.550 90.051  137.694 1.00 30.95  ? 62   PHE C CD1 1 
ATOM   2069  C CD2 . PHE C  1 62  ? 122.389 89.378  139.983 1.00 33.53  ? 62   PHE C CD2 1 
ATOM   2070  C CE1 . PHE C  1 62  ? 121.561 89.132  137.349 1.00 29.58  ? 62   PHE C CE1 1 
ATOM   2071  C CE2 . PHE C  1 62  ? 121.404 88.456  139.645 1.00 32.44  ? 62   PHE C CE2 1 
ATOM   2072  C CZ  . PHE C  1 62  ? 120.989 88.333  138.328 1.00 29.74  ? 62   PHE C CZ  1 
ATOM   2073  N N   . SER C  1 63  ? 124.759 94.030  141.135 1.00 35.77  ? 63   SER C N   1 
ATOM   2074  C CA  . SER C  1 63  ? 125.839 94.945  141.517 1.00 34.98  ? 63   SER C CA  1 
ATOM   2075  C C   . SER C  1 63  ? 126.141 94.763  142.996 1.00 36.17  ? 63   SER C C   1 
ATOM   2076  O O   . SER C  1 63  ? 125.248 94.913  143.842 1.00 38.00  ? 63   SER C O   1 
ATOM   2077  C CB  . SER C  1 63  ? 125.469 96.406  141.225 1.00 36.08  ? 63   SER C CB  1 
ATOM   2078  O OG  . SER C  1 63  ? 124.401 96.843  142.048 1.00 31.30  ? 63   SER C OG  1 
ATOM   2079  N N   . GLY C  1 64  ? 127.388 94.434  143.313 1.00 35.76  ? 64   GLY C N   1 
ATOM   2080  C CA  . GLY C  1 64  ? 127.777 94.220  144.698 1.00 32.51  ? 64   GLY C CA  1 
ATOM   2081  C C   . GLY C  1 64  ? 128.243 95.510  145.351 1.00 30.68  ? 64   GLY C C   1 
ATOM   2082  O O   . GLY C  1 64  ? 128.632 96.458  144.658 1.00 26.24  ? 64   GLY C O   1 
ATOM   2083  N N   . SER C  1 65  ? 128.202 95.545  146.695 1.00 31.18  ? 65   SER C N   1 
ATOM   2084  C CA  . SER C  1 65  ? 128.773 96.690  147.454 1.00 33.07  ? 65   SER C CA  1 
ATOM   2085  C C   . SER C  1 65  ? 129.286 96.387  148.875 1.00 34.79  ? 65   SER C C   1 
ATOM   2086  O O   . SER C  1 65  ? 128.675 95.621  149.624 1.00 33.83  ? 65   SER C O   1 
ATOM   2087  C CB  . SER C  1 65  ? 127.773 97.857  147.523 1.00 33.36  ? 65   SER C CB  1 
ATOM   2088  O OG  . SER C  1 65  ? 126.652 97.518  148.323 1.00 35.57  ? 65   SER C OG  1 
ATOM   2089  N N   . GLY C  1 66  ? 130.415 97.017  149.223 1.00 36.25  ? 66   GLY C N   1 
ATOM   2090  C CA  . GLY C  1 66  ? 130.991 96.973  150.580 1.00 36.79  ? 66   GLY C CA  1 
ATOM   2091  C C   . GLY C  1 66  ? 132.466 96.609  150.721 1.00 37.71  ? 66   GLY C C   1 
ATOM   2092  O O   . GLY C  1 66  ? 133.126 96.239  149.744 1.00 35.40  ? 66   GLY C O   1 
ATOM   2093  N N   . SER C  1 67  ? 132.971 96.736  151.955 1.00 39.40  ? 67   SER C N   1 
ATOM   2094  C CA  . SER C  1 67  ? 134.303 96.238  152.369 1.00 41.21  ? 67   SER C CA  1 
ATOM   2095  C C   . SER C  1 67  ? 134.348 95.830  153.845 1.00 42.24  ? 67   SER C C   1 
ATOM   2096  O O   . SER C  1 67  ? 133.984 96.641  154.738 1.00 43.36  ? 67   SER C O   1 
ATOM   2097  C CB  . SER C  1 67  ? 135.400 97.290  152.124 1.00 44.03  ? 67   SER C CB  1 
ATOM   2098  O OG  . SER C  1 67  ? 136.356 97.296  153.189 1.00 45.40  ? 67   SER C OG  1 
ATOM   2099  N N   . GLY C  1 68  ? 134.813 94.593  154.090 1.00 42.39  ? 68   GLY C N   1 
ATOM   2100  C CA  . GLY C  1 68  ? 135.111 94.123  155.452 1.00 42.61  ? 68   GLY C CA  1 
ATOM   2101  C C   . GLY C  1 68  ? 134.126 93.099  155.986 1.00 43.36  ? 68   GLY C C   1 
ATOM   2102  O O   . GLY C  1 68  ? 134.381 91.889  155.967 1.00 42.69  ? 68   GLY C O   1 
ATOM   2103  N N   . THR C  1 69  ? 133.006 93.614  156.487 1.00 43.39  ? 69   THR C N   1 
ATOM   2104  C CA  . THR C  1 69  ? 131.897 92.816  156.991 1.00 43.84  ? 69   THR C CA  1 
ATOM   2105  C C   . THR C  1 69  ? 130.602 93.590  156.754 1.00 45.01  ? 69   THR C C   1 
ATOM   2106  O O   . THR C  1 69  ? 129.849 93.865  157.701 1.00 44.97  ? 69   THR C O   1 
ATOM   2107  C CB  . THR C  1 69  ? 132.032 92.556  158.502 1.00 44.62  ? 69   THR C CB  1 
ATOM   2108  O OG1 . THR C  1 69  ? 133.415 92.439  158.860 1.00 47.33  ? 69   THR C OG1 1 
ATOM   2109  C CG2 . THR C  1 69  ? 131.331 91.306  158.885 1.00 42.64  ? 69   THR C CG2 1 
ATOM   2110  N N   . ASP C  1 70  ? 130.366 93.985  155.507 1.00 45.37  ? 70   ASP C N   1 
ATOM   2111  C CA  . ASP C  1 70  ? 129.083 94.575  155.113 1.00 47.20  ? 70   ASP C CA  1 
ATOM   2112  C C   . ASP C  1 70  ? 128.923 94.620  153.607 1.00 46.47  ? 70   ASP C C   1 
ATOM   2113  O O   . ASP C  1 70  ? 129.269 95.592  152.931 1.00 47.71  ? 70   ASP C O   1 
ATOM   2114  C CB  . ASP C  1 70  ? 128.795 95.927  155.786 1.00 49.13  ? 70   ASP C CB  1 
ATOM   2115  C CG  . ASP C  1 70  ? 127.592 95.858  156.735 1.00 54.12  ? 70   ASP C CG  1 
ATOM   2116  O OD1 . ASP C  1 70  ? 127.112 96.929  157.162 1.00 52.99  ? 70   ASP C OD1 1 
ATOM   2117  O OD2 . ASP C  1 70  ? 127.116 94.741  157.046 1.00 53.17  ? 70   ASP C OD2 1 
ATOM   2118  N N   . PHE C  1 71  ? 128.370 93.518  153.120 1.00 44.25  ? 71   PHE C N   1 
ATOM   2119  C CA  . PHE C  1 71  ? 128.298 93.200  151.716 1.00 42.85  ? 71   PHE C CA  1 
ATOM   2120  C C   . PHE C  1 71  ? 126.840 92.932  151.342 1.00 41.54  ? 71   PHE C C   1 
ATOM   2121  O O   . PHE C  1 71  ? 126.107 92.253  152.076 1.00 39.02  ? 71   PHE C O   1 
ATOM   2122  C CB  . PHE C  1 71  ? 129.178 91.974  151.417 1.00 44.64  ? 71   PHE C CB  1 
ATOM   2123  C CG  . PHE C  1 71  ? 130.674 92.239  151.515 1.00 46.13  ? 71   PHE C CG  1 
ATOM   2124  C CD1 . PHE C  1 71  ? 131.332 92.249  152.748 1.00 48.27  ? 71   PHE C CD1 1 
ATOM   2125  C CD2 . PHE C  1 71  ? 131.426 92.445  150.365 1.00 47.66  ? 71   PHE C CD2 1 
ATOM   2126  C CE1 . PHE C  1 71  ? 132.711 92.481  152.825 1.00 48.38  ? 71   PHE C CE1 1 
ATOM   2127  C CE2 . PHE C  1 71  ? 132.806 92.677  150.439 1.00 48.73  ? 71   PHE C CE2 1 
ATOM   2128  C CZ  . PHE C  1 71  ? 133.444 92.694  151.666 1.00 45.63  ? 71   PHE C CZ  1 
ATOM   2129  N N   . THR C  1 72  ? 126.432 93.499  150.206 1.00 39.90  ? 72   THR C N   1 
ATOM   2130  C CA  . THR C  1 72  ? 125.077 93.365  149.685 1.00 37.76  ? 72   THR C CA  1 
ATOM   2131  C C   . THR C  1 72  ? 125.118 92.757  148.304 1.00 37.00  ? 72   THR C C   1 
ATOM   2132  O O   . THR C  1 72  ? 126.143 92.787  147.620 1.00 35.80  ? 72   THR C O   1 
ATOM   2133  C CB  . THR C  1 72  ? 124.379 94.742  149.505 1.00 37.45  ? 72   THR C CB  1 
ATOM   2134  O OG1 . THR C  1 72  ? 124.725 95.620  150.585 1.00 31.94  ? 72   THR C OG1 1 
ATOM   2135  C CG2 . THR C  1 72  ? 122.846 94.598  149.442 1.00 37.03  ? 72   THR C CG2 1 
ATOM   2136  N N   . LEU C  1 73  ? 123.982 92.202  147.903 1.00 36.89  ? 73   LEU C N   1 
ATOM   2137  C CA  . LEU C  1 73  ? 123.695 91.994  146.510 1.00 38.37  ? 73   LEU C CA  1 
ATOM   2138  C C   . LEU C  1 73  ? 122.302 92.549  146.348 1.00 40.14  ? 73   LEU C C   1 
ATOM   2139  O O   . LEU C  1 73  ? 121.407 92.250  147.154 1.00 43.06  ? 73   LEU C O   1 
ATOM   2140  C CB  . LEU C  1 73  ? 123.724 90.507  146.163 1.00 36.65  ? 73   LEU C CB  1 
ATOM   2141  C CG  . LEU C  1 73  ? 123.674 90.150  144.674 1.00 35.50  ? 73   LEU C CG  1 
ATOM   2142  C CD1 . LEU C  1 73  ? 125.056 90.232  144.048 1.00 27.44  ? 73   LEU C CD1 1 
ATOM   2143  C CD2 . LEU C  1 73  ? 123.091 88.760  144.484 1.00 27.11  ? 73   LEU C CD2 1 
ATOM   2144  N N   . THR C  1 74  ? 122.123 93.390  145.335 1.00 39.48  ? 74   THR C N   1 
ATOM   2145  C CA  . THR C  1 74  ? 120.805 93.897  145.001 1.00 42.15  ? 74   THR C CA  1 
ATOM   2146  C C   . THR C  1 74  ? 120.537 93.543  143.559 1.00 42.68  ? 74   THR C C   1 
ATOM   2147  O O   . THR C  1 74  ? 121.395 93.749  142.695 1.00 43.32  ? 74   THR C O   1 
ATOM   2148  C CB  . THR C  1 74  ? 120.700 95.437  145.136 1.00 42.51  ? 74   THR C CB  1 
ATOM   2149  O OG1 . THR C  1 74  ? 121.568 95.906  146.183 1.00 44.90  ? 74   THR C OG1 1 
ATOM   2150  C CG2 . THR C  1 74  ? 119.258 95.864  145.419 1.00 44.65  ? 74   THR C CG2 1 
ATOM   2151  N N   . ILE C  1 75  ? 119.356 92.996  143.295 1.00 42.47  ? 75   ILE C N   1 
ATOM   2152  C CA  . ILE C  1 75  ? 118.902 92.868  141.923 1.00 42.17  ? 75   ILE C CA  1 
ATOM   2153  C C   . ILE C  1 75  ? 117.819 93.914  141.747 1.00 43.56  ? 75   ILE C C   1 
ATOM   2154  O O   . ILE C  1 75  ? 116.697 93.749  142.239 1.00 43.15  ? 75   ILE C O   1 
ATOM   2155  C CB  . ILE C  1 75  ? 118.384 91.451  141.589 1.00 40.89  ? 75   ILE C CB  1 
ATOM   2156  C CG1 . ILE C  1 75  ? 119.445 90.392  141.932 1.00 35.57  ? 75   ILE C CG1 1 
ATOM   2157  C CG2 . ILE C  1 75  ? 117.990 91.370  140.115 1.00 41.28  ? 75   ILE C CG2 1 
ATOM   2158  C CD1 . ILE C  1 75  ? 118.781 89.017  142.343 1.00 31.55  ? 75   ILE C CD1 1 
ATOM   2159  N N   . SER C  1 76  ? 118.175 95.007  141.079 1.00 45.43  ? 76   SER C N   1 
ATOM   2160  C CA  . SER C  1 76  ? 117.245 96.105  140.852 1.00 45.95  ? 76   SER C CA  1 
ATOM   2161  C C   . SER C  1 76  ? 116.020 95.626  140.078 1.00 47.53  ? 76   SER C C   1 
ATOM   2162  O O   . SER C  1 76  ? 114.930 96.202  140.203 1.00 47.95  ? 76   SER C O   1 
ATOM   2163  C CB  . SER C  1 76  ? 117.930 97.256  140.105 1.00 46.16  ? 76   SER C CB  1 
ATOM   2164  O OG  . SER C  1 76  ? 118.508 96.805  138.885 1.00 44.80  ? 76   SER C OG  1 
ATOM   2165  N N   . SER C  1 77  ? 116.186 94.557  139.302 1.00 49.41  ? 77   SER C N   1 
ATOM   2166  C CA  . SER C  1 77  ? 115.186 94.209  138.298 1.00 50.33  ? 77   SER C CA  1 
ATOM   2167  C C   . SER C  1 77  ? 114.736 92.743  138.218 1.00 50.63  ? 77   SER C C   1 
ATOM   2168  O O   . SER C  1 77  ? 114.420 92.261  137.114 1.00 50.44  ? 77   SER C O   1 
ATOM   2169  C CB  . SER C  1 77  ? 115.671 94.678  136.920 1.00 51.62  ? 77   SER C CB  1 
ATOM   2170  O OG  . SER C  1 77  ? 115.786 96.116  136.881 1.00 55.74  ? 77   SER C OG  1 
ATOM   2171  N N   . LEU C  1 78  ? 114.671 92.047  139.355 1.00 50.72  ? 78   LEU C N   1 
ATOM   2172  C CA  . LEU C  1 78  ? 114.322 90.608  139.407 1.00 50.24  ? 78   LEU C CA  1 
ATOM   2173  C C   . LEU C  1 78  ? 113.542 90.059  138.194 1.00 47.94  ? 78   LEU C C   1 
ATOM   2174  O O   . LEU C  1 78  ? 112.480 90.575  137.849 1.00 49.11  ? 78   LEU C O   1 
ATOM   2175  C CB  . LEU C  1 78  ? 113.562 90.282  140.703 1.00 51.73  ? 78   LEU C CB  1 
ATOM   2176  C CG  . LEU C  1 78  ? 113.229 88.801  140.933 1.00 52.05  ? 78   LEU C CG  1 
ATOM   2177  C CD1 . LEU C  1 78  ? 114.513 87.972  141.028 1.00 55.61  ? 78   LEU C CD1 1 
ATOM   2178  C CD2 . LEU C  1 78  ? 112.383 88.610  142.195 1.00 50.82  ? 78   LEU C CD2 1 
ATOM   2179  N N   . GLN C  1 79  ? 114.064 88.999  137.572 1.00 46.01  ? 79   GLN C N   1 
ATOM   2180  C CA  . GLN C  1 79  ? 113.450 88.399  136.371 1.00 43.45  ? 79   GLN C CA  1 
ATOM   2181  C C   . GLN C  1 79  ? 113.128 86.907  136.548 1.00 41.85  ? 79   GLN C C   1 
ATOM   2182  O O   . GLN C  1 79  ? 113.759 86.247  137.392 1.00 41.61  ? 79   GLN C O   1 
ATOM   2183  C CB  . GLN C  1 79  ? 114.376 88.577  135.166 1.00 43.04  ? 79   GLN C CB  1 
ATOM   2184  C CG  . GLN C  1 79  ? 114.585 90.013  134.725 1.00 41.79  ? 79   GLN C CG  1 
ATOM   2185  C CD  . GLN C  1 79  ? 113.396 90.611  133.985 1.00 39.36  ? 79   GLN C CD  1 
ATOM   2186  O OE1 . GLN C  1 79  ? 113.425 91.784  133.620 1.00 40.97  ? 79   GLN C OE1 1 
ATOM   2187  N NE2 . GLN C  1 79  ? 112.353 89.816  133.759 1.00 37.81  ? 79   GLN C NE2 1 
ATOM   2188  N N   . PRO C  1 80  ? 112.178 86.351  135.749 1.00 39.25  ? 80   PRO C N   1 
ATOM   2189  C CA  . PRO C  1 80  ? 111.770 84.962  136.017 1.00 36.79  ? 80   PRO C CA  1 
ATOM   2190  C C   . PRO C  1 80  ? 112.994 84.053  136.053 1.00 36.16  ? 80   PRO C C   1 
ATOM   2191  O O   . PRO C  1 80  ? 112.968 82.967  136.638 1.00 36.18  ? 80   PRO C O   1 
ATOM   2192  C CB  . PRO C  1 80  ? 110.925 84.597  134.792 1.00 36.63  ? 80   PRO C CB  1 
ATOM   2193  C CG  . PRO C  1 80  ? 110.456 85.879  134.224 1.00 35.13  ? 80   PRO C CG  1 
ATOM   2194  C CD  . PRO C  1 80  ? 111.486 86.914  134.570 1.00 39.26  ? 80   PRO C CD  1 
ATOM   2195  N N   . GLU C  1 81  ? 114.065 84.556  135.449 1.00 34.60  ? 81   GLU C N   1 
ATOM   2196  C CA  . GLU C  1 81  ? 115.250 83.801  135.077 1.00 34.53  ? 81   GLU C CA  1 
ATOM   2197  C C   . GLU C  1 81  ? 116.356 83.997  136.099 1.00 33.88  ? 81   GLU C C   1 
ATOM   2198  O O   . GLU C  1 81  ? 117.473 83.486  135.947 1.00 33.78  ? 81   GLU C O   1 
ATOM   2199  C CB  . GLU C  1 81  ? 115.728 84.325  133.723 1.00 35.29  ? 81   GLU C CB  1 
ATOM   2200  C CG  . GLU C  1 81  ? 115.671 85.854  133.621 1.00 39.91  ? 81   GLU C CG  1 
ATOM   2201  C CD  . GLU C  1 81  ? 116.211 86.392  132.316 1.00 48.16  ? 81   GLU C CD  1 
ATOM   2202  O OE1 . GLU C  1 81  ? 117.256 85.879  131.837 1.00 52.43  ? 81   GLU C OE1 1 
ATOM   2203  O OE2 . GLU C  1 81  ? 115.603 87.336  131.764 1.00 40.19  ? 81   GLU C OE2 1 
ATOM   2204  N N   . ASP C  1 82  ? 116.015 84.743  137.144 1.00 32.38  ? 82   ASP C N   1 
ATOM   2205  C CA  . ASP C  1 82  ? 116.973 85.223  138.121 1.00 28.16  ? 82   ASP C CA  1 
ATOM   2206  C C   . ASP C  1 82  ? 116.787 84.355  139.350 1.00 28.44  ? 82   ASP C C   1 
ATOM   2207  O O   . ASP C  1 82  ? 117.470 84.494  140.365 1.00 25.94  ? 82   ASP C O   1 
ATOM   2208  C CB  . ASP C  1 82  ? 116.630 86.690  138.444 1.00 29.24  ? 82   ASP C CB  1 
ATOM   2209  C CG  . ASP C  1 82  ? 117.507 87.643  137.647 1.00 22.30  ? 82   ASP C CG  1 
ATOM   2210  O OD1 . ASP C  1 82  ? 117.860 87.357  136.466 1.00 20.38  ? 82   ASP C OD1 1 
ATOM   2211  O OD2 . ASP C  1 82  ? 117.861 88.699  138.206 1.00 24.71  ? 82   ASP C OD2 1 
ATOM   2212  N N   . PHE C  1 83  ? 115.849 83.423  139.203 1.00 29.19  ? 83   PHE C N   1 
ATOM   2213  C CA  . PHE C  1 83  ? 115.346 82.571  140.262 1.00 32.03  ? 83   PHE C CA  1 
ATOM   2214  C C   . PHE C  1 83  ? 116.389 81.538  140.575 1.00 33.47  ? 83   PHE C C   1 
ATOM   2215  O O   . PHE C  1 83  ? 116.819 80.790  139.687 1.00 34.83  ? 83   PHE C O   1 
ATOM   2216  C CB  . PHE C  1 83  ? 114.041 81.928  139.765 1.00 34.66  ? 83   PHE C CB  1 
ATOM   2217  C CG  . PHE C  1 83  ? 113.814 80.503  140.223 1.00 34.48  ? 83   PHE C CG  1 
ATOM   2218  C CD1 . PHE C  1 83  ? 113.448 80.218  141.538 1.00 40.20  ? 83   PHE C CD1 1 
ATOM   2219  C CD2 . PHE C  1 83  ? 113.907 79.448  139.315 1.00 41.10  ? 83   PHE C CD2 1 
ATOM   2220  C CE1 . PHE C  1 83  ? 113.218 78.900  141.949 1.00 44.30  ? 83   PHE C CE1 1 
ATOM   2221  C CE2 . PHE C  1 83  ? 113.674 78.130  139.716 1.00 43.31  ? 83   PHE C CE2 1 
ATOM   2222  C CZ  . PHE C  1 83  ? 113.332 77.855  141.035 1.00 41.75  ? 83   PHE C CZ  1 
ATOM   2223  N N   . ALA C  1 84  ? 116.807 81.492  141.824 1.00 34.69  ? 84   ALA C N   1 
ATOM   2224  C CA  . ALA C  1 84  ? 117.896 80.625  142.164 1.00 33.66  ? 84   ALA C CA  1 
ATOM   2225  C C   . ALA C  1 84  ? 118.136 80.763  143.632 1.00 32.66  ? 84   ALA C C   1 
ATOM   2226  O O   . ALA C  1 84  ? 117.252 81.154  144.401 1.00 34.26  ? 84   ALA C O   1 
ATOM   2227  C CB  . ALA C  1 84  ? 119.156 81.030  141.381 1.00 34.69  ? 84   ALA C CB  1 
ATOM   2228  N N   . THR C  1 85  ? 119.360 80.441  144.000 1.00 32.79  ? 85   THR C N   1 
ATOM   2229  C CA  . THR C  1 85  ? 119.842 80.529  145.338 1.00 29.45  ? 85   THR C CA  1 
ATOM   2230  C C   . THR C  1 85  ? 121.176 81.222  145.068 1.00 28.97  ? 85   THR C C   1 
ATOM   2231  O O   . THR C  1 85  ? 122.034 80.680  144.328 1.00 29.59  ? 85   THR C O   1 
ATOM   2232  C CB  . THR C  1 85  ? 120.018 79.099  145.902 1.00 29.72  ? 85   THR C CB  1 
ATOM   2233  O OG1 . THR C  1 85  ? 118.747 78.422  145.861 1.00 20.83  ? 85   THR C OG1 1 
ATOM   2234  C CG2 . THR C  1 85  ? 120.536 79.131  147.364 1.00 29.96  ? 85   THR C CG2 1 
ATOM   2235  N N   . TYR C  1 86  ? 121.327 82.438  145.602 1.00 27.38  ? 86   TYR C N   1 
ATOM   2236  C CA  . TYR C  1 86  ? 122.541 83.229  145.433 1.00 25.99  ? 86   TYR C CA  1 
ATOM   2237  C C   . TYR C  1 86  ? 123.422 83.054  146.655 1.00 26.45  ? 86   TYR C C   1 
ATOM   2238  O O   . TYR C  1 86  ? 122.924 82.833  147.771 1.00 25.96  ? 86   TYR C O   1 
ATOM   2239  C CB  . TYR C  1 86  ? 122.201 84.710  145.274 1.00 27.67  ? 86   TYR C CB  1 
ATOM   2240  C CG  . TYR C  1 86  ? 121.371 85.017  144.056 1.00 25.87  ? 86   TYR C CG  1 
ATOM   2241  C CD1 . TYR C  1 86  ? 119.980 84.943  144.099 1.00 18.28  ? 86   TYR C CD1 1 
ATOM   2242  C CD2 . TYR C  1 86  ? 121.975 85.378  142.857 1.00 21.12  ? 86   TYR C CD2 1 
ATOM   2243  C CE1 . TYR C  1 86  ? 119.214 85.223  142.970 1.00 25.73  ? 86   TYR C CE1 1 
ATOM   2244  C CE2 . TYR C  1 86  ? 121.224 85.658  141.731 1.00 24.71  ? 86   TYR C CE2 1 
ATOM   2245  C CZ  . TYR C  1 86  ? 119.849 85.582  141.791 1.00 27.78  ? 86   TYR C CZ  1 
ATOM   2246  O OH  . TYR C  1 86  ? 119.129 85.873  140.660 1.00 28.61  ? 86   TYR C OH  1 
ATOM   2247  N N   . TYR C  1 87  ? 124.731 83.189  146.444 1.00 25.16  ? 87   TYR C N   1 
ATOM   2248  C CA  . TYR C  1 87  ? 125.733 82.862  147.451 1.00 24.21  ? 87   TYR C CA  1 
ATOM   2249  C C   . TYR C  1 87  ? 126.849 83.879  147.518 1.00 24.91  ? 87   TYR C C   1 
ATOM   2250  O O   . TYR C  1 87  ? 127.272 84.424  146.499 1.00 24.06  ? 87   TYR C O   1 
ATOM   2251  C CB  . TYR C  1 87  ? 126.399 81.539  147.090 1.00 24.02  ? 87   TYR C CB  1 
ATOM   2252  C CG  . TYR C  1 87  ? 125.559 80.342  147.387 1.00 23.98  ? 87   TYR C CG  1 
ATOM   2253  C CD1 . TYR C  1 87  ? 124.890 79.672  146.371 1.00 24.46  ? 87   TYR C CD1 1 
ATOM   2254  C CD2 . TYR C  1 87  ? 125.426 79.873  148.686 1.00 14.81  ? 87   TYR C CD2 1 
ATOM   2255  C CE1 . TYR C  1 87  ? 124.109 78.561  146.644 1.00 25.99  ? 87   TYR C CE1 1 
ATOM   2256  C CE2 . TYR C  1 87  ? 124.645 78.764  148.972 1.00 22.37  ? 87   TYR C CE2 1 
ATOM   2257  C CZ  . TYR C  1 87  ? 123.992 78.109  147.947 1.00 19.43  ? 87   TYR C CZ  1 
ATOM   2258  O OH  . TYR C  1 87  ? 123.213 77.004  148.223 1.00 23.99  ? 87   TYR C OH  1 
ATOM   2259  N N   . CYS C  1 88  ? 127.357 84.092  148.737 1.00 25.36  ? 88   CYS C N   1 
ATOM   2260  C CA  . CYS C  1 88  ? 128.555 84.898  148.945 1.00 26.88  ? 88   CYS C CA  1 
ATOM   2261  C C   . CYS C  1 88  ? 129.626 83.962  149.463 1.00 27.17  ? 88   CYS C C   1 
ATOM   2262  O O   . CYS C  1 88  ? 129.359 83.107  150.310 1.00 27.23  ? 88   CYS C O   1 
ATOM   2263  C CB  . CYS C  1 88  ? 128.307 86.040  149.943 1.00 26.56  ? 88   CYS C CB  1 
ATOM   2264  S SG  . CYS C  1 88  ? 127.597 85.502  151.575 1.00 30.35  ? 88   CYS C SG  1 
ATOM   2265  N N   . GLN C  1 89  ? 130.830 84.108  148.941 1.00 27.84  ? 89   GLN C N   1 
ATOM   2266  C CA  . GLN C  1 89  ? 131.916 83.231  149.311 1.00 28.39  ? 89   GLN C CA  1 
ATOM   2267  C C   . GLN C  1 89  ? 133.019 84.175  149.760 1.00 30.76  ? 89   GLN C C   1 
ATOM   2268  O O   . GLN C  1 89  ? 132.935 85.377  149.490 1.00 32.85  ? 89   GLN C O   1 
ATOM   2269  C CB  . GLN C  1 89  ? 132.324 82.427  148.076 1.00 28.49  ? 89   GLN C CB  1 
ATOM   2270  C CG  . GLN C  1 89  ? 133.239 81.244  148.324 1.00 19.71  ? 89   GLN C CG  1 
ATOM   2271  C CD  . GLN C  1 89  ? 134.132 80.982  147.104 1.00 20.81  ? 89   GLN C CD  1 
ATOM   2272  O OE1 . GLN C  1 89  ? 134.121 81.737  146.136 1.00 25.81  ? 89   GLN C OE1 1 
ATOM   2273  N NE2 . GLN C  1 89  ? 134.927 79.908  147.151 1.00 17.27  ? 89   GLN C NE2 1 
ATOM   2274  N N   . GLN C  1 90  ? 134.037 83.674  150.457 1.00 32.58  ? 90   GLN C N   1 
ATOM   2275  C CA  . GLN C  1 90  ? 135.245 84.485  150.648 1.00 33.41  ? 90   GLN C CA  1 
ATOM   2276  C C   . GLN C  1 90  ? 136.475 83.840  150.044 1.00 33.59  ? 90   GLN C C   1 
ATOM   2277  O O   . GLN C  1 90  ? 136.914 82.772  150.456 1.00 33.86  ? 90   GLN C O   1 
ATOM   2278  C CB  . GLN C  1 90  ? 135.486 84.936  152.105 1.00 33.08  ? 90   GLN C CB  1 
ATOM   2279  C CG  . GLN C  1 90  ? 135.559 83.829  153.163 1.00 37.13  ? 90   GLN C CG  1 
ATOM   2280  C CD  . GLN C  1 90  ? 136.970 83.315  153.413 1.00 39.70  ? 90   GLN C CD  1 
ATOM   2281  O OE1 . GLN C  1 90  ? 137.226 82.117  153.315 1.00 37.45  ? 90   GLN C OE1 1 
ATOM   2282  N NE2 . GLN C  1 90  ? 137.886 84.214  153.749 1.00 40.05  ? 90   GLN C NE2 1 
ATOM   2283  N N   . SER C  1 91  ? 137.013 84.529  149.051 1.00 35.45  ? 91   SER C N   1 
ATOM   2284  C CA  . SER C  1 91  ? 138.218 84.124  148.360 1.00 35.24  ? 91   SER C CA  1 
ATOM   2285  C C   . SER C  1 91  ? 139.458 84.570  149.147 1.00 34.70  ? 91   SER C C   1 
ATOM   2286  O O   . SER C  1 91  ? 140.507 84.879  148.559 1.00 35.58  ? 91   SER C O   1 
ATOM   2287  C CB  . SER C  1 91  ? 138.199 84.755  146.960 1.00 35.56  ? 91   SER C CB  1 
ATOM   2288  O OG  . SER C  1 91  ? 139.405 84.429  146.206 1.00 41.10  ? 91   SER C OG  1 
ATOM   2289  N N   . TYR C  1 92  ? 139.343 84.558  150.477 1.00 34.40  ? 92   TYR C N   1 
ATOM   2290  C CA  . TYR C  1 92  ? 140.303 85.251  151.341 1.00 33.48  ? 92   TYR C CA  1 
ATOM   2291  C C   . TYR C  1 92  ? 141.290 84.388  152.123 1.00 35.50  ? 92   TYR C C   1 
ATOM   2292  O O   . TYR C  1 92  ? 142.525 84.681  152.121 1.00 35.50  ? 92   TYR C O   1 
ATOM   2293  C CB  . TYR C  1 92  ? 139.548 86.119  152.329 1.00 32.58  ? 92   TYR C CB  1 
ATOM   2294  C CG  . TYR C  1 92  ? 140.430 87.000  153.168 1.00 31.71  ? 92   TYR C CG  1 
ATOM   2295  C CD1 . TYR C  1 92  ? 140.424 88.367  152.960 1.00 24.42  ? 92   TYR C CD1 1 
ATOM   2296  C CD2 . TYR C  1 92  ? 141.260 86.481  154.176 1.00 29.47  ? 92   TYR C CD2 1 
ATOM   2297  C CE1 . TYR C  1 92  ? 141.209 89.209  153.705 1.00 23.53  ? 92   TYR C CE1 1 
ATOM   2298  C CE2 . TYR C  1 92  ? 142.070 87.326  154.934 1.00 32.45  ? 92   TYR C CE2 1 
ATOM   2299  C CZ  . TYR C  1 92  ? 142.031 88.701  154.686 1.00 30.82  ? 92   TYR C CZ  1 
ATOM   2300  O OH  . TYR C  1 92  ? 142.831 89.610  155.396 1.00 38.19  ? 92   TYR C OH  1 
ATOM   2301  N N   . SER C  1 93  ? 140.785 83.376  152.826 1.00 36.66  ? 93   SER C N   1 
ATOM   2302  C CA  . SER C  1 93  ? 141.677 82.421  153.453 1.00 37.57  ? 93   SER C CA  1 
ATOM   2303  C C   . SER C  1 93  ? 141.187 81.087  152.989 1.00 39.43  ? 93   SER C C   1 
ATOM   2304  O O   . SER C  1 93  ? 139.950 80.898  152.856 1.00 41.91  ? 93   SER C O   1 
ATOM   2305  C CB  . SER C  1 93  ? 141.632 82.522  154.983 1.00 37.82  ? 93   SER C CB  1 
ATOM   2306  O OG  . SER C  1 93  ? 140.308 82.325  155.477 1.00 35.72  ? 93   SER C OG  1 
ATOM   2307  N N   . THR C  1 94  ? 142.108 80.176  152.679 1.00 41.46  ? 94   THR C N   1 
ATOM   2308  C CA  . THR C  1 94  ? 141.634 78.808  152.500 1.00 43.49  ? 94   THR C CA  1 
ATOM   2309  C C   . THR C  1 94  ? 141.116 78.408  153.888 1.00 44.92  ? 94   THR C C   1 
ATOM   2310  O O   . THR C  1 94  ? 141.829 78.585  154.898 1.00 47.71  ? 94   THR C O   1 
ATOM   2311  C CB  . THR C  1 94  ? 142.739 77.879  151.982 1.00 42.98  ? 94   THR C CB  1 
ATOM   2312  O OG1 . THR C  1 94  ? 143.932 78.092  152.737 1.00 47.23  ? 94   THR C OG1 1 
ATOM   2313  C CG2 . THR C  1 94  ? 143.030 78.170  150.516 1.00 42.51  ? 94   THR C CG2 1 
ATOM   2314  N N   . PRO C  1 95  ? 139.874 77.894  153.968 1.00 45.08  ? 95   PRO C N   1 
ATOM   2315  C CA  . PRO C  1 95  ? 138.993 77.553  152.865 1.00 44.87  ? 95   PRO C CA  1 
ATOM   2316  C C   . PRO C  1 95  ? 138.092 78.710  152.467 1.00 43.50  ? 95   PRO C C   1 
ATOM   2317  O O   . PRO C  1 95  ? 137.381 79.262  153.311 1.00 44.18  ? 95   PRO C O   1 
ATOM   2318  C CB  . PRO C  1 95  ? 138.152 76.412  153.449 1.00 45.23  ? 95   PRO C CB  1 
ATOM   2319  C CG  . PRO C  1 95  ? 138.074 76.711  154.926 1.00 44.82  ? 95   PRO C CG  1 
ATOM   2320  C CD  . PRO C  1 95  ? 139.232 77.627  155.270 1.00 44.89  ? 95   PRO C CD  1 
ATOM   2321  N N   . ASN C  1 96  ? 138.152 79.096  151.198 1.00 41.00  ? 96   ASN C N   1 
ATOM   2322  C CA  . ASN C  1 96  ? 137.139 79.981  150.652 1.00 39.53  ? 96   ASN C CA  1 
ATOM   2323  C C   . ASN C  1 96  ? 135.771 79.507  151.188 1.00 38.74  ? 96   ASN C C   1 
ATOM   2324  O O   . ASN C  1 96  ? 135.278 78.425  150.787 1.00 40.30  ? 96   ASN C O   1 
ATOM   2325  C CB  . ASN C  1 96  ? 137.219 79.936  149.119 1.00 37.22  ? 96   ASN C CB  1 
ATOM   2326  C CG  . ASN C  1 96  ? 138.665 79.833  148.603 1.00 39.11  ? 96   ASN C CG  1 
ATOM   2327  O OD1 . ASN C  1 96  ? 139.483 79.091  149.153 1.00 42.81  ? 96   ASN C OD1 1 
ATOM   2328  N ND2 . ASN C  1 96  ? 138.974 80.573  147.540 1.00 30.93  ? 96   ASN C ND2 1 
ATOM   2329  N N   . THR C  1 97  ? 135.184 80.267  152.124 1.00 36.71  ? 97   THR C N   1 
ATOM   2330  C CA  . THR C  1 97  ? 133.918 79.846  152.760 1.00 34.14  ? 97   THR C CA  1 
ATOM   2331  C C   . THR C  1 97  ? 132.717 80.436  152.040 1.00 33.03  ? 97   THR C C   1 
ATOM   2332  O O   . THR C  1 97  ? 132.819 81.501  151.438 1.00 32.96  ? 97   THR C O   1 
ATOM   2333  C CB  . THR C  1 97  ? 133.800 80.269  154.251 1.00 33.27  ? 97   THR C CB  1 
ATOM   2334  O OG1 . THR C  1 97  ? 135.102 80.514  154.813 1.00 33.42  ? 97   THR C OG1 1 
ATOM   2335  C CG2 . THR C  1 97  ? 133.082 79.195  155.065 1.00 34.78  ? 97   THR C CG2 1 
ATOM   2336  N N   . PHE C  1 98  ? 131.577 79.747  152.128 1.00 31.21  ? 98   PHE C N   1 
ATOM   2337  C CA  . PHE C  1 98  ? 130.307 80.218  151.558 1.00 31.29  ? 98   PHE C CA  1 
ATOM   2338  C C   . PHE C  1 98  ? 129.309 80.692  152.604 1.00 30.00  ? 98   PHE C C   1 
ATOM   2339  O O   . PHE C  1 98  ? 129.419 80.367  153.788 1.00 30.74  ? 98   PHE C O   1 
ATOM   2340  C CB  . PHE C  1 98  ? 129.618 79.106  150.766 1.00 27.65  ? 98   PHE C CB  1 
ATOM   2341  C CG  . PHE C  1 98  ? 130.114 78.951  149.368 1.00 23.71  ? 98   PHE C CG  1 
ATOM   2342  C CD1 . PHE C  1 98  ? 131.334 78.339  149.126 1.00 20.48  ? 98   PHE C CD1 1 
ATOM   2343  C CD2 . PHE C  1 98  ? 129.351 79.383  148.287 1.00 25.38  ? 98   PHE C CD2 1 
ATOM   2344  C CE1 . PHE C  1 98  ? 131.805 78.176  147.837 1.00 11.64  ? 98   PHE C CE1 1 
ATOM   2345  C CE2 . PHE C  1 98  ? 129.812 79.224  146.982 1.00 22.38  ? 98   PHE C CE2 1 
ATOM   2346  C CZ  . PHE C  1 98  ? 131.049 78.615  146.762 1.00 12.04  ? 98   PHE C CZ  1 
ATOM   2347  N N   . GLY C  1 99  ? 128.324 81.454  152.136 1.00 29.49  ? 99   GLY C N   1 
ATOM   2348  C CA  . GLY C  1 99  ? 127.147 81.780  152.926 1.00 31.77  ? 99   GLY C CA  1 
ATOM   2349  C C   . GLY C  1 99  ? 126.024 80.837  152.537 1.00 32.65  ? 99   GLY C C   1 
ATOM   2350  O O   . GLY C  1 99  ? 125.949 80.410  151.385 1.00 33.03  ? 99   GLY C O   1 
ATOM   2351  N N   . GLN C  1 100 ? 125.143 80.515  153.479 1.00 33.64  ? 100  GLN C N   1 
ATOM   2352  C CA  . GLN C  1 100 ? 124.156 79.443  153.275 1.00 34.02  ? 100  GLN C CA  1 
ATOM   2353  C C   . GLN C  1 100 ? 123.090 79.689  152.201 1.00 33.90  ? 100  GLN C C   1 
ATOM   2354  O O   . GLN C  1 100 ? 122.185 78.858  152.039 1.00 38.04  ? 100  GLN C O   1 
ATOM   2355  C CB  . GLN C  1 100 ? 123.487 79.028  154.603 1.00 34.06  ? 100  GLN C CB  1 
ATOM   2356  C CG  . GLN C  1 100 ? 122.725 80.140  155.316 1.00 37.86  ? 100  GLN C CG  1 
ATOM   2357  C CD  . GLN C  1 100 ? 123.651 81.137  155.998 1.00 40.32  ? 100  GLN C CD  1 
ATOM   2358  O OE1 . GLN C  1 100 ? 124.709 81.495  155.469 1.00 43.64  ? 100  GLN C OE1 1 
ATOM   2359  N NE2 . GLN C  1 100 ? 123.254 81.596  157.181 1.00 42.38  ? 100  GLN C NE2 1 
ATOM   2360  N N   . GLY C  1 101 ? 123.180 80.812  151.483 1.00 34.02  ? 101  GLY C N   1 
ATOM   2361  C CA  . GLY C  1 101 ? 122.367 81.034  150.276 1.00 33.75  ? 101  GLY C CA  1 
ATOM   2362  C C   . GLY C  1 101 ? 120.981 81.660  150.410 1.00 35.11  ? 101  GLY C C   1 
ATOM   2363  O O   . GLY C  1 101 ? 120.062 81.042  151.025 1.00 37.16  ? 101  GLY C O   1 
ATOM   2364  N N   . THR C  1 102 ? 120.808 82.864  149.839 1.00 33.84  ? 102  THR C N   1 
ATOM   2365  C CA  . THR C  1 102 ? 119.459 83.442  149.748 1.00 34.60  ? 102  THR C CA  1 
ATOM   2366  C C   . THR C  1 102 ? 118.695 82.837  148.562 1.00 33.70  ? 102  THR C C   1 
ATOM   2367  O O   . THR C  1 102 ? 119.089 83.056  147.404 1.00 31.73  ? 102  THR C O   1 
ATOM   2368  C CB  . THR C  1 102 ? 119.499 84.979  149.569 1.00 35.54  ? 102  THR C CB  1 
ATOM   2369  O OG1 . THR C  1 102 ? 120.263 85.571  150.628 1.00 34.93  ? 102  THR C OG1 1 
ATOM   2370  C CG2 . THR C  1 102 ? 118.087 85.559  149.578 1.00 33.56  ? 102  THR C CG2 1 
ATOM   2371  N N   . LYS C  1 103 ? 117.614 82.097  148.822 1.00 34.32  ? 103  LYS C N   1 
ATOM   2372  C CA  . LYS C  1 103 ? 116.802 81.554  147.710 1.00 35.99  ? 103  LYS C CA  1 
ATOM   2373  C C   . LYS C  1 103 ? 115.706 82.515  147.239 1.00 37.56  ? 103  LYS C C   1 
ATOM   2374  O O   . LYS C  1 103 ? 114.632 82.610  147.847 1.00 38.42  ? 103  LYS C O   1 
ATOM   2375  C CB  . LYS C  1 103 ? 116.198 80.165  148.023 1.00 34.95  ? 103  LYS C CB  1 
ATOM   2376  C CG  . LYS C  1 103 ? 117.070 79.247  148.866 1.00 37.00  ? 103  LYS C CG  1 
ATOM   2377  C CD  . LYS C  1 103 ? 116.456 79.097  150.262 1.00 38.30  ? 103  LYS C CD  1 
ATOM   2378  C CE  . LYS C  1 103 ? 117.487 78.538  151.253 1.00 41.54  ? 103  LYS C CE  1 
ATOM   2379  N NZ  . LYS C  1 103 ? 117.945 77.149  150.909 1.00 48.72  ? 103  LYS C NZ  1 
ATOM   2380  N N   . VAL C  1 104 ? 115.997 83.219  146.151 1.00 37.79  ? 104  VAL C N   1 
ATOM   2381  C CA  . VAL C  1 104 ? 115.012 84.078  145.525 1.00 37.60  ? 104  VAL C CA  1 
ATOM   2382  C C   . VAL C  1 104 ? 114.016 83.185  144.767 1.00 39.41  ? 104  VAL C C   1 
ATOM   2383  O O   . VAL C  1 104 ? 114.399 82.404  143.883 1.00 40.54  ? 104  VAL C O   1 
ATOM   2384  C CB  . VAL C  1 104 ? 115.669 85.141  144.603 1.00 37.02  ? 104  VAL C CB  1 
ATOM   2385  C CG1 . VAL C  1 104 ? 114.617 86.104  144.070 1.00 33.75  ? 104  VAL C CG1 1 
ATOM   2386  C CG2 . VAL C  1 104 ? 116.728 85.926  145.372 1.00 33.44  ? 104  VAL C CG2 1 
ATOM   2387  N N   . GLU C  1 105 ? 112.741 83.266  145.172 1.00 41.33  ? 105  GLU C N   1 
ATOM   2388  C CA  . GLU C  1 105 ? 111.619 82.642  144.422 1.00 41.30  ? 105  GLU C CA  1 
ATOM   2389  C C   . GLU C  1 105 ? 111.088 83.575  143.317 1.00 40.90  ? 105  GLU C C   1 
ATOM   2390  O O   . GLU C  1 105 ? 111.684 84.630  143.067 1.00 40.72  ? 105  GLU C O   1 
ATOM   2391  C CB  . GLU C  1 105 ? 110.484 82.244  145.375 1.00 42.16  ? 105  GLU C CB  1 
ATOM   2392  C CG  . GLU C  1 105 ? 110.506 80.783  145.796 1.00 43.69  ? 105  GLU C CG  1 
ATOM   2393  C CD  . GLU C  1 105 ? 110.284 79.823  144.632 1.00 48.16  ? 105  GLU C CD  1 
ATOM   2394  O OE1 . GLU C  1 105 ? 109.660 80.220  143.620 1.00 47.57  ? 105  GLU C OE1 1 
ATOM   2395  O OE2 . GLU C  1 105 ? 110.732 78.660  144.733 1.00 44.11  ? 105  GLU C OE2 1 
ATOM   2396  N N   . ILE C  1 106 ? 109.990 83.202  142.650 1.00 40.80  ? 106  ILE C N   1 
ATOM   2397  C CA  . ILE C  1 106 ? 109.341 84.097  141.667 1.00 40.62  ? 106  ILE C CA  1 
ATOM   2398  C C   . ILE C  1 106 ? 107.809 84.148  141.818 1.00 40.55  ? 106  ILE C C   1 
ATOM   2399  O O   . ILE C  1 106 ? 107.232 85.272  141.895 1.00 40.25  ? 106  ILE C O   1 
ATOM   2400  C CB  . ILE C  1 106 ? 109.744 83.768  140.180 1.00 40.08  ? 106  ILE C CB  1 
ATOM   2401  C CG1 . ILE C  1 106 ? 109.723 85.056  139.317 1.00 36.92  ? 106  ILE C CG1 1 
ATOM   2402  C CG2 . ILE C  1 106 ? 108.781 82.725  139.562 1.00 41.65  ? 106  ILE C CG2 1 
ATOM   2403  C CD1 . ILE C  1 106 ? 110.832 86.062  139.632 1.00 30.89  ? 106  ILE C CD1 1 
ATOM   2404  N N   . ASP D  1 1   ? 148.365 83.783  132.601 1.00 34.41  ? 1    ASP D N   1 
ATOM   2405  C CA  . ASP D  1 1   ? 149.670 84.403  132.215 1.00 33.65  ? 1    ASP D CA  1 
ATOM   2406  C C   . ASP D  1 1   ? 149.447 85.817  131.636 1.00 34.21  ? 1    ASP D C   1 
ATOM   2407  O O   . ASP D  1 1   ? 149.168 85.982  130.438 1.00 34.98  ? 1    ASP D O   1 
ATOM   2408  C CB  . ASP D  1 1   ? 150.424 83.491  131.240 1.00 34.10  ? 1    ASP D CB  1 
ATOM   2409  C CG  . ASP D  1 1   ? 151.922 83.720  131.263 1.00 33.50  ? 1    ASP D CG  1 
ATOM   2410  O OD1 . ASP D  1 1   ? 152.555 83.465  132.314 1.00 25.57  ? 1    ASP D OD1 1 
ATOM   2411  O OD2 . ASP D  1 1   ? 152.474 84.142  130.223 1.00 39.93  ? 1    ASP D OD2 1 
ATOM   2412  N N   . ILE D  1 2   ? 149.576 86.822  132.520 1.00 30.93  ? 2    ILE D N   1 
ATOM   2413  C CA  . ILE D  1 2   ? 149.228 88.249  132.265 1.00 28.70  ? 2    ILE D CA  1 
ATOM   2414  C C   . ILE D  1 2   ? 150.444 89.202  132.359 1.00 28.10  ? 2    ILE D C   1 
ATOM   2415  O O   . ILE D  1 2   ? 151.337 88.972  133.186 1.00 21.54  ? 2    ILE D O   1 
ATOM   2416  C CB  . ILE D  1 2   ? 148.159 88.741  133.306 1.00 29.80  ? 2    ILE D CB  1 
ATOM   2417  C CG1 . ILE D  1 2   ? 146.891 87.866  133.271 1.00 28.05  ? 2    ILE D CG1 1 
ATOM   2418  C CG2 . ILE D  1 2   ? 147.824 90.235  133.139 1.00 29.08  ? 2    ILE D CG2 1 
ATOM   2419  C CD1 . ILE D  1 2   ? 145.918 88.086  134.451 1.00 24.39  ? 2    ILE D CD1 1 
ATOM   2420  N N   . GLN D  1 3   ? 150.482 90.265  131.546 1.00 27.87  ? 3    GLN D N   1 
ATOM   2421  C CA  . GLN D  1 3   ? 151.565 91.266  131.645 1.00 27.54  ? 3    GLN D CA  1 
ATOM   2422  C C   . GLN D  1 3   ? 151.276 92.437  132.611 1.00 23.72  ? 3    GLN D C   1 
ATOM   2423  O O   . GLN D  1 3   ? 150.114 92.770  132.877 1.00 22.60  ? 3    GLN D O   1 
ATOM   2424  C CB  . GLN D  1 3   ? 151.995 91.774  130.257 1.00 23.82  ? 3    GLN D CB  1 
ATOM   2425  C CG  . GLN D  1 3   ? 153.148 90.965  129.630 1.00 32.91  ? 3    GLN D CG  1 
ATOM   2426  C CD  . GLN D  1 3   ? 152.736 89.559  129.191 1.00 38.63  ? 3    GLN D CD  1 
ATOM   2427  O OE1 . GLN D  1 3   ? 151.943 89.389  128.259 1.00 33.79  ? 3    GLN D OE1 1 
ATOM   2428  N NE2 . GLN D  1 3   ? 153.294 88.543  129.842 1.00 40.67  ? 3    GLN D NE2 1 
ATOM   2429  N N   . MET D  1 4   ? 152.338 93.039  133.145 1.00 24.72  ? 4    MET D N   1 
ATOM   2430  C CA  . MET D  1 4   ? 152.236 94.157  134.086 1.00 24.56  ? 4    MET D CA  1 
ATOM   2431  C C   . MET D  1 4   ? 153.094 95.296  133.578 1.00 23.83  ? 4    MET D C   1 
ATOM   2432  O O   . MET D  1 4   ? 154.320 95.193  133.627 1.00 25.43  ? 4    MET D O   1 
ATOM   2433  C CB  . MET D  1 4   ? 152.764 93.718  135.464 1.00 24.45  ? 4    MET D CB  1 
ATOM   2434  C CG  . MET D  1 4   ? 151.740 93.790  136.597 1.00 25.77  ? 4    MET D CG  1 
ATOM   2435  S SD  . MET D  1 4   ? 150.161 93.026  136.173 1.00 34.34  ? 4    MET D SD  1 
ATOM   2436  C CE  . MET D  1 4   ? 149.006 94.132  137.044 1.00 30.47  ? 4    MET D CE  1 
ATOM   2437  N N   . THR D  1 5   ? 152.485 96.372  133.083 1.00 21.96  ? 5    THR D N   1 
ATOM   2438  C CA  . THR D  1 5   ? 153.268 97.471  132.500 1.00 19.75  ? 5    THR D CA  1 
ATOM   2439  C C   . THR D  1 5   ? 153.459 98.618  133.497 1.00 20.62  ? 5    THR D C   1 
ATOM   2440  O O   . THR D  1 5   ? 152.704 99.598  133.486 1.00 21.72  ? 5    THR D O   1 
ATOM   2441  C CB  . THR D  1 5   ? 152.638 97.985  131.187 1.00 18.17  ? 5    THR D CB  1 
ATOM   2442  O OG1 . THR D  1 5   ? 152.200 96.869  130.397 1.00 21.59  ? 5    THR D OG1 1 
ATOM   2443  C CG2 . THR D  1 5   ? 153.656 98.794  130.383 1.00 13.08  ? 5    THR D CG2 1 
ATOM   2444  N N   . GLN D  1 6   ? 154.465 98.491  134.353 1.00 20.48  ? 6    GLN D N   1 
ATOM   2445  C CA  . GLN D  1 6   ? 154.673 99.448  135.440 1.00 20.25  ? 6    GLN D CA  1 
ATOM   2446  C C   . GLN D  1 6   ? 155.612 100.547 134.964 1.00 19.89  ? 6    GLN D C   1 
ATOM   2447  O O   . GLN D  1 6   ? 156.556 100.273 134.216 1.00 19.07  ? 6    GLN D O   1 
ATOM   2448  C CB  . GLN D  1 6   ? 155.286 98.717  136.635 1.00 20.72  ? 6    GLN D CB  1 
ATOM   2449  C CG  . GLN D  1 6   ? 155.331 99.481  137.951 1.00 21.75  ? 6    GLN D CG  1 
ATOM   2450  C CD  . GLN D  1 6   ? 156.078 98.705  139.033 1.00 25.78  ? 6    GLN D CD  1 
ATOM   2451  O OE1 . GLN D  1 6   ? 156.077 97.472  139.047 1.00 30.23  ? 6    GLN D OE1 1 
ATOM   2452  N NE2 . GLN D  1 6   ? 156.715 99.430  139.949 1.00 33.00  ? 6    GLN D NE2 1 
ATOM   2453  N N   . SER D  1 7   ? 155.348 101.782 135.380 1.00 24.53  ? 7    SER D N   1 
ATOM   2454  C CA  . SER D  1 7   ? 156.277 102.892 135.166 1.00 24.15  ? 7    SER D CA  1 
ATOM   2455  C C   . SER D  1 7   ? 156.018 103.953 136.241 1.00 23.10  ? 7    SER D C   1 
ATOM   2456  O O   . SER D  1 7   ? 154.964 103.926 136.880 1.00 24.79  ? 7    SER D O   1 
ATOM   2457  C CB  . SER D  1 7   ? 156.136 103.476 133.752 1.00 24.13  ? 7    SER D CB  1 
ATOM   2458  O OG  . SER D  1 7   ? 155.316 104.636 133.750 1.00 30.69  ? 7    SER D OG  1 
ATOM   2459  N N   . PRO D  1 8   ? 156.961 104.890 136.459 1.00 24.15  ? 8    PRO D N   1 
ATOM   2460  C CA  . PRO D  1 8   ? 158.215 105.172 135.775 1.00 24.10  ? 8    PRO D CA  1 
ATOM   2461  C C   . PRO D  1 8   ? 159.243 104.145 136.192 1.00 24.26  ? 8    PRO D C   1 
ATOM   2462  O O   . PRO D  1 8   ? 158.958 103.277 137.022 1.00 24.92  ? 8    PRO D O   1 
ATOM   2463  C CB  . PRO D  1 8   ? 158.610 106.553 136.316 1.00 22.69  ? 8    PRO D CB  1 
ATOM   2464  C CG  . PRO D  1 8   ? 157.437 107.023 137.133 1.00 25.00  ? 8    PRO D CG  1 
ATOM   2465  C CD  . PRO D  1 8   ? 156.774 105.795 137.607 1.00 24.15  ? 8    PRO D CD  1 
ATOM   2466  N N   . SER D  1 9   ? 160.445 104.247 135.630 1.00 24.60  ? 9    SER D N   1 
ATOM   2467  C CA  . SER D  1 9   ? 161.454 103.236 135.887 1.00 23.08  ? 9    SER D CA  1 
ATOM   2468  C C   . SER D  1 9   ? 162.171 103.501 137.211 1.00 22.71  ? 9    SER D C   1 
ATOM   2469  O O   . SER D  1 9   ? 162.695 102.570 137.841 1.00 21.78  ? 9    SER D O   1 
ATOM   2470  C CB  . SER D  1 9   ? 162.443 103.168 134.718 1.00 22.45  ? 9    SER D CB  1 
ATOM   2471  O OG  . SER D  1 9   ? 163.300 102.046 134.845 1.00 21.10  ? 9    SER D OG  1 
ATOM   2472  N N   . SER D  1 10  ? 162.186 104.773 137.620 1.00 22.76  ? 10   SER D N   1 
ATOM   2473  C CA  . SER D  1 10  ? 162.750 105.227 138.902 1.00 25.39  ? 10   SER D CA  1 
ATOM   2474  C C   . SER D  1 10  ? 162.432 106.700 139.156 1.00 28.89  ? 10   SER D C   1 
ATOM   2475  O O   . SER D  1 10  ? 162.094 107.438 138.215 1.00 30.99  ? 10   SER D O   1 
ATOM   2476  C CB  . SER D  1 10  ? 164.280 105.027 138.952 1.00 23.16  ? 10   SER D CB  1 
ATOM   2477  O OG  . SER D  1 10  ? 164.814 105.270 137.533 1.00 24.11  ? 10   SER D OG  1 
ATOM   2478  N N   . LEU D  1 11  ? 162.561 107.128 140.415 1.00 29.88  ? 11   LEU D N   1 
ATOM   2479  C CA  . LEU D  1 11  ? 162.145 108.477 140.817 1.00 29.54  ? 11   LEU D CA  1 
ATOM   2480  C C   . LEU D  1 11  ? 163.080 109.172 141.790 1.00 30.89  ? 11   LEU D C   1 
ATOM   2481  O O   . LEU D  1 11  ? 163.347 108.648 142.879 1.00 33.23  ? 11   LEU D O   1 
ATOM   2482  C CB  . LEU D  1 11  ? 160.796 108.404 141.523 1.00 28.90  ? 11   LEU D CB  1 
ATOM   2483  C CG  . LEU D  1 11  ? 159.513 108.655 140.756 1.00 26.40  ? 11   LEU D CG  1 
ATOM   2484  C CD1 . LEU D  1 11  ? 159.142 107.440 139.922 1.00 25.96  ? 11   LEU D CD1 1 
ATOM   2485  C CD2 . LEU D  1 11  ? 158.392 108.925 141.767 1.00 15.44  ? 11   LEU D CD2 1 
ATOM   2486  N N   . SER D  1 12  ? 163.572 110.349 141.417 1.00 31.14  ? 12   SER D N   1 
ATOM   2487  C CA  . SER D  1 12  ? 164.129 111.247 142.414 1.00 32.07  ? 12   SER D CA  1 
ATOM   2488  C C   . SER D  1 12  ? 162.996 112.099 142.921 1.00 30.23  ? 12   SER D C   1 
ATOM   2489  O O   . SER D  1 12  ? 162.174 112.599 142.145 1.00 31.38  ? 12   SER D O   1 
ATOM   2490  C CB  . SER D  1 12  ? 165.226 112.148 141.840 1.00 30.09  ? 12   SER D CB  1 
ATOM   2491  O OG  . SER D  1 12  ? 166.469 111.430 141.648 1.00 34.99  ? 12   SER D OG  1 
ATOM   2492  N N   . ALA D  1 13  ? 162.957 112.263 144.234 1.00 28.06  ? 13   ALA D N   1 
ATOM   2493  C CA  . ALA D  1 13  ? 161.968 113.114 144.845 1.00 27.08  ? 13   ALA D CA  1 
ATOM   2494  C C   . ALA D  1 13  ? 162.461 113.619 146.178 1.00 26.36  ? 13   ALA D C   1 
ATOM   2495  O O   . ALA D  1 13  ? 163.488 113.189 146.708 1.00 24.39  ? 13   ALA D O   1 
ATOM   2496  C CB  . ALA D  1 13  ? 160.634 112.366 145.004 1.00 27.19  ? 13   ALA D CB  1 
ATOM   2497  N N   . SER D  1 14  ? 161.676 114.529 146.727 1.00 27.75  ? 14   SER D N   1 
ATOM   2498  C CA  . SER D  1 14  ? 162.054 115.242 147.908 1.00 29.26  ? 14   SER D CA  1 
ATOM   2499  C C   . SER D  1 14  ? 161.003 115.044 148.979 1.00 29.77  ? 14   SER D C   1 
ATOM   2500  O O   . SER D  1 14  ? 159.811 114.860 148.697 1.00 27.95  ? 14   SER D O   1 
ATOM   2501  C CB  . SER D  1 14  ? 162.234 116.727 147.578 1.00 29.70  ? 14   SER D CB  1 
ATOM   2502  O OG  . SER D  1 14  ? 161.210 117.192 146.712 1.00 31.96  ? 14   SER D OG  1 
ATOM   2503  N N   . VAL D  1 15  ? 161.494 115.091 150.214 1.00 31.68  ? 15   VAL D N   1 
ATOM   2504  C CA  . VAL D  1 15  ? 160.733 114.674 151.375 1.00 31.42  ? 15   VAL D CA  1 
ATOM   2505  C C   . VAL D  1 15  ? 159.545 115.596 151.523 1.00 33.34  ? 15   VAL D C   1 
ATOM   2506  O O   . VAL D  1 15  ? 159.661 116.692 152.084 1.00 34.55  ? 15   VAL D O   1 
ATOM   2507  C CB  . VAL D  1 15  ? 161.612 114.724 152.653 1.00 32.50  ? 15   VAL D CB  1 
ATOM   2508  C CG1 . VAL D  1 15  ? 160.798 114.327 153.931 1.00 32.06  ? 15   VAL D CG1 1 
ATOM   2509  C CG2 . VAL D  1 15  ? 162.820 113.793 152.507 1.00 22.33  ? 15   VAL D CG2 1 
ATOM   2510  N N   . GLY D  1 16  ? 158.403 115.156 150.983 1.00 35.06  ? 16   GLY D N   1 
ATOM   2511  C CA  . GLY D  1 16  ? 157.151 115.883 151.229 1.00 36.83  ? 16   GLY D CA  1 
ATOM   2512  C C   . GLY D  1 16  ? 156.208 115.806 150.051 1.00 39.92  ? 16   GLY D C   1 
ATOM   2513  O O   . GLY D  1 16  ? 155.077 116.299 150.114 1.00 41.61  ? 16   GLY D O   1 
ATOM   2514  N N   . ASP D  1 17  ? 156.675 115.167 148.982 1.00 40.88  ? 17   ASP D N   1 
ATOM   2515  C CA  . ASP D  1 17  ? 155.989 115.219 147.703 1.00 39.50  ? 17   ASP D CA  1 
ATOM   2516  C C   . ASP D  1 17  ? 155.177 114.003 147.337 1.00 39.20  ? 17   ASP D C   1 
ATOM   2517  O O   . ASP D  1 17  ? 155.492 112.864 147.730 1.00 41.44  ? 17   ASP D O   1 
ATOM   2518  C CB  . ASP D  1 17  ? 156.994 115.465 146.587 1.00 40.10  ? 17   ASP D CB  1 
ATOM   2519  C CG  . ASP D  1 17  ? 157.306 116.923 146.404 1.00 40.41  ? 17   ASP D CG  1 
ATOM   2520  O OD1 . ASP D  1 17  ? 157.007 117.724 147.318 1.00 37.84  ? 17   ASP D OD1 1 
ATOM   2521  O OD2 . ASP D  1 17  ? 157.863 117.276 145.341 1.00 41.79  ? 17   ASP D OD2 1 
ATOM   2522  N N   . ARG D  1 18  ? 154.143 114.273 146.545 1.00 37.86  ? 18   ARG D N   1 
ATOM   2523  C CA  . ARG D  1 18  ? 153.357 113.240 145.891 1.00 36.79  ? 18   ARG D CA  1 
ATOM   2524  C C   . ARG D  1 18  ? 154.169 112.434 144.863 1.00 34.57  ? 18   ARG D C   1 
ATOM   2525  O O   . ARG D  1 18  ? 154.190 112.779 143.675 1.00 35.65  ? 18   ARG D O   1 
ATOM   2526  C CB  . ARG D  1 18  ? 152.154 113.897 145.204 1.00 38.05  ? 18   ARG D CB  1 
ATOM   2527  C CG  . ARG D  1 18  ? 150.831 113.192 145.460 1.00 41.54  ? 18   ARG D CG  1 
ATOM   2528  C CD  . ARG D  1 18  ? 149.663 113.972 144.851 1.00 39.62  ? 18   ARG D CD  1 
ATOM   2529  N NE  . ARG D  1 18  ? 148.390 113.322 145.158 1.00 42.51  ? 18   ARG D NE  1 
ATOM   2530  C CZ  . ARG D  1 18  ? 147.524 113.747 146.076 1.00 47.89  ? 18   ARG D CZ  1 
ATOM   2531  N NH1 . ARG D  1 18  ? 147.774 114.841 146.788 1.00 47.90  ? 18   ARG D NH1 1 
ATOM   2532  N NH2 . ARG D  1 18  ? 146.397 113.075 146.277 1.00 46.93  ? 18   ARG D NH2 1 
ATOM   2533  N N   . VAL D  1 19  ? 154.831 111.369 145.315 1.00 31.75  ? 19   VAL D N   1 
ATOM   2534  C CA  . VAL D  1 19  ? 155.341 110.344 144.381 1.00 30.93  ? 19   VAL D CA  1 
ATOM   2535  C C   . VAL D  1 19  ? 154.164 109.600 143.746 1.00 31.62  ? 19   VAL D C   1 
ATOM   2536  O O   . VAL D  1 19  ? 153.150 109.364 144.410 1.00 31.03  ? 19   VAL D O   1 
ATOM   2537  C CB  . VAL D  1 19  ? 156.265 109.319 145.094 1.00 31.84  ? 19   VAL D CB  1 
ATOM   2538  C CG1 . VAL D  1 19  ? 156.256 107.939 144.387 1.00 27.86  ? 19   VAL D CG1 1 
ATOM   2539  C CG2 . VAL D  1 19  ? 157.687 109.859 145.214 1.00 26.03  ? 19   VAL D CG2 1 
ATOM   2540  N N   . THR D  1 20  ? 154.299 109.231 142.472 1.00 31.09  ? 20   THR D N   1 
ATOM   2541  C CA  . THR D  1 20  ? 153.219 108.544 141.753 1.00 30.29  ? 20   THR D CA  1 
ATOM   2542  C C   . THR D  1 20  ? 153.698 107.441 140.778 1.00 30.22  ? 20   THR D C   1 
ATOM   2543  O O   . THR D  1 20  ? 154.311 107.728 139.729 1.00 28.06  ? 20   THR D O   1 
ATOM   2544  C CB  . THR D  1 20  ? 152.297 109.560 141.035 1.00 29.19  ? 20   THR D CB  1 
ATOM   2545  O OG1 . THR D  1 20  ? 151.530 110.290 142.038 1.00 27.67  ? 20   THR D OG1 1 
ATOM   2546  C CG2 . THR D  1 20  ? 151.320 108.856 140.107 1.00 33.59  ? 20   THR D CG2 1 
ATOM   2547  N N   . ILE D  1 21  ? 153.402 106.190 141.136 1.00 28.01  ? 21   ILE D N   1 
ATOM   2548  C CA  . ILE D  1 21  ? 153.709 105.056 140.270 1.00 25.25  ? 21   ILE D CA  1 
ATOM   2549  C C   . ILE D  1 21  ? 152.405 104.482 139.699 1.00 27.71  ? 21   ILE D C   1 
ATOM   2550  O O   . ILE D  1 21  ? 151.533 104.027 140.463 1.00 27.53  ? 21   ILE D O   1 
ATOM   2551  C CB  . ILE D  1 21  ? 154.513 103.966 141.030 1.00 25.01  ? 21   ILE D CB  1 
ATOM   2552  C CG1 . ILE D  1 21  ? 155.823 104.556 141.581 1.00 20.89  ? 21   ILE D CG1 1 
ATOM   2553  C CG2 . ILE D  1 21  ? 154.822 102.784 140.108 1.00 26.13  ? 21   ILE D CG2 1 
ATOM   2554  C CD1 . ILE D  1 21  ? 156.335 103.845 142.834 1.00 14.04  ? 21   ILE D CD1 1 
ATOM   2555  N N   . THR D  1 22  ? 152.250 104.519 138.377 1.00 28.60  ? 22   THR D N   1 
ATOM   2556  C CA  . THR D  1 22  ? 151.100 103.862 137.752 1.00 31.62  ? 22   THR D CA  1 
ATOM   2557  C C   . THR D  1 22  ? 151.525 102.499 137.218 1.00 30.72  ? 22   THR D C   1 
ATOM   2558  O O   . THR D  1 22  ? 152.679 102.320 136.772 1.00 33.25  ? 22   THR D O   1 
ATOM   2559  C CB  . THR D  1 22  ? 150.420 104.720 136.640 1.00 33.15  ? 22   THR D CB  1 
ATOM   2560  O OG1 . THR D  1 22  ? 151.273 104.808 135.489 1.00 38.53  ? 22   THR D OG1 1 
ATOM   2561  C CG2 . THR D  1 22  ? 150.103 106.125 137.144 1.00 32.05  ? 22   THR D CG2 1 
ATOM   2562  N N   . CYS D  1 23  ? 150.607 101.537 137.280 1.00 29.65  ? 23   CYS D N   1 
ATOM   2563  C CA  . CYS D  1 23  ? 150.879 100.191 136.794 1.00 28.03  ? 23   CYS D CA  1 
ATOM   2564  C C   . CYS D  1 23  ? 149.668 99.729  136.009 1.00 26.96  ? 23   CYS D C   1 
ATOM   2565  O O   . CYS D  1 23  ? 148.559 100.214 136.241 1.00 27.72  ? 23   CYS D O   1 
ATOM   2566  C CB  . CYS D  1 23  ? 151.170 99.245  137.956 1.00 28.79  ? 23   CYS D CB  1 
ATOM   2567  S SG  . CYS D  1 23  ? 151.024 97.474  137.557 1.00 34.45  ? 23   CYS D SG  1 
ATOM   2568  N N   . ARG D  1 24  ? 149.860 98.787  135.094 1.00 27.62  ? 24   ARG D N   1 
ATOM   2569  C CA  . ARG D  1 24  ? 148.902 98.619  134.009 1.00 26.99  ? 24   ARG D CA  1 
ATOM   2570  C C   . ARG D  1 24  ? 148.882 97.197  133.476 1.00 24.69  ? 24   ARG D C   1 
ATOM   2571  O O   . ARG D  1 24  ? 149.927 96.709  133.032 1.00 26.89  ? 24   ARG D O   1 
ATOM   2572  C CB  . ARG D  1 24  ? 149.301 99.569  132.878 1.00 27.95  ? 24   ARG D CB  1 
ATOM   2573  C CG  . ARG D  1 24  ? 148.358 99.592  131.690 1.00 24.93  ? 24   ARG D CG  1 
ATOM   2574  C CD  . ARG D  1 24  ? 147.272 100.610 131.954 1.00 25.15  ? 24   ARG D CD  1 
ATOM   2575  N NE  . ARG D  1 24  ? 146.252 100.755 130.910 1.00 24.21  ? 24   ARG D NE  1 
ATOM   2576  C CZ  . ARG D  1 24  ? 146.414 100.496 129.615 1.00 25.98  ? 24   ARG D CZ  1 
ATOM   2577  N NH1 . ARG D  1 24  ? 147.577 100.071 129.131 1.00 27.08  ? 24   ARG D NH1 1 
ATOM   2578  N NH2 . ARG D  1 24  ? 145.395 100.674 128.786 1.00 29.61  ? 24   ARG D NH2 1 
ATOM   2579  N N   . ALA D  1 25  ? 147.717 96.539  133.471 1.00 26.91  ? 25   ALA D N   1 
ATOM   2580  C CA  . ALA D  1 25  ? 147.651 95.115  133.067 1.00 28.79  ? 25   ALA D CA  1 
ATOM   2581  C C   . ALA D  1 25  ? 147.371 94.848  131.573 1.00 30.68  ? 25   ALA D C   1 
ATOM   2582  O O   . ALA D  1 25  ? 146.752 95.666  130.888 1.00 32.77  ? 25   ALA D O   1 
ATOM   2583  C CB  . ALA D  1 25  ? 146.650 94.361  133.940 1.00 30.23  ? 25   ALA D CB  1 
ATOM   2584  N N   . SER D  1 26  ? 147.833 93.694  131.088 1.00 30.09  ? 26   SER D N   1 
ATOM   2585  C CA  . SER D  1 26  ? 147.530 93.229  129.736 1.00 31.16  ? 26   SER D CA  1 
ATOM   2586  C C   . SER D  1 26  ? 146.081 92.756  129.551 1.00 33.57  ? 26   SER D C   1 
ATOM   2587  O O   . SER D  1 26  ? 145.576 92.718  128.422 1.00 31.77  ? 26   SER D O   1 
ATOM   2588  C CB  . SER D  1 26  ? 148.493 92.117  129.331 1.00 31.13  ? 26   SER D CB  1 
ATOM   2589  O OG  . SER D  1 26  ? 148.372 91.003  130.205 1.00 23.54  ? 26   SER D OG  1 
ATOM   2590  N N   . GLN D  1 27  ? 145.415 92.400  130.653 1.00 35.24  ? 27   GLN D N   1 
ATOM   2591  C CA  . GLN D  1 27  ? 143.970 92.085  130.608 1.00 36.97  ? 27   GLN D CA  1 
ATOM   2592  C C   . GLN D  1 27  ? 143.225 92.614  131.848 1.00 35.60  ? 27   GLN D C   1 
ATOM   2593  O O   . GLN D  1 27  ? 143.825 93.297  132.679 1.00 35.60  ? 27   GLN D O   1 
ATOM   2594  C CB  . GLN D  1 27  ? 143.735 90.583  130.413 1.00 38.69  ? 27   GLN D CB  1 
ATOM   2595  C CG  . GLN D  1 27  ? 144.652 89.691  131.223 1.00 44.44  ? 27   GLN D CG  1 
ATOM   2596  C CD  . GLN D  1 27  ? 144.303 88.229  131.084 1.00 52.63  ? 27   GLN D CD  1 
ATOM   2597  O OE1 . GLN D  1 27  ? 144.932 87.496  130.318 1.00 51.39  ? 27   GLN D OE1 1 
ATOM   2598  N NE2 . GLN D  1 27  ? 143.285 87.790  131.816 1.00 52.93  ? 27   GLN D NE2 1 
ATOM   2599  N N   . SER D  1 28  ? 141.927 92.318  131.972 1.00 36.57  ? 28   SER D N   1 
ATOM   2600  C CA  . SER D  1 28  ? 141.161 92.744  133.158 1.00 36.98  ? 28   SER D CA  1 
ATOM   2601  C C   . SER D  1 28  ? 141.435 91.849  134.367 1.00 36.06  ? 28   SER D C   1 
ATOM   2602  O O   . SER D  1 28  ? 141.542 90.627  134.227 1.00 36.51  ? 28   SER D O   1 
ATOM   2603  C CB  . SER D  1 28  ? 139.657 92.790  132.874 1.00 39.24  ? 28   SER D CB  1 
ATOM   2604  O OG  . SER D  1 28  ? 138.931 93.186  134.031 1.00 42.46  ? 28   SER D OG  1 
ATOM   2605  N N   . ILE D  1 29  ? 141.525 92.468  135.554 1.00 34.20  ? 29   ILE D N   1 
ATOM   2606  C CA  . ILE D  1 29  ? 141.931 91.770  136.779 1.00 30.80  ? 29   ILE D CA  1 
ATOM   2607  C C   . ILE D  1 29  ? 141.219 92.260  138.046 1.00 31.62  ? 29   ILE D C   1 
ATOM   2608  O O   . ILE D  1 29  ? 141.661 91.964  139.188 1.00 30.37  ? 29   ILE D O   1 
ATOM   2609  C CB  . ILE D  1 29  ? 143.468 91.833  136.990 1.00 29.50  ? 29   ILE D CB  1 
ATOM   2610  C CG1 . ILE D  1 29  ? 143.952 93.291  137.117 1.00 23.69  ? 29   ILE D CG1 1 
ATOM   2611  C CG2 . ILE D  1 29  ? 144.252 91.090  135.844 1.00 31.41  ? 29   ILE D CG2 1 
ATOM   2612  C CD1 . ILE D  1 29  ? 145.284 93.430  137.837 1.00 20.93  ? 29   ILE D CD1 1 
ATOM   2613  N N   . SER D  1 30  ? 140.146 93.025  137.842 1.00 31.86  ? 30   SER D N   1 
ATOM   2614  C CA  . SER D  1 30  ? 139.212 93.348  138.916 1.00 32.23  ? 30   SER D CA  1 
ATOM   2615  C C   . SER D  1 30  ? 139.656 94.439  139.886 1.00 33.68  ? 30   SER D C   1 
ATOM   2616  O O   . SER D  1 30  ? 139.133 95.548  139.858 1.00 33.28  ? 30   SER D O   1 
ATOM   2617  C CB  . SER D  1 30  ? 138.885 92.086  139.710 1.00 30.42  ? 30   SER D CB  1 
ATOM   2618  O OG  . SER D  1 30  ? 137.847 92.469  140.666 1.00 29.72  ? 30   SER D OG  1 
ATOM   2619  N N   . SER D  1 31  ? 140.594 94.083  140.758 1.00 33.67  ? 31   SER D N   1 
ATOM   2620  C CA  . SER D  1 31  ? 141.086 94.907  141.863 1.00 34.32  ? 31   SER D CA  1 
ATOM   2621  C C   . SER D  1 31  ? 141.948 93.936  142.646 1.00 35.59  ? 31   SER D C   1 
ATOM   2622  O O   . SER D  1 31  ? 142.355 94.185  143.774 1.00 34.65  ? 31   SER D O   1 
ATOM   2623  C CB  . SER D  1 31  ? 139.947 95.457  142.728 1.00 33.55  ? 31   SER D CB  1 
ATOM   2624  O OG  . SER D  1 31  ? 139.003 94.441  143.058 1.00 31.55  ? 31   SER D OG  1 
ATOM   2625  N N   . TYR D  1 32  ? 142.210 92.812  141.982 1.00 35.84  ? 32   TYR D N   1 
ATOM   2626  C CA  . TYR D  1 32  ? 143.058 91.741  142.462 1.00 36.68  ? 32   TYR D CA  1 
ATOM   2627  C C   . TYR D  1 32  ? 144.515 92.155  142.143 1.00 35.56  ? 32   TYR D C   1 
ATOM   2628  O O   . TYR D  1 32  ? 145.250 91.410  141.485 1.00 36.49  ? 32   TYR D O   1 
ATOM   2629  C CB  . TYR D  1 32  ? 142.676 90.438  141.718 1.00 39.96  ? 32   TYR D CB  1 
ATOM   2630  C CG  . TYR D  1 32  ? 141.815 89.388  142.441 1.00 41.79  ? 32   TYR D CG  1 
ATOM   2631  C CD1 . TYR D  1 32  ? 140.475 89.163  142.086 1.00 46.19  ? 32   TYR D CD1 1 
ATOM   2632  C CD2 . TYR D  1 32  ? 142.373 88.562  143.418 1.00 44.07  ? 32   TYR D CD2 1 
ATOM   2633  C CE1 . TYR D  1 32  ? 139.707 88.169  142.728 1.00 44.44  ? 32   TYR D CE1 1 
ATOM   2634  C CE2 . TYR D  1 32  ? 141.621 87.571  144.060 1.00 42.33  ? 32   TYR D CE2 1 
ATOM   2635  C CZ  . TYR D  1 32  ? 140.293 87.378  143.713 1.00 47.96  ? 32   TYR D CZ  1 
ATOM   2636  O OH  . TYR D  1 32  ? 139.558 86.400  144.355 1.00 47.59  ? 32   TYR D OH  1 
ATOM   2637  N N   . LEU D  1 33  ? 144.914 93.350  142.594 1.00 30.09  ? 33   LEU D N   1 
ATOM   2638  C CA  . LEU D  1 33  ? 146.291 93.845  142.412 1.00 26.99  ? 33   LEU D CA  1 
ATOM   2639  C C   . LEU D  1 33  ? 146.944 94.405  143.686 1.00 26.13  ? 33   LEU D C   1 
ATOM   2640  O O   . LEU D  1 33  ? 146.489 95.426  144.262 1.00 22.53  ? 33   LEU D O   1 
ATOM   2641  C CB  . LEU D  1 33  ? 146.392 94.859  141.259 1.00 25.86  ? 33   LEU D CB  1 
ATOM   2642  C CG  . LEU D  1 33  ? 147.653 95.759  141.295 1.00 24.53  ? 33   LEU D CG  1 
ATOM   2643  C CD1 . LEU D  1 33  ? 148.448 95.716  139.942 1.00 8.13   ? 33   LEU D CD1 1 
ATOM   2644  C CD2 . LEU D  1 33  ? 147.274 97.203  141.725 1.00 23.46  ? 33   LEU D CD2 1 
ATOM   2645  N N   . ASN D  1 34  ? 148.029 93.741  144.092 1.00 24.29  ? 34   ASN D N   1 
ATOM   2646  C CA  . ASN D  1 34  ? 148.805 94.076  145.286 1.00 24.47  ? 34   ASN D CA  1 
ATOM   2647  C C   . ASN D  1 34  ? 150.003 94.995  144.983 1.00 24.01  ? 34   ASN D C   1 
ATOM   2648  O O   . ASN D  1 34  ? 150.556 94.953  143.870 1.00 23.70  ? 34   ASN D O   1 
ATOM   2649  C CB  . ASN D  1 34  ? 149.309 92.779  145.928 1.00 22.84  ? 34   ASN D CB  1 
ATOM   2650  C CG  . ASN D  1 34  ? 148.339 91.623  145.742 1.00 28.49  ? 34   ASN D CG  1 
ATOM   2651  O OD1 . ASN D  1 34  ? 147.420 91.433  146.538 1.00 32.38  ? 34   ASN D OD1 1 
ATOM   2652  N ND2 . ASN D  1 34  ? 148.542 90.843  144.681 1.00 22.85  ? 34   ASN D ND2 1 
ATOM   2653  N N   . TRP D  1 35  ? 150.393 95.823  145.962 1.00 21.63  ? 35   TRP D N   1 
ATOM   2654  C CA  . TRP D  1 35  ? 151.619 96.649  145.899 1.00 19.54  ? 35   TRP D CA  1 
ATOM   2655  C C   . TRP D  1 35  ? 152.624 96.201  146.947 1.00 19.80  ? 35   TRP D C   1 
ATOM   2656  O O   . TRP D  1 35  ? 152.255 95.913  148.092 1.00 21.84  ? 35   TRP D O   1 
ATOM   2657  C CB  . TRP D  1 35  ? 151.317 98.135  146.134 1.00 17.72  ? 35   TRP D CB  1 
ATOM   2658  C CG  . TRP D  1 35  ? 150.467 98.708  145.087 1.00 13.08  ? 35   TRP D CG  1 
ATOM   2659  C CD1 . TRP D  1 35  ? 149.119 98.923  145.155 1.00 10.92  ? 35   TRP D CD1 1 
ATOM   2660  C CD2 . TRP D  1 35  ? 150.882 99.116  143.779 1.00 16.82  ? 35   TRP D CD2 1 
ATOM   2661  N NE1 . TRP D  1 35  ? 148.664 99.452  143.969 1.00 14.37  ? 35   TRP D NE1 1 
ATOM   2662  C CE2 . TRP D  1 35  ? 149.724 99.580  143.098 1.00 16.82  ? 35   TRP D CE2 1 
ATOM   2663  C CE3 . TRP D  1 35  ? 152.118 99.139  143.110 1.00 7.34   ? 35   TRP D CE3 1 
ATOM   2664  C CZ2 . TRP D  1 35  ? 149.765 100.066 141.787 1.00 16.88  ? 35   TRP D CZ2 1 
ATOM   2665  C CZ3 . TRP D  1 35  ? 152.161 99.623  141.806 1.00 12.40  ? 35   TRP D CZ3 1 
ATOM   2666  C CH2 . TRP D  1 35  ? 150.988 100.080 141.160 1.00 18.23  ? 35   TRP D CH2 1 
ATOM   2667  N N   . TYR D  1 36  ? 153.894 96.160  146.562 1.00 19.38  ? 36   TYR D N   1 
ATOM   2668  C CA  . TYR D  1 36  ? 154.945 95.703  147.459 1.00 19.51  ? 36   TYR D CA  1 
ATOM   2669  C C   . TYR D  1 36  ? 156.051 96.746  147.607 1.00 20.96  ? 36   TYR D C   1 
ATOM   2670  O O   . TYR D  1 36  ? 156.365 97.474  146.664 1.00 22.75  ? 36   TYR D O   1 
ATOM   2671  C CB  . TYR D  1 36  ? 155.566 94.407  146.931 1.00 18.78  ? 36   TYR D CB  1 
ATOM   2672  C CG  . TYR D  1 36  ? 154.745 93.131  147.062 1.00 18.72  ? 36   TYR D CG  1 
ATOM   2673  C CD1 . TYR D  1 36  ? 154.062 92.607  145.963 1.00 14.27  ? 36   TYR D CD1 1 
ATOM   2674  C CD2 . TYR D  1 36  ? 154.700 92.414  148.261 1.00 20.64  ? 36   TYR D CD2 1 
ATOM   2675  C CE1 . TYR D  1 36  ? 153.329 91.421  146.054 1.00 13.65  ? 36   TYR D CE1 1 
ATOM   2676  C CE2 . TYR D  1 36  ? 153.975 91.218  148.363 1.00 22.08  ? 36   TYR D CE2 1 
ATOM   2677  C CZ  . TYR D  1 36  ? 153.288 90.730  147.255 1.00 20.01  ? 36   TYR D CZ  1 
ATOM   2678  O OH  . TYR D  1 36  ? 152.560 89.557  147.343 1.00 19.40  ? 36   TYR D OH  1 
ATOM   2679  N N   . GLN D  1 37  ? 156.639 96.803  148.798 1.00 21.06  ? 37   GLN D N   1 
ATOM   2680  C CA  . GLN D  1 37  ? 157.823 97.613  149.049 1.00 19.91  ? 37   GLN D CA  1 
ATOM   2681  C C   . GLN D  1 37  ? 158.973 96.667  149.317 1.00 21.88  ? 37   GLN D C   1 
ATOM   2682  O O   . GLN D  1 37  ? 158.821 95.655  150.005 1.00 22.94  ? 37   GLN D O   1 
ATOM   2683  C CB  . GLN D  1 37  ? 157.596 98.536  150.253 1.00 21.21  ? 37   GLN D CB  1 
ATOM   2684  C CG  . GLN D  1 37  ? 158.785 99.406  150.667 1.00 11.85  ? 37   GLN D CG  1 
ATOM   2685  C CD  . GLN D  1 37  ? 158.503 100.193 151.941 1.00 16.19  ? 37   GLN D CD  1 
ATOM   2686  O OE1 . GLN D  1 37  ? 158.516 99.642  153.042 1.00 14.32  ? 37   GLN D OE1 1 
ATOM   2687  N NE2 . GLN D  1 37  ? 158.240 101.496 151.796 1.00 12.94  ? 37   GLN D NE2 1 
ATOM   2688  N N   . GLN D  1 38  ? 160.125 97.008  148.764 1.00 22.05  ? 38   GLN D N   1 
ATOM   2689  C CA  . GLN D  1 38  ? 161.277 96.168  148.906 1.00 19.76  ? 38   GLN D CA  1 
ATOM   2690  C C   . GLN D  1 38  ? 162.457 97.067  149.190 1.00 21.75  ? 38   GLN D C   1 
ATOM   2691  O O   . GLN D  1 38  ? 162.994 97.730  148.292 1.00 21.10  ? 38   GLN D O   1 
ATOM   2692  C CB  . GLN D  1 38  ? 161.468 95.340  147.639 1.00 17.55  ? 38   GLN D CB  1 
ATOM   2693  C CG  . GLN D  1 38  ? 162.644 94.393  147.695 1.00 14.85  ? 38   GLN D CG  1 
ATOM   2694  C CD  . GLN D  1 38  ? 162.596 93.396  146.568 1.00 17.12  ? 38   GLN D CD  1 
ATOM   2695  O OE1 . GLN D  1 38  ? 163.561 93.240  145.824 1.00 18.06  ? 38   GLN D OE1 1 
ATOM   2696  N NE2 . GLN D  1 38  ? 161.464 92.723  146.417 1.00 13.84  ? 38   GLN D NE2 1 
ATOM   2697  N N   . LYS D  1 39  ? 162.822 97.111  150.470 1.00 22.42  ? 39   LYS D N   1 
ATOM   2698  C CA  . LYS D  1 39  ? 163.982 97.865  150.911 1.00 23.95  ? 39   LYS D CA  1 
ATOM   2699  C C   . LYS D  1 39  ? 165.200 97.061  150.463 1.00 25.66  ? 39   LYS D C   1 
ATOM   2700  O O   . LYS D  1 39  ? 165.200 95.836  150.588 1.00 27.26  ? 39   LYS D O   1 
ATOM   2701  C CB  . LYS D  1 39  ? 163.945 98.064  152.431 1.00 23.80  ? 39   LYS D CB  1 
ATOM   2702  C CG  . LYS D  1 39  ? 162.793 98.954  152.909 1.00 21.47  ? 39   LYS D CG  1 
ATOM   2703  C CD  . LYS D  1 39  ? 163.055 99.537  154.295 1.00 25.25  ? 39   LYS D CD  1 
ATOM   2704  C CE  . LYS D  1 39  ? 163.840 100.849 154.211 1.00 28.24  ? 39   LYS D CE  1 
ATOM   2705  N NZ  . LYS D  1 39  ? 164.264 101.298 155.591 1.00 25.35  ? 39   LYS D NZ  1 
ATOM   2706  N N   . PRO D  1 40  ? 166.235 97.740  149.917 1.00 25.67  ? 40   PRO D N   1 
ATOM   2707  C CA  . PRO D  1 40  ? 167.311 97.063  149.176 1.00 24.63  ? 40   PRO D CA  1 
ATOM   2708  C C   . PRO D  1 40  ? 167.921 95.961  150.011 1.00 24.24  ? 40   PRO D C   1 
ATOM   2709  O O   . PRO D  1 40  ? 168.143 96.156  151.218 1.00 25.35  ? 40   PRO D O   1 
ATOM   2710  C CB  . PRO D  1 40  ? 168.349 98.179  148.948 1.00 24.77  ? 40   PRO D CB  1 
ATOM   2711  C CG  . PRO D  1 40  ? 167.964 99.283  149.901 1.00 24.98  ? 40   PRO D CG  1 
ATOM   2712  C CD  . PRO D  1 40  ? 166.465 99.194  150.005 1.00 25.81  ? 40   PRO D CD  1 
ATOM   2713  N N   . GLY D  1 41  ? 168.190 94.812  149.398 1.00 26.19  ? 41   GLY D N   1 
ATOM   2714  C CA  . GLY D  1 41  ? 168.718 93.677  150.159 1.00 27.21  ? 41   GLY D CA  1 
ATOM   2715  C C   . GLY D  1 41  ? 167.652 92.909  150.928 1.00 27.30  ? 41   GLY D C   1 
ATOM   2716  O O   . GLY D  1 41  ? 167.748 91.686  151.065 1.00 30.60  ? 41   GLY D O   1 
ATOM   2717  N N   . LYS D  1 42  ? 166.645 93.622  151.438 1.00 26.12  ? 42   LYS D N   1 
ATOM   2718  C CA  . LYS D  1 42  ? 165.460 92.998  152.031 1.00 25.83  ? 42   LYS D CA  1 
ATOM   2719  C C   . LYS D  1 42  ? 164.551 92.482  150.912 1.00 27.24  ? 42   LYS D C   1 
ATOM   2720  O O   . LYS D  1 42  ? 165.002 92.292  149.779 1.00 26.71  ? 42   LYS D O   1 
ATOM   2721  C CB  . LYS D  1 42  ? 164.723 93.978  152.966 1.00 24.62  ? 42   LYS D CB  1 
ATOM   2722  C CG  . LYS D  1 42  ? 165.380 94.135  154.360 1.00 28.29  ? 42   LYS D CG  1 
ATOM   2723  C CD  . LYS D  1 42  ? 165.027 92.921  155.278 1.00 30.99  ? 42   LYS D CD  1 
ATOM   2724  C CE  . LYS D  1 42  ? 165.629 93.137  156.674 1.00 32.86  ? 42   LYS D CE  1 
ATOM   2725  N NZ  . LYS D  1 42  ? 165.181 92.104  157.667 1.00 19.38  ? 42   LYS D NZ  1 
ATOM   2726  N N   . ALA D  1 43  ? 163.278 92.259  151.215 1.00 28.57  ? 43   ALA D N   1 
ATOM   2727  C CA  . ALA D  1 43  ? 162.404 91.605  150.253 1.00 29.13  ? 43   ALA D CA  1 
ATOM   2728  C C   . ALA D  1 43  ? 161.056 92.318  150.174 1.00 29.66  ? 43   ALA D C   1 
ATOM   2729  O O   . ALA D  1 43  ? 160.833 93.300  150.891 1.00 30.72  ? 43   ALA D O   1 
ATOM   2730  C CB  . ALA D  1 43  ? 162.240 90.158  150.653 1.00 30.93  ? 43   ALA D CB  1 
ATOM   2731  N N   . PRO D  1 44  ? 160.154 91.830  149.300 1.00 28.23  ? 44   PRO D N   1 
ATOM   2732  C CA  . PRO D  1 44  ? 158.861 92.455  149.199 1.00 26.09  ? 44   PRO D CA  1 
ATOM   2733  C C   . PRO D  1 44  ? 158.034 92.165  150.430 1.00 26.36  ? 44   PRO D C   1 
ATOM   2734  O O   . PRO D  1 44  ? 158.231 91.155  151.127 1.00 24.92  ? 44   PRO D O   1 
ATOM   2735  C CB  . PRO D  1 44  ? 158.220 91.775  147.978 1.00 24.78  ? 44   PRO D CB  1 
ATOM   2736  C CG  . PRO D  1 44  ? 159.301 91.045  147.299 1.00 23.51  ? 44   PRO D CG  1 
ATOM   2737  C CD  . PRO D  1 44  ? 160.260 90.682  148.382 1.00 27.89  ? 44   PRO D CD  1 
ATOM   2738  N N   . LYS D  1 45  ? 157.088 93.063  150.647 1.00 27.56  ? 45   LYS D N   1 
ATOM   2739  C CA  . LYS D  1 45  ? 156.259 93.108  151.817 1.00 27.59  ? 45   LYS D CA  1 
ATOM   2740  C C   . LYS D  1 45  ? 155.021 93.845  151.349 1.00 27.11  ? 45   LYS D C   1 
ATOM   2741  O O   . LYS D  1 45  ? 155.109 94.804  150.562 1.00 25.68  ? 45   LYS D O   1 
ATOM   2742  C CB  . LYS D  1 45  ? 156.985 93.891  152.905 1.00 29.65  ? 45   LYS D CB  1 
ATOM   2743  C CG  . LYS D  1 45  ? 156.375 93.791  154.290 1.00 34.27  ? 45   LYS D CG  1 
ATOM   2744  C CD  . LYS D  1 45  ? 157.468 93.747  155.362 1.00 37.51  ? 45   LYS D CD  1 
ATOM   2745  C CE  . LYS D  1 45  ? 158.689 94.679  154.945 1.00 36.19  ? 45   LYS D CE  1 
ATOM   2746  N NZ  . LYS D  1 45  ? 159.849 94.471  155.861 1.00 43.20  ? 45   LYS D NZ  1 
ATOM   2747  N N   . LEU D  1 46  ? 153.862 93.380  151.855 1.00 26.85  ? 46   LEU D N   1 
ATOM   2748  C CA  . LEU D  1 46  ? 152.603 93.759  151.217 1.00 24.74  ? 46   LEU D CA  1 
ATOM   2749  C C   . LEU D  1 46  ? 152.207 95.104  151.771 1.00 24.84  ? 46   LEU D C   1 
ATOM   2750  O O   . LEU D  1 46  ? 152.190 95.286  153.009 1.00 24.19  ? 46   LEU D O   1 
ATOM   2751  C CB  . LEU D  1 46  ? 151.545 92.706  151.560 1.00 25.04  ? 46   LEU D CB  1 
ATOM   2752  C CG  . LEU D  1 46  ? 150.484 92.230  150.559 1.00 25.19  ? 46   LEU D CG  1 
ATOM   2753  C CD1 . LEU D  1 46  ? 149.563 93.338  150.104 1.00 29.13  ? 46   LEU D CD1 1 
ATOM   2754  C CD2 . LEU D  1 46  ? 151.069 91.503  149.377 1.00 21.69  ? 46   LEU D CD2 1 
ATOM   2755  N N   . LEU D  1 47  ? 151.918 96.051  150.862 1.00 25.14  ? 47   LEU D N   1 
ATOM   2756  C CA  . LEU D  1 47  ? 151.571 97.396  151.334 1.00 22.84  ? 47   LEU D CA  1 
ATOM   2757  C C   . LEU D  1 47  ? 150.089 97.542  151.097 1.00 24.01  ? 47   LEU D C   1 
ATOM   2758  O O   . LEU D  1 47  ? 149.339 98.013  151.995 1.00 23.61  ? 47   LEU D O   1 
ATOM   2759  C CB  . LEU D  1 47  ? 152.333 98.460  150.528 1.00 20.04  ? 47   LEU D CB  1 
ATOM   2760  C CG  . LEU D  1 47  ? 153.837 98.718  150.735 1.00 18.65  ? 47   LEU D CG  1 
ATOM   2761  C CD1 . LEU D  1 47  ? 154.298 99.710  149.680 1.00 20.25  ? 47   LEU D CD1 1 
ATOM   2762  C CD2 . LEU D  1 47  ? 154.158 99.244  152.132 1.00 8.88   ? 47   LEU D CD2 1 
ATOM   2763  N N   . ILE D  1 48  ? 149.672 97.118  149.891 1.00 25.13  ? 48   ILE D N   1 
ATOM   2764  C CA  . ILE D  1 48  ? 148.264 97.159  149.519 1.00 23.89  ? 48   ILE D CA  1 
ATOM   2765  C C   . ILE D  1 48  ? 147.854 95.840  148.881 1.00 22.23  ? 48   ILE D C   1 
ATOM   2766  O O   . ILE D  1 48  ? 148.498 95.403  147.916 1.00 14.63  ? 48   ILE D O   1 
ATOM   2767  C CB  . ILE D  1 48  ? 147.990 98.290  148.491 1.00 24.26  ? 48   ILE D CB  1 
ATOM   2768  C CG1 . ILE D  1 48  ? 148.080 99.674  149.142 1.00 27.31  ? 48   ILE D CG1 1 
ATOM   2769  C CG2 . ILE D  1 48  ? 146.637 98.117  147.814 1.00 25.28  ? 48   ILE D CG2 1 
ATOM   2770  C CD1 . ILE D  1 48  ? 149.541 100.253 149.208 1.00 28.93  ? 48   ILE D CD1 1 
ATOM   2771  N N   . TYR D  1 49  ? 146.801 95.203  149.400 1.00 26.22  ? 49   TYR D N   1 
ATOM   2772  C CA  . TYR D  1 49  ? 146.123 94.172  148.592 1.00 31.30  ? 49   TYR D CA  1 
ATOM   2773  C C   . TYR D  1 49  ? 144.794 94.641  148.018 1.00 31.52  ? 49   TYR D C   1 
ATOM   2774  O O   . TYR D  1 49  ? 144.227 95.654  148.451 1.00 31.53  ? 49   TYR D O   1 
ATOM   2775  C CB  . TYR D  1 49  ? 145.961 92.815  149.304 1.00 34.52  ? 49   TYR D CB  1 
ATOM   2776  C CG  . TYR D  1 49  ? 145.124 92.820  150.563 1.00 39.24  ? 49   TYR D CG  1 
ATOM   2777  C CD1 . TYR D  1 49  ? 143.803 93.277  150.567 1.00 37.97  ? 49   TYR D CD1 1 
ATOM   2778  C CD2 . TYR D  1 49  ? 145.649 92.320  151.750 1.00 42.76  ? 49   TYR D CD2 1 
ATOM   2779  C CE1 . TYR D  1 49  ? 143.050 93.270  151.730 1.00 39.29  ? 49   TYR D CE1 1 
ATOM   2780  C CE2 . TYR D  1 49  ? 144.900 92.303  152.915 1.00 45.95  ? 49   TYR D CE2 1 
ATOM   2781  C CZ  . TYR D  1 49  ? 143.603 92.780  152.900 1.00 46.18  ? 49   TYR D CZ  1 
ATOM   2782  O OH  . TYR D  1 49  ? 142.859 92.763  154.057 1.00 48.87  ? 49   TYR D OH  1 
ATOM   2783  N N   . ALA D  1 50  ? 144.312 93.872  147.042 1.00 34.09  ? 50   ALA D N   1 
ATOM   2784  C CA  . ALA D  1 50  ? 143.056 94.148  146.362 1.00 34.49  ? 50   ALA D CA  1 
ATOM   2785  C C   . ALA D  1 50  ? 142.960 95.624  145.984 1.00 34.32  ? 50   ALA D C   1 
ATOM   2786  O O   . ALA D  1 50  ? 142.072 96.345  146.453 1.00 34.93  ? 50   ALA D O   1 
ATOM   2787  C CB  . ALA D  1 50  ? 141.869 93.717  147.212 1.00 32.45  ? 50   ALA D CB  1 
ATOM   2788  N N   . ALA D  1 51  ? 143.903 96.058  145.146 1.00 34.14  ? 51   ALA D N   1 
ATOM   2789  C CA  . ALA D  1 51  ? 143.955 97.410  144.558 1.00 33.86  ? 51   ALA D CA  1 
ATOM   2790  C C   . ALA D  1 51  ? 144.090 98.593  145.516 1.00 33.17  ? 51   ALA D C   1 
ATOM   2791  O O   . ALA D  1 51  ? 144.962 99.441  145.321 1.00 34.31  ? 51   ALA D O   1 
ATOM   2792  C CB  . ALA D  1 51  ? 142.780 97.637  143.595 1.00 31.55  ? 51   ALA D CB  1 
ATOM   2793  N N   . SER D  1 52  ? 143.234 98.661  146.533 1.00 32.57  ? 52   SER D N   1 
ATOM   2794  C CA  . SER D  1 52  ? 143.066 99.920  147.246 1.00 33.45  ? 52   SER D CA  1 
ATOM   2795  C C   . SER D  1 52  ? 142.895 99.737  148.743 1.00 33.26  ? 52   SER D C   1 
ATOM   2796  O O   . SER D  1 52  ? 142.833 100.720 149.492 1.00 34.17  ? 52   SER D O   1 
ATOM   2797  C CB  . SER D  1 52  ? 141.843 100.663 146.697 1.00 34.85  ? 52   SER D CB  1 
ATOM   2798  O OG  . SER D  1 52  ? 140.665 100.253 147.396 1.00 34.22  ? 52   SER D OG  1 
ATOM   2799  N N   . SER D  1 53  ? 142.787 98.481  149.171 1.00 33.14  ? 53   SER D N   1 
ATOM   2800  C CA  . SER D  1 53  ? 142.721 98.161  150.589 1.00 34.11  ? 53   SER D CA  1 
ATOM   2801  C C   . SER D  1 53  ? 144.131 98.128  151.167 1.00 33.28  ? 53   SER D C   1 
ATOM   2802  O O   . SER D  1 53  ? 144.971 97.301  150.785 1.00 32.66  ? 53   SER D O   1 
ATOM   2803  C CB  . SER D  1 53  ? 141.993 96.834  150.829 1.00 34.31  ? 53   SER D CB  1 
ATOM   2804  O OG  . SER D  1 53  ? 141.891 96.558  152.222 1.00 38.72  ? 53   SER D OG  1 
ATOM   2805  N N   . LEU D  1 54  ? 144.372 99.069  152.074 1.00 32.02  ? 54   LEU D N   1 
ATOM   2806  C CA  . LEU D  1 54  ? 145.633 99.241  152.776 1.00 31.01  ? 54   LEU D CA  1 
ATOM   2807  C C   . LEU D  1 54  ? 145.843 98.110  153.768 1.00 32.55  ? 54   LEU D C   1 
ATOM   2808  O O   . LEU D  1 54  ? 144.866 97.525  154.270 1.00 32.60  ? 54   LEU D O   1 
ATOM   2809  C CB  . LEU D  1 54  ? 145.575 100.575 153.537 1.00 29.07  ? 54   LEU D CB  1 
ATOM   2810  C CG  . LEU D  1 54  ? 146.819 101.284 154.086 1.00 25.90  ? 54   LEU D CG  1 
ATOM   2811  C CD1 . LEU D  1 54  ? 147.083 100.936 155.549 1.00 22.43  ? 54   LEU D CD1 1 
ATOM   2812  C CD2 . LEU D  1 54  ? 148.042 101.035 153.197 1.00 15.91  ? 54   LEU D CD2 1 
ATOM   2813  N N   . GLN D  1 55  ? 147.108 97.811  154.063 1.00 34.11  ? 55   GLN D N   1 
ATOM   2814  C CA  . GLN D  1 55  ? 147.451 96.862  155.111 1.00 34.82  ? 55   GLN D CA  1 
ATOM   2815  C C   . GLN D  1 55  ? 147.388 97.475  156.494 1.00 35.59  ? 55   GLN D C   1 
ATOM   2816  O O   . GLN D  1 55  ? 146.424 98.156  156.874 1.00 34.45  ? 55   GLN D O   1 
ATOM   2817  C CB  . GLN D  1 55  ? 148.863 96.307  154.918 1.00 36.01  ? 55   GLN D CB  1 
ATOM   2818  C CG  . GLN D  1 55  ? 148.977 95.244  153.882 1.00 37.75  ? 55   GLN D CG  1 
ATOM   2819  C CD  . GLN D  1 55  ? 147.866 94.256  154.015 1.00 42.09  ? 55   GLN D CD  1 
ATOM   2820  O OE1 . GLN D  1 55  ? 146.847 94.375  153.345 1.00 39.55  ? 55   GLN D OE1 1 
ATOM   2821  N NE2 . GLN D  1 55  ? 148.029 93.291  154.913 1.00 44.71  ? 55   GLN D NE2 1 
ATOM   2822  N N   . SER D  1 56  ? 148.465 97.234  157.234 1.00 35.57  ? 56   SER D N   1 
ATOM   2823  C CA  . SER D  1 56  ? 148.487 97.386  158.670 1.00 38.27  ? 56   SER D CA  1 
ATOM   2824  C C   . SER D  1 56  ? 149.946 97.393  159.127 1.00 38.43  ? 56   SER D C   1 
ATOM   2825  O O   . SER D  1 56  ? 150.678 96.423  158.914 1.00 39.26  ? 56   SER D O   1 
ATOM   2826  C CB  . SER D  1 56  ? 147.714 96.227  159.310 1.00 39.18  ? 56   SER D CB  1 
ATOM   2827  O OG  . SER D  1 56  ? 147.664 96.367  160.721 1.00 43.77  ? 56   SER D OG  1 
ATOM   2828  N N   . GLY D  1 57  ? 150.354 98.500  159.757 1.00 40.25  ? 57   GLY D N   1 
ATOM   2829  C CA  . GLY D  1 57  ? 151.784 98.799  159.963 1.00 41.57  ? 57   GLY D CA  1 
ATOM   2830  C C   . GLY D  1 57  ? 152.290 99.799  158.931 1.00 42.66  ? 57   GLY D C   1 
ATOM   2831  O O   . GLY D  1 57  ? 153.203 100.585 159.198 1.00 45.94  ? 57   GLY D O   1 
ATOM   2832  N N   . VAL D  1 58  ? 151.679 99.753  157.752 1.00 40.06  ? 58   VAL D N   1 
ATOM   2833  C CA  . VAL D  1 58  ? 151.988 100.634 156.633 1.00 38.43  ? 58   VAL D CA  1 
ATOM   2834  C C   . VAL D  1 58  ? 151.099 101.882 156.723 1.00 38.26  ? 58   VAL D C   1 
ATOM   2835  O O   . VAL D  1 58  ? 149.864 101.770 156.675 1.00 39.39  ? 58   VAL D O   1 
ATOM   2836  C CB  . VAL D  1 58  ? 151.835 99.860  155.278 1.00 39.60  ? 58   VAL D CB  1 
ATOM   2837  C CG1 . VAL D  1 58  ? 150.840 98.694  155.449 1.00 38.60  ? 58   VAL D CG1 1 
ATOM   2838  C CG2 . VAL D  1 58  ? 151.444 100.782 154.086 1.00 37.45  ? 58   VAL D CG2 1 
ATOM   2839  N N   . PRO D  1 59  ? 151.717 103.073 156.879 1.00 38.11  ? 59   PRO D N   1 
ATOM   2840  C CA  . PRO D  1 59  ? 150.967 104.291 157.210 1.00 39.18  ? 59   PRO D CA  1 
ATOM   2841  C C   . PRO D  1 59  ? 149.985 104.775 156.142 1.00 38.92  ? 59   PRO D C   1 
ATOM   2842  O O   . PRO D  1 59  ? 150.075 104.388 154.973 1.00 41.77  ? 59   PRO D O   1 
ATOM   2843  C CB  . PRO D  1 59  ? 152.067 105.334 157.432 1.00 36.56  ? 59   PRO D CB  1 
ATOM   2844  C CG  . PRO D  1 59  ? 153.193 104.861 156.605 1.00 36.43  ? 59   PRO D CG  1 
ATOM   2845  C CD  . PRO D  1 59  ? 153.166 103.349 156.753 1.00 37.81  ? 59   PRO D CD  1 
ATOM   2846  N N   . SER D  1 60  ? 149.081 105.649 156.578 1.00 37.59  ? 60   SER D N   1 
ATOM   2847  C CA  . SER D  1 60  ? 147.937 106.121 155.807 1.00 34.98  ? 60   SER D CA  1 
ATOM   2848  C C   . SER D  1 60  ? 148.272 107.109 154.685 1.00 32.95  ? 60   SER D C   1 
ATOM   2849  O O   . SER D  1 60  ? 147.496 108.041 154.426 1.00 29.71  ? 60   SER D O   1 
ATOM   2850  C CB  . SER D  1 60  ? 146.947 106.791 156.776 1.00 35.36  ? 60   SER D CB  1 
ATOM   2851  O OG  . SER D  1 60  ? 147.545 107.918 157.419 1.00 37.79  ? 60   SER D OG  1 
ATOM   2852  N N   . ARG D  1 61  ? 149.407 106.928 154.013 1.00 31.52  ? 61   ARG D N   1 
ATOM   2853  C CA  . ARG D  1 61  ? 149.789 107.835 152.925 1.00 33.75  ? 61   ARG D CA  1 
ATOM   2854  C C   . ARG D  1 61  ? 149.968 107.099 151.602 1.00 34.30  ? 61   ARG D C   1 
ATOM   2855  O O   . ARG D  1 61  ? 150.236 107.707 150.561 1.00 31.62  ? 61   ARG D O   1 
ATOM   2856  C CB  . ARG D  1 61  ? 151.043 108.634 153.298 1.00 32.55  ? 61   ARG D CB  1 
ATOM   2857  C CG  . ARG D  1 61  ? 152.348 107.885 153.207 1.00 31.46  ? 61   ARG D CG  1 
ATOM   2858  C CD  . ARG D  1 61  ? 153.300 108.407 154.245 1.00 28.92  ? 61   ARG D CD  1 
ATOM   2859  N NE  . ARG D  1 61  ? 154.588 107.723 154.228 1.00 24.41  ? 61   ARG D NE  1 
ATOM   2860  C CZ  . ARG D  1 61  ? 155.506 107.849 155.181 1.00 33.06  ? 61   ARG D CZ  1 
ATOM   2861  N NH1 . ARG D  1 61  ? 155.278 108.629 156.231 1.00 30.59  ? 61   ARG D NH1 1 
ATOM   2862  N NH2 . ARG D  1 61  ? 156.651 107.188 155.095 1.00 30.77  ? 61   ARG D NH2 1 
ATOM   2863  N N   . PHE D  1 62  ? 149.792 105.787 151.659 1.00 35.43  ? 62   PHE D N   1 
ATOM   2864  C CA  . PHE D  1 62  ? 150.013 104.916 150.527 1.00 36.37  ? 62   PHE D CA  1 
ATOM   2865  C C   . PHE D  1 62  ? 148.682 104.542 149.927 1.00 36.66  ? 62   PHE D C   1 
ATOM   2866  O O   . PHE D  1 62  ? 148.037 103.591 150.381 1.00 37.64  ? 62   PHE D O   1 
ATOM   2867  C CB  . PHE D  1 62  ? 150.696 103.642 150.999 1.00 35.63  ? 62   PHE D CB  1 
ATOM   2868  C CG  . PHE D  1 62  ? 152.064 103.858 151.528 1.00 35.47  ? 62   PHE D CG  1 
ATOM   2869  C CD1 . PHE D  1 62  ? 152.274 104.617 152.671 1.00 40.42  ? 62   PHE D CD1 1 
ATOM   2870  C CD2 . PHE D  1 62  ? 153.154 103.288 150.893 1.00 32.52  ? 62   PHE D CD2 1 
ATOM   2871  C CE1 . PHE D  1 62  ? 153.550 104.818 153.164 1.00 37.63  ? 62   PHE D CE1 1 
ATOM   2872  C CE2 . PHE D  1 62  ? 154.437 103.479 151.382 1.00 36.94  ? 62   PHE D CE2 1 
ATOM   2873  C CZ  . PHE D  1 62  ? 154.633 104.249 152.524 1.00 34.32  ? 62   PHE D CZ  1 
ATOM   2874  N N   . SER D  1 63  ? 148.266 105.269 148.898 1.00 36.05  ? 63   SER D N   1 
ATOM   2875  C CA  . SER D  1 63  ? 146.986 104.981 148.259 1.00 33.59  ? 63   SER D CA  1 
ATOM   2876  C C   . SER D  1 63  ? 147.119 104.113 147.004 1.00 33.99  ? 63   SER D C   1 
ATOM   2877  O O   . SER D  1 63  ? 148.007 104.328 146.169 1.00 31.06  ? 63   SER D O   1 
ATOM   2878  C CB  . SER D  1 63  ? 146.221 106.283 147.948 1.00 32.63  ? 63   SER D CB  1 
ATOM   2879  O OG  . SER D  1 63  ? 145.243 106.047 146.909 1.00 28.78  ? 63   SER D OG  1 
ATOM   2880  N N   . GLY D  1 64  ? 146.230 103.125 146.905 1.00 32.22  ? 64   GLY D N   1 
ATOM   2881  C CA  . GLY D  1 64  ? 146.078 102.372 145.679 1.00 33.49  ? 64   GLY D CA  1 
ATOM   2882  C C   . GLY D  1 64  ? 144.851 102.932 144.995 1.00 35.93  ? 64   GLY D C   1 
ATOM   2883  O O   . GLY D  1 64  ? 143.942 103.442 145.658 1.00 34.63  ? 64   GLY D O   1 
ATOM   2884  N N   . SER D  1 65  ? 144.817 102.859 143.672 1.00 37.37  ? 65   SER D N   1 
ATOM   2885  C CA  . SER D  1 65  ? 143.598 103.212 142.960 1.00 39.19  ? 65   SER D CA  1 
ATOM   2886  C C   . SER D  1 65  ? 143.391 102.346 141.734 1.00 39.89  ? 65   SER D C   1 
ATOM   2887  O O   . SER D  1 65  ? 144.347 101.844 141.140 1.00 41.02  ? 65   SER D O   1 
ATOM   2888  C CB  . SER D  1 65  ? 143.576 104.700 142.579 1.00 39.46  ? 65   SER D CB  1 
ATOM   2889  O OG  . SER D  1 65  ? 144.696 105.043 141.785 1.00 45.02  ? 65   SER D OG  1 
ATOM   2890  N N   . GLY D  1 66  ? 142.124 102.169 141.378 1.00 41.35  ? 66   GLY D N   1 
ATOM   2891  C CA  . GLY D  1 66  ? 141.757 101.566 140.103 1.00 40.80  ? 66   GLY D CA  1 
ATOM   2892  C C   . GLY D  1 66  ? 141.138 100.187 140.175 1.00 39.95  ? 66   GLY D C   1 
ATOM   2893  O O   . GLY D  1 66  ? 140.975 99.611  141.254 1.00 40.20  ? 66   GLY D O   1 
ATOM   2894  N N   . SER D  1 67  ? 140.804 99.669  138.995 1.00 39.31  ? 67   SER D N   1 
ATOM   2895  C CA  . SER D  1 67  ? 140.165 98.367  138.811 1.00 39.25  ? 67   SER D CA  1 
ATOM   2896  C C   . SER D  1 67  ? 140.154 98.065  137.310 1.00 39.40  ? 67   SER D C   1 
ATOM   2897  O O   . SER D  1 67  ? 139.664 98.892  136.522 1.00 42.45  ? 67   SER D O   1 
ATOM   2898  C CB  . SER D  1 67  ? 138.736 98.395  139.380 1.00 39.48  ? 67   SER D CB  1 
ATOM   2899  O OG  . SER D  1 67  ? 137.863 97.468  138.620 1.00 40.76  ? 67   SER D OG  1 
ATOM   2900  N N   . GLY D  1 68  ? 140.702 96.891  136.915 1.00 37.77  ? 68   GLY D N   1 
ATOM   2901  C CA  . GLY D  1 68  ? 140.695 96.477  135.477 1.00 37.11  ? 68   GLY D CA  1 
ATOM   2902  C C   . GLY D  1 68  ? 142.098 96.353  134.863 1.00 35.95  ? 68   GLY D C   1 
ATOM   2903  O O   . GLY D  1 68  ? 142.860 95.440  135.192 1.00 34.67  ? 68   GLY D O   1 
ATOM   2904  N N   . THR D  1 69  ? 142.392 97.266  133.932 1.00 34.61  ? 69   THR D N   1 
ATOM   2905  C CA  . THR D  1 69  ? 143.714 97.471  133.354 1.00 34.32  ? 69   THR D CA  1 
ATOM   2906  C C   . THR D  1 69  ? 144.561 98.443  134.190 1.00 33.38  ? 69   THR D C   1 
ATOM   2907  O O   . THR D  1 69  ? 145.790 98.272  134.320 1.00 32.07  ? 69   THR D O   1 
ATOM   2908  C CB  . THR D  1 69  ? 143.517 98.129  131.951 1.00 33.59  ? 69   THR D CB  1 
ATOM   2909  O OG1 . THR D  1 69  ? 142.322 97.576  131.350 1.00 35.91  ? 69   THR D OG1 1 
ATOM   2910  C CG2 . THR D  1 69  ? 144.736 97.877  131.017 1.00 35.72  ? 69   THR D CG2 1 
ATOM   2911  N N   . ASP D  1 70  ? 143.890 99.442  134.773 1.00 31.39  ? 70   ASP D N   1 
ATOM   2912  C CA  . ASP D  1 70  ? 144.579 100.678 135.121 1.00 32.26  ? 70   ASP D CA  1 
ATOM   2913  C C   . ASP D  1 70  ? 144.630 101.077 136.601 1.00 31.68  ? 70   ASP D C   1 
ATOM   2914  O O   . ASP D  1 70  ? 143.657 101.638 137.167 1.00 33.29  ? 70   ASP D O   1 
ATOM   2915  C CB  . ASP D  1 70  ? 144.044 101.820 134.266 1.00 31.87  ? 70   ASP D CB  1 
ATOM   2916  C CG  . ASP D  1 70  ? 145.145 102.683 133.733 1.00 33.54  ? 70   ASP D CG  1 
ATOM   2917  O OD1 . ASP D  1 70  ? 145.730 102.329 132.688 1.00 28.90  ? 70   ASP D OD1 1 
ATOM   2918  O OD2 . ASP D  1 70  ? 145.434 103.723 134.354 1.00 41.91  ? 70   ASP D OD2 1 
ATOM   2919  N N   . PHE D  1 71  ? 145.813 100.813 137.181 1.00 28.21  ? 71   PHE D N   1 
ATOM   2920  C CA  . PHE D  1 71  ? 146.136 101.017 138.598 1.00 28.35  ? 71   PHE D CA  1 
ATOM   2921  C C   . PHE D  1 71  ? 147.209 102.093 138.825 1.00 26.69  ? 71   PHE D C   1 
ATOM   2922  O O   . PHE D  1 71  ? 147.855 102.535 137.873 1.00 23.40  ? 71   PHE D O   1 
ATOM   2923  C CB  . PHE D  1 71  ? 146.557 99.669  139.194 1.00 28.02  ? 71   PHE D CB  1 
ATOM   2924  C CG  . PHE D  1 71  ? 145.569 98.582  138.913 1.00 28.16  ? 71   PHE D CG  1 
ATOM   2925  C CD1 . PHE D  1 71  ? 145.590 97.893  137.702 1.00 21.44  ? 71   PHE D CD1 1 
ATOM   2926  C CD2 . PHE D  1 71  ? 144.568 98.298  139.828 1.00 28.78  ? 71   PHE D CD2 1 
ATOM   2927  C CE1 . PHE D  1 71  ? 144.649 96.918  137.426 1.00 15.97  ? 71   PHE D CE1 1 
ATOM   2928  C CE2 . PHE D  1 71  ? 143.630 97.324  139.565 1.00 22.34  ? 71   PHE D CE2 1 
ATOM   2929  C CZ  . PHE D  1 71  ? 143.668 96.637  138.363 1.00 17.03  ? 71   PHE D CZ  1 
ATOM   2930  N N   . THR D  1 72  ? 147.398 102.502 140.082 1.00 25.71  ? 72   THR D N   1 
ATOM   2931  C CA  . THR D  1 72  ? 148.272 103.629 140.429 1.00 24.57  ? 72   THR D CA  1 
ATOM   2932  C C   . THR D  1 72  ? 148.694 103.552 141.899 1.00 22.34  ? 72   THR D C   1 
ATOM   2933  O O   . THR D  1 72  ? 147.928 103.061 142.730 1.00 22.89  ? 72   THR D O   1 
ATOM   2934  C CB  . THR D  1 72  ? 147.534 104.973 140.178 1.00 26.25  ? 72   THR D CB  1 
ATOM   2935  O OG1 . THR D  1 72  ? 147.418 105.201 138.768 1.00 29.04  ? 72   THR D OG1 1 
ATOM   2936  C CG2 . THR D  1 72  ? 148.263 106.162 140.829 1.00 28.67  ? 72   THR D CG2 1 
ATOM   2937  N N   . LEU D  1 73  ? 149.894 104.041 142.221 1.00 20.25  ? 73   LEU D N   1 
ATOM   2938  C CA  . LEU D  1 73  ? 150.334 104.129 143.623 1.00 18.53  ? 73   LEU D CA  1 
ATOM   2939  C C   . LEU D  1 73  ? 150.897 105.497 143.977 1.00 20.42  ? 73   LEU D C   1 
ATOM   2940  O O   . LEU D  1 73  ? 151.911 105.946 143.426 1.00 23.13  ? 73   LEU D O   1 
ATOM   2941  C CB  . LEU D  1 73  ? 151.391 103.055 143.934 1.00 20.21  ? 73   LEU D CB  1 
ATOM   2942  C CG  . LEU D  1 73  ? 151.921 102.999 145.369 1.00 16.28  ? 73   LEU D CG  1 
ATOM   2943  C CD1 . LEU D  1 73  ? 151.180 101.907 146.124 1.00 23.12  ? 73   LEU D CD1 1 
ATOM   2944  C CD2 . LEU D  1 73  ? 153.419 102.689 145.382 1.00 19.47  ? 73   LEU D CD2 1 
ATOM   2945  N N   . THR D  1 74  ? 150.230 106.131 144.938 1.00 22.35  ? 74   THR D N   1 
ATOM   2946  C CA  . THR D  1 74  ? 150.575 107.453 145.423 1.00 22.26  ? 74   THR D CA  1 
ATOM   2947  C C   . THR D  1 74  ? 151.066 107.332 146.855 1.00 24.58  ? 74   THR D C   1 
ATOM   2948  O O   . THR D  1 74  ? 150.293 106.973 147.754 1.00 27.72  ? 74   THR D O   1 
ATOM   2949  C CB  . THR D  1 74  ? 149.334 108.391 145.395 1.00 21.99  ? 74   THR D CB  1 
ATOM   2950  O OG1 . THR D  1 74  ? 148.857 108.506 144.042 1.00 20.60  ? 74   THR D OG1 1 
ATOM   2951  C CG2 . THR D  1 74  ? 149.667 109.786 145.933 1.00 22.29  ? 74   THR D CG2 1 
ATOM   2952  N N   . ILE D  1 75  ? 152.352 107.586 147.068 1.00 28.37  ? 75   ILE D N   1 
ATOM   2953  C CA  . ILE D  1 75  ? 152.773 107.962 148.393 1.00 29.05  ? 75   ILE D CA  1 
ATOM   2954  C C   . ILE D  1 75  ? 152.324 109.429 148.435 1.00 33.11  ? 75   ILE D C   1 
ATOM   2955  O O   . ILE D  1 75  ? 152.687 110.215 147.531 1.00 31.75  ? 75   ILE D O   1 
ATOM   2956  C CB  . ILE D  1 75  ? 154.290 107.798 148.557 1.00 30.17  ? 75   ILE D CB  1 
ATOM   2957  C CG1 . ILE D  1 75  ? 154.724 106.399 148.054 1.00 31.08  ? 75   ILE D CG1 1 
ATOM   2958  C CG2 . ILE D  1 75  ? 154.696 108.022 150.017 1.00 24.26  ? 75   ILE D CG2 1 
ATOM   2959  C CD1 . ILE D  1 75  ? 156.259 106.228 147.974 1.00 26.82  ? 75   ILE D CD1 1 
ATOM   2960  N N   . SER D  1 76  ? 151.502 109.787 149.427 1.00 35.70  ? 76   SER D N   1 
ATOM   2961  C CA  . SER D  1 76  ? 150.960 111.151 149.515 1.00 39.28  ? 76   SER D CA  1 
ATOM   2962  C C   . SER D  1 76  ? 152.094 112.147 149.731 1.00 42.21  ? 76   SER D C   1 
ATOM   2963  O O   . SER D  1 76  ? 152.259 113.115 148.976 1.00 42.68  ? 76   SER D O   1 
ATOM   2964  C CB  . SER D  1 76  ? 149.926 111.262 150.649 1.00 40.62  ? 76   SER D CB  1 
ATOM   2965  O OG  . SER D  1 76  ? 150.563 111.110 151.933 1.00 41.94  ? 76   SER D OG  1 
ATOM   2966  N N   . SER D  1 77  ? 152.870 111.878 150.784 1.00 42.99  ? 77   SER D N   1 
ATOM   2967  C CA  . SER D  1 77  ? 154.092 112.603 151.136 1.00 43.62  ? 77   SER D CA  1 
ATOM   2968  C C   . SER D  1 77  ? 155.234 111.595 151.379 1.00 43.76  ? 77   SER D C   1 
ATOM   2969  O O   . SER D  1 77  ? 155.082 110.682 152.200 1.00 42.40  ? 77   SER D O   1 
ATOM   2970  C CB  . SER D  1 77  ? 153.834 113.462 152.386 1.00 44.04  ? 77   SER D CB  1 
ATOM   2971  O OG  . SER D  1 77  ? 154.968 113.513 153.265 1.00 42.48  ? 77   SER D OG  1 
ATOM   2972  N N   . LEU D  1 78  ? 156.365 111.766 150.678 1.00 44.68  ? 78   LEU D N   1 
ATOM   2973  C CA  . LEU D  1 78  ? 157.515 110.814 150.735 1.00 44.60  ? 78   LEU D CA  1 
ATOM   2974  C C   . LEU D  1 78  ? 158.497 111.020 151.900 1.00 46.02  ? 78   LEU D C   1 
ATOM   2975  O O   . LEU D  1 78  ? 158.799 112.166 152.283 1.00 46.30  ? 78   LEU D O   1 
ATOM   2976  C CB  . LEU D  1 78  ? 158.308 110.852 149.418 1.00 45.49  ? 78   LEU D CB  1 
ATOM   2977  C CG  . LEU D  1 78  ? 159.441 109.839 149.199 1.00 43.30  ? 78   LEU D CG  1 
ATOM   2978  C CD1 . LEU D  1 78  ? 158.909 108.595 148.498 1.00 41.56  ? 78   LEU D CD1 1 
ATOM   2979  C CD2 . LEU D  1 78  ? 160.572 110.462 148.393 1.00 40.93  ? 78   LEU D CD2 1 
ATOM   2980  N N   . GLN D  1 79  ? 159.019 109.910 152.428 1.00 45.55  ? 79   GLN D N   1 
ATOM   2981  C CA  . GLN D  1 79  ? 159.944 109.938 153.564 1.00 45.22  ? 79   GLN D CA  1 
ATOM   2982  C C   . GLN D  1 79  ? 161.232 109.139 153.316 1.00 45.62  ? 79   GLN D C   1 
ATOM   2983  O O   . GLN D  1 79  ? 161.298 108.358 152.367 1.00 46.41  ? 79   GLN D O   1 
ATOM   2984  C CB  . GLN D  1 79  ? 159.240 109.431 154.823 1.00 46.21  ? 79   GLN D CB  1 
ATOM   2985  C CG  . GLN D  1 79  ? 157.980 110.193 155.209 1.00 45.30  ? 79   GLN D CG  1 
ATOM   2986  C CD  . GLN D  1 79  ? 158.223 111.662 155.472 1.00 50.57  ? 79   GLN D CD  1 
ATOM   2987  O OE1 . GLN D  1 79  ? 157.362 112.499 155.182 1.00 53.81  ? 79   GLN D OE1 1 
ATOM   2988  N NE2 . GLN D  1 79  ? 159.397 111.990 156.032 1.00 52.55  ? 79   GLN D NE2 1 
ATOM   2989  N N   . PRO D  1 80  ? 162.273 109.356 154.152 1.00 44.10  ? 80   PRO D N   1 
ATOM   2990  C CA  . PRO D  1 80  ? 163.556 108.652 154.008 1.00 42.97  ? 80   PRO D CA  1 
ATOM   2991  C C   . PRO D  1 80  ? 163.404 107.125 154.041 1.00 43.69  ? 80   PRO D C   1 
ATOM   2992  O O   . PRO D  1 80  ? 163.818 106.448 153.094 1.00 44.11  ? 80   PRO D O   1 
ATOM   2993  C CB  . PRO D  1 80  ? 164.369 109.163 155.205 1.00 41.94  ? 80   PRO D CB  1 
ATOM   2994  C CG  . PRO D  1 80  ? 163.804 110.524 155.483 1.00 43.56  ? 80   PRO D CG  1 
ATOM   2995  C CD  . PRO D  1 80  ? 162.322 110.322 155.268 1.00 44.61  ? 80   PRO D CD  1 
ATOM   2996  N N   . GLU D  1 81  ? 162.842 106.607 155.145 1.00 44.02  ? 81   GLU D N   1 
ATOM   2997  C CA  . GLU D  1 81  ? 162.215 105.279 155.198 1.00 43.25  ? 81   GLU D CA  1 
ATOM   2998  C C   . GLU D  1 81  ? 161.667 104.767 153.846 1.00 42.68  ? 81   GLU D C   1 
ATOM   2999  O O   . GLU D  1 81  ? 161.830 103.590 153.513 1.00 42.21  ? 81   GLU D O   1 
ATOM   3000  C CB  . GLU D  1 81  ? 161.064 105.327 156.225 1.00 41.98  ? 81   GLU D CB  1 
ATOM   3001  C CG  . GLU D  1 81  ? 160.046 106.461 155.944 1.00 45.47  ? 81   GLU D CG  1 
ATOM   3002  C CD  . GLU D  1 81  ? 159.079 106.777 157.095 1.00 45.52  ? 81   GLU D CD  1 
ATOM   3003  O OE1 . GLU D  1 81  ? 158.272 105.896 157.466 1.00 41.39  ? 81   GLU D OE1 1 
ATOM   3004  O OE2 . GLU D  1 81  ? 159.106 107.925 157.605 1.00 45.71  ? 81   GLU D OE2 1 
ATOM   3005  N N   . ASP D  1 82  ? 161.030 105.663 153.080 1.00 41.59  ? 82   ASP D N   1 
ATOM   3006  C CA  . ASP D  1 82  ? 160.221 105.287 151.901 1.00 41.07  ? 82   ASP D CA  1 
ATOM   3007  C C   . ASP D  1 82  ? 161.016 104.859 150.669 1.00 40.46  ? 82   ASP D C   1 
ATOM   3008  O O   . ASP D  1 82  ? 160.454 104.283 149.732 1.00 42.06  ? 82   ASP D O   1 
ATOM   3009  C CB  . ASP D  1 82  ? 159.233 106.401 151.520 1.00 39.13  ? 82   ASP D CB  1 
ATOM   3010  C CG  . ASP D  1 82  ? 158.068 106.498 152.486 1.00 36.75  ? 82   ASP D CG  1 
ATOM   3011  O OD1 . ASP D  1 82  ? 157.883 105.572 153.312 1.00 36.45  ? 82   ASP D OD1 1 
ATOM   3012  O OD2 . ASP D  1 82  ? 157.323 107.502 152.419 1.00 36.48  ? 82   ASP D OD2 1 
ATOM   3013  N N   . PHE D  1 83  ? 162.313 105.175 150.669 1.00 38.42  ? 83   PHE D N   1 
ATOM   3014  C CA  . PHE D  1 83  ? 163.264 104.601 149.719 1.00 35.58  ? 83   PHE D CA  1 
ATOM   3015  C C   . PHE D  1 83  ? 162.881 103.163 149.486 1.00 33.28  ? 83   PHE D C   1 
ATOM   3016  O O   . PHE D  1 83  ? 162.686 102.412 150.458 1.00 29.99  ? 83   PHE D O   1 
ATOM   3017  C CB  . PHE D  1 83  ? 164.679 104.588 150.321 1.00 37.03  ? 83   PHE D CB  1 
ATOM   3018  C CG  . PHE D  1 83  ? 165.712 103.864 149.470 1.00 39.75  ? 83   PHE D CG  1 
ATOM   3019  C CD1 . PHE D  1 83  ? 167.046 103.832 149.863 1.00 40.27  ? 83   PHE D CD1 1 
ATOM   3020  C CD2 . PHE D  1 83  ? 165.370 103.248 148.267 1.00 43.22  ? 83   PHE D CD2 1 
ATOM   3021  C CE1 . PHE D  1 83  ? 168.012 103.177 149.087 1.00 39.50  ? 83   PHE D CE1 1 
ATOM   3022  C CE2 . PHE D  1 83  ? 166.325 102.594 147.489 1.00 46.09  ? 83   PHE D CE2 1 
ATOM   3023  C CZ  . PHE D  1 83  ? 167.647 102.557 147.897 1.00 41.19  ? 83   PHE D CZ  1 
ATOM   3024  N N   . ALA D  1 84  ? 162.796 102.770 148.206 1.00 32.09  ? 84   ALA D N   1 
ATOM   3025  C CA  . ALA D  1 84  ? 162.531 101.376 147.911 1.00 30.73  ? 84   ALA D CA  1 
ATOM   3026  C C   . ALA D  1 84  ? 162.089 101.178 146.495 1.00 29.10  ? 84   ALA D C   1 
ATOM   3027  O O   . ALA D  1 84  ? 161.690 102.106 145.780 1.00 29.09  ? 84   ALA D O   1 
ATOM   3028  C CB  . ALA D  1 84  ? 161.480 100.799 148.859 1.00 28.46  ? 84   ALA D CB  1 
ATOM   3029  N N   . THR D  1 85  ? 162.183 99.916  146.121 1.00 28.07  ? 85   THR D N   1 
ATOM   3030  C CA  . THR D  1 85  ? 161.665 99.418  144.887 1.00 23.70  ? 85   THR D CA  1 
ATOM   3031  C C   . THR D  1 85  ? 160.271 98.893  145.156 1.00 23.29  ? 85   THR D C   1 
ATOM   3032  O O   . THR D  1 85  ? 160.054 97.946  145.920 1.00 22.97  ? 85   THR D O   1 
ATOM   3033  C CB  . THR D  1 85  ? 162.591 98.347  144.340 1.00 22.86  ? 85   THR D CB  1 
ATOM   3034  O OG1 . THR D  1 85  ? 163.948 98.839  144.428 1.00 23.82  ? 85   THR D OG1 1 
ATOM   3035  C CG2 . THR D  1 85  ? 162.278 98.052  142.888 1.00 16.82  ? 85   THR D CG2 1 
ATOM   3036  N N   . TYR D  1 86  ? 159.334 99.557  144.494 1.00 23.86  ? 86   TYR D N   1 
ATOM   3037  C CA  . TYR D  1 86  ? 157.925 99.313  144.652 1.00 21.61  ? 86   TYR D CA  1 
ATOM   3038  C C   . TYR D  1 86  ? 157.474 98.524  143.446 1.00 21.26  ? 86   TYR D C   1 
ATOM   3039  O O   . TYR D  1 86  ? 157.774 98.882  142.301 1.00 19.97  ? 86   TYR D O   1 
ATOM   3040  C CB  . TYR D  1 86  ? 157.191 100.648 144.744 1.00 19.75  ? 86   TYR D CB  1 
ATOM   3041  C CG  . TYR D  1 86  ? 157.513 101.379 146.022 1.00 21.57  ? 86   TYR D CG  1 
ATOM   3042  C CD1 . TYR D  1 86  ? 158.550 102.311 146.088 1.00 27.78  ? 86   TYR D CD1 1 
ATOM   3043  C CD2 . TYR D  1 86  ? 156.794 101.113 147.183 1.00 23.61  ? 86   TYR D CD2 1 
ATOM   3044  C CE1 . TYR D  1 86  ? 158.848 102.969 147.282 1.00 25.09  ? 86   TYR D CE1 1 
ATOM   3045  C CE2 . TYR D  1 86  ? 157.081 101.760 148.371 1.00 18.04  ? 86   TYR D CE2 1 
ATOM   3046  C CZ  . TYR D  1 86  ? 158.103 102.684 148.419 1.00 21.03  ? 86   TYR D CZ  1 
ATOM   3047  O OH  . TYR D  1 86  ? 158.364 103.314 149.613 1.00 26.76  ? 86   TYR D OH  1 
ATOM   3048  N N   . TYR D  1 87  ? 156.748 97.398  143.725 1.00 20.36  ? 87   TYR D N   1 
ATOM   3049  C CA  . TYR D  1 87  ? 156.317 96.534  142.604 1.00 20.17  ? 87   TYR D CA  1 
ATOM   3050  C C   . TYR D  1 87  ? 154.841 96.350  142.595 1.00 22.43  ? 87   TYR D C   1 
ATOM   3051  O O   . TYR D  1 87  ? 154.231 96.208  143.662 1.00 24.23  ? 87   TYR D O   1 
ATOM   3052  C CB  . TYR D  1 87  ? 156.879 95.107  142.739 1.00 20.85  ? 87   TYR D CB  1 
ATOM   3053  C CG  . TYR D  1 87  ? 158.340 94.988  142.493 1.00 20.25  ? 87   TYR D CG  1 
ATOM   3054  C CD1 . TYR D  1 87  ? 159.229 94.971  143.560 1.00 25.24  ? 87   TYR D CD1 1 
ATOM   3055  C CD2 . TYR D  1 87  ? 158.845 94.883  141.206 1.00 19.13  ? 87   TYR D CD2 1 
ATOM   3056  C CE1 . TYR D  1 87  ? 160.594 94.862  143.355 1.00 16.26  ? 87   TYR D CE1 1 
ATOM   3057  C CE2 . TYR D  1 87  ? 160.221 94.777  140.986 1.00 23.88  ? 87   TYR D CE2 1 
ATOM   3058  C CZ  . TYR D  1 87  ? 161.078 94.771  142.065 1.00 21.42  ? 87   TYR D CZ  1 
ATOM   3059  O OH  . TYR D  1 87  ? 162.430 94.665  141.856 1.00 28.96  ? 87   TYR D OH  1 
ATOM   3060  N N   . CYS D  1 88  ? 154.247 96.343  141.406 1.00 20.23  ? 88   CYS D N   1 
ATOM   3061  C CA  . CYS D  1 88  ? 152.874 95.880  141.300 1.00 20.14  ? 88   CYS D CA  1 
ATOM   3062  C C   . CYS D  1 88  ? 152.858 94.402  140.962 1.00 19.40  ? 88   CYS D C   1 
ATOM   3063  O O   . CYS D  1 88  ? 153.750 93.898  140.273 1.00 19.94  ? 88   CYS D O   1 
ATOM   3064  C CB  . CYS D  1 88  ? 152.049 96.689  140.278 1.00 21.51  ? 88   CYS D CB  1 
ATOM   3065  S SG  . CYS D  1 88  ? 152.605 96.639  138.554 1.00 24.38  ? 88   CYS D SG  1 
ATOM   3066  N N   . GLN D  1 89  ? 151.847 93.710  141.476 1.00 18.99  ? 89   GLN D N   1 
ATOM   3067  C CA  . GLN D  1 89  ? 151.655 92.291  141.213 1.00 20.80  ? 89   GLN D CA  1 
ATOM   3068  C C   . GLN D  1 89  ? 150.180 91.955  141.032 1.00 23.69  ? 89   GLN D C   1 
ATOM   3069  O O   . GLN D  1 89  ? 149.316 92.676  141.550 1.00 25.96  ? 89   GLN D O   1 
ATOM   3070  C CB  . GLN D  1 89  ? 152.212 91.437  142.387 1.00 20.32  ? 89   GLN D CB  1 
ATOM   3071  C CG  . GLN D  1 89  ? 152.044 89.958  142.092 1.00 19.52  ? 89   GLN D CG  1 
ATOM   3072  C CD  . GLN D  1 89  ? 151.838 89.109  143.320 1.00 25.77  ? 89   GLN D CD  1 
ATOM   3073  O OE1 . GLN D  1 89  ? 151.066 89.457  144.219 1.00 24.96  ? 89   GLN D OE1 1 
ATOM   3074  N NE2 . GLN D  1 89  ? 152.520 87.969  143.364 1.00 30.26  ? 89   GLN D NE2 1 
ATOM   3075  N N   . GLN D  1 90  ? 149.882 90.861  140.329 1.00 25.48  ? 90   GLN D N   1 
ATOM   3076  C CA  . GLN D  1 90  ? 148.494 90.380  140.221 1.00 27.86  ? 90   GLN D CA  1 
ATOM   3077  C C   . GLN D  1 90  ? 148.176 89.053  140.953 1.00 30.84  ? 90   GLN D C   1 
ATOM   3078  O O   . GLN D  1 90  ? 148.808 88.001  140.711 1.00 31.98  ? 90   GLN D O   1 
ATOM   3079  C CB  . GLN D  1 90  ? 148.023 90.351  138.758 1.00 27.30  ? 90   GLN D CB  1 
ATOM   3080  C CG  . GLN D  1 90  ? 147.303 89.080  138.331 1.00 25.33  ? 90   GLN D CG  1 
ATOM   3081  C CD  . GLN D  1 90  ? 148.248 88.123  137.640 1.00 28.83  ? 90   GLN D CD  1 
ATOM   3082  O OE1 . GLN D  1 90  ? 148.970 87.349  138.280 1.00 30.58  ? 90   GLN D OE1 1 
ATOM   3083  N NE2 . GLN D  1 90  ? 148.301 88.197  136.323 1.00 34.55  ? 90   GLN D NE2 1 
ATOM   3084  N N   . SER D  1 91  ? 147.199 89.134  141.865 1.00 33.96  ? 91   SER D N   1 
ATOM   3085  C CA  . SER D  1 91  ? 146.667 87.979  142.601 1.00 33.39  ? 91   SER D CA  1 
ATOM   3086  C C   . SER D  1 91  ? 145.659 87.201  141.762 1.00 34.30  ? 91   SER D C   1 
ATOM   3087  O O   . SER D  1 91  ? 145.375 86.029  142.034 1.00 33.14  ? 91   SER D O   1 
ATOM   3088  C CB  . SER D  1 91  ? 145.928 88.453  143.864 1.00 34.85  ? 91   SER D CB  1 
ATOM   3089  O OG  . SER D  1 91  ? 146.828 88.906  144.889 1.00 39.28  ? 91   SER D OG  1 
ATOM   3090  N N   . TYR D  1 92  ? 145.107 87.881  140.760 1.00 34.20  ? 92   TYR D N   1 
ATOM   3091  C CA  . TYR D  1 92  ? 144.000 87.412  139.913 1.00 33.59  ? 92   TYR D CA  1 
ATOM   3092  C C   . TYR D  1 92  ? 144.172 86.012  139.284 1.00 33.00  ? 92   TYR D C   1 
ATOM   3093  O O   . TYR D  1 92  ? 143.365 85.115  139.532 1.00 33.50  ? 92   TYR D O   1 
ATOM   3094  C CB  . TYR D  1 92  ? 143.769 88.466  138.825 1.00 32.70  ? 92   TYR D CB  1 
ATOM   3095  C CG  . TYR D  1 92  ? 142.510 88.345  138.002 1.00 34.67  ? 92   TYR D CG  1 
ATOM   3096  C CD1 . TYR D  1 92  ? 141.301 88.867  138.463 1.00 36.09  ? 92   TYR D CD1 1 
ATOM   3097  C CD2 . TYR D  1 92  ? 142.539 87.765  136.733 1.00 36.46  ? 92   TYR D CD2 1 
ATOM   3098  C CE1 . TYR D  1 92  ? 140.145 88.793  137.691 1.00 32.65  ? 92   TYR D CE1 1 
ATOM   3099  C CE2 . TYR D  1 92  ? 141.386 87.677  135.954 1.00 36.27  ? 92   TYR D CE2 1 
ATOM   3100  C CZ  . TYR D  1 92  ? 140.194 88.195  136.438 1.00 32.91  ? 92   TYR D CZ  1 
ATOM   3101  O OH  . TYR D  1 92  ? 139.040 88.117  135.685 1.00 37.85  ? 92   TYR D OH  1 
ATOM   3102  N N   . SER D  1 93  ? 145.223 85.843  138.478 1.00 32.01  ? 93   SER D N   1 
ATOM   3103  C CA  . SER D  1 93  ? 145.505 84.592  137.744 1.00 33.64  ? 93   SER D CA  1 
ATOM   3104  C C   . SER D  1 93  ? 146.956 84.128  137.958 1.00 34.02  ? 93   SER D C   1 
ATOM   3105  O O   . SER D  1 93  ? 147.859 84.959  138.037 1.00 33.61  ? 93   SER D O   1 
ATOM   3106  C CB  . SER D  1 93  ? 145.230 84.800  136.246 1.00 33.65  ? 93   SER D CB  1 
ATOM   3107  O OG  . SER D  1 93  ? 146.056 83.977  135.427 1.00 33.45  ? 93   SER D OG  1 
ATOM   3108  N N   . THR D  1 94  ? 147.192 82.818  138.044 1.00 34.12  ? 94   THR D N   1 
ATOM   3109  C CA  . THR D  1 94  ? 148.566 82.309  138.224 1.00 34.29  ? 94   THR D CA  1 
ATOM   3110  C C   . THR D  1 94  ? 149.172 81.856  136.895 1.00 35.04  ? 94   THR D C   1 
ATOM   3111  O O   . THR D  1 94  ? 148.452 81.286  136.063 1.00 37.06  ? 94   THR D O   1 
ATOM   3112  C CB  . THR D  1 94  ? 148.621 81.078  139.143 1.00 34.29  ? 94   THR D CB  1 
ATOM   3113  O OG1 . THR D  1 94  ? 148.430 79.893  138.358 1.00 33.77  ? 94   THR D OG1 1 
ATOM   3114  C CG2 . THR D  1 94  ? 147.580 81.145  140.258 1.00 31.97  ? 94   THR D CG2 1 
ATOM   3115  N N   . PRO D  1 95  ? 150.490 82.071  136.676 1.00 34.28  ? 95   PRO D N   1 
ATOM   3116  C CA  . PRO D  1 95  ? 151.576 82.759  137.371 1.00 33.07  ? 95   PRO D CA  1 
ATOM   3117  C C   . PRO D  1 95  ? 151.248 84.160  137.819 1.00 31.57  ? 95   PRO D C   1 
ATOM   3118  O O   . PRO D  1 95  ? 150.709 84.969  137.057 1.00 34.04  ? 95   PRO D O   1 
ATOM   3119  C CB  . PRO D  1 95  ? 152.673 82.833  136.305 1.00 33.15  ? 95   PRO D CB  1 
ATOM   3120  C CG  . PRO D  1 95  ? 152.488 81.606  135.547 1.00 32.16  ? 95   PRO D CG  1 
ATOM   3121  C CD  . PRO D  1 95  ? 150.998 81.417  135.456 1.00 32.36  ? 95   PRO D CD  1 
ATOM   3122  N N   . ASN D  1 96  ? 151.591 84.420  139.069 1.00 28.86  ? 96   ASN D N   1 
ATOM   3123  C CA  . ASN D  1 96  ? 151.444 85.732  139.633 1.00 27.10  ? 96   ASN D CA  1 
ATOM   3124  C C   . ASN D  1 96  ? 152.620 86.567  139.225 1.00 26.17  ? 96   ASN D C   1 
ATOM   3125  O O   . ASN D  1 96  ? 153.719 86.485  139.784 1.00 29.07  ? 96   ASN D O   1 
ATOM   3126  C CB  . ASN D  1 96  ? 151.314 85.649  141.133 1.00 25.95  ? 96   ASN D CB  1 
ATOM   3127  C CG  . ASN D  1 96  ? 149.952 85.165  141.556 1.00 24.99  ? 96   ASN D CG  1 
ATOM   3128  O OD1 . ASN D  1 96  ? 149.154 84.700  140.735 1.00 19.63  ? 96   ASN D OD1 1 
ATOM   3129  N ND2 . ASN D  1 96  ? 149.672 85.271  142.848 1.00 20.15  ? 96   ASN D ND2 1 
ATOM   3130  N N   . THR D  1 97  ? 152.342 87.387  138.225 1.00 24.08  ? 97   THR D N   1 
ATOM   3131  C CA  . THR D  1 97  ? 153.355 88.058  137.471 1.00 20.45  ? 97   THR D CA  1 
ATOM   3132  C C   . THR D  1 97  ? 153.611 89.363  138.191 1.00 22.63  ? 97   THR D C   1 
ATOM   3133  O O   . THR D  1 97  ? 152.677 90.001  138.691 1.00 23.87  ? 97   THR D O   1 
ATOM   3134  C CB  . THR D  1 97  ? 152.868 88.284  136.018 1.00 19.87  ? 97   THR D CB  1 
ATOM   3135  O OG1 . THR D  1 97  ? 151.448 88.656  136.005 1.00 16.00  ? 97   THR D OG1 1 
ATOM   3136  C CG2 . THR D  1 97  ? 153.041 86.989  135.208 1.00 11.39  ? 97   THR D CG2 1 
ATOM   3137  N N   . PHE D  1 98  ? 154.880 89.743  138.261 1.00 22.16  ? 98   PHE D N   1 
ATOM   3138  C CA  . PHE D  1 98  ? 155.244 90.942  138.982 1.00 20.73  ? 98   PHE D CA  1 
ATOM   3139  C C   . PHE D  1 98  ? 155.443 92.100  138.028 1.00 21.12  ? 98   PHE D C   1 
ATOM   3140  O O   . PHE D  1 98  ? 155.412 91.928  136.806 1.00 21.03  ? 98   PHE D O   1 
ATOM   3141  C CB  . PHE D  1 98  ? 156.525 90.695  139.763 1.00 18.80  ? 98   PHE D CB  1 
ATOM   3142  C CG  . PHE D  1 98  ? 156.302 90.185  141.150 1.00 20.48  ? 98   PHE D CG  1 
ATOM   3143  C CD1 . PHE D  1 98  ? 156.234 88.817  141.408 1.00 12.86  ? 98   PHE D CD1 1 
ATOM   3144  C CD2 . PHE D  1 98  ? 156.179 91.073  142.211 1.00 15.56  ? 98   PHE D CD2 1 
ATOM   3145  C CE1 . PHE D  1 98  ? 156.043 88.345  142.703 1.00 4.67   ? 98   PHE D CE1 1 
ATOM   3146  C CE2 . PHE D  1 98  ? 155.982 90.607  143.510 1.00 17.95  ? 98   PHE D CE2 1 
ATOM   3147  C CZ  . PHE D  1 98  ? 155.914 89.241  143.753 1.00 10.41  ? 98   PHE D CZ  1 
ATOM   3148  N N   . GLY D  1 99  ? 155.652 93.286  138.598 1.00 23.49  ? 99   GLY D N   1 
ATOM   3149  C CA  . GLY D  1 99  ? 155.925 94.485  137.820 1.00 23.21  ? 99   GLY D CA  1 
ATOM   3150  C C   . GLY D  1 99  ? 157.410 94.789  137.818 1.00 24.10  ? 99   GLY D C   1 
ATOM   3151  O O   . GLY D  1 99  ? 158.100 94.575  138.810 1.00 26.16  ? 99   GLY D O   1 
ATOM   3152  N N   . GLN D  1 100 ? 157.887 95.287  136.678 1.00 24.17  ? 100  GLN D N   1 
ATOM   3153  C CA  . GLN D  1 100 ? 159.305 95.574  136.471 1.00 24.59  ? 100  GLN D CA  1 
ATOM   3154  C C   . GLN D  1 100 ? 159.852 96.654  137.424 1.00 24.99  ? 100  GLN D C   1 
ATOM   3155  O O   . GLN D  1 100 ? 161.035 96.994  137.374 1.00 25.33  ? 100  GLN D O   1 
ATOM   3156  C CB  . GLN D  1 100 ? 159.567 95.896  134.985 1.00 25.00  ? 100  GLN D CB  1 
ATOM   3157  C CG  . GLN D  1 100 ? 158.602 96.914  134.371 1.00 30.28  ? 100  GLN D CG  1 
ATOM   3158  C CD  . GLN D  1 100 ? 157.876 96.400  133.123 1.00 29.47  ? 100  GLN D CD  1 
ATOM   3159  O OE1 . GLN D  1 100 ? 158.494 95.993  132.131 1.00 29.24  ? 100  GLN D OE1 1 
ATOM   3160  N NE2 . GLN D  1 100 ? 156.548 96.438  133.169 1.00 32.17  ? 100  GLN D NE2 1 
ATOM   3161  N N   . GLY D  1 101 ? 158.984 97.187  138.283 1.00 26.89  ? 101  GLY D N   1 
ATOM   3162  C CA  . GLY D  1 101 ? 159.422 97.895  139.486 1.00 26.67  ? 101  GLY D CA  1 
ATOM   3163  C C   . GLY D  1 101 ? 159.814 99.352  139.383 1.00 27.32  ? 101  GLY D C   1 
ATOM   3164  O O   . GLY D  1 101 ? 159.999 99.886  138.286 1.00 25.06  ? 101  GLY D O   1 
ATOM   3165  N N   . THR D  1 102 ? 159.937 99.994  140.543 1.00 26.54  ? 102  THR D N   1 
ATOM   3166  C CA  . THR D  1 102 ? 160.326 101.398 140.603 1.00 26.27  ? 102  THR D CA  1 
ATOM   3167  C C   . THR D  1 102 ? 161.164 101.754 141.825 1.00 27.37  ? 102  THR D C   1 
ATOM   3168  O O   . THR D  1 102 ? 160.666 101.846 142.958 1.00 25.73  ? 102  THR D O   1 
ATOM   3169  C CB  . THR D  1 102 ? 159.111 102.331 140.507 1.00 24.98  ? 102  THR D CB  1 
ATOM   3170  O OG1 . THR D  1 102 ? 158.385 102.039 139.301 1.00 29.06  ? 102  THR D OG1 1 
ATOM   3171  C CG2 . THR D  1 102 ? 159.553 103.789 140.465 1.00 22.84  ? 102  THR D CG2 1 
ATOM   3172  N N   . LYS D  1 103 ? 162.448 101.964 141.549 1.00 28.19  ? 103  LYS D N   1 
ATOM   3173  C CA  . LYS D  1 103 ? 163.418 102.449 142.513 1.00 28.15  ? 103  LYS D CA  1 
ATOM   3174  C C   . LYS D  1 103 ? 163.116 103.914 142.758 1.00 27.51  ? 103  LYS D C   1 
ATOM   3175  O O   . LYS D  1 103 ? 163.280 104.760 141.879 1.00 29.02  ? 103  LYS D O   1 
ATOM   3176  C CB  . LYS D  1 103 ? 164.844 102.319 141.966 1.00 28.51  ? 103  LYS D CB  1 
ATOM   3177  C CG  . LYS D  1 103 ? 165.068 101.156 140.996 1.00 29.87  ? 103  LYS D CG  1 
ATOM   3178  C CD  . LYS D  1 103 ? 166.533 101.030 140.590 1.00 26.29  ? 103  LYS D CD  1 
ATOM   3179  C CE  . LYS D  1 103 ? 167.400 100.584 141.767 1.00 31.97  ? 103  LYS D CE  1 
ATOM   3180  N NZ  . LYS D  1 103 ? 168.785 100.164 141.297 1.00 34.41  ? 103  LYS D NZ  1 
ATOM   3181  N N   . VAL D  1 104 ? 162.659 104.197 143.967 1.00 24.13  ? 104  VAL D N   1 
ATOM   3182  C CA  . VAL D  1 104 ? 162.332 105.544 144.362 1.00 21.61  ? 104  VAL D CA  1 
ATOM   3183  C C   . VAL D  1 104 ? 163.442 105.961 145.297 1.00 20.64  ? 104  VAL D C   1 
ATOM   3184  O O   . VAL D  1 104 ? 163.616 105.349 146.356 1.00 17.06  ? 104  VAL D O   1 
ATOM   3185  C CB  . VAL D  1 104 ? 160.994 105.542 145.132 1.00 22.97  ? 104  VAL D CB  1 
ATOM   3186  C CG1 . VAL D  1 104 ? 160.741 106.894 145.822 1.00 24.10  ? 104  VAL D CG1 1 
ATOM   3187  C CG2 . VAL D  1 104 ? 159.844 105.220 144.189 1.00 16.99  ? 104  VAL D CG2 1 
ATOM   3188  N N   . GLU D  1 105 ? 164.215 106.970 144.908 1.00 22.25  ? 105  GLU D N   1 
ATOM   3189  C CA  . GLU D  1 105 ? 165.245 107.510 145.799 1.00 23.74  ? 105  GLU D CA  1 
ATOM   3190  C C   . GLU D  1 105 ? 165.015 108.984 146.064 1.00 22.70  ? 105  GLU D C   1 
ATOM   3191  O O   . GLU D  1 105 ? 164.566 109.716 145.171 1.00 23.86  ? 105  GLU D O   1 
ATOM   3192  C CB  . GLU D  1 105 ? 166.663 107.306 145.243 1.00 24.11  ? 105  GLU D CB  1 
ATOM   3193  C CG  . GLU D  1 105 ? 166.816 107.565 143.756 1.00 29.99  ? 105  GLU D CG  1 
ATOM   3194  C CD  . GLU D  1 105 ? 166.515 106.331 142.933 1.00 36.04  ? 105  GLU D CD  1 
ATOM   3195  O OE1 . GLU D  1 105 ? 166.493 105.214 143.507 1.00 38.45  ? 105  GLU D OE1 1 
ATOM   3196  O OE2 . GLU D  1 105 ? 166.299 106.468 141.711 1.00 34.83  ? 105  GLU D OE2 1 
ATOM   3197  N N   . ILE D  1 106 ? 165.335 109.410 147.296 1.00 23.47  ? 106  ILE D N   1 
ATOM   3198  C CA  . ILE D  1 106 ? 165.246 110.840 147.666 1.00 22.46  ? 106  ILE D CA  1 
ATOM   3199  C C   . ILE D  1 106 ? 166.367 111.651 146.999 1.00 22.71  ? 106  ILE D C   1 
ATOM   3200  O O   . ILE D  1 106 ? 166.163 112.780 146.545 1.00 24.06  ? 106  ILE D O   1 
ATOM   3201  C CB  . ILE D  1 106 ? 165.295 111.037 149.212 1.00 22.03  ? 106  ILE D CB  1 
ATOM   3202  C CG1 . ILE D  1 106 ? 164.117 110.334 149.901 1.00 21.58  ? 106  ILE D CG1 1 
ATOM   3203  C CG2 . ILE D  1 106 ? 165.253 112.514 149.586 1.00 22.48  ? 106  ILE D CG2 1 
ATOM   3204  C CD1 . ILE D  1 106 ? 164.422 108.846 150.327 1.00 30.34  ? 106  ILE D CD1 1 
ATOM   3205  N N   . ASP E  1 1   ? 150.371 135.347 145.780 1.00 40.96  ? 1    ASP E N   1 
ATOM   3206  C CA  . ASP E  1 1   ? 151.807 134.971 146.046 1.00 41.06  ? 1    ASP E CA  1 
ATOM   3207  C C   . ASP E  1 1   ? 151.904 133.438 146.245 1.00 39.15  ? 1    ASP E C   1 
ATOM   3208  O O   . ASP E  1 1   ? 151.842 132.920 147.372 1.00 40.73  ? 1    ASP E O   1 
ATOM   3209  C CB  . ASP E  1 1   ? 152.371 135.775 147.243 1.00 41.64  ? 1    ASP E CB  1 
ATOM   3210  C CG  . ASP E  1 1   ? 153.887 135.693 147.336 1.00 46.89  ? 1    ASP E CG  1 
ATOM   3211  O OD1 . ASP E  1 1   ? 154.548 135.318 146.340 1.00 54.68  ? 1    ASP E OD1 1 
ATOM   3212  O OD2 . ASP E  1 1   ? 154.425 136.012 148.418 1.00 46.42  ? 1    ASP E OD2 1 
ATOM   3213  N N   . ILE E  1 2   ? 152.076 132.739 145.119 1.00 35.63  ? 2    ILE E N   1 
ATOM   3214  C CA  . ILE E  1 2   ? 151.632 131.337 144.955 1.00 33.40  ? 2    ILE E CA  1 
ATOM   3215  C C   . ILE E  1 2   ? 152.727 130.309 144.635 1.00 33.16  ? 2    ILE E C   1 
ATOM   3216  O O   . ILE E  1 2   ? 153.554 130.518 143.743 1.00 32.85  ? 2    ILE E O   1 
ATOM   3217  C CB  . ILE E  1 2   ? 150.550 131.243 143.840 1.00 32.75  ? 2    ILE E CB  1 
ATOM   3218  C CG1 . ILE E  1 2   ? 149.351 132.141 144.178 1.00 28.46  ? 2    ILE E CG1 1 
ATOM   3219  C CG2 . ILE E  1 2   ? 150.088 129.795 143.635 1.00 31.13  ? 2    ILE E CG2 1 
ATOM   3220  C CD1 . ILE E  1 2   ? 148.432 132.411 142.989 1.00 9.87   ? 2    ILE E CD1 1 
ATOM   3221  N N   . GLN E  1 3   ? 152.684 129.183 145.347 1.00 33.31  ? 3    GLN E N   1 
ATOM   3222  C CA  . GLN E  1 3   ? 153.692 128.135 145.228 1.00 31.54  ? 3    GLN E CA  1 
ATOM   3223  C C   . GLN E  1 3   ? 153.190 126.878 144.520 1.00 30.18  ? 3    GLN E C   1 
ATOM   3224  O O   . GLN E  1 3   ? 152.041 126.458 144.687 1.00 29.52  ? 3    GLN E O   1 
ATOM   3225  C CB  . GLN E  1 3   ? 154.250 127.791 146.615 1.00 31.61  ? 3    GLN E CB  1 
ATOM   3226  C CG  . GLN E  1 3   ? 155.292 128.793 147.104 1.00 39.02  ? 3    GLN E CG  1 
ATOM   3227  C CD  . GLN E  1 3   ? 155.000 129.341 148.494 1.00 41.38  ? 3    GLN E CD  1 
ATOM   3228  O OE1 . GLN E  1 3   ? 154.693 128.595 149.426 1.00 37.52  ? 3    GLN E OE1 1 
ATOM   3229  N NE2 . GLN E  1 3   ? 155.104 130.658 148.639 1.00 41.61  ? 3    GLN E NE2 1 
ATOM   3230  N N   . MET E  1 4   ? 154.088 126.297 143.725 1.00 26.97  ? 4    MET E N   1 
ATOM   3231  C CA  . MET E  1 4   ? 153.802 125.121 142.924 1.00 23.69  ? 4    MET E CA  1 
ATOM   3232  C C   . MET E  1 4   ? 154.806 124.044 143.296 1.00 23.25  ? 4    MET E C   1 
ATOM   3233  O O   . MET E  1 4   ? 156.008 124.151 143.023 1.00 21.80  ? 4    MET E O   1 
ATOM   3234  C CB  . MET E  1 4   ? 153.884 125.433 141.426 1.00 23.09  ? 4    MET E CB  1 
ATOM   3235  C CG  . MET E  1 4   ? 152.950 126.547 140.951 1.00 21.51  ? 4    MET E CG  1 
ATOM   3236  S SD  . MET E  1 4   ? 151.122 126.274 141.317 1.00 35.68  ? 4    MET E SD  1 
ATOM   3237  C CE  . MET E  1 4   ? 151.066 124.465 140.413 1.00 23.32  ? 4    MET E CE  1 
ATOM   3238  N N   . THR E  1 5   ? 154.286 123.017 143.958 1.00 23.31  ? 5    THR E N   1 
ATOM   3239  C CA  . THR E  1 5   ? 155.044 121.841 144.340 1.00 22.90  ? 5    THR E CA  1 
ATOM   3240  C C   . THR E  1 5   ? 154.865 120.744 143.292 1.00 21.20  ? 5    THR E C   1 
ATOM   3241  O O   . THR E  1 5   ? 153.792 120.136 143.201 1.00 18.63  ? 5    THR E O   1 
ATOM   3242  C CB  . THR E  1 5   ? 154.525 121.310 145.687 1.00 21.64  ? 5    THR E CB  1 
ATOM   3243  O OG1 . THR E  1 5   ? 154.372 122.404 146.602 1.00 24.85  ? 5    THR E OG1 1 
ATOM   3244  C CG2 . THR E  1 5   ? 155.490 120.287 146.277 1.00 23.23  ? 5    THR E CG2 1 
ATOM   3245  N N   . GLN E  1 6   ? 155.906 120.486 142.507 1.00 20.95  ? 6    GLN E N   1 
ATOM   3246  C CA  . GLN E  1 6   ? 155.851 119.467 141.457 1.00 22.18  ? 6    GLN E CA  1 
ATOM   3247  C C   . GLN E  1 6   ? 156.606 118.212 141.871 1.00 21.07  ? 6    GLN E C   1 
ATOM   3248  O O   . GLN E  1 6   ? 157.652 118.309 142.536 1.00 22.66  ? 6    GLN E O   1 
ATOM   3249  C CB  . GLN E  1 6   ? 156.468 120.026 140.171 1.00 23.16  ? 6    GLN E CB  1 
ATOM   3250  C CG  . GLN E  1 6   ? 156.392 119.097 138.961 1.00 26.40  ? 6    GLN E CG  1 
ATOM   3251  C CD  . GLN E  1 6   ? 156.771 119.825 137.687 1.00 26.25  ? 6    GLN E CD  1 
ATOM   3252  O OE1 . GLN E  1 6   ? 156.825 121.058 137.649 1.00 25.99  ? 6    GLN E OE1 1 
ATOM   3253  N NE2 . GLN E  1 6   ? 157.039 119.069 136.625 1.00 27.41  ? 6    GLN E NE2 1 
ATOM   3254  N N   . SER E  1 7   ? 156.099 117.046 141.488 1.00 19.73  ? 7    SER E N   1 
ATOM   3255  C CA  . SER E  1 7   ? 156.863 115.806 141.671 1.00 18.70  ? 7    SER E CA  1 
ATOM   3256  C C   . SER E  1 7   ? 156.558 114.846 140.526 1.00 16.40  ? 7    SER E C   1 
ATOM   3257  O O   . SER E  1 7   ? 155.382 114.809 140.050 1.00 16.80  ? 7    SER E O   1 
ATOM   3258  C CB  . SER E  1 7   ? 156.504 115.156 143.001 1.00 20.17  ? 7    SER E CB  1 
ATOM   3259  O OG  . SER E  1 7   ? 155.109 114.882 143.052 1.00 19.97  ? 7    SER E OG  1 
ATOM   3260  N N   . PRO E  1 8   ? 157.531 114.019 140.094 1.00 14.87  ? 8    PRO E N   1 
ATOM   3261  C CA  . PRO E  1 8   ? 158.829 113.688 140.707 1.00 18.08  ? 8    PRO E CA  1 
ATOM   3262  C C   . PRO E  1 8   ? 159.809 114.737 140.246 1.00 21.40  ? 8    PRO E C   1 
ATOM   3263  O O   . PRO E  1 8   ? 159.445 115.567 139.405 1.00 23.07  ? 8    PRO E O   1 
ATOM   3264  C CB  . PRO E  1 8   ? 159.165 112.324 140.092 1.00 16.48  ? 8    PRO E CB  1 
ATOM   3265  C CG  . PRO E  1 8   ? 158.325 112.209 138.854 1.00 14.33  ? 8    PRO E CG  1 
ATOM   3266  C CD  . PRO E  1 8   ? 157.355 113.345 138.790 1.00 16.59  ? 8    PRO E CD  1 
ATOM   3267  N N   . SER E  1 9   ? 161.022 114.737 140.789 1.00 23.29  ? 9    SER E N   1 
ATOM   3268  C CA  . SER E  1 9   ? 162.018 115.706 140.345 1.00 25.94  ? 9    SER E CA  1 
ATOM   3269  C C   . SER E  1 9   ? 162.788 115.196 139.123 1.00 27.13  ? 9    SER E C   1 
ATOM   3270  O O   . SER E  1 9   ? 162.954 115.925 138.144 1.00 26.84  ? 9    SER E O   1 
ATOM   3271  C CB  . SER E  1 9   ? 162.951 116.089 141.492 1.00 26.85  ? 9    SER E CB  1 
ATOM   3272  O OG  . SER E  1 9   ? 162.242 116.832 142.480 1.00 28.28  ? 9    SER E OG  1 
ATOM   3273  N N   . SER E  1 10  ? 163.253 113.948 139.190 1.00 30.52  ? 10   SER E N   1 
ATOM   3274  C CA  . SER E  1 10  ? 163.868 113.267 138.044 1.00 31.34  ? 10   SER E CA  1 
ATOM   3275  C C   . SER E  1 10  ? 163.286 111.864 137.875 1.00 32.71  ? 10   SER E C   1 
ATOM   3276  O O   . SER E  1 10  ? 162.878 111.234 138.855 1.00 33.02  ? 10   SER E O   1 
ATOM   3277  C CB  . SER E  1 10  ? 165.397 113.214 138.177 1.00 29.79  ? 10   SER E CB  1 
ATOM   3278  O OG  . SER E  1 10  ? 165.812 113.296 139.535 1.00 33.03  ? 10   SER E OG  1 
ATOM   3279  N N   . LEU E  1 11  ? 163.266 111.380 136.634 1.00 34.07  ? 11   LEU E N   1 
ATOM   3280  C CA  . LEU E  1 11  ? 162.465 110.214 136.274 1.00 34.85  ? 11   LEU E CA  1 
ATOM   3281  C C   . LEU E  1 11  ? 162.949 109.598 134.965 1.00 35.12  ? 11   LEU E C   1 
ATOM   3282  O O   . LEU E  1 11  ? 163.140 110.313 133.963 1.00 37.87  ? 11   LEU E O   1 
ATOM   3283  C CB  . LEU E  1 11  ? 160.987 110.645 136.181 1.00 34.37  ? 11   LEU E CB  1 
ATOM   3284  C CG  . LEU E  1 11  ? 159.908 109.997 135.307 1.00 37.76  ? 11   LEU E CG  1 
ATOM   3285  C CD1 . LEU E  1 11  ? 158.549 110.094 136.012 1.00 38.41  ? 11   LEU E CD1 1 
ATOM   3286  C CD2 . LEU E  1 11  ? 159.851 110.684 133.935 1.00 34.30  ? 11   LEU E CD2 1 
ATOM   3287  N N   . SER E  1 12  ? 163.177 108.289 134.980 1.00 34.57  ? 12   SER E N   1 
ATOM   3288  C CA  . SER E  1 12  ? 163.321 107.545 133.747 1.00 32.53  ? 12   SER E CA  1 
ATOM   3289  C C   . SER E  1 12  ? 162.162 106.575 133.703 1.00 29.74  ? 12   SER E C   1 
ATOM   3290  O O   . SER E  1 12  ? 161.536 106.260 134.725 1.00 27.39  ? 12   SER E O   1 
ATOM   3291  C CB  . SER E  1 12  ? 164.652 106.795 133.662 1.00 33.22  ? 12   SER E CB  1 
ATOM   3292  O OG  . SER E  1 12  ? 165.674 107.508 134.409 1.00 36.94  ? 12   SER E OG  1 
ATOM   3293  N N   . ALA E  1 13  ? 161.911 106.102 132.498 1.00 26.39  ? 13   ALA E N   1 
ATOM   3294  C CA  . ALA E  1 13  ? 160.731 105.351 132.128 1.00 23.12  ? 13   ALA E CA  1 
ATOM   3295  C C   . ALA E  1 13  ? 161.198 105.078 130.722 1.00 21.80  ? 13   ALA E C   1 
ATOM   3296  O O   . ALA E  1 13  ? 161.864 105.929 130.117 1.00 22.54  ? 13   ALA E O   1 
ATOM   3297  C CB  . ALA E  1 13  ? 159.481 106.249 132.124 1.00 20.55  ? 13   ALA E CB  1 
ATOM   3298  N N   . SER E  1 14  ? 160.917 103.899 130.190 1.00 20.61  ? 14   SER E N   1 
ATOM   3299  C CA  . SER E  1 14  ? 161.395 103.630 128.839 1.00 21.48  ? 14   SER E CA  1 
ATOM   3300  C C   . SER E  1 14  ? 160.378 104.058 127.774 1.00 21.28  ? 14   SER E C   1 
ATOM   3301  O O   . SER E  1 14  ? 159.468 104.842 128.050 1.00 20.43  ? 14   SER E O   1 
ATOM   3302  C CB  . SER E  1 14  ? 161.845 102.173 128.679 1.00 21.27  ? 14   SER E CB  1 
ATOM   3303  O OG  . SER E  1 14  ? 160.818 101.279 129.069 1.00 26.35  ? 14   SER E OG  1 
ATOM   3304  N N   . VAL E  1 15  ? 160.542 103.535 126.561 1.00 20.49  ? 15   VAL E N   1 
ATOM   3305  C CA  . VAL E  1 15  ? 159.747 103.964 125.397 1.00 22.61  ? 15   VAL E CA  1 
ATOM   3306  C C   . VAL E  1 15  ? 158.368 103.285 125.317 1.00 21.58  ? 15   VAL E C   1 
ATOM   3307  O O   . VAL E  1 15  ? 158.262 102.051 125.377 1.00 26.78  ? 15   VAL E O   1 
ATOM   3308  C CB  . VAL E  1 15  ? 160.539 103.747 124.080 1.00 22.73  ? 15   VAL E CB  1 
ATOM   3309  C CG1 . VAL E  1 15  ? 159.710 104.140 122.864 1.00 23.20  ? 15   VAL E CG1 1 
ATOM   3310  C CG2 . VAL E  1 15  ? 161.845 104.533 124.101 1.00 21.89  ? 15   VAL E CG2 1 
ATOM   3311  N N   . GLY E  1 16  ? 157.323 104.100 125.163 1.00 22.24  ? 16   GLY E N   1 
ATOM   3312  C CA  . GLY E  1 16  ? 155.930 103.617 125.158 1.00 23.55  ? 16   GLY E CA  1 
ATOM   3313  C C   . GLY E  1 16  ? 155.314 103.717 126.540 1.00 25.47  ? 16   GLY E C   1 
ATOM   3314  O O   . GLY E  1 16  ? 154.156 103.330 126.752 1.00 24.26  ? 16   GLY E O   1 
ATOM   3315  N N   . ASP E  1 17  ? 156.095 104.233 127.480 1.00 25.42  ? 17   ASP E N   1 
ATOM   3316  C CA  . ASP E  1 17  ? 155.619 104.337 128.834 1.00 27.74  ? 17   ASP E CA  1 
ATOM   3317  C C   . ASP E  1 17  ? 154.743 105.545 129.044 1.00 27.41  ? 17   ASP E C   1 
ATOM   3318  O O   . ASP E  1 17  ? 154.646 106.449 128.202 1.00 25.86  ? 17   ASP E O   1 
ATOM   3319  C CB  . ASP E  1 17  ? 156.779 104.335 129.826 1.00 29.82  ? 17   ASP E CB  1 
ATOM   3320  C CG  . ASP E  1 17  ? 157.361 102.952 130.025 1.00 33.30  ? 17   ASP E CG  1 
ATOM   3321  O OD1 . ASP E  1 17  ? 156.582 101.996 130.239 1.00 34.66  ? 17   ASP E OD1 1 
ATOM   3322  O OD2 . ASP E  1 17  ? 158.609 102.810 129.984 1.00 41.08  ? 17   ASP E OD2 1 
ATOM   3323  N N   . ARG E  1 18  ? 154.095 105.510 130.194 1.00 26.10  ? 18   ARG E N   1 
ATOM   3324  C CA  . ARG E  1 18  ? 153.255 106.556 130.676 1.00 25.26  ? 18   ARG E CA  1 
ATOM   3325  C C   . ARG E  1 18  ? 154.161 107.202 131.697 1.00 25.70  ? 18   ARG E C   1 
ATOM   3326  O O   . ARG E  1 18  ? 154.872 106.516 132.436 1.00 25.86  ? 18   ARG E O   1 
ATOM   3327  C CB  . ARG E  1 18  ? 152.067 105.891 131.351 1.00 25.15  ? 18   ARG E CB  1 
ATOM   3328  C CG  . ARG E  1 18  ? 150.855 106.735 131.633 1.00 28.31  ? 18   ARG E CG  1 
ATOM   3329  C CD  . ARG E  1 18  ? 149.942 105.846 132.461 1.00 36.54  ? 18   ARG E CD  1 
ATOM   3330  N NE  . ARG E  1 18  ? 148.558 105.750 131.971 1.00 36.79  ? 18   ARG E NE  1 
ATOM   3331  C CZ  . ARG E  1 18  ? 148.211 105.242 130.767 1.00 42.49  ? 18   ARG E CZ  1 
ATOM   3332  N NH1 . ARG E  1 18  ? 149.140 104.778 129.853 1.00 42.69  ? 18   ARG E NH1 1 
ATOM   3333  N NH2 . ARG E  1 18  ? 146.912 105.214 130.463 1.00 47.38  ? 18   ARG E NH2 1 
ATOM   3334  N N   . VAL E  1 19  ? 154.160 108.529 131.721 1.00 22.47  ? 19   VAL E N   1 
ATOM   3335  C CA  . VAL E  1 19  ? 154.947 109.260 132.690 1.00 21.29  ? 19   VAL E CA  1 
ATOM   3336  C C   . VAL E  1 19  ? 153.893 110.030 133.443 1.00 21.49  ? 19   VAL E C   1 
ATOM   3337  O O   . VAL E  1 19  ? 153.114 110.771 132.831 1.00 21.67  ? 19   VAL E O   1 
ATOM   3338  C CB  . VAL E  1 19  ? 155.947 110.190 131.962 1.00 24.04  ? 19   VAL E CB  1 
ATOM   3339  C CG1 . VAL E  1 19  ? 156.194 111.514 132.724 1.00 23.91  ? 19   VAL E CG1 1 
ATOM   3340  C CG2 . VAL E  1 19  ? 157.260 109.465 131.694 1.00 22.54  ? 19   VAL E CG2 1 
ATOM   3341  N N   . THR E  1 20  ? 153.809 109.850 134.749 1.00 19.81  ? 20   THR E N   1 
ATOM   3342  C CA  . THR E  1 20  ? 152.812 110.630 135.457 1.00 19.40  ? 20   THR E CA  1 
ATOM   3343  C C   . THR E  1 20  ? 153.513 111.691 136.304 1.00 17.81  ? 20   THR E C   1 
ATOM   3344  O O   . THR E  1 20  ? 154.460 111.395 137.052 1.00 17.57  ? 20   THR E O   1 
ATOM   3345  C CB  . THR E  1 20  ? 151.779 109.741 136.179 1.00 18.97  ? 20   THR E CB  1 
ATOM   3346  O OG1 . THR E  1 20  ? 151.177 108.855 135.215 1.00 22.87  ? 20   THR E OG1 1 
ATOM   3347  C CG2 . THR E  1 20  ? 150.684 110.583 136.825 1.00 14.64  ? 20   THR E CG2 1 
ATOM   3348  N N   . ILE E  1 21  ? 153.054 112.932 136.141 1.00 16.74  ? 21   ILE E N   1 
ATOM   3349  C CA  . ILE E  1 21  ? 153.782 114.120 136.586 1.00 19.63  ? 21   ILE E CA  1 
ATOM   3350  C C   . ILE E  1 21  ? 152.811 115.104 137.248 1.00 21.27  ? 21   ILE E C   1 
ATOM   3351  O O   . ILE E  1 21  ? 151.854 115.557 136.607 1.00 22.88  ? 21   ILE E O   1 
ATOM   3352  C CB  . ILE E  1 21  ? 154.501 114.782 135.381 1.00 20.16  ? 21   ILE E CB  1 
ATOM   3353  C CG1 . ILE E  1 21  ? 155.924 114.160 135.225 1.00 24.13  ? 21   ILE E CG1 1 
ATOM   3354  C CG2 . ILE E  1 21  ? 154.635 116.292 135.559 1.00 22.88  ? 21   ILE E CG2 1 
ATOM   3355  C CD1 . ILE E  1 21  ? 156.693 114.703 134.024 1.00 29.39  ? 21   ILE E CD1 1 
ATOM   3356  N N   . THR E  1 22  ? 153.039 115.427 138.520 1.00 20.46  ? 22   THR E N   1 
ATOM   3357  C CA  . THR E  1 22  ? 152.004 116.132 139.287 1.00 24.07  ? 22   THR E CA  1 
ATOM   3358  C C   . THR E  1 22  ? 152.389 117.515 139.853 1.00 23.70  ? 22   THR E C   1 
ATOM   3359  O O   . THR E  1 22  ? 153.573 117.794 140.104 1.00 26.71  ? 22   THR E O   1 
ATOM   3360  C CB  . THR E  1 22  ? 151.381 115.222 140.393 1.00 24.58  ? 22   THR E CB  1 
ATOM   3361  O OG1 . THR E  1 22  ? 152.410 114.658 141.218 1.00 27.85  ? 22   THR E OG1 1 
ATOM   3362  C CG2 . THR E  1 22  ? 150.552 114.093 139.770 1.00 22.98  ? 22   THR E CG2 1 
ATOM   3363  N N   . CYS E  1 23  ? 151.383 118.376 140.027 1.00 23.98  ? 23   CYS E N   1 
ATOM   3364  C CA  . CYS E  1 23  ? 151.567 119.690 140.652 1.00 25.65  ? 23   CYS E CA  1 
ATOM   3365  C C   . CYS E  1 23  ? 150.382 120.065 141.519 1.00 25.55  ? 23   CYS E C   1 
ATOM   3366  O O   . CYS E  1 23  ? 149.251 119.632 141.274 1.00 24.19  ? 23   CYS E O   1 
ATOM   3367  C CB  . CYS E  1 23  ? 151.758 120.794 139.599 1.00 25.94  ? 23   CYS E CB  1 
ATOM   3368  S SG  . CYS E  1 23  ? 153.251 120.621 138.562 1.00 36.94  ? 23   CYS E SG  1 
ATOM   3369  N N   . ARG E  1 24  ? 150.652 120.897 142.518 1.00 26.21  ? 24   ARG E N   1 
ATOM   3370  C CA  . ARG E  1 24  ? 149.615 121.438 143.377 1.00 27.22  ? 24   ARG E CA  1 
ATOM   3371  C C   . ARG E  1 24  ? 149.902 122.886 143.721 1.00 27.52  ? 24   ARG E C   1 
ATOM   3372  O O   . ARG E  1 24  ? 151.056 123.327 143.696 1.00 27.39  ? 24   ARG E O   1 
ATOM   3373  C CB  . ARG E  1 24  ? 149.499 120.620 144.657 1.00 28.54  ? 24   ARG E CB  1 
ATOM   3374  C CG  . ARG E  1 24  ? 148.955 119.237 144.437 1.00 27.89  ? 24   ARG E CG  1 
ATOM   3375  C CD  . ARG E  1 24  ? 148.959 118.485 145.736 1.00 28.38  ? 24   ARG E CD  1 
ATOM   3376  N NE  . ARG E  1 24  ? 147.673 118.576 146.424 1.00 29.80  ? 24   ARG E NE  1 
ATOM   3377  C CZ  . ARG E  1 24  ? 147.483 118.097 147.649 1.00 35.88  ? 24   ARG E CZ  1 
ATOM   3378  N NH1 . ARG E  1 24  ? 148.502 117.509 148.303 1.00 36.54  ? 24   ARG E NH1 1 
ATOM   3379  N NH2 . ARG E  1 24  ? 146.286 118.197 148.234 1.00 33.44  ? 24   ARG E NH2 1 
ATOM   3380  N N   . ALA E  1 25  ? 148.841 123.616 144.055 1.00 27.00  ? 25   ALA E N   1 
ATOM   3381  C CA  . ALA E  1 25  ? 148.951 125.027 144.398 1.00 28.03  ? 25   ALA E CA  1 
ATOM   3382  C C   . ALA E  1 25  ? 148.478 125.329 145.816 1.00 28.75  ? 25   ALA E C   1 
ATOM   3383  O O   . ALA E  1 25  ? 147.401 124.889 146.250 1.00 27.67  ? 25   ALA E O   1 
ATOM   3384  C CB  . ALA E  1 25  ? 148.214 125.888 143.379 1.00 29.47  ? 25   ALA E CB  1 
ATOM   3385  N N   . SER E  1 26  ? 149.327 126.080 146.518 1.00 30.96  ? 26   SER E N   1 
ATOM   3386  C CA  . SER E  1 26  ? 149.077 126.598 147.859 1.00 32.79  ? 26   SER E CA  1 
ATOM   3387  C C   . SER E  1 26  ? 147.701 127.232 148.019 1.00 33.70  ? 26   SER E C   1 
ATOM   3388  O O   . SER E  1 26  ? 147.297 127.594 149.138 1.00 35.32  ? 26   SER E O   1 
ATOM   3389  C CB  . SER E  1 26  ? 150.115 127.687 148.152 1.00 32.89  ? 26   SER E CB  1 
ATOM   3390  O OG  . SER E  1 26  ? 149.867 128.847 147.319 1.00 37.02  ? 26   SER E OG  1 
ATOM   3391  N N   . GLN E  1 27  ? 146.993 127.369 146.897 1.00 35.19  ? 27   GLN E N   1 
ATOM   3392  C CA  . GLN E  1 27  ? 145.807 128.209 146.770 1.00 33.24  ? 27   GLN E CA  1 
ATOM   3393  C C   . GLN E  1 27  ? 145.106 127.843 145.464 1.00 33.15  ? 27   GLN E C   1 
ATOM   3394  O O   . GLN E  1 27  ? 145.740 127.848 144.402 1.00 35.58  ? 27   GLN E O   1 
ATOM   3395  C CB  . GLN E  1 27  ? 146.243 129.684 146.749 1.00 35.38  ? 27   GLN E CB  1 
ATOM   3396  C CG  . GLN E  1 27  ? 145.222 130.678 146.187 1.00 34.19  ? 27   GLN E CG  1 
ATOM   3397  C CD  . GLN E  1 27  ? 145.789 132.091 146.032 1.00 34.42  ? 27   GLN E CD  1 
ATOM   3398  O OE1 . GLN E  1 27  ? 146.888 132.397 146.502 1.00 33.20  ? 27   GLN E OE1 1 
ATOM   3399  N NE2 . GLN E  1 27  ? 145.033 132.962 145.371 1.00 31.79  ? 27   GLN E NE2 1 
ATOM   3400  N N   . SER E  1 28  ? 143.813 127.525 145.532 1.00 31.78  ? 28   SER E N   1 
ATOM   3401  C CA  . SER E  1 28  ? 143.102 127.073 144.326 1.00 29.87  ? 28   SER E CA  1 
ATOM   3402  C C   . SER E  1 28  ? 143.294 128.066 143.160 1.00 30.54  ? 28   SER E C   1 
ATOM   3403  O O   . SER E  1 28  ? 143.021 129.257 143.325 1.00 32.75  ? 28   SER E O   1 
ATOM   3404  C CB  . SER E  1 28  ? 141.619 126.870 144.664 1.00 29.04  ? 28   SER E CB  1 
ATOM   3405  O OG  . SER E  1 28  ? 140.919 126.249 143.580 1.00 25.66  ? 28   SER E OG  1 
ATOM   3406  N N   . ILE E  1 29  ? 143.781 127.589 142.006 1.00 31.39  ? 29   ILE E N   1 
ATOM   3407  C CA  . ILE E  1 29  ? 144.063 128.474 140.849 1.00 29.85  ? 29   ILE E CA  1 
ATOM   3408  C C   . ILE E  1 29  ? 143.152 128.212 139.647 1.00 31.31  ? 29   ILE E C   1 
ATOM   3409  O O   . ILE E  1 29  ? 143.571 128.304 138.487 1.00 30.54  ? 29   ILE E O   1 
ATOM   3410  C CB  . ILE E  1 29  ? 145.545 128.418 140.398 1.00 29.39  ? 29   ILE E CB  1 
ATOM   3411  C CG1 . ILE E  1 29  ? 146.043 126.970 140.314 1.00 26.63  ? 29   ILE E CG1 1 
ATOM   3412  C CG2 . ILE E  1 29  ? 146.418 129.226 141.341 1.00 29.59  ? 29   ILE E CG2 1 
ATOM   3413  C CD1 . ILE E  1 29  ? 146.953 126.693 139.136 1.00 21.91  ? 29   ILE E CD1 1 
ATOM   3414  N N   . SER E  1 30  ? 141.902 127.880 139.965 1.00 31.28  ? 30   SER E N   1 
ATOM   3415  C CA  . SER E  1 30  ? 140.878 127.515 138.988 1.00 31.06  ? 30   SER E CA  1 
ATOM   3416  C C   . SER E  1 30  ? 141.358 126.321 138.158 1.00 30.69  ? 30   SER E C   1 
ATOM   3417  O O   . SER E  1 30  ? 141.471 125.210 138.670 1.00 30.36  ? 30   SER E O   1 
ATOM   3418  C CB  . SER E  1 30  ? 140.501 128.720 138.111 1.00 31.25  ? 30   SER E CB  1 
ATOM   3419  O OG  . SER E  1 30  ? 139.437 128.397 137.234 1.00 36.63  ? 30   SER E OG  1 
ATOM   3420  N N   . SER E  1 31  ? 141.615 126.547 136.876 1.00 28.27  ? 31   SER E N   1 
ATOM   3421  C CA  . SER E  1 31  ? 142.429 125.630 136.087 1.00 27.60  ? 31   SER E CA  1 
ATOM   3422  C C   . SER E  1 31  ? 143.328 126.511 135.246 1.00 27.64  ? 31   SER E C   1 
ATOM   3423  O O   . SER E  1 31  ? 143.507 126.309 134.036 1.00 26.55  ? 31   SER E O   1 
ATOM   3424  C CB  . SER E  1 31  ? 141.562 124.692 135.240 1.00 25.82  ? 31   SER E CB  1 
ATOM   3425  O OG  . SER E  1 31  ? 140.641 125.426 134.451 1.00 31.47  ? 31   SER E OG  1 
ATOM   3426  N N   . TYR E  1 32  ? 143.893 127.498 135.924 1.00 29.52  ? 32   TYR E N   1 
ATOM   3427  C CA  . TYR E  1 32  ? 144.674 128.501 135.269 1.00 30.38  ? 32   TYR E CA  1 
ATOM   3428  C C   . TYR E  1 32  ? 146.129 128.064 135.292 1.00 27.57  ? 32   TYR E C   1 
ATOM   3429  O O   . TYR E  1 32  ? 146.998 128.735 135.855 1.00 29.36  ? 32   TYR E O   1 
ATOM   3430  C CB  . TYR E  1 32  ? 144.464 129.836 135.967 1.00 31.94  ? 32   TYR E CB  1 
ATOM   3431  C CG  . TYR E  1 32  ? 144.283 130.963 135.004 1.00 35.08  ? 32   TYR E CG  1 
ATOM   3432  C CD1 . TYR E  1 32  ? 143.505 132.068 135.338 1.00 36.82  ? 32   TYR E CD1 1 
ATOM   3433  C CD2 . TYR E  1 32  ? 144.884 130.929 133.746 1.00 42.45  ? 32   TYR E CD2 1 
ATOM   3434  C CE1 . TYR E  1 32  ? 143.340 133.118 134.451 1.00 36.80  ? 32   TYR E CE1 1 
ATOM   3435  C CE2 . TYR E  1 32  ? 144.724 131.970 132.852 1.00 46.57  ? 32   TYR E CE2 1 
ATOM   3436  C CZ  . TYR E  1 32  ? 143.950 133.063 133.210 1.00 38.28  ? 32   TYR E CZ  1 
ATOM   3437  O OH  . TYR E  1 32  ? 143.778 134.105 132.327 1.00 38.07  ? 32   TYR E OH  1 
ATOM   3438  N N   . LEU E  1 33  ? 146.373 126.919 134.656 1.00 26.72  ? 33   LEU E N   1 
ATOM   3439  C CA  . LEU E  1 33  ? 147.655 126.236 134.719 1.00 25.28  ? 33   LEU E CA  1 
ATOM   3440  C C   . LEU E  1 33  ? 148.170 125.888 133.334 1.00 24.40  ? 33   LEU E C   1 
ATOM   3441  O O   . LEU E  1 33  ? 147.392 125.722 132.386 1.00 24.41  ? 33   LEU E O   1 
ATOM   3442  C CB  . LEU E  1 33  ? 147.549 124.946 135.554 1.00 24.66  ? 33   LEU E CB  1 
ATOM   3443  C CG  . LEU E  1 33  ? 148.895 124.208 135.633 1.00 25.24  ? 33   LEU E CG  1 
ATOM   3444  C CD1 . LEU E  1 33  ? 149.792 124.860 136.708 1.00 35.17  ? 33   LEU E CD1 1 
ATOM   3445  C CD2 . LEU E  1 33  ? 148.763 122.699 135.867 1.00 19.73  ? 33   LEU E CD2 1 
ATOM   3446  N N   . ASN E  1 34  ? 149.496 125.748 133.246 1.00 20.56  ? 34   ASN E N   1 
ATOM   3447  C CA  . ASN E  1 34  ? 150.154 125.484 131.978 1.00 19.89  ? 34   ASN E CA  1 
ATOM   3448  C C   . ASN E  1 34  ? 151.239 124.425 132.145 1.00 20.92  ? 34   ASN E C   1 
ATOM   3449  O O   . ASN E  1 34  ? 151.770 124.229 133.251 1.00 21.88  ? 34   ASN E O   1 
ATOM   3450  C CB  . ASN E  1 34  ? 150.722 126.789 131.392 1.00 19.08  ? 34   ASN E CB  1 
ATOM   3451  C CG  . ASN E  1 34  ? 149.655 127.884 131.243 1.00 24.31  ? 34   ASN E CG  1 
ATOM   3452  O OD1 . ASN E  1 34  ? 148.535 127.627 130.794 1.00 28.31  ? 34   ASN E OD1 1 
ATOM   3453  N ND2 . ASN E  1 34  ? 150.013 129.107 131.615 1.00 28.30  ? 34   ASN E ND2 1 
ATOM   3454  N N   . TRP E  1 35  ? 151.537 123.734 131.038 1.00 18.39  ? 35   TRP E N   1 
ATOM   3455  C CA  . TRP E  1 35  ? 152.548 122.680 131.058 1.00 17.69  ? 35   TRP E CA  1 
ATOM   3456  C C   . TRP E  1 35  ? 153.542 122.988 129.952 1.00 17.60  ? 35   TRP E C   1 
ATOM   3457  O O   . TRP E  1 35  ? 153.151 123.077 128.745 1.00 15.23  ? 35   TRP E O   1 
ATOM   3458  C CB  . TRP E  1 35  ? 151.922 121.285 130.877 1.00 16.06  ? 35   TRP E CB  1 
ATOM   3459  C CG  . TRP E  1 35  ? 151.211 120.712 132.102 1.00 15.78  ? 35   TRP E CG  1 
ATOM   3460  C CD1 . TRP E  1 35  ? 149.858 120.594 132.280 1.00 16.02  ? 35   TRP E CD1 1 
ATOM   3461  C CD2 . TRP E  1 35  ? 151.822 120.161 133.284 1.00 18.00  ? 35   TRP E CD2 1 
ATOM   3462  N NE1 . TRP E  1 35  ? 149.586 120.015 133.497 1.00 19.17  ? 35   TRP E NE1 1 
ATOM   3463  C CE2 . TRP E  1 35  ? 150.772 119.732 134.132 1.00 17.77  ? 35   TRP E CE2 1 
ATOM   3464  C CE3 . TRP E  1 35  ? 153.151 119.986 133.705 1.00 8.38   ? 35   TRP E CE3 1 
ATOM   3465  C CZ2 . TRP E  1 35  ? 151.008 119.153 135.378 1.00 17.13  ? 35   TRP E CZ2 1 
ATOM   3466  C CZ3 . TRP E  1 35  ? 153.392 119.401 134.943 1.00 9.99   ? 35   TRP E CZ3 1 
ATOM   3467  C CH2 . TRP E  1 35  ? 152.319 118.995 135.763 1.00 18.10  ? 35   TRP E CH2 1 
ATOM   3468  N N   . TYR E  1 36  ? 154.793 123.192 130.363 1.00 18.57  ? 36   TYR E N   1 
ATOM   3469  C CA  . TYR E  1 36  ? 155.825 123.699 129.483 1.00 18.29  ? 36   TYR E CA  1 
ATOM   3470  C C   . TYR E  1 36  ? 156.886 122.618 129.357 1.00 21.34  ? 36   TYR E C   1 
ATOM   3471  O O   . TYR E  1 36  ? 157.065 121.808 130.276 1.00 21.03  ? 36   TYR E O   1 
ATOM   3472  C CB  . TYR E  1 36  ? 156.440 124.963 130.101 1.00 16.56  ? 36   TYR E CB  1 
ATOM   3473  C CG  . TYR E  1 36  ? 155.771 126.292 129.766 1.00 22.96  ? 36   TYR E CG  1 
ATOM   3474  C CD1 . TYR E  1 36  ? 154.747 126.814 130.565 1.00 24.51  ? 36   TYR E CD1 1 
ATOM   3475  C CD2 . TYR E  1 36  ? 156.220 127.064 128.693 1.00 18.62  ? 36   TYR E CD2 1 
ATOM   3476  C CE1 . TYR E  1 36  ? 154.165 128.055 130.277 1.00 22.21  ? 36   TYR E CE1 1 
ATOM   3477  C CE2 . TYR E  1 36  ? 155.646 128.301 128.396 1.00 22.37  ? 36   TYR E CE2 1 
ATOM   3478  C CZ  . TYR E  1 36  ? 154.622 128.790 129.193 1.00 25.62  ? 36   TYR E CZ  1 
ATOM   3479  O OH  . TYR E  1 36  ? 154.051 130.012 128.905 1.00 18.43  ? 36   TYR E OH  1 
ATOM   3480  N N   . GLN E  1 37  ? 157.573 122.595 128.223 1.00 22.16  ? 37   GLN E N   1 
ATOM   3481  C CA  . GLN E  1 37  ? 158.599 121.599 127.974 1.00 24.36  ? 37   GLN E CA  1 
ATOM   3482  C C   . GLN E  1 37  ? 159.872 122.310 127.619 1.00 25.02  ? 37   GLN E C   1 
ATOM   3483  O O   . GLN E  1 37  ? 159.892 123.182 126.750 1.00 24.97  ? 37   GLN E O   1 
ATOM   3484  C CB  . GLN E  1 37  ? 158.197 120.683 126.823 1.00 24.69  ? 37   GLN E CB  1 
ATOM   3485  C CG  . GLN E  1 37  ? 159.330 119.801 126.332 1.00 24.05  ? 37   GLN E CG  1 
ATOM   3486  C CD  . GLN E  1 37  ? 158.963 119.035 125.091 1.00 32.93  ? 37   GLN E CD  1 
ATOM   3487  O OE1 . GLN E  1 37  ? 158.518 119.610 124.096 1.00 36.46  ? 37   GLN E OE1 1 
ATOM   3488  N NE2 . GLN E  1 37  ? 159.148 117.721 125.133 1.00 28.49  ? 37   GLN E NE2 1 
ATOM   3489  N N   . GLN E  1 38  ? 160.942 121.931 128.291 1.00 24.87  ? 38   GLN E N   1 
ATOM   3490  C CA  . GLN E  1 38  ? 162.194 122.555 128.008 1.00 25.42  ? 38   GLN E CA  1 
ATOM   3491  C C   . GLN E  1 38  ? 163.209 121.475 127.758 1.00 24.66  ? 38   GLN E C   1 
ATOM   3492  O O   . GLN E  1 38  ? 163.705 120.831 128.693 1.00 25.26  ? 38   GLN E O   1 
ATOM   3493  C CB  . GLN E  1 38  ? 162.609 123.448 129.164 1.00 26.31  ? 38   GLN E CB  1 
ATOM   3494  C CG  . GLN E  1 38  ? 164.060 123.872 129.076 1.00 30.17  ? 38   GLN E CG  1 
ATOM   3495  C CD  . GLN E  1 38  ? 164.401 124.851 130.159 1.00 34.93  ? 38   GLN E CD  1 
ATOM   3496  O OE1 . GLN E  1 38  ? 165.477 124.782 130.745 1.00 38.05  ? 38   GLN E OE1 1 
ATOM   3497  N NE2 . GLN E  1 38  ? 163.487 125.773 130.444 1.00 39.38  ? 38   GLN E NE2 1 
ATOM   3498  N N   . LYS E  1 39  ? 163.470 121.244 126.478 1.00 25.43  ? 39   LYS E N   1 
ATOM   3499  C CA  . LYS E  1 39  ? 164.608 120.452 126.085 1.00 25.11  ? 39   LYS E CA  1 
ATOM   3500  C C   . LYS E  1 39  ? 165.819 121.343 126.278 1.00 24.49  ? 39   LYS E C   1 
ATOM   3501  O O   . LYS E  1 39  ? 165.716 122.569 126.174 1.00 23.45  ? 39   LYS E O   1 
ATOM   3502  C CB  . LYS E  1 39  ? 164.486 119.955 124.639 1.00 24.40  ? 39   LYS E CB  1 
ATOM   3503  C CG  . LYS E  1 39  ? 163.346 120.554 123.830 1.00 27.23  ? 39   LYS E CG  1 
ATOM   3504  C CD  . LYS E  1 39  ? 163.065 119.731 122.554 1.00 25.24  ? 39   LYS E CD  1 
ATOM   3505  C CE  . LYS E  1 39  ? 162.568 118.290 122.919 1.00 25.30  ? 39   LYS E CE  1 
ATOM   3506  N NZ  . LYS E  1 39  ? 162.441 117.487 121.608 1.00 31.11  ? 39   LYS E NZ  1 
ATOM   3507  N N   . PRO E  1 40  ? 166.975 120.726 126.549 1.00 24.89  ? 40   PRO E N   1 
ATOM   3508  C CA  . PRO E  1 40  ? 168.198 121.358 127.016 1.00 24.13  ? 40   PRO E CA  1 
ATOM   3509  C C   . PRO E  1 40  ? 168.715 122.307 125.949 1.00 24.77  ? 40   PRO E C   1 
ATOM   3510  O O   . PRO E  1 40  ? 168.663 121.983 124.759 1.00 21.20  ? 40   PRO E O   1 
ATOM   3511  C CB  . PRO E  1 40  ? 169.155 120.172 127.209 1.00 26.44  ? 40   PRO E CB  1 
ATOM   3512  C CG  . PRO E  1 40  ? 168.287 118.947 127.272 1.00 25.98  ? 40   PRO E CG  1 
ATOM   3513  C CD  . PRO E  1 40  ? 167.170 119.275 126.331 1.00 24.34  ? 40   PRO E CD  1 
ATOM   3514  N N   . GLY E  1 41  ? 169.203 123.469 126.363 1.00 27.96  ? 41   GLY E N   1 
ATOM   3515  C CA  . GLY E  1 41  ? 169.482 124.517 125.403 1.00 28.18  ? 41   GLY E CA  1 
ATOM   3516  C C   . GLY E  1 41  ? 168.152 125.203 125.155 1.00 30.72  ? 41   GLY E C   1 
ATOM   3517  O O   . GLY E  1 41  ? 167.880 126.252 125.756 1.00 31.55  ? 41   GLY E O   1 
ATOM   3518  N N   . LYS E  1 42  ? 167.302 124.601 124.319 1.00 31.65  ? 42   LYS E N   1 
ATOM   3519  C CA  . LYS E  1 42  ? 166.046 125.238 123.884 1.00 31.99  ? 42   LYS E CA  1 
ATOM   3520  C C   . LYS E  1 42  ? 165.212 125.826 125.033 1.00 30.84  ? 42   LYS E C   1 
ATOM   3521  O O   . LYS E  1 42  ? 165.351 125.419 126.205 1.00 32.03  ? 42   LYS E O   1 
ATOM   3522  C CB  . LYS E  1 42  ? 165.201 124.296 123.002 1.00 32.34  ? 42   LYS E CB  1 
ATOM   3523  C CG  . LYS E  1 42  ? 165.801 124.002 121.605 1.00 36.06  ? 42   LYS E CG  1 
ATOM   3524  C CD  . LYS E  1 42  ? 165.659 125.188 120.635 1.00 34.86  ? 42   LYS E CD  1 
ATOM   3525  C CE  . LYS E  1 42  ? 166.413 124.941 119.324 1.00 33.08  ? 42   LYS E CE  1 
ATOM   3526  N NZ  . LYS E  1 42  ? 165.707 123.950 118.449 1.00 21.98  ? 42   LYS E NZ  1 
ATOM   3527  N N   . ALA E  1 43  ? 164.350 126.789 124.680 1.00 29.12  ? 43   ALA E N   1 
ATOM   3528  C CA  . ALA E  1 43  ? 163.596 127.546 125.686 1.00 27.73  ? 43   ALA E CA  1 
ATOM   3529  C C   . ALA E  1 43  ? 162.513 126.656 126.285 1.00 26.71  ? 43   ALA E C   1 
ATOM   3530  O O   . ALA E  1 43  ? 162.371 125.498 125.877 1.00 29.53  ? 43   ALA E O   1 
ATOM   3531  C CB  . ALA E  1 43  ? 162.983 128.780 125.029 1.00 25.88  ? 43   ALA E CB  1 
ATOM   3532  N N   . PRO E  1 44  ? 161.759 127.169 127.273 1.00 23.82  ? 44   PRO E N   1 
ATOM   3533  C CA  . PRO E  1 44  ? 160.569 126.392 127.613 1.00 24.22  ? 44   PRO E CA  1 
ATOM   3534  C C   . PRO E  1 44  ? 159.462 126.447 126.544 1.00 26.18  ? 44   PRO E C   1 
ATOM   3535  O O   . PRO E  1 44  ? 158.677 127.408 126.534 1.00 29.43  ? 44   PRO E O   1 
ATOM   3536  C CB  . PRO E  1 44  ? 160.074 127.052 128.914 1.00 24.91  ? 44   PRO E CB  1 
ATOM   3537  C CG  . PRO E  1 44  ? 161.212 127.918 129.389 1.00 18.06  ? 44   PRO E CG  1 
ATOM   3538  C CD  . PRO E  1 44  ? 161.932 128.338 128.158 1.00 25.40  ? 44   PRO E CD  1 
ATOM   3539  N N   . LYS E  1 45  ? 159.384 125.451 125.658 1.00 25.62  ? 45   LYS E N   1 
ATOM   3540  C CA  . LYS E  1 45  ? 158.216 125.373 124.751 1.00 24.58  ? 45   LYS E CA  1 
ATOM   3541  C C   . LYS E  1 45  ? 156.984 124.801 125.450 1.00 23.45  ? 45   LYS E C   1 
ATOM   3542  O O   . LYS E  1 45  ? 157.062 123.832 126.205 1.00 22.03  ? 45   LYS E O   1 
ATOM   3543  C CB  . LYS E  1 45  ? 158.542 124.604 123.435 1.00 23.01  ? 45   LYS E CB  1 
ATOM   3544  C CG  . LYS E  1 45  ? 159.513 125.407 122.547 1.00 27.64  ? 45   LYS E CG  1 
ATOM   3545  C CD  . LYS E  1 45  ? 159.956 124.595 121.341 1.00 25.99  ? 45   LYS E CD  1 
ATOM   3546  C CE  . LYS E  1 45  ? 161.320 125.187 120.816 1.00 24.08  ? 45   LYS E CE  1 
ATOM   3547  N NZ  . LYS E  1 45  ? 161.676 124.443 119.538 1.00 32.62  ? 45   LYS E NZ  1 
ATOM   3548  N N   . LEU E  1 46  ? 155.846 125.412 125.146 1.00 24.08  ? 46   LEU E N   1 
ATOM   3549  C CA  . LEU E  1 46  ? 154.590 125.180 125.842 1.00 23.08  ? 46   LEU E CA  1 
ATOM   3550  C C   . LEU E  1 46  ? 153.735 124.085 125.196 1.00 23.74  ? 46   LEU E C   1 
ATOM   3551  O O   . LEU E  1 46  ? 153.694 123.961 123.969 1.00 23.04  ? 46   LEU E O   1 
ATOM   3552  C CB  . LEU E  1 46  ? 153.815 126.497 125.893 1.00 21.63  ? 46   LEU E CB  1 
ATOM   3553  C CG  . LEU E  1 46  ? 152.388 126.441 126.436 1.00 21.05  ? 46   LEU E CG  1 
ATOM   3554  C CD1 . LEU E  1 46  ? 152.361 126.166 127.929 1.00 18.31  ? 46   LEU E CD1 1 
ATOM   3555  C CD2 . LEU E  1 46  ? 151.719 127.757 126.148 1.00 27.93  ? 46   LEU E CD2 1 
ATOM   3556  N N   . LEU E  1 47  ? 153.044 123.304 126.031 1.00 22.11  ? 47   LEU E N   1 
ATOM   3557  C CA  . LEU E  1 47  ? 152.284 122.148 125.552 1.00 18.68  ? 47   LEU E CA  1 
ATOM   3558  C C   . LEU E  1 47  ? 150.776 122.258 125.779 1.00 20.85  ? 47   LEU E C   1 
ATOM   3559  O O   . LEU E  1 47  ? 149.994 122.048 124.852 1.00 23.53  ? 47   LEU E O   1 
ATOM   3560  C CB  . LEU E  1 47  ? 152.809 120.843 126.182 1.00 18.45  ? 47   LEU E CB  1 
ATOM   3561  C CG  . LEU E  1 47  ? 154.278 120.389 126.039 1.00 15.89  ? 47   LEU E CG  1 
ATOM   3562  C CD1 . LEU E  1 47  ? 154.421 118.949 126.519 1.00 11.88  ? 47   LEU E CD1 1 
ATOM   3563  C CD2 . LEU E  1 47  ? 154.840 120.535 124.621 1.00 17.48  ? 47   LEU E CD2 1 
ATOM   3564  N N   . ILE E  1 48  ? 150.375 122.582 127.009 1.00 21.66  ? 48   ILE E N   1 
ATOM   3565  C CA  . ILE E  1 48  ? 148.957 122.607 127.368 1.00 21.63  ? 48   ILE E CA  1 
ATOM   3566  C C   . ILE E  1 48  ? 148.526 123.968 127.874 1.00 22.63  ? 48   ILE E C   1 
ATOM   3567  O O   . ILE E  1 48  ? 149.315 124.697 128.485 1.00 21.42  ? 48   ILE E O   1 
ATOM   3568  C CB  . ILE E  1 48  ? 148.631 121.529 128.448 1.00 22.45  ? 48   ILE E CB  1 
ATOM   3569  C CG1 . ILE E  1 48  ? 148.124 120.244 127.790 1.00 19.78  ? 48   ILE E CG1 1 
ATOM   3570  C CG2 . ILE E  1 48  ? 147.581 122.011 129.457 1.00 22.08  ? 48   ILE E CG2 1 
ATOM   3571  C CD1 . ILE E  1 48  ? 149.240 119.288 127.387 1.00 24.31  ? 48   ILE E CD1 1 
ATOM   3572  N N   . TYR E  1 49  ? 147.264 124.299 127.609 1.00 26.82  ? 49   TYR E N   1 
ATOM   3573  C CA  . TYR E  1 49  ? 146.622 125.441 128.230 1.00 28.99  ? 49   TYR E CA  1 
ATOM   3574  C C   . TYR E  1 49  ? 145.460 125.086 129.078 1.00 26.57  ? 49   TYR E C   1 
ATOM   3575  O O   . TYR E  1 49  ? 144.660 124.164 128.700 1.00 24.33  ? 49   TYR E O   1 
ATOM   3576  C CB  . TYR E  1 49  ? 146.095 126.413 127.195 1.00 33.77  ? 49   TYR E CB  1 
ATOM   3577  C CG  . TYR E  1 49  ? 147.087 127.467 126.995 1.00 38.26  ? 49   TYR E CG  1 
ATOM   3578  C CD1 . TYR E  1 49  ? 147.349 127.977 125.743 1.00 44.16  ? 49   TYR E CD1 1 
ATOM   3579  C CD2 . TYR E  1 49  ? 147.851 127.907 128.073 1.00 44.58  ? 49   TYR E CD2 1 
ATOM   3580  C CE1 . TYR E  1 49  ? 148.316 128.932 125.572 1.00 51.35  ? 49   TYR E CE1 1 
ATOM   3581  C CE2 . TYR E  1 49  ? 148.810 128.856 127.922 1.00 49.44  ? 49   TYR E CE2 1 
ATOM   3582  C CZ  . TYR E  1 49  ? 149.042 129.370 126.675 1.00 47.36  ? 49   TYR E CZ  1 
ATOM   3583  O OH  . TYR E  1 49  ? 150.012 130.329 126.555 1.00 47.40  ? 49   TYR E OH  1 
ATOM   3584  N N   . ALA E  1 50  ? 145.317 125.854 130.178 1.00 25.60  ? 50   ALA E N   1 
ATOM   3585  C CA  . ALA E  1 50  ? 144.084 125.759 130.956 1.00 27.30  ? 50   ALA E CA  1 
ATOM   3586  C C   . ALA E  1 50  ? 143.838 124.296 131.255 1.00 28.44  ? 50   ALA E C   1 
ATOM   3587  O O   . ALA E  1 50  ? 142.782 123.727 130.910 1.00 28.23  ? 50   ALA E O   1 
ATOM   3588  C CB  . ALA E  1 50  ? 142.912 126.387 130.188 1.00 23.98  ? 50   ALA E CB  1 
ATOM   3589  N N   . ALA E  1 51  ? 144.858 123.684 131.847 1.00 28.68  ? 51   ALA E N   1 
ATOM   3590  C CA  . ALA E  1 51  ? 144.769 122.335 132.368 1.00 29.27  ? 51   ALA E CA  1 
ATOM   3591  C C   . ALA E  1 51  ? 144.652 121.216 131.327 1.00 30.21  ? 51   ALA E C   1 
ATOM   3592  O O   . ALA E  1 51  ? 145.351 120.205 131.472 1.00 31.65  ? 51   ALA E O   1 
ATOM   3593  C CB  . ALA E  1 51  ? 143.642 122.221 133.421 1.00 24.90  ? 51   ALA E CB  1 
ATOM   3594  N N   . SER E  1 52  ? 143.813 121.361 130.292 1.00 28.69  ? 52   SER E N   1 
ATOM   3595  C CA  . SER E  1 52  ? 143.461 120.193 129.439 1.00 29.58  ? 52   SER E CA  1 
ATOM   3596  C C   . SER E  1 52  ? 143.544 120.393 127.917 1.00 30.37  ? 52   SER E C   1 
ATOM   3597  O O   . SER E  1 52  ? 143.571 119.421 127.140 1.00 31.48  ? 52   SER E O   1 
ATOM   3598  C CB  . SER E  1 52  ? 142.058 119.675 129.805 1.00 28.66  ? 52   SER E CB  1 
ATOM   3599  O OG  . SER E  1 52  ? 141.010 120.604 129.395 1.00 31.95  ? 52   SER E OG  1 
ATOM   3600  N N   . SER E  1 53  ? 143.572 121.656 127.524 1.00 30.58  ? 53   SER E N   1 
ATOM   3601  C CA  . SER E  1 53  ? 143.614 122.064 126.140 1.00 29.71  ? 53   SER E CA  1 
ATOM   3602  C C   . SER E  1 53  ? 145.055 122.132 125.634 1.00 29.93  ? 53   SER E C   1 
ATOM   3603  O O   . SER E  1 53  ? 145.871 122.883 126.162 1.00 32.57  ? 53   SER E O   1 
ATOM   3604  C CB  . SER E  1 53  ? 142.940 123.442 126.040 1.00 26.84  ? 53   SER E CB  1 
ATOM   3605  O OG  . SER E  1 53  ? 143.188 124.051 124.789 1.00 28.77  ? 53   SER E OG  1 
ATOM   3606  N N   . LEU E  1 54  ? 145.347 121.338 124.604 1.00 29.67  ? 54   LEU E N   1 
ATOM   3607  C CA  . LEU E  1 54  ? 146.668 121.266 123.977 1.00 30.57  ? 54   LEU E CA  1 
ATOM   3608  C C   . LEU E  1 54  ? 146.969 122.490 123.135 1.00 31.33  ? 54   LEU E C   1 
ATOM   3609  O O   . LEU E  1 54  ? 146.054 123.259 122.796 1.00 33.02  ? 54   LEU E O   1 
ATOM   3610  C CB  . LEU E  1 54  ? 146.704 120.070 123.025 1.00 28.68  ? 54   LEU E CB  1 
ATOM   3611  C CG  . LEU E  1 54  ? 146.503 118.630 123.534 1.00 32.26  ? 54   LEU E CG  1 
ATOM   3612  C CD1 . LEU E  1 54  ? 146.175 117.715 122.362 1.00 31.28  ? 54   LEU E CD1 1 
ATOM   3613  C CD2 . LEU E  1 54  ? 147.717 118.109 124.309 1.00 26.62  ? 54   LEU E CD2 1 
ATOM   3614  N N   . GLN E  1 55  ? 148.230 122.672 122.764 1.00 30.55  ? 55   GLN E N   1 
ATOM   3615  C CA  . GLN E  1 55  ? 148.523 123.649 121.725 1.00 31.24  ? 55   GLN E CA  1 
ATOM   3616  C C   . GLN E  1 55  ? 148.910 122.922 120.450 1.00 30.39  ? 55   GLN E C   1 
ATOM   3617  O O   . GLN E  1 55  ? 149.507 121.847 120.506 1.00 33.05  ? 55   GLN E O   1 
ATOM   3618  C CB  . GLN E  1 55  ? 149.614 124.609 122.188 1.00 31.32  ? 55   GLN E CB  1 
ATOM   3619  C CG  . GLN E  1 55  ? 149.152 125.483 123.346 1.00 33.07  ? 55   GLN E CG  1 
ATOM   3620  C CD  . GLN E  1 55  ? 148.043 126.427 122.930 1.00 37.20  ? 55   GLN E CD  1 
ATOM   3621  O OE1 . GLN E  1 55  ? 146.872 126.218 123.255 1.00 36.34  ? 55   GLN E OE1 1 
ATOM   3622  N NE2 . GLN E  1 55  ? 148.406 127.466 122.186 1.00 37.49  ? 55   GLN E NE2 1 
ATOM   3623  N N   . SER E  1 56  ? 148.555 123.502 119.306 1.00 28.23  ? 56   SER E N   1 
ATOM   3624  C CA  . SER E  1 56  ? 148.870 122.917 118.001 1.00 30.73  ? 56   SER E CA  1 
ATOM   3625  C C   . SER E  1 56  ? 150.348 122.545 117.884 1.00 30.91  ? 56   SER E C   1 
ATOM   3626  O O   . SER E  1 56  ? 151.215 123.179 118.500 1.00 32.13  ? 56   SER E O   1 
ATOM   3627  C CB  . SER E  1 56  ? 148.473 123.877 116.878 1.00 31.43  ? 56   SER E CB  1 
ATOM   3628  O OG  . SER E  1 56  ? 147.113 124.284 117.008 1.00 32.25  ? 56   SER E OG  1 
ATOM   3629  N N   . GLY E  1 57  ? 150.631 121.518 117.092 1.00 31.41  ? 57   GLY E N   1 
ATOM   3630  C CA  . GLY E  1 57  ? 151.976 120.981 117.032 1.00 31.34  ? 57   GLY E CA  1 
ATOM   3631  C C   . GLY E  1 57  ? 152.217 119.968 118.140 1.00 33.06  ? 57   GLY E C   1 
ATOM   3632  O O   . GLY E  1 57  ? 153.039 119.067 117.970 1.00 36.22  ? 57   GLY E O   1 
ATOM   3633  N N   . VAL E  1 58  ? 151.517 120.101 119.276 1.00 31.95  ? 58   VAL E N   1 
ATOM   3634  C CA  . VAL E  1 58  ? 151.734 119.140 120.362 1.00 30.67  ? 58   VAL E CA  1 
ATOM   3635  C C   . VAL E  1 58  ? 151.163 117.793 119.929 1.00 29.99  ? 58   VAL E C   1 
ATOM   3636  O O   . VAL E  1 58  ? 150.004 117.721 119.507 1.00 33.51  ? 58   VAL E O   1 
ATOM   3637  C CB  . VAL E  1 58  ? 151.115 119.604 121.705 1.00 31.89  ? 58   VAL E CB  1 
ATOM   3638  C CG1 . VAL E  1 58  ? 149.770 118.932 121.938 1.00 29.66  ? 58   VAL E CG1 1 
ATOM   3639  C CG2 . VAL E  1 58  ? 152.051 119.255 122.846 1.00 31.82  ? 58   VAL E CG2 1 
ATOM   3640  N N   . PRO E  1 59  ? 151.993 116.730 119.957 1.00 27.20  ? 59   PRO E N   1 
ATOM   3641  C CA  . PRO E  1 59  ? 151.423 115.395 119.753 1.00 23.72  ? 59   PRO E CA  1 
ATOM   3642  C C   . PRO E  1 59  ? 150.278 115.153 120.729 1.00 21.61  ? 59   PRO E C   1 
ATOM   3643  O O   . PRO E  1 59  ? 150.210 115.804 121.778 1.00 20.06  ? 59   PRO E O   1 
ATOM   3644  C CB  . PRO E  1 59  ? 152.587 114.442 120.077 1.00 23.35  ? 59   PRO E CB  1 
ATOM   3645  C CG  . PRO E  1 59  ? 153.699 115.308 120.583 1.00 19.89  ? 59   PRO E CG  1 
ATOM   3646  C CD  . PRO E  1 59  ? 153.470 116.694 120.108 1.00 23.28  ? 59   PRO E CD  1 
ATOM   3647  N N   . SER E  1 60  ? 149.391 114.219 120.422 1.00 23.13  ? 60   SER E N   1 
ATOM   3648  C CA  . SER E  1 60  ? 148.230 114.042 121.288 1.00 25.14  ? 60   SER E CA  1 
ATOM   3649  C C   . SER E  1 60  ? 148.479 113.122 122.503 1.00 25.06  ? 60   SER E C   1 
ATOM   3650  O O   . SER E  1 60  ? 147.552 112.844 123.275 1.00 24.27  ? 60   SER E O   1 
ATOM   3651  C CB  . SER E  1 60  ? 147.020 113.592 120.466 1.00 25.53  ? 60   SER E CB  1 
ATOM   3652  O OG  . SER E  1 60  ? 147.254 112.220 119.947 1.00 29.68  ? 60   SER E OG  1 
ATOM   3653  N N   . ARG E  1 61  ? 149.729 112.671 122.665 1.00 24.19  ? 61   ARG E N   1 
ATOM   3654  C CA  . ARG E  1 61  ? 150.137 111.745 123.741 1.00 23.03  ? 61   ARG E CA  1 
ATOM   3655  C C   . ARG E  1 61  ? 150.073 112.459 125.083 1.00 22.65  ? 61   ARG E C   1 
ATOM   3656  O O   . ARG E  1 61  ? 149.714 111.874 126.118 1.00 23.56  ? 61   ARG E O   1 
ATOM   3657  C CB  . ARG E  1 61  ? 151.587 111.302 123.507 1.00 22.13  ? 61   ARG E CB  1 
ATOM   3658  C CG  . ARG E  1 61  ? 151.841 110.532 122.214 1.00 28.34  ? 61   ARG E CG  1 
ATOM   3659  C CD  . ARG E  1 61  ? 153.093 111.040 121.484 1.00 35.21  ? 61   ARG E CD  1 
ATOM   3660  N NE  . ARG E  1 61  ? 154.161 111.456 122.404 1.00 30.56  ? 61   ARG E NE  1 
ATOM   3661  C CZ  . ARG E  1 61  ? 155.259 112.118 122.044 1.00 37.47  ? 61   ARG E CZ  1 
ATOM   3662  N NH1 . ARG E  1 61  ? 155.466 112.456 120.772 1.00 39.21  ? 61   ARG E NH1 1 
ATOM   3663  N NH2 . ARG E  1 61  ? 156.147 112.456 122.966 1.00 42.07  ? 61   ARG E NH2 1 
ATOM   3664  N N   . PHE E  1 62  ? 150.456 113.730 125.029 1.00 23.37  ? 62   PHE E N   1 
ATOM   3665  C CA  . PHE E  1 62  ? 150.479 114.628 126.158 1.00 19.17  ? 62   PHE E CA  1 
ATOM   3666  C C   . PHE E  1 62  ? 149.076 115.045 126.529 1.00 18.72  ? 62   PHE E C   1 
ATOM   3667  O O   . PHE E  1 62  ? 148.216 115.193 125.649 1.00 15.46  ? 62   PHE E O   1 
ATOM   3668  C CB  . PHE E  1 62  ? 151.234 115.897 125.762 1.00 20.59  ? 62   PHE E CB  1 
ATOM   3669  C CG  . PHE E  1 62  ? 152.684 115.675 125.468 1.00 14.84  ? 62   PHE E CG  1 
ATOM   3670  C CD1 . PHE E  1 62  ? 153.178 115.799 124.169 1.00 6.22   ? 62   PHE E CD1 1 
ATOM   3671  C CD2 . PHE E  1 62  ? 153.574 115.368 126.493 1.00 13.96  ? 62   PHE E CD2 1 
ATOM   3672  C CE1 . PHE E  1 62  ? 154.533 115.605 123.902 1.00 4.56   ? 62   PHE E CE1 1 
ATOM   3673  C CE2 . PHE E  1 62  ? 154.928 115.175 126.233 1.00 4.81   ? 62   PHE E CE2 1 
ATOM   3674  C CZ  . PHE E  1 62  ? 155.410 115.292 124.937 1.00 14.95  ? 62   PHE E CZ  1 
ATOM   3675  N N   . SER E  1 63  ? 148.851 115.244 127.827 1.00 21.27  ? 63   SER E N   1 
ATOM   3676  C CA  . SER E  1 63  ? 147.640 115.920 128.291 1.00 22.70  ? 63   SER E CA  1 
ATOM   3677  C C   . SER E  1 63  ? 147.658 116.324 129.758 1.00 22.68  ? 63   SER E C   1 
ATOM   3678  O O   . SER E  1 63  ? 148.565 115.991 130.526 1.00 23.23  ? 63   SER E O   1 
ATOM   3679  C CB  . SER E  1 63  ? 146.375 115.103 127.981 1.00 23.65  ? 63   SER E CB  1 
ATOM   3680  O OG  . SER E  1 63  ? 146.449 113.802 128.557 1.00 29.06  ? 63   SER E OG  1 
ATOM   3681  N N   . GLY E  1 64  ? 146.597 117.040 130.112 1.00 20.83  ? 64   GLY E N   1 
ATOM   3682  C CA  . GLY E  1 64  ? 146.450 117.656 131.403 1.00 20.36  ? 64   GLY E CA  1 
ATOM   3683  C C   . GLY E  1 64  ? 145.006 117.479 131.798 1.00 21.52  ? 64   GLY E C   1 
ATOM   3684  O O   . GLY E  1 64  ? 144.113 117.321 130.955 1.00 16.48  ? 64   GLY E O   1 
ATOM   3685  N N   . SER E  1 65  ? 144.802 117.497 133.097 1.00 22.19  ? 65   SER E N   1 
ATOM   3686  C CA  . SER E  1 65  ? 143.532 117.228 133.679 1.00 25.96  ? 65   SER E CA  1 
ATOM   3687  C C   . SER E  1 65  ? 143.669 117.836 135.033 1.00 26.17  ? 65   SER E C   1 
ATOM   3688  O O   . SER E  1 65  ? 144.768 117.918 135.598 1.00 26.77  ? 65   SER E O   1 
ATOM   3689  C CB  . SER E  1 65  ? 143.317 115.721 133.825 1.00 26.94  ? 65   SER E CB  1 
ATOM   3690  O OG  . SER E  1 65  ? 144.412 115.118 134.501 1.00 31.38  ? 65   SER E OG  1 
ATOM   3691  N N   . GLY E  1 66  ? 142.526 118.288 135.557 1.00 27.95  ? 66   GLY E N   1 
ATOM   3692  C CA  . GLY E  1 66  ? 142.542 118.491 137.008 1.00 33.79  ? 66   GLY E CA  1 
ATOM   3693  C C   . GLY E  1 66  ? 142.195 119.930 137.175 1.00 35.52  ? 66   GLY E C   1 
ATOM   3694  O O   . GLY E  1 66  ? 142.531 120.761 136.330 1.00 36.92  ? 66   GLY E O   1 
ATOM   3695  N N   . SER E  1 67  ? 141.495 120.228 138.253 1.00 36.61  ? 67   SER E N   1 
ATOM   3696  C CA  . SER E  1 67  ? 141.131 121.599 138.490 1.00 36.77  ? 67   SER E CA  1 
ATOM   3697  C C   . SER E  1 67  ? 141.317 121.993 139.935 1.00 35.97  ? 67   SER E C   1 
ATOM   3698  O O   . SER E  1 67  ? 141.194 121.165 140.843 1.00 37.30  ? 67   SER E O   1 
ATOM   3699  C CB  . SER E  1 67  ? 139.683 121.858 138.073 1.00 37.52  ? 67   SER E CB  1 
ATOM   3700  O OG  . SER E  1 67  ? 139.307 123.244 138.351 1.00 41.89  ? 67   SER E OG  1 
ATOM   3701  N N   . GLY E  1 68  ? 141.611 123.273 140.137 1.00 33.78  ? 68   GLY E N   1 
ATOM   3702  C CA  . GLY E  1 68  ? 141.682 123.857 141.470 1.00 31.73  ? 68   GLY E CA  1 
ATOM   3703  C C   . GLY E  1 68  ? 143.067 123.797 142.085 1.00 29.95  ? 68   GLY E C   1 
ATOM   3704  O O   . GLY E  1 68  ? 143.811 124.784 142.063 1.00 27.51  ? 68   GLY E O   1 
ATOM   3705  N N   . THR E  1 69  ? 143.400 122.624 142.625 1.00 32.12  ? 69   THR E N   1 
ATOM   3706  C CA  . THR E  1 69  ? 144.653 122.385 143.340 1.00 29.58  ? 69   THR E CA  1 
ATOM   3707  C C   . THR E  1 69  ? 145.482 121.261 142.702 1.00 29.66  ? 69   THR E C   1 
ATOM   3708  O O   . THR E  1 69  ? 146.701 121.396 142.550 1.00 27.89  ? 69   THR E O   1 
ATOM   3709  C CB  . THR E  1 69  ? 144.370 122.044 144.823 1.00 31.32  ? 69   THR E CB  1 
ATOM   3710  O OG1 . THR E  1 69  ? 143.509 123.046 145.391 1.00 31.23  ? 69   THR E OG1 1 
ATOM   3711  C CG2 . THR E  1 69  ? 145.671 121.973 145.636 1.00 30.48  ? 69   THR E CG2 1 
ATOM   3712  N N   . ASP E  1 70  ? 144.835 120.158 142.331 1.00 29.85  ? 70   ASP E N   1 
ATOM   3713  C CA  . ASP E  1 70  ? 145.524 119.046 141.672 1.00 28.06  ? 70   ASP E CA  1 
ATOM   3714  C C   . ASP E  1 70  ? 145.598 119.230 140.174 1.00 25.56  ? 70   ASP E C   1 
ATOM   3715  O O   . ASP E  1 70  ? 144.568 119.509 139.511 1.00 24.73  ? 70   ASP E O   1 
ATOM   3716  C CB  . ASP E  1 70  ? 144.805 117.730 141.933 1.00 28.91  ? 70   ASP E CB  1 
ATOM   3717  C CG  . ASP E  1 70  ? 145.163 117.140 143.258 1.00 32.62  ? 70   ASP E CG  1 
ATOM   3718  O OD1 . ASP E  1 70  ? 145.348 115.904 143.332 1.00 36.15  ? 70   ASP E OD1 1 
ATOM   3719  O OD2 . ASP E  1 70  ? 145.269 117.910 144.240 1.00 26.37  ? 70   ASP E OD2 1 
ATOM   3720  N N   . PHE E  1 71  ? 146.792 119.076 139.616 1.00 22.72  ? 71   PHE E N   1 
ATOM   3721  C CA  . PHE E  1 71  ? 146.959 119.202 138.170 1.00 19.84  ? 71   PHE E CA  1 
ATOM   3722  C C   . PHE E  1 71  ? 147.864 118.094 137.637 1.00 19.07  ? 71   PHE E C   1 
ATOM   3723  O O   . PHE E  1 71  ? 148.799 117.671 138.337 1.00 19.15  ? 71   PHE E O   1 
ATOM   3724  C CB  . PHE E  1 71  ? 147.456 120.604 137.825 1.00 19.77  ? 71   PHE E CB  1 
ATOM   3725  C CG  . PHE E  1 71  ? 146.414 121.670 138.034 1.00 13.84  ? 71   PHE E CG  1 
ATOM   3726  C CD1 . PHE E  1 71  ? 146.373 122.409 139.212 1.00 13.80  ? 71   PHE E CD1 1 
ATOM   3727  C CD2 . PHE E  1 71  ? 145.453 121.911 137.057 1.00 20.41  ? 71   PHE E CD2 1 
ATOM   3728  C CE1 . PHE E  1 71  ? 145.398 123.379 139.404 1.00 6.98   ? 71   PHE E CE1 1 
ATOM   3729  C CE2 . PHE E  1 71  ? 144.477 122.881 137.238 1.00 20.74  ? 71   PHE E CE2 1 
ATOM   3730  C CZ  . PHE E  1 71  ? 144.446 123.611 138.409 1.00 14.78  ? 71   PHE E CZ  1 
ATOM   3731  N N   . THR E  1 72  ? 147.595 117.591 136.432 1.00 20.49  ? 72   THR E N   1 
ATOM   3732  C CA  . THR E  1 72  ? 148.284 116.369 135.982 1.00 19.66  ? 72   THR E CA  1 
ATOM   3733  C C   . THR E  1 72  ? 148.796 116.349 134.518 1.00 21.42  ? 72   THR E C   1 
ATOM   3734  O O   . THR E  1 72  ? 148.023 116.555 133.543 1.00 22.39  ? 72   THR E O   1 
ATOM   3735  C CB  . THR E  1 72  ? 147.437 115.088 136.323 1.00 19.91  ? 72   THR E CB  1 
ATOM   3736  O OG1 . THR E  1 72  ? 146.903 115.196 137.671 1.00 20.37  ? 72   THR E OG1 1 
ATOM   3737  C CG2 . THR E  1 72  ? 148.285 113.806 136.222 1.00 18.89  ? 72   THR E CG2 1 
ATOM   3738  N N   . LEU E  1 73  ? 150.100 116.118 134.358 1.00 24.53  ? 73   LEU E N   1 
ATOM   3739  C CA  . LEU E  1 73  ? 150.641 115.892 133.024 1.00 23.44  ? 73   LEU E CA  1 
ATOM   3740  C C   . LEU E  1 73  ? 150.880 114.415 132.812 1.00 21.43  ? 73   LEU E C   1 
ATOM   3741  O O   . LEU E  1 73  ? 151.622 113.786 133.571 1.00 24.15  ? 73   LEU E O   1 
ATOM   3742  C CB  . LEU E  1 73  ? 151.949 116.659 132.798 1.00 20.87  ? 73   LEU E CB  1 
ATOM   3743  C CG  . LEU E  1 73  ? 152.489 116.469 131.360 1.00 19.00  ? 73   LEU E CG  1 
ATOM   3744  C CD1 . LEU E  1 73  ? 151.652 117.235 130.335 1.00 18.99  ? 73   LEU E CD1 1 
ATOM   3745  C CD2 . LEU E  1 73  ? 153.927 116.925 131.312 1.00 21.76  ? 73   LEU E CD2 1 
ATOM   3746  N N   . THR E  1 74  ? 150.253 113.868 131.777 1.00 22.76  ? 74   THR E N   1 
ATOM   3747  C CA  . THR E  1 74  ? 150.409 112.473 131.445 1.00 21.14  ? 74   THR E CA  1 
ATOM   3748  C C   . THR E  1 74  ? 150.960 112.374 130.051 1.00 21.18  ? 74   THR E C   1 
ATOM   3749  O O   . THR E  1 74  ? 150.349 112.855 129.092 1.00 21.41  ? 74   THR E O   1 
ATOM   3750  C CB  . THR E  1 74  ? 149.057 111.767 131.456 1.00 19.30  ? 74   THR E CB  1 
ATOM   3751  O OG1 . THR E  1 74  ? 148.375 112.078 132.677 1.00 26.21  ? 74   THR E OG1 1 
ATOM   3752  C CG2 . THR E  1 74  ? 149.239 110.252 131.344 1.00 21.47  ? 74   THR E CG2 1 
ATOM   3753  N N   . ILE E  1 75  ? 152.122 111.747 129.932 1.00 22.77  ? 75   ILE E N   1 
ATOM   3754  C CA  . ILE E  1 75  ? 152.611 111.432 128.613 1.00 23.43  ? 75   ILE E CA  1 
ATOM   3755  C C   . ILE E  1 75  ? 152.325 109.949 128.403 1.00 24.98  ? 75   ILE E C   1 
ATOM   3756  O O   . ILE E  1 75  ? 153.104 109.103 128.844 1.00 25.36  ? 75   ILE E O   1 
ATOM   3757  C CB  . ILE E  1 75  ? 154.105 111.754 128.495 1.00 21.57  ? 75   ILE E CB  1 
ATOM   3758  C CG1 . ILE E  1 75  ? 154.391 113.133 129.113 1.00 21.51  ? 75   ILE E CG1 1 
ATOM   3759  C CG2 . ILE E  1 75  ? 154.531 111.710 127.019 1.00 9.94   ? 75   ILE E CG2 1 
ATOM   3760  C CD1 . ILE E  1 75  ? 155.866 113.414 129.390 1.00 21.22  ? 75   ILE E CD1 1 
ATOM   3761  N N   . SER E  1 76  ? 151.208 109.626 127.751 1.00 26.58  ? 76   SER E N   1 
ATOM   3762  C CA  . SER E  1 76  ? 150.807 108.216 127.651 1.00 28.03  ? 76   SER E CA  1 
ATOM   3763  C C   . SER E  1 76  ? 151.774 107.286 126.902 1.00 30.47  ? 76   SER E C   1 
ATOM   3764  O O   . SER E  1 76  ? 151.822 106.090 127.215 1.00 31.44  ? 76   SER E O   1 
ATOM   3765  C CB  . SER E  1 76  ? 149.341 108.037 127.183 1.00 27.53  ? 76   SER E CB  1 
ATOM   3766  O OG  . SER E  1 76  ? 148.940 109.033 126.238 1.00 30.01  ? 76   SER E OG  1 
ATOM   3767  N N   . SER E  1 77  ? 152.546 107.806 125.949 1.00 30.95  ? 77   SER E N   1 
ATOM   3768  C CA  . SER E  1 77  ? 153.559 106.958 125.298 1.00 32.18  ? 77   SER E CA  1 
ATOM   3769  C C   . SER E  1 77  ? 154.865 107.710 124.974 1.00 31.73  ? 77   SER E C   1 
ATOM   3770  O O   . SER E  1 77  ? 154.938 108.467 124.002 1.00 33.98  ? 77   SER E O   1 
ATOM   3771  C CB  . SER E  1 77  ? 152.956 106.207 124.082 1.00 30.62  ? 77   SER E CB  1 
ATOM   3772  O OG  . SER E  1 77  ? 154.002 105.817 123.158 1.00 33.99  ? 77   SER E OG  1 
ATOM   3773  N N   . LEU E  1 78  ? 155.878 107.482 125.817 1.00 30.46  ? 78   LEU E N   1 
ATOM   3774  C CA  . LEU E  1 78  ? 157.154 108.221 125.813 1.00 28.60  ? 78   LEU E CA  1 
ATOM   3775  C C   . LEU E  1 78  ? 158.016 107.867 124.600 1.00 29.76  ? 78   LEU E C   1 
ATOM   3776  O O   . LEU E  1 78  ? 157.883 106.767 124.056 1.00 29.16  ? 78   LEU E O   1 
ATOM   3777  C CB  . LEU E  1 78  ? 157.919 107.895 127.103 1.00 29.55  ? 78   LEU E CB  1 
ATOM   3778  C CG  . LEU E  1 78  ? 159.060 108.775 127.621 1.00 28.10  ? 78   LEU E CG  1 
ATOM   3779  C CD1 . LEU E  1 78  ? 158.520 110.059 128.289 1.00 23.10  ? 78   LEU E CD1 1 
ATOM   3780  C CD2 . LEU E  1 78  ? 159.898 107.991 128.616 1.00 27.77  ? 78   LEU E CD2 1 
ATOM   3781  N N   . GLN E  1 79  ? 158.898 108.780 124.179 1.00 29.47  ? 79   GLN E N   1 
ATOM   3782  C CA  . GLN E  1 79  ? 159.780 108.565 123.004 1.00 27.92  ? 79   GLN E CA  1 
ATOM   3783  C C   . GLN E  1 79  ? 161.089 109.352 123.103 1.00 28.01  ? 79   GLN E C   1 
ATOM   3784  O O   . GLN E  1 79  ? 161.216 110.243 123.955 1.00 29.84  ? 79   GLN E O   1 
ATOM   3785  C CB  . GLN E  1 79  ? 159.115 109.027 121.691 1.00 28.35  ? 79   GLN E CB  1 
ATOM   3786  C CG  . GLN E  1 79  ? 157.622 109.053 121.716 1.00 20.00  ? 79   GLN E CG  1 
ATOM   3787  C CD  . GLN E  1 79  ? 157.025 107.777 121.170 1.00 19.08  ? 79   GLN E CD  1 
ATOM   3788  O OE1 . GLN E  1 79  ? 155.950 107.343 121.598 1.00 17.53  ? 79   GLN E OE1 1 
ATOM   3789  N NE2 . GLN E  1 79  ? 157.701 107.158 120.199 1.00 8.41   ? 79   GLN E NE2 1 
ATOM   3790  N N   . PRO E  1 80  ? 162.064 109.063 122.208 1.00 29.44  ? 80   PRO E N   1 
ATOM   3791  C CA  . PRO E  1 80  ? 163.369 109.674 122.509 1.00 29.00  ? 80   PRO E CA  1 
ATOM   3792  C C   . PRO E  1 80  ? 163.304 111.204 122.561 1.00 30.91  ? 80   PRO E C   1 
ATOM   3793  O O   . PRO E  1 80  ? 163.775 111.814 123.525 1.00 33.92  ? 80   PRO E O   1 
ATOM   3794  C CB  . PRO E  1 80  ? 164.290 109.174 121.353 1.00 27.70  ? 80   PRO E CB  1 
ATOM   3795  C CG  . PRO E  1 80  ? 163.578 107.937 120.843 1.00 30.79  ? 80   PRO E CG  1 
ATOM   3796  C CD  . PRO E  1 80  ? 162.118 108.236 120.980 1.00 28.21  ? 80   PRO E CD  1 
ATOM   3797  N N   . GLU E  1 81  ? 162.702 111.788 121.537 1.00 29.25  ? 81   GLU E N   1 
ATOM   3798  C CA  . GLU E  1 81  ? 162.323 113.199 121.474 1.00 27.03  ? 81   GLU E CA  1 
ATOM   3799  C C   . GLU E  1 81  ? 161.465 113.755 122.636 1.00 26.59  ? 81   GLU E C   1 
ATOM   3800  O O   . GLU E  1 81  ? 161.247 114.980 122.696 1.00 21.55  ? 81   GLU E O   1 
ATOM   3801  C CB  . GLU E  1 81  ? 161.507 113.319 120.212 1.00 29.47  ? 81   GLU E CB  1 
ATOM   3802  C CG  . GLU E  1 81  ? 160.736 112.027 120.080 1.00 33.94  ? 81   GLU E CG  1 
ATOM   3803  C CD  . GLU E  1 81  ? 160.085 111.859 118.770 1.00 43.03  ? 81   GLU E CD  1 
ATOM   3804  O OE1 . GLU E  1 81  ? 159.121 112.617 118.492 1.00 48.62  ? 81   GLU E OE1 1 
ATOM   3805  O OE2 . GLU E  1 81  ? 160.503 110.954 118.018 1.00 44.25  ? 81   GLU E OE2 1 
ATOM   3806  N N   . ASP E  1 82  ? 160.959 112.898 123.535 1.00 25.39  ? 82   ASP E N   1 
ATOM   3807  C CA  . ASP E  1 82  ? 160.304 113.430 124.748 1.00 28.82  ? 82   ASP E CA  1 
ATOM   3808  C C   . ASP E  1 82  ? 161.302 113.545 125.903 1.00 30.26  ? 82   ASP E C   1 
ATOM   3809  O O   . ASP E  1 82  ? 160.936 113.465 127.083 1.00 30.05  ? 82   ASP E O   1 
ATOM   3810  C CB  . ASP E  1 82  ? 159.040 112.631 125.196 1.00 29.41  ? 82   ASP E CB  1 
ATOM   3811  C CG  . ASP E  1 82  ? 158.417 111.833 124.055 1.00 36.87  ? 82   ASP E CG  1 
ATOM   3812  O OD1 . ASP E  1 82  ? 158.709 112.120 122.851 1.00 37.71  ? 82   ASP E OD1 1 
ATOM   3813  O OD2 . ASP E  1 82  ? 157.597 110.929 124.373 1.00 36.77  ? 82   ASP E OD2 1 
ATOM   3814  N N   . PHE E  1 83  ? 162.565 113.737 125.540 1.00 30.83  ? 83   PHE E N   1 
ATOM   3815  C CA  . PHE E  1 83  ? 163.642 113.873 126.499 1.00 30.64  ? 83   PHE E CA  1 
ATOM   3816  C C   . PHE E  1 83  ? 163.726 115.290 127.021 1.00 30.77  ? 83   PHE E C   1 
ATOM   3817  O O   . PHE E  1 83  ? 164.387 116.140 126.411 1.00 29.82  ? 83   PHE E O   1 
ATOM   3818  C CB  . PHE E  1 83  ? 164.970 113.503 125.846 1.00 32.85  ? 83   PHE E CB  1 
ATOM   3819  C CG  . PHE E  1 83  ? 166.041 113.204 126.830 1.00 30.78  ? 83   PHE E CG  1 
ATOM   3820  C CD1 . PHE E  1 83  ? 166.225 111.905 127.281 1.00 34.06  ? 83   PHE E CD1 1 
ATOM   3821  C CD2 . PHE E  1 83  ? 166.856 114.216 127.331 1.00 31.31  ? 83   PHE E CD2 1 
ATOM   3822  C CE1 . PHE E  1 83  ? 167.211 111.611 128.199 1.00 39.07  ? 83   PHE E CE1 1 
ATOM   3823  C CE2 . PHE E  1 83  ? 167.844 113.933 128.257 1.00 34.18  ? 83   PHE E CE2 1 
ATOM   3824  C CZ  . PHE E  1 83  ? 168.022 112.628 128.692 1.00 37.93  ? 83   PHE E CZ  1 
ATOM   3825  N N   . ALA E  1 84  ? 163.075 115.550 128.156 1.00 29.22  ? 84   ALA E N   1 
ATOM   3826  C CA  . ALA E  1 84  ? 163.009 116.914 128.688 1.00 28.60  ? 84   ALA E CA  1 
ATOM   3827  C C   . ALA E  1 84  ? 162.646 117.072 130.169 1.00 28.56  ? 84   ALA E C   1 
ATOM   3828  O O   . ALA E  1 84  ? 161.970 116.230 130.766 1.00 28.10  ? 84   ALA E O   1 
ATOM   3829  C CB  . ALA E  1 84  ? 162.077 117.777 127.827 1.00 25.76  ? 84   ALA E CB  1 
ATOM   3830  N N   . THR E  1 85  ? 163.161 118.164 130.741 1.00 23.34  ? 85   THR E N   1 
ATOM   3831  C CA  . THR E  1 85  ? 162.675 118.750 131.989 1.00 20.34  ? 85   THR E CA  1 
ATOM   3832  C C   . THR E  1 85  ? 161.427 119.587 131.711 1.00 21.93  ? 85   THR E C   1 
ATOM   3833  O O   . THR E  1 85  ? 161.527 120.692 131.168 1.00 21.57  ? 85   THR E O   1 
ATOM   3834  C CB  . THR E  1 85  ? 163.713 119.732 132.569 1.00 20.01  ? 85   THR E CB  1 
ATOM   3835  O OG1 . THR E  1 85  ? 165.059 119.273 132.279 1.00 19.68  ? 85   THR E OG1 1 
ATOM   3836  C CG2 . THR E  1 85  ? 163.556 119.863 134.085 1.00 7.95   ? 85   THR E CG2 1 
ATOM   3837  N N   . TYR E  1 86  ? 160.257 119.062 132.089 1.00 21.50  ? 86   TYR E N   1 
ATOM   3838  C CA  . TYR E  1 86  ? 158.972 119.742 131.889 1.00 20.45  ? 86   TYR E CA  1 
ATOM   3839  C C   . TYR E  1 86  ? 158.582 120.521 133.135 1.00 20.63  ? 86   TYR E C   1 
ATOM   3840  O O   . TYR E  1 86  ? 158.855 120.079 134.246 1.00 23.36  ? 86   TYR E O   1 
ATOM   3841  C CB  . TYR E  1 86  ? 157.864 118.723 131.641 1.00 20.74  ? 86   TYR E CB  1 
ATOM   3842  C CG  . TYR E  1 86  ? 157.984 117.873 130.400 1.00 23.10  ? 86   TYR E CG  1 
ATOM   3843  C CD1 . TYR E  1 86  ? 159.030 116.964 130.237 1.00 23.69  ? 86   TYR E CD1 1 
ATOM   3844  C CD2 . TYR E  1 86  ? 157.004 117.931 129.414 1.00 21.85  ? 86   TYR E CD2 1 
ATOM   3845  C CE1 . TYR E  1 86  ? 159.118 116.167 129.101 1.00 20.21  ? 86   TYR E CE1 1 
ATOM   3846  C CE2 . TYR E  1 86  ? 157.078 117.139 128.282 1.00 20.08  ? 86   TYR E CE2 1 
ATOM   3847  C CZ  . TYR E  1 86  ? 158.135 116.261 128.130 1.00 20.93  ? 86   TYR E CZ  1 
ATOM   3848  O OH  . TYR E  1 86  ? 158.208 115.478 126.992 1.00 19.93  ? 86   TYR E OH  1 
ATOM   3849  N N   . TYR E  1 87  ? 157.896 121.644 132.950 1.00 19.57  ? 87   TYR E N   1 
ATOM   3850  C CA  . TYR E  1 87  ? 157.560 122.541 134.049 1.00 20.42  ? 87   TYR E CA  1 
ATOM   3851  C C   . TYR E  1 87  ? 156.081 122.802 134.120 1.00 20.31  ? 87   TYR E C   1 
ATOM   3852  O O   . TYR E  1 87  ? 155.448 122.976 133.075 1.00 24.00  ? 87   TYR E O   1 
ATOM   3853  C CB  . TYR E  1 87  ? 158.233 123.885 133.789 1.00 18.43  ? 87   TYR E CB  1 
ATOM   3854  C CG  . TYR E  1 87  ? 159.693 123.858 134.075 1.00 18.04  ? 87   TYR E CG  1 
ATOM   3855  C CD1 . TYR E  1 87  ? 160.628 123.662 133.058 1.00 17.85  ? 87   TYR E CD1 1 
ATOM   3856  C CD2 . TYR E  1 87  ? 160.150 124.016 135.373 1.00 16.24  ? 87   TYR E CD2 1 
ATOM   3857  C CE1 . TYR E  1 87  ? 161.987 123.633 133.341 1.00 13.23  ? 87   TYR E CE1 1 
ATOM   3858  C CE2 . TYR E  1 87  ? 161.496 123.987 135.667 1.00 18.39  ? 87   TYR E CE2 1 
ATOM   3859  C CZ  . TYR E  1 87  ? 162.409 123.796 134.650 1.00 12.77  ? 87   TYR E CZ  1 
ATOM   3860  O OH  . TYR E  1 87  ? 163.757 123.772 134.948 1.00 20.66  ? 87   TYR E OH  1 
ATOM   3861  N N   . CYS E  1 88  ? 155.508 122.849 135.323 1.00 18.96  ? 88   CYS E N   1 
ATOM   3862  C CA  . CYS E  1 88  ? 154.169 123.425 135.428 1.00 17.51  ? 88   CYS E CA  1 
ATOM   3863  C C   . CYS E  1 88  ? 154.262 124.892 135.821 1.00 15.71  ? 88   CYS E C   1 
ATOM   3864  O O   . CYS E  1 88  ? 155.217 125.320 136.472 1.00 9.41   ? 88   CYS E O   1 
ATOM   3865  C CB  . CYS E  1 88  ? 153.236 122.642 136.357 1.00 18.94  ? 88   CYS E CB  1 
ATOM   3866  S SG  . CYS E  1 88  ? 153.693 122.569 138.088 1.00 23.43  ? 88   CYS E SG  1 
ATOM   3867  N N   . GLN E  1 89  ? 153.250 125.648 135.409 1.00 17.49  ? 89   GLN E N   1 
ATOM   3868  C CA  . GLN E  1 89  ? 153.267 127.097 135.475 1.00 23.36  ? 89   GLN E CA  1 
ATOM   3869  C C   . GLN E  1 89  ? 151.831 127.601 135.600 1.00 25.86  ? 89   GLN E C   1 
ATOM   3870  O O   . GLN E  1 89  ? 151.019 127.369 134.701 1.00 26.60  ? 89   GLN E O   1 
ATOM   3871  C CB  . GLN E  1 89  ? 153.905 127.622 134.184 1.00 23.11  ? 89   GLN E CB  1 
ATOM   3872  C CG  . GLN E  1 89  ? 154.494 129.008 134.282 1.00 22.58  ? 89   GLN E CG  1 
ATOM   3873  C CD  . GLN E  1 89  ? 153.684 130.050 133.536 1.00 22.95  ? 89   GLN E CD  1 
ATOM   3874  O OE1 . GLN E  1 89  ? 152.474 129.908 133.358 1.00 23.28  ? 89   GLN E OE1 1 
ATOM   3875  N NE2 . GLN E  1 89  ? 154.351 131.110 133.096 1.00 16.78  ? 89   GLN E NE2 1 
ATOM   3876  N N   . GLN E  1 90  ? 151.500 128.271 136.705 1.00 28.12  ? 90   GLN E N   1 
ATOM   3877  C CA  . GLN E  1 90  ? 150.163 128.864 136.838 1.00 26.06  ? 90   GLN E CA  1 
ATOM   3878  C C   . GLN E  1 90  ? 150.154 130.238 136.188 1.00 25.94  ? 90   GLN E C   1 
ATOM   3879  O O   . GLN E  1 90  ? 151.088 131.025 136.370 1.00 26.99  ? 90   GLN E O   1 
ATOM   3880  C CB  . GLN E  1 90  ? 149.708 128.974 138.299 1.00 24.65  ? 90   GLN E CB  1 
ATOM   3881  C CG  . GLN E  1 90  ? 149.448 130.413 138.794 1.00 27.09  ? 90   GLN E CG  1 
ATOM   3882  C CD  . GLN E  1 90  ? 150.620 130.944 139.594 1.00 19.31  ? 90   GLN E CD  1 
ATOM   3883  O OE1 . GLN E  1 90  ? 151.530 130.192 139.942 1.00 23.55  ? 90   GLN E OE1 1 
ATOM   3884  N NE2 . GLN E  1 90  ? 150.598 132.238 139.915 1.00 15.09  ? 90   GLN E NE2 1 
ATOM   3885  N N   . SER E  1 91  ? 149.109 130.526 135.422 1.00 27.72  ? 91   SER E N   1 
ATOM   3886  C CA  . SER E  1 91  ? 149.030 131.787 134.685 1.00 29.68  ? 91   SER E CA  1 
ATOM   3887  C C   . SER E  1 91  ? 148.090 132.750 135.394 1.00 29.87  ? 91   SER E C   1 
ATOM   3888  O O   . SER E  1 91  ? 147.534 133.673 134.789 1.00 27.47  ? 91   SER E O   1 
ATOM   3889  C CB  . SER E  1 91  ? 148.537 131.513 133.263 1.00 31.47  ? 91   SER E CB  1 
ATOM   3890  O OG  . SER E  1 91  ? 148.087 132.709 132.609 1.00 37.52  ? 91   SER E OG  1 
ATOM   3891  N N   . TYR E  1 92  ? 147.950 132.541 136.694 1.00 30.30  ? 92   TYR E N   1 
ATOM   3892  C CA  . TYR E  1 92  ? 146.794 133.000 137.437 1.00 31.11  ? 92   TYR E CA  1 
ATOM   3893  C C   . TYR E  1 92  ? 146.974 134.384 138.042 1.00 32.23  ? 92   TYR E C   1 
ATOM   3894  O O   . TYR E  1 92  ? 146.261 135.335 137.677 1.00 32.54  ? 92   TYR E O   1 
ATOM   3895  C CB  . TYR E  1 92  ? 146.511 131.972 138.527 1.00 30.36  ? 92   TYR E CB  1 
ATOM   3896  C CG  . TYR E  1 92  ? 145.232 132.166 139.275 1.00 29.13  ? 92   TYR E CG  1 
ATOM   3897  C CD1 . TYR E  1 92  ? 144.059 131.562 138.840 1.00 28.94  ? 92   TYR E CD1 1 
ATOM   3898  C CD2 . TYR E  1 92  ? 145.198 132.919 140.442 1.00 20.98  ? 92   TYR E CD2 1 
ATOM   3899  C CE1 . TYR E  1 92  ? 142.877 131.721 139.530 1.00 24.02  ? 92   TYR E CE1 1 
ATOM   3900  C CE2 . TYR E  1 92  ? 144.022 133.091 141.141 1.00 18.77  ? 92   TYR E CE2 1 
ATOM   3901  C CZ  . TYR E  1 92  ? 142.868 132.487 140.681 1.00 22.15  ? 92   TYR E CZ  1 
ATOM   3902  O OH  . TYR E  1 92  ? 141.689 132.646 141.373 1.00 31.21  ? 92   TYR E OH  1 
ATOM   3903  N N   . SER E  1 93  ? 147.905 134.478 138.984 1.00 32.03  ? 93   SER E N   1 
ATOM   3904  C CA  . SER E  1 93  ? 148.201 135.741 139.614 1.00 30.16  ? 93   SER E CA  1 
ATOM   3905  C C   . SER E  1 93  ? 149.576 136.124 139.155 1.00 28.33  ? 93   SER E C   1 
ATOM   3906  O O   . SER E  1 93  ? 150.480 135.265 139.105 1.00 26.22  ? 93   SER E O   1 
ATOM   3907  C CB  . SER E  1 93  ? 148.180 135.604 141.139 1.00 30.61  ? 93   SER E CB  1 
ATOM   3908  O OG  . SER E  1 93  ? 149.519 135.041 141.571 1.00 36.35  ? 93   SER E OG  1 
ATOM   3909  N N   . THR E  1 94  ? 149.762 137.385 138.810 1.00 27.42  ? 94   THR E N   1 
ATOM   3910  C CA  . THR E  1 94  ? 151.121 137.825 138.582 1.00 28.77  ? 94   THR E CA  1 
ATOM   3911  C C   . THR E  1 94  ? 151.720 138.157 139.961 1.00 29.08  ? 94   THR E C   1 
ATOM   3912  O O   . THR E  1 94  ? 151.073 138.856 140.765 1.00 29.33  ? 94   THR E O   1 
ATOM   3913  C CB  . THR E  1 94  ? 151.167 138.983 137.593 1.00 28.26  ? 94   THR E CB  1 
ATOM   3914  O OG1 . THR E  1 94  ? 150.367 140.064 138.077 1.00 30.67  ? 94   THR E OG1 1 
ATOM   3915  C CG2 . THR E  1 94  ? 150.659 138.529 136.217 1.00 27.86  ? 94   THR E CG2 1 
ATOM   3916  N N   . PRO E  1 95  ? 152.937 137.646 140.264 1.00 28.88  ? 95   PRO E N   1 
ATOM   3917  C CA  . PRO E  1 95  ? 153.891 136.823 139.494 1.00 29.47  ? 95   PRO E CA  1 
ATOM   3918  C C   . PRO E  1 95  ? 153.437 135.410 139.125 1.00 30.75  ? 95   PRO E C   1 
ATOM   3919  O O   . PRO E  1 95  ? 153.187 134.570 140.007 1.00 29.15  ? 95   PRO E O   1 
ATOM   3920  C CB  . PRO E  1 95  ? 155.141 136.779 140.387 1.00 28.45  ? 95   PRO E CB  1 
ATOM   3921  C CG  . PRO E  1 95  ? 154.634 137.027 141.779 1.00 29.48  ? 95   PRO E CG  1 
ATOM   3922  C CD  . PRO E  1 95  ? 153.457 137.965 141.610 1.00 28.12  ? 95   PRO E CD  1 
ATOM   3923  N N   . ASN E  1 96  ? 153.324 135.182 137.813 1.00 31.03  ? 96   ASN E N   1 
ATOM   3924  C CA  . ASN E  1 96  ? 153.089 133.863 137.232 1.00 29.25  ? 96   ASN E CA  1 
ATOM   3925  C C   . ASN E  1 96  ? 154.148 132.892 137.737 1.00 28.91  ? 96   ASN E C   1 
ATOM   3926  O O   . ASN E  1 96  ? 155.317 132.993 137.341 1.00 29.02  ? 96   ASN E O   1 
ATOM   3927  C CB  . ASN E  1 96  ? 153.166 133.950 135.697 1.00 27.80  ? 96   ASN E CB  1 
ATOM   3928  C CG  . ASN E  1 96  ? 152.138 134.911 135.109 1.00 26.90  ? 96   ASN E CG  1 
ATOM   3929  O OD1 . ASN E  1 96  ? 151.248 135.397 135.805 1.00 19.33  ? 96   ASN E OD1 1 
ATOM   3930  N ND2 . ASN E  1 96  ? 152.257 135.189 133.805 1.00 19.76  ? 96   ASN E ND2 1 
ATOM   3931  N N   . THR E  1 97  ? 153.769 131.969 138.619 1.00 26.39  ? 97   THR E N   1 
ATOM   3932  C CA  . THR E  1 97  ? 154.779 131.099 139.235 1.00 24.38  ? 97   THR E CA  1 
ATOM   3933  C C   . THR E  1 97  ? 154.980 129.741 138.568 1.00 26.64  ? 97   THR E C   1 
ATOM   3934  O O   . THR E  1 97  ? 154.019 129.072 138.151 1.00 26.46  ? 97   THR E O   1 
ATOM   3935  C CB  . THR E  1 97  ? 154.636 130.961 140.777 1.00 23.47  ? 97   THR E CB  1 
ATOM   3936  O OG1 . THR E  1 97  ? 153.287 130.641 141.131 1.00 20.51  ? 97   THR E OG1 1 
ATOM   3937  C CG2 . THR E  1 97  ? 155.065 132.257 141.462 1.00 19.96  ? 97   THR E CG2 1 
ATOM   3938  N N   . PHE E  1 98  ? 156.257 129.372 138.470 1.00 24.84  ? 98   PHE E N   1 
ATOM   3939  C CA  . PHE E  1 98  ? 156.664 128.115 137.878 1.00 28.02  ? 98   PHE E CA  1 
ATOM   3940  C C   . PHE E  1 98  ? 156.882 127.100 138.986 1.00 29.05  ? 98   PHE E C   1 
ATOM   3941  O O   . PHE E  1 98  ? 157.317 127.452 140.087 1.00 29.12  ? 98   PHE E O   1 
ATOM   3942  C CB  . PHE E  1 98  ? 157.984 128.293 137.121 1.00 27.93  ? 98   PHE E CB  1 
ATOM   3943  C CG  . PHE E  1 98  ? 157.847 128.929 135.761 1.00 31.92  ? 98   PHE E CG  1 
ATOM   3944  C CD1 . PHE E  1 98  ? 157.438 130.253 135.625 1.00 30.34  ? 98   PHE E CD1 1 
ATOM   3945  C CD2 . PHE E  1 98  ? 158.174 128.209 134.615 1.00 33.54  ? 98   PHE E CD2 1 
ATOM   3946  C CE1 . PHE E  1 98  ? 157.328 130.832 134.368 1.00 30.80  ? 98   PHE E CE1 1 
ATOM   3947  C CE2 . PHE E  1 98  ? 158.073 128.786 133.353 1.00 29.54  ? 98   PHE E CE2 1 
ATOM   3948  C CZ  . PHE E  1 98  ? 157.650 130.100 133.233 1.00 26.95  ? 98   PHE E CZ  1 
ATOM   3949  N N   . GLY E  1 99  ? 156.575 125.841 138.685 1.00 30.94  ? 99   GLY E N   1 
ATOM   3950  C CA  . GLY E  1 99  ? 157.034 124.713 139.489 1.00 29.39  ? 99   GLY E CA  1 
ATOM   3951  C C   . GLY E  1 99  ? 158.477 124.415 139.117 1.00 31.25  ? 99   GLY E C   1 
ATOM   3952  O O   . GLY E  1 99  ? 159.055 125.095 138.266 1.00 32.99  ? 99   GLY E O   1 
ATOM   3953  N N   . GLN E  1 100 ? 159.060 123.399 139.739 1.00 30.79  ? 100  GLN E N   1 
ATOM   3954  C CA  . GLN E  1 100 ? 160.484 123.136 139.547 1.00 29.74  ? 100  GLN E CA  1 
ATOM   3955  C C   . GLN E  1 100 ? 160.757 122.025 138.533 1.00 29.85  ? 100  GLN E C   1 
ATOM   3956  O O   . GLN E  1 100 ? 161.882 121.523 138.434 1.00 30.42  ? 100  GLN E O   1 
ATOM   3957  C CB  . GLN E  1 100 ? 161.182 122.873 140.893 1.00 30.96  ? 100  GLN E CB  1 
ATOM   3958  C CG  . GLN E  1 100 ? 160.621 121.706 141.716 1.00 31.22  ? 100  GLN E CG  1 
ATOM   3959  C CD  . GLN E  1 100 ? 159.261 121.998 142.347 1.00 37.09  ? 100  GLN E CD  1 
ATOM   3960  O OE1 . GLN E  1 100 ? 158.275 121.349 142.029 1.00 37.28  ? 100  GLN E OE1 1 
ATOM   3961  N NE2 . GLN E  1 100 ? 159.212 122.977 143.246 1.00 40.82  ? 100  GLN E NE2 1 
ATOM   3962  N N   . GLY E  1 101 ? 159.722 121.653 137.782 1.00 31.28  ? 101  GLY E N   1 
ATOM   3963  C CA  . GLY E  1 101 ? 159.868 120.771 136.627 1.00 31.27  ? 101  GLY E CA  1 
ATOM   3964  C C   . GLY E  1 101 ? 160.361 119.364 136.895 1.00 32.51  ? 101  GLY E C   1 
ATOM   3965  O O   . GLY E  1 101 ? 161.104 119.115 137.856 1.00 32.49  ? 101  GLY E O   1 
ATOM   3966  N N   . THR E  1 102 ? 159.968 118.437 136.031 1.00 31.72  ? 102  THR E N   1 
ATOM   3967  C CA  . THR E  1 102 ? 160.410 117.061 136.177 1.00 31.49  ? 102  THR E CA  1 
ATOM   3968  C C   . THR E  1 102 ? 161.378 116.659 135.068 1.00 31.74  ? 102  THR E C   1 
ATOM   3969  O O   . THR E  1 102 ? 161.043 116.722 133.882 1.00 31.45  ? 102  THR E O   1 
ATOM   3970  C CB  . THR E  1 102 ? 159.222 116.097 136.220 1.00 29.89  ? 102  THR E CB  1 
ATOM   3971  O OG1 . THR E  1 102 ? 158.309 116.510 137.252 1.00 28.40  ? 102  THR E OG1 1 
ATOM   3972  C CG2 . THR E  1 102 ? 159.712 114.673 136.524 1.00 27.50  ? 102  THR E CG2 1 
ATOM   3973  N N   . LYS E  1 103 ? 162.574 116.240 135.472 1.00 30.59  ? 103  LYS E N   1 
ATOM   3974  C CA  . LYS E  1 103 ? 163.587 115.761 134.542 1.00 31.21  ? 103  LYS E CA  1 
ATOM   3975  C C   . LYS E  1 103 ? 163.223 114.376 134.005 1.00 31.45  ? 103  LYS E C   1 
ATOM   3976  O O   . LYS E  1 103 ? 163.265 113.384 134.744 1.00 32.23  ? 103  LYS E O   1 
ATOM   3977  C CB  . LYS E  1 103 ? 164.950 115.716 135.229 1.00 31.84  ? 103  LYS E CB  1 
ATOM   3978  C CG  . LYS E  1 103 ? 166.121 115.637 134.251 1.00 33.54  ? 103  LYS E CG  1 
ATOM   3979  C CD  . LYS E  1 103 ? 167.316 116.457 134.849 1.00 28.06  ? 103  LYS E CD  1 
ATOM   3980  C CE  . LYS E  1 103 ? 166.755 117.913 135.110 1.00 28.69  ? 103  LYS E CE  1 
ATOM   3981  N NZ  . LYS E  1 103 ? 167.329 118.475 136.400 1.00 35.63  ? 103  LYS E NZ  1 
ATOM   3982  N N   . VAL E  1 104 ? 162.869 114.306 132.723 1.00 30.63  ? 104  VAL E N   1 
ATOM   3983  C CA  . VAL E  1 104 ? 162.469 113.037 132.093 1.00 29.02  ? 104  VAL E CA  1 
ATOM   3984  C C   . VAL E  1 104 ? 163.588 112.460 131.207 1.00 27.93  ? 104  VAL E C   1 
ATOM   3985  O O   . VAL E  1 104 ? 163.937 113.044 130.179 1.00 24.15  ? 104  VAL E O   1 
ATOM   3986  C CB  . VAL E  1 104 ? 161.153 113.186 131.260 1.00 27.15  ? 104  VAL E CB  1 
ATOM   3987  C CG1 . VAL E  1 104 ? 160.701 111.835 130.702 1.00 25.35  ? 104  VAL E CG1 1 
ATOM   3988  C CG2 . VAL E  1 104 ? 160.043 113.835 132.093 1.00 24.57  ? 104  VAL E CG2 1 
ATOM   3989  N N   . GLU E  1 105 ? 164.140 111.316 131.612 1.00 29.10  ? 105  GLU E N   1 
ATOM   3990  C CA  . GLU E  1 105 ? 165.189 110.613 130.856 1.00 30.72  ? 105  GLU E CA  1 
ATOM   3991  C C   . GLU E  1 105 ? 164.602 109.341 130.221 1.00 32.68  ? 105  GLU E C   1 
ATOM   3992  O O   . GLU E  1 105 ? 163.703 108.735 130.804 1.00 37.17  ? 105  GLU E O   1 
ATOM   3993  C CB  . GLU E  1 105 ? 166.313 110.207 131.819 1.00 30.34  ? 105  GLU E CB  1 
ATOM   3994  C CG  . GLU E  1 105 ? 167.732 110.214 131.250 1.00 33.69  ? 105  GLU E CG  1 
ATOM   3995  C CD  . GLU E  1 105 ? 168.606 111.342 131.805 1.00 41.65  ? 105  GLU E CD  1 
ATOM   3996  O OE1 . GLU E  1 105 ? 169.846 111.190 131.784 1.00 39.02  ? 105  GLU E OE1 1 
ATOM   3997  O OE2 . GLU E  1 105 ? 168.061 112.373 132.258 1.00 43.04  ? 105  GLU E OE2 1 
ATOM   3998  N N   . ILE E  1 106 ? 165.084 108.930 129.044 1.00 34.06  ? 106  ILE E N   1 
ATOM   3999  C CA  . ILE E  1 106 ? 164.774 107.573 128.557 1.00 32.73  ? 106  ILE E CA  1 
ATOM   4000  C C   . ILE E  1 106 ? 165.860 106.615 129.039 1.00 34.91  ? 106  ILE E C   1 
ATOM   4001  O O   . ILE E  1 106 ? 165.635 105.808 129.943 1.00 36.72  ? 106  ILE E O   1 
ATOM   4002  C CB  . ILE E  1 106 ? 164.634 107.467 127.015 1.00 31.10  ? 106  ILE E CB  1 
ATOM   4003  C CG1 . ILE E  1 106 ? 163.185 107.692 126.561 1.00 28.77  ? 106  ILE E CG1 1 
ATOM   4004  C CG2 . ILE E  1 106 ? 165.082 106.038 126.518 1.00 32.50  ? 106  ILE E CG2 1 
ATOM   4005  C CD1 . ILE E  1 106 ? 162.703 109.117 126.710 1.00 23.89  ? 106  ILE E CD1 1 
ATOM   4006  N N   . ASP F  1 1   ? 142.384 139.878 116.619 1.00 45.13  ? 1    ASP F N   1 
ATOM   4007  C CA  . ASP F  1 1   ? 141.286 140.884 116.763 1.00 44.57  ? 1    ASP F CA  1 
ATOM   4008  C C   . ASP F  1 1   ? 139.943 140.157 116.888 1.00 44.74  ? 1    ASP F C   1 
ATOM   4009  O O   . ASP F  1 1   ? 139.065 140.309 116.037 1.00 45.30  ? 1    ASP F O   1 
ATOM   4010  C CB  . ASP F  1 1   ? 141.292 141.838 115.551 1.00 44.62  ? 1    ASP F CB  1 
ATOM   4011  C CG  . ASP F  1 1   ? 140.805 143.247 115.902 1.00 44.58  ? 1    ASP F CG  1 
ATOM   4012  O OD1 . ASP F  1 1   ? 140.540 143.529 117.095 1.00 44.35  ? 1    ASP F OD1 1 
ATOM   4013  O OD2 . ASP F  1 1   ? 140.692 144.081 114.977 1.00 46.07  ? 1    ASP F OD2 1 
ATOM   4014  N N   . ILE F  1 2   ? 139.787 139.370 117.953 1.00 42.96  ? 2    ILE F N   1 
ATOM   4015  C CA  . ILE F  1 2   ? 138.616 138.492 118.133 1.00 42.96  ? 2    ILE F CA  1 
ATOM   4016  C C   . ILE F  1 2   ? 137.291 139.224 118.429 1.00 43.13  ? 2    ILE F C   1 
ATOM   4017  O O   . ILE F  1 2   ? 137.201 139.961 119.408 1.00 43.95  ? 2    ILE F O   1 
ATOM   4018  C CB  . ILE F  1 2   ? 138.868 137.454 119.275 1.00 42.54  ? 2    ILE F CB  1 
ATOM   4019  C CG1 . ILE F  1 2   ? 140.226 136.773 119.084 1.00 38.99  ? 2    ILE F CG1 1 
ATOM   4020  C CG2 . ILE F  1 2   ? 137.737 136.415 119.332 1.00 43.25  ? 2    ILE F CG2 1 
ATOM   4021  C CD1 . ILE F  1 2   ? 140.899 136.318 120.364 1.00 34.90  ? 2    ILE F CD1 1 
ATOM   4022  N N   . GLN F  1 3   ? 136.268 139.012 117.592 1.00 42.31  ? 3    GLN F N   1 
ATOM   4023  C CA  . GLN F  1 3   ? 134.899 139.459 117.923 1.00 42.77  ? 3    GLN F CA  1 
ATOM   4024  C C   . GLN F  1 3   ? 134.186 138.398 118.780 1.00 42.54  ? 3    GLN F C   1 
ATOM   4025  O O   . GLN F  1 3   ? 134.442 137.203 118.618 1.00 42.38  ? 3    GLN F O   1 
ATOM   4026  C CB  . GLN F  1 3   ? 134.088 139.744 116.643 1.00 41.38  ? 3    GLN F CB  1 
ATOM   4027  C CG  . GLN F  1 3   ? 134.188 141.235 116.117 1.00 43.87  ? 3    GLN F CG  1 
ATOM   4028  C CD  . GLN F  1 3   ? 133.582 141.341 114.659 1.00 44.26  ? 3    GLN F CD  1 
ATOM   4029  O OE1 . GLN F  1 3   ? 133.375 140.340 113.951 1.00 44.05  ? 3    GLN F OE1 1 
ATOM   4030  N NE2 . GLN F  1 3   ? 133.314 142.572 114.209 1.00 33.02  ? 3    GLN F NE2 1 
ATOM   4031  N N   . MET F  1 4   ? 133.315 138.827 119.694 1.00 41.52  ? 4    MET F N   1 
ATOM   4032  C CA  . MET F  1 4   ? 132.415 137.891 120.385 1.00 41.43  ? 4    MET F CA  1 
ATOM   4033  C C   . MET F  1 4   ? 130.982 138.192 119.987 1.00 39.97  ? 4    MET F C   1 
ATOM   4034  O O   . MET F  1 4   ? 130.533 139.352 120.042 1.00 41.32  ? 4    MET F O   1 
ATOM   4035  C CB  . MET F  1 4   ? 132.533 137.975 121.918 1.00 42.75  ? 4    MET F CB  1 
ATOM   4036  C CG  . MET F  1 4   ? 133.923 137.735 122.512 1.00 43.09  ? 4    MET F CG  1 
ATOM   4037  S SD  . MET F  1 4   ? 134.762 136.195 121.952 1.00 50.54  ? 4    MET F SD  1 
ATOM   4038  C CE  . MET F  1 4   ? 133.728 134.865 122.786 1.00 52.71  ? 4    MET F CE  1 
ATOM   4039  N N   . THR F  1 5   ? 130.256 137.151 119.598 1.00 37.30  ? 5    THR F N   1 
ATOM   4040  C CA  . THR F  1 5   ? 128.896 137.312 119.106 1.00 36.52  ? 5    THR F CA  1 
ATOM   4041  C C   . THR F  1 5   ? 127.855 136.653 120.019 1.00 38.54  ? 5    THR F C   1 
ATOM   4042  O O   . THR F  1 5   ? 127.780 135.427 120.164 1.00 38.54  ? 5    THR F O   1 
ATOM   4043  C CB  . THR F  1 5   ? 128.767 136.917 117.616 1.00 36.89  ? 5    THR F CB  1 
ATOM   4044  O OG1 . THR F  1 5   ? 129.937 136.195 117.203 1.00 37.02  ? 5    THR F OG1 1 
ATOM   4045  C CG2 . THR F  1 5   ? 128.642 138.173 116.759 1.00 34.84  ? 5    THR F CG2 1 
ATOM   4046  N N   . GLN F  1 6   ? 127.067 137.542 120.620 1.00 37.92  ? 6    GLN F N   1 
ATOM   4047  C CA  . GLN F  1 6   ? 126.173 137.273 121.738 1.00 37.84  ? 6    GLN F CA  1 
ATOM   4048  C C   . GLN F  1 6   ? 124.699 137.374 121.335 1.00 39.37  ? 6    GLN F C   1 
ATOM   4049  O O   . GLN F  1 6   ? 124.322 138.216 120.514 1.00 40.16  ? 6    GLN F O   1 
ATOM   4050  C CB  . GLN F  1 6   ? 126.494 138.287 122.840 1.00 38.16  ? 6    GLN F CB  1 
ATOM   4051  C CG  . GLN F  1 6   ? 125.354 138.634 123.770 1.00 43.82  ? 6    GLN F CG  1 
ATOM   4052  C CD  . GLN F  1 6   ? 125.458 137.943 125.108 1.00 48.78  ? 6    GLN F CD  1 
ATOM   4053  O OE1 . GLN F  1 6   ? 126.546 137.803 125.670 1.00 51.13  ? 6    GLN F OE1 1 
ATOM   4054  N NE2 . GLN F  1 6   ? 124.324 137.513 125.636 1.00 52.35  ? 6    GLN F NE2 1 
ATOM   4055  N N   . SER F  1 7   ? 123.878 136.519 121.957 1.00 38.36  ? 7    SER F N   1 
ATOM   4056  C CA  . SER F  1 7   ? 122.489 136.294 121.560 1.00 37.55  ? 7    SER F CA  1 
ATOM   4057  C C   . SER F  1 7   ? 121.876 135.176 122.403 1.00 38.85  ? 7    SER F C   1 
ATOM   4058  O O   . SER F  1 7   ? 122.555 134.180 122.692 1.00 38.28  ? 7    SER F O   1 
ATOM   4059  C CB  . SER F  1 7   ? 122.417 135.855 120.095 1.00 38.09  ? 7    SER F CB  1 
ATOM   4060  O OG  . SER F  1 7   ? 123.006 134.533 119.938 1.00 35.08  ? 7    SER F OG  1 
ATOM   4061  N N   . PRO F  1 8   ? 120.593 135.314 122.804 1.00 40.24  ? 8    PRO F N   1 
ATOM   4062  C CA  . PRO F  1 8   ? 119.670 136.455 122.677 1.00 41.46  ? 8    PRO F CA  1 
ATOM   4063  C C   . PRO F  1 8   ? 120.270 137.782 123.174 1.00 42.14  ? 8    PRO F C   1 
ATOM   4064  O O   . PRO F  1 8   ? 121.363 137.792 123.758 1.00 45.34  ? 8    PRO F O   1 
ATOM   4065  C CB  . PRO F  1 8   ? 118.489 136.056 123.590 1.00 41.18  ? 8    PRO F CB  1 
ATOM   4066  C CG  . PRO F  1 8   ? 118.953 134.837 124.349 1.00 42.21  ? 8    PRO F CG  1 
ATOM   4067  C CD  . PRO F  1 8   ? 119.934 134.169 123.457 1.00 41.06  ? 8    PRO F CD  1 
ATOM   4068  N N   . SER F  1 9   ? 119.562 138.892 122.960 1.00 41.80  ? 9    SER F N   1 
ATOM   4069  C CA  . SER F  1 9   ? 119.976 140.175 123.569 1.00 41.41  ? 9    SER F CA  1 
ATOM   4070  C C   . SER F  1 9   ? 118.924 140.840 124.472 1.00 40.73  ? 9    SER F C   1 
ATOM   4071  O O   . SER F  1 9   ? 119.231 141.825 125.164 1.00 38.57  ? 9    SER F O   1 
ATOM   4072  C CB  . SER F  1 9   ? 120.495 141.178 122.515 1.00 42.53  ? 9    SER F CB  1 
ATOM   4073  O OG  . SER F  1 9   ? 120.809 142.480 123.297 1.00 44.29  ? 9    SER F OG  1 
ATOM   4074  N N   . SER F  1 10  ? 117.698 140.333 124.466 1.00 39.69  ? 10   SER F N   1 
ATOM   4075  C CA  . SER F  1 10  ? 116.812 140.565 125.602 1.00 39.25  ? 10   SER F CA  1 
ATOM   4076  C C   . SER F  1 10  ? 116.022 139.328 125.906 1.00 39.59  ? 10   SER F C   1 
ATOM   4077  O O   . SER F  1 10  ? 115.892 138.428 125.073 1.00 39.25  ? 10   SER F O   1 
ATOM   4078  C CB  . SER F  1 10  ? 115.906 141.802 125.441 1.00 38.93  ? 10   SER F CB  1 
ATOM   4079  O OG  . SER F  1 10  ? 115.047 141.667 124.285 1.00 41.16  ? 10   SER F OG  1 
ATOM   4080  N N   . LEU F  1 11  ? 115.509 139.286 127.123 1.00 38.21  ? 11   LEU F N   1 
ATOM   4081  C CA  . LEU F  1 11  ? 115.063 138.038 127.658 1.00 39.51  ? 11   LEU F CA  1 
ATOM   4082  C C   . LEU F  1 11  ? 113.994 138.216 128.705 1.00 41.43  ? 11   LEU F C   1 
ATOM   4083  O O   . LEU F  1 11  ? 114.170 138.938 129.680 1.00 40.52  ? 11   LEU F O   1 
ATOM   4084  C CB  . LEU F  1 11  ? 116.264 137.270 128.227 1.00 39.48  ? 11   LEU F CB  1 
ATOM   4085  C CG  . LEU F  1 11  ? 116.195 135.752 128.021 1.00 38.32  ? 11   LEU F CG  1 
ATOM   4086  C CD1 . LEU F  1 11  ? 115.109 135.114 128.941 1.00 39.26  ? 11   LEU F CD1 1 
ATOM   4087  C CD2 . LEU F  1 11  ? 115.950 135.382 126.547 1.00 34.66  ? 11   LEU F CD2 1 
ATOM   4088  N N   . SER F  1 12  ? 112.880 137.540 128.463 1.00 42.43  ? 12   SER F N   1 
ATOM   4089  C CA  . SER F  1 12  ? 111.758 137.495 129.372 1.00 42.77  ? 12   SER F CA  1 
ATOM   4090  C C   . SER F  1 12  ? 111.584 136.070 129.859 1.00 43.22  ? 12   SER F C   1 
ATOM   4091  O O   . SER F  1 12  ? 111.644 135.126 129.074 1.00 44.17  ? 12   SER F O   1 
ATOM   4092  C CB  . SER F  1 12  ? 110.483 137.950 128.658 1.00 43.61  ? 12   SER F CB  1 
ATOM   4093  O OG  . SER F  1 12  ? 110.486 139.396 128.534 1.00 41.82  ? 12   SER F OG  1 
ATOM   4094  N N   . ALA F  1 13  ? 111.388 135.930 131.165 1.00 42.74  ? 13   ALA F N   1 
ATOM   4095  C CA  . ALA F  1 13  ? 111.110 134.646 131.795 1.00 42.89  ? 13   ALA F CA  1 
ATOM   4096  C C   . ALA F  1 13  ? 110.552 134.918 133.181 1.00 43.74  ? 13   ALA F C   1 
ATOM   4097  O O   . ALA F  1 13  ? 110.852 135.964 133.779 1.00 42.87  ? 13   ALA F O   1 
ATOM   4098  C CB  . ALA F  1 13  ? 112.377 133.802 131.886 1.00 42.33  ? 13   ALA F CB  1 
ATOM   4099  N N   . SER F  1 14  ? 109.740 133.991 133.690 1.00 45.33  ? 14   SER F N   1 
ATOM   4100  C CA  . SER F  1 14  ? 109.173 134.165 135.025 1.00 46.63  ? 14   SER F CA  1 
ATOM   4101  C C   . SER F  1 14  ? 110.197 133.692 136.047 1.00 46.10  ? 14   SER F C   1 
ATOM   4102  O O   . SER F  1 14  ? 111.344 133.412 135.691 1.00 46.15  ? 14   SER F O   1 
ATOM   4103  C CB  . SER F  1 14  ? 107.860 133.390 135.154 1.00 46.61  ? 14   SER F CB  1 
ATOM   4104  O OG  . SER F  1 14  ? 108.062 132.005 134.878 1.00 49.69  ? 14   SER F OG  1 
ATOM   4105  N N   . VAL F  1 15  ? 109.808 133.608 137.312 1.00 44.92  ? 15   VAL F N   1 
ATOM   4106  C CA  . VAL F  1 15  ? 110.726 133.073 138.307 1.00 44.87  ? 15   VAL F CA  1 
ATOM   4107  C C   . VAL F  1 15  ? 110.628 131.542 138.305 1.00 44.41  ? 15   VAL F C   1 
ATOM   4108  O O   . VAL F  1 15  ? 109.539 130.976 138.524 1.00 44.14  ? 15   VAL F O   1 
ATOM   4109  C CB  . VAL F  1 15  ? 110.482 133.677 139.718 1.00 46.26  ? 15   VAL F CB  1 
ATOM   4110  C CG1 . VAL F  1 15  ? 111.434 133.067 140.740 1.00 43.41  ? 15   VAL F CG1 1 
ATOM   4111  C CG2 . VAL F  1 15  ? 110.644 135.199 139.688 1.00 43.66  ? 15   VAL F CG2 1 
ATOM   4112  N N   . GLY F  1 16  ? 111.759 130.881 138.037 1.00 43.91  ? 16   GLY F N   1 
ATOM   4113  C CA  . GLY F  1 16  ? 111.847 129.413 138.009 1.00 43.05  ? 16   GLY F CA  1 
ATOM   4114  C C   . GLY F  1 16  ? 112.225 128.827 136.655 1.00 44.16  ? 16   GLY F C   1 
ATOM   4115  O O   . GLY F  1 16  ? 112.125 127.607 136.437 1.00 43.75  ? 16   GLY F O   1 
ATOM   4116  N N   . ASP F  1 17  ? 112.678 129.708 135.758 1.00 43.60  ? 17   ASP F N   1 
ATOM   4117  C CA  . ASP F  1 17  ? 112.893 129.379 134.353 1.00 42.56  ? 17   ASP F CA  1 
ATOM   4118  C C   . ASP F  1 17  ? 114.362 129.131 134.016 1.00 42.75  ? 17   ASP F C   1 
ATOM   4119  O O   . ASP F  1 17  ? 115.251 129.782 134.571 1.00 41.50  ? 17   ASP F O   1 
ATOM   4120  C CB  . ASP F  1 17  ? 112.350 130.516 133.484 1.00 42.26  ? 17   ASP F CB  1 
ATOM   4121  C CG  . ASP F  1 17  ? 110.878 130.799 133.747 1.00 45.85  ? 17   ASP F CG  1 
ATOM   4122  O OD1 . ASP F  1 17  ? 110.469 130.805 134.934 1.00 54.54  ? 17   ASP F OD1 1 
ATOM   4123  O OD2 . ASP F  1 17  ? 110.123 131.015 132.767 1.00 46.52  ? 17   ASP F OD2 1 
ATOM   4124  N N   . ARG F  1 18  ? 114.602 128.185 133.105 1.00 43.21  ? 18   ARG F N   1 
ATOM   4125  C CA  . ARG F  1 18  ? 115.947 127.899 132.594 1.00 41.61  ? 18   ARG F CA  1 
ATOM   4126  C C   . ARG F  1 18  ? 116.278 128.947 131.556 1.00 40.08  ? 18   ARG F C   1 
ATOM   4127  O O   . ARG F  1 18  ? 115.757 128.897 130.438 1.00 41.81  ? 18   ARG F O   1 
ATOM   4128  C CB  . ARG F  1 18  ? 115.987 126.511 131.933 1.00 42.53  ? 18   ARG F CB  1 
ATOM   4129  C CG  . ARG F  1 18  ? 117.266 126.187 131.118 1.00 44.98  ? 18   ARG F CG  1 
ATOM   4130  C CD  . ARG F  1 18  ? 118.267 125.314 131.879 1.00 45.40  ? 18   ARG F CD  1 
ATOM   4131  N NE  . ARG F  1 18  ? 117.660 124.046 132.300 1.00 52.85  ? 18   ARG F NE  1 
ATOM   4132  C CZ  . ARG F  1 18  ? 117.104 123.837 133.492 1.00 53.68  ? 18   ARG F CZ  1 
ATOM   4133  N NH1 . ARG F  1 18  ? 117.073 124.802 134.405 1.00 53.86  ? 18   ARG F NH1 1 
ATOM   4134  N NH2 . ARG F  1 18  ? 116.572 122.656 133.776 1.00 57.06  ? 18   ARG F NH2 1 
ATOM   4135  N N   . VAL F  1 19  ? 117.111 129.917 131.921 1.00 37.22  ? 19   VAL F N   1 
ATOM   4136  C CA  . VAL F  1 19  ? 117.642 130.848 130.932 1.00 32.43  ? 19   VAL F CA  1 
ATOM   4137  C C   . VAL F  1 19  ? 118.908 130.217 130.356 1.00 32.49  ? 19   VAL F C   1 
ATOM   4138  O O   . VAL F  1 19  ? 119.792 129.798 131.107 1.00 31.18  ? 19   VAL F O   1 
ATOM   4139  C CB  . VAL F  1 19  ? 117.961 132.227 131.558 1.00 31.64  ? 19   VAL F CB  1 
ATOM   4140  C CG1 . VAL F  1 19  ? 118.461 133.208 130.494 1.00 25.99  ? 19   VAL F CG1 1 
ATOM   4141  C CG2 . VAL F  1 19  ? 116.728 132.792 132.243 1.00 30.67  ? 19   VAL F CG2 1 
ATOM   4142  N N   . THR F  1 20  ? 118.988 130.137 129.027 1.00 29.72  ? 20   THR F N   1 
ATOM   4143  C CA  . THR F  1 20  ? 120.160 129.575 128.340 1.00 29.15  ? 20   THR F CA  1 
ATOM   4144  C C   . THR F  1 20  ? 120.804 130.585 127.385 1.00 29.98  ? 20   THR F C   1 
ATOM   4145  O O   . THR F  1 20  ? 120.360 130.724 126.235 1.00 29.55  ? 20   THR F O   1 
ATOM   4146  C CB  . THR F  1 20  ? 119.798 128.318 127.504 1.00 27.64  ? 20   THR F CB  1 
ATOM   4147  O OG1 . THR F  1 20  ? 118.951 127.433 128.262 1.00 25.62  ? 20   THR F OG1 1 
ATOM   4148  C CG2 . THR F  1 20  ? 121.067 127.567 127.076 1.00 24.64  ? 20   THR F CG2 1 
ATOM   4149  N N   . ILE F  1 21  ? 121.844 131.284 127.835 1.00 30.77  ? 21   ILE F N   1 
ATOM   4150  C CA  . ILE F  1 21  ? 122.498 132.260 126.955 1.00 32.28  ? 21   ILE F CA  1 
ATOM   4151  C C   . ILE F  1 21  ? 123.690 131.657 126.193 1.00 33.12  ? 21   ILE F C   1 
ATOM   4152  O O   . ILE F  1 21  ? 124.486 130.905 126.757 1.00 32.90  ? 21   ILE F O   1 
ATOM   4153  C CB  . ILE F  1 21  ? 122.902 133.557 127.692 1.00 30.80  ? 21   ILE F CB  1 
ATOM   4154  C CG1 . ILE F  1 21  ? 121.662 134.268 128.247 1.00 28.66  ? 21   ILE F CG1 1 
ATOM   4155  C CG2 . ILE F  1 21  ? 123.648 134.510 126.742 1.00 34.14  ? 21   ILE F CG2 1 
ATOM   4156  C CD1 . ILE F  1 21  ? 121.975 135.432 129.240 1.00 29.75  ? 21   ILE F CD1 1 
ATOM   4157  N N   . THR F  1 22  ? 123.800 132.035 124.912 1.00 33.76  ? 22   THR F N   1 
ATOM   4158  C CA  . THR F  1 22  ? 124.749 131.450 123.940 1.00 34.85  ? 22   THR F CA  1 
ATOM   4159  C C   . THR F  1 22  ? 125.643 132.493 123.236 1.00 35.64  ? 22   THR F C   1 
ATOM   4160  O O   . THR F  1 22  ? 125.151 133.346 122.491 1.00 33.07  ? 22   THR F O   1 
ATOM   4161  C CB  . THR F  1 22  ? 124.005 130.629 122.853 1.00 35.70  ? 22   THR F CB  1 
ATOM   4162  O OG1 . THR F  1 22  ? 122.707 131.189 122.614 1.00 38.97  ? 22   THR F OG1 1 
ATOM   4163  C CG2 . THR F  1 22  ? 123.859 129.162 123.261 1.00 32.93  ? 22   THR F CG2 1 
ATOM   4164  N N   . CYS F  1 23  ? 126.957 132.392 123.458 1.00 37.08  ? 23   CYS F N   1 
ATOM   4165  C CA  . CYS F  1 23  ? 127.937 133.374 122.965 1.00 36.30  ? 23   CYS F CA  1 
ATOM   4166  C C   . CYS F  1 23  ? 129.116 132.721 122.222 1.00 34.22  ? 23   CYS F C   1 
ATOM   4167  O O   . CYS F  1 23  ? 129.693 131.744 122.712 1.00 29.40  ? 23   CYS F O   1 
ATOM   4168  C CB  . CYS F  1 23  ? 128.407 134.241 124.140 1.00 36.92  ? 23   CYS F CB  1 
ATOM   4169  S SG  . CYS F  1 23  ? 130.143 134.764 124.149 1.00 43.48  ? 23   CYS F SG  1 
ATOM   4170  N N   . ARG F  1 24  ? 129.457 133.244 121.043 1.00 36.32  ? 24   ARG F N   1 
ATOM   4171  C CA  . ARG F  1 24  ? 130.451 132.601 120.167 1.00 35.91  ? 24   ARG F CA  1 
ATOM   4172  C C   . ARG F  1 24  ? 131.565 133.583 119.810 1.00 36.12  ? 24   ARG F C   1 
ATOM   4173  O O   . ARG F  1 24  ? 131.352 134.798 119.829 1.00 35.70  ? 24   ARG F O   1 
ATOM   4174  C CB  . ARG F  1 24  ? 129.771 132.062 118.894 1.00 36.52  ? 24   ARG F CB  1 
ATOM   4175  C CG  . ARG F  1 24  ? 130.255 130.639 118.432 1.00 35.54  ? 24   ARG F CG  1 
ATOM   4176  C CD  . ARG F  1 24  ? 129.575 130.275 117.085 1.00 33.98  ? 24   ARG F CD  1 
ATOM   4177  N NE  . ARG F  1 24  ? 130.064 129.014 116.512 1.00 34.26  ? 24   ARG F NE  1 
ATOM   4178  C CZ  . ARG F  1 24  ? 130.914 128.917 115.489 1.00 38.93  ? 24   ARG F CZ  1 
ATOM   4179  N NH1 . ARG F  1 24  ? 131.394 130.007 114.897 1.00 42.28  ? 24   ARG F NH1 1 
ATOM   4180  N NH2 . ARG F  1 24  ? 131.287 127.721 115.053 1.00 46.47  ? 24   ARG F NH2 1 
ATOM   4181  N N   . ALA F  1 25  ? 132.747 133.057 119.494 1.00 37.60  ? 25   ALA F N   1 
ATOM   4182  C CA  . ALA F  1 25  ? 133.881 133.896 119.125 1.00 38.43  ? 25   ALA F CA  1 
ATOM   4183  C C   . ALA F  1 25  ? 134.189 133.691 117.657 1.00 39.42  ? 25   ALA F C   1 
ATOM   4184  O O   . ALA F  1 25  ? 133.638 132.794 117.007 1.00 42.47  ? 25   ALA F O   1 
ATOM   4185  C CB  . ALA F  1 25  ? 135.093 133.541 119.958 1.00 37.25  ? 25   ALA F CB  1 
ATOM   4186  N N   . SER F  1 26  ? 135.076 134.525 117.135 1.00 39.45  ? 26   SER F N   1 
ATOM   4187  C CA  . SER F  1 26  ? 135.533 134.383 115.768 1.00 39.22  ? 26   SER F CA  1 
ATOM   4188  C C   . SER F  1 26  ? 136.512 133.216 115.611 1.00 39.56  ? 26   SER F C   1 
ATOM   4189  O O   . SER F  1 26  ? 136.638 132.660 114.518 1.00 39.49  ? 26   SER F O   1 
ATOM   4190  C CB  . SER F  1 26  ? 136.162 135.694 115.285 1.00 39.06  ? 26   SER F CB  1 
ATOM   4191  O OG  . SER F  1 26  ? 136.723 136.435 116.373 1.00 36.92  ? 26   SER F OG  1 
ATOM   4192  N N   . GLN F  1 27  ? 137.189 132.839 116.698 1.00 39.93  ? 27   GLN F N   1 
ATOM   4193  C CA  . GLN F  1 27  ? 138.290 131.871 116.619 1.00 39.97  ? 27   GLN F CA  1 
ATOM   4194  C C   . GLN F  1 27  ? 138.525 131.116 117.932 1.00 39.94  ? 27   GLN F C   1 
ATOM   4195  O O   . GLN F  1 27  ? 138.696 131.744 118.992 1.00 42.06  ? 27   GLN F O   1 
ATOM   4196  C CB  . GLN F  1 27  ? 139.586 132.577 116.169 1.00 39.95  ? 27   GLN F CB  1 
ATOM   4197  C CG  . GLN F  1 27  ? 140.110 133.644 117.158 1.00 35.99  ? 27   GLN F CG  1 
ATOM   4198  C CD  . GLN F  1 27  ? 141.260 134.491 116.599 1.00 40.92  ? 27   GLN F CD  1 
ATOM   4199  O OE1 . GLN F  1 27  ? 141.649 134.353 115.432 1.00 44.11  ? 27   GLN F OE1 1 
ATOM   4200  N NE2 . GLN F  1 27  ? 141.813 135.364 117.439 1.00 33.71  ? 27   GLN F NE2 1 
ATOM   4201  N N   . SER F  1 28  ? 138.519 129.779 117.852 1.00 38.46  ? 28   SER F N   1 
ATOM   4202  C CA  . SER F  1 28  ? 138.834 128.920 119.000 1.00 38.09  ? 28   SER F CA  1 
ATOM   4203  C C   . SER F  1 28  ? 139.740 129.576 120.054 1.00 35.50  ? 28   SER F C   1 
ATOM   4204  O O   . SER F  1 28  ? 140.936 129.783 119.821 1.00 36.24  ? 28   SER F O   1 
ATOM   4205  C CB  . SER F  1 28  ? 139.465 127.618 118.508 1.00 36.60  ? 28   SER F CB  1 
ATOM   4206  O OG  . SER F  1 28  ? 140.599 127.899 117.675 1.00 40.56  ? 28   SER F OG  1 
ATOM   4207  N N   . ILE F  1 29  ? 139.146 129.905 121.201 1.00 32.16  ? 29   ILE F N   1 
ATOM   4208  C CA  . ILE F  1 29  ? 139.835 130.572 122.301 1.00 29.23  ? 29   ILE F CA  1 
ATOM   4209  C C   . ILE F  1 29  ? 140.160 129.580 123.415 1.00 31.07  ? 29   ILE F C   1 
ATOM   4210  O O   . ILE F  1 29  ? 139.899 129.864 124.591 1.00 30.43  ? 29   ILE F O   1 
ATOM   4211  C CB  . ILE F  1 29  ? 139.002 131.759 122.880 1.00 29.97  ? 29   ILE F CB  1 
ATOM   4212  C CG1 . ILE F  1 29  ? 137.588 131.302 123.283 1.00 30.10  ? 29   ILE F CG1 1 
ATOM   4213  C CG2 . ILE F  1 29  ? 138.935 132.915 121.872 1.00 25.44  ? 29   ILE F CG2 1 
ATOM   4214  C CD1 . ILE F  1 29  ? 136.868 132.246 124.238 1.00 23.70  ? 29   ILE F CD1 1 
ATOM   4215  N N   . SER F  1 30  ? 140.748 128.438 123.054 1.00 31.50  ? 30   SER F N   1 
ATOM   4216  C CA  . SER F  1 30  ? 140.987 127.370 124.018 1.00 33.06  ? 30   SER F CA  1 
ATOM   4217  C C   . SER F  1 30  ? 139.751 127.304 124.908 1.00 32.93  ? 30   SER F C   1 
ATOM   4218  O O   . SER F  1 30  ? 138.732 126.727 124.520 1.00 35.40  ? 30   SER F O   1 
ATOM   4219  C CB  . SER F  1 30  ? 142.244 127.656 124.854 1.00 34.19  ? 30   SER F CB  1 
ATOM   4220  O OG  . SER F  1 30  ? 142.093 128.860 125.630 1.00 40.32  ? 30   SER F OG  1 
ATOM   4221  N N   . SER F  1 31  ? 139.841 127.930 126.089 1.00 32.07  ? 31   SER F N   1 
ATOM   4222  C CA  . SER F  1 31  ? 138.715 128.097 127.026 1.00 31.65  ? 31   SER F CA  1 
ATOM   4223  C C   . SER F  1 31  ? 138.962 129.234 128.049 1.00 32.67  ? 31   SER F C   1 
ATOM   4224  O O   . SER F  1 31  ? 138.591 129.139 129.227 1.00 30.19  ? 31   SER F O   1 
ATOM   4225  C CB  . SER F  1 31  ? 138.381 126.772 127.725 1.00 30.37  ? 31   SER F CB  1 
ATOM   4226  O OG  . SER F  1 31  ? 139.301 126.491 128.788 1.00 31.04  ? 31   SER F OG  1 
ATOM   4227  N N   . TYR F  1 32  ? 139.608 130.295 127.560 1.00 33.05  ? 32   TYR F N   1 
ATOM   4228  C CA  . TYR F  1 32  ? 139.668 131.595 128.237 1.00 34.31  ? 32   TYR F CA  1 
ATOM   4229  C C   . TYR F  1 32  ? 138.352 132.368 128.020 1.00 34.07  ? 32   TYR F C   1 
ATOM   4230  O O   . TYR F  1 32  ? 138.300 133.259 127.168 1.00 34.47  ? 32   TYR F O   1 
ATOM   4231  C CB  . TYR F  1 32  ? 140.848 132.433 127.681 1.00 34.66  ? 32   TYR F CB  1 
ATOM   4232  C CG  . TYR F  1 32  ? 142.233 131.974 128.110 1.00 35.72  ? 32   TYR F CG  1 
ATOM   4233  C CD1 . TYR F  1 32  ? 142.765 130.775 127.636 1.00 39.11  ? 32   TYR F CD1 1 
ATOM   4234  C CD2 . TYR F  1 32  ? 143.013 132.735 128.983 1.00 35.46  ? 32   TYR F CD2 1 
ATOM   4235  C CE1 . TYR F  1 32  ? 144.025 130.329 128.023 1.00 33.69  ? 32   TYR F CE1 1 
ATOM   4236  C CE2 . TYR F  1 32  ? 144.290 132.297 129.379 1.00 40.34  ? 32   TYR F CE2 1 
ATOM   4237  C CZ  . TYR F  1 32  ? 144.787 131.090 128.890 1.00 37.50  ? 32   TYR F CZ  1 
ATOM   4238  O OH  . TYR F  1 32  ? 146.048 130.637 129.259 1.00 34.76  ? 32   TYR F OH  1 
ATOM   4239  N N   . LEU F  1 33  ? 137.292 132.040 128.765 1.00 32.74  ? 33   LEU F N   1 
ATOM   4240  C CA  . LEU F  1 33  ? 136.037 132.818 128.644 1.00 32.86  ? 33   LEU F CA  1 
ATOM   4241  C C   . LEU F  1 33  ? 135.309 133.151 129.952 1.00 32.95  ? 33   LEU F C   1 
ATOM   4242  O O   . LEU F  1 33  ? 135.204 132.319 130.861 1.00 32.65  ? 33   LEU F O   1 
ATOM   4243  C CB  . LEU F  1 33  ? 135.066 132.194 127.609 1.00 32.79  ? 33   LEU F CB  1 
ATOM   4244  C CG  . LEU F  1 33  ? 133.642 132.805 127.577 1.00 30.99  ? 33   LEU F CG  1 
ATOM   4245  C CD1 . LEU F  1 33  ? 133.332 133.435 126.189 1.00 34.40  ? 33   LEU F CD1 1 
ATOM   4246  C CD2 . LEU F  1 33  ? 132.588 131.745 128.020 1.00 31.72  ? 33   LEU F CD2 1 
ATOM   4247  N N   . ASN F  1 34  ? 134.799 134.383 130.006 1.00 32.47  ? 34   ASN F N   1 
ATOM   4248  C CA  . ASN F  1 34  ? 134.177 134.942 131.206 1.00 32.59  ? 34   ASN F CA  1 
ATOM   4249  C C   . ASN F  1 34  ? 132.694 135.303 131.063 1.00 31.62  ? 34   ASN F C   1 
ATOM   4250  O O   . ASN F  1 34  ? 132.186 135.514 129.956 1.00 33.19  ? 34   ASN F O   1 
ATOM   4251  C CB  . ASN F  1 34  ? 135.001 136.141 131.702 1.00 32.82  ? 34   ASN F CB  1 
ATOM   4252  C CG  . ASN F  1 34  ? 136.458 135.770 131.997 1.00 37.22  ? 34   ASN F CG  1 
ATOM   4253  O OD1 . ASN F  1 34  ? 136.821 134.592 132.053 1.00 41.46  ? 34   ASN F OD1 1 
ATOM   4254  N ND2 . ASN F  1 34  ? 137.294 136.781 132.198 1.00 41.42  ? 34   ASN F ND2 1 
ATOM   4255  N N   . TRP F  1 35  ? 132.013 135.333 132.204 1.00 30.88  ? 35   TRP F N   1 
ATOM   4256  C CA  . TRP F  1 35  ? 130.619 135.715 132.311 1.00 29.44  ? 35   TRP F CA  1 
ATOM   4257  C C   . TRP F  1 35  ? 130.505 136.592 133.537 1.00 30.49  ? 35   TRP F C   1 
ATOM   4258  O O   . TRP F  1 35  ? 130.738 136.137 134.656 1.00 31.77  ? 35   TRP F O   1 
ATOM   4259  C CB  . TRP F  1 35  ? 129.747 134.475 132.510 1.00 28.68  ? 35   TRP F CB  1 
ATOM   4260  C CG  . TRP F  1 35  ? 129.509 133.699 131.271 1.00 29.31  ? 35   TRP F CG  1 
ATOM   4261  C CD1 . TRP F  1 35  ? 129.964 132.446 130.998 1.00 26.28  ? 35   TRP F CD1 1 
ATOM   4262  C CD2 . TRP F  1 35  ? 128.742 134.108 130.130 1.00 30.99  ? 35   TRP F CD2 1 
ATOM   4263  N NE1 . TRP F  1 35  ? 129.529 132.042 129.760 1.00 24.47  ? 35   TRP F NE1 1 
ATOM   4264  C CE2 . TRP F  1 35  ? 128.779 133.044 129.203 1.00 27.27  ? 35   TRP F CE2 1 
ATOM   4265  C CE3 . TRP F  1 35  ? 128.027 135.271 129.802 1.00 27.27  ? 35   TRP F CE3 1 
ATOM   4266  C CZ2 . TRP F  1 35  ? 128.134 133.103 127.963 1.00 28.25  ? 35   TRP F CZ2 1 
ATOM   4267  C CZ3 . TRP F  1 35  ? 127.380 135.333 128.568 1.00 27.01  ? 35   TRP F CZ3 1 
ATOM   4268  C CH2 . TRP F  1 35  ? 127.441 134.252 127.665 1.00 24.68  ? 35   TRP F CH2 1 
ATOM   4269  N N   . TYR F  1 36  ? 130.174 137.856 133.322 1.00 31.78  ? 36   TYR F N   1 
ATOM   4270  C CA  . TYR F  1 36  ? 130.059 138.817 134.407 1.00 33.53  ? 36   TYR F CA  1 
ATOM   4271  C C   . TYR F  1 36  ? 128.569 138.998 134.737 1.00 34.67  ? 36   TYR F C   1 
ATOM   4272  O O   . TYR F  1 36  ? 127.721 138.390 134.075 1.00 36.09  ? 36   TYR F O   1 
ATOM   4273  C CB  . TYR F  1 36  ? 130.732 140.128 133.977 1.00 33.89  ? 36   TYR F CB  1 
ATOM   4274  C CG  . TYR F  1 36  ? 132.246 140.135 134.146 1.00 34.90  ? 36   TYR F CG  1 
ATOM   4275  C CD1 . TYR F  1 36  ? 133.096 139.553 133.200 1.00 32.39  ? 36   TYR F CD1 1 
ATOM   4276  C CD2 . TYR F  1 36  ? 132.824 140.744 135.253 1.00 34.99  ? 36   TYR F CD2 1 
ATOM   4277  C CE1 . TYR F  1 36  ? 134.490 139.572 133.375 1.00 34.74  ? 36   TYR F CE1 1 
ATOM   4278  C CE2 . TYR F  1 36  ? 134.203 140.763 135.443 1.00 36.30  ? 36   TYR F CE2 1 
ATOM   4279  C CZ  . TYR F  1 36  ? 135.032 140.184 134.499 1.00 38.40  ? 36   TYR F CZ  1 
ATOM   4280  O OH  . TYR F  1 36  ? 136.399 140.210 134.682 1.00 34.39  ? 36   TYR F OH  1 
ATOM   4281  N N   . GLN F  1 37  ? 128.227 139.789 135.751 1.00 34.41  ? 37   GLN F N   1 
ATOM   4282  C CA  . GLN F  1 37  ? 126.820 140.170 135.905 1.00 35.46  ? 37   GLN F CA  1 
ATOM   4283  C C   . GLN F  1 37  ? 126.666 141.679 135.972 1.00 35.94  ? 37   GLN F C   1 
ATOM   4284  O O   . GLN F  1 37  ? 127.242 142.335 136.844 1.00 37.60  ? 37   GLN F O   1 
ATOM   4285  C CB  . GLN F  1 37  ? 126.145 139.475 137.105 1.00 35.25  ? 37   GLN F CB  1 
ATOM   4286  C CG  . GLN F  1 37  ? 124.600 139.473 137.008 1.00 38.03  ? 37   GLN F CG  1 
ATOM   4287  C CD  . GLN F  1 37  ? 123.925 138.627 138.079 1.00 34.93  ? 37   GLN F CD  1 
ATOM   4288  O OE1 . GLN F  1 37  ? 124.395 138.548 139.214 1.00 38.19  ? 37   GLN F OE1 1 
ATOM   4289  N NE2 . GLN F  1 37  ? 122.810 138.002 137.726 1.00 29.48  ? 37   GLN F NE2 1 
ATOM   4290  N N   . GLN F  1 38  ? 125.897 142.229 135.036 1.00 36.61  ? 38   GLN F N   1 
ATOM   4291  C CA  . GLN F  1 38  ? 125.580 143.646 135.104 1.00 38.26  ? 38   GLN F CA  1 
ATOM   4292  C C   . GLN F  1 38  ? 124.162 143.982 135.534 1.00 37.38  ? 38   GLN F C   1 
ATOM   4293  O O   . GLN F  1 38  ? 123.267 144.174 134.701 1.00 37.38  ? 38   GLN F O   1 
ATOM   4294  C CB  . GLN F  1 38  ? 125.978 144.395 133.839 1.00 37.69  ? 38   GLN F CB  1 
ATOM   4295  C CG  . GLN F  1 38  ? 127.172 145.284 134.106 1.00 36.87  ? 38   GLN F CG  1 
ATOM   4296  C CD  . GLN F  1 38  ? 127.048 146.624 133.439 1.00 40.17  ? 38   GLN F CD  1 
ATOM   4297  O OE1 . GLN F  1 38  ? 126.748 146.712 132.247 1.00 43.71  ? 38   GLN F OE1 1 
ATOM   4298  N NE2 . GLN F  1 38  ? 127.283 147.689 134.198 1.00 38.38  ? 38   GLN F NE2 1 
ATOM   4299  N N   . LYS F  1 39  ? 123.983 144.043 136.854 1.00 37.17  ? 39   LYS F N   1 
ATOM   4300  C CA  . LYS F  1 39  ? 122.819 144.684 137.456 1.00 37.18  ? 39   LYS F CA  1 
ATOM   4301  C C   . LYS F  1 39  ? 122.857 146.145 137.037 1.00 37.90  ? 39   LYS F C   1 
ATOM   4302  O O   . LYS F  1 39  ? 123.896 146.799 137.176 1.00 38.88  ? 39   LYS F O   1 
ATOM   4303  C CB  . LYS F  1 39  ? 122.839 144.581 138.994 1.00 35.57  ? 39   LYS F CB  1 
ATOM   4304  C CG  . LYS F  1 39  ? 122.932 143.150 139.558 1.00 34.73  ? 39   LYS F CG  1 
ATOM   4305  C CD  . LYS F  1 39  ? 121.627 142.649 140.336 1.00 30.05  ? 39   LYS F CD  1 
ATOM   4306  C CE  . LYS F  1 39  ? 120.336 143.357 139.864 1.00 29.51  ? 39   LYS F CE  1 
ATOM   4307  N NZ  . LYS F  1 39  ? 119.117 142.699 140.551 1.00 32.73  ? 39   LYS F NZ  1 
ATOM   4308  N N   . PRO F  1 40  ? 121.745 146.640 136.473 1.00 37.13  ? 40   PRO F N   1 
ATOM   4309  C CA  . PRO F  1 40  ? 121.542 148.067 136.293 1.00 37.03  ? 40   PRO F CA  1 
ATOM   4310  C C   . PRO F  1 40  ? 122.347 148.928 137.290 1.00 37.34  ? 40   PRO F C   1 
ATOM   4311  O O   . PRO F  1 40  ? 122.333 148.673 138.508 1.00 37.65  ? 40   PRO F O   1 
ATOM   4312  C CB  . PRO F  1 40  ? 120.029 148.225 136.553 1.00 36.29  ? 40   PRO F CB  1 
ATOM   4313  C CG  . PRO F  1 40  ? 119.431 146.835 136.217 1.00 38.13  ? 40   PRO F CG  1 
ATOM   4314  C CD  . PRO F  1 40  ? 120.599 145.874 135.950 1.00 36.60  ? 40   PRO F CD  1 
ATOM   4315  N N   . GLY F  1 41  ? 123.054 149.929 136.769 1.00 37.41  ? 41   GLY F N   1 
ATOM   4316  C CA  . GLY F  1 41  ? 123.626 150.998 137.600 1.00 37.42  ? 41   GLY F CA  1 
ATOM   4317  C C   . GLY F  1 41  ? 124.928 150.661 138.302 1.00 37.88  ? 41   GLY F C   1 
ATOM   4318  O O   . GLY F  1 41  ? 125.895 151.429 138.237 1.00 38.46  ? 41   GLY F O   1 
ATOM   4319  N N   . LYS F  1 42  ? 124.943 149.523 138.991 1.00 37.45  ? 42   LYS F N   1 
ATOM   4320  C CA  . LYS F  1 42  ? 126.184 148.975 139.512 1.00 36.45  ? 42   LYS F CA  1 
ATOM   4321  C C   . LYS F  1 42  ? 126.970 148.394 138.320 1.00 36.79  ? 42   LYS F C   1 
ATOM   4322  O O   . LYS F  1 42  ? 126.410 148.173 137.236 1.00 35.28  ? 42   LYS F O   1 
ATOM   4323  C CB  . LYS F  1 42  ? 125.910 147.927 140.601 1.00 35.83  ? 42   LYS F CB  1 
ATOM   4324  C CG  . LYS F  1 42  ? 126.933 147.893 141.752 1.00 39.03  ? 42   LYS F CG  1 
ATOM   4325  C CD  . LYS F  1 42  ? 126.387 148.501 143.054 1.00 34.24  ? 42   LYS F CD  1 
ATOM   4326  C CE  . LYS F  1 42  ? 127.526 148.947 144.009 1.00 33.68  ? 42   LYS F CE  1 
ATOM   4327  N NZ  . LYS F  1 42  ? 128.711 147.878 144.082 1.00 32.97  ? 42   LYS F NZ  1 
ATOM   4328  N N   . ALA F  1 43  ? 128.267 148.162 138.528 1.00 36.89  ? 43   ALA F N   1 
ATOM   4329  C CA  . ALA F  1 43  ? 129.215 147.744 137.475 1.00 35.57  ? 43   ALA F CA  1 
ATOM   4330  C C   . ALA F  1 43  ? 129.033 146.255 137.090 1.00 35.04  ? 43   ALA F C   1 
ATOM   4331  O O   . ALA F  1 43  ? 127.988 145.675 137.406 1.00 36.40  ? 43   ALA F O   1 
ATOM   4332  C CB  . ALA F  1 43  ? 130.640 148.022 137.955 1.00 36.19  ? 43   ALA F CB  1 
ATOM   4333  N N   . PRO F  1 44  ? 130.017 145.632 136.376 1.00 34.81  ? 44   PRO F N   1 
ATOM   4334  C CA  . PRO F  1 44  ? 130.007 144.155 136.258 1.00 34.67  ? 44   PRO F CA  1 
ATOM   4335  C C   . PRO F  1 44  ? 130.917 143.390 137.256 1.00 35.16  ? 44   PRO F C   1 
ATOM   4336  O O   . PRO F  1 44  ? 131.818 143.993 137.854 1.00 35.54  ? 44   PRO F O   1 
ATOM   4337  C CB  . PRO F  1 44  ? 130.504 143.922 134.822 1.00 32.80  ? 44   PRO F CB  1 
ATOM   4338  C CG  . PRO F  1 44  ? 131.161 145.249 134.384 1.00 35.59  ? 44   PRO F CG  1 
ATOM   4339  C CD  . PRO F  1 44  ? 131.107 146.205 135.562 1.00 34.78  ? 44   PRO F CD  1 
ATOM   4340  N N   . LYS F  1 45  ? 130.682 142.076 137.417 1.00 35.13  ? 45   LYS F N   1 
ATOM   4341  C CA  . LYS F  1 45  ? 131.447 141.176 138.329 1.00 34.46  ? 45   LYS F CA  1 
ATOM   4342  C C   . LYS F  1 45  ? 131.484 139.717 137.808 1.00 35.12  ? 45   LYS F C   1 
ATOM   4343  O O   . LYS F  1 45  ? 130.485 139.264 137.250 1.00 35.85  ? 45   LYS F O   1 
ATOM   4344  C CB  . LYS F  1 45  ? 130.817 141.189 139.729 1.00 34.63  ? 45   LYS F CB  1 
ATOM   4345  C CG  . LYS F  1 45  ? 131.117 142.444 140.558 1.00 36.81  ? 45   LYS F CG  1 
ATOM   4346  C CD  . LYS F  1 45  ? 130.033 142.625 141.668 1.00 33.11  ? 45   LYS F CD  1 
ATOM   4347  C CE  . LYS F  1 45  ? 130.374 143.868 142.505 1.00 34.91  ? 45   LYS F CE  1 
ATOM   4348  N NZ  . LYS F  1 45  ? 129.577 143.934 143.822 1.00 38.34  ? 45   LYS F NZ  1 
ATOM   4349  N N   . LEU F  1 46  ? 132.582 138.975 137.987 1.00 32.88  ? 46   LEU F N   1 
ATOM   4350  C CA  . LEU F  1 46  ? 132.599 137.584 137.486 1.00 33.68  ? 46   LEU F CA  1 
ATOM   4351  C C   . LEU F  1 46  ? 131.467 136.796 138.101 1.00 32.38  ? 46   LEU F C   1 
ATOM   4352  O O   . LEU F  1 46  ? 131.396 136.662 139.336 1.00 33.21  ? 46   LEU F O   1 
ATOM   4353  C CB  . LEU F  1 46  ? 133.888 136.813 137.862 1.00 31.73  ? 46   LEU F CB  1 
ATOM   4354  C CG  . LEU F  1 46  ? 135.305 137.221 137.397 1.00 29.84  ? 46   LEU F CG  1 
ATOM   4355  C CD1 . LEU F  1 46  ? 135.496 136.980 135.876 1.00 37.82  ? 46   LEU F CD1 1 
ATOM   4356  C CD2 . LEU F  1 46  ? 135.656 138.687 137.775 1.00 28.74  ? 46   LEU F CD2 1 
ATOM   4357  N N   . LEU F  1 47  ? 130.576 136.285 137.254 1.00 30.52  ? 47   LEU F N   1 
ATOM   4358  C CA  . LEU F  1 47  ? 129.917 135.038 137.609 1.00 32.18  ? 47   LEU F CA  1 
ATOM   4359  C C   . LEU F  1 47  ? 130.891 133.915 137.249 1.00 31.43  ? 47   LEU F C   1 
ATOM   4360  O O   . LEU F  1 47  ? 131.772 133.572 138.039 1.00 29.51  ? 47   LEU F O   1 
ATOM   4361  C CB  . LEU F  1 47  ? 128.588 134.855 136.853 1.00 31.05  ? 47   LEU F CB  1 
ATOM   4362  C CG  . LEU F  1 47  ? 127.318 135.584 137.324 1.00 38.21  ? 47   LEU F CG  1 
ATOM   4363  C CD1 . LEU F  1 47  ? 126.328 135.710 136.179 1.00 41.31  ? 47   LEU F CD1 1 
ATOM   4364  C CD2 . LEU F  1 47  ? 126.671 134.891 138.496 1.00 35.73  ? 47   LEU F CD2 1 
ATOM   4365  N N   . ILE F  1 48  ? 130.736 133.368 136.048 1.00 29.67  ? 48   ILE F N   1 
ATOM   4366  C CA  . ILE F  1 48  ? 131.472 132.175 135.633 1.00 30.10  ? 48   ILE F CA  1 
ATOM   4367  C C   . ILE F  1 48  ? 132.745 132.583 134.923 1.00 30.99  ? 48   ILE F C   1 
ATOM   4368  O O   . ILE F  1 48  ? 132.718 133.523 134.112 1.00 31.29  ? 48   ILE F O   1 
ATOM   4369  C CB  . ILE F  1 48  ? 130.610 131.314 134.670 1.00 30.04  ? 48   ILE F CB  1 
ATOM   4370  C CG1 . ILE F  1 48  ? 129.402 130.744 135.428 1.00 30.74  ? 48   ILE F CG1 1 
ATOM   4371  C CG2 . ILE F  1 48  ? 131.447 130.204 134.013 1.00 26.43  ? 48   ILE F CG2 1 
ATOM   4372  C CD1 . ILE F  1 48  ? 128.421 129.958 134.566 1.00 29.29  ? 48   ILE F CD1 1 
ATOM   4373  N N   . TYR F  1 49  ? 133.852 131.887 135.187 1.00 32.79  ? 49   TYR F N   1 
ATOM   4374  C CA  . TYR F  1 49  ? 135.040 132.199 134.396 1.00 36.16  ? 49   TYR F CA  1 
ATOM   4375  C C   . TYR F  1 49  ? 135.929 130.991 134.067 1.00 34.98  ? 49   TYR F C   1 
ATOM   4376  O O   . TYR F  1 49  ? 135.666 129.857 134.496 1.00 31.81  ? 49   TYR F O   1 
ATOM   4377  C CB  . TYR F  1 49  ? 135.853 133.313 135.075 1.00 36.76  ? 49   TYR F CB  1 
ATOM   4378  C CG  . TYR F  1 49  ? 136.512 132.761 136.278 1.00 40.97  ? 49   TYR F CG  1 
ATOM   4379  C CD1 . TYR F  1 49  ? 136.271 131.445 136.647 1.00 40.74  ? 49   TYR F CD1 1 
ATOM   4380  C CD2 . TYR F  1 49  ? 137.349 133.526 137.066 1.00 46.89  ? 49   TYR F CD2 1 
ATOM   4381  C CE1 . TYR F  1 49  ? 136.847 130.889 137.732 1.00 47.63  ? 49   TYR F CE1 1 
ATOM   4382  C CE2 . TYR F  1 49  ? 137.944 132.974 138.177 1.00 47.55  ? 49   TYR F CE2 1 
ATOM   4383  C CZ  . TYR F  1 49  ? 137.684 131.647 138.502 1.00 46.13  ? 49   TYR F CZ  1 
ATOM   4384  O OH  . TYR F  1 49  ? 138.261 131.073 139.609 1.00 46.52  ? 49   TYR F OH  1 
ATOM   4385  N N   . ALA F  1 50  ? 136.984 131.276 133.305 1.00 35.88  ? 50   ALA F N   1 
ATOM   4386  C CA  . ALA F  1 50  ? 137.700 130.255 132.538 1.00 36.58  ? 50   ALA F CA  1 
ATOM   4387  C C   . ALA F  1 50  ? 136.804 129.038 132.275 1.00 37.27  ? 50   ALA F C   1 
ATOM   4388  O O   . ALA F  1 50  ? 136.904 128.014 132.962 1.00 38.96  ? 50   ALA F O   1 
ATOM   4389  C CB  . ALA F  1 50  ? 139.039 129.858 133.227 1.00 36.07  ? 50   ALA F CB  1 
ATOM   4390  N N   . ALA F  1 51  ? 135.907 129.200 131.299 1.00 37.96  ? 51   ALA F N   1 
ATOM   4391  C CA  . ALA F  1 51  ? 135.095 128.120 130.721 1.00 38.81  ? 51   ALA F CA  1 
ATOM   4392  C C   . ALA F  1 51  ? 133.826 127.806 131.502 1.00 39.19  ? 51   ALA F C   1 
ATOM   4393  O O   . ALA F  1 51  ? 132.718 127.936 130.967 1.00 40.35  ? 51   ALA F O   1 
ATOM   4394  C CB  . ALA F  1 51  ? 135.932 126.844 130.487 1.00 39.38  ? 51   ALA F CB  1 
ATOM   4395  N N   . SER F  1 52  ? 133.990 127.403 132.758 1.00 38.72  ? 52   SER F N   1 
ATOM   4396  C CA  . SER F  1 52  ? 132.904 126.793 133.503 1.00 37.18  ? 52   SER F CA  1 
ATOM   4397  C C   . SER F  1 52  ? 133.240 126.771 134.975 1.00 37.96  ? 52   SER F C   1 
ATOM   4398  O O   . SER F  1 52  ? 132.503 126.195 135.786 1.00 38.42  ? 52   SER F O   1 
ATOM   4399  C CB  . SER F  1 52  ? 132.709 125.355 133.023 1.00 37.09  ? 52   SER F CB  1 
ATOM   4400  O OG  . SER F  1 52  ? 133.896 124.593 133.194 1.00 34.50  ? 52   SER F OG  1 
ATOM   4401  N N   . SER F  1 53  ? 134.362 127.391 135.322 1.00 36.25  ? 53   SER F N   1 
ATOM   4402  C CA  . SER F  1 53  ? 134.812 127.375 136.696 1.00 34.58  ? 53   SER F CA  1 
ATOM   4403  C C   . SER F  1 53  ? 134.076 128.447 137.481 1.00 34.19  ? 53   SER F C   1 
ATOM   4404  O O   . SER F  1 53  ? 134.126 129.638 137.137 1.00 33.57  ? 53   SER F O   1 
ATOM   4405  C CB  . SER F  1 53  ? 136.327 127.582 136.766 1.00 35.33  ? 53   SER F CB  1 
ATOM   4406  O OG  . SER F  1 53  ? 136.795 127.471 138.098 1.00 28.35  ? 53   SER F OG  1 
ATOM   4407  N N   . LEU F  1 54  ? 133.370 128.027 138.523 1.00 36.09  ? 54   LEU F N   1 
ATOM   4408  C CA  . LEU F  1 54  ? 132.607 128.975 139.313 1.00 37.29  ? 54   LEU F CA  1 
ATOM   4409  C C   . LEU F  1 54  ? 133.481 129.778 140.278 1.00 40.28  ? 54   LEU F C   1 
ATOM   4410  O O   . LEU F  1 54  ? 134.718 129.705 140.276 1.00 41.02  ? 54   LEU F O   1 
ATOM   4411  C CB  . LEU F  1 54  ? 131.452 128.281 140.057 1.00 37.96  ? 54   LEU F CB  1 
ATOM   4412  C CG  . LEU F  1 54  ? 130.276 129.130 140.551 1.00 29.90  ? 54   LEU F CG  1 
ATOM   4413  C CD1 . LEU F  1 54  ? 129.170 129.254 139.461 1.00 29.71  ? 54   LEU F CD1 1 
ATOM   4414  C CD2 . LEU F  1 54  ? 129.650 128.477 141.787 1.00 25.89  ? 54   LEU F CD2 1 
ATOM   4415  N N   . GLN F  1 55  ? 132.778 130.532 141.112 1.00 41.20  ? 55   GLN F N   1 
ATOM   4416  C CA  . GLN F  1 55  ? 133.322 131.626 141.874 1.00 42.37  ? 55   GLN F CA  1 
ATOM   4417  C C   . GLN F  1 55  ? 132.599 131.708 143.207 1.00 43.36  ? 55   GLN F C   1 
ATOM   4418  O O   . GLN F  1 55  ? 131.345 131.677 143.276 1.00 43.83  ? 55   GLN F O   1 
ATOM   4419  C CB  . GLN F  1 55  ? 133.110 132.930 141.099 1.00 42.46  ? 55   GLN F CB  1 
ATOM   4420  C CG  . GLN F  1 55  ? 134.161 133.201 140.050 1.00 43.22  ? 55   GLN F CG  1 
ATOM   4421  C CD  . GLN F  1 55  ? 135.488 133.516 140.677 1.00 50.82  ? 55   GLN F CD  1 
ATOM   4422  O OE1 . GLN F  1 55  ? 136.463 132.798 140.489 1.00 55.21  ? 55   GLN F OE1 1 
ATOM   4423  N NE2 . GLN F  1 55  ? 135.522 134.586 141.480 1.00 54.12  ? 55   GLN F NE2 1 
ATOM   4424  N N   . SER F  1 56  ? 133.409 131.792 144.262 1.00 43.36  ? 56   SER F N   1 
ATOM   4425  C CA  . SER F  1 56  ? 132.926 132.016 145.610 1.00 44.24  ? 56   SER F CA  1 
ATOM   4426  C C   . SER F  1 56  ? 132.376 133.433 145.695 1.00 44.20  ? 56   SER F C   1 
ATOM   4427  O O   . SER F  1 56  ? 133.030 134.398 145.287 1.00 44.53  ? 56   SER F O   1 
ATOM   4428  C CB  . SER F  1 56  ? 134.066 131.841 146.613 1.00 44.48  ? 56   SER F CB  1 
ATOM   4429  O OG  . SER F  1 56  ? 134.991 130.841 146.180 1.00 41.76  ? 56   SER F OG  1 
ATOM   4430  N N   . GLY F  1 57  ? 131.166 133.541 146.234 1.00 42.77  ? 57   GLY F N   1 
ATOM   4431  C CA  . GLY F  1 57  ? 130.428 134.797 146.258 1.00 42.71  ? 57   GLY F CA  1 
ATOM   4432  C C   . GLY F  1 57  ? 129.117 134.686 145.493 1.00 42.98  ? 57   GLY F C   1 
ATOM   4433  O O   . GLY F  1 57  ? 128.131 135.347 145.836 1.00 42.48  ? 57   GLY F O   1 
ATOM   4434  N N   . VAL F  1 58  ? 129.097 133.833 144.475 1.00 41.81  ? 58   VAL F N   1 
ATOM   4435  C CA  . VAL F  1 58  ? 127.976 133.783 143.544 1.00 40.63  ? 58   VAL F CA  1 
ATOM   4436  C C   . VAL F  1 58  ? 127.275 132.420 143.561 1.00 41.83  ? 58   VAL F C   1 
ATOM   4437  O O   . VAL F  1 58  ? 127.945 131.382 143.552 1.00 42.31  ? 58   VAL F O   1 
ATOM   4438  C CB  . VAL F  1 58  ? 128.422 134.238 142.112 1.00 41.59  ? 58   VAL F CB  1 
ATOM   4439  C CG1 . VAL F  1 58  ? 129.886 133.891 141.848 1.00 40.95  ? 58   VAL F CG1 1 
ATOM   4440  C CG2 . VAL F  1 58  ? 127.541 133.632 141.029 1.00 37.53  ? 58   VAL F CG2 1 
ATOM   4441  N N   . PRO F  1 59  ? 125.919 132.430 143.602 1.00 40.66  ? 59   PRO F N   1 
ATOM   4442  C CA  . PRO F  1 59  ? 125.141 131.207 143.734 1.00 40.21  ? 59   PRO F CA  1 
ATOM   4443  C C   . PRO F  1 59  ? 125.458 130.240 142.620 1.00 39.93  ? 59   PRO F C   1 
ATOM   4444  O O   . PRO F  1 59  ? 126.002 130.628 141.585 1.00 36.97  ? 59   PRO F O   1 
ATOM   4445  C CB  . PRO F  1 59  ? 123.686 131.690 143.625 1.00 41.11  ? 59   PRO F CB  1 
ATOM   4446  C CG  . PRO F  1 59  ? 123.767 133.036 142.998 1.00 42.37  ? 59   PRO F CG  1 
ATOM   4447  C CD  . PRO F  1 59  ? 125.040 133.610 143.510 1.00 43.01  ? 59   PRO F CD  1 
ATOM   4448  N N   . SER F  1 60  ? 125.127 128.981 142.842 1.00 41.00  ? 60   SER F N   1 
ATOM   4449  C CA  . SER F  1 60  ? 125.495 127.964 141.893 1.00 40.27  ? 60   SER F CA  1 
ATOM   4450  C C   . SER F  1 60  ? 124.309 127.496 141.063 1.00 41.02  ? 60   SER F C   1 
ATOM   4451  O O   . SER F  1 60  ? 124.211 126.301 140.791 1.00 41.25  ? 60   SER F O   1 
ATOM   4452  C CB  . SER F  1 60  ? 126.087 126.755 142.634 1.00 40.13  ? 60   SER F CB  1 
ATOM   4453  O OG  . SER F  1 60  ? 125.048 126.016 143.360 1.00 38.46  ? 60   SER F OG  1 
ATOM   4454  N N   . ARG F  1 61  ? 123.400 128.371 140.646 1.00 41.22  ? 61   ARG F N   1 
ATOM   4455  C CA  . ARG F  1 61  ? 122.463 127.887 139.620 1.00 41.34  ? 61   ARG F CA  1 
ATOM   4456  C C   . ARG F  1 61  ? 122.990 128.198 138.214 1.00 41.25  ? 61   ARG F C   1 
ATOM   4457  O O   . ARG F  1 61  ? 122.229 128.312 137.241 1.00 41.04  ? 61   ARG F O   1 
ATOM   4458  C CB  . ARG F  1 61  ? 120.980 128.271 139.870 1.00 41.77  ? 61   ARG F CB  1 
ATOM   4459  C CG  . ARG F  1 61  ? 120.595 129.715 139.599 1.00 46.14  ? 61   ARG F CG  1 
ATOM   4460  C CD  . ARG F  1 61  ? 120.668 130.547 140.868 1.00 48.45  ? 61   ARG F CD  1 
ATOM   4461  N NE  . ARG F  1 61  ? 120.221 131.917 140.630 1.00 47.80  ? 61   ARG F NE  1 
ATOM   4462  C CZ  . ARG F  1 61  ? 120.111 132.850 141.572 1.00 47.85  ? 61   ARG F CZ  1 
ATOM   4463  N NH1 . ARG F  1 61  ? 120.404 132.575 142.838 1.00 40.97  ? 61   ARG F NH1 1 
ATOM   4464  N NH2 . ARG F  1 61  ? 119.700 134.063 141.254 1.00 50.55  ? 61   ARG F NH2 1 
ATOM   4465  N N   . PHE F  1 62  ? 124.324 128.294 138.146 1.00 39.06  ? 62   PHE F N   1 
ATOM   4466  C CA  . PHE F  1 62  ? 125.058 128.682 136.938 1.00 39.07  ? 62   PHE F CA  1 
ATOM   4467  C C   . PHE F  1 62  ? 125.927 127.578 136.373 1.00 39.70  ? 62   PHE F C   1 
ATOM   4468  O O   . PHE F  1 62  ? 126.944 127.209 136.969 1.00 39.70  ? 62   PHE F O   1 
ATOM   4469  C CB  . PHE F  1 62  ? 125.942 129.891 137.244 1.00 38.26  ? 62   PHE F CB  1 
ATOM   4470  C CG  . PHE F  1 62  ? 125.173 131.052 137.732 1.00 34.92  ? 62   PHE F CG  1 
ATOM   4471  C CD1 . PHE F  1 62  ? 125.101 131.336 139.083 1.00 24.53  ? 62   PHE F CD1 1 
ATOM   4472  C CD2 . PHE F  1 62  ? 124.454 131.831 136.838 1.00 34.22  ? 62   PHE F CD2 1 
ATOM   4473  C CE1 . PHE F  1 62  ? 124.349 132.401 139.534 1.00 24.82  ? 62   PHE F CE1 1 
ATOM   4474  C CE2 . PHE F  1 62  ? 123.704 132.898 137.277 1.00 30.81  ? 62   PHE F CE2 1 
ATOM   4475  C CZ  . PHE F  1 62  ? 123.649 133.184 138.630 1.00 32.73  ? 62   PHE F CZ  1 
ATOM   4476  N N   . SER F  1 63  ? 125.527 127.048 135.224 1.00 38.92  ? 63   SER F N   1 
ATOM   4477  C CA  . SER F  1 63  ? 126.407 126.172 134.473 1.00 38.35  ? 63   SER F CA  1 
ATOM   4478  C C   . SER F  1 63  ? 126.995 126.947 133.303 1.00 38.00  ? 63   SER F C   1 
ATOM   4479  O O   . SER F  1 63  ? 126.278 127.616 132.535 1.00 36.97  ? 63   SER F O   1 
ATOM   4480  C CB  . SER F  1 63  ? 125.685 124.897 133.998 1.00 36.87  ? 63   SER F CB  1 
ATOM   4481  O OG  . SER F  1 63  ? 125.088 124.233 135.131 1.00 36.04  ? 63   SER F OG  1 
ATOM   4482  N N   . GLY F  1 64  ? 128.318 126.878 133.217 1.00 35.61  ? 64   GLY F N   1 
ATOM   4483  C CA  . GLY F  1 64  ? 129.088 127.449 132.119 1.00 36.30  ? 64   GLY F CA  1 
ATOM   4484  C C   . GLY F  1 64  ? 129.692 126.271 131.404 1.00 38.43  ? 64   GLY F C   1 
ATOM   4485  O O   . GLY F  1 64  ? 130.149 125.319 132.048 1.00 37.53  ? 64   GLY F O   1 
ATOM   4486  N N   . SER F  1 65  ? 129.675 126.302 130.074 1.00 39.09  ? 65   SER F N   1 
ATOM   4487  C CA  . SER F  1 65  ? 130.094 125.120 129.342 1.00 39.56  ? 65   SER F CA  1 
ATOM   4488  C C   . SER F  1 65  ? 130.599 125.387 127.926 1.00 37.99  ? 65   SER F C   1 
ATOM   4489  O O   . SER F  1 65  ? 130.175 126.341 127.264 1.00 38.19  ? 65   SER F O   1 
ATOM   4490  C CB  . SER F  1 65  ? 128.971 124.058 129.339 1.00 40.21  ? 65   SER F CB  1 
ATOM   4491  O OG  . SER F  1 65  ? 127.851 124.511 128.522 1.00 36.45  ? 65   SER F OG  1 
ATOM   4492  N N   . GLY F  1 66  ? 131.541 124.542 127.489 1.00 37.03  ? 66   GLY F N   1 
ATOM   4493  C CA  . GLY F  1 66  ? 131.993 124.491 126.071 1.00 35.70  ? 66   GLY F CA  1 
ATOM   4494  C C   . GLY F  1 66  ? 133.422 124.984 125.847 1.00 36.21  ? 66   GLY F C   1 
ATOM   4495  O O   . GLY F  1 66  ? 133.981 125.669 126.712 1.00 29.67  ? 66   GLY F O   1 
ATOM   4496  N N   . SER F  1 67  ? 134.027 124.647 124.710 1.00 37.85  ? 67   SER F N   1 
ATOM   4497  C CA  . SER F  1 67  ? 135.357 125.189 124.403 1.00 40.22  ? 67   SER F CA  1 
ATOM   4498  C C   . SER F  1 67  ? 135.514 125.597 122.949 1.00 39.19  ? 67   SER F C   1 
ATOM   4499  O O   . SER F  1 67  ? 134.680 125.263 122.104 1.00 40.37  ? 67   SER F O   1 
ATOM   4500  C CB  . SER F  1 67  ? 136.476 124.217 124.807 1.00 40.12  ? 67   SER F CB  1 
ATOM   4501  O OG  . SER F  1 67  ? 136.164 122.813 124.350 1.00 46.83  ? 67   SER F OG  1 
ATOM   4502  N N   . GLY F  1 68  ? 136.588 126.329 122.667 1.00 38.16  ? 68   GLY F N   1 
ATOM   4503  C CA  . GLY F  1 68  ? 136.906 126.716 121.300 1.00 36.90  ? 68   GLY F CA  1 
ATOM   4504  C C   . GLY F  1 68  ? 136.146 127.954 120.874 1.00 36.34  ? 68   GLY F C   1 
ATOM   4505  O O   . GLY F  1 68  ? 136.540 129.071 121.207 1.00 37.35  ? 68   GLY F O   1 
ATOM   4506  N N   . THR F  1 69  ? 135.047 127.757 120.150 1.00 36.15  ? 69   THR F N   1 
ATOM   4507  C CA  . THR F  1 69  ? 134.268 128.876 119.617 1.00 36.48  ? 69   THR F CA  1 
ATOM   4508  C C   . THR F  1 69  ? 132.911 129.042 120.301 1.00 37.11  ? 69   THR F C   1 
ATOM   4509  O O   . THR F  1 69  ? 132.424 130.165 120.446 1.00 35.78  ? 69   THR F O   1 
ATOM   4510  C CB  . THR F  1 69  ? 134.063 128.745 118.089 1.00 37.11  ? 69   THR F CB  1 
ATOM   4511  O OG1 . THR F  1 69  ? 135.252 128.229 117.481 1.00 37.24  ? 69   THR F OG1 1 
ATOM   4512  C CG2 . THR F  1 69  ? 133.722 130.087 117.462 1.00 37.00  ? 69   THR F CG2 1 
ATOM   4513  N N   . ASP F  1 70  ? 132.315 127.935 120.745 1.00 38.72  ? 70   ASP F N   1 
ATOM   4514  C CA  . ASP F  1 70  ? 130.930 128.000 121.194 1.00 40.41  ? 70   ASP F CA  1 
ATOM   4515  C C   . ASP F  1 70  ? 130.681 127.852 122.696 1.00 39.99  ? 70   ASP F C   1 
ATOM   4516  O O   . ASP F  1 70  ? 131.261 126.982 123.356 1.00 39.85  ? 70   ASP F O   1 
ATOM   4517  C CB  . ASP F  1 70  ? 130.069 127.018 120.420 1.00 40.52  ? 70   ASP F CB  1 
ATOM   4518  C CG  . ASP F  1 70  ? 128.609 127.302 120.603 1.00 47.45  ? 70   ASP F CG  1 
ATOM   4519  O OD1 . ASP F  1 70  ? 128.096 128.240 119.952 1.00 54.49  ? 70   ASP F OD1 1 
ATOM   4520  O OD2 . ASP F  1 70  ? 127.965 126.607 121.427 1.00 56.12  ? 70   ASP F OD2 1 
ATOM   4521  N N   . PHE F  1 71  ? 129.786 128.695 123.217 1.00 40.79  ? 71   PHE F N   1 
ATOM   4522  C CA  . PHE F  1 71  ? 129.692 128.917 124.661 1.00 41.54  ? 71   PHE F CA  1 
ATOM   4523  C C   . PHE F  1 71  ? 128.312 129.094 125.252 1.00 42.25  ? 71   PHE F C   1 
ATOM   4524  O O   . PHE F  1 71  ? 127.456 129.767 124.671 1.00 42.58  ? 71   PHE F O   1 
ATOM   4525  C CB  . PHE F  1 71  ? 130.579 130.087 125.057 1.00 40.19  ? 71   PHE F CB  1 
ATOM   4526  C CG  . PHE F  1 71  ? 132.009 129.733 125.040 1.00 42.15  ? 71   PHE F CG  1 
ATOM   4527  C CD1 . PHE F  1 71  ? 132.823 130.088 123.971 1.00 40.19  ? 71   PHE F CD1 1 
ATOM   4528  C CD2 . PHE F  1 71  ? 132.535 128.963 126.066 1.00 39.70  ? 71   PHE F CD2 1 
ATOM   4529  C CE1 . PHE F  1 71  ? 134.159 129.717 123.954 1.00 41.88  ? 71   PHE F CE1 1 
ATOM   4530  C CE2 . PHE F  1 71  ? 133.862 128.596 126.064 1.00 45.02  ? 71   PHE F CE2 1 
ATOM   4531  C CZ  . PHE F  1 71  ? 134.679 128.967 125.005 1.00 42.31  ? 71   PHE F CZ  1 
ATOM   4532  N N   . THR F  1 72  ? 128.100 128.491 126.419 1.00 42.55  ? 72   THR F N   1 
ATOM   4533  C CA  . THR F  1 72  ? 126.775 128.542 126.997 1.00 43.70  ? 72   THR F CA  1 
ATOM   4534  C C   . THR F  1 72  ? 126.706 128.674 128.512 1.00 43.73  ? 72   THR F C   1 
ATOM   4535  O O   . THR F  1 72  ? 126.817 127.687 129.274 1.00 42.99  ? 72   THR F O   1 
ATOM   4536  C CB  . THR F  1 72  ? 125.862 127.389 126.488 1.00 44.84  ? 72   THR F CB  1 
ATOM   4537  O OG1 . THR F  1 72  ? 126.145 127.116 125.110 1.00 45.50  ? 72   THR F OG1 1 
ATOM   4538  C CG2 . THR F  1 72  ? 124.397 127.778 126.620 1.00 43.59  ? 72   THR F CG2 1 
ATOM   4539  N N   . LEU F  1 73  ? 126.531 129.933 128.912 1.00 43.42  ? 73   LEU F N   1 
ATOM   4540  C CA  . LEU F  1 73  ? 125.948 130.264 130.196 1.00 44.31  ? 73   LEU F CA  1 
ATOM   4541  C C   . LEU F  1 73  ? 124.541 129.677 130.269 1.00 44.80  ? 73   LEU F C   1 
ATOM   4542  O O   . LEU F  1 73  ? 123.809 129.641 129.276 1.00 44.83  ? 73   LEU F O   1 
ATOM   4543  C CB  . LEU F  1 73  ? 125.877 131.783 130.355 1.00 44.16  ? 73   LEU F CB  1 
ATOM   4544  C CG  . LEU F  1 73  ? 124.867 132.326 131.382 1.00 40.97  ? 73   LEU F CG  1 
ATOM   4545  C CD1 . LEU F  1 73  ? 125.221 131.894 132.826 1.00 38.59  ? 73   LEU F CD1 1 
ATOM   4546  C CD2 . LEU F  1 73  ? 124.782 133.845 131.277 1.00 42.60  ? 73   LEU F CD2 1 
ATOM   4547  N N   . THR F  1 74  ? 124.176 129.244 131.474 1.00 45.30  ? 74   THR F N   1 
ATOM   4548  C CA  . THR F  1 74  ? 122.942 128.529 131.736 1.00 45.40  ? 74   THR F CA  1 
ATOM   4549  C C   . THR F  1 74  ? 122.505 128.832 133.159 1.00 45.44  ? 74   THR F C   1 
ATOM   4550  O O   . THR F  1 74  ? 123.176 128.413 134.127 1.00 48.04  ? 74   THR F O   1 
ATOM   4551  C CB  . THR F  1 74  ? 123.173 127.002 131.612 1.00 45.45  ? 74   THR F CB  1 
ATOM   4552  O OG1 . THR F  1 74  ? 123.245 126.637 130.223 1.00 48.23  ? 74   THR F OG1 1 
ATOM   4553  C CG2 . THR F  1 74  ? 122.052 126.195 132.292 1.00 41.94  ? 74   THR F CG2 1 
ATOM   4554  N N   . ILE F  1 75  ? 121.398 129.553 133.307 1.00 45.02  ? 75   ILE F N   1 
ATOM   4555  C CA  . ILE F  1 75  ? 120.867 129.816 134.641 1.00 42.96  ? 75   ILE F CA  1 
ATOM   4556  C C   . ILE F  1 75  ? 119.695 128.877 134.928 1.00 42.61  ? 75   ILE F C   1 
ATOM   4557  O O   . ILE F  1 75  ? 118.576 129.089 134.417 1.00 42.53  ? 75   ILE F O   1 
ATOM   4558  C CB  . ILE F  1 75  ? 120.441 131.281 134.795 1.00 40.80  ? 75   ILE F CB  1 
ATOM   4559  C CG1 . ILE F  1 75  ? 121.581 132.203 134.352 1.00 42.80  ? 75   ILE F CG1 1 
ATOM   4560  C CG2 . ILE F  1 75  ? 120.033 131.572 136.240 1.00 38.67  ? 75   ILE F CG2 1 
ATOM   4561  C CD1 . ILE F  1 75  ? 121.113 133.449 133.621 1.00 41.52  ? 75   ILE F CD1 1 
ATOM   4562  N N   . SER F  1 76  ? 119.945 127.851 135.744 1.00 42.16  ? 76   SER F N   1 
ATOM   4563  C CA  . SER F  1 76  ? 118.953 126.783 135.934 1.00 41.32  ? 76   SER F CA  1 
ATOM   4564  C C   . SER F  1 76  ? 117.660 127.151 136.688 1.00 40.88  ? 76   SER F C   1 
ATOM   4565  O O   . SER F  1 76  ? 116.621 126.521 136.466 1.00 41.09  ? 76   SER F O   1 
ATOM   4566  C CB  . SER F  1 76  ? 119.609 125.545 136.557 1.00 40.73  ? 76   SER F CB  1 
ATOM   4567  O OG  . SER F  1 76  ? 120.117 125.828 137.849 1.00 43.96  ? 76   SER F OG  1 
ATOM   4568  N N   . SER F  1 77  ? 117.718 128.154 137.564 1.00 40.89  ? 77   SER F N   1 
ATOM   4569  C CA  . SER F  1 77  ? 116.546 128.544 138.352 1.00 40.80  ? 77   SER F CA  1 
ATOM   4570  C C   . SER F  1 77  ? 116.559 130.041 138.514 1.00 41.31  ? 77   SER F C   1 
ATOM   4571  O O   . SER F  1 77  ? 116.990 130.548 139.554 1.00 42.95  ? 77   SER F O   1 
ATOM   4572  C CB  . SER F  1 77  ? 116.586 127.891 139.741 1.00 40.62  ? 77   SER F CB  1 
ATOM   4573  O OG  . SER F  1 77  ? 116.086 126.557 139.699 1.00 41.32  ? 77   SER F OG  1 
ATOM   4574  N N   . LEU F  1 78  ? 116.118 130.756 137.486 1.00 41.22  ? 78   LEU F N   1 
ATOM   4575  C CA  . LEU F  1 78  ? 116.085 132.215 137.564 1.00 41.53  ? 78   LEU F CA  1 
ATOM   4576  C C   . LEU F  1 78  ? 115.344 132.624 138.834 1.00 42.55  ? 78   LEU F C   1 
ATOM   4577  O O   . LEU F  1 78  ? 114.387 131.947 139.246 1.00 41.35  ? 78   LEU F O   1 
ATOM   4578  C CB  . LEU F  1 78  ? 115.386 132.809 136.337 1.00 41.65  ? 78   LEU F CB  1 
ATOM   4579  C CG  . LEU F  1 78  ? 115.611 134.296 136.051 1.00 40.28  ? 78   LEU F CG  1 
ATOM   4580  C CD1 . LEU F  1 78  ? 117.007 134.496 135.444 1.00 44.31  ? 78   LEU F CD1 1 
ATOM   4581  C CD2 . LEU F  1 78  ? 114.522 134.822 135.100 1.00 42.67  ? 78   LEU F CD2 1 
ATOM   4582  N N   . GLN F  1 79  ? 115.779 133.720 139.454 1.00 43.81  ? 79   GLN F N   1 
ATOM   4583  C CA  . GLN F  1 79  ? 115.046 134.283 140.592 1.00 45.81  ? 79   GLN F CA  1 
ATOM   4584  C C   . GLN F  1 79  ? 115.048 135.832 140.569 1.00 46.29  ? 79   GLN F C   1 
ATOM   4585  O O   . GLN F  1 79  ? 115.426 136.420 139.542 1.00 46.02  ? 79   GLN F O   1 
ATOM   4586  C CB  . GLN F  1 79  ? 115.509 133.630 141.930 1.00 44.85  ? 79   GLN F CB  1 
ATOM   4587  C CG  . GLN F  1 79  ? 115.108 132.127 141.984 1.00 47.09  ? 79   GLN F CG  1 
ATOM   4588  C CD  . GLN F  1 79  ? 115.238 131.424 143.335 1.00 49.07  ? 79   GLN F CD  1 
ATOM   4589  O OE1 . GLN F  1 79  ? 114.708 130.323 143.510 1.00 47.92  ? 79   GLN F OE1 1 
ATOM   4590  N NE2 . GLN F  1 79  ? 115.952 132.035 144.278 1.00 50.80  ? 79   GLN F NE2 1 
ATOM   4591  N N   . PRO F  1 80  ? 114.597 136.492 141.665 1.00 46.87  ? 80   PRO F N   1 
ATOM   4592  C CA  . PRO F  1 80  ? 114.519 137.962 141.784 1.00 46.67  ? 80   PRO F CA  1 
ATOM   4593  C C   . PRO F  1 80  ? 115.759 138.688 141.239 1.00 46.38  ? 80   PRO F C   1 
ATOM   4594  O O   . PRO F  1 80  ? 115.802 139.040 140.059 1.00 46.84  ? 80   PRO F O   1 
ATOM   4595  C CB  . PRO F  1 80  ? 114.370 138.186 143.307 1.00 46.20  ? 80   PRO F CB  1 
ATOM   4596  C CG  . PRO F  1 80  ? 114.521 136.822 143.943 1.00 44.99  ? 80   PRO F CG  1 
ATOM   4597  C CD  . PRO F  1 80  ? 114.100 135.855 142.895 1.00 46.99  ? 80   PRO F CD  1 
ATOM   4598  N N   . GLU F  1 81  ? 116.710 138.953 142.131 1.00 46.16  ? 81   GLU F N   1 
ATOM   4599  C CA  . GLU F  1 81  ? 118.134 139.148 141.834 1.00 46.56  ? 81   GLU F CA  1 
ATOM   4600  C C   . GLU F  1 81  ? 118.576 139.283 140.364 1.00 47.58  ? 81   GLU F C   1 
ATOM   4601  O O   . GLU F  1 81  ? 119.259 140.243 140.003 1.00 48.89  ? 81   GLU F O   1 
ATOM   4602  C CB  . GLU F  1 81  ? 118.887 137.989 142.500 1.00 45.95  ? 81   GLU F CB  1 
ATOM   4603  C CG  . GLU F  1 81  ? 118.087 136.670 142.444 1.00 48.44  ? 81   GLU F CG  1 
ATOM   4604  C CD  . GLU F  1 81  ? 118.260 135.788 143.665 1.00 49.82  ? 81   GLU F CD  1 
ATOM   4605  O OE1 . GLU F  1 81  ? 119.417 135.510 144.045 1.00 44.89  ? 81   GLU F OE1 1 
ATOM   4606  O OE2 . GLU F  1 81  ? 117.240 135.354 144.238 1.00 51.90  ? 81   GLU F OE2 1 
ATOM   4607  N N   . ASP F  1 82  ? 118.169 138.326 139.533 1.00 46.27  ? 82   ASP F N   1 
ATOM   4608  C CA  . ASP F  1 82  ? 118.747 138.111 138.210 1.00 45.05  ? 82   ASP F CA  1 
ATOM   4609  C C   . ASP F  1 82  ? 118.183 139.011 137.106 1.00 45.50  ? 82   ASP F C   1 
ATOM   4610  O O   . ASP F  1 82  ? 118.379 138.758 135.910 1.00 45.61  ? 82   ASP F O   1 
ATOM   4611  C CB  . ASP F  1 82  ? 118.616 136.635 137.860 1.00 43.58  ? 82   ASP F CB  1 
ATOM   4612  C CG  . ASP F  1 82  ? 118.969 135.747 139.046 1.00 42.12  ? 82   ASP F CG  1 
ATOM   4613  O OD1 . ASP F  1 82  ? 119.810 136.154 139.894 1.00 36.16  ? 82   ASP F OD1 1 
ATOM   4614  O OD2 . ASP F  1 82  ? 118.399 134.641 139.130 1.00 43.58  ? 82   ASP F OD2 1 
ATOM   4615  N N   . PHE F  1 83  ? 117.474 140.058 137.533 1.00 45.73  ? 83   PHE F N   1 
ATOM   4616  C CA  . PHE F  1 83  ? 117.130 141.193 136.685 1.00 44.54  ? 83   PHE F CA  1 
ATOM   4617  C C   . PHE F  1 83  ? 118.428 141.881 136.350 1.00 43.29  ? 83   PHE F C   1 
ATOM   4618  O O   . PHE F  1 83  ? 118.970 142.619 137.182 1.00 41.99  ? 83   PHE F O   1 
ATOM   4619  C CB  . PHE F  1 83  ? 116.268 142.207 137.455 1.00 44.18  ? 83   PHE F CB  1 
ATOM   4620  C CG  . PHE F  1 83  ? 115.483 143.144 136.566 1.00 42.84  ? 83   PHE F CG  1 
ATOM   4621  C CD1 . PHE F  1 83  ? 114.134 143.369 136.824 1.00 40.81  ? 83   PHE F CD1 1 
ATOM   4622  C CD2 . PHE F  1 83  ? 116.071 143.789 135.474 1.00 45.29  ? 83   PHE F CD2 1 
ATOM   4623  C CE1 . PHE F  1 83  ? 113.378 144.213 136.016 1.00 37.79  ? 83   PHE F CE1 1 
ATOM   4624  C CE2 . PHE F  1 83  ? 115.322 144.640 134.659 1.00 41.77  ? 83   PHE F CE2 1 
ATOM   4625  C CZ  . PHE F  1 83  ? 113.973 144.852 134.934 1.00 43.12  ? 83   PHE F CZ  1 
ATOM   4626  N N   . ALA F  1 84  ? 118.931 141.639 135.139 1.00 42.24  ? 84   ALA F N   1 
ATOM   4627  C CA  . ALA F  1 84  ? 120.208 142.210 134.728 1.00 41.12  ? 84   ALA F CA  1 
ATOM   4628  C C   . ALA F  1 84  ? 120.754 141.612 133.444 1.00 40.29  ? 84   ALA F C   1 
ATOM   4629  O O   . ALA F  1 84  ? 120.182 140.681 132.855 1.00 41.06  ? 84   ALA F O   1 
ATOM   4630  C CB  . ALA F  1 84  ? 121.247 142.061 135.831 1.00 41.02  ? 84   ALA F CB  1 
ATOM   4631  N N   . THR F  1 85  ? 121.894 142.166 133.044 1.00 39.42  ? 85   THR F N   1 
ATOM   4632  C CA  . THR F  1 85  ? 122.596 141.811 131.833 1.00 38.32  ? 85   THR F CA  1 
ATOM   4633  C C   . THR F  1 85  ? 123.823 140.993 132.186 1.00 41.57  ? 85   THR F C   1 
ATOM   4634  O O   . THR F  1 85  ? 124.582 141.334 133.101 1.00 41.72  ? 85   THR F O   1 
ATOM   4635  C CB  . THR F  1 85  ? 123.067 143.079 131.104 1.00 38.42  ? 85   THR F CB  1 
ATOM   4636  O OG1 . THR F  1 85  ? 121.977 144.037 131.059 1.00 41.22  ? 85   THR F OG1 1 
ATOM   4637  C CG2 . THR F  1 85  ? 123.550 142.784 129.680 1.00 27.69  ? 85   THR F CG2 1 
ATOM   4638  N N   . TYR F  1 86  ? 124.019 139.923 131.430 1.00 43.08  ? 86   TYR F N   1 
ATOM   4639  C CA  . TYR F  1 86  ? 125.088 138.977 131.654 1.00 43.80  ? 86   TYR F CA  1 
ATOM   4640  C C   . TYR F  1 86  ? 125.931 138.969 130.373 1.00 44.52  ? 86   TYR F C   1 
ATOM   4641  O O   . TYR F  1 86  ? 125.382 138.697 129.271 1.00 44.94  ? 86   TYR F O   1 
ATOM   4642  C CB  . TYR F  1 86  ? 124.470 137.595 131.924 1.00 44.91  ? 86   TYR F CB  1 
ATOM   4643  C CG  . TYR F  1 86  ? 123.450 137.527 133.068 1.00 44.05  ? 86   TYR F CG  1 
ATOM   4644  C CD1 . TYR F  1 86  ? 122.420 138.468 133.201 1.00 44.82  ? 86   TYR F CD1 1 
ATOM   4645  C CD2 . TYR F  1 86  ? 123.503 136.491 133.995 1.00 44.15  ? 86   TYR F CD2 1 
ATOM   4646  C CE1 . TYR F  1 86  ? 121.500 138.390 134.237 1.00 45.08  ? 86   TYR F CE1 1 
ATOM   4647  C CE2 . TYR F  1 86  ? 122.583 136.406 135.030 1.00 45.85  ? 86   TYR F CE2 1 
ATOM   4648  C CZ  . TYR F  1 86  ? 121.586 137.357 135.140 1.00 47.30  ? 86   TYR F CZ  1 
ATOM   4649  O OH  . TYR F  1 86  ? 120.684 137.270 136.160 1.00 45.39  ? 86   TYR F OH  1 
ATOM   4650  N N   . TYR F  1 87  ? 127.245 139.277 130.505 1.00 45.04  ? 87   TYR F N   1 
ATOM   4651  C CA  . TYR F  1 87  ? 128.118 139.384 129.321 1.00 44.04  ? 87   TYR F CA  1 
ATOM   4652  C C   . TYR F  1 87  ? 129.239 138.370 129.310 1.00 43.85  ? 87   TYR F C   1 
ATOM   4653  O O   . TYR F  1 87  ? 129.969 138.209 130.320 1.00 45.19  ? 87   TYR F O   1 
ATOM   4654  C CB  . TYR F  1 87  ? 128.878 140.700 129.300 1.00 43.57  ? 87   TYR F CB  1 
ATOM   4655  C CG  . TYR F  1 87  ? 128.117 141.984 129.269 1.00 45.50  ? 87   TYR F CG  1 
ATOM   4656  C CD1 . TYR F  1 87  ? 127.442 142.444 130.394 1.00 45.16  ? 87   TYR F CD1 1 
ATOM   4657  C CD2 . TYR F  1 87  ? 128.164 142.805 128.144 1.00 48.26  ? 87   TYR F CD2 1 
ATOM   4658  C CE1 . TYR F  1 87  ? 126.779 143.662 130.380 1.00 50.01  ? 87   TYR F CE1 1 
ATOM   4659  C CE2 . TYR F  1 87  ? 127.501 144.024 128.119 1.00 46.11  ? 87   TYR F CE2 1 
ATOM   4660  C CZ  . TYR F  1 87  ? 126.812 144.448 129.239 1.00 48.33  ? 87   TYR F CZ  1 
ATOM   4661  O OH  . TYR F  1 87  ? 126.153 145.658 129.217 1.00 47.44  ? 87   TYR F OH  1 
ATOM   4662  N N   . CYS F  1 88  ? 129.431 137.715 128.173 1.00 43.35  ? 88   CYS F N   1 
ATOM   4663  C CA  . CYS F  1 88  ? 130.645 136.953 127.995 1.00 41.17  ? 88   CYS F CA  1 
ATOM   4664  C C   . CYS F  1 88  ? 131.760 137.918 127.634 1.00 39.11  ? 88   CYS F C   1 
ATOM   4665  O O   . CYS F  1 88  ? 131.522 139.004 127.078 1.00 38.31  ? 88   CYS F O   1 
ATOM   4666  C CB  . CYS F  1 88  ? 130.491 135.860 126.940 1.00 41.53  ? 88   CYS F CB  1 
ATOM   4667  S SG  . CYS F  1 88  ? 130.089 136.454 125.285 1.00 42.60  ? 88   CYS F SG  1 
ATOM   4668  N N   . GLN F  1 89  ? 132.973 137.516 127.978 1.00 39.43  ? 89   GLN F N   1 
ATOM   4669  C CA  . GLN F  1 89  ? 134.165 138.286 127.724 1.00 38.10  ? 89   GLN F CA  1 
ATOM   4670  C C   . GLN F  1 89  ? 135.211 137.222 127.439 1.00 39.95  ? 89   GLN F C   1 
ATOM   4671  O O   . GLN F  1 89  ? 135.026 136.055 127.818 1.00 39.48  ? 89   GLN F O   1 
ATOM   4672  C CB  . GLN F  1 89  ? 134.499 139.099 128.980 1.00 36.12  ? 89   GLN F CB  1 
ATOM   4673  C CG  . GLN F  1 89  ? 135.701 140.017 128.872 1.00 33.57  ? 89   GLN F CG  1 
ATOM   4674  C CD  . GLN F  1 89  ? 136.848 139.567 129.751 1.00 30.53  ? 89   GLN F CD  1 
ATOM   4675  O OE1 . GLN F  1 89  ? 136.949 138.395 130.118 1.00 37.33  ? 89   GLN F OE1 1 
ATOM   4676  N NE2 . GLN F  1 89  ? 137.725 140.501 130.097 1.00 25.31  ? 89   GLN F NE2 1 
ATOM   4677  N N   . GLN F  1 90  ? 136.293 137.581 126.761 1.00 40.55  ? 90   GLN F N   1 
ATOM   4678  C CA  . GLN F  1 90  ? 137.387 136.625 126.627 1.00 41.23  ? 90   GLN F CA  1 
ATOM   4679  C C   . GLN F  1 90  ? 138.747 137.190 126.992 1.00 41.47  ? 90   GLN F C   1 
ATOM   4680  O O   . GLN F  1 90  ? 139.004 138.386 126.875 1.00 40.85  ? 90   GLN F O   1 
ATOM   4681  C CB  . GLN F  1 90  ? 137.381 135.898 125.269 1.00 41.08  ? 90   GLN F CB  1 
ATOM   4682  C CG  . GLN F  1 90  ? 137.570 136.777 124.051 1.00 43.51  ? 90   GLN F CG  1 
ATOM   4683  C CD  . GLN F  1 90  ? 139.014 136.852 123.610 1.00 45.64  ? 90   GLN F CD  1 
ATOM   4684  O OE1 . GLN F  1 90  ? 139.472 136.032 122.819 1.00 49.94  ? 90   GLN F OE1 1 
ATOM   4685  N NE2 . GLN F  1 90  ? 139.744 137.831 124.126 1.00 45.81  ? 90   GLN F NE2 1 
ATOM   4686  N N   . SER F  1 91  ? 139.606 136.286 127.439 1.00 42.83  ? 91   SER F N   1 
ATOM   4687  C CA  . SER F  1 91  ? 140.809 136.659 128.126 1.00 43.54  ? 91   SER F CA  1 
ATOM   4688  C C   . SER F  1 91  ? 141.910 135.974 127.361 1.00 43.72  ? 91   SER F C   1 
ATOM   4689  O O   . SER F  1 91  ? 143.080 135.997 127.757 1.00 44.70  ? 91   SER F O   1 
ATOM   4690  C CB  . SER F  1 91  ? 140.723 136.137 129.562 1.00 42.99  ? 91   SER F CB  1 
ATOM   4691  O OG  . SER F  1 91  ? 141.902 136.542 130.334 1.00 44.37  ? 91   SER F OG  1 
ATOM   4692  N N   . TYR F  1 92  ? 141.507 135.357 126.252 1.00 43.73  ? 92   TYR F N   1 
ATOM   4693  C CA  . TYR F  1 92  ? 142.419 134.633 125.398 1.00 43.12  ? 92   TYR F CA  1 
ATOM   4694  C C   . TYR F  1 92  ? 143.447 135.593 124.852 1.00 42.62  ? 92   TYR F C   1 
ATOM   4695  O O   . TYR F  1 92  ? 144.645 135.411 125.080 1.00 44.16  ? 92   TYR F O   1 
ATOM   4696  C CB  . TYR F  1 92  ? 141.691 133.929 124.256 1.00 43.30  ? 92   TYR F CB  1 
ATOM   4697  C CG  . TYR F  1 92  ? 142.591 132.961 123.534 1.00 43.03  ? 92   TYR F CG  1 
ATOM   4698  C CD1 . TYR F  1 92  ? 142.870 131.707 124.080 1.00 46.60  ? 92   TYR F CD1 1 
ATOM   4699  C CD2 . TYR F  1 92  ? 143.186 133.301 122.321 1.00 45.34  ? 92   TYR F CD2 1 
ATOM   4700  C CE1 . TYR F  1 92  ? 143.708 130.811 123.428 1.00 45.84  ? 92   TYR F CE1 1 
ATOM   4701  C CE2 . TYR F  1 92  ? 144.027 132.413 121.662 1.00 49.03  ? 92   TYR F CE2 1 
ATOM   4702  C CZ  . TYR F  1 92  ? 144.285 131.172 122.221 1.00 45.72  ? 92   TYR F CZ  1 
ATOM   4703  O OH  . TYR F  1 92  ? 145.120 130.294 121.563 1.00 43.28  ? 92   TYR F OH  1 
ATOM   4704  N N   . SER F  1 93  ? 142.993 136.623 124.144 1.00 41.48  ? 93   SER F N   1 
ATOM   4705  C CA  . SER F  1 93  ? 143.941 137.593 123.620 1.00 40.35  ? 93   SER F CA  1 
ATOM   4706  C C   . SER F  1 93  ? 143.510 139.052 123.744 1.00 37.60  ? 93   SER F C   1 
ATOM   4707  O O   . SER F  1 93  ? 142.392 139.432 123.378 1.00 37.19  ? 93   SER F O   1 
ATOM   4708  C CB  . SER F  1 93  ? 144.334 137.253 122.166 1.00 40.95  ? 93   SER F CB  1 
ATOM   4709  O OG  . SER F  1 93  ? 143.672 138.080 121.169 1.00 41.21  ? 93   SER F OG  1 
ATOM   4710  N N   . THR F  1 94  ? 144.431 139.856 124.264 1.00 36.70  ? 94   THR F N   1 
ATOM   4711  C CA  . THR F  1 94  ? 144.201 141.272 124.475 1.00 33.88  ? 94   THR F CA  1 
ATOM   4712  C C   . THR F  1 94  ? 144.277 142.038 123.154 1.00 36.18  ? 94   THR F C   1 
ATOM   4713  O O   . THR F  1 94  ? 145.142 141.750 122.319 1.00 32.37  ? 94   THR F O   1 
ATOM   4714  C CB  . THR F  1 94  ? 145.184 141.855 125.507 1.00 33.21  ? 94   THR F CB  1 
ATOM   4715  O OG1 . THR F  1 94  ? 146.519 141.453 125.179 1.00 25.02  ? 94   THR F OG1 1 
ATOM   4716  C CG2 . THR F  1 94  ? 144.845 141.370 126.909 1.00 32.24  ? 94   THR F CG2 1 
ATOM   4717  N N   . PRO F  1 95  ? 143.367 143.010 122.955 1.00 38.43  ? 95   PRO F N   1 
ATOM   4718  C CA  . PRO F  1 95  ? 142.266 143.425 123.828 1.00 39.07  ? 95   PRO F CA  1 
ATOM   4719  C C   . PRO F  1 95  ? 141.099 142.442 124.003 1.00 39.47  ? 95   PRO F C   1 
ATOM   4720  O O   . PRO F  1 95  ? 140.096 142.536 123.288 1.00 37.43  ? 95   PRO F O   1 
ATOM   4721  C CB  . PRO F  1 95  ? 141.771 144.711 123.157 1.00 38.97  ? 95   PRO F CB  1 
ATOM   4722  C CG  . PRO F  1 95  ? 142.127 144.561 121.741 1.00 40.76  ? 95   PRO F CG  1 
ATOM   4723  C CD  . PRO F  1 95  ? 143.443 143.859 121.749 1.00 38.93  ? 95   PRO F CD  1 
ATOM   4724  N N   . ASN F  1 96  ? 141.265 141.504 124.940 1.00 39.21  ? 96   ASN F N   1 
ATOM   4725  C CA  . ASN F  1 96  ? 140.152 140.867 125.637 1.00 38.73  ? 96   ASN F CA  1 
ATOM   4726  C C   . ASN F  1 96  ? 138.807 141.369 125.170 1.00 38.37  ? 96   ASN F C   1 
ATOM   4727  O O   . ASN F  1 96  ? 138.348 142.405 125.660 1.00 37.93  ? 96   ASN F O   1 
ATOM   4728  C CB  . ASN F  1 96  ? 140.205 141.271 127.116 1.00 39.83  ? 96   ASN F CB  1 
ATOM   4729  C CG  . ASN F  1 96  ? 141.359 140.652 127.872 1.00 39.11  ? 96   ASN F CG  1 
ATOM   4730  O OD1 . ASN F  1 96  ? 141.960 139.664 127.445 1.00 39.24  ? 96   ASN F OD1 1 
ATOM   4731  N ND2 . ASN F  1 96  ? 141.670 141.233 129.029 1.00 40.34  ? 96   ASN F ND2 1 
ATOM   4732  N N   . THR F  1 97  ? 138.140 140.688 124.257 1.00 39.01  ? 97   THR F N   1 
ATOM   4733  C CA  . THR F  1 97  ? 136.891 141.278 123.783 1.00 39.45  ? 97   THR F CA  1 
ATOM   4734  C C   . THR F  1 97  ? 135.667 140.805 124.556 1.00 39.61  ? 97   THR F C   1 
ATOM   4735  O O   . THR F  1 97  ? 135.662 139.713 125.123 1.00 42.24  ? 97   THR F O   1 
ATOM   4736  C CB  . THR F  1 97  ? 136.691 141.067 122.285 1.00 38.57  ? 97   THR F CB  1 
ATOM   4737  O OG1 . THR F  1 97  ? 136.748 139.662 121.993 1.00 42.75  ? 97   THR F OG1 1 
ATOM   4738  C CG2 . THR F  1 97  ? 137.799 141.776 121.510 1.00 35.79  ? 97   THR F CG2 1 
ATOM   4739  N N   . PHE F  1 98  ? 134.633 141.648 124.574 1.00 38.11  ? 98   PHE F N   1 
ATOM   4740  C CA  . PHE F  1 98  ? 133.330 141.288 125.150 1.00 38.59  ? 98   PHE F CA  1 
ATOM   4741  C C   . PHE F  1 98  ? 132.330 140.827 124.109 1.00 39.51  ? 98   PHE F C   1 
ATOM   4742  O O   . PHE F  1 98  ? 132.336 141.296 122.956 1.00 37.33  ? 98   PHE F O   1 
ATOM   4743  C CB  . PHE F  1 98  ? 132.673 142.486 125.854 1.00 35.13  ? 98   PHE F CB  1 
ATOM   4744  C CG  . PHE F  1 98  ? 133.188 142.745 127.224 1.00 28.98  ? 98   PHE F CG  1 
ATOM   4745  C CD1 . PHE F  1 98  ? 134.429 143.338 127.398 1.00 14.36  ? 98   PHE F CD1 1 
ATOM   4746  C CD2 . PHE F  1 98  ? 132.422 142.435 128.347 1.00 27.83  ? 98   PHE F CD2 1 
ATOM   4747  C CE1 . PHE F  1 98  ? 134.921 143.598 128.663 1.00 18.67  ? 98   PHE F CE1 1 
ATOM   4748  C CE2 . PHE F  1 98  ? 132.907 142.696 129.623 1.00 26.61  ? 98   PHE F CE2 1 
ATOM   4749  C CZ  . PHE F  1 98  ? 134.160 143.280 129.780 1.00 24.84  ? 98   PHE F CZ  1 
ATOM   4750  N N   . GLY F  1 99  ? 131.440 139.935 124.545 1.00 41.18  ? 99   GLY F N   1 
ATOM   4751  C CA  . GLY F  1 99  ? 130.140 139.755 123.878 1.00 43.02  ? 99   GLY F CA  1 
ATOM   4752  C C   . GLY F  1 99  ? 129.335 141.026 124.121 1.00 44.68  ? 99   GLY F C   1 
ATOM   4753  O O   . GLY F  1 99  ? 129.846 141.994 124.706 1.00 45.91  ? 99   GLY F O   1 
ATOM   4754  N N   . GLN F  1 100 ? 128.082 141.050 123.679 1.00 44.73  ? 100  GLN F N   1 
ATOM   4755  C CA  . GLN F  1 100 ? 127.310 142.297 123.796 1.00 46.88  ? 100  GLN F CA  1 
ATOM   4756  C C   . GLN F  1 100 ? 126.178 142.293 124.836 1.00 46.32  ? 100  GLN F C   1 
ATOM   4757  O O   . GLN F  1 100 ? 125.425 143.274 124.959 1.00 45.46  ? 100  GLN F O   1 
ATOM   4758  C CB  . GLN F  1 100 ? 126.868 142.847 122.418 1.00 47.08  ? 100  GLN F CB  1 
ATOM   4759  C CG  . GLN F  1 100 ? 126.679 141.809 121.303 1.00 48.01  ? 100  GLN F CG  1 
ATOM   4760  C CD  . GLN F  1 100 ? 126.787 142.435 119.913 1.00 52.04  ? 100  GLN F CD  1 
ATOM   4761  O OE1 . GLN F  1 100 ? 127.028 141.738 118.928 1.00 60.00  ? 100  GLN F OE1 1 
ATOM   4762  N NE2 . GLN F  1 100 ? 126.609 143.753 119.832 1.00 56.91  ? 100  GLN F NE2 1 
ATOM   4763  N N   . GLY F  1 101 ? 126.093 141.194 125.589 1.00 46.06  ? 101  GLY F N   1 
ATOM   4764  C CA  . GLY F  1 101 ? 125.226 141.111 126.765 1.00 43.47  ? 101  GLY F CA  1 
ATOM   4765  C C   . GLY F  1 101 ? 123.808 140.660 126.460 1.00 42.13  ? 101  GLY F C   1 
ATOM   4766  O O   . GLY F  1 101 ? 123.393 140.593 125.298 1.00 41.74  ? 101  GLY F O   1 
ATOM   4767  N N   . THR F  1 102 ? 123.061 140.333 127.509 1.00 40.40  ? 102  THR F N   1 
ATOM   4768  C CA  . THR F  1 102 ? 121.612 140.168 127.384 1.00 41.53  ? 102  THR F CA  1 
ATOM   4769  C C   . THR F  1 102 ? 120.927 140.857 128.572 1.00 41.79  ? 102  THR F C   1 
ATOM   4770  O O   . THR F  1 102 ? 121.546 141.056 129.616 1.00 44.89  ? 102  THR F O   1 
ATOM   4771  C CB  . THR F  1 102 ? 121.192 138.670 127.357 1.00 40.38  ? 102  THR F CB  1 
ATOM   4772  O OG1 . THR F  1 102 ? 122.197 137.892 126.692 1.00 42.87  ? 102  THR F OG1 1 
ATOM   4773  C CG2 . THR F  1 102 ? 119.838 138.483 126.640 1.00 37.84  ? 102  THR F CG2 1 
ATOM   4774  N N   . LYS F  1 103 ? 119.657 141.221 128.426 1.00 40.86  ? 103  LYS F N   1 
ATOM   4775  C CA  . LYS F  1 103 ? 118.858 141.670 129.571 1.00 40.95  ? 103  LYS F CA  1 
ATOM   4776  C C   . LYS F  1 103 ? 117.990 140.521 130.044 1.00 42.33  ? 103  LYS F C   1 
ATOM   4777  O O   . LYS F  1 103 ? 117.129 140.062 129.296 1.00 42.92  ? 103  LYS F O   1 
ATOM   4778  C CB  . LYS F  1 103 ? 117.949 142.836 129.186 1.00 39.64  ? 103  LYS F CB  1 
ATOM   4779  C CG  . LYS F  1 103 ? 118.666 144.155 129.099 1.00 36.28  ? 103  LYS F CG  1 
ATOM   4780  C CD  . LYS F  1 103 ? 118.032 144.951 127.860 1.00 31.01  ? 103  LYS F CD  1 
ATOM   4781  C CE  . LYS F  1 103 ? 118.593 146.383 127.961 1.00 33.32  ? 103  LYS F CE  1 
ATOM   4782  N NZ  . LYS F  1 103 ? 120.023 146.507 127.407 1.00 30.53  ? 103  LYS F NZ  1 
ATOM   4783  N N   . VAL F  1 104 ? 118.188 140.049 131.266 1.00 43.45  ? 104  VAL F N   1 
ATOM   4784  C CA  . VAL F  1 104 ? 117.264 139.046 131.769 1.00 45.96  ? 104  VAL F CA  1 
ATOM   4785  C C   . VAL F  1 104 ? 116.121 139.743 132.533 1.00 47.38  ? 104  VAL F C   1 
ATOM   4786  O O   . VAL F  1 104 ? 116.350 140.383 133.563 1.00 50.11  ? 104  VAL F O   1 
ATOM   4787  C CB  . VAL F  1 104 ? 117.975 137.911 132.556 1.00 45.67  ? 104  VAL F CB  1 
ATOM   4788  C CG1 . VAL F  1 104 ? 116.971 136.865 132.987 1.00 43.69  ? 104  VAL F CG1 1 
ATOM   4789  C CG2 . VAL F  1 104 ? 119.067 137.259 131.698 1.00 42.28  ? 104  VAL F CG2 1 
ATOM   4790  N N   . GLU F  1 105 ? 114.902 139.634 131.983 1.00 48.65  ? 105  GLU F N   1 
ATOM   4791  C CA  . GLU F  1 105 ? 113.676 140.323 132.459 1.00 49.50  ? 105  GLU F CA  1 
ATOM   4792  C C   . GLU F  1 105 ? 112.723 139.374 133.188 1.00 50.84  ? 105  GLU F C   1 
ATOM   4793  O O   . GLU F  1 105 ? 112.586 138.216 132.789 1.00 51.72  ? 105  GLU F O   1 
ATOM   4794  C CB  . GLU F  1 105 ? 112.909 140.904 131.262 1.00 49.75  ? 105  GLU F CB  1 
ATOM   4795  C CG  . GLU F  1 105 ? 111.758 141.821 131.624 1.00 47.95  ? 105  GLU F CG  1 
ATOM   4796  C CD  . GLU F  1 105 ? 112.236 143.224 131.901 1.00 50.45  ? 105  GLU F CD  1 
ATOM   4797  O OE1 . GLU F  1 105 ? 111.731 143.849 132.866 1.00 49.00  ? 105  GLU F OE1 1 
ATOM   4798  O OE2 . GLU F  1 105 ? 113.131 143.710 131.153 1.00 50.55  ? 105  GLU F OE2 1 
ATOM   4799  N N   . ILE F  1 106 ? 112.044 139.857 134.229 1.00 51.28  ? 106  ILE F N   1 
ATOM   4800  C CA  . ILE F  1 106 ? 111.150 138.989 135.013 1.00 51.53  ? 106  ILE F CA  1 
ATOM   4801  C C   . ILE F  1 106 ? 109.680 139.204 134.637 1.00 51.50  ? 106  ILE F C   1 
ATOM   4802  O O   . ILE F  1 106 ? 109.020 138.287 134.141 1.00 52.88  ? 106  ILE F O   1 
ATOM   4803  C CB  . ILE F  1 106 ? 111.337 139.168 136.555 1.00 52.57  ? 106  ILE F CB  1 
ATOM   4804  C CG1 . ILE F  1 106 ? 112.817 139.035 136.968 1.00 49.24  ? 106  ILE F CG1 1 
ATOM   4805  C CG2 . ILE F  1 106 ? 110.415 138.220 137.334 1.00 51.60  ? 106  ILE F CG2 1 
ATOM   4806  C CD1 . ILE F  1 106 ? 113.340 137.584 137.123 1.00 41.50  ? 106  ILE F CD1 1 
ATOM   4807  N N   . ASP G  1 1   ? 96.734  113.458 132.581 1.00 51.58  ? 1    ASP G N   1 
ATOM   4808  C CA  . ASP G  1 1   ? 97.020  114.896 132.278 1.00 52.02  ? 1    ASP G CA  1 
ATOM   4809  C C   . ASP G  1 1   ? 98.480  115.264 132.622 1.00 51.13  ? 1    ASP G C   1 
ATOM   4810  O O   . ASP G  1 1   ? 99.100  114.642 133.494 1.00 52.64  ? 1    ASP G O   1 
ATOM   4811  C CB  . ASP G  1 1   ? 95.986  115.806 132.966 1.00 52.56  ? 1    ASP G CB  1 
ATOM   4812  C CG  . ASP G  1 1   ? 96.354  117.276 132.896 1.00 54.74  ? 1    ASP G CG  1 
ATOM   4813  O OD1 . ASP G  1 1   ? 95.889  117.978 131.976 1.00 57.24  ? 1    ASP G OD1 1 
ATOM   4814  O OD2 . ASP G  1 1   ? 97.121  117.734 133.769 1.00 56.53  ? 1    ASP G OD2 1 
ATOM   4815  N N   . ILE G  1 2   ? 98.998  116.293 131.931 1.00 49.27  ? 2    ILE G N   1 
ATOM   4816  C CA  . ILE G  1 2   ? 100.443 116.606 131.801 1.00 46.66  ? 2    ILE G CA  1 
ATOM   4817  C C   . ILE G  1 2   ? 100.646 118.137 131.720 1.00 46.82  ? 2    ILE G C   1 
ATOM   4818  O O   . ILE G  1 2   ? 99.713  118.836 131.273 1.00 45.94  ? 2    ILE G O   1 
ATOM   4819  C CB  . ILE G  1 2   ? 100.972 116.007 130.462 1.00 46.63  ? 2    ILE G CB  1 
ATOM   4820  C CG1 . ILE G  1 2   ? 100.593 114.517 130.342 1.00 47.94  ? 2    ILE G CG1 1 
ATOM   4821  C CG2 . ILE G  1 2   ? 102.482 116.241 130.298 1.00 46.19  ? 2    ILE G CG2 1 
ATOM   4822  C CD1 . ILE G  1 2   ? 101.670 113.489 130.757 1.00 49.87  ? 2    ILE G CD1 1 
ATOM   4823  N N   . GLN G  1 3   ? 101.827 118.672 132.108 1.00 44.99  ? 3    GLN G N   1 
ATOM   4824  C CA  . GLN G  1 3   ? 102.093 120.151 132.024 1.00 44.90  ? 3    GLN G CA  1 
ATOM   4825  C C   . GLN G  1 3   ? 103.506 120.653 131.612 1.00 44.42  ? 3    GLN G C   1 
ATOM   4826  O O   . GLN G  1 3   ? 104.522 120.271 132.190 1.00 45.07  ? 3    GLN G O   1 
ATOM   4827  C CB  . GLN G  1 3   ? 101.652 120.877 133.305 1.00 44.72  ? 3    GLN G CB  1 
ATOM   4828  C CG  . GLN G  1 3   ? 100.181 121.291 133.341 1.00 42.89  ? 3    GLN G CG  1 
ATOM   4829  C CD  . GLN G  1 3   ? 99.297  120.259 134.020 1.00 44.09  ? 3    GLN G CD  1 
ATOM   4830  O OE1 . GLN G  1 3   ? 99.589  119.059 133.993 1.00 45.55  ? 3    GLN G OE1 1 
ATOM   4831  N NE2 . GLN G  1 3   ? 98.215  120.730 134.648 1.00 41.28  ? 3    GLN G NE2 1 
ATOM   4832  N N   . MET G  1 4   ? 103.521 121.574 130.651 1.00 42.85  ? 4    MET G N   1 
ATOM   4833  C CA  . MET G  1 4   ? 104.731 121.968 129.923 1.00 40.43  ? 4    MET G CA  1 
ATOM   4834  C C   . MET G  1 4   ? 105.269 123.302 130.430 1.00 39.49  ? 4    MET G C   1 
ATOM   4835  O O   . MET G  1 4   ? 104.495 124.236 130.647 1.00 39.22  ? 4    MET G O   1 
ATOM   4836  C CB  . MET G  1 4   ? 104.399 122.064 128.429 1.00 41.41  ? 4    MET G CB  1 
ATOM   4837  C CG  . MET G  1 4   ? 103.388 121.021 127.947 1.00 37.22  ? 4    MET G CG  1 
ATOM   4838  S SD  . MET G  1 4   ? 103.948 119.294 128.164 1.00 38.09  ? 4    MET G SD  1 
ATOM   4839  C CE  . MET G  1 4   ? 105.499 119.318 127.231 1.00 37.74  ? 4    MET G CE  1 
ATOM   4840  N N   . THR G  1 5   ? 106.580 123.397 130.626 1.00 37.59  ? 5    THR G N   1 
ATOM   4841  C CA  . THR G  1 5   ? 107.130 124.590 131.255 1.00 35.81  ? 5    THR G CA  1 
ATOM   4842  C C   . THR G  1 5   ? 108.134 125.203 130.322 1.00 37.55  ? 5    THR G C   1 
ATOM   4843  O O   . THR G  1 5   ? 109.130 124.575 129.969 1.00 38.79  ? 5    THR G O   1 
ATOM   4844  C CB  . THR G  1 5   ? 107.829 124.262 132.572 1.00 36.60  ? 5    THR G CB  1 
ATOM   4845  O OG1 . THR G  1 5   ? 107.299 123.033 133.109 1.00 31.01  ? 5    THR G OG1 1 
ATOM   4846  C CG2 . THR G  1 5   ? 107.633 125.393 133.576 1.00 29.52  ? 5    THR G CG2 1 
ATOM   4847  N N   . GLN G  1 6   ? 107.890 126.441 129.928 1.00 38.85  ? 6    GLN G N   1 
ATOM   4848  C CA  . GLN G  1 6   ? 108.601 126.928 128.784 1.00 39.14  ? 6    GLN G CA  1 
ATOM   4849  C C   . GLN G  1 6   ? 109.153 128.315 128.986 1.00 39.54  ? 6    GLN G C   1 
ATOM   4850  O O   . GLN G  1 6   ? 108.494 129.210 129.520 1.00 39.64  ? 6    GLN G O   1 
ATOM   4851  C CB  . GLN G  1 6   ? 107.689 126.860 127.558 1.00 39.00  ? 6    GLN G CB  1 
ATOM   4852  C CG  . GLN G  1 6   ? 108.409 126.853 126.244 1.00 40.12  ? 6    GLN G CG  1 
ATOM   4853  C CD  . GLN G  1 6   ? 107.469 127.178 125.108 1.00 36.67  ? 6    GLN G CD  1 
ATOM   4854  O OE1 . GLN G  1 6   ? 106.269 126.909 125.179 1.00 45.11  ? 6    GLN G OE1 1 
ATOM   4855  N NE2 . GLN G  1 6   ? 108.004 127.769 124.045 1.00 23.37  ? 6    GLN G NE2 1 
ATOM   4856  N N   . SER G  1 7   ? 110.388 128.458 128.532 1.00 40.76  ? 7    SER G N   1 
ATOM   4857  C CA  . SER G  1 7   ? 111.197 129.624 128.759 1.00 39.79  ? 7    SER G CA  1 
ATOM   4858  C C   . SER G  1 7   ? 112.303 129.548 127.715 1.00 39.99  ? 7    SER G C   1 
ATOM   4859  O O   . SER G  1 7   ? 112.710 128.450 127.316 1.00 39.28  ? 7    SER G O   1 
ATOM   4860  C CB  . SER G  1 7   ? 111.780 129.608 130.172 1.00 40.05  ? 7    SER G CB  1 
ATOM   4861  O OG  . SER G  1 7   ? 112.370 128.333 130.479 1.00 36.80  ? 7    SER G OG  1 
ATOM   4862  N N   . PRO G  1 8   ? 112.796 130.709 127.263 1.00 40.40  ? 8    PRO G N   1 
ATOM   4863  C CA  . PRO G  1 8   ? 112.419 131.981 127.848 1.00 40.50  ? 8    PRO G CA  1 
ATOM   4864  C C   . PRO G  1 8   ? 111.061 132.384 127.301 1.00 40.66  ? 8    PRO G C   1 
ATOM   4865  O O   . PRO G  1 8   ? 110.499 131.669 126.466 1.00 41.62  ? 8    PRO G O   1 
ATOM   4866  C CB  . PRO G  1 8   ? 113.509 132.916 127.349 1.00 39.95  ? 8    PRO G CB  1 
ATOM   4867  C CG  . PRO G  1 8   ? 113.877 132.370 126.024 1.00 41.13  ? 8    PRO G CG  1 
ATOM   4868  C CD  . PRO G  1 8   ? 113.696 130.881 126.100 1.00 41.06  ? 8    PRO G CD  1 
ATOM   4869  N N   . SER G  1 9   ? 110.522 133.503 127.763 1.00 39.97  ? 9    SER G N   1 
ATOM   4870  C CA  . SER G  1 9   ? 109.189 133.888 127.321 1.00 40.53  ? 9    SER G CA  1 
ATOM   4871  C C   . SER G  1 9   ? 109.223 134.920 126.201 1.00 38.47  ? 9    SER G C   1 
ATOM   4872  O O   . SER G  1 9   ? 108.173 135.353 125.710 1.00 38.13  ? 9    SER G O   1 
ATOM   4873  C CB  . SER G  1 9   ? 108.327 134.383 128.508 1.00 40.38  ? 9    SER G CB  1 
ATOM   4874  O OG  . SER G  1 9   ? 106.987 134.604 128.099 1.00 47.44  ? 9    SER G OG  1 
ATOM   4875  N N   . SER G  1 10  ? 110.436 135.315 125.824 1.00 37.87  ? 10   SER G N   1 
ATOM   4876  C CA  . SER G  1 10  ? 110.698 136.156 124.664 1.00 38.63  ? 10   SER G CA  1 
ATOM   4877  C C   . SER G  1 10  ? 112.125 136.647 124.718 1.00 40.05  ? 10   SER G C   1 
ATOM   4878  O O   . SER G  1 10  ? 112.649 137.050 125.759 1.00 40.52  ? 10   SER G O   1 
ATOM   4879  C CB  . SER G  1 10  ? 109.712 137.321 124.488 1.00 37.32  ? 10   SER G CB  1 
ATOM   4880  O OG  . SER G  1 10  ? 109.658 138.132 125.650 1.00 34.00  ? 10   SER G OG  1 
ATOM   4881  N N   . LEU G  1 11  ? 112.717 136.595 123.540 1.00 41.36  ? 11   LEU G N   1 
ATOM   4882  C CA  . LEU G  1 11  ? 114.110 136.806 123.306 1.00 43.04  ? 11   LEU G CA  1 
ATOM   4883  C C   . LEU G  1 11  ? 114.080 137.839 122.212 1.00 44.84  ? 11   LEU G C   1 
ATOM   4884  O O   . LEU G  1 11  ? 113.026 138.095 121.620 1.00 44.64  ? 11   LEU G O   1 
ATOM   4885  C CB  . LEU G  1 11  ? 114.724 135.512 122.759 1.00 42.75  ? 11   LEU G CB  1 
ATOM   4886  C CG  . LEU G  1 11  ? 114.025 134.184 123.092 1.00 43.84  ? 11   LEU G CG  1 
ATOM   4887  C CD1 . LEU G  1 11  ? 112.679 134.034 122.377 1.00 43.15  ? 11   LEU G CD1 1 
ATOM   4888  C CD2 . LEU G  1 11  ? 114.920 133.021 122.742 1.00 43.36  ? 11   LEU G CD2 1 
ATOM   4889  N N   . SER G  1 12  ? 115.224 138.452 121.953 1.00 45.86  ? 12   SER G N   1 
ATOM   4890  C CA  . SER G  1 12  ? 115.351 139.334 120.814 1.00 45.57  ? 12   SER G CA  1 
ATOM   4891  C C   . SER G  1 12  ? 116.805 139.395 120.435 1.00 45.84  ? 12   SER G C   1 
ATOM   4892  O O   . SER G  1 12  ? 117.672 139.715 121.258 1.00 44.89  ? 12   SER G O   1 
ATOM   4893  C CB  . SER G  1 12  ? 114.846 140.750 121.127 1.00 45.33  ? 12   SER G CB  1 
ATOM   4894  O OG  . SER G  1 12  ? 113.616 140.715 121.875 1.00 46.61  ? 12   SER G OG  1 
ATOM   4895  N N   . ALA G  1 13  ? 117.055 139.062 119.176 1.00 46.87  ? 13   ALA G N   1 
ATOM   4896  C CA  . ALA G  1 13  ? 118.339 139.261 118.545 1.00 47.06  ? 13   ALA G CA  1 
ATOM   4897  C C   . ALA G  1 13  ? 118.017 139.473 117.076 1.00 47.58  ? 13   ALA G C   1 
ATOM   4898  O O   . ALA G  1 13  ? 116.943 139.994 116.750 1.00 47.09  ? 13   ALA G O   1 
ATOM   4899  C CB  . ALA G  1 13  ? 119.234 138.045 118.748 1.00 48.20  ? 13   ALA G CB  1 
ATOM   4900  N N   . SER G  1 14  ? 118.933 139.074 116.190 1.00 47.93  ? 14   SER G N   1 
ATOM   4901  C CA  . SER G  1 14  ? 118.706 139.180 114.737 1.00 49.13  ? 14   SER G CA  1 
ATOM   4902  C C   . SER G  1 14  ? 119.679 138.355 113.866 1.00 48.83  ? 14   SER G C   1 
ATOM   4903  O O   . SER G  1 14  ? 120.060 137.237 114.229 1.00 47.44  ? 14   SER G O   1 
ATOM   4904  C CB  . SER G  1 14  ? 118.672 140.656 114.292 1.00 50.17  ? 14   SER G CB  1 
ATOM   4905  O OG  . SER G  1 14  ? 120.006 141.262 114.386 1.00 50.53  ? 14   SER G OG  1 
ATOM   4906  N N   . VAL G  1 15  ? 120.071 138.954 112.736 1.00 48.41  ? 15   VAL G N   1 
ATOM   4907  C CA  . VAL G  1 15  ? 120.675 138.264 111.583 1.00 47.94  ? 15   VAL G CA  1 
ATOM   4908  C C   . VAL G  1 15  ? 121.238 136.878 111.910 1.00 47.54  ? 15   VAL G C   1 
ATOM   4909  O O   . VAL G  1 15  ? 122.445 136.701 112.161 1.00 47.78  ? 15   VAL G O   1 
ATOM   4910  C CB  . VAL G  1 15  ? 121.688 139.166 110.790 1.00 47.90  ? 15   VAL G CB  1 
ATOM   4911  C CG1 . VAL G  1 15  ? 122.106 138.495 109.479 1.00 49.32  ? 15   VAL G CG1 1 
ATOM   4912  C CG2 . VAL G  1 15  ? 121.075 140.531 110.491 1.00 48.15  ? 15   VAL G CG2 1 
ATOM   4913  N N   . GLY G  1 16  ? 120.315 135.918 111.943 1.00 46.69  ? 16   GLY G N   1 
ATOM   4914  C CA  . GLY G  1 16  ? 120.616 134.515 112.170 1.00 45.28  ? 16   GLY G CA  1 
ATOM   4915  C C   . GLY G  1 16  ? 121.463 134.129 113.364 1.00 45.31  ? 16   GLY G C   1 
ATOM   4916  O O   . GLY G  1 16  ? 122.657 133.871 113.197 1.00 46.03  ? 16   GLY G O   1 
ATOM   4917  N N   . ASP G  1 17  ? 120.867 134.055 114.556 1.00 44.00  ? 17   ASP G N   1 
ATOM   4918  C CA  . ASP G  1 17  ? 121.643 133.592 115.718 1.00 43.50  ? 17   ASP G CA  1 
ATOM   4919  C C   . ASP G  1 17  ? 121.094 132.365 116.421 1.00 44.67  ? 17   ASP G C   1 
ATOM   4920  O O   . ASP G  1 17  ? 120.224 131.660 115.900 1.00 43.64  ? 17   ASP G O   1 
ATOM   4921  C CB  . ASP G  1 17  ? 121.859 134.725 116.754 1.00 42.78  ? 17   ASP G CB  1 
ATOM   4922  C CG  . ASP G  1 17  ? 122.618 135.889 116.142 1.00 43.52  ? 17   ASP G CG  1 
ATOM   4923  O OD1 . ASP G  1 17  ? 123.559 135.666 115.342 1.00 47.60  ? 17   ASP G OD1 1 
ATOM   4924  O OD2 . ASP G  1 17  ? 122.269 137.047 116.466 1.00 38.92  ? 17   ASP G OD2 1 
ATOM   4925  N N   . ARG G  1 18  ? 121.663 132.104 117.595 1.00 44.20  ? 18   ARG G N   1 
ATOM   4926  C CA  . ARG G  1 18  ? 121.272 130.978 118.410 1.00 43.34  ? 18   ARG G CA  1 
ATOM   4927  C C   . ARG G  1 18  ? 119.999 131.336 119.120 1.00 44.59  ? 18   ARG G C   1 
ATOM   4928  O O   . ARG G  1 18  ? 119.799 132.488 119.524 1.00 45.82  ? 18   ARG G O   1 
ATOM   4929  C CB  . ARG G  1 18  ? 122.341 130.691 119.460 1.00 42.96  ? 18   ARG G CB  1 
ATOM   4930  C CG  . ARG G  1 18  ? 123.242 129.517 119.136 1.00 37.77  ? 18   ARG G CG  1 
ATOM   4931  C CD  . ARG G  1 18  ? 122.637 128.175 119.587 1.00 31.19  ? 18   ARG G CD  1 
ATOM   4932  N NE  . ARG G  1 18  ? 123.521 127.043 119.290 1.00 33.08  ? 18   ARG G NE  1 
ATOM   4933  C CZ  . ARG G  1 18  ? 124.852 127.115 119.198 1.00 37.90  ? 18   ARG G CZ  1 
ATOM   4934  N NH1 . ARG G  1 18  ? 125.494 128.264 119.396 1.00 36.36  ? 18   ARG G NH1 1 
ATOM   4935  N NH2 . ARG G  1 18  ? 125.556 126.025 118.917 1.00 37.53  ? 18   ARG G NH2 1 
ATOM   4936  N N   . VAL G  1 19  ? 119.128 130.356 119.271 1.00 45.50  ? 19   VAL G N   1 
ATOM   4937  C CA  . VAL G  1 19  ? 118.081 130.514 120.247 1.00 46.44  ? 19   VAL G CA  1 
ATOM   4938  C C   . VAL G  1 19  ? 118.001 129.249 121.051 1.00 47.27  ? 19   VAL G C   1 
ATOM   4939  O O   . VAL G  1 19  ? 117.862 128.154 120.498 1.00 47.17  ? 19   VAL G O   1 
ATOM   4940  C CB  . VAL G  1 19  ? 116.694 130.807 119.626 1.00 47.12  ? 19   VAL G CB  1 
ATOM   4941  C CG1 . VAL G  1 19  ? 115.758 131.309 120.696 1.00 46.46  ? 19   VAL G CG1 1 
ATOM   4942  C CG2 . VAL G  1 19  ? 116.795 131.840 118.500 1.00 45.59  ? 19   VAL G CG2 1 
ATOM   4943  N N   . THR G  1 20  ? 118.100 129.389 122.360 1.00 47.21  ? 20   THR G N   1 
ATOM   4944  C CA  . THR G  1 20  ? 117.779 128.253 123.172 1.00 48.69  ? 20   THR G CA  1 
ATOM   4945  C C   . THR G  1 20  ? 116.396 128.454 123.790 1.00 48.47  ? 20   THR G C   1 
ATOM   4946  O O   . THR G  1 20  ? 116.205 129.287 124.688 1.00 47.58  ? 20   THR G O   1 
ATOM   4947  C CB  . THR G  1 20  ? 118.889 127.904 124.180 1.00 50.46  ? 20   THR G CB  1 
ATOM   4948  O OG1 . THR G  1 20  ? 120.169 128.248 123.632 1.00 53.02  ? 20   THR G OG1 1 
ATOM   4949  C CG2 . THR G  1 20  ? 118.866 126.410 124.488 1.00 46.10  ? 20   THR G CG2 1 
ATOM   4950  N N   . ILE G  1 21  ? 115.427 127.721 123.243 1.00 49.11  ? 21   ILE G N   1 
ATOM   4951  C CA  . ILE G  1 21  ? 114.072 127.660 123.787 1.00 48.99  ? 21   ILE G CA  1 
ATOM   4952  C C   . ILE G  1 21  ? 113.804 126.256 124.334 1.00 49.07  ? 21   ILE G C   1 
ATOM   4953  O O   . ILE G  1 21  ? 113.677 125.288 123.568 1.00 48.65  ? 21   ILE G O   1 
ATOM   4954  C CB  . ILE G  1 21  ? 112.987 128.045 122.741 1.00 48.94  ? 21   ILE G CB  1 
ATOM   4955  C CG1 . ILE G  1 21  ? 113.250 129.454 122.188 1.00 47.64  ? 21   ILE G CG1 1 
ATOM   4956  C CG2 . ILE G  1 21  ? 111.588 127.958 123.368 1.00 48.54  ? 21   ILE G CG2 1 
ATOM   4957  C CD1 . ILE G  1 21  ? 112.361 129.808 120.976 1.00 47.22  ? 21   ILE G CD1 1 
ATOM   4958  N N   . THR G  1 22  ? 113.724 126.157 125.662 1.00 48.48  ? 22   THR G N   1 
ATOM   4959  C CA  . THR G  1 22  ? 113.468 124.890 126.358 1.00 48.73  ? 22   THR G CA  1 
ATOM   4960  C C   . THR G  1 22  ? 112.037 124.831 126.852 1.00 47.60  ? 22   THR G C   1 
ATOM   4961  O O   . THR G  1 22  ? 111.496 125.823 127.367 1.00 46.92  ? 22   THR G O   1 
ATOM   4962  C CB  . THR G  1 22  ? 114.318 124.720 127.637 1.00 49.57  ? 22   THR G CB  1 
ATOM   4963  O OG1 . THR G  1 22  ? 113.519 125.034 128.796 1.00 52.82  ? 22   THR G OG1 1 
ATOM   4964  C CG2 . THR G  1 22  ? 115.568 125.603 127.615 1.00 50.48  ? 22   THR G CG2 1 
ATOM   4965  N N   . CYS G  1 23  ? 111.436 123.655 126.732 1.00 47.76  ? 23   CYS G N   1 
ATOM   4966  C CA  . CYS G  1 23  ? 110.100 123.425 127.245 1.00 47.98  ? 23   CYS G CA  1 
ATOM   4967  C C   . CYS G  1 23  ? 110.127 122.148 128.054 1.00 47.22  ? 23   CYS G C   1 
ATOM   4968  O O   . CYS G  1 23  ? 110.434 121.080 127.519 1.00 47.45  ? 23   CYS G O   1 
ATOM   4969  C CB  . CYS G  1 23  ? 109.125 123.287 126.085 1.00 47.48  ? 23   CYS G CB  1 
ATOM   4970  S SG  . CYS G  1 23  ? 107.488 122.640 126.507 1.00 48.57  ? 23   CYS G SG  1 
ATOM   4971  N N   . ARG G  1 24  ? 109.818 122.245 129.340 1.00 46.26  ? 24   ARG G N   1 
ATOM   4972  C CA  . ARG G  1 24  ? 109.902 121.064 130.181 1.00 46.29  ? 24   ARG G CA  1 
ATOM   4973  C C   . ARG G  1 24  ? 108.554 120.549 130.674 1.00 46.53  ? 24   ARG G C   1 
ATOM   4974  O O   . ARG G  1 24  ? 107.790 121.265 131.325 1.00 46.20  ? 24   ARG G O   1 
ATOM   4975  C CB  . ARG G  1 24  ? 110.927 121.251 131.303 1.00 45.09  ? 24   ARG G CB  1 
ATOM   4976  C CG  . ARG G  1 24  ? 112.359 121.303 130.744 1.00 46.57  ? 24   ARG G CG  1 
ATOM   4977  C CD  . ARG G  1 24  ? 113.427 121.019 131.788 1.00 46.08  ? 24   ARG G CD  1 
ATOM   4978  N NE  . ARG G  1 24  ? 113.105 119.840 132.588 1.00 47.83  ? 24   ARG G NE  1 
ATOM   4979  C CZ  . ARG G  1 24  ? 113.467 119.686 133.859 1.00 47.21  ? 24   ARG G CZ  1 
ATOM   4980  N NH1 . ARG G  1 24  ? 114.168 120.634 134.473 1.00 50.48  ? 24   ARG G NH1 1 
ATOM   4981  N NH2 . ARG G  1 24  ? 113.125 118.587 134.523 1.00 47.80  ? 24   ARG G NH2 1 
ATOM   4982  N N   . ALA G  1 25  ? 108.277 119.295 130.324 1.00 47.91  ? 25   ALA G N   1 
ATOM   4983  C CA  . ALA G  1 25  ? 107.053 118.591 130.716 1.00 49.41  ? 25   ALA G CA  1 
ATOM   4984  C C   . ALA G  1 25  ? 106.917 118.527 132.238 1.00 49.55  ? 25   ALA G C   1 
ATOM   4985  O O   . ALA G  1 25  ? 107.880 118.788 132.962 1.00 51.86  ? 25   ALA G O   1 
ATOM   4986  C CB  . ALA G  1 25  ? 107.041 117.182 130.113 1.00 47.08  ? 25   ALA G CB  1 
ATOM   4987  N N   . SER G  1 26  ? 105.724 118.207 132.731 1.00 49.91  ? 26   SER G N   1 
ATOM   4988  C CA  . SER G  1 26  ? 105.560 117.978 134.164 1.00 50.02  ? 26   SER G CA  1 
ATOM   4989  C C   . SER G  1 26  ? 105.815 116.510 134.453 1.00 49.50  ? 26   SER G C   1 
ATOM   4990  O O   . SER G  1 26  ? 106.411 116.155 135.472 1.00 49.19  ? 26   SER G O   1 
ATOM   4991  C CB  . SER G  1 26  ? 104.164 118.383 134.646 1.00 49.13  ? 26   SER G CB  1 
ATOM   4992  O OG  . SER G  1 26  ? 103.134 117.397 134.172 1.00 47.76  ? 26   SER G OG  1 
ATOM   4993  N N   . GLN G  1 27  ? 105.368 115.667 133.531 1.00 49.25  ? 27   GLN G N   1 
ATOM   4994  C CA  . GLN G  1 27  ? 105.426 114.229 133.691 1.00 50.55  ? 27   GLN G CA  1 
ATOM   4995  C C   . GLN G  1 27  ? 106.509 113.619 132.804 1.00 51.21  ? 27   GLN G C   1 
ATOM   4996  O O   . GLN G  1 27  ? 106.942 114.243 131.833 1.00 50.65  ? 27   GLN G O   1 
ATOM   4997  C CB  . GLN G  1 27  ? 104.058 113.643 133.346 1.00 50.68  ? 27   GLN G CB  1 
ATOM   4998  C CG  . GLN G  1 27  ? 104.054 112.163 133.016 1.00 52.16  ? 27   GLN G CG  1 
ATOM   4999  C CD  . GLN G  1 27  ? 103.987 111.301 134.252 1.00 53.35  ? 27   GLN G CD  1 
ATOM   5000  O OE1 . GLN G  1 27  ? 104.843 111.377 135.139 1.00 54.17  ? 27   GLN G OE1 1 
ATOM   5001  N NE2 . GLN G  1 27  ? 102.963 110.457 134.316 1.00 51.30  ? 27   GLN G NE2 1 
ATOM   5002  N N   . SER G  1 28  ? 106.958 112.413 133.146 1.00 51.84  ? 28   SER G N   1 
ATOM   5003  C CA  . SER G  1 28  ? 107.809 111.656 132.239 1.00 51.93  ? 28   SER G CA  1 
ATOM   5004  C C   . SER G  1 28  ? 106.980 111.241 131.028 1.00 51.82  ? 28   SER G C   1 
ATOM   5005  O O   . SER G  1 28  ? 106.262 110.232 131.049 1.00 51.24  ? 28   SER G O   1 
ATOM   5006  C CB  . SER G  1 28  ? 108.475 110.457 132.935 1.00 51.98  ? 28   SER G CB  1 
ATOM   5007  O OG  . SER G  1 28  ? 109.271 109.731 131.985 1.00 52.61  ? 28   SER G OG  1 
ATOM   5008  N N   . ILE G  1 29  ? 107.074 112.073 129.991 1.00 51.33  ? 29   ILE G N   1 
ATOM   5009  C CA  . ILE G  1 29  ? 106.244 111.960 128.805 1.00 48.40  ? 29   ILE G CA  1 
ATOM   5010  C C   . ILE G  1 29  ? 107.076 111.461 127.633 1.00 48.76  ? 29   ILE G C   1 
ATOM   5011  O O   . ILE G  1 29  ? 106.744 111.690 126.461 1.00 49.11  ? 29   ILE G O   1 
ATOM   5012  C CB  . ILE G  1 29  ? 105.508 113.291 128.458 1.00 49.23  ? 29   ILE G CB  1 
ATOM   5013  C CG1 . ILE G  1 29  ? 106.450 114.289 127.755 1.00 48.13  ? 29   ILE G CG1 1 
ATOM   5014  C CG2 . ILE G  1 29  ? 104.905 113.918 129.710 1.00 49.33  ? 29   ILE G CG2 1 
ATOM   5015  C CD1 . ILE G  1 29  ? 105.704 115.396 126.991 1.00 43.79  ? 29   ILE G CD1 1 
ATOM   5016  N N   . SER G  1 30  ? 108.167 110.773 127.963 1.00 48.54  ? 30   SER G N   1 
ATOM   5017  C CA  . SER G  1 30  ? 108.959 110.023 126.989 1.00 48.21  ? 30   SER G CA  1 
ATOM   5018  C C   . SER G  1 30  ? 109.372 110.855 125.767 1.00 45.85  ? 30   SER G C   1 
ATOM   5019  O O   . SER G  1 30  ? 110.255 111.710 125.867 1.00 45.58  ? 30   SER G O   1 
ATOM   5020  C CB  . SER G  1 30  ? 108.216 108.734 126.591 1.00 48.13  ? 30   SER G CB  1 
ATOM   5021  O OG  . SER G  1 30  ? 108.808 108.131 125.367 1.00 54.46  ? 30   SER G OG  1 
ATOM   5022  N N   . SER G  1 31  ? 108.739 110.608 124.623 1.00 44.05  ? 31   SER G N   1 
ATOM   5023  C CA  . SER G  1 31  ? 109.117 111.318 123.412 1.00 43.46  ? 31   SER G CA  1 
ATOM   5024  C C   . SER G  1 31  ? 107.931 111.611 122.498 1.00 43.99  ? 31   SER G C   1 
ATOM   5025  O O   . SER G  1 31  ? 108.024 111.490 121.273 1.00 44.82  ? 31   SER G O   1 
ATOM   5026  C CB  . SER G  1 31  ? 110.221 110.557 122.672 1.00 43.07  ? 31   SER G CB  1 
ATOM   5027  O OG  . SER G  1 31  ? 111.137 111.460 122.080 1.00 41.66  ? 31   SER G OG  1 
ATOM   5028  N N   . TYR G  1 32  ? 106.818 111.994 123.106 1.00 44.86  ? 32   TYR G N   1 
ATOM   5029  C CA  . TYR G  1 32  ? 105.698 112.501 122.354 1.00 45.43  ? 32   TYR G CA  1 
ATOM   5030  C C   . TYR G  1 32  ? 105.743 114.031 122.445 1.00 45.32  ? 32   TYR G C   1 
ATOM   5031  O O   . TYR G  1 32  ? 105.059 114.624 123.274 1.00 44.48  ? 32   TYR G O   1 
ATOM   5032  C CB  . TYR G  1 32  ? 104.395 111.878 122.881 1.00 46.52  ? 32   TYR G CB  1 
ATOM   5033  C CG  . TYR G  1 32  ? 104.158 110.471 122.352 1.00 47.89  ? 32   TYR G CG  1 
ATOM   5034  C CD1 . TYR G  1 32  ? 104.123 109.355 123.199 1.00 50.99  ? 32   TYR G CD1 1 
ATOM   5035  C CD2 . TYR G  1 32  ? 103.990 110.260 120.987 1.00 43.91  ? 32   TYR G CD2 1 
ATOM   5036  C CE1 . TYR G  1 32  ? 103.912 108.065 122.677 1.00 50.17  ? 32   TYR G CE1 1 
ATOM   5037  C CE2 . TYR G  1 32  ? 103.779 108.995 120.465 1.00 46.79  ? 32   TYR G CE2 1 
ATOM   5038  C CZ  . TYR G  1 32  ? 103.738 107.902 121.305 1.00 49.42  ? 32   TYR G CZ  1 
ATOM   5039  O OH  . TYR G  1 32  ? 103.518 106.648 120.754 1.00 48.21  ? 32   TYR G OH  1 
ATOM   5040  N N   . LEU G  1 33  ? 106.591 114.659 121.617 1.00 45.47  ? 33   LEU G N   1 
ATOM   5041  C CA  . LEU G  1 33  ? 106.752 116.134 121.624 1.00 44.35  ? 33   LEU G CA  1 
ATOM   5042  C C   . LEU G  1 33  ? 106.755 116.837 120.259 1.00 43.06  ? 33   LEU G C   1 
ATOM   5043  O O   . LEU G  1 33  ? 107.198 116.273 119.265 1.00 44.11  ? 33   LEU G O   1 
ATOM   5044  C CB  . LEU G  1 33  ? 107.989 116.582 122.415 1.00 44.89  ? 33   LEU G CB  1 
ATOM   5045  C CG  . LEU G  1 33  ? 107.785 118.081 122.762 1.00 42.95  ? 33   LEU G CG  1 
ATOM   5046  C CD1 . LEU G  1 33  ? 107.065 118.229 124.102 1.00 40.56  ? 33   LEU G CD1 1 
ATOM   5047  C CD2 . LEU G  1 33  ? 109.104 118.882 122.754 1.00 42.33  ? 33   LEU G CD2 1 
ATOM   5048  N N   . ASN G  1 34  ? 106.296 118.095 120.255 1.00 41.55  ? 34   ASN G N   1 
ATOM   5049  C CA  . ASN G  1 34  ? 106.005 118.843 119.022 1.00 39.15  ? 34   ASN G CA  1 
ATOM   5050  C C   . ASN G  1 34  ? 106.365 120.337 119.091 1.00 40.07  ? 34   ASN G C   1 
ATOM   5051  O O   . ASN G  1 34  ? 106.380 120.924 120.174 1.00 39.43  ? 34   ASN G O   1 
ATOM   5052  C CB  . ASN G  1 34  ? 104.514 118.684 118.663 1.00 38.90  ? 34   ASN G CB  1 
ATOM   5053  C CG  . ASN G  1 34  ? 104.031 117.236 118.798 1.00 38.71  ? 34   ASN G CG  1 
ATOM   5054  O OD1 . ASN G  1 34  ? 104.582 116.327 118.179 1.00 43.87  ? 34   ASN G OD1 1 
ATOM   5055  N ND2 . ASN G  1 34  ? 102.991 117.024 119.601 1.00 33.65  ? 34   ASN G ND2 1 
ATOM   5056  N N   . TRP G  1 35  ? 106.655 120.949 117.938 1.00 40.14  ? 35   TRP G N   1 
ATOM   5057  C CA  . TRP G  1 35  ? 106.866 122.403 117.891 1.00 39.87  ? 35   TRP G CA  1 
ATOM   5058  C C   . TRP G  1 35  ? 106.143 123.099 116.736 1.00 39.05  ? 35   TRP G C   1 
ATOM   5059  O O   . TRP G  1 35  ? 106.102 122.595 115.604 1.00 40.12  ? 35   TRP G O   1 
ATOM   5060  C CB  . TRP G  1 35  ? 108.357 122.786 117.911 1.00 39.94  ? 35   TRP G CB  1 
ATOM   5061  C CG  . TRP G  1 35  ? 109.109 122.320 119.135 1.00 42.73  ? 35   TRP G CG  1 
ATOM   5062  C CD1 . TRP G  1 35  ? 109.739 121.121 119.289 1.00 44.60  ? 35   TRP G CD1 1 
ATOM   5063  C CD2 . TRP G  1 35  ? 109.318 123.042 120.363 1.00 44.38  ? 35   TRP G CD2 1 
ATOM   5064  N NE1 . TRP G  1 35  ? 110.326 121.045 120.527 1.00 41.79  ? 35   TRP G NE1 1 
ATOM   5065  C CE2 . TRP G  1 35  ? 110.082 122.207 121.211 1.00 45.49  ? 35   TRP G CE2 1 
ATOM   5066  C CE3 . TRP G  1 35  ? 108.936 124.309 120.829 1.00 42.24  ? 35   TRP G CE3 1 
ATOM   5067  C CZ2 . TRP G  1 35  ? 110.473 122.595 122.497 1.00 45.51  ? 35   TRP G CZ2 1 
ATOM   5068  C CZ3 . TRP G  1 35  ? 109.326 124.696 122.111 1.00 41.21  ? 35   TRP G CZ3 1 
ATOM   5069  C CH2 . TRP G  1 35  ? 110.089 123.839 122.927 1.00 42.60  ? 35   TRP G CH2 1 
ATOM   5070  N N   . TYR G  1 36  ? 105.584 124.270 117.057 1.00 36.75  ? 36   TYR G N   1 
ATOM   5071  C CA  . TYR G  1 36  ? 104.761 125.017 116.121 1.00 34.72  ? 36   TYR G CA  1 
ATOM   5072  C C   . TYR G  1 36  ? 105.317 126.414 115.932 1.00 35.82  ? 36   TYR G C   1 
ATOM   5073  O O   . TYR G  1 36  ? 105.726 127.071 116.885 1.00 33.96  ? 36   TYR G O   1 
ATOM   5074  C CB  . TYR G  1 36  ? 103.314 125.126 116.627 1.00 33.05  ? 36   TYR G CB  1 
ATOM   5075  C CG  . TYR G  1 36  ? 102.546 123.819 116.709 1.00 25.91  ? 36   TYR G CG  1 
ATOM   5076  C CD1 . TYR G  1 36  ? 102.495 123.097 117.900 1.00 14.76  ? 36   TYR G CD1 1 
ATOM   5077  C CD2 . TYR G  1 36  ? 101.853 123.318 115.605 1.00 20.97  ? 36   TYR G CD2 1 
ATOM   5078  C CE1 . TYR G  1 36  ? 101.789 121.903 117.989 1.00 17.14  ? 36   TYR G CE1 1 
ATOM   5079  C CE2 . TYR G  1 36  ? 101.139 122.122 115.685 1.00 15.23  ? 36   TYR G CE2 1 
ATOM   5080  C CZ  . TYR G  1 36  ? 101.114 121.420 116.879 1.00 24.94  ? 36   TYR G CZ  1 
ATOM   5081  O OH  . TYR G  1 36  ? 100.414 120.233 116.968 1.00 28.49  ? 36   TYR G OH  1 
ATOM   5082  N N   . GLN G  1 37  ? 105.344 126.846 114.685 1.00 36.52  ? 37   GLN G N   1 
ATOM   5083  C CA  . GLN G  1 37  ? 105.531 128.236 114.373 1.00 37.44  ? 37   GLN G CA  1 
ATOM   5084  C C   . GLN G  1 37  ? 104.119 128.718 114.089 1.00 38.38  ? 37   GLN G C   1 
ATOM   5085  O O   . GLN G  1 37  ? 103.396 128.112 113.290 1.00 40.21  ? 37   GLN G O   1 
ATOM   5086  C CB  . GLN G  1 37  ? 106.389 128.340 113.121 1.00 38.00  ? 37   GLN G CB  1 
ATOM   5087  C CG  . GLN G  1 37  ? 106.935 129.712 112.799 1.00 39.30  ? 37   GLN G CG  1 
ATOM   5088  C CD  . GLN G  1 37  ? 107.396 129.766 111.355 1.00 38.10  ? 37   GLN G CD  1 
ATOM   5089  O OE1 . GLN G  1 37  ? 106.707 129.268 110.463 1.00 41.61  ? 37   GLN G OE1 1 
ATOM   5090  N NE2 . GLN G  1 37  ? 108.559 130.362 111.110 1.00 40.31  ? 37   GLN G NE2 1 
ATOM   5091  N N   . GLN G  1 38  ? 103.704 129.782 114.758 1.00 36.55  ? 38   GLN G N   1 
ATOM   5092  C CA  . GLN G  1 38  ? 102.452 130.433 114.403 1.00 35.51  ? 38   GLN G CA  1 
ATOM   5093  C C   . GLN G  1 38  ? 102.745 131.917 114.221 1.00 34.95  ? 38   GLN G C   1 
ATOM   5094  O O   . GLN G  1 38  ? 103.016 132.628 115.198 1.00 34.35  ? 38   GLN G O   1 
ATOM   5095  C CB  . GLN G  1 38  ? 101.388 130.150 115.473 1.00 35.73  ? 38   GLN G CB  1 
ATOM   5096  C CG  . GLN G  1 38  ? 100.323 131.205 115.637 1.00 36.35  ? 38   GLN G CG  1 
ATOM   5097  C CD  . GLN G  1 38  ? 99.805  131.275 117.064 1.00 41.78  ? 38   GLN G CD  1 
ATOM   5098  O OE1 . GLN G  1 38  ? 99.431  132.344 117.545 1.00 40.90  ? 38   GLN G OE1 1 
ATOM   5099  N NE2 . GLN G  1 38  ? 99.788  130.133 117.760 1.00 33.34  ? 38   GLN G NE2 1 
ATOM   5100  N N   . LYS G  1 39  ? 102.727 132.375 112.974 1.00 32.74  ? 39   LYS G N   1 
ATOM   5101  C CA  . LYS G  1 39  ? 103.154 133.741 112.679 1.00 33.94  ? 39   LYS G CA  1 
ATOM   5102  C C   . LYS G  1 39  ? 102.239 134.802 113.315 1.00 35.00  ? 39   LYS G C   1 
ATOM   5103  O O   . LYS G  1 39  ? 101.124 134.471 113.743 1.00 34.28  ? 39   LYS G O   1 
ATOM   5104  C CB  . LYS G  1 39  ? 103.281 133.937 111.173 1.00 33.05  ? 39   LYS G CB  1 
ATOM   5105  C CG  . LYS G  1 39  ? 104.532 133.286 110.601 1.00 35.35  ? 39   LYS G CG  1 
ATOM   5106  C CD  . LYS G  1 39  ? 104.846 133.819 109.210 1.00 40.71  ? 39   LYS G CD  1 
ATOM   5107  C CE  . LYS G  1 39  ? 105.153 135.324 109.237 1.00 39.79  ? 39   LYS G CE  1 
ATOM   5108  N NZ  . LYS G  1 39  ? 105.594 135.811 107.888 1.00 42.89  ? 39   LYS G NZ  1 
ATOM   5109  N N   . PRO G  1 40  ? 102.701 136.072 113.408 1.00 36.19  ? 40   PRO G N   1 
ATOM   5110  C CA  . PRO G  1 40  ? 101.730 137.000 113.990 1.00 38.71  ? 40   PRO G CA  1 
ATOM   5111  C C   . PRO G  1 40  ? 100.360 136.903 113.304 1.00 40.82  ? 40   PRO G C   1 
ATOM   5112  O O   . PRO G  1 40  ? 100.282 136.998 112.037 1.00 39.74  ? 40   PRO G O   1 
ATOM   5113  C CB  . PRO G  1 40  ? 102.363 138.384 113.749 1.00 37.52  ? 40   PRO G CB  1 
ATOM   5114  C CG  . PRO G  1 40  ? 103.491 138.147 112.778 1.00 38.98  ? 40   PRO G CG  1 
ATOM   5115  C CD  . PRO G  1 40  ? 103.958 136.754 113.045 1.00 35.52  ? 40   PRO G CD  1 
ATOM   5116  N N   . GLY G  1 41  ? 99.310  136.697 114.136 1.00 40.78  ? 41   GLY G N   1 
ATOM   5117  C CA  . GLY G  1 41  ? 97.936  136.568 113.628 1.00 42.02  ? 41   GLY G CA  1 
ATOM   5118  C C   . GLY G  1 41  ? 97.680  135.423 112.662 1.00 44.10  ? 41   GLY G C   1 
ATOM   5119  O O   . GLY G  1 41  ? 97.000  135.609 111.651 1.00 42.55  ? 41   GLY G O   1 
ATOM   5120  N N   . LYS G  1 42  ? 98.219  134.242 112.967 1.00 46.80  ? 42   LYS G N   1 
ATOM   5121  C CA  . LYS G  1 42  ? 97.975  133.029 112.160 1.00 47.68  ? 42   LYS G CA  1 
ATOM   5122  C C   . LYS G  1 42  ? 97.807  131.763 113.023 1.00 49.35  ? 42   LYS G C   1 
ATOM   5123  O O   . LYS G  1 42  ? 97.895  131.839 114.254 1.00 51.22  ? 42   LYS G O   1 
ATOM   5124  C CB  . LYS G  1 42  ? 99.049  132.861 111.065 1.00 45.61  ? 42   LYS G CB  1 
ATOM   5125  C CG  . LYS G  1 42  ? 98.606  133.466 109.713 1.00 42.68  ? 42   LYS G CG  1 
ATOM   5126  C CD  . LYS G  1 42  ? 99.793  133.741 108.777 1.00 41.15  ? 42   LYS G CD  1 
ATOM   5127  C CE  . LYS G  1 42  ? 99.356  134.555 107.540 1.00 39.24  ? 42   LYS G CE  1 
ATOM   5128  N NZ  . LYS G  1 42  ? 98.759  133.632 106.464 1.00 33.78  ? 42   LYS G NZ  1 
ATOM   5129  N N   . ALA G  1 43  ? 97.531  130.620 112.386 1.00 49.85  ? 43   ALA G N   1 
ATOM   5130  C CA  . ALA G  1 43  ? 97.409  129.342 113.099 1.00 48.87  ? 43   ALA G CA  1 
ATOM   5131  C C   . ALA G  1 43  ? 98.798  128.786 113.375 1.00 49.38  ? 43   ALA G C   1 
ATOM   5132  O O   . ALA G  1 43  ? 99.769  129.209 112.729 1.00 50.98  ? 43   ALA G O   1 
ATOM   5133  C CB  . ALA G  1 43  ? 96.593  128.354 112.267 1.00 48.42  ? 43   ALA G CB  1 
ATOM   5134  N N   . PRO G  1 44  ? 98.918  127.870 114.357 1.00 48.94  ? 44   PRO G N   1 
ATOM   5135  C CA  . PRO G  1 44  ? 100.116 127.049 114.386 1.00 48.42  ? 44   PRO G CA  1 
ATOM   5136  C C   . PRO G  1 44  ? 100.241 126.191 113.127 1.00 49.38  ? 44   PRO G C   1 
ATOM   5137  O O   . PRO G  1 44  ? 99.435  125.280 112.920 1.00 50.48  ? 44   PRO G O   1 
ATOM   5138  C CB  . PRO G  1 44  ? 99.885  126.145 115.609 1.00 48.15  ? 44   PRO G CB  1 
ATOM   5139  C CG  . PRO G  1 44  ? 98.961  126.914 116.470 1.00 46.75  ? 44   PRO G CG  1 
ATOM   5140  C CD  . PRO G  1 44  ? 98.040  127.598 115.511 1.00 49.12  ? 44   PRO G CD  1 
ATOM   5141  N N   . LYS G  1 45  ? 101.211 126.510 112.272 1.00 49.75  ? 45   LYS G N   1 
ATOM   5142  C CA  . LYS G  1 45  ? 101.784 125.499 111.384 1.00 50.63  ? 45   LYS G CA  1 
ATOM   5143  C C   . LYS G  1 45  ? 102.782 124.717 112.260 1.00 50.85  ? 45   LYS G C   1 
ATOM   5144  O O   . LYS G  1 45  ? 103.277 125.249 113.256 1.00 51.64  ? 45   LYS G O   1 
ATOM   5145  C CB  . LYS G  1 45  ? 102.466 126.140 110.159 1.00 50.89  ? 45   LYS G CB  1 
ATOM   5146  C CG  . LYS G  1 45  ? 101.643 126.139 108.850 1.00 51.57  ? 45   LYS G CG  1 
ATOM   5147  C CD  . LYS G  1 45  ? 102.198 127.160 107.829 1.00 51.77  ? 45   LYS G CD  1 
ATOM   5148  C CE  . LYS G  1 45  ? 102.333 126.557 106.406 1.00 54.04  ? 45   LYS G CE  1 
ATOM   5149  N NZ  . LYS G  1 45  ? 101.055 126.572 105.573 1.00 54.28  ? 45   LYS G NZ  1 
ATOM   5150  N N   . LEU G  1 46  ? 103.067 123.463 111.903 1.00 49.37  ? 46   LEU G N   1 
ATOM   5151  C CA  . LEU G  1 46  ? 103.877 122.561 112.748 1.00 48.94  ? 46   LEU G CA  1 
ATOM   5152  C C   . LEU G  1 46  ? 105.250 122.222 112.172 1.00 50.97  ? 46   LEU G C   1 
ATOM   5153  O O   . LEU G  1 46  ? 105.358 121.774 111.013 1.00 51.60  ? 46   LEU G O   1 
ATOM   5154  C CB  . LEU G  1 46  ? 103.110 121.257 113.023 1.00 48.74  ? 46   LEU G CB  1 
ATOM   5155  C CG  . LEU G  1 46  ? 103.835 119.988 113.520 1.00 47.10  ? 46   LEU G CG  1 
ATOM   5156  C CD1 . LEU G  1 46  ? 104.419 120.159 114.920 1.00 40.18  ? 46   LEU G CD1 1 
ATOM   5157  C CD2 . LEU G  1 46  ? 102.875 118.811 113.534 1.00 45.35  ? 46   LEU G CD2 1 
ATOM   5158  N N   . LEU G  1 47  ? 106.289 122.393 112.984 1.00 52.43  ? 47   LEU G N   1 
ATOM   5159  C CA  . LEU G  1 47  ? 107.653 122.140 112.545 1.00 53.40  ? 47   LEU G CA  1 
ATOM   5160  C C   . LEU G  1 47  ? 108.132 120.772 113.017 1.00 55.29  ? 47   LEU G C   1 
ATOM   5161  O O   . LEU G  1 47  ? 108.075 119.790 112.279 1.00 54.95  ? 47   LEU G O   1 
ATOM   5162  C CB  . LEU G  1 47  ? 108.581 123.234 113.072 1.00 53.84  ? 47   LEU G CB  1 
ATOM   5163  C CG  . LEU G  1 47  ? 107.949 124.627 113.128 1.00 52.01  ? 47   LEU G CG  1 
ATOM   5164  C CD1 . LEU G  1 47  ? 108.319 125.326 114.436 1.00 49.79  ? 47   LEU G CD1 1 
ATOM   5165  C CD2 . LEU G  1 47  ? 108.319 125.458 111.895 1.00 47.34  ? 47   LEU G CD2 1 
ATOM   5166  N N   . ILE G  1 48  ? 108.612 120.723 114.255 1.00 55.64  ? 48   ILE G N   1 
ATOM   5167  C CA  . ILE G  1 48  ? 109.156 119.495 114.816 1.00 56.06  ? 48   ILE G CA  1 
ATOM   5168  C C   . ILE G  1 48  ? 108.174 118.831 115.755 1.00 56.85  ? 48   ILE G C   1 
ATOM   5169  O O   . ILE G  1 48  ? 107.919 119.301 116.857 1.00 56.70  ? 48   ILE G O   1 
ATOM   5170  C CB  . ILE G  1 48  ? 110.482 119.718 115.587 1.00 56.37  ? 48   ILE G CB  1 
ATOM   5171  C CG1 . ILE G  1 48  ? 111.479 120.531 114.740 1.00 56.47  ? 48   ILE G CG1 1 
ATOM   5172  C CG2 . ILE G  1 48  ? 111.079 118.390 116.060 1.00 55.98  ? 48   ILE G CG2 1 
ATOM   5173  C CD1 . ILE G  1 48  ? 111.401 122.077 114.988 1.00 58.20  ? 48   ILE G CD1 1 
ATOM   5174  N N   . TYR G  1 49  ? 107.653 117.713 115.283 1.00 57.71  ? 49   TYR G N   1 
ATOM   5175  C CA  . TYR G  1 49  ? 106.845 116.792 116.044 1.00 58.94  ? 49   TYR G CA  1 
ATOM   5176  C C   . TYR G  1 49  ? 107.739 115.587 116.338 1.00 59.75  ? 49   TYR G C   1 
ATOM   5177  O O   . TYR G  1 49  ? 108.823 115.441 115.740 1.00 59.13  ? 49   TYR G O   1 
ATOM   5178  C CB  . TYR G  1 49  ? 105.712 116.326 115.150 1.00 60.30  ? 49   TYR G CB  1 
ATOM   5179  C CG  . TYR G  1 49  ? 106.258 115.592 113.952 1.00 62.57  ? 49   TYR G CG  1 
ATOM   5180  C CD1 . TYR G  1 49  ? 107.338 116.117 113.228 1.00 65.79  ? 49   TYR G CD1 1 
ATOM   5181  C CD2 . TYR G  1 49  ? 105.730 114.375 113.549 1.00 63.47  ? 49   TYR G CD2 1 
ATOM   5182  C CE1 . TYR G  1 49  ? 107.868 115.458 112.143 1.00 66.36  ? 49   TYR G CE1 1 
ATOM   5183  C CE2 . TYR G  1 49  ? 106.254 113.709 112.446 1.00 66.34  ? 49   TYR G CE2 1 
ATOM   5184  C CZ  . TYR G  1 49  ? 107.325 114.255 111.752 1.00 66.76  ? 49   TYR G CZ  1 
ATOM   5185  O OH  . TYR G  1 49  ? 107.849 113.601 110.661 1.00 65.60  ? 49   TYR G OH  1 
ATOM   5186  N N   . ALA G  1 50  ? 107.274 114.716 117.231 1.00 60.26  ? 50   ALA G N   1 
ATOM   5187  C CA  . ALA G  1 50  ? 107.984 113.487 117.608 1.00 60.03  ? 50   ALA G CA  1 
ATOM   5188  C C   . ALA G  1 50  ? 109.409 113.728 118.115 1.00 58.36  ? 50   ALA G C   1 
ATOM   5189  O O   . ALA G  1 50  ? 110.370 113.107 117.641 1.00 59.68  ? 50   ALA G O   1 
ATOM   5190  C CB  . ALA G  1 50  ? 107.965 112.474 116.462 1.00 59.90  ? 50   ALA G CB  1 
ATOM   5191  N N   . ALA G  1 51  ? 109.516 114.644 119.079 1.00 57.19  ? 51   ALA G N   1 
ATOM   5192  C CA  . ALA G  1 51  ? 110.762 114.954 119.788 1.00 56.41  ? 51   ALA G CA  1 
ATOM   5193  C C   . ALA G  1 51  ? 111.734 115.800 118.975 1.00 55.49  ? 51   ALA G C   1 
ATOM   5194  O O   . ALA G  1 51  ? 112.035 116.942 119.337 1.00 55.39  ? 51   ALA G O   1 
ATOM   5195  C CB  . ALA G  1 51  ? 111.452 113.671 120.293 1.00 56.34  ? 51   ALA G CB  1 
ATOM   5196  N N   . SER G  1 52  ? 112.206 115.232 117.866 1.00 54.99  ? 52   SER G N   1 
ATOM   5197  C CA  . SER G  1 52  ? 113.407 115.719 117.192 1.00 54.52  ? 52   SER G CA  1 
ATOM   5198  C C   . SER G  1 52  ? 113.321 115.612 115.670 1.00 53.75  ? 52   SER G C   1 
ATOM   5199  O O   . SER G  1 52  ? 114.347 115.480 114.996 1.00 54.68  ? 52   SER G O   1 
ATOM   5200  C CB  . SER G  1 52  ? 114.625 114.909 117.665 1.00 54.63  ? 52   SER G CB  1 
ATOM   5201  O OG  . SER G  1 52  ? 114.535 114.544 119.040 1.00 56.92  ? 52   SER G OG  1 
ATOM   5202  N N   . SER G  1 53  ? 112.107 115.684 115.129 1.00 51.35  ? 53   SER G N   1 
ATOM   5203  C CA  . SER G  1 53  ? 111.863 115.368 113.718 1.00 48.34  ? 53   SER G CA  1 
ATOM   5204  C C   . SER G  1 53  ? 111.383 116.562 112.865 1.00 46.82  ? 53   SER G C   1 
ATOM   5205  O O   . SER G  1 53  ? 110.441 117.263 113.232 1.00 46.47  ? 53   SER G O   1 
ATOM   5206  C CB  . SER G  1 53  ? 110.895 114.179 113.630 1.00 48.03  ? 53   SER G CB  1 
ATOM   5207  O OG  . SER G  1 53  ? 110.591 113.853 112.273 1.00 44.24  ? 53   SER G OG  1 
ATOM   5208  N N   . LEU G  1 54  ? 112.029 116.742 111.707 1.00 45.04  ? 54   LEU G N   1 
ATOM   5209  C CA  . LEU G  1 54  ? 111.917 117.959 110.890 1.00 42.62  ? 54   LEU G CA  1 
ATOM   5210  C C   . LEU G  1 54  ? 110.866 117.852 109.790 1.00 43.68  ? 54   LEU G C   1 
ATOM   5211  O O   . LEU G  1 54  ? 110.532 116.755 109.332 1.00 43.23  ? 54   LEU G O   1 
ATOM   5212  C CB  . LEU G  1 54  ? 113.280 118.271 110.256 1.00 41.56  ? 54   LEU G CB  1 
ATOM   5213  C CG  . LEU G  1 54  ? 113.902 119.673 110.153 1.00 38.83  ? 54   LEU G CG  1 
ATOM   5214  C CD1 . LEU G  1 54  ? 115.270 119.547 109.505 1.00 35.39  ? 54   LEU G CD1 1 
ATOM   5215  C CD2 . LEU G  1 54  ? 113.054 120.650 109.384 1.00 32.42  ? 54   LEU G CD2 1 
ATOM   5216  N N   . GLN G  1 55  ? 110.362 119.011 109.371 1.00 43.50  ? 55   GLN G N   1 
ATOM   5217  C CA  . GLN G  1 55  ? 109.325 119.058 108.361 1.00 41.88  ? 55   GLN G CA  1 
ATOM   5218  C C   . GLN G  1 55  ? 109.807 119.483 106.995 1.00 40.74  ? 55   GLN G C   1 
ATOM   5219  O O   . GLN G  1 55  ? 110.652 120.368 106.821 1.00 39.04  ? 55   GLN G O   1 
ATOM   5220  C CB  . GLN G  1 55  ? 108.135 119.922 108.790 1.00 40.79  ? 55   GLN G CB  1 
ATOM   5221  C CG  . GLN G  1 55  ? 107.130 119.212 109.684 1.00 41.12  ? 55   GLN G CG  1 
ATOM   5222  C CD  . GLN G  1 55  ? 106.568 117.941 109.071 1.00 46.18  ? 55   GLN G CD  1 
ATOM   5223  O OE1 . GLN G  1 55  ? 106.908 116.836 109.490 1.00 50.75  ? 55   GLN G OE1 1 
ATOM   5224  N NE2 . GLN G  1 55  ? 105.700 118.091 108.075 1.00 45.42  ? 55   GLN G NE2 1 
ATOM   5225  N N   . SER G  1 56  ? 109.220 118.790 106.038 1.00 42.58  ? 56   SER G N   1 
ATOM   5226  C CA  . SER G  1 56  ? 109.222 119.108 104.642 1.00 42.98  ? 56   SER G CA  1 
ATOM   5227  C C   . SER G  1 56  ? 108.844 120.573 104.440 1.00 44.36  ? 56   SER G C   1 
ATOM   5228  O O   . SER G  1 56  ? 107.670 120.945 104.546 1.00 45.70  ? 56   SER G O   1 
ATOM   5229  C CB  . SER G  1 56  ? 108.166 118.195 104.005 1.00 43.51  ? 56   SER G CB  1 
ATOM   5230  O OG  . SER G  1 56  ? 107.185 117.800 105.007 1.00 38.62  ? 56   SER G OG  1 
ATOM   5231  N N   . GLY G  1 57  ? 109.851 121.401 104.167 1.00 43.74  ? 57   GLY G N   1 
ATOM   5232  C CA  . GLY G  1 57  ? 109.649 122.832 103.958 1.00 42.67  ? 57   GLY G CA  1 
ATOM   5233  C C   . GLY G  1 57  ? 110.435 123.686 104.933 1.00 43.55  ? 57   GLY G C   1 
ATOM   5234  O O   . GLY G  1 57  ? 110.760 124.838 104.631 1.00 42.93  ? 57   GLY G O   1 
ATOM   5235  N N   . VAL G  1 58  ? 110.738 123.127 106.105 1.00 44.03  ? 58   VAL G N   1 
ATOM   5236  C CA  . VAL G  1 58  ? 111.412 123.910 107.138 1.00 43.57  ? 58   VAL G CA  1 
ATOM   5237  C C   . VAL G  1 58  ? 112.922 123.662 107.189 1.00 44.90  ? 58   VAL G C   1 
ATOM   5238  O O   . VAL G  1 58  ? 113.373 122.517 107.270 1.00 44.78  ? 58   VAL G O   1 
ATOM   5239  C CB  . VAL G  1 58  ? 110.699 123.825 108.538 1.00 43.39  ? 58   VAL G CB  1 
ATOM   5240  C CG1 . VAL G  1 58  ? 110.457 122.409 108.968 1.00 44.48  ? 58   VAL G CG1 1 
ATOM   5241  C CG2 . VAL G  1 58  ? 111.468 124.580 109.608 1.00 42.66  ? 58   VAL G CG2 1 
ATOM   5242  N N   . PRO G  1 59  ? 113.696 124.758 107.090 1.00 46.06  ? 59   PRO G N   1 
ATOM   5243  C CA  . PRO G  1 59  ? 115.150 124.863 107.135 1.00 47.42  ? 59   PRO G CA  1 
ATOM   5244  C C   . PRO G  1 59  ? 115.705 124.133 108.344 1.00 49.57  ? 59   PRO G C   1 
ATOM   5245  O O   . PRO G  1 59  ? 115.103 124.178 109.417 1.00 49.69  ? 59   PRO G O   1 
ATOM   5246  C CB  . PRO G  1 59  ? 115.383 126.376 107.262 1.00 47.63  ? 59   PRO G CB  1 
ATOM   5247  C CG  . PRO G  1 59  ? 114.043 126.962 107.615 1.00 46.18  ? 59   PRO G CG  1 
ATOM   5248  C CD  . PRO G  1 59  ? 113.087 126.085 106.909 1.00 46.56  ? 59   PRO G CD  1 
ATOM   5249  N N   . SER G  1 60  ? 116.841 123.463 108.169 1.00 50.70  ? 60   SER G N   1 
ATOM   5250  C CA  . SER G  1 60  ? 117.321 122.511 109.173 1.00 51.81  ? 60   SER G CA  1 
ATOM   5251  C C   . SER G  1 60  ? 117.735 123.150 110.501 1.00 52.32  ? 60   SER G C   1 
ATOM   5252  O O   . SER G  1 60  ? 117.409 122.615 111.575 1.00 51.44  ? 60   SER G O   1 
ATOM   5253  C CB  . SER G  1 60  ? 118.436 121.610 108.615 1.00 52.47  ? 60   SER G CB  1 
ATOM   5254  O OG  . SER G  1 60  ? 119.622 122.352 108.325 1.00 53.79  ? 60   SER G OG  1 
ATOM   5255  N N   . ARG G  1 61  ? 118.447 124.280 110.412 1.00 54.00  ? 61   ARG G N   1 
ATOM   5256  C CA  . ARG G  1 61  ? 118.751 125.189 111.537 1.00 53.94  ? 61   ARG G CA  1 
ATOM   5257  C C   . ARG G  1 61  ? 117.764 125.052 112.688 1.00 54.31  ? 61   ARG G C   1 
ATOM   5258  O O   . ARG G  1 61  ? 118.132 125.000 113.866 1.00 55.44  ? 61   ARG G O   1 
ATOM   5259  C CB  . ARG G  1 61  ? 118.737 126.644 111.027 1.00 54.82  ? 61   ARG G CB  1 
ATOM   5260  C CG  . ARG G  1 61  ? 117.508 127.004 110.154 1.00 54.30  ? 61   ARG G CG  1 
ATOM   5261  C CD  . ARG G  1 61  ? 117.679 128.297 109.348 1.00 55.80  ? 61   ARG G CD  1 
ATOM   5262  N NE  . ARG G  1 61  ? 116.823 129.394 109.821 1.00 55.49  ? 61   ARG G NE  1 
ATOM   5263  C CZ  . ARG G  1 61  ? 115.913 130.031 109.083 1.00 54.96  ? 61   ARG G CZ  1 
ATOM   5264  N NH1 . ARG G  1 61  ? 115.718 129.702 107.805 1.00 59.57  ? 61   ARG G NH1 1 
ATOM   5265  N NH2 . ARG G  1 61  ? 115.201 131.013 109.625 1.00 56.42  ? 61   ARG G NH2 1 
ATOM   5266  N N   . PHE G  1 62  ? 116.502 124.999 112.278 1.00 54.37  ? 62   PHE G N   1 
ATOM   5267  C CA  . PHE G  1 62  ? 115.315 124.838 113.086 1.00 53.75  ? 62   PHE G CA  1 
ATOM   5268  C C   . PHE G  1 62  ? 115.325 123.479 113.797 1.00 54.02  ? 62   PHE G C   1 
ATOM   5269  O O   . PHE G  1 62  ? 114.337 122.745 113.734 1.00 54.32  ? 62   PHE G O   1 
ATOM   5270  C CB  . PHE G  1 62  ? 114.143 124.846 112.101 1.00 52.63  ? 62   PHE G CB  1 
ATOM   5271  C CG  . PHE G  1 62  ? 113.106 125.897 112.359 1.00 53.57  ? 62   PHE G CG  1 
ATOM   5272  C CD1 . PHE G  1 62  ? 113.175 127.134 111.724 1.00 54.93  ? 62   PHE G CD1 1 
ATOM   5273  C CD2 . PHE G  1 62  ? 112.018 125.626 113.177 1.00 51.13  ? 62   PHE G CD2 1 
ATOM   5274  C CE1 . PHE G  1 62  ? 112.196 128.098 111.937 1.00 51.75  ? 62   PHE G CE1 1 
ATOM   5275  C CE2 . PHE G  1 62  ? 111.044 126.588 113.399 1.00 49.33  ? 62   PHE G CE2 1 
ATOM   5276  C CZ  . PHE G  1 62  ? 111.128 127.821 112.773 1.00 48.41  ? 62   PHE G CZ  1 
ATOM   5277  N N   . SER G  1 63  ? 116.424 123.128 114.462 1.00 54.23  ? 63   SER G N   1 
ATOM   5278  C CA  . SER G  1 63  ? 116.503 121.818 115.107 1.00 55.07  ? 63   SER G CA  1 
ATOM   5279  C C   . SER G  1 63  ? 115.962 121.815 116.542 1.00 54.96  ? 63   SER G C   1 
ATOM   5280  O O   . SER G  1 63  ? 115.871 122.865 117.187 1.00 54.27  ? 63   SER G O   1 
ATOM   5281  C CB  . SER G  1 63  ? 117.925 121.240 115.036 1.00 54.05  ? 63   SER G CB  1 
ATOM   5282  O OG  . SER G  1 63  ? 118.836 122.004 115.806 1.00 58.54  ? 63   SER G OG  1 
ATOM   5283  N N   . GLY G  1 64  ? 115.590 120.628 117.018 1.00 55.72  ? 64   GLY G N   1 
ATOM   5284  C CA  . GLY G  1 64  ? 115.039 120.449 118.360 1.00 56.40  ? 64   GLY G CA  1 
ATOM   5285  C C   . GLY G  1 64  ? 115.196 119.032 118.874 1.00 56.56  ? 64   GLY G C   1 
ATOM   5286  O O   . GLY G  1 64  ? 115.519 118.120 118.103 1.00 56.78  ? 64   GLY G O   1 
ATOM   5287  N N   . SER G  1 65  ? 114.953 118.848 120.177 1.00 56.02  ? 65   SER G N   1 
ATOM   5288  C CA  . SER G  1 65  ? 115.396 117.633 120.853 1.00 55.18  ? 65   SER G CA  1 
ATOM   5289  C C   . SER G  1 65  ? 115.128 117.590 122.353 1.00 55.90  ? 65   SER G C   1 
ATOM   5290  O O   . SER G  1 65  ? 114.626 118.547 122.948 1.00 54.93  ? 65   SER G O   1 
ATOM   5291  C CB  . SER G  1 65  ? 116.908 117.485 120.668 1.00 54.66  ? 65   SER G CB  1 
ATOM   5292  O OG  . SER G  1 65  ? 117.597 118.531 121.399 1.00 53.55  ? 65   SER G OG  1 
ATOM   5293  N N   . GLY G  1 66  ? 115.534 116.469 122.945 1.00 56.31  ? 66   GLY G N   1 
ATOM   5294  C CA  . GLY G  1 66  ? 115.340 116.185 124.362 1.00 56.68  ? 66   GLY G CA  1 
ATOM   5295  C C   . GLY G  1 66  ? 114.737 114.799 124.479 1.00 56.08  ? 66   GLY G C   1 
ATOM   5296  O O   . GLY G  1 66  ? 114.532 114.124 123.463 1.00 56.17  ? 66   GLY G O   1 
ATOM   5297  N N   . SER G  1 67  ? 114.430 114.376 125.708 1.00 55.71  ? 67   SER G N   1 
ATOM   5298  C CA  . SER G  1 67  ? 113.911 113.023 125.957 1.00 54.71  ? 67   SER G CA  1 
ATOM   5299  C C   . SER G  1 67  ? 113.386 112.771 127.382 1.00 52.48  ? 67   SER G C   1 
ATOM   5300  O O   . SER G  1 67  ? 114.183 112.495 128.302 1.00 51.85  ? 67   SER G O   1 
ATOM   5301  C CB  . SER G  1 67  ? 114.983 111.980 125.608 1.00 54.59  ? 67   SER G CB  1 
ATOM   5302  O OG  . SER G  1 67  ? 114.545 110.662 125.915 1.00 57.01  ? 67   SER G OG  1 
ATOM   5303  N N   . GLY G  1 68  ? 112.057 112.852 127.553 1.00 51.00  ? 68   GLY G N   1 
ATOM   5304  C CA  . GLY G  1 68  ? 111.443 112.465 128.833 1.00 48.87  ? 68   GLY G CA  1 
ATOM   5305  C C   . GLY G  1 68  ? 110.741 113.634 129.478 1.00 47.36  ? 68   GLY G C   1 
ATOM   5306  O O   . GLY G  1 68  ? 109.673 114.064 129.016 1.00 46.65  ? 68   GLY G O   1 
ATOM   5307  N N   . THR G  1 69  ? 111.338 114.140 130.554 1.00 44.82  ? 69   THR G N   1 
ATOM   5308  C CA  . THR G  1 69  ? 110.857 115.375 131.153 1.00 43.92  ? 69   THR G CA  1 
ATOM   5309  C C   . THR G  1 69  ? 111.879 116.504 130.926 1.00 43.22  ? 69   THR G C   1 
ATOM   5310  O O   . THR G  1 69  ? 112.073 117.366 131.791 1.00 40.41  ? 69   THR G O   1 
ATOM   5311  C CB  . THR G  1 69  ? 110.527 115.180 132.648 1.00 44.05  ? 69   THR G CB  1 
ATOM   5312  O OG1 . THR G  1 69  ? 110.248 113.794 132.908 1.00 45.44  ? 69   THR G OG1 1 
ATOM   5313  C CG2 . THR G  1 69  ? 109.325 116.007 133.051 1.00 40.34  ? 69   THR G CG2 1 
ATOM   5314  N N   . ASP G  1 70  ? 112.543 116.473 129.765 1.00 43.68  ? 70   ASP G N   1 
ATOM   5315  C CA  . ASP G  1 70  ? 113.285 117.636 129.234 1.00 44.29  ? 70   ASP G CA  1 
ATOM   5316  C C   . ASP G  1 70  ? 113.464 117.611 127.717 1.00 43.41  ? 70   ASP G C   1 
ATOM   5317  O O   . ASP G  1 70  ? 113.764 116.561 127.134 1.00 43.90  ? 70   ASP G O   1 
ATOM   5318  C CB  . ASP G  1 70  ? 114.660 117.828 129.897 1.00 45.89  ? 70   ASP G CB  1 
ATOM   5319  C CG  . ASP G  1 70  ? 115.301 119.170 129.505 1.00 46.83  ? 70   ASP G CG  1 
ATOM   5320  O OD1 . ASP G  1 70  ? 114.544 120.120 129.050 1.00 51.84  ? 70   ASP G OD1 1 
ATOM   5321  O OD2 . ASP G  1 70  ? 116.562 119.279 129.635 1.00 49.49  ? 70   ASP G OD2 1 
ATOM   5322  N N   . PHE G  1 71  ? 113.283 118.789 127.100 1.00 42.80  ? 71   PHE G N   1 
ATOM   5323  C CA  . PHE G  1 71  ? 113.430 118.973 125.653 1.00 42.68  ? 71   PHE G CA  1 
ATOM   5324  C C   . PHE G  1 71  ? 113.833 120.422 125.296 1.00 42.95  ? 71   PHE G C   1 
ATOM   5325  O O   . PHE G  1 71  ? 113.583 121.354 126.068 1.00 43.10  ? 71   PHE G O   1 
ATOM   5326  C CB  . PHE G  1 71  ? 112.142 118.576 124.905 1.00 41.61  ? 71   PHE G CB  1 
ATOM   5327  C CG  . PHE G  1 71  ? 111.572 117.224 125.302 1.00 34.61  ? 71   PHE G CG  1 
ATOM   5328  C CD1 . PHE G  1 71  ? 110.837 117.078 126.479 1.00 33.75  ? 71   PHE G CD1 1 
ATOM   5329  C CD2 . PHE G  1 71  ? 111.728 116.112 124.477 1.00 31.77  ? 71   PHE G CD2 1 
ATOM   5330  C CE1 . PHE G  1 71  ? 110.313 115.846 126.845 1.00 39.56  ? 71   PHE G CE1 1 
ATOM   5331  C CE2 . PHE G  1 71  ? 111.194 114.868 124.834 1.00 35.86  ? 71   PHE G CE2 1 
ATOM   5332  C CZ  . PHE G  1 71  ? 110.484 114.742 126.018 1.00 34.49  ? 71   PHE G CZ  1 
ATOM   5333  N N   . THR G  1 72  ? 114.442 120.601 124.121 1.00 42.74  ? 72   THR G N   1 
ATOM   5334  C CA  . THR G  1 72  ? 115.020 121.887 123.727 1.00 41.65  ? 72   THR G CA  1 
ATOM   5335  C C   . THR G  1 72  ? 114.914 122.163 122.229 1.00 41.09  ? 72   THR G C   1 
ATOM   5336  O O   . THR G  1 72  ? 115.097 121.245 121.401 1.00 38.24  ? 72   THR G O   1 
ATOM   5337  C CB  . THR G  1 72  ? 116.497 121.994 124.197 1.00 40.90  ? 72   THR G CB  1 
ATOM   5338  O OG1 . THR G  1 72  ? 116.528 122.151 125.627 1.00 45.29  ? 72   THR G OG1 1 
ATOM   5339  C CG2 . THR G  1 72  ? 117.217 123.179 123.551 1.00 38.15  ? 72   THR G CG2 1 
ATOM   5340  N N   . LEU G  1 73  ? 114.596 123.433 121.915 1.00 44.97  ? 73   LEU G N   1 
ATOM   5341  C CA  . LEU G  1 73  ? 114.552 123.907 120.546 1.00 45.49  ? 73   LEU G CA  1 
ATOM   5342  C C   . LEU G  1 73  ? 115.708 124.875 120.355 1.00 44.92  ? 73   LEU G C   1 
ATOM   5343  O O   . LEU G  1 73  ? 116.010 125.722 121.209 1.00 45.14  ? 73   LEU G O   1 
ATOM   5344  C CB  . LEU G  1 73  ? 113.225 124.612 120.258 1.00 44.95  ? 73   LEU G CB  1 
ATOM   5345  C CG  . LEU G  1 73  ? 112.968 125.291 118.900 1.00 47.85  ? 73   LEU G CG  1 
ATOM   5346  C CD1 . LEU G  1 73  ? 112.670 124.270 117.807 1.00 49.61  ? 73   LEU G CD1 1 
ATOM   5347  C CD2 . LEU G  1 73  ? 111.822 126.284 119.024 1.00 47.66  ? 73   LEU G CD2 1 
ATOM   5348  N N   . THR G  1 74  ? 116.339 124.712 119.204 1.00 45.65  ? 74   THR G N   1 
ATOM   5349  C CA  . THR G  1 74  ? 117.581 125.347 118.890 1.00 44.62  ? 74   THR G CA  1 
ATOM   5350  C C   . THR G  1 74  ? 117.405 125.802 117.461 1.00 44.39  ? 74   THR G C   1 
ATOM   5351  O O   . THR G  1 74  ? 117.581 124.990 116.489 1.00 44.86  ? 74   THR G O   1 
ATOM   5352  C CB  . THR G  1 74  ? 118.740 124.331 118.950 1.00 44.84  ? 74   THR G CB  1 
ATOM   5353  O OG1 . THR G  1 74  ? 118.327 123.095 118.343 1.00 44.97  ? 74   THR G OG1 1 
ATOM   5354  C CG2 . THR G  1 74  ? 119.160 124.062 120.390 1.00 44.13  ? 74   THR G CG2 1 
ATOM   5355  N N   . ILE G  1 75  ? 116.987 127.072 117.329 1.00 44.29  ? 75   ILE G N   1 
ATOM   5356  C CA  . ILE G  1 75  ? 117.086 127.736 116.045 1.00 43.45  ? 75   ILE G CA  1 
ATOM   5357  C C   . ILE G  1 75  ? 118.556 128.059 115.950 1.00 44.67  ? 75   ILE G C   1 
ATOM   5358  O O   . ILE G  1 75  ? 119.082 128.865 116.738 1.00 46.03  ? 75   ILE G O   1 
ATOM   5359  C CB  . ILE G  1 75  ? 116.254 129.029 115.994 1.00 43.81  ? 75   ILE G CB  1 
ATOM   5360  C CG1 . ILE G  1 75  ? 114.758 128.693 116.021 1.00 41.14  ? 75   ILE G CG1 1 
ATOM   5361  C CG2 . ILE G  1 75  ? 116.600 129.851 114.739 1.00 41.50  ? 75   ILE G CG2 1 
ATOM   5362  C CD1 . ILE G  1 75  ? 113.856 129.856 116.434 1.00 40.84  ? 75   ILE G CD1 1 
ATOM   5363  N N   . SER G  1 76  ? 119.234 127.392 115.022 1.00 44.40  ? 76   SER G N   1 
ATOM   5364  C CA  . SER G  1 76  ? 120.670 127.560 114.934 1.00 44.89  ? 76   SER G CA  1 
ATOM   5365  C C   . SER G  1 76  ? 121.021 128.783 114.101 1.00 46.02  ? 76   SER G C   1 
ATOM   5366  O O   . SER G  1 76  ? 122.200 129.108 113.958 1.00 45.80  ? 76   SER G O   1 
ATOM   5367  C CB  . SER G  1 76  ? 121.356 126.290 114.414 1.00 44.87  ? 76   SER G CB  1 
ATOM   5368  O OG  . SER G  1 76  ? 121.393 126.253 113.000 1.00 43.27  ? 76   SER G OG  1 
ATOM   5369  N N   . SER G  1 77  ? 120.002 129.456 113.557 1.00 47.15  ? 77   SER G N   1 
ATOM   5370  C CA  . SER G  1 77  ? 120.190 130.727 112.844 1.00 47.45  ? 77   SER G CA  1 
ATOM   5371  C C   . SER G  1 77  ? 118.865 131.351 112.375 1.00 47.90  ? 77   SER G C   1 
ATOM   5372  O O   . SER G  1 77  ? 118.141 130.775 111.563 1.00 48.86  ? 77   SER G O   1 
ATOM   5373  C CB  . SER G  1 77  ? 121.167 130.565 111.661 1.00 48.11  ? 77   SER G CB  1 
ATOM   5374  O OG  . SER G  1 77  ? 121.785 131.801 111.335 1.00 49.22  ? 77   SER G OG  1 
ATOM   5375  N N   . LEU G  1 78  ? 118.583 132.541 112.897 1.00 48.12  ? 78   LEU G N   1 
ATOM   5376  C CA  . LEU G  1 78  ? 117.310 133.244 112.729 1.00 47.38  ? 78   LEU G CA  1 
ATOM   5377  C C   . LEU G  1 78  ? 117.189 133.895 111.346 1.00 47.69  ? 78   LEU G C   1 
ATOM   5378  O O   . LEU G  1 78  ? 118.190 134.308 110.769 1.00 47.79  ? 78   LEU G O   1 
ATOM   5379  C CB  . LEU G  1 78  ? 117.237 134.320 113.826 1.00 47.91  ? 78   LEU G CB  1 
ATOM   5380  C CG  . LEU G  1 78  ? 116.032 135.183 114.226 1.00 48.21  ? 78   LEU G CG  1 
ATOM   5381  C CD1 . LEU G  1 78  ? 114.787 134.337 114.543 1.00 48.60  ? 78   LEU G CD1 1 
ATOM   5382  C CD2 . LEU G  1 78  ? 116.420 136.091 115.425 1.00 46.94  ? 78   LEU G CD2 1 
ATOM   5383  N N   . GLN G  1 79  ? 115.967 133.978 110.818 1.00 46.98  ? 79   GLN G N   1 
ATOM   5384  C CA  . GLN G  1 79  ? 115.690 134.828 109.645 1.00 46.10  ? 79   GLN G CA  1 
ATOM   5385  C C   . GLN G  1 79  ? 114.491 135.760 109.947 1.00 46.80  ? 79   GLN G C   1 
ATOM   5386  O O   . GLN G  1 79  ? 113.855 135.596 110.995 1.00 48.29  ? 79   GLN G O   1 
ATOM   5387  C CB  . GLN G  1 79  ? 115.479 133.975 108.388 1.00 45.79  ? 79   GLN G CB  1 
ATOM   5388  C CG  . GLN G  1 79  ? 116.761 133.315 107.869 1.00 47.57  ? 79   GLN G CG  1 
ATOM   5389  C CD  . GLN G  1 79  ? 117.840 134.326 107.521 1.00 48.35  ? 79   GLN G CD  1 
ATOM   5390  O OE1 . GLN G  1 79  ? 118.759 134.576 108.315 1.00 48.80  ? 79   GLN G OE1 1 
ATOM   5391  N NE2 . GLN G  1 79  ? 117.721 134.929 106.341 1.00 46.61  ? 79   GLN G NE2 1 
ATOM   5392  N N   . PRO G  1 80  ? 114.187 136.750 109.068 1.00 46.77  ? 80   PRO G N   1 
ATOM   5393  C CA  . PRO G  1 80  ? 113.030 137.587 109.439 1.00 46.51  ? 80   PRO G CA  1 
ATOM   5394  C C   . PRO G  1 80  ? 111.715 136.828 109.301 1.00 46.92  ? 80   PRO G C   1 
ATOM   5395  O O   . PRO G  1 80  ? 110.655 137.338 109.691 1.00 47.09  ? 80   PRO G O   1 
ATOM   5396  C CB  . PRO G  1 80  ? 113.079 138.748 108.431 1.00 45.73  ? 80   PRO G CB  1 
ATOM   5397  C CG  . PRO G  1 80  ? 114.416 138.648 107.757 1.00 46.56  ? 80   PRO G CG  1 
ATOM   5398  C CD  . PRO G  1 80  ? 114.785 137.197 107.793 1.00 46.17  ? 80   PRO G CD  1 
ATOM   5399  N N   . GLU G  1 81  ? 111.800 135.621 108.746 1.00 47.89  ? 81   GLU G N   1 
ATOM   5400  C CA  . GLU G  1 81  ? 110.642 134.753 108.612 1.00 47.12  ? 81   GLU G CA  1 
ATOM   5401  C C   . GLU G  1 81  ? 110.406 133.952 109.903 1.00 47.24  ? 81   GLU G C   1 
ATOM   5402  O O   . GLU G  1 81  ? 109.600 133.014 109.917 1.00 47.57  ? 81   GLU G O   1 
ATOM   5403  C CB  . GLU G  1 81  ? 110.759 133.846 107.362 1.00 46.24  ? 81   GLU G CB  1 
ATOM   5404  C CG  . GLU G  1 81  ? 112.091 133.074 107.180 1.00 46.08  ? 81   GLU G CG  1 
ATOM   5405  C CD  . GLU G  1 81  ? 112.968 133.575 106.019 1.00 45.86  ? 81   GLU G CD  1 
ATOM   5406  O OE1 . GLU G  1 81  ? 113.941 132.868 105.668 1.00 37.81  ? 81   GLU G OE1 1 
ATOM   5407  O OE2 . GLU G  1 81  ? 112.692 134.662 105.462 1.00 44.55  ? 81   GLU G OE2 1 
ATOM   5408  N N   . ASP G  1 82  ? 111.086 134.343 110.988 1.00 45.23  ? 82   ASP G N   1 
ATOM   5409  C CA  . ASP G  1 82  ? 110.978 133.596 112.247 1.00 43.70  ? 82   ASP G CA  1 
ATOM   5410  C C   . ASP G  1 82  ? 110.316 134.319 113.454 1.00 43.64  ? 82   ASP G C   1 
ATOM   5411  O O   . ASP G  1 82  ? 109.839 133.653 114.390 1.00 41.40  ? 82   ASP G O   1 
ATOM   5412  C CB  . ASP G  1 82  ? 112.328 132.936 112.615 1.00 42.62  ? 82   ASP G CB  1 
ATOM   5413  C CG  . ASP G  1 82  ? 112.832 131.975 111.517 1.00 37.29  ? 82   ASP G CG  1 
ATOM   5414  O OD1 . ASP G  1 82  ? 112.923 132.390 110.340 1.00 28.34  ? 82   ASP G OD1 1 
ATOM   5415  O OD2 . ASP G  1 82  ? 113.162 130.813 111.843 1.00 27.68  ? 82   ASP G OD2 1 
ATOM   5416  N N   . PHE G  1 83  ? 110.282 135.662 113.412 1.00 43.89  ? 83   PHE G N   1 
ATOM   5417  C CA  . PHE G  1 83  ? 109.563 136.547 114.375 1.00 45.23  ? 83   PHE G CA  1 
ATOM   5418  C C   . PHE G  1 83  ? 108.197 135.986 114.681 1.00 46.95  ? 83   PHE G C   1 
ATOM   5419  O O   . PHE G  1 83  ? 107.264 136.122 113.875 1.00 47.55  ? 83   PHE G O   1 
ATOM   5420  C CB  . PHE G  1 83  ? 109.515 138.004 113.823 1.00 46.13  ? 83   PHE G CB  1 
ATOM   5421  C CG  . PHE G  1 83  ? 108.339 138.883 114.296 1.00 44.22  ? 83   PHE G CG  1 
ATOM   5422  C CD1 . PHE G  1 83  ? 108.369 139.554 115.522 1.00 45.93  ? 83   PHE G CD1 1 
ATOM   5423  C CD2 . PHE G  1 83  ? 107.263 139.141 113.440 1.00 43.42  ? 83   PHE G CD2 1 
ATOM   5424  C CE1 . PHE G  1 83  ? 107.310 140.405 115.919 1.00 39.73  ? 83   PHE G CE1 1 
ATOM   5425  C CE2 . PHE G  1 83  ? 106.206 139.987 113.827 1.00 46.51  ? 83   PHE G CE2 1 
ATOM   5426  C CZ  . PHE G  1 83  ? 106.231 140.619 115.068 1.00 43.66  ? 83   PHE G CZ  1 
ATOM   5427  N N   . ALA G  1 84  ? 108.088 135.311 115.821 1.00 46.29  ? 84   ALA G N   1 
ATOM   5428  C CA  . ALA G  1 84  ? 106.827 134.715 116.212 1.00 46.08  ? 84   ALA G CA  1 
ATOM   5429  C C   . ALA G  1 84  ? 106.942 133.787 117.395 1.00 45.61  ? 84   ALA G C   1 
ATOM   5430  O O   . ALA G  1 84  ? 107.908 133.810 118.161 1.00 46.03  ? 84   ALA G O   1 
ATOM   5431  C CB  . ALA G  1 84  ? 106.185 133.967 115.026 1.00 45.93  ? 84   ALA G CB  1 
ATOM   5432  N N   . THR G  1 85  ? 105.918 132.950 117.491 1.00 44.33  ? 85   THR G N   1 
ATOM   5433  C CA  . THR G  1 85  ? 105.701 132.089 118.618 1.00 43.21  ? 85   THR G CA  1 
ATOM   5434  C C   . THR G  1 85  ? 105.899 130.645 118.247 1.00 42.81  ? 85   THR G C   1 
ATOM   5435  O O   . THR G  1 85  ? 105.387 130.147 117.238 1.00 44.42  ? 85   THR G O   1 
ATOM   5436  C CB  . THR G  1 85  ? 104.278 132.253 119.170 1.00 42.49  ? 85   THR G CB  1 
ATOM   5437  O OG1 . THR G  1 85  ? 103.905 133.649 119.098 1.00 43.91  ? 85   THR G OG1 1 
ATOM   5438  C CG2 . THR G  1 85  ? 104.231 131.803 120.633 1.00 41.03  ? 85   THR G CG2 1 
ATOM   5439  N N   . TYR G  1 86  ? 106.661 129.983 119.100 1.00 41.30  ? 86   TYR G N   1 
ATOM   5440  C CA  . TYR G  1 86  ? 106.760 128.557 119.068 1.00 39.89  ? 86   TYR G CA  1 
ATOM   5441  C C   . TYR G  1 86  ? 106.183 128.032 120.349 1.00 39.27  ? 86   TYR G C   1 
ATOM   5442  O O   . TYR G  1 86  ? 106.248 128.654 121.406 1.00 36.92  ? 86   TYR G O   1 
ATOM   5443  C CB  . TYR G  1 86  ? 108.200 128.100 118.868 1.00 39.77  ? 86   TYR G CB  1 
ATOM   5444  C CG  . TYR G  1 86  ? 108.883 128.860 117.767 1.00 40.84  ? 86   TYR G CG  1 
ATOM   5445  C CD1 . TYR G  1 86  ? 109.558 130.046 118.047 1.00 40.57  ? 86   TYR G CD1 1 
ATOM   5446  C CD2 . TYR G  1 86  ? 108.834 128.418 116.445 1.00 40.37  ? 86   TYR G CD2 1 
ATOM   5447  C CE1 . TYR G  1 86  ? 110.178 130.767 117.053 1.00 40.61  ? 86   TYR G CE1 1 
ATOM   5448  C CE2 . TYR G  1 86  ? 109.459 129.138 115.436 1.00 40.13  ? 86   TYR G CE2 1 
ATOM   5449  C CZ  . TYR G  1 86  ? 110.128 130.312 115.753 1.00 39.50  ? 86   TYR G CZ  1 
ATOM   5450  O OH  . TYR G  1 86  ? 110.760 131.044 114.782 1.00 40.61  ? 86   TYR G OH  1 
ATOM   5451  N N   . TYR G  1 87  ? 105.616 126.851 120.192 1.00 39.19  ? 87   TYR G N   1 
ATOM   5452  C CA  . TYR G  1 87  ? 104.803 126.220 121.175 1.00 38.48  ? 87   TYR G CA  1 
ATOM   5453  C C   . TYR G  1 87  ? 105.321 124.826 121.194 1.00 38.04  ? 87   TYR G C   1 
ATOM   5454  O O   . TYR G  1 87  ? 105.771 124.289 120.170 1.00 38.02  ? 87   TYR G O   1 
ATOM   5455  C CB  . TYR G  1 87  ? 103.367 126.148 120.677 1.00 37.80  ? 87   TYR G CB  1 
ATOM   5456  C CG  . TYR G  1 87  ? 102.562 127.348 121.041 1.00 37.92  ? 87   TYR G CG  1 
ATOM   5457  C CD1 . TYR G  1 87  ? 102.655 128.513 120.293 1.00 34.87  ? 87   TYR G CD1 1 
ATOM   5458  C CD2 . TYR G  1 87  ? 101.711 127.327 122.140 1.00 42.02  ? 87   TYR G CD2 1 
ATOM   5459  C CE1 . TYR G  1 87  ? 101.920 129.624 120.620 1.00 33.33  ? 87   TYR G CE1 1 
ATOM   5460  C CE2 . TYR G  1 87  ? 100.971 128.443 122.480 1.00 40.10  ? 87   TYR G CE2 1 
ATOM   5461  C CZ  . TYR G  1 87  ? 101.083 129.593 121.710 1.00 37.73  ? 87   TYR G CZ  1 
ATOM   5462  O OH  . TYR G  1 87  ? 100.364 130.727 122.007 1.00 41.07  ? 87   TYR G OH  1 
ATOM   5463  N N   . CYS G  1 88  ? 105.240 124.219 122.366 1.00 37.60  ? 88   CYS G N   1 
ATOM   5464  C CA  . CYS G  1 88  ? 105.605 122.846 122.534 1.00 37.44  ? 88   CYS G CA  1 
ATOM   5465  C C   . CYS G  1 88  ? 104.333 122.172 122.976 1.00 37.93  ? 88   CYS G C   1 
ATOM   5466  O O   . CYS G  1 88  ? 103.520 122.765 123.686 1.00 37.52  ? 88   CYS G O   1 
ATOM   5467  C CB  . CYS G  1 88  ? 106.688 122.711 123.599 1.00 37.47  ? 88   CYS G CB  1 
ATOM   5468  S SG  . CYS G  1 88  ? 106.331 123.604 125.128 1.00 39.51  ? 88   CYS G SG  1 
ATOM   5469  N N   . GLN G  1 89  ? 104.150 120.930 122.533 1.00 39.86  ? 89   GLN G N   1 
ATOM   5470  C CA  . GLN G  1 89  ? 102.912 120.235 122.796 1.00 42.59  ? 89   GLN G CA  1 
ATOM   5471  C C   . GLN G  1 89  ? 103.241 118.781 122.617 1.00 43.82  ? 89   GLN G C   1 
ATOM   5472  O O   . GLN G  1 89  ? 103.939 118.402 121.678 1.00 42.93  ? 89   GLN G O   1 
ATOM   5473  C CB  . GLN G  1 89  ? 101.825 120.653 121.802 1.00 43.33  ? 89   GLN G CB  1 
ATOM   5474  C CG  . GLN G  1 89  ? 100.417 120.167 122.157 1.00 43.58  ? 89   GLN G CG  1 
ATOM   5475  C CD  . GLN G  1 89  ? 99.680  119.573 120.969 1.00 43.73  ? 89   GLN G CD  1 
ATOM   5476  O OE1 . GLN G  1 89  ? 100.293 119.192 119.968 1.00 41.82  ? 89   GLN G OE1 1 
ATOM   5477  N NE2 . GLN G  1 89  ? 98.360  119.465 121.083 1.00 45.43  ? 89   GLN G NE2 1 
ATOM   5478  N N   . GLN G  1 90  ? 102.752 117.967 123.531 1.00 45.30  ? 90   GLN G N   1 
ATOM   5479  C CA  . GLN G  1 90  ? 102.970 116.547 123.465 1.00 46.12  ? 90   GLN G CA  1 
ATOM   5480  C C   . GLN G  1 90  ? 101.979 115.921 122.500 1.00 47.26  ? 90   GLN G C   1 
ATOM   5481  O O   . GLN G  1 90  ? 101.022 116.575 122.055 1.00 47.89  ? 90   GLN G O   1 
ATOM   5482  C CB  . GLN G  1 90  ? 102.674 115.963 124.824 1.00 45.94  ? 90   GLN G CB  1 
ATOM   5483  C CG  . GLN G  1 90  ? 101.183 115.839 125.023 1.00 43.71  ? 90   GLN G CG  1 
ATOM   5484  C CD  . GLN G  1 90  ? 100.781 116.176 126.394 1.00 43.49  ? 90   GLN G CD  1 
ATOM   5485  O OE1 . GLN G  1 90  ? 101.359 115.679 127.353 1.00 37.31  ? 90   GLN G OE1 1 
ATOM   5486  N NE2 . GLN G  1 90  ? 99.780  117.033 126.525 1.00 47.91  ? 90   GLN G NE2 1 
ATOM   5487  N N   . SER G  1 91  ? 102.210 114.654 122.177 1.00 49.27  ? 91   SER G N   1 
ATOM   5488  C CA  . SER G  1 91  ? 101.109 113.782 121.816 1.00 50.78  ? 91   SER G CA  1 
ATOM   5489  C C   . SER G  1 91  ? 100.718 113.030 123.086 1.00 52.17  ? 91   SER G C   1 
ATOM   5490  O O   . SER G  1 91  ? 99.641  112.431 123.146 1.00 51.19  ? 91   SER G O   1 
ATOM   5491  C CB  . SER G  1 91  ? 101.513 112.793 120.717 1.00 51.73  ? 91   SER G CB  1 
ATOM   5492  O OG  . SER G  1 91  ? 100.505 111.812 120.502 1.00 49.08  ? 91   SER G OG  1 
ATOM   5493  N N   . TYR G  1 92  ? 101.587 113.083 124.101 1.00 52.70  ? 92   TYR G N   1 
ATOM   5494  C CA  . TYR G  1 92  ? 101.468 112.183 125.247 1.00 53.51  ? 92   TYR G CA  1 
ATOM   5495  C C   . TYR G  1 92  ? 100.070 112.076 125.865 1.00 52.39  ? 92   TYR G C   1 
ATOM   5496  O O   . TYR G  1 92  ? 99.520  110.976 125.883 1.00 53.53  ? 92   TYR G O   1 
ATOM   5497  C CB  . TYR G  1 92  ? 102.563 112.365 126.320 1.00 54.64  ? 92   TYR G CB  1 
ATOM   5498  C CG  . TYR G  1 92  ? 102.781 111.091 127.141 1.00 57.76  ? 92   TYR G CG  1 
ATOM   5499  C CD1 . TYR G  1 92  ? 104.008 110.419 127.126 1.00 55.73  ? 92   TYR G CD1 1 
ATOM   5500  C CD2 . TYR G  1 92  ? 101.739 110.538 127.903 1.00 59.17  ? 92   TYR G CD2 1 
ATOM   5501  C CE1 . TYR G  1 92  ? 104.201 109.247 127.872 1.00 56.56  ? 92   TYR G CE1 1 
ATOM   5502  C CE2 . TYR G  1 92  ? 101.920 109.371 128.639 1.00 58.98  ? 92   TYR G CE2 1 
ATOM   5503  C CZ  . TYR G  1 92  ? 103.151 108.730 128.621 1.00 59.43  ? 92   TYR G CZ  1 
ATOM   5504  O OH  . TYR G  1 92  ? 103.330 107.576 129.352 1.00 60.49  ? 92   TYR G OH  1 
ATOM   5505  N N   . SER G  1 93  ? 99.470  113.166 126.345 1.00 51.03  ? 93   SER G N   1 
ATOM   5506  C CA  . SER G  1 93  ? 98.166  113.004 127.012 1.00 49.63  ? 93   SER G CA  1 
ATOM   5507  C C   . SER G  1 93  ? 97.009  113.868 126.521 1.00 48.75  ? 93   SER G C   1 
ATOM   5508  O O   . SER G  1 93  ? 97.202  114.823 125.780 1.00 47.17  ? 93   SER G O   1 
ATOM   5509  C CB  . SER G  1 93  ? 98.303  113.130 128.531 1.00 50.29  ? 93   SER G CB  1 
ATOM   5510  O OG  . SER G  1 93  ? 98.119  114.522 128.944 1.00 49.48  ? 93   SER G OG  1 
ATOM   5511  N N   . THR G  1 94  ? 95.817  113.507 126.978 1.00 47.17  ? 94   THR G N   1 
ATOM   5512  C CA  . THR G  1 94  ? 94.587  114.122 126.535 1.00 46.64  ? 94   THR G CA  1 
ATOM   5513  C C   . THR G  1 94  ? 93.802  114.408 127.798 1.00 45.43  ? 94   THR G C   1 
ATOM   5514  O O   . THR G  1 94  ? 93.321  113.490 128.455 1.00 45.49  ? 94   THR G O   1 
ATOM   5515  C CB  . THR G  1 94  ? 93.842  113.200 125.568 1.00 46.50  ? 94   THR G CB  1 
ATOM   5516  O OG1 . THR G  1 94  ? 94.461  111.902 125.593 1.00 49.77  ? 94   THR G OG1 1 
ATOM   5517  C CG2 . THR G  1 94  ? 93.944  113.733 124.153 1.00 47.23  ? 94   THR G CG2 1 
ATOM   5518  N N   . PRO G  1 95  ? 93.710  115.686 128.178 1.00 44.92  ? 95   PRO G N   1 
ATOM   5519  C CA  . PRO G  1 95  ? 94.038  116.928 127.479 1.00 44.54  ? 95   PRO G CA  1 
ATOM   5520  C C   . PRO G  1 95  ? 95.425  117.007 126.827 1.00 44.76  ? 95   PRO G C   1 
ATOM   5521  O O   . PRO G  1 95  ? 96.430  116.817 127.514 1.00 46.23  ? 95   PRO G O   1 
ATOM   5522  C CB  . PRO G  1 95  ? 93.926  117.987 128.593 1.00 44.19  ? 95   PRO G CB  1 
ATOM   5523  C CG  . PRO G  1 95  ? 93.993  117.214 129.887 1.00 45.31  ? 95   PRO G CG  1 
ATOM   5524  C CD  . PRO G  1 95  ? 93.266  115.963 129.571 1.00 45.08  ? 95   PRO G CD  1 
ATOM   5525  N N   . ASN G  1 96  ? 95.470  117.297 125.522 1.00 44.35  ? 96   ASN G N   1 
ATOM   5526  C CA  . ASN G  1 96  ? 96.727  117.611 124.823 1.00 43.87  ? 96   ASN G CA  1 
ATOM   5527  C C   . ASN G  1 96  ? 97.202  119.038 125.105 1.00 43.30  ? 96   ASN G C   1 
ATOM   5528  O O   . ASN G  1 96  ? 96.921  119.965 124.327 1.00 46.22  ? 96   ASN G O   1 
ATOM   5529  C CB  . ASN G  1 96  ? 96.600  117.379 123.301 1.00 42.46  ? 96   ASN G CB  1 
ATOM   5530  C CG  . ASN G  1 96  ? 96.909  115.934 122.902 1.00 42.02  ? 96   ASN G CG  1 
ATOM   5531  O OD1 . ASN G  1 96  ? 96.818  115.015 123.708 1.00 42.88  ? 96   ASN G OD1 1 
ATOM   5532  N ND2 . ASN G  1 96  ? 97.273  115.734 121.638 1.00 34.58  ? 96   ASN G ND2 1 
ATOM   5533  N N   . THR G  1 97  ? 97.915  119.200 126.220 1.00 41.58  ? 97   THR G N   1 
ATOM   5534  C CA  . THR G  1 97  ? 98.435  120.505 126.650 1.00 40.26  ? 97   THR G CA  1 
ATOM   5535  C C   . THR G  1 97  ? 99.434  121.169 125.701 1.00 39.98  ? 97   THR G C   1 
ATOM   5536  O O   . THR G  1 97  ? 100.321 120.519 125.146 1.00 42.31  ? 97   THR G O   1 
ATOM   5537  C CB  . THR G  1 97  ? 99.083  120.404 128.039 1.00 39.69  ? 97   THR G CB  1 
ATOM   5538  O OG1 . THR G  1 97  ? 99.866  119.200 128.120 1.00 37.37  ? 97   THR G OG1 1 
ATOM   5539  C CG2 . THR G  1 97  ? 98.011  120.378 129.115 1.00 39.50  ? 97   THR G CG2 1 
ATOM   5540  N N   . PHE G  1 98  ? 99.269  122.483 125.558 1.00 38.26  ? 98   PHE G N   1 
ATOM   5541  C CA  . PHE G  1 98  ? 100.149 123.329 124.744 1.00 36.35  ? 98   PHE G CA  1 
ATOM   5542  C C   . PHE G  1 98  ? 101.292 123.929 125.544 1.00 35.11  ? 98   PHE G C   1 
ATOM   5543  O O   . PHE G  1 98  ? 101.328 123.807 126.776 1.00 33.25  ? 98   PHE G O   1 
ATOM   5544  C CB  . PHE G  1 98  ? 99.330  124.406 124.022 1.00 35.90  ? 98   PHE G CB  1 
ATOM   5545  C CG  . PHE G  1 98  ? 98.798  123.941 122.708 1.00 39.76  ? 98   PHE G CG  1 
ATOM   5546  C CD1 . PHE G  1 98  ? 97.967  122.827 122.641 1.00 41.35  ? 98   PHE G CD1 1 
ATOM   5547  C CD2 . PHE G  1 98  ? 99.174  124.566 121.525 1.00 39.98  ? 98   PHE G CD2 1 
ATOM   5548  C CE1 . PHE G  1 98  ? 97.494  122.364 121.429 1.00 38.05  ? 98   PHE G CE1 1 
ATOM   5549  C CE2 . PHE G  1 98  ? 98.701  124.105 120.300 1.00 38.61  ? 98   PHE G CE2 1 
ATOM   5550  C CZ  . PHE G  1 98  ? 97.858  123.000 120.256 1.00 39.39  ? 98   PHE G CZ  1 
ATOM   5551  N N   . GLY G  1 99  ? 102.245 124.545 124.840 1.00 34.35  ? 99   GLY G N   1 
ATOM   5552  C CA  . GLY G  1 99  ? 103.340 125.221 125.536 1.00 33.37  ? 99   GLY G CA  1 
ATOM   5553  C C   . GLY G  1 99  ? 102.704 126.418 126.213 1.00 31.16  ? 99   GLY G C   1 
ATOM   5554  O O   . GLY G  1 99  ? 101.472 126.578 126.202 1.00 29.96  ? 99   GLY G O   1 
ATOM   5555  N N   . GLN G  1 100 ? 103.516 127.262 126.825 1.00 31.27  ? 100  GLN G N   1 
ATOM   5556  C CA  . GLN G  1 100 ? 103.063 128.628 126.999 1.00 31.82  ? 100  GLN G CA  1 
ATOM   5557  C C   . GLN G  1 100 ? 103.806 129.495 125.972 1.00 32.15  ? 100  GLN G C   1 
ATOM   5558  O O   . GLN G  1 100 ? 103.902 130.716 126.110 1.00 33.74  ? 100  GLN G O   1 
ATOM   5559  C CB  . GLN G  1 100 ? 103.112 129.128 128.465 1.00 30.94  ? 100  GLN G CB  1 
ATOM   5560  C CG  . GLN G  1 100 ? 104.384 128.859 129.302 1.00 33.37  ? 100  GLN G CG  1 
ATOM   5561  C CD  . GLN G  1 100 ? 104.458 127.427 129.864 1.00 36.34  ? 100  GLN G CD  1 
ATOM   5562  O OE1 . GLN G  1 100 ? 105.066 126.546 129.247 1.00 30.26  ? 100  GLN G OE1 1 
ATOM   5563  N NE2 . GLN G  1 100 ? 103.874 127.203 131.043 1.00 30.75  ? 100  GLN G NE2 1 
ATOM   5564  N N   . GLY G  1 101 ? 104.313 128.815 124.935 1.00 32.34  ? 101  GLY G N   1 
ATOM   5565  C CA  . GLY G  1 101 ? 104.949 129.418 123.745 1.00 31.93  ? 101  GLY G CA  1 
ATOM   5566  C C   . GLY G  1 101 ? 106.211 130.248 123.915 1.00 32.41  ? 101  GLY G C   1 
ATOM   5567  O O   . GLY G  1 101 ? 106.542 130.655 125.055 1.00 30.98  ? 101  GLY G O   1 
ATOM   5568  N N   . THR G  1 102 ? 106.916 130.518 122.806 1.00 32.36  ? 102  THR G N   1 
ATOM   5569  C CA  . THR G  1 102 ? 107.942 131.589 122.886 1.00 32.87  ? 102  THR G CA  1 
ATOM   5570  C C   . THR G  1 102 ? 107.946 132.610 121.741 1.00 32.63  ? 102  THR G C   1 
ATOM   5571  O O   . THR G  1 102 ? 108.144 132.275 120.570 1.00 32.01  ? 102  THR G O   1 
ATOM   5572  C CB  . THR G  1 102 ? 109.361 131.056 123.159 1.00 33.30  ? 102  THR G CB  1 
ATOM   5573  O OG1 . THR G  1 102 ? 109.322 130.212 124.321 1.00 37.87  ? 102  THR G OG1 1 
ATOM   5574  C CG2 . THR G  1 102 ? 110.314 132.201 123.437 1.00 25.75  ? 102  THR G CG2 1 
ATOM   5575  N N   . LYS G  1 103 ? 107.756 133.874 122.137 1.00 33.05  ? 103  LYS G N   1 
ATOM   5576  C CA  . LYS G  1 103 ? 107.651 135.013 121.219 1.00 36.75  ? 103  LYS G CA  1 
ATOM   5577  C C   . LYS G  1 103 ? 109.004 135.644 120.849 1.00 35.49  ? 103  LYS G C   1 
ATOM   5578  O O   . LYS G  1 103 ? 109.382 136.706 121.355 1.00 35.96  ? 103  LYS G O   1 
ATOM   5579  C CB  . LYS G  1 103 ? 106.651 136.058 121.754 1.00 37.29  ? 103  LYS G CB  1 
ATOM   5580  C CG  . LYS G  1 103 ? 105.167 135.658 121.576 1.00 39.48  ? 103  LYS G CG  1 
ATOM   5581  C CD  . LYS G  1 103 ? 104.199 136.750 122.053 1.00 39.75  ? 103  LYS G CD  1 
ATOM   5582  C CE  . LYS G  1 103 ? 102.746 136.482 121.541 1.00 43.26  ? 103  LYS G CE  1 
ATOM   5583  N NZ  . LYS G  1 103 ? 101.768 137.456 122.265 1.00 43.16  ? 103  LYS G NZ  1 
ATOM   5584  N N   . VAL G  1 104 ? 109.715 134.966 119.948 1.00 33.74  ? 104  VAL G N   1 
ATOM   5585  C CA  . VAL G  1 104 ? 110.939 135.483 119.347 1.00 31.52  ? 104  VAL G CA  1 
ATOM   5586  C C   . VAL G  1 104 ? 110.580 136.616 118.408 1.00 31.86  ? 104  VAL G C   1 
ATOM   5587  O O   . VAL G  1 104 ? 109.684 136.491 117.568 1.00 31.51  ? 104  VAL G O   1 
ATOM   5588  C CB  . VAL G  1 104 ? 111.700 134.403 118.530 1.00 32.48  ? 104  VAL G CB  1 
ATOM   5589  C CG1 . VAL G  1 104 ? 112.981 134.992 117.909 1.00 25.10  ? 104  VAL G CG1 1 
ATOM   5590  C CG2 . VAL G  1 104 ? 112.031 133.187 119.380 1.00 29.27  ? 104  VAL G CG2 1 
ATOM   5591  N N   . GLU G  1 105 ? 111.286 137.729 118.571 1.00 32.82  ? 105  GLU G N   1 
ATOM   5592  C CA  . GLU G  1 105 ? 111.141 138.872 117.689 1.00 33.96  ? 105  GLU G CA  1 
ATOM   5593  C C   . GLU G  1 105 ? 112.493 139.512 117.374 1.00 35.69  ? 105  GLU G C   1 
ATOM   5594  O O   . GLU G  1 105 ? 113.325 139.770 118.262 1.00 36.01  ? 105  GLU G O   1 
ATOM   5595  C CB  . GLU G  1 105 ? 110.121 139.885 118.234 1.00 33.96  ? 105  GLU G CB  1 
ATOM   5596  C CG  . GLU G  1 105 ? 110.590 140.756 119.394 1.00 35.61  ? 105  GLU G CG  1 
ATOM   5597  C CD  . GLU G  1 105 ? 111.171 142.103 118.940 1.00 36.76  ? 105  GLU G CD  1 
ATOM   5598  O OE1 . GLU G  1 105 ? 111.867 142.175 117.902 1.00 40.34  ? 105  GLU G OE1 1 
ATOM   5599  O OE2 . GLU G  1 105 ? 110.927 143.105 119.644 1.00 31.49  ? 105  GLU G OE2 1 
ATOM   5600  N N   . ILE G  1 106 ? 112.670 139.747 116.073 1.00 37.05  ? 106  ILE G N   1 
ATOM   5601  C CA  . ILE G  1 106 ? 113.848 140.351 115.460 1.00 36.73  ? 106  ILE G CA  1 
ATOM   5602  C C   . ILE G  1 106 ? 113.731 141.872 115.511 1.00 38.82  ? 106  ILE G C   1 
ATOM   5603  O O   . ILE G  1 106 ? 114.530 142.547 116.162 1.00 41.71  ? 106  ILE G O   1 
ATOM   5604  C CB  . ILE G  1 106 ? 113.962 139.933 113.960 1.00 36.25  ? 106  ILE G CB  1 
ATOM   5605  C CG1 . ILE G  1 106 ? 114.249 138.429 113.804 1.00 33.96  ? 106  ILE G CG1 1 
ATOM   5606  C CG2 . ILE G  1 106 ? 115.050 140.734 113.233 1.00 38.62  ? 106  ILE G CG2 1 
ATOM   5607  C CD1 . ILE G  1 106 ? 112.989 137.556 113.715 1.00 18.23  ? 106  ILE G CD1 1 
ATOM   5608  N N   . ILE H  1 2   ? 97.452  103.368 105.434 1.00 55.65  ? 2    ILE H N   1 
ATOM   5609  C CA  . ILE H  1 2   ? 98.825  102.826 105.666 1.00 55.91  ? 2    ILE H CA  1 
ATOM   5610  C C   . ILE H  1 2   ? 98.824  101.314 105.906 1.00 56.33  ? 2    ILE H C   1 
ATOM   5611  O O   . ILE H  1 2   ? 98.015  100.793 106.681 1.00 56.40  ? 2    ILE H O   1 
ATOM   5612  C CB  . ILE H  1 2   ? 99.559  103.592 106.815 1.00 55.45  ? 2    ILE H CB  1 
ATOM   5613  C CG1 . ILE H  1 2   ? 100.697 104.454 106.253 1.00 53.23  ? 2    ILE H CG1 1 
ATOM   5614  C CG2 . ILE H  1 2   ? 100.127 102.641 107.864 1.00 55.61  ? 2    ILE H CG2 1 
ATOM   5615  C CD1 . ILE H  1 2   ? 100.243 105.753 105.604 1.00 51.25  ? 2    ILE H CD1 1 
ATOM   5616  N N   . GLN H  1 3   ? 99.721  100.622 105.205 1.00 56.64  ? 3    GLN H N   1 
ATOM   5617  C CA  . GLN H  1 3   ? 99.973  99.199  105.417 1.00 55.91  ? 3    GLN H CA  1 
ATOM   5618  C C   . GLN H  1 3   ? 101.419 99.039  105.863 1.00 56.44  ? 3    GLN H C   1 
ATOM   5619  O O   . GLN H  1 3   ? 102.340 99.448  105.151 1.00 57.16  ? 3    GLN H O   1 
ATOM   5620  C CB  . GLN H  1 3   ? 99.732  98.400  104.129 1.00 54.88  ? 3    GLN H CB  1 
ATOM   5621  C CG  . GLN H  1 3   ? 98.263  98.206  103.751 1.00 54.26  ? 3    GLN H CG  1 
ATOM   5622  C CD  . GLN H  1 3   ? 97.626  99.446  103.125 1.00 55.29  ? 3    GLN H CD  1 
ATOM   5623  O OE1 . GLN H  1 3   ? 97.577  100.514 103.730 1.00 48.02  ? 3    GLN H OE1 1 
ATOM   5624  N NE2 . GLN H  1 3   ? 97.112  99.293  101.909 1.00 57.46  ? 3    GLN H NE2 1 
ATOM   5625  N N   . MET H  1 4   ? 101.617 98.457  107.042 1.00 56.62  ? 4    MET H N   1 
ATOM   5626  C CA  . MET H  1 4   ? 102.960 98.257  107.596 1.00 57.28  ? 4    MET H CA  1 
ATOM   5627  C C   . MET H  1 4   ? 103.526 96.905  107.136 1.00 56.71  ? 4    MET H C   1 
ATOM   5628  O O   . MET H  1 4   ? 102.836 95.888  107.226 1.00 55.72  ? 4    MET H O   1 
ATOM   5629  C CB  . MET H  1 4   ? 102.924 98.334  109.129 1.00 58.50  ? 4    MET H CB  1 
ATOM   5630  C CG  . MET H  1 4   ? 102.326 99.623  109.715 1.00 61.38  ? 4    MET H CG  1 
ATOM   5631  S SD  . MET H  1 4   ? 103.546 100.873 110.192 1.00 69.74  ? 4    MET H SD  1 
ATOM   5632  C CE  . MET H  1 4   ? 103.582 101.965 108.739 1.00 64.88  ? 4    MET H CE  1 
ATOM   5633  N N   . THR H  1 5   ? 104.766 96.894  106.635 1.00 56.28  ? 5    THR H N   1 
ATOM   5634  C CA  . THR H  1 5   ? 105.370 95.655  106.096 1.00 55.07  ? 5    THR H CA  1 
ATOM   5635  C C   . THR H  1 5   ? 106.640 95.182  106.840 1.00 54.01  ? 5    THR H C   1 
ATOM   5636  O O   . THR H  1 5   ? 107.655 95.879  106.901 1.00 53.91  ? 5    THR H O   1 
ATOM   5637  C CB  . THR H  1 5   ? 105.574 95.704  104.549 1.00 55.66  ? 5    THR H CB  1 
ATOM   5638  O OG1 . THR H  1 5   ? 106.634 96.616  104.220 1.00 54.64  ? 5    THR H OG1 1 
ATOM   5639  C CG2 . THR H  1 5   ? 104.290 96.130  103.830 1.00 54.32  ? 5    THR H CG2 1 
ATOM   5640  N N   . GLN H  1 6   ? 106.559 93.948  107.340 1.00 52.74  ? 6    GLN H N   1 
ATOM   5641  C CA  . GLN H  1 6   ? 107.300 93.488  108.513 1.00 51.83  ? 6    GLN H CA  1 
ATOM   5642  C C   . GLN H  1 6   ? 108.127 92.209  108.293 1.00 51.30  ? 6    GLN H C   1 
ATOM   5643  O O   . GLN H  1 6   ? 107.574 91.125  108.077 1.00 50.37  ? 6    GLN H O   1 
ATOM   5644  C CB  . GLN H  1 6   ? 106.263 93.256  109.614 1.00 51.44  ? 6    GLN H CB  1 
ATOM   5645  C CG  . GLN H  1 6   ? 106.707 93.312  111.060 1.00 50.75  ? 6    GLN H CG  1 
ATOM   5646  C CD  . GLN H  1 6   ? 105.497 93.355  111.988 1.00 52.20  ? 6    GLN H CD  1 
ATOM   5647  O OE1 . GLN H  1 6   ? 104.742 94.324  111.989 1.00 45.61  ? 6    GLN H OE1 1 
ATOM   5648  N NE2 . GLN H  1 6   ? 105.302 92.290  112.767 1.00 54.76  ? 6    GLN H NE2 1 
ATOM   5649  N N   . SER H  1 7   ? 109.450 92.398  108.297 1.00 49.12  ? 7    SER H N   1 
ATOM   5650  C CA  . SER H  1 7   ? 110.498 91.364  108.471 1.00 48.34  ? 7    SER H CA  1 
ATOM   5651  C C   . SER H  1 7   ? 110.143 89.908  108.800 1.00 48.24  ? 7    SER H C   1 
ATOM   5652  O O   . SER H  1 7   ? 108.964 89.532  108.836 1.00 47.25  ? 7    SER H O   1 
ATOM   5653  C CB  . SER H  1 7   ? 111.468 91.852  109.542 1.00 48.07  ? 7    SER H CB  1 
ATOM   5654  O OG  . SER H  1 7   ? 110.922 91.603  110.854 1.00 45.77  ? 7    SER H OG  1 
ATOM   5655  N N   . PRO H  1 8   ? 111.186 89.087  109.067 1.00 48.53  ? 8    PRO H N   1 
ATOM   5656  C CA  . PRO H  1 8   ? 111.046 87.699  109.444 1.00 48.99  ? 8    PRO H CA  1 
ATOM   5657  C C   . PRO H  1 8   ? 109.635 87.339  109.914 1.00 48.43  ? 8    PRO H C   1 
ATOM   5658  O O   . PRO H  1 8   ? 109.245 87.707  111.022 1.00 51.18  ? 8    PRO H O   1 
ATOM   5659  C CB  . PRO H  1 8   ? 112.051 87.594  110.589 1.00 49.27  ? 8    PRO H CB  1 
ATOM   5660  C CG  . PRO H  1 8   ? 113.168 88.585  110.187 1.00 47.84  ? 8    PRO H CG  1 
ATOM   5661  C CD  . PRO H  1 8   ? 112.617 89.450  109.069 1.00 47.96  ? 8    PRO H CD  1 
ATOM   5662  N N   . SER H  1 9   ? 108.880 86.638  109.067 1.00 47.58  ? 9    SER H N   1 
ATOM   5663  C CA  . SER H  1 9   ? 107.465 86.321  109.335 1.00 46.47  ? 9    SER H CA  1 
ATOM   5664  C C   . SER H  1 9   ? 107.216 85.407  110.536 1.00 46.05  ? 9    SER H C   1 
ATOM   5665  O O   . SER H  1 9   ? 106.325 85.675  111.342 1.00 44.77  ? 9    SER H O   1 
ATOM   5666  C CB  . SER H  1 9   ? 106.795 85.740  108.087 1.00 46.32  ? 9    SER H CB  1 
ATOM   5667  O OG  . SER H  1 9   ? 105.732 84.852  108.427 1.00 46.74  ? 9    SER H OG  1 
ATOM   5668  N N   . SER H  1 10  ? 107.962 84.311  110.629 1.00 45.40  ? 10   SER H N   1 
ATOM   5669  C CA  . SER H  1 10  ? 107.911 83.476  111.821 1.00 44.73  ? 10   SER H CA  1 
ATOM   5670  C C   . SER H  1 10  ? 109.312 83.111  112.275 1.00 44.35  ? 10   SER H C   1 
ATOM   5671  O O   . SER H  1 10  ? 110.143 82.627  111.499 1.00 43.20  ? 10   SER H O   1 
ATOM   5672  C CB  . SER H  1 10  ? 107.041 82.229  111.618 1.00 45.35  ? 10   SER H CB  1 
ATOM   5673  O OG  . SER H  1 10  ? 107.604 81.361  110.651 1.00 47.79  ? 10   SER H OG  1 
ATOM   5674  N N   . LEU H  1 11  ? 109.543 83.369  113.557 1.00 44.07  ? 11   LEU H N   1 
ATOM   5675  C CA  . LEU H  1 11  ? 110.831 83.201  114.198 1.00 42.99  ? 11   LEU H CA  1 
ATOM   5676  C C   . LEU H  1 11  ? 110.877 81.967  115.078 1.00 43.99  ? 11   LEU H C   1 
ATOM   5677  O O   . LEU H  1 11  ? 110.042 81.789  115.973 1.00 43.91  ? 11   LEU H O   1 
ATOM   5678  C CB  . LEU H  1 11  ? 111.129 84.417  115.072 1.00 43.35  ? 11   LEU H CB  1 
ATOM   5679  C CG  . LEU H  1 11  ? 111.925 85.599  114.511 1.00 40.99  ? 11   LEU H CG  1 
ATOM   5680  C CD1 . LEU H  1 11  ? 111.807 86.797  115.527 1.00 38.92  ? 11   LEU H CD1 1 
ATOM   5681  C CD2 . LEU H  1 11  ? 113.399 85.152  114.285 1.00 35.71  ? 11   LEU H CD2 1 
ATOM   5682  N N   . SER H  1 12  ? 111.866 81.124  114.818 1.00 44.57  ? 12   SER H N   1 
ATOM   5683  C CA  . SER H  1 12  ? 112.209 80.040  115.712 1.00 43.22  ? 12   SER H CA  1 
ATOM   5684  C C   . SER H  1 12  ? 113.656 80.251  116.156 1.00 43.45  ? 12   SER H C   1 
ATOM   5685  O O   . SER H  1 12  ? 114.572 80.098  115.353 1.00 45.02  ? 12   SER H O   1 
ATOM   5686  C CB  . SER H  1 12  ? 112.048 78.701  114.984 1.00 42.62  ? 12   SER H CB  1 
ATOM   5687  O OG  . SER H  1 12  ? 112.612 77.626  115.722 1.00 44.42  ? 12   SER H OG  1 
ATOM   5688  N N   . ALA H  1 13  ? 113.869 80.614  117.424 1.00 43.45  ? 13   ALA H N   1 
ATOM   5689  C CA  . ALA H  1 13  ? 115.241 80.794  117.947 1.00 43.45  ? 13   ALA H CA  1 
ATOM   5690  C C   . ALA H  1 13  ? 115.541 79.931  119.185 1.00 41.37  ? 13   ALA H C   1 
ATOM   5691  O O   . ALA H  1 13  ? 114.722 79.101  119.578 1.00 41.45  ? 13   ALA H O   1 
ATOM   5692  C CB  . ALA H  1 13  ? 115.520 82.288  118.232 1.00 42.62  ? 13   ALA H CB  1 
ATOM   5693  N N   . SER H  1 14  ? 116.718 80.132  119.785 1.00 38.86  ? 14   SER H N   1 
ATOM   5694  C CA  . SER H  1 14  ? 117.175 79.360  120.954 1.00 37.32  ? 14   SER H CA  1 
ATOM   5695  C C   . SER H  1 14  ? 117.478 80.293  122.135 1.00 36.69  ? 14   SER H C   1 
ATOM   5696  O O   . SER H  1 14  ? 117.801 81.463  121.920 1.00 35.43  ? 14   SER H O   1 
ATOM   5697  C CB  . SER H  1 14  ? 118.425 78.555  120.582 1.00 37.65  ? 14   SER H CB  1 
ATOM   5698  O OG  . SER H  1 14  ? 118.193 77.755  119.427 1.00 34.76  ? 14   SER H OG  1 
ATOM   5699  N N   . VAL H  1 15  ? 117.376 79.789  123.370 1.00 36.21  ? 15   VAL H N   1 
ATOM   5700  C CA  . VAL H  1 15  ? 117.528 80.657  124.551 1.00 35.33  ? 15   VAL H CA  1 
ATOM   5701  C C   . VAL H  1 15  ? 118.865 81.387  124.527 1.00 36.19  ? 15   VAL H C   1 
ATOM   5702  O O   . VAL H  1 15  ? 119.935 80.759  124.542 1.00 37.08  ? 15   VAL H O   1 
ATOM   5703  C CB  . VAL H  1 15  ? 117.402 79.921  125.911 1.00 34.98  ? 15   VAL H CB  1 
ATOM   5704  C CG1 . VAL H  1 15  ? 116.748 80.817  126.950 1.00 29.50  ? 15   VAL H CG1 1 
ATOM   5705  C CG2 . VAL H  1 15  ? 116.710 78.547  125.770 1.00 35.36  ? 15   VAL H CG2 1 
ATOM   5706  N N   . GLY H  1 16  ? 118.789 82.713  124.467 1.00 35.71  ? 16   GLY H N   1 
ATOM   5707  C CA  . GLY H  1 16  ? 119.989 83.533  124.592 1.00 36.10  ? 16   GLY H CA  1 
ATOM   5708  C C   . GLY H  1 16  ? 120.470 84.238  123.336 1.00 36.89  ? 16   GLY H C   1 
ATOM   5709  O O   . GLY H  1 16  ? 121.547 84.837  123.353 1.00 37.59  ? 16   GLY H O   1 
ATOM   5710  N N   . ASP H  1 17  ? 119.704 84.193  122.250 1.00 35.73  ? 17   ASP H N   1 
ATOM   5711  C CA  . ASP H  1 17  ? 120.180 84.805  121.002 1.00 38.77  ? 17   ASP H CA  1 
ATOM   5712  C C   . ASP H  1 17  ? 119.704 86.237  120.771 1.00 40.51  ? 17   ASP H C   1 
ATOM   5713  O O   . ASP H  1 17  ? 118.818 86.735  121.466 1.00 41.59  ? 17   ASP H O   1 
ATOM   5714  C CB  . ASP H  1 17  ? 119.781 83.960  119.785 1.00 40.24  ? 17   ASP H CB  1 
ATOM   5715  C CG  . ASP H  1 17  ? 120.442 82.601  119.782 1.00 43.02  ? 17   ASP H CG  1 
ATOM   5716  O OD1 . ASP H  1 17  ? 121.689 82.527  119.897 1.00 43.53  ? 17   ASP H OD1 1 
ATOM   5717  O OD2 . ASP H  1 17  ? 119.701 81.597  119.646 1.00 46.53  ? 17   ASP H OD2 1 
ATOM   5718  N N   . ARG H  1 18  ? 120.301 86.876  119.765 1.00 40.71  ? 18   ARG H N   1 
ATOM   5719  C CA  . ARG H  1 18  ? 119.830 88.165  119.280 1.00 41.08  ? 18   ARG H CA  1 
ATOM   5720  C C   . ARG H  1 18  ? 118.834 88.000  118.131 1.00 43.25  ? 18   ARG H C   1 
ATOM   5721  O O   . ARG H  1 18  ? 119.192 87.612  117.014 1.00 44.55  ? 18   ARG H O   1 
ATOM   5722  C CB  . ARG H  1 18  ? 120.990 89.058  118.859 1.00 39.63  ? 18   ARG H CB  1 
ATOM   5723  C CG  . ARG H  1 18  ? 120.659 90.527  118.963 1.00 34.95  ? 18   ARG H CG  1 
ATOM   5724  C CD  . ARG H  1 18  ? 120.919 91.203  117.640 1.00 24.21  ? 18   ARG H CD  1 
ATOM   5725  N NE  . ARG H  1 18  ? 121.157 92.634  117.802 1.00 21.53  ? 18   ARG H NE  1 
ATOM   5726  C CZ  . ARG H  1 18  ? 122.348 93.169  118.056 1.00 34.08  ? 18   ARG H CZ  1 
ATOM   5727  N NH1 . ARG H  1 18  ? 123.425 92.394  118.179 1.00 40.74  ? 18   ARG H NH1 1 
ATOM   5728  N NH2 . ARG H  1 18  ? 122.465 94.485  118.186 1.00 31.60  ? 18   ARG H NH2 1 
ATOM   5729  N N   . VAL H  1 19  ? 117.580 88.312  118.446 1.00 44.39  ? 19   VAL H N   1 
ATOM   5730  C CA  . VAL H  1 19  ? 116.446 88.182  117.545 1.00 44.57  ? 19   VAL H CA  1 
ATOM   5731  C C   . VAL H  1 19  ? 116.048 89.559  117.007 1.00 45.68  ? 19   VAL H C   1 
ATOM   5732  O O   . VAL H  1 19  ? 115.604 90.419  117.769 1.00 45.49  ? 19   VAL H O   1 
ATOM   5733  C CB  . VAL H  1 19  ? 115.245 87.545  118.291 1.00 44.25  ? 19   VAL H CB  1 
ATOM   5734  C CG1 . VAL H  1 19  ? 113.967 87.676  117.492 1.00 41.93  ? 19   VAL H CG1 1 
ATOM   5735  C CG2 . VAL H  1 19  ? 115.527 86.076  118.618 1.00 43.75  ? 19   VAL H CG2 1 
ATOM   5736  N N   . THR H  1 20  ? 116.211 89.756  115.698 1.00 45.96  ? 20   THR H N   1 
ATOM   5737  C CA  . THR H  1 20  ? 115.855 91.008  115.027 1.00 46.18  ? 20   THR H CA  1 
ATOM   5738  C C   . THR H  1 20  ? 114.557 90.851  114.218 1.00 47.65  ? 20   THR H C   1 
ATOM   5739  O O   . THR H  1 20  ? 114.515 90.091  113.251 1.00 48.95  ? 20   THR H O   1 
ATOM   5740  C CB  . THR H  1 20  ? 117.013 91.487  114.093 1.00 46.15  ? 20   THR H CB  1 
ATOM   5741  O OG1 . THR H  1 20  ? 118.191 91.749  114.868 1.00 45.60  ? 20   THR H OG1 1 
ATOM   5742  C CG2 . THR H  1 20  ? 116.629 92.743  113.332 1.00 41.69  ? 20   THR H CG2 1 
ATOM   5743  N N   . ILE H  1 21  ? 113.505 91.559  114.629 1.00 48.32  ? 21   ILE H N   1 
ATOM   5744  C CA  . ILE H  1 21  ? 112.307 91.712  113.804 1.00 47.61  ? 21   ILE H CA  1 
ATOM   5745  C C   . ILE H  1 21  ? 112.287 93.153  113.318 1.00 49.58  ? 21   ILE H C   1 
ATOM   5746  O O   . ILE H  1 21  ? 112.160 94.084  114.123 1.00 49.29  ? 21   ILE H O   1 
ATOM   5747  C CB  . ILE H  1 21  ? 110.986 91.455  114.583 1.00 47.94  ? 21   ILE H CB  1 
ATOM   5748  C CG1 . ILE H  1 21  ? 111.213 90.520  115.812 1.00 42.27  ? 21   ILE H CG1 1 
ATOM   5749  C CG2 . ILE H  1 21  ? 109.890 90.972  113.624 1.00 44.86  ? 21   ILE H CG2 1 
ATOM   5750  C CD1 . ILE H  1 21  ? 109.889 90.111  116.486 1.00 37.78  ? 21   ILE H CD1 1 
ATOM   5751  N N   . THR H  1 22  ? 112.433 93.335  112.008 1.00 50.92  ? 22   THR H N   1 
ATOM   5752  C CA  . THR H  1 22  ? 112.298 94.649  111.386 1.00 51.49  ? 22   THR H CA  1 
ATOM   5753  C C   . THR H  1 22  ? 110.832 94.923  111.079 1.00 51.97  ? 22   THR H C   1 
ATOM   5754  O O   . THR H  1 22  ? 109.967 94.053  111.241 1.00 52.12  ? 22   THR H O   1 
ATOM   5755  C CB  . THR H  1 22  ? 113.060 94.737  110.033 1.00 51.78  ? 22   THR H CB  1 
ATOM   5756  O OG1 . THR H  1 22  ? 114.027 93.669  109.925 1.00 52.34  ? 22   THR H OG1 1 
ATOM   5757  C CG2 . THR H  1 22  ? 113.756 96.079  109.867 1.00 49.72  ? 22   THR H CG2 1 
ATOM   5758  N N   . CYS H  1 23  ? 110.574 96.152  110.641 1.00 52.46  ? 23   CYS H N   1 
ATOM   5759  C CA  . CYS H  1 23  ? 109.327 96.544  109.995 1.00 52.21  ? 23   CYS H CA  1 
ATOM   5760  C C   . CYS H  1 23  ? 109.631 97.660  108.988 1.00 51.86  ? 23   CYS H C   1 
ATOM   5761  O O   . CYS H  1 23  ? 110.563 98.447  109.188 1.00 52.47  ? 23   CYS H O   1 
ATOM   5762  C CB  . CYS H  1 23  ? 108.307 97.033  111.025 1.00 53.30  ? 23   CYS H CB  1 
ATOM   5763  S SG  . CYS H  1 23  ? 106.836 97.809  110.306 1.00 52.85  ? 23   CYS H SG  1 
ATOM   5764  N N   . ARG H  1 24  ? 108.838 97.714  107.908 1.00 52.29  ? 24   ARG H N   1 
ATOM   5765  C CA  . ARG H  1 24  ? 108.914 98.795  106.903 1.00 53.38  ? 24   ARG H CA  1 
ATOM   5766  C C   . ARG H  1 24  ? 107.651 99.678  106.834 1.00 53.18  ? 24   ARG H C   1 
ATOM   5767  O O   . ARG H  1 24  ? 106.563 99.215  107.229 1.00 53.13  ? 24   ARG H O   1 
ATOM   5768  C CB  . ARG H  1 24  ? 109.213 98.210  105.520 1.00 52.43  ? 24   ARG H CB  1 
ATOM   5769  C CG  . ARG H  1 24  ? 110.633 98.428  105.103 1.00 53.41  ? 24   ARG H CG  1 
ATOM   5770  C CD  . ARG H  1 24  ? 110.985 99.853  105.475 1.00 51.74  ? 24   ARG H CD  1 
ATOM   5771  N NE  . ARG H  1 24  ? 112.084 100.381 104.689 1.00 54.07  ? 24   ARG H NE  1 
ATOM   5772  C CZ  . ARG H  1 24  ? 111.944 100.865 103.458 1.00 59.67  ? 24   ARG H CZ  1 
ATOM   5773  N NH1 . ARG H  1 24  ? 110.749 100.884 102.862 1.00 59.53  ? 24   ARG H NH1 1 
ATOM   5774  N NH2 . ARG H  1 24  ? 113.004 101.333 102.814 1.00 63.54  ? 24   ARG H NH2 1 
ATOM   5775  N N   . ALA H  1 25  ? 107.789 100.928 106.330 1.00 53.13  ? 25   ALA H N   1 
ATOM   5776  C CA  . ALA H  1 25  ? 106.636 101.872 106.264 1.00 53.12  ? 25   ALA H CA  1 
ATOM   5777  C C   . ALA H  1 25  ? 106.369 102.500 104.877 1.00 53.09  ? 25   ALA H C   1 
ATOM   5778  O O   . ALA H  1 25  ? 107.270 102.572 104.039 1.00 54.03  ? 25   ALA H O   1 
ATOM   5779  C CB  . ALA H  1 25  ? 106.767 102.968 107.327 1.00 52.63  ? 25   ALA H CB  1 
ATOM   5780  N N   . SER H  1 26  ? 105.126 102.951 104.661 1.00 52.30  ? 26   SER H N   1 
ATOM   5781  C CA  . SER H  1 26  ? 104.674 103.547 103.387 1.00 50.77  ? 26   SER H CA  1 
ATOM   5782  C C   . SER H  1 26  ? 104.634 105.077 103.484 1.00 51.00  ? 26   SER H C   1 
ATOM   5783  O O   . SER H  1 26  ? 103.675 105.660 104.034 1.00 52.37  ? 26   SER H O   1 
ATOM   5784  C CB  . SER H  1 26  ? 103.283 103.028 103.009 1.00 49.28  ? 26   SER H CB  1 
ATOM   5785  O OG  . SER H  1 26  ? 103.001 101.780 103.636 1.00 49.39  ? 26   SER H OG  1 
ATOM   5786  N N   . GLN H  1 27  ? 105.665 105.712 102.915 1.00 49.77  ? 27   GLN H N   1 
ATOM   5787  C CA  . GLN H  1 27  ? 106.080 107.103 103.212 1.00 47.97  ? 27   GLN H CA  1 
ATOM   5788  C C   . GLN H  1 27  ? 106.396 107.354 104.688 1.00 47.68  ? 27   GLN H C   1 
ATOM   5789  O O   . GLN H  1 27  ? 105.814 106.740 105.581 1.00 48.49  ? 27   GLN H O   1 
ATOM   5790  C CB  . GLN H  1 27  ? 105.120 108.180 102.660 1.00 47.22  ? 27   GLN H CB  1 
ATOM   5791  C CG  . GLN H  1 27  ? 105.648 108.964 101.430 1.00 47.44  ? 27   GLN H CG  1 
ATOM   5792  C CD  . GLN H  1 27  ? 106.765 109.984 101.758 1.00 44.22  ? 27   GLN H CD  1 
ATOM   5793  O OE1 . GLN H  1 27  ? 107.912 109.616 102.094 1.00 41.29  ? 27   GLN H OE1 1 
ATOM   5794  N NE2 . GLN H  1 27  ? 106.445 111.270 101.642 1.00 31.21  ? 27   GLN H NE2 1 
ATOM   5795  N N   . SER H  1 28  ? 107.343 108.261 104.902 1.00 45.65  ? 28   SER H N   1 
ATOM   5796  C CA  . SER H  1 28  ? 107.812 108.705 106.215 1.00 44.95  ? 28   SER H CA  1 
ATOM   5797  C C   . SER H  1 28  ? 106.717 108.727 107.314 1.00 45.42  ? 28   SER H C   1 
ATOM   5798  O O   . SER H  1 28  ? 105.696 109.403 107.147 1.00 45.56  ? 28   SER H O   1 
ATOM   5799  C CB  . SER H  1 28  ? 108.447 110.095 106.028 1.00 44.18  ? 28   SER H CB  1 
ATOM   5800  O OG  . SER H  1 28  ? 109.110 110.550 107.212 1.00 41.08  ? 28   SER H OG  1 
ATOM   5801  N N   . ILE H  1 29  ? 106.922 107.977 108.412 1.00 46.49  ? 29   ILE H N   1 
ATOM   5802  C CA  . ILE H  1 29  ? 105.949 107.915 109.542 1.00 45.81  ? 29   ILE H CA  1 
ATOM   5803  C C   . ILE H  1 29  ? 106.555 108.325 110.901 1.00 47.37  ? 29   ILE H C   1 
ATOM   5804  O O   . ILE H  1 29  ? 106.075 107.921 111.975 1.00 46.06  ? 29   ILE H O   1 
ATOM   5805  C CB  . ILE H  1 29  ? 105.227 106.520 109.673 1.00 45.52  ? 29   ILE H CB  1 
ATOM   5806  C CG1 . ILE H  1 29  ? 106.159 105.459 110.302 1.00 45.38  ? 29   ILE H CG1 1 
ATOM   5807  C CG2 . ILE H  1 29  ? 104.637 106.052 108.312 1.00 45.88  ? 29   ILE H CG2 1 
ATOM   5808  C CD1 . ILE H  1 29  ? 105.392 104.368 111.076 1.00 38.84  ? 29   ILE H CD1 1 
ATOM   5809  N N   . SER H  1 30  ? 107.598 109.154 110.817 1.00 48.38  ? 30   SER H N   1 
ATOM   5810  C CA  . SER H  1 30  ? 108.366 109.641 111.968 1.00 48.72  ? 30   SER H CA  1 
ATOM   5811  C C   . SER H  1 30  ? 108.624 108.611 113.059 1.00 50.32  ? 30   SER H C   1 
ATOM   5812  O O   . SER H  1 30  ? 109.062 107.490 112.795 1.00 48.99  ? 30   SER H O   1 
ATOM   5813  C CB  . SER H  1 30  ? 107.694 110.877 112.576 1.00 49.25  ? 30   SER H CB  1 
ATOM   5814  O OG  . SER H  1 30  ? 108.522 111.483 113.561 1.00 45.59  ? 30   SER H OG  1 
ATOM   5815  N N   . SER H  1 31  ? 108.337 109.026 114.288 1.00 51.14  ? 31   SER H N   1 
ATOM   5816  C CA  . SER H  1 31  ? 108.568 108.233 115.477 1.00 53.64  ? 31   SER H CA  1 
ATOM   5817  C C   . SER H  1 31  ? 107.245 107.664 115.989 1.00 53.28  ? 31   SER H C   1 
ATOM   5818  O O   . SER H  1 31  ? 107.072 107.442 117.190 1.00 53.45  ? 31   SER H O   1 
ATOM   5819  C CB  . SER H  1 31  ? 109.240 109.097 116.549 1.00 54.54  ? 31   SER H CB  1 
ATOM   5820  O OG  . SER H  1 31  ? 110.277 109.896 115.994 1.00 58.24  ? 31   SER H OG  1 
ATOM   5821  N N   . TYR H  1 32  ? 106.308 107.422 115.079 1.00 53.51  ? 32   TYR H N   1 
ATOM   5822  C CA  . TYR H  1 32  ? 104.987 106.942 115.477 1.00 52.91  ? 32   TYR H CA  1 
ATOM   5823  C C   . TYR H  1 32  ? 104.730 105.485 115.094 1.00 52.52  ? 32   TYR H C   1 
ATOM   5824  O O   . TYR H  1 32  ? 103.588 105.056 114.908 1.00 53.37  ? 32   TYR H O   1 
ATOM   5825  C CB  . TYR H  1 32  ? 103.901 107.925 115.026 1.00 52.82  ? 32   TYR H CB  1 
ATOM   5826  C CG  . TYR H  1 32  ? 104.094 109.277 115.684 1.00 53.41  ? 32   TYR H CG  1 
ATOM   5827  C CD1 . TYR H  1 32  ? 104.182 110.445 114.932 1.00 51.14  ? 32   TYR H CD1 1 
ATOM   5828  C CD2 . TYR H  1 32  ? 104.237 109.376 117.068 1.00 51.96  ? 32   TYR H CD2 1 
ATOM   5829  C CE1 . TYR H  1 32  ? 104.378 111.683 115.549 1.00 53.63  ? 32   TYR H CE1 1 
ATOM   5830  C CE2 . TYR H  1 32  ? 104.437 110.600 117.688 1.00 50.14  ? 32   TYR H CE2 1 
ATOM   5831  C CZ  . TYR H  1 32  ? 104.503 111.748 116.928 1.00 53.77  ? 32   TYR H CZ  1 
ATOM   5832  O OH  . TYR H  1 32  ? 104.698 112.962 117.546 1.00 56.75  ? 32   TYR H OH  1 
ATOM   5833  N N   . LEU H  1 33  ? 105.830 104.741 114.995 1.00 51.85  ? 33   LEU H N   1 
ATOM   5834  C CA  . LEU H  1 33  ? 105.815 103.287 114.998 1.00 50.28  ? 33   LEU H CA  1 
ATOM   5835  C C   . LEU H  1 33  ? 105.780 102.830 116.458 1.00 48.99  ? 33   LEU H C   1 
ATOM   5836  O O   . LEU H  1 33  ? 106.285 103.521 117.351 1.00 49.66  ? 33   LEU H O   1 
ATOM   5837  C CB  . LEU H  1 33  ? 107.071 102.741 114.270 1.00 50.07  ? 33   LEU H CB  1 
ATOM   5838  C CG  . LEU H  1 33  ? 107.340 101.225 114.345 1.00 49.80  ? 33   LEU H CG  1 
ATOM   5839  C CD1 . LEU H  1 33  ? 107.438 100.577 112.965 1.00 45.93  ? 33   LEU H CD1 1 
ATOM   5840  C CD2 . LEU H  1 33  ? 108.580 100.964 115.200 1.00 37.00  ? 33   LEU H CD2 1 
ATOM   5841  N N   . ASN H  1 34  ? 105.161 101.678 116.693 1.00 46.80  ? 34   ASN H N   1 
ATOM   5842  C CA  . ASN H  1 34  ? 105.199 101.046 118.001 1.00 44.28  ? 34   ASN H CA  1 
ATOM   5843  C C   . ASN H  1 34  ? 105.468 99.568  117.826 1.00 43.26  ? 34   ASN H C   1 
ATOM   5844  O O   . ASN H  1 34  ? 105.270 99.000  116.739 1.00 42.49  ? 34   ASN H O   1 
ATOM   5845  C CB  . ASN H  1 34  ? 103.882 101.227 118.742 1.00 43.63  ? 34   ASN H CB  1 
ATOM   5846  C CG  . ASN H  1 34  ? 103.360 102.629 118.648 1.00 47.71  ? 34   ASN H CG  1 
ATOM   5847  O OD1 . ASN H  1 34  ? 102.482 102.921 117.837 1.00 51.83  ? 34   ASN H OD1 1 
ATOM   5848  N ND2 . ASN H  1 34  ? 103.910 103.523 119.462 1.00 46.61  ? 34   ASN H ND2 1 
ATOM   5849  N N   . TRP H  1 35  ? 105.914 98.953  118.916 1.00 40.92  ? 35   TRP H N   1 
ATOM   5850  C CA  . TRP H  1 35  ? 106.232 97.546  118.958 1.00 37.43  ? 35   TRP H CA  1 
ATOM   5851  C C   . TRP H  1 35  ? 105.494 96.980  120.116 1.00 36.67  ? 35   TRP H C   1 
ATOM   5852  O O   . TRP H  1 35  ? 105.755 97.320  121.273 1.00 39.18  ? 35   TRP H O   1 
ATOM   5853  C CB  . TRP H  1 35  ? 107.722 97.337  119.173 1.00 37.55  ? 35   TRP H CB  1 
ATOM   5854  C CG  . TRP H  1 35  ? 108.400 97.499  117.929 1.00 35.00  ? 35   TRP H CG  1 
ATOM   5855  C CD1 . TRP H  1 35  ? 109.020 98.619  117.480 1.00 37.13  ? 35   TRP H CD1 1 
ATOM   5856  C CD2 . TRP H  1 35  ? 108.466 96.541  116.878 1.00 39.28  ? 35   TRP H CD2 1 
ATOM   5857  N NE1 . TRP H  1 35  ? 109.510 98.410  116.214 1.00 40.81  ? 35   TRP H NE1 1 
ATOM   5858  C CE2 . TRP H  1 35  ? 109.176 97.143  115.817 1.00 35.51  ? 35   TRP H CE2 1 
ATOM   5859  C CE3 . TRP H  1 35  ? 108.010 95.221  116.733 1.00 38.57  ? 35   TRP H CE3 1 
ATOM   5860  C CZ2 . TRP H  1 35  ? 109.452 96.469  114.627 1.00 34.85  ? 35   TRP H CZ2 1 
ATOM   5861  C CZ3 . TRP H  1 35  ? 108.277 94.551  115.549 1.00 35.55  ? 35   TRP H CZ3 1 
ATOM   5862  C CH2 . TRP H  1 35  ? 108.995 95.178  114.510 1.00 38.28  ? 35   TRP H CH2 1 
ATOM   5863  N N   . TYR H  1 36  ? 104.541 96.124  119.791 1.00 35.95  ? 36   TYR H N   1 
ATOM   5864  C CA  . TYR H  1 36  ? 103.799 95.454  120.807 1.00 34.04  ? 36   TYR H CA  1 
ATOM   5865  C C   . TYR H  1 36  ? 104.322 94.051  120.746 1.00 33.21  ? 36   TYR H C   1 
ATOM   5866  O O   . TYR H  1 36  ? 104.893 93.618  119.739 1.00 29.15  ? 36   TYR H O   1 
ATOM   5867  C CB  . TYR H  1 36  ? 102.318 95.427  120.462 1.00 35.40  ? 36   TYR H CB  1 
ATOM   5868  C CG  . TYR H  1 36  ? 101.647 96.773  120.378 1.00 33.48  ? 36   TYR H CG  1 
ATOM   5869  C CD1 . TYR H  1 36  ? 102.034 97.705  119.417 1.00 36.03  ? 36   TYR H CD1 1 
ATOM   5870  C CD2 . TYR H  1 36  ? 100.594 97.101  121.231 1.00 33.78  ? 36   TYR H CD2 1 
ATOM   5871  C CE1 . TYR H  1 36  ? 101.407 98.933  119.323 1.00 40.05  ? 36   TYR H CE1 1 
ATOM   5872  C CE2 . TYR H  1 36  ? 99.957  98.333  121.144 1.00 33.06  ? 36   TYR H CE2 1 
ATOM   5873  C CZ  . TYR H  1 36  ? 100.371 99.243  120.186 1.00 36.52  ? 36   TYR H CZ  1 
ATOM   5874  O OH  . TYR H  1 36  ? 99.752  100.474 120.080 1.00 39.58  ? 36   TYR H OH  1 
ATOM   5875  N N   . GLN H  1 37  ? 104.113 93.346  121.842 1.00 35.98  ? 37   GLN H N   1 
ATOM   5876  C CA  . GLN H  1 37  ? 104.380 91.938  121.942 1.00 37.32  ? 37   GLN H CA  1 
ATOM   5877  C C   . GLN H  1 37  ? 103.027 91.369  122.278 1.00 37.52  ? 37   GLN H C   1 
ATOM   5878  O O   . GLN H  1 37  ? 102.192 92.091  122.841 1.00 37.44  ? 37   GLN H O   1 
ATOM   5879  C CB  . GLN H  1 37  ? 105.322 91.698  123.124 1.00 37.67  ? 37   GLN H CB  1 
ATOM   5880  C CG  . GLN H  1 37  ? 105.024 90.403  123.852 1.00 37.64  ? 37   GLN H CG  1 
ATOM   5881  C CD  . GLN H  1 37  ? 105.849 90.193  125.097 1.00 38.99  ? 37   GLN H CD  1 
ATOM   5882  O OE1 . GLN H  1 37  ? 105.722 89.165  125.763 1.00 36.54  ? 37   GLN H OE1 1 
ATOM   5883  N NE2 . GLN H  1 37  ? 106.704 91.154  125.424 1.00 35.71  ? 37   GLN H NE2 1 
ATOM   5884  N N   . GLN H  1 38  ? 102.781 90.095  121.982 1.00 36.27  ? 38   GLN H N   1 
ATOM   5885  C CA  . GLN H  1 38  ? 101.480 89.573  122.386 1.00 38.19  ? 38   GLN H CA  1 
ATOM   5886  C C   . GLN H  1 38  ? 101.355 88.064  122.658 1.00 36.42  ? 38   GLN H C   1 
ATOM   5887  O O   . GLN H  1 38  ? 101.214 87.241  121.693 1.00 34.26  ? 38   GLN H O   1 
ATOM   5888  C CB  . GLN H  1 38  ? 100.403 90.004  121.372 1.00 37.10  ? 38   GLN H CB  1 
ATOM   5889  C CG  . GLN H  1 38  ? 99.043  89.466  121.741 1.00 40.16  ? 38   GLN H CG  1 
ATOM   5890  C CD  . GLN H  1 38  ? 98.010  89.812  120.717 1.00 40.68  ? 38   GLN H CD  1 
ATOM   5891  O OE1 . GLN H  1 38  ? 98.192  89.572  119.522 1.00 35.86  ? 38   GLN H OE1 1 
ATOM   5892  N NE2 . GLN H  1 38  ? 96.898  90.374  121.172 1.00 43.50  ? 38   GLN H NE2 1 
ATOM   5893  N N   . LYS H  1 39  ? 101.373 87.689  123.951 1.00 36.64  ? 39   LYS H N   1 
ATOM   5894  C CA  . LYS H  1 39  ? 101.133 86.287  124.341 1.00 39.17  ? 39   LYS H CA  1 
ATOM   5895  C C   . LYS H  1 39  ? 99.804  85.795  123.730 1.00 40.92  ? 39   LYS H C   1 
ATOM   5896  O O   . LYS H  1 39  ? 98.933  86.643  123.367 1.00 39.90  ? 39   LYS H O   1 
ATOM   5897  C CB  . LYS H  1 39  ? 101.143 86.123  125.880 1.00 37.51  ? 39   LYS H CB  1 
ATOM   5898  C CG  . LYS H  1 39  ? 102.486 86.458  126.563 1.00 36.53  ? 39   LYS H CG  1 
ATOM   5899  C CD  . LYS H  1 39  ? 102.357 86.292  128.080 1.00 38.47  ? 39   LYS H CD  1 
ATOM   5900  C CE  . LYS H  1 39  ? 103.473 87.012  128.842 1.00 39.36  ? 39   LYS H CE  1 
ATOM   5901  N NZ  . LYS H  1 39  ? 103.070 87.225  130.318 1.00 36.24  ? 39   LYS H NZ  1 
ATOM   5902  N N   . PRO H  1 40  ? 99.615  84.467  123.577 1.00 44.22  ? 40   PRO H N   1 
ATOM   5903  C CA  . PRO H  1 40  ? 98.430  84.004  122.834 1.00 46.06  ? 40   PRO H CA  1 
ATOM   5904  C C   . PRO H  1 40  ? 97.108  84.025  123.619 1.00 47.97  ? 40   PRO H C   1 
ATOM   5905  O O   . PRO H  1 40  ? 97.110  83.813  124.833 1.00 49.03  ? 40   PRO H O   1 
ATOM   5906  C CB  . PRO H  1 40  ? 98.800  82.562  122.446 1.00 46.31  ? 40   PRO H CB  1 
ATOM   5907  C CG  . PRO H  1 40  ? 100.265 82.365  122.860 1.00 44.04  ? 40   PRO H CG  1 
ATOM   5908  C CD  . PRO H  1 40  ? 100.455 83.336  124.001 1.00 43.50  ? 40   PRO H CD  1 
ATOM   5909  N N   . GLY H  1 41  ? 95.997  84.276  122.920 1.00 48.08  ? 41   GLY H N   1 
ATOM   5910  C CA  . GLY H  1 41  ? 94.655  84.271  123.528 1.00 49.94  ? 41   GLY H CA  1 
ATOM   5911  C C   . GLY H  1 41  ? 94.227  85.587  124.156 1.00 50.59  ? 41   GLY H C   1 
ATOM   5912  O O   . GLY H  1 41  ? 93.049  85.783  124.471 1.00 49.80  ? 41   GLY H O   1 
ATOM   5913  N N   . LYS H  1 42  ? 95.189  86.486  124.331 1.00 50.70  ? 42   LYS H N   1 
ATOM   5914  C CA  . LYS H  1 42  ? 94.954  87.753  125.011 1.00 51.00  ? 42   LYS H CA  1 
ATOM   5915  C C   . LYS H  1 42  ? 95.602  88.928  124.284 1.00 51.92  ? 42   LYS H C   1 
ATOM   5916  O O   . LYS H  1 42  ? 96.377  88.752  123.339 1.00 51.36  ? 42   LYS H O   1 
ATOM   5917  C CB  . LYS H  1 42  ? 95.440  87.672  126.464 1.00 51.29  ? 42   LYS H CB  1 
ATOM   5918  C CG  . LYS H  1 42  ? 96.480  86.579  126.716 1.00 51.71  ? 42   LYS H CG  1 
ATOM   5919  C CD  . LYS H  1 42  ? 96.887  86.512  128.177 1.00 49.09  ? 42   LYS H CD  1 
ATOM   5920  C CE  . LYS H  1 42  ? 98.060  87.436  128.453 1.00 42.35  ? 42   LYS H CE  1 
ATOM   5921  N NZ  . LYS H  1 42  ? 97.969  88.031  129.843 1.00 38.39  ? 42   LYS H NZ  1 
ATOM   5922  N N   . ALA H  1 43  ? 95.257  90.121  124.764 1.00 51.75  ? 43   ALA H N   1 
ATOM   5923  C CA  . ALA H  1 43  ? 95.659  91.421  124.226 1.00 52.02  ? 43   ALA H CA  1 
ATOM   5924  C C   . ALA H  1 43  ? 97.166  91.624  124.029 1.00 52.39  ? 43   ALA H C   1 
ATOM   5925  O O   . ALA H  1 43  ? 97.975  90.846  124.554 1.00 54.57  ? 43   ALA H O   1 
ATOM   5926  C CB  . ALA H  1 43  ? 95.106  92.513  125.139 1.00 53.51  ? 43   ALA H CB  1 
ATOM   5927  N N   . PRO H  1 44  ? 97.548  92.676  123.264 1.00 51.38  ? 44   PRO H N   1 
ATOM   5928  C CA  . PRO H  1 44  ? 98.946  93.086  123.177 1.00 50.07  ? 44   PRO H CA  1 
ATOM   5929  C C   . PRO H  1 44  ? 99.429  93.926  124.353 1.00 49.61  ? 44   PRO H C   1 
ATOM   5930  O O   . PRO H  1 44  ? 98.705  94.800  124.845 1.00 50.05  ? 44   PRO H O   1 
ATOM   5931  C CB  . PRO H  1 44  ? 98.989  93.948  121.900 1.00 48.69  ? 44   PRO H CB  1 
ATOM   5932  C CG  . PRO H  1 44  ? 97.633  93.815  121.265 1.00 49.92  ? 44   PRO H CG  1 
ATOM   5933  C CD  . PRO H  1 44  ? 96.707  93.498  122.381 1.00 50.88  ? 44   PRO H CD  1 
ATOM   5934  N N   . LYS H  1 45  ? 100.654 93.644  124.785 1.00 48.15  ? 45   LYS H N   1 
ATOM   5935  C CA  . LYS H  1 45  ? 101.408 94.575  125.613 1.00 46.32  ? 45   LYS H CA  1 
ATOM   5936  C C   . LYS H  1 45  ? 102.142 95.578  124.699 1.00 45.56  ? 45   LYS H C   1 
ATOM   5937  O O   . LYS H  1 45  ? 102.550 95.230  123.589 1.00 47.22  ? 45   LYS H O   1 
ATOM   5938  C CB  . LYS H  1 45  ? 102.430 93.812  126.502 1.00 46.50  ? 45   LYS H CB  1 
ATOM   5939  N N   . LEU H  1 46  ? 102.284 96.817  125.176 1.00 43.59  ? 46   LEU H N   1 
ATOM   5940  C CA  . LEU H  1 46  ? 103.111 97.853  124.534 1.00 42.53  ? 46   LEU H CA  1 
ATOM   5941  C C   . LEU H  1 46  ? 104.542 97.791  125.058 1.00 44.07  ? 46   LEU H C   1 
ATOM   5942  O O   . LEU H  1 46  ? 104.744 97.857  126.285 1.00 43.06  ? 46   LEU H O   1 
ATOM   5943  C CB  . LEU H  1 46  ? 102.566 99.255  124.913 1.00 40.77  ? 46   LEU H CB  1 
ATOM   5944  C CG  . LEU H  1 46  ? 102.729 100.492 124.024 1.00 33.90  ? 46   LEU H CG  1 
ATOM   5945  C CD1 . LEU H  1 46  ? 103.744 100.323 122.890 1.00 33.07  ? 46   LEU H CD1 1 
ATOM   5946  C CD2 . LEU H  1 46  ? 101.368 100.873 123.441 1.00 28.42  ? 46   LEU H CD2 1 
ATOM   5947  N N   . LEU H  1 47  ? 105.538 97.662  124.182 1.00 45.17  ? 47   LEU H N   1 
ATOM   5948  C CA  . LEU H  1 47  ? 106.930 97.738  124.638 1.00 45.54  ? 47   LEU H CA  1 
ATOM   5949  C C   . LEU H  1 47  ? 107.521 99.098  124.308 1.00 46.45  ? 47   LEU H C   1 
ATOM   5950  O O   . LEU H  1 47  ? 108.095 99.772  125.167 1.00 47.32  ? 47   LEU H O   1 
ATOM   5951  C CB  . LEU H  1 47  ? 107.814 96.659  123.997 1.00 44.89  ? 47   LEU H CB  1 
ATOM   5952  C CG  . LEU H  1 47  ? 107.248 95.312  123.532 1.00 46.78  ? 47   LEU H CG  1 
ATOM   5953  C CD1 . LEU H  1 47  ? 108.076 94.831  122.341 1.00 41.55  ? 47   LEU H CD1 1 
ATOM   5954  C CD2 . LEU H  1 47  ? 107.329 94.279  124.677 1.00 49.49  ? 47   LEU H CD2 1 
ATOM   5955  N N   . ILE H  1 48  ? 107.387 99.482  123.045 1.00 47.07  ? 48   ILE H N   1 
ATOM   5956  C CA  . ILE H  1 48  ? 108.133 100.604 122.522 1.00 46.37  ? 48   ILE H CA  1 
ATOM   5957  C C   . ILE H  1 48  ? 107.238 101.721 122.028 1.00 48.67  ? 48   ILE H C   1 
ATOM   5958  O O   . ILE H  1 48  ? 106.137 101.505 121.513 1.00 48.69  ? 48   ILE H O   1 
ATOM   5959  C CB  . ILE H  1 48  ? 109.095 100.191 121.373 1.00 45.22  ? 48   ILE H CB  1 
ATOM   5960  C CG1 . ILE H  1 48  ? 109.653 98.756  121.576 1.00 41.23  ? 48   ILE H CG1 1 
ATOM   5961  C CG2 . ILE H  1 48  ? 110.199 101.212 121.209 1.00 45.98  ? 48   ILE H CG2 1 
ATOM   5962  C CD1 . ILE H  1 48  ? 110.675 98.571  122.760 1.00 39.03  ? 48   ILE H CD1 1 
ATOM   5963  N N   . TYR H  1 49  ? 107.777 102.922 122.180 1.00 49.32  ? 49   TYR H N   1 
ATOM   5964  C CA  . TYR H  1 49  ? 107.131 104.144 121.801 1.00 50.86  ? 49   TYR H CA  1 
ATOM   5965  C C   . TYR H  1 49  ? 107.986 104.847 120.816 1.00 51.97  ? 49   TYR H C   1 
ATOM   5966  O O   . TYR H  1 49  ? 109.144 104.473 120.629 1.00 52.78  ? 49   TYR H O   1 
ATOM   5967  C CB  . TYR H  1 49  ? 107.064 105.054 123.015 1.00 52.14  ? 49   TYR H CB  1 
ATOM   5968  C CG  . TYR H  1 49  ? 105.758 104.918 123.661 1.00 55.48  ? 49   TYR H CG  1 
ATOM   5969  C CD1 . TYR H  1 49  ? 105.616 105.081 125.030 1.00 54.89  ? 49   TYR H CD1 1 
ATOM   5970  C CD2 . TYR H  1 49  ? 104.644 104.575 122.889 1.00 55.15  ? 49   TYR H CD2 1 
ATOM   5971  C CE1 . TYR H  1 49  ? 104.379 104.936 125.607 1.00 57.14  ? 49   TYR H CE1 1 
ATOM   5972  C CE2 . TYR H  1 49  ? 103.427 104.418 123.448 1.00 56.61  ? 49   TYR H CE2 1 
ATOM   5973  C CZ  . TYR H  1 49  ? 103.297 104.591 124.803 1.00 57.96  ? 49   TYR H CZ  1 
ATOM   5974  O OH  . TYR H  1 49  ? 102.067 104.413 125.345 1.00 58.18  ? 49   TYR H OH  1 
ATOM   5975  N N   . ALA H  1 50  ? 107.436 105.897 120.211 1.00 51.31  ? 50   ALA H N   1 
ATOM   5976  C CA  . ALA H  1 50  ? 108.251 106.891 119.511 1.00 50.84  ? 50   ALA H CA  1 
ATOM   5977  C C   . ALA H  1 50  ? 109.350 106.228 118.679 1.00 50.92  ? 50   ALA H C   1 
ATOM   5978  O O   . ALA H  1 50  ? 110.489 106.704 118.643 1.00 52.37  ? 50   ALA H O   1 
ATOM   5979  C CB  . ALA H  1 50  ? 108.854 107.891 120.524 1.00 49.92  ? 50   ALA H CB  1 
ATOM   5980  N N   . ALA H  1 51  ? 108.984 105.139 117.998 1.00 50.11  ? 51   ALA H N   1 
ATOM   5981  C CA  . ALA H  1 51  ? 109.952 104.190 117.443 1.00 49.87  ? 51   ALA H CA  1 
ATOM   5982  C C   . ALA H  1 51  ? 110.904 103.553 118.484 1.00 49.66  ? 51   ALA H C   1 
ATOM   5983  O O   . ALA H  1 51  ? 111.290 102.384 118.318 1.00 47.27  ? 51   ALA H O   1 
ATOM   5984  C CB  . ALA H  1 51  ? 110.742 104.810 116.277 1.00 48.70  ? 51   ALA H CB  1 
ATOM   5985  N N   . SER H  1 52  ? 111.265 104.285 119.555 1.00 50.73  ? 52   SER H N   1 
ATOM   5986  C CA  . SER H  1 52  ? 112.402 103.861 120.421 1.00 50.97  ? 52   SER H CA  1 
ATOM   5987  C C   . SER H  1 52  ? 112.428 103.854 121.991 1.00 51.08  ? 52   SER H C   1 
ATOM   5988  O O   . SER H  1 52  ? 113.237 103.108 122.547 1.00 51.56  ? 52   SER H O   1 
ATOM   5989  C CB  . SER H  1 52  ? 113.710 104.483 119.899 1.00 51.59  ? 52   SER H CB  1 
ATOM   5990  O OG  . SER H  1 52  ? 113.836 105.841 120.297 1.00 53.56  ? 52   SER H OG  1 
ATOM   5991  N N   . SER H  1 53  ? 111.612 104.639 122.710 1.00 51.59  ? 53   SER H N   1 
ATOM   5992  C CA  . SER H  1 53  ? 111.695 104.654 124.202 1.00 50.97  ? 53   SER H CA  1 
ATOM   5993  C C   . SER H  1 53  ? 111.202 103.338 124.835 1.00 50.83  ? 53   SER H C   1 
ATOM   5994  O O   . SER H  1 53  ? 110.165 102.817 124.418 1.00 51.63  ? 53   SER H O   1 
ATOM   5995  C CB  . SER H  1 53  ? 110.927 105.845 124.796 1.00 51.34  ? 53   SER H CB  1 
ATOM   5996  O OG  . SER H  1 53  ? 111.534 106.264 126.046 1.00 47.93  ? 53   SER H OG  1 
ATOM   5997  N N   . LEU H  1 54  ? 111.930 102.798 125.820 1.00 49.76  ? 54   LEU H N   1 
ATOM   5998  C CA  . LEU H  1 54  ? 111.435 101.626 126.559 1.00 49.88  ? 54   LEU H CA  1 
ATOM   5999  C C   . LEU H  1 54  ? 110.210 102.023 127.382 1.00 51.29  ? 54   LEU H C   1 
ATOM   6000  O O   . LEU H  1 54  ? 110.050 103.188 127.781 1.00 51.41  ? 54   LEU H O   1 
ATOM   6001  C CB  . LEU H  1 54  ? 112.529 100.986 127.454 1.00 48.53  ? 54   LEU H CB  1 
ATOM   6002  C CG  . LEU H  1 54  ? 112.427 99.552  128.023 1.00 48.08  ? 54   LEU H CG  1 
ATOM   6003  C CD1 . LEU H  1 54  ? 111.654 99.486  129.333 1.00 41.90  ? 54   LEU H CD1 1 
ATOM   6004  C CD2 . LEU H  1 54  ? 111.895 98.565  126.993 1.00 39.02  ? 54   LEU H CD2 1 
ATOM   6005  N N   . GLN H  1 55  ? 109.346 101.040 127.610 1.00 51.19  ? 55   GLN H N   1 
ATOM   6006  C CA  . GLN H  1 55  ? 108.169 101.215 128.438 1.00 51.30  ? 55   GLN H CA  1 
ATOM   6007  C C   . GLN H  1 55  ? 108.165 100.306 129.640 1.00 52.48  ? 55   GLN H C   1 
ATOM   6008  O O   . GLN H  1 55  ? 108.691 99.190  129.590 1.00 52.32  ? 55   GLN H O   1 
ATOM   6009  C CB  . GLN H  1 55  ? 106.913 100.966 127.637 1.00 50.73  ? 55   GLN H CB  1 
ATOM   6010  C CG  . GLN H  1 55  ? 106.519 102.150 126.845 1.00 49.05  ? 55   GLN H CG  1 
ATOM   6011  C CD  . GLN H  1 55  ? 105.085 102.510 127.101 1.00 48.70  ? 55   GLN H CD  1 
ATOM   6012  O OE1 . GLN H  1 55  ? 104.216 102.456 126.154 1.00 43.36  ? 55   GLN H OE1 1 
ATOM   6013  N NE2 . GLN H  1 55  ? 104.800 102.847 128.382 1.00 40.81  ? 55   GLN H NE2 1 
ATOM   6014  N N   . SER H  1 56  ? 107.540 100.787 130.713 1.00 52.98  ? 56   SER H N   1 
ATOM   6015  C CA  . SER H  1 56  ? 107.424 100.045 131.963 1.00 54.47  ? 56   SER H CA  1 
ATOM   6016  C C   . SER H  1 56  ? 106.908 98.632  131.721 1.00 55.04  ? 56   SER H C   1 
ATOM   6017  O O   . SER H  1 56  ? 106.361 98.316  130.598 1.00 56.02  ? 56   SER H O   1 
ATOM   6018  C CB  . SER H  1 56  ? 106.492 100.770 132.937 1.00 55.43  ? 56   SER H CB  1 
ATOM   6019  O OG  . SER H  1 56  ? 106.835 102.184 133.025 1.00 57.30  ? 56   SER H OG  1 
ATOM   6020  N N   . GLY H  1 57  ? 107.062 97.784  132.771 1.00 54.42  ? 57   GLY H N   1 
ATOM   6021  C CA  . GLY H  1 57  ? 106.682 96.382  132.595 1.00 53.14  ? 57   GLY H CA  1 
ATOM   6022  C C   . GLY H  1 57  ? 107.652 95.624  131.704 1.00 51.97  ? 57   GLY H C   1 
ATOM   6023  O O   . GLY H  1 57  ? 107.754 94.402  131.810 1.00 51.50  ? 57   GLY H O   1 
ATOM   6024  N N   . VAL H  1 58  ? 108.363 96.336  130.827 1.00 50.56  ? 58   VAL H N   1 
ATOM   6025  C CA  . VAL H  1 58  ? 109.286 95.688  129.890 1.00 48.66  ? 58   VAL H CA  1 
ATOM   6026  C C   . VAL H  1 58  ? 110.728 95.598  130.418 1.00 47.59  ? 58   VAL H C   1 
ATOM   6027  O O   . VAL H  1 58  ? 111.362 96.625  130.692 1.00 47.29  ? 58   VAL H O   1 
ATOM   6028  C CB  . VAL H  1 58  ? 109.202 96.286  128.456 1.00 48.38  ? 58   VAL H CB  1 
ATOM   6029  C CG1 . VAL H  1 58  ? 110.410 95.938  127.631 1.00 46.16  ? 58   VAL H CG1 1 
ATOM   6030  C CG2 . VAL H  1 58  ? 107.937 95.797  127.773 1.00 49.77  ? 58   VAL H CG2 1 
ATOM   6031  N N   . PRO H  1 59  ? 111.229 94.359  130.605 1.00 47.55  ? 59   PRO H N   1 
ATOM   6032  C CA  . PRO H  1 59  ? 112.657 94.125  130.818 1.00 45.59  ? 59   PRO H CA  1 
ATOM   6033  C C   . PRO H  1 59  ? 113.459 94.756  129.684 1.00 44.38  ? 59   PRO H C   1 
ATOM   6034  O O   . PRO H  1 59  ? 113.090 94.611  128.521 1.00 41.60  ? 59   PRO H O   1 
ATOM   6035  C CB  . PRO H  1 59  ? 112.784 92.596  130.760 1.00 45.58  ? 59   PRO H CB  1 
ATOM   6036  C CG  . PRO H  1 59  ? 111.449 92.077  130.232 1.00 44.00  ? 59   PRO H CG  1 
ATOM   6037  C CD  . PRO H  1 59  ? 110.455 93.097  130.659 1.00 47.35  ? 59   PRO H CD  1 
ATOM   6038  N N   . SER H  1 60  ? 114.553 95.436  130.016 1.00 46.32  ? 60   SER H N   1 
ATOM   6039  C CA  . SER H  1 60  ? 115.261 96.274  129.037 1.00 47.10  ? 60   SER H CA  1 
ATOM   6040  C C   . SER H  1 60  ? 116.161 95.561  128.004 1.00 48.38  ? 60   SER H C   1 
ATOM   6041  O O   . SER H  1 60  ? 116.991 96.234  127.352 1.00 49.16  ? 60   SER H O   1 
ATOM   6042  C CB  . SER H  1 60  ? 116.009 97.421  129.742 1.00 47.17  ? 60   SER H CB  1 
ATOM   6043  O OG  . SER H  1 60  ? 116.949 96.921  130.685 1.00 48.24  ? 60   SER H OG  1 
ATOM   6044  N N   . ARG H  1 61  ? 115.989 94.240  127.825 1.00 48.87  ? 61   ARG H N   1 
ATOM   6045  C CA  . ARG H  1 61  ? 116.640 93.601  126.650 1.00 47.60  ? 61   ARG H CA  1 
ATOM   6046  C C   . ARG H  1 61  ? 115.950 94.032  125.329 1.00 46.95  ? 61   ARG H C   1 
ATOM   6047  O O   . ARG H  1 61  ? 116.353 93.599  124.245 1.00 46.69  ? 61   ARG H O   1 
ATOM   6048  C CB  . ARG H  1 61  ? 116.664 92.065  126.776 1.00 47.21  ? 61   ARG H CB  1 
ATOM   6049  C CG  . ARG H  1 61  ? 115.554 91.487  127.676 1.00 50.56  ? 61   ARG H CG  1 
ATOM   6050  C CD  . ARG H  1 61  ? 115.321 90.007  127.328 1.00 54.61  ? 61   ARG H CD  1 
ATOM   6051  N NE  . ARG H  1 61  ? 114.224 89.420  128.102 1.00 52.94  ? 61   ARG H NE  1 
ATOM   6052  C CZ  . ARG H  1 61  ? 114.069 89.518  129.423 1.00 55.86  ? 61   ARG H CZ  1 
ATOM   6053  N NH1 . ARG H  1 61  ? 114.955 90.163  130.174 1.00 56.46  ? 61   ARG H NH1 1 
ATOM   6054  N NH2 . ARG H  1 61  ? 113.025 88.943  130.005 1.00 56.53  ? 61   ARG H NH2 1 
ATOM   6055  N N   . PHE H  1 62  ? 114.938 94.897  125.430 1.00 46.39  ? 62   PHE H N   1 
ATOM   6056  C CA  . PHE H  1 62  ? 114.051 95.228  124.304 1.00 46.10  ? 62   PHE H CA  1 
ATOM   6057  C C   . PHE H  1 62  ? 114.210 96.670  123.813 1.00 44.71  ? 62   PHE H C   1 
ATOM   6058  O O   . PHE H  1 62  ? 113.920 97.611  124.564 1.00 42.57  ? 62   PHE H O   1 
ATOM   6059  C CB  . PHE H  1 62  ? 112.590 95.047  124.736 1.00 46.95  ? 62   PHE H CB  1 
ATOM   6060  C CG  . PHE H  1 62  ? 112.172 93.618  124.932 1.00 46.98  ? 62   PHE H CG  1 
ATOM   6061  C CD1 . PHE H  1 62  ? 112.265 93.012  126.181 1.00 50.95  ? 62   PHE H CD1 1 
ATOM   6062  C CD2 . PHE H  1 62  ? 111.648 92.885  123.874 1.00 50.74  ? 62   PHE H CD2 1 
ATOM   6063  C CE1 . PHE H  1 62  ? 111.864 91.689  126.369 1.00 52.08  ? 62   PHE H CE1 1 
ATOM   6064  C CE2 . PHE H  1 62  ? 111.242 91.565  124.054 1.00 52.60  ? 62   PHE H CE2 1 
ATOM   6065  C CZ  . PHE H  1 62  ? 111.353 90.964  125.301 1.00 47.52  ? 62   PHE H CZ  1 
ATOM   6066  N N   . SER H  1 63  ? 114.641 96.858  122.555 1.00 44.26  ? 63   SER H N   1 
ATOM   6067  C CA  . SER H  1 63  ? 114.776 98.240  122.052 1.00 45.69  ? 63   SER H CA  1 
ATOM   6068  C C   . SER H  1 63  ? 114.356 98.514  120.589 1.00 45.44  ? 63   SER H C   1 
ATOM   6069  O O   . SER H  1 63  ? 113.902 97.610  119.869 1.00 44.48  ? 63   SER H O   1 
ATOM   6070  C CB  . SER H  1 63  ? 116.188 98.804  122.333 1.00 46.16  ? 63   SER H CB  1 
ATOM   6071  O OG  . SER H  1 63  ? 117.210 98.004  121.719 1.00 52.49  ? 63   SER H OG  1 
ATOM   6072  N N   . GLY H  1 64  ? 114.498 99.785  120.179 1.00 46.95  ? 64   GLY H N   1 
ATOM   6073  C CA  . GLY H  1 64  ? 114.135 100.301 118.828 1.00 47.37  ? 64   GLY H CA  1 
ATOM   6074  C C   . GLY H  1 64  ? 114.931 101.543 118.398 1.00 49.34  ? 64   GLY H C   1 
ATOM   6075  O O   . GLY H  1 64  ? 115.542 102.205 119.247 1.00 49.14  ? 64   GLY H O   1 
ATOM   6076  N N   . SER H  1 65  ? 114.926 101.872 117.100 1.00 51.06  ? 65   SER H N   1 
ATOM   6077  C CA  . SER H  1 65  ? 115.875 102.864 116.551 1.00 51.92  ? 65   SER H CA  1 
ATOM   6078  C C   . SER H  1 65  ? 115.590 103.329 115.111 1.00 53.32  ? 65   SER H C   1 
ATOM   6079  O O   . SER H  1 65  ? 114.863 102.662 114.373 1.00 53.12  ? 65   SER H O   1 
ATOM   6080  C CB  . SER H  1 65  ? 117.301 102.295 116.625 1.00 52.63  ? 65   SER H CB  1 
ATOM   6081  O OG  . SER H  1 65  ? 117.343 100.886 116.156 1.00 50.59  ? 65   SER H OG  1 
ATOM   6082  N N   . GLY H  1 66  ? 116.174 104.470 114.723 1.00 54.86  ? 66   GLY H N   1 
ATOM   6083  C CA  . GLY H  1 66  ? 116.037 105.024 113.361 1.00 57.28  ? 66   GLY H CA  1 
ATOM   6084  C C   . GLY H  1 66  ? 114.730 105.756 113.081 1.00 59.03  ? 66   GLY H C   1 
ATOM   6085  O O   . GLY H  1 66  ? 113.704 105.456 113.697 1.00 58.45  ? 66   GLY H O   1 
ATOM   6086  N N   . SER H  1 67  ? 114.761 106.705 112.142 1.00 60.67  ? 67   SER H N   1 
ATOM   6087  C CA  . SER H  1 67  ? 113.568 107.488 111.784 1.00 62.10  ? 67   SER H CA  1 
ATOM   6088  C C   . SER H  1 67  ? 113.091 107.301 110.347 1.00 62.60  ? 67   SER H C   1 
ATOM   6089  O O   . SER H  1 67  ? 113.870 106.956 109.451 1.00 63.01  ? 67   SER H O   1 
ATOM   6090  C CB  . SER H  1 67  ? 113.797 108.987 112.037 1.00 62.59  ? 67   SER H CB  1 
ATOM   6091  O OG  . SER H  1 67  ? 112.932 109.777 111.204 1.00 63.74  ? 67   SER H OG  1 
ATOM   6092  N N   . GLY H  1 68  ? 111.798 107.547 110.145 1.00 63.17  ? 68   GLY H N   1 
ATOM   6093  C CA  . GLY H  1 68  ? 111.219 107.644 108.814 1.00 63.57  ? 68   GLY H CA  1 
ATOM   6094  C C   . GLY H  1 68  ? 110.345 106.484 108.381 1.00 63.37  ? 68   GLY H C   1 
ATOM   6095  O O   . GLY H  1 68  ? 109.125 106.626 108.286 1.00 63.84  ? 68   GLY H O   1 
ATOM   6096  N N   . THR H  1 69  ? 110.970 105.325 108.140 1.00 63.26  ? 69   THR H N   1 
ATOM   6097  C CA  . THR H  1 69  ? 110.344 104.251 107.345 1.00 62.89  ? 69   THR H CA  1 
ATOM   6098  C C   . THR H  1 69  ? 110.684 102.788 107.742 1.00 63.06  ? 69   THR H C   1 
ATOM   6099  O O   . THR H  1 69  ? 109.780 101.978 107.956 1.00 64.72  ? 69   THR H O   1 
ATOM   6100  C CB  . THR H  1 69  ? 110.654 104.457 105.841 1.00 63.49  ? 69   THR H CB  1 
ATOM   6101  O OG1 . THR H  1 69  ? 112.014 104.892 105.680 1.00 64.83  ? 69   THR H OG1 1 
ATOM   6102  C CG2 . THR H  1 69  ? 109.725 105.494 105.217 1.00 62.01  ? 69   THR H CG2 1 
ATOM   6103  N N   . ASP H  1 70  ? 111.976 102.459 107.807 1.00 62.21  ? 70   ASP H N   1 
ATOM   6104  C CA  . ASP H  1 70  ? 112.463 101.135 108.236 1.00 61.22  ? 70   ASP H CA  1 
ATOM   6105  C C   . ASP H  1 70  ? 112.724 101.219 109.749 1.00 61.21  ? 70   ASP H C   1 
ATOM   6106  O O   . ASP H  1 70  ? 113.430 102.131 110.187 1.00 61.14  ? 70   ASP H O   1 
ATOM   6107  C CB  . ASP H  1 70  ? 113.753 100.797 107.455 1.00 61.42  ? 70   ASP H CB  1 
ATOM   6108  C CG  . ASP H  1 70  ? 114.122 99.312  107.499 1.00 60.98  ? 70   ASP H CG  1 
ATOM   6109  O OD1 . ASP H  1 70  ? 113.755 98.562  106.563 1.00 57.18  ? 70   ASP H OD1 1 
ATOM   6110  O OD2 . ASP H  1 70  ? 114.800 98.900  108.464 1.00 55.12  ? 70   ASP H OD2 1 
ATOM   6111  N N   . PHE H  1 71  ? 112.148 100.306 110.549 1.00 60.26  ? 71   PHE H N   1 
ATOM   6112  C CA  . PHE H  1 71  ? 112.326 100.300 112.034 1.00 59.40  ? 71   PHE H CA  1 
ATOM   6113  C C   . PHE H  1 71  ? 112.546 98.873  112.601 1.00 58.29  ? 71   PHE H C   1 
ATOM   6114  O O   . PHE H  1 71  ? 112.085 97.904  112.000 1.00 57.22  ? 71   PHE H O   1 
ATOM   6115  C CB  . PHE H  1 71  ? 111.127 100.934 112.766 1.00 59.41  ? 71   PHE H CB  1 
ATOM   6116  C CG  . PHE H  1 71  ? 110.658 102.262 112.203 1.00 62.07  ? 71   PHE H CG  1 
ATOM   6117  C CD1 . PHE H  1 71  ? 109.696 102.304 111.197 1.00 63.70  ? 71   PHE H CD1 1 
ATOM   6118  C CD2 . PHE H  1 71  ? 111.133 103.466 112.720 1.00 65.37  ? 71   PHE H CD2 1 
ATOM   6119  C CE1 . PHE H  1 71  ? 109.236 103.519 110.693 1.00 63.27  ? 71   PHE H CE1 1 
ATOM   6120  C CE2 . PHE H  1 71  ? 110.681 104.690 112.215 1.00 66.75  ? 71   PHE H CE2 1 
ATOM   6121  C CZ  . PHE H  1 71  ? 109.730 104.712 111.200 1.00 64.09  ? 71   PHE H CZ  1 
ATOM   6122  N N   . THR H  1 72  ? 113.206 98.744  113.761 1.00 57.29  ? 72   THR H N   1 
ATOM   6123  C CA  . THR H  1 72  ? 113.684 97.418  114.230 1.00 55.38  ? 72   THR H CA  1 
ATOM   6124  C C   . THR H  1 72  ? 113.538 97.069  115.733 1.00 54.67  ? 72   THR H C   1 
ATOM   6125  O O   . THR H  1 72  ? 114.094 97.756  116.601 1.00 54.31  ? 72   THR H O   1 
ATOM   6126  C CB  . THR H  1 72  ? 115.171 97.202  113.837 1.00 55.09  ? 72   THR H CB  1 
ATOM   6127  O OG1 . THR H  1 72  ? 115.583 98.203  112.896 1.00 52.95  ? 72   THR H OG1 1 
ATOM   6128  C CG2 . THR H  1 72  ? 115.365 95.828  113.231 1.00 53.70  ? 72   THR H CG2 1 
ATOM   6129  N N   . LEU H  1 73  ? 112.799 95.990  116.018 1.00 54.14  ? 73   LEU H N   1 
ATOM   6130  C CA  . LEU H  1 73  ? 112.699 95.438  117.378 1.00 53.41  ? 73   LEU H CA  1 
ATOM   6131  C C   . LEU H  1 73  ? 113.428 94.112  117.541 1.00 54.11  ? 73   LEU H C   1 
ATOM   6132  O O   . LEU H  1 73  ? 113.096 93.084  116.925 1.00 54.96  ? 73   LEU H O   1 
ATOM   6133  C CB  . LEU H  1 73  ? 111.260 95.319  117.871 1.00 52.37  ? 73   LEU H CB  1 
ATOM   6134  C CG  . LEU H  1 73  ? 111.148 94.803  119.311 1.00 51.96  ? 73   LEU H CG  1 
ATOM   6135  C CD1 . LEU H  1 73  ? 111.374 95.908  120.334 1.00 48.41  ? 73   LEU H CD1 1 
ATOM   6136  C CD2 . LEU H  1 73  ? 109.817 94.117  119.538 1.00 47.71  ? 73   LEU H CD2 1 
ATOM   6137  N N   . THR H  1 74  ? 114.395 94.175  118.445 1.00 54.61  ? 74   THR H N   1 
ATOM   6138  C CA  . THR H  1 74  ? 115.502 93.258  118.519 1.00 54.69  ? 74   THR H CA  1 
ATOM   6139  C C   . THR H  1 74  ? 115.601 92.671  119.900 1.00 55.44  ? 74   THR H C   1 
ATOM   6140  O O   . THR H  1 74  ? 116.489 93.066  120.662 1.00 55.45  ? 74   THR H O   1 
ATOM   6141  C CB  . THR H  1 74  ? 116.837 94.030  118.314 1.00 55.24  ? 74   THR H CB  1 
ATOM   6142  O OG1 . THR H  1 74  ? 116.806 95.248  119.087 1.00 50.08  ? 74   THR H OG1 1 
ATOM   6143  C CG2 . THR H  1 74  ? 117.059 94.355  116.831 1.00 54.98  ? 74   THR H CG2 1 
ATOM   6144  N N   . ILE H  1 75  ? 114.709 91.751  120.259 1.00 56.89  ? 75   ILE H N   1 
ATOM   6145  C CA  . ILE H  1 75  ? 114.936 91.011  121.493 1.00 58.19  ? 75   ILE H CA  1 
ATOM   6146  C C   . ILE H  1 75  ? 116.406 90.586  121.440 1.00 58.37  ? 75   ILE H C   1 
ATOM   6147  O O   . ILE H  1 75  ? 116.843 89.962  120.465 1.00 58.51  ? 75   ILE H O   1 
ATOM   6148  C CB  . ILE H  1 75  ? 114.030 89.776  121.619 1.00 58.27  ? 75   ILE H CB  1 
ATOM   6149  C CG1 . ILE H  1 75  ? 112.544 90.191  121.528 1.00 58.89  ? 75   ILE H CG1 1 
ATOM   6150  C CG2 . ILE H  1 75  ? 114.298 89.063  122.953 1.00 59.61  ? 75   ILE H CG2 1 
ATOM   6151  C CD1 . ILE H  1 75  ? 111.683 89.256  120.709 1.00 59.95  ? 75   ILE H CD1 1 
ATOM   6152  N N   . SER H  1 76  ? 117.172 90.944  122.470 1.00 58.09  ? 76   SER H N   1 
ATOM   6153  C CA  . SER H  1 76  ? 118.629 90.732  122.453 1.00 57.23  ? 76   SER H CA  1 
ATOM   6154  C C   . SER H  1 76  ? 119.110 89.398  123.040 1.00 56.36  ? 76   SER H C   1 
ATOM   6155  O O   . SER H  1 76  ? 120.132 88.866  122.602 1.00 58.15  ? 76   SER H O   1 
ATOM   6156  C CB  . SER H  1 76  ? 119.371 91.915  123.087 1.00 57.21  ? 76   SER H CB  1 
ATOM   6157  O OG  . SER H  1 76  ? 118.907 92.176  124.398 1.00 57.79  ? 76   SER H OG  1 
ATOM   6158  N N   . SER H  1 77  ? 118.397 88.879  124.036 1.00 53.28  ? 77   SER H N   1 
ATOM   6159  C CA  . SER H  1 77  ? 118.612 87.510  124.503 1.00 51.62  ? 77   SER H CA  1 
ATOM   6160  C C   . SER H  1 77  ? 117.240 86.919  124.777 1.00 49.94  ? 77   SER H C   1 
ATOM   6161  O O   . SER H  1 77  ? 116.631 87.234  125.803 1.00 49.01  ? 77   SER H O   1 
ATOM   6162  C CB  . SER H  1 77  ? 119.470 87.493  125.771 1.00 51.17  ? 77   SER H CB  1 
ATOM   6163  O OG  . SER H  1 77  ? 118.772 88.149  126.890 1.00 49.95  ? 77   SER H OG  1 
ATOM   6164  N N   . LEU H  1 78  ? 116.728 86.087  123.868 1.00 48.69  ? 78   LEU H N   1 
ATOM   6165  C CA  . LEU H  1 78  ? 115.343 85.620  124.018 1.00 48.26  ? 78   LEU H CA  1 
ATOM   6166  C C   . LEU H  1 78  ? 115.120 84.753  125.255 1.00 47.00  ? 78   LEU H C   1 
ATOM   6167  O O   . LEU H  1 78  ? 116.055 84.147  125.803 1.00 46.34  ? 78   LEU H O   1 
ATOM   6168  C CB  . LEU H  1 78  ? 114.775 84.941  122.746 1.00 48.95  ? 78   LEU H CB  1 
ATOM   6169  C CG  . LEU H  1 78  ? 113.250 85.096  122.558 1.00 48.85  ? 78   LEU H CG  1 
ATOM   6170  C CD1 . LEU H  1 78  ? 112.950 86.161  121.529 1.00 48.54  ? 78   LEU H CD1 1 
ATOM   6171  C CD2 . LEU H  1 78  ? 112.610 83.794  122.105 1.00 46.37  ? 78   LEU H CD2 1 
ATOM   6172  N N   . GLN H  1 79  ? 113.854 84.720  125.673 1.00 45.27  ? 79   GLN H N   1 
ATOM   6173  C CA  . GLN H  1 79  ? 113.491 84.211  126.988 1.00 43.98  ? 79   GLN H CA  1 
ATOM   6174  C C   . GLN H  1 79  ? 112.200 83.411  126.875 1.00 45.28  ? 79   GLN H C   1 
ATOM   6175  O O   . GLN H  1 79  ? 111.268 83.830  126.185 1.00 46.82  ? 79   GLN H O   1 
ATOM   6176  C CB  . GLN H  1 79  ? 113.306 85.381  127.982 1.00 43.17  ? 79   GLN H CB  1 
ATOM   6177  C CG  . GLN H  1 79  ? 114.608 86.105  128.367 1.00 40.10  ? 79   GLN H CG  1 
ATOM   6178  C CD  . GLN H  1 79  ? 115.692 85.176  128.904 1.00 39.52  ? 79   GLN H CD  1 
ATOM   6179  O OE1 . GLN H  1 79  ? 116.859 85.286  128.526 1.00 41.76  ? 79   GLN H OE1 1 
ATOM   6180  N NE2 . GLN H  1 79  ? 115.309 84.257  129.790 1.00 28.47  ? 79   GLN H NE2 1 
ATOM   6181  N N   . PRO H  1 80  ? 112.148 82.248  127.551 1.00 43.85  ? 80   PRO H N   1 
ATOM   6182  C CA  . PRO H  1 80  ? 111.067 81.256  127.562 1.00 43.09  ? 80   PRO H CA  1 
ATOM   6183  C C   . PRO H  1 80  ? 109.657 81.825  127.748 1.00 44.79  ? 80   PRO H C   1 
ATOM   6184  O O   . PRO H  1 80  ? 108.674 81.128  127.482 1.00 44.91  ? 80   PRO H O   1 
ATOM   6185  C CB  . PRO H  1 80  ? 111.426 80.373  128.758 1.00 43.55  ? 80   PRO H CB  1 
ATOM   6186  C CG  . PRO H  1 80  ? 112.896 80.430  128.819 1.00 43.40  ? 80   PRO H CG  1 
ATOM   6187  C CD  . PRO H  1 80  ? 113.267 81.827  128.418 1.00 43.86  ? 80   PRO H CD  1 
ATOM   6188  N N   . GLU H  1 81  ? 109.573 83.069  128.214 1.00 44.30  ? 81   GLU H N   1 
ATOM   6189  C CA  . GLU H  1 81  ? 108.305 83.771  128.386 1.00 43.18  ? 81   GLU H CA  1 
ATOM   6190  C C   . GLU H  1 81  ? 108.001 84.657  127.178 1.00 43.16  ? 81   GLU H C   1 
ATOM   6191  O O   . GLU H  1 81  ? 106.915 85.246  127.090 1.00 43.53  ? 81   GLU H O   1 
ATOM   6192  C CB  . GLU H  1 81  ? 108.351 84.632  129.651 1.00 43.68  ? 81   GLU H CB  1 
ATOM   6193  C CG  . GLU H  1 81  ? 108.963 86.015  129.431 1.00 44.53  ? 81   GLU H CG  1 
ATOM   6194  C CD  . GLU H  1 81  ? 110.045 86.343  130.432 1.00 48.36  ? 81   GLU H CD  1 
ATOM   6195  O OE1 . GLU H  1 81  ? 109.895 87.346  131.160 1.00 48.88  ? 81   GLU H OE1 1 
ATOM   6196  O OE2 . GLU H  1 81  ? 111.047 85.599  130.497 1.00 51.57  ? 81   GLU H OE2 1 
ATOM   6197  N N   . ASP H  1 82  ? 108.946 84.754  126.247 1.00 42.22  ? 82   ASP H N   1 
ATOM   6198  C CA  . ASP H  1 82  ? 108.774 85.662  125.120 1.00 41.56  ? 82   ASP H CA  1 
ATOM   6199  C C   . ASP H  1 82  ? 108.038 85.052  123.909 1.00 40.44  ? 82   ASP H C   1 
ATOM   6200  O O   . ASP H  1 82  ? 107.765 85.772  122.939 1.00 38.47  ? 82   ASP H O   1 
ATOM   6201  C CB  . ASP H  1 82  ? 110.120 86.297  124.693 1.00 41.09  ? 82   ASP H CB  1 
ATOM   6202  C CG  . ASP H  1 82  ? 110.672 87.297  125.726 1.00 38.75  ? 82   ASP H CG  1 
ATOM   6203  O OD1 . ASP H  1 82  ? 109.880 88.038  126.361 1.00 26.45  ? 82   ASP H OD1 1 
ATOM   6204  O OD2 . ASP H  1 82  ? 111.911 87.358  125.879 1.00 41.65  ? 82   ASP H OD2 1 
ATOM   6205  N N   . PHE H  1 83  ? 107.711 83.754  123.944 1.00 40.88  ? 83   PHE H N   1 
ATOM   6206  C CA  . PHE H  1 83  ? 107.054 83.124  122.782 1.00 41.67  ? 83   PHE H CA  1 
ATOM   6207  C C   . PHE H  1 83  ? 105.630 83.664  122.546 1.00 42.77  ? 83   PHE H C   1 
ATOM   6208  O O   . PHE H  1 83  ? 104.642 83.192  123.119 1.00 40.05  ? 83   PHE H O   1 
ATOM   6209  C CB  . PHE H  1 83  ? 107.183 81.581  122.776 1.00 41.79  ? 83   PHE H CB  1 
ATOM   6210  C CG  . PHE H  1 83  ? 105.924 80.839  123.145 1.00 41.84  ? 83   PHE H CG  1 
ATOM   6211  C CD1 . PHE H  1 83  ? 105.134 80.251  122.159 1.00 41.96  ? 83   PHE H CD1 1 
ATOM   6212  C CD2 . PHE H  1 83  ? 105.541 80.701  124.477 1.00 42.18  ? 83   PHE H CD2 1 
ATOM   6213  C CE1 . PHE H  1 83  ? 103.971 79.556  122.495 1.00 41.08  ? 83   PHE H CE1 1 
ATOM   6214  C CE2 . PHE H  1 83  ? 104.381 80.012  124.824 1.00 44.27  ? 83   PHE H CE2 1 
ATOM   6215  C CZ  . PHE H  1 83  ? 103.595 79.438  123.831 1.00 43.03  ? 83   PHE H CZ  1 
ATOM   6216  N N   . ALA H  1 84  ? 105.573 84.689  121.700 1.00 45.73  ? 84   ALA H N   1 
ATOM   6217  C CA  . ALA H  1 84  ? 104.364 85.441  121.400 1.00 47.35  ? 84   ALA H CA  1 
ATOM   6218  C C   . ALA H  1 84  ? 104.632 86.172  120.092 1.00 47.76  ? 84   ALA H C   1 
ATOM   6219  O O   . ALA H  1 84  ? 105.790 86.437  119.773 1.00 48.35  ? 84   ALA H O   1 
ATOM   6220  C CB  . ALA H  1 84  ? 104.108 86.430  122.499 1.00 48.08  ? 84   ALA H CB  1 
ATOM   6221  N N   . THR H  1 85  ? 103.581 86.480  119.323 1.00 47.73  ? 85   THR H N   1 
ATOM   6222  C CA  . THR H  1 85  ? 103.726 87.229  118.062 1.00 50.06  ? 85   THR H CA  1 
ATOM   6223  C C   . THR H  1 85  ? 104.087 88.702  118.346 1.00 50.86  ? 85   THR H C   1 
ATOM   6224  O O   . THR H  1 85  ? 103.770 89.212  119.425 1.00 51.48  ? 85   THR H O   1 
ATOM   6225  C CB  . THR H  1 85  ? 102.428 87.148  117.213 1.00 49.51  ? 85   THR H CB  1 
ATOM   6226  O OG1 . THR H  1 85  ? 101.800 85.861  117.390 1.00 51.44  ? 85   THR H OG1 1 
ATOM   6227  C CG2 . THR H  1 85  ? 102.712 87.368  115.738 1.00 47.45  ? 85   THR H CG2 1 
ATOM   6228  N N   . TYR H  1 86  ? 104.741 89.382  117.394 1.00 52.24  ? 86   TYR H N   1 
ATOM   6229  C CA  . TYR H  1 86  ? 105.224 90.779  117.587 1.00 54.31  ? 86   TYR H CA  1 
ATOM   6230  C C   . TYR H  1 86  ? 104.777 91.790  116.499 1.00 53.87  ? 86   TYR H C   1 
ATOM   6231  O O   . TYR H  1 86  ? 104.530 91.392  115.359 1.00 55.58  ? 86   TYR H O   1 
ATOM   6232  C CB  . TYR H  1 86  ? 106.743 90.802  117.766 1.00 54.89  ? 86   TYR H CB  1 
ATOM   6233  C CG  . TYR H  1 86  ? 107.226 90.176  119.061 1.00 56.78  ? 86   TYR H CG  1 
ATOM   6234  C CD1 . TYR H  1 86  ? 107.444 88.806  119.158 1.00 57.74  ? 86   TYR H CD1 1 
ATOM   6235  C CD2 . TYR H  1 86  ? 107.472 90.957  120.189 1.00 61.15  ? 86   TYR H CD2 1 
ATOM   6236  C CE1 . TYR H  1 86  ? 107.889 88.225  120.348 1.00 55.96  ? 86   TYR H CE1 1 
ATOM   6237  C CE2 . TYR H  1 86  ? 107.920 90.384  121.381 1.00 61.91  ? 86   TYR H CE2 1 
ATOM   6238  C CZ  . TYR H  1 86  ? 108.122 89.016  121.452 1.00 59.43  ? 86   TYR H CZ  1 
ATOM   6239  O OH  . TYR H  1 86  ? 108.562 88.442  122.621 1.00 58.71  ? 86   TYR H OH  1 
ATOM   6240  N N   . TYR H  1 87  ? 104.702 93.090  116.845 1.00 53.58  ? 87   TYR H N   1 
ATOM   6241  C CA  . TYR H  1 87  ? 103.781 94.027  116.137 1.00 54.05  ? 87   TYR H CA  1 
ATOM   6242  C C   . TYR H  1 87  ? 104.156 95.488  115.819 1.00 54.67  ? 87   TYR H C   1 
ATOM   6243  O O   . TYR H  1 87  ? 105.307 95.900  115.991 1.00 53.92  ? 87   TYR H O   1 
ATOM   6244  C CB  . TYR H  1 87  ? 102.429 94.005  116.850 1.00 51.98  ? 87   TYR H CB  1 
ATOM   6245  C CG  . TYR H  1 87  ? 101.669 92.789  116.448 1.00 52.33  ? 87   TYR H CG  1 
ATOM   6246  C CD1 . TYR H  1 87  ? 100.785 92.828  115.378 1.00 53.21  ? 87   TYR H CD1 1 
ATOM   6247  C CD2 . TYR H  1 87  ? 101.884 91.570  117.089 1.00 53.07  ? 87   TYR H CD2 1 
ATOM   6248  C CE1 . TYR H  1 87  ? 100.110 91.693  114.978 1.00 53.22  ? 87   TYR H CE1 1 
ATOM   6249  C CE2 . TYR H  1 87  ? 101.221 90.433  116.695 1.00 53.21  ? 87   TYR H CE2 1 
ATOM   6250  C CZ  . TYR H  1 87  ? 100.334 90.497  115.640 1.00 50.47  ? 87   TYR H CZ  1 
ATOM   6251  O OH  . TYR H  1 87  ? 99.661  89.364  115.250 1.00 49.30  ? 87   TYR H OH  1 
ATOM   6252  N N   . CYS H  1 88  ? 103.166 96.255  115.337 1.00 56.74  ? 88   CYS H N   1 
ATOM   6253  C CA  . CYS H  1 88  ? 103.351 97.690  115.054 1.00 58.77  ? 88   CYS H CA  1 
ATOM   6254  C C   . CYS H  1 88  ? 102.105 98.524  114.704 1.00 58.39  ? 88   CYS H C   1 
ATOM   6255  O O   . CYS H  1 88  ? 100.975 98.201  115.109 1.00 59.04  ? 88   CYS H O   1 
ATOM   6256  C CB  . CYS H  1 88  ? 104.437 97.909  113.985 1.00 58.78  ? 88   CYS H CB  1 
ATOM   6257  S SG  . CYS H  1 88  ? 104.299 96.819  112.545 1.00 64.66  ? 88   CYS H SG  1 
ATOM   6258  N N   . GLN H  1 89  ? 102.364 99.600  113.951 1.00 57.87  ? 89   GLN H N   1 
ATOM   6259  C CA  . GLN H  1 89  ? 101.418 100.679 113.636 1.00 58.24  ? 89   GLN H CA  1 
ATOM   6260  C C   . GLN H  1 89  ? 102.210 101.879 113.089 1.00 57.96  ? 89   GLN H C   1 
ATOM   6261  O O   . GLN H  1 89  ? 102.028 103.028 113.501 1.00 57.25  ? 89   GLN H O   1 
ATOM   6262  C CB  . GLN H  1 89  ? 100.591 101.084 114.860 1.00 57.56  ? 89   GLN H CB  1 
ATOM   6263  C CG  . GLN H  1 89  ? 99.499  102.097 114.543 1.00 58.29  ? 89   GLN H CG  1 
ATOM   6264  C CD  . GLN H  1 89  ? 98.452  102.191 115.628 1.00 59.53  ? 89   GLN H CD  1 
ATOM   6265  O OE1 . GLN H  1 89  ? 98.612  101.646 116.723 1.00 58.71  ? 89   GLN H OE1 1 
ATOM   6266  N NE2 . GLN H  1 89  ? 97.365  102.890 115.331 1.00 61.55  ? 89   GLN H NE2 1 
ATOM   6267  N N   . PHE H  1 98  ? 98.124  98.990  111.828 1.00 56.28  ? 98   PHE H N   1 
ATOM   6268  C CA  . PHE H  1 98  ? 98.475  97.926  112.764 1.00 55.65  ? 98   PHE H CA  1 
ATOM   6269  C C   . PHE H  1 98  ? 98.881  96.663  112.002 1.00 54.96  ? 98   PHE H C   1 
ATOM   6270  O O   . PHE H  1 98  ? 98.205  96.252  111.053 1.00 55.48  ? 98   PHE H O   1 
ATOM   6271  C CB  . PHE H  1 98  ? 97.309  97.642  113.711 1.00 56.49  ? 98   PHE H CB  1 
ATOM   6272  C CG  . PHE H  1 98  ? 97.711  97.560  115.156 1.00 55.77  ? 98   PHE H CG  1 
ATOM   6273  C CD1 . PHE H  1 98  ? 97.620  98.678  115.979 1.00 56.78  ? 98   PHE H CD1 1 
ATOM   6274  C CD2 . PHE H  1 98  ? 98.189  96.371  115.695 1.00 55.36  ? 98   PHE H CD2 1 
ATOM   6275  C CE1 . PHE H  1 98  ? 97.993  98.610  117.319 1.00 56.78  ? 98   PHE H CE1 1 
ATOM   6276  C CE2 . PHE H  1 98  ? 98.563  96.293  117.033 1.00 56.68  ? 98   PHE H CE2 1 
ATOM   6277  C CZ  . PHE H  1 98  ? 98.466  97.415  117.846 1.00 57.56  ? 98   PHE H CZ  1 
ATOM   6278  N N   . GLY H  1 99  ? 99.970  96.036  112.446 1.00 53.72  ? 99   GLY H N   1 
ATOM   6279  C CA  . GLY H  1 99  ? 100.756 95.116  111.611 1.00 52.57  ? 99   GLY H CA  1 
ATOM   6280  C C   . GLY H  1 99  ? 100.414 93.640  111.494 1.00 51.42  ? 99   GLY H C   1 
ATOM   6281  O O   . GLY H  1 99  ? 99.512  93.138  112.162 1.00 50.86  ? 99   GLY H O   1 
ATOM   6282  N N   . GLN H  1 100 ? 101.171 92.956  110.629 1.00 50.24  ? 100  GLN H N   1 
ATOM   6283  C CA  . GLN H  1 100 ? 100.987 91.527  110.330 1.00 49.60  ? 100  GLN H CA  1 
ATOM   6284  C C   . GLN H  1 100 ? 101.402 90.593  111.486 1.00 50.30  ? 100  GLN H C   1 
ATOM   6285  O O   . GLN H  1 100 ? 100.564 89.851  112.006 1.00 49.34  ? 100  GLN H O   1 
ATOM   6286  C CB  . GLN H  1 100 ? 101.638 91.128  108.979 1.00 50.15  ? 100  GLN H CB  1 
ATOM   6287  C CG  . GLN H  1 100 ? 103.175 91.289  108.852 1.00 49.49  ? 100  GLN H CG  1 
ATOM   6288  C CD  . GLN H  1 100 ? 103.613 92.267  107.754 1.00 51.03  ? 100  GLN H CD  1 
ATOM   6289  O OE1 . GLN H  1 100 ? 104.261 91.876  106.782 1.00 49.32  ? 100  GLN H OE1 1 
ATOM   6290  N NE2 . GLN H  1 100 ? 103.270 93.541  107.918 1.00 48.63  ? 100  GLN H NE2 1 
ATOM   6291  N N   . GLY H  1 101 ? 102.682 90.624  111.876 1.00 51.44  ? 101  GLY H N   1 
ATOM   6292  C CA  . GLY H  1 101 ? 103.178 89.859  113.040 1.00 52.05  ? 101  GLY H CA  1 
ATOM   6293  C C   . GLY H  1 101 ? 104.561 89.215  112.917 1.00 51.45  ? 101  GLY H C   1 
ATOM   6294  O O   . GLY H  1 101 ? 105.315 89.525  111.991 1.00 53.65  ? 101  GLY H O   1 
ATOM   6295  N N   . THR H  1 102 ? 104.893 88.343  113.877 1.00 49.02  ? 102  THR H N   1 
ATOM   6296  C CA  . THR H  1 102 ? 106.040 87.411  113.805 1.00 46.10  ? 102  THR H CA  1 
ATOM   6297  C C   . THR H  1 102 ? 105.921 86.316  114.883 1.00 44.73  ? 102  THR H C   1 
ATOM   6298  O O   . THR H  1 102 ? 106.073 86.605  116.075 1.00 46.57  ? 102  THR H O   1 
ATOM   6299  C CB  . THR H  1 102 ? 107.412 88.131  113.908 1.00 45.64  ? 102  THR H CB  1 
ATOM   6300  O OG1 . THR H  1 102 ? 107.656 88.862  112.700 1.00 42.59  ? 102  THR H OG1 1 
ATOM   6301  C CG2 . THR H  1 102 ? 108.543 87.129  114.103 1.00 41.93  ? 102  THR H CG2 1 
ATOM   6302  N N   . LYS H  1 103 ? 105.645 85.074  114.477 1.00 42.79  ? 103  LYS H N   1 
ATOM   6303  C CA  . LYS H  1 103 ? 105.334 84.041  115.476 1.00 41.41  ? 103  LYS H CA  1 
ATOM   6304  C C   . LYS H  1 103 ? 106.579 83.438  116.175 1.00 39.21  ? 103  LYS H C   1 
ATOM   6305  O O   . LYS H  1 103 ? 107.024 82.322  115.864 1.00 39.04  ? 103  LYS H O   1 
ATOM   6306  C CB  . LYS H  1 103 ? 104.374 82.954  114.897 1.00 41.24  ? 103  LYS H CB  1 
ATOM   6307  C CG  . LYS H  1 103 ? 103.021 83.494  114.351 1.00 42.44  ? 103  LYS H CG  1 
ATOM   6308  C CD  . LYS H  1 103 ? 101.913 83.482  115.422 1.00 46.00  ? 103  LYS H CD  1 
ATOM   6309  C CE  . LYS H  1 103 ? 100.455 83.575  114.674 1.00 45.03  ? 103  LYS H CE  1 
ATOM   6310  N NZ  . LYS H  1 103 ? 99.310  83.388  115.626 1.00 44.37  ? 103  LYS H NZ  1 
ATOM   6311  N N   . VAL H  1 104 ? 107.100 84.208  117.137 1.00 37.16  ? 104  VAL H N   1 
ATOM   6312  C CA  . VAL H  1 104 ? 108.377 83.959  117.840 1.00 36.14  ? 104  VAL H CA  1 
ATOM   6313  C C   . VAL H  1 104 ? 108.398 82.691  118.724 1.00 36.32  ? 104  VAL H C   1 
ATOM   6314  O O   . VAL H  1 104 ? 108.464 82.771  119.954 1.00 36.61  ? 104  VAL H O   1 
ATOM   6315  C CB  . VAL H  1 104 ? 108.840 85.237  118.638 1.00 35.74  ? 104  VAL H CB  1 
ATOM   6316  C CG1 . VAL H  1 104 ? 110.203 85.022  119.310 1.00 32.68  ? 104  VAL H CG1 1 
ATOM   6317  C CG2 . VAL H  1 104 ? 108.953 86.438  117.710 1.00 35.35  ? 104  VAL H CG2 1 
ATOM   6318  N N   . GLU H  1 105 ? 108.340 81.524  118.075 1.00 36.84  ? 105  GLU H N   1 
ATOM   6319  C CA  . GLU H  1 105 ? 108.526 80.216  118.723 1.00 37.42  ? 105  GLU H CA  1 
ATOM   6320  C C   . GLU H  1 105 ? 109.900 80.149  119.428 1.00 36.75  ? 105  GLU H C   1 
ATOM   6321  O O   . GLU H  1 105 ? 110.792 80.930  119.089 1.00 36.40  ? 105  GLU H O   1 
ATOM   6322  C CB  . GLU H  1 105 ? 108.383 79.133  117.640 1.00 38.74  ? 105  GLU H CB  1 
ATOM   6323  C CG  . GLU H  1 105 ? 109.139 77.830  117.856 1.00 37.65  ? 105  GLU H CG  1 
ATOM   6324  C CD  . GLU H  1 105 ? 108.349 76.812  118.651 1.00 42.84  ? 105  GLU H CD  1 
ATOM   6325  O OE1 . GLU H  1 105 ? 107.600 77.202  119.574 1.00 42.60  ? 105  GLU H OE1 1 
ATOM   6326  O OE2 . GLU H  1 105 ? 108.480 75.605  118.360 1.00 41.08  ? 105  GLU H OE2 1 
ATOM   6327  N N   . ILE H  1 106 ? 110.089 79.247  120.394 1.00 35.40  ? 106  ILE H N   1 
ATOM   6328  C CA  . ILE H  1 106 ? 111.418 79.119  121.024 1.00 35.23  ? 106  ILE H CA  1 
ATOM   6329  C C   . ILE H  1 106 ? 111.928 77.661  121.205 1.00 35.58  ? 106  ILE H C   1 
ATOM   6330  O O   . ILE H  1 106 ? 112.877 77.266  120.501 1.00 36.71  ? 106  ILE H O   1 
ATOM   6331  C CB  . ILE H  1 106 ? 111.504 79.866  122.372 1.00 35.40  ? 106  ILE H CB  1 
ATOM   6332  C CG1 . ILE H  1 106 ? 112.990 80.228  122.673 1.00 32.60  ? 106  ILE H CG1 1 
ATOM   6333  C CG2 . ILE H  1 106 ? 110.849 79.031  123.491 1.00 36.81  ? 106  ILE H CG2 1 
ATOM   6334  C CD1 . ILE H  1 106 ? 113.271 80.986  123.975 1.00 35.79  ? 106  ILE H CD1 1 
ATOM   6335  N N   . ASP I  1 1   ? 139.925 78.961  120.086 1.00 39.49  ? 1    ASP I N   1 
ATOM   6336  C CA  . ASP I  1 1   ? 138.804 78.523  119.190 1.00 40.92  ? 1    ASP I CA  1 
ATOM   6337  C C   . ASP I  1 1   ? 137.622 79.500  119.269 1.00 40.90  ? 1    ASP I C   1 
ATOM   6338  O O   . ASP I  1 1   ? 137.034 79.714  120.337 1.00 38.90  ? 1    ASP I O   1 
ATOM   6339  C CB  . ASP I  1 1   ? 138.375 77.093  119.532 1.00 42.07  ? 1    ASP I CB  1 
ATOM   6340  C CG  . ASP I  1 1   ? 138.117 76.251  118.298 1.00 44.06  ? 1    ASP I CG  1 
ATOM   6341  O OD1 . ASP I  1 1   ? 139.099 75.832  117.644 1.00 42.10  ? 1    ASP I OD1 1 
ATOM   6342  O OD2 . ASP I  1 1   ? 136.931 75.992  117.986 1.00 41.38  ? 1    ASP I OD2 1 
ATOM   6343  N N   . ILE I  1 2   ? 137.289 80.072  118.113 1.00 39.85  ? 2    ILE I N   1 
ATOM   6344  C CA  . ILE I  1 2   ? 136.370 81.209  117.998 1.00 38.64  ? 2    ILE I CA  1 
ATOM   6345  C C   . ILE I  1 2   ? 134.947 80.717  117.737 1.00 39.20  ? 2    ILE I C   1 
ATOM   6346  O O   . ILE I  1 2   ? 134.699 79.965  116.786 1.00 38.68  ? 2    ILE I O   1 
ATOM   6347  C CB  . ILE I  1 2   ? 136.839 82.174  116.869 1.00 39.22  ? 2    ILE I CB  1 
ATOM   6348  C CG1 . ILE I  1 2   ? 138.375 82.279  116.875 1.00 40.46  ? 2    ILE I CG1 1 
ATOM   6349  C CG2 . ILE I  1 2   ? 136.098 83.548  116.972 1.00 37.92  ? 2    ILE I CG2 1 
ATOM   6350  C CD1 . ILE I  1 2   ? 138.949 83.667  116.605 1.00 39.84  ? 2    ILE I CD1 1 
ATOM   6351  N N   . GLN I  1 3   ? 134.026 81.129  118.609 1.00 39.57  ? 3    GLN I N   1 
ATOM   6352  C CA  . GLN I  1 3   ? 132.623 80.698  118.578 1.00 38.36  ? 3    GLN I CA  1 
ATOM   6353  C C   . GLN I  1 3   ? 131.795 81.689  117.793 1.00 37.29  ? 3    GLN I C   1 
ATOM   6354  O O   . GLN I  1 3   ? 131.960 82.904  117.952 1.00 38.28  ? 3    GLN I O   1 
ATOM   6355  C CB  . GLN I  1 3   ? 132.049 80.671  120.001 1.00 39.99  ? 3    GLN I CB  1 
ATOM   6356  C CG  . GLN I  1 3   ? 132.124 79.342  120.756 1.00 41.68  ? 3    GLN I CG  1 
ATOM   6357  C CD  . GLN I  1 3   ? 133.541 78.971  121.146 1.00 46.75  ? 3    GLN I CD  1 
ATOM   6358  O OE1 . GLN I  1 3   ? 133.959 79.163  122.297 1.00 46.16  ? 3    GLN I OE1 1 
ATOM   6359  N NE2 . GLN I  1 3   ? 134.292 78.428  120.188 1.00 46.23  ? 3    GLN I NE2 1 
ATOM   6360  N N   . MET I  1 4   ? 130.891 81.191  116.958 1.00 36.41  ? 4    MET I N   1 
ATOM   6361  C CA  . MET I  1 4   ? 130.008 82.064  116.200 1.00 36.11  ? 4    MET I CA  1 
ATOM   6362  C C   . MET I  1 4   ? 128.584 81.846  116.668 1.00 35.99  ? 4    MET I C   1 
ATOM   6363  O O   . MET I  1 4   ? 128.060 80.737  116.549 1.00 37.69  ? 4    MET I O   1 
ATOM   6364  C CB  . MET I  1 4   ? 130.100 81.758  114.701 1.00 36.43  ? 4    MET I CB  1 
ATOM   6365  C CG  . MET I  1 4   ? 131.514 81.596  114.147 1.00 38.31  ? 4    MET I CG  1 
ATOM   6366  S SD  . MET I  1 4   ? 132.605 83.020  114.428 1.00 43.04  ? 4    MET I SD  1 
ATOM   6367  C CE  . MET I  1 4   ? 131.614 84.363  113.561 1.00 45.74  ? 4    MET I CE  1 
ATOM   6368  N N   . THR I  1 5   ? 127.952 82.882  117.208 1.00 34.79  ? 5    THR I N   1 
ATOM   6369  C CA  . THR I  1 5   ? 126.555 82.748  117.600 1.00 34.83  ? 5    THR I CA  1 
ATOM   6370  C C   . THR I  1 5   ? 125.651 83.268  116.474 1.00 34.22  ? 5    THR I C   1 
ATOM   6371  O O   . THR I  1 5   ? 125.667 84.455  116.141 1.00 33.23  ? 5    THR I O   1 
ATOM   6372  C CB  . THR I  1 5   ? 126.247 83.409  118.977 1.00 35.50  ? 5    THR I CB  1 
ATOM   6373  O OG1 . THR I  1 5   ? 127.385 83.288  119.848 1.00 34.45  ? 5    THR I OG1 1 
ATOM   6374  C CG2 . THR I  1 5   ? 125.050 82.739  119.635 1.00 35.58  ? 5    THR I CG2 1 
ATOM   6375  N N   . GLN I  1 6   ? 124.898 82.354  115.869 1.00 35.76  ? 6    GLN I N   1 
ATOM   6376  C CA  . GLN I  1 6   ? 123.965 82.664  114.788 1.00 36.76  ? 6    GLN I CA  1 
ATOM   6377  C C   . GLN I  1 6   ? 122.542 82.491  115.332 1.00 35.83  ? 6    GLN I C   1 
ATOM   6378  O O   . GLN I  1 6   ? 122.325 81.697  116.255 1.00 35.90  ? 6    GLN I O   1 
ATOM   6379  C CB  . GLN I  1 6   ? 124.243 81.720  113.607 1.00 36.51  ? 6    GLN I CB  1 
ATOM   6380  C CG  . GLN I  1 6   ? 123.268 81.790  112.412 1.00 34.22  ? 6    GLN I CG  1 
ATOM   6381  C CD  . GLN I  1 6   ? 123.873 81.195  111.140 1.00 39.08  ? 6    GLN I CD  1 
ATOM   6382  O OE1 . GLN I  1 6   ? 124.876 80.462  111.176 1.00 39.34  ? 6    GLN I OE1 1 
ATOM   6383  N NE2 . GLN I  1 6   ? 123.270 81.518  110.005 1.00 44.33  ? 6    GLN I NE2 1 
ATOM   6384  N N   . SER I  1 7   ? 121.586 83.244  114.778 1.00 36.42  ? 7    SER I N   1 
ATOM   6385  C CA  . SER I  1 7   ? 120.155 83.129  115.134 1.00 36.41  ? 7    SER I CA  1 
ATOM   6386  C C   . SER I  1 7   ? 119.278 83.789  114.073 1.00 38.50  ? 7    SER I C   1 
ATOM   6387  O O   . SER I  1 7   ? 119.715 84.763  113.445 1.00 37.72  ? 7    SER I O   1 
ATOM   6388  C CB  . SER I  1 7   ? 119.880 83.814  116.473 1.00 35.99  ? 7    SER I CB  1 
ATOM   6389  O OG  . SER I  1 7   ? 120.231 85.207  116.432 1.00 27.41  ? 7    SER I OG  1 
ATOM   6390  N N   . PRO I  1 8   ? 118.035 83.296  113.858 1.00 40.34  ? 8    PRO I N   1 
ATOM   6391  C CA  . PRO I  1 8   ? 117.203 82.139  114.265 1.00 40.96  ? 8    PRO I CA  1 
ATOM   6392  C C   . PRO I  1 8   ? 117.531 80.761  113.662 1.00 42.66  ? 8    PRO I C   1 
ATOM   6393  O O   . PRO I  1 8   ? 118.539 80.604  112.961 1.00 43.48  ? 8    PRO I O   1 
ATOM   6394  C CB  . PRO I  1 8   ? 115.809 82.544  113.754 1.00 41.49  ? 8    PRO I CB  1 
ATOM   6395  C CG  . PRO I  1 8   ? 116.090 83.350  112.535 1.00 39.89  ? 8    PRO I CG  1 
ATOM   6396  C CD  . PRO I  1 8   ? 117.249 84.241  113.036 1.00 40.33  ? 8    PRO I CD  1 
ATOM   6397  N N   . SER I  1 9   ? 116.647 79.792  113.940 1.00 43.62  ? 9    SER I N   1 
ATOM   6398  C CA  . SER I  1 9   ? 116.681 78.449  113.331 1.00 44.95  ? 9    SER I CA  1 
ATOM   6399  C C   . SER I  1 9   ? 115.696 78.279  112.171 1.00 46.03  ? 9    SER I C   1 
ATOM   6400  O O   . SER I  1 9   ? 116.018 77.614  111.176 1.00 47.40  ? 9    SER I O   1 
ATOM   6401  C CB  . SER I  1 9   ? 116.377 77.372  114.386 1.00 45.15  ? 9    SER I CB  1 
ATOM   6402  O OG  . SER I  1 9   ? 114.929 77.092  114.437 1.00 43.50  ? 9    SER I OG  1 
ATOM   6403  N N   . SER I  1 10  ? 114.494 78.834  112.320 1.00 46.54  ? 10   SER I N   1 
ATOM   6404  C CA  . SER I  1 10  ? 113.499 78.790  111.262 1.00 47.61  ? 10   SER I CA  1 
ATOM   6405  C C   . SER I  1 10  ? 113.081 80.234  111.075 1.00 47.63  ? 10   SER I C   1 
ATOM   6406  O O   . SER I  1 10  ? 112.521 80.877  112.001 1.00 48.67  ? 10   SER I O   1 
ATOM   6407  C CB  . SER I  1 10  ? 112.292 77.940  111.686 1.00 47.71  ? 10   SER I CB  1 
ATOM   6408  O OG  . SER I  1 10  ? 111.864 77.076  110.600 1.00 46.84  ? 10   SER I OG  1 
ATOM   6409  N N   . LEU I  1 11  ? 113.392 80.761  109.897 1.00 48.44  ? 11   LEU I N   1 
ATOM   6410  C CA  . LEU I  1 11  ? 112.873 82.043  109.484 1.00 49.34  ? 11   LEU I CA  1 
ATOM   6411  C C   . LEU I  1 11  ? 112.062 81.799  108.232 1.00 51.04  ? 11   LEU I C   1 
ATOM   6412  O O   . LEU I  1 11  ? 112.618 81.527  107.165 1.00 50.68  ? 11   LEU I O   1 
ATOM   6413  C CB  . LEU I  1 11  ? 114.001 83.021  109.201 1.00 49.87  ? 11   LEU I CB  1 
ATOM   6414  C CG  . LEU I  1 11  ? 113.499 84.463  109.155 1.00 45.16  ? 11   LEU I CG  1 
ATOM   6415  C CD1 . LEU I  1 11  ? 112.709 84.715  110.430 1.00 46.79  ? 11   LEU I CD1 1 
ATOM   6416  C CD2 . LEU I  1 11  ? 114.675 85.400  109.063 1.00 47.14  ? 11   LEU I CD2 1 
ATOM   6417  N N   . SER I  1 12  ? 110.745 81.905  108.368 1.00 52.93  ? 12   SER I N   1 
ATOM   6418  C CA  . SER I  1 12  ? 109.837 81.361  107.373 1.00 55.46  ? 12   SER I CA  1 
ATOM   6419  C C   . SER I  1 12  ? 108.822 82.395  106.901 1.00 56.74  ? 12   SER I C   1 
ATOM   6420  O O   . SER I  1 12  ? 107.704 82.483  107.428 1.00 57.98  ? 12   SER I O   1 
ATOM   6421  C CB  . SER I  1 12  ? 109.130 80.134  107.956 1.00 55.94  ? 12   SER I CB  1 
ATOM   6422  O OG  . SER I  1 12  ? 108.356 79.470  106.973 1.00 57.30  ? 12   SER I OG  1 
ATOM   6423  N N   . ALA I  1 13  ? 109.217 83.170  105.894 1.00 57.16  ? 13   ALA I N   1 
ATOM   6424  C CA  . ALA I  1 13  ? 108.414 84.289  105.411 1.00 57.51  ? 13   ALA I CA  1 
ATOM   6425  C C   . ALA I  1 13  ? 107.669 83.980  104.113 1.00 57.83  ? 13   ALA I C   1 
ATOM   6426  O O   . ALA I  1 13  ? 107.816 82.899  103.546 1.00 58.49  ? 13   ALA I O   1 
ATOM   6427  C CB  . ALA I  1 13  ? 109.289 85.529  105.253 1.00 57.50  ? 13   ALA I CB  1 
ATOM   6428  N N   . SER I  1 14  ? 106.867 84.946  103.664 1.00 57.01  ? 14   SER I N   1 
ATOM   6429  C CA  . SER I  1 14  ? 106.110 84.850  102.416 1.00 55.27  ? 14   SER I CA  1 
ATOM   6430  C C   . SER I  1 14  ? 106.789 85.631  101.293 1.00 54.63  ? 14   SER I C   1 
ATOM   6431  O O   . SER I  1 14  ? 107.451 86.644  101.536 1.00 54.60  ? 14   SER I O   1 
ATOM   6432  C CB  . SER I  1 14  ? 104.655 85.289  102.613 1.00 56.88  ? 14   SER I CB  1 
ATOM   6433  O OG  . SER I  1 14  ? 104.562 86.411  103.485 1.00 52.79  ? 14   SER I OG  1 
ATOM   6434  N N   . VAL I  1 15  ? 106.579 85.158  100.067 1.00 53.19  ? 15   VAL I N   1 
ATOM   6435  C CA  . VAL I  1 15  ? 107.455 85.433  98.922  1.00 51.26  ? 15   VAL I CA  1 
ATOM   6436  C C   . VAL I  1 15  ? 107.850 86.900  98.701  1.00 51.28  ? 15   VAL I C   1 
ATOM   6437  O O   . VAL I  1 15  ? 107.222 87.623  97.917  1.00 48.96  ? 15   VAL I O   1 
ATOM   6438  C CB  . VAL I  1 15  ? 106.884 84.824  97.609  1.00 51.29  ? 15   VAL I CB  1 
ATOM   6439  C CG1 . VAL I  1 15  ? 108.013 84.240  96.764  1.00 49.31  ? 15   VAL I CG1 1 
ATOM   6440  C CG2 . VAL I  1 15  ? 105.860 83.730  97.918  1.00 52.65  ? 15   VAL I CG2 1 
ATOM   6441  N N   . GLY I  1 16  ? 108.901 87.321  99.404  1.00 50.40  ? 16   GLY I N   1 
ATOM   6442  C CA  . GLY I  1 16  ? 109.508 88.621  99.140  1.00 50.18  ? 16   GLY I CA  1 
ATOM   6443  C C   . GLY I  1 16  ? 109.526 89.550  100.330 1.00 50.07  ? 16   GLY I C   1 
ATOM   6444  O O   . GLY I  1 16  ? 109.385 90.766  100.173 1.00 48.85  ? 16   GLY I O   1 
ATOM   6445  N N   . ASP I  1 17  ? 109.697 88.982  101.521 1.00 49.83  ? 17   ASP I N   1 
ATOM   6446  C CA  . ASP I  1 17  ? 109.908 89.797  102.702 1.00 49.50  ? 17   ASP I CA  1 
ATOM   6447  C C   . ASP I  1 17  ? 111.278 90.416  102.686 1.00 48.28  ? 17   ASP I C   1 
ATOM   6448  O O   . ASP I  1 17  ? 112.102 90.182  101.791 1.00 49.09  ? 17   ASP I O   1 
ATOM   6449  C CB  . ASP I  1 17  ? 109.834 88.955  103.976 1.00 50.43  ? 17   ASP I CB  1 
ATOM   6450  C CG  . ASP I  1 17  ? 108.503 89.050  104.656 1.00 50.57  ? 17   ASP I CG  1 
ATOM   6451  O OD1 . ASP I  1 17  ? 107.475 88.759  104.006 1.00 54.22  ? 17   ASP I OD1 1 
ATOM   6452  O OD2 . ASP I  1 17  ? 108.473 89.399  105.856 1.00 44.80  ? 17   ASP I OD2 1 
ATOM   6453  N N   . ARG I  1 18  ? 111.509 91.195  103.731 1.00 46.69  ? 18   ARG I N   1 
ATOM   6454  C CA  . ARG I  1 18  ? 112.843 91.589  104.088 1.00 44.71  ? 18   ARG I CA  1 
ATOM   6455  C C   . ARG I  1 18  ? 113.363 90.775  105.280 1.00 43.85  ? 18   ARG I C   1 
ATOM   6456  O O   . ARG I  1 18  ? 113.218 91.165  106.446 1.00 42.46  ? 18   ARG I O   1 
ATOM   6457  C CB  . ARG I  1 18  ? 112.908 93.083  104.358 1.00 43.71  ? 18   ARG I CB  1 
ATOM   6458  C CG  . ARG I  1 18  ? 114.276 93.613  104.083 1.00 44.02  ? 18   ARG I CG  1 
ATOM   6459  C CD  . ARG I  1 18  ? 115.212 93.330  105.238 1.00 36.43  ? 18   ARG I CD  1 
ATOM   6460  N NE  . ARG I  1 18  ? 115.248 94.481  106.120 1.00 38.21  ? 18   ARG I NE  1 
ATOM   6461  C CZ  . ARG I  1 18  ? 115.795 95.643  105.775 1.00 46.23  ? 18   ARG I CZ  1 
ATOM   6462  N NH1 . ARG I  1 18  ? 116.355 95.803  104.573 1.00 51.96  ? 18   ARG I NH1 1 
ATOM   6463  N NH2 . ARG I  1 18  ? 115.789 96.658  106.629 1.00 43.65  ? 18   ARG I NH2 1 
ATOM   6464  N N   . VAL I  1 19  ? 113.963 89.634  104.938 1.00 42.61  ? 19   VAL I N   1 
ATOM   6465  C CA  . VAL I  1 19  ? 114.680 88.744  105.864 1.00 41.55  ? 19   VAL I CA  1 
ATOM   6466  C C   . VAL I  1 19  ? 115.965 89.381  106.401 1.00 41.19  ? 19   VAL I C   1 
ATOM   6467  O O   . VAL I  1 19  ? 116.778 89.929  105.631 1.00 39.70  ? 19   VAL I O   1 
ATOM   6468  C CB  . VAL I  1 19  ? 115.032 87.397  105.163 1.00 42.19  ? 19   VAL I CB  1 
ATOM   6469  C CG1 . VAL I  1 19  ? 116.002 86.566  105.990 1.00 40.60  ? 19   VAL I CG1 1 
ATOM   6470  C CG2 . VAL I  1 19  ? 113.769 86.595  104.864 1.00 39.01  ? 19   VAL I CG2 1 
ATOM   6471  N N   . THR I  1 20  ? 116.145 89.277  107.720 1.00 40.31  ? 20   THR I N   1 
ATOM   6472  C CA  . THR I  1 20  ? 117.317 89.824  108.398 1.00 38.57  ? 20   THR I CA  1 
ATOM   6473  C C   . THR I  1 20  ? 117.948 88.763  109.315 1.00 37.01  ? 20   THR I C   1 
ATOM   6474  O O   . THR I  1 20  ? 117.552 88.625  110.474 1.00 36.46  ? 20   THR I O   1 
ATOM   6475  C CB  . THR I  1 20  ? 116.932 91.084  109.204 1.00 38.73  ? 20   THR I CB  1 
ATOM   6476  O OG1 . THR I  1 20  ? 115.929 91.827  108.493 1.00 41.44  ? 20   THR I OG1 1 
ATOM   6477  C CG2 . THR I  1 20  ? 118.145 91.967  109.466 1.00 40.65  ? 20   THR I CG2 1 
ATOM   6478  N N   . ILE I  1 21  ? 118.914 88.008  108.790 1.00 36.50  ? 21   ILE I N   1 
ATOM   6479  C CA  . ILE I  1 21  ? 119.640 87.013  109.592 1.00 35.19  ? 21   ILE I CA  1 
ATOM   6480  C C   . ILE I  1 21  ? 120.876 87.627  110.254 1.00 35.73  ? 21   ILE I C   1 
ATOM   6481  O O   . ILE I  1 21  ? 121.706 88.259  109.591 1.00 36.08  ? 21   ILE I O   1 
ATOM   6482  C CB  . ILE I  1 21  ? 120.048 85.747  108.783 1.00 35.28  ? 21   ILE I CB  1 
ATOM   6483  C CG1 . ILE I  1 21  ? 118.889 85.269  107.890 1.00 31.33  ? 21   ILE I CG1 1 
ATOM   6484  C CG2 . ILE I  1 21  ? 120.549 84.636  109.731 1.00 36.02  ? 21   ILE I CG2 1 
ATOM   6485  C CD1 . ILE I  1 21  ? 119.283 84.148  106.913 1.00 33.44  ? 21   ILE I CD1 1 
ATOM   6486  N N   . THR I  1 22  ? 120.971 87.424  111.571 1.00 36.23  ? 22   THR I N   1 
ATOM   6487  C CA  . THR I  1 22  ? 122.055 87.931  112.421 1.00 38.56  ? 22   THR I CA  1 
ATOM   6488  C C   . THR I  1 22  ? 123.054 86.844  112.774 1.00 40.30  ? 22   THR I C   1 
ATOM   6489  O O   . THR I  1 22  ? 122.660 85.707  113.103 1.00 38.46  ? 22   THR I O   1 
ATOM   6490  C CB  . THR I  1 22  ? 121.522 88.382  113.800 1.00 38.78  ? 22   THR I CB  1 
ATOM   6491  O OG1 . THR I  1 22  ? 120.844 87.281  114.441 1.00 40.09  ? 22   THR I OG1 1 
ATOM   6492  C CG2 . THR I  1 22  ? 120.549 89.580  113.656 1.00 38.45  ? 22   THR I CG2 1 
ATOM   6493  N N   . CYS I  1 23  ? 124.336 87.189  112.743 1.00 41.53  ? 23   CYS I N   1 
ATOM   6494  C CA  . CYS I  1 23  ? 125.374 86.306  113.266 1.00 42.89  ? 23   CYS I CA  1 
ATOM   6495  C C   . CYS I  1 23  ? 126.368 87.150  114.072 1.00 44.75  ? 23   CYS I C   1 
ATOM   6496  O O   . CYS I  1 23  ? 126.294 88.388  114.047 1.00 45.42  ? 23   CYS I O   1 
ATOM   6497  C CB  . CYS I  1 23  ? 125.999 85.468  112.122 1.00 43.68  ? 23   CYS I CB  1 
ATOM   6498  S SG  . CYS I  1 23  ? 127.636 84.694  112.396 1.00 42.03  ? 23   CYS I SG  1 
ATOM   6499  N N   . ARG I  1 24  ? 127.284 86.489  114.779 1.00 45.97  ? 24   ARG I N   1 
ATOM   6500  C CA  . ARG I  1 24  ? 127.915 87.113  115.932 1.00 46.51  ? 24   ARG I CA  1 
ATOM   6501  C C   . ARG I  1 24  ? 129.155 86.342  116.373 1.00 47.72  ? 24   ARG I C   1 
ATOM   6502  O O   . ARG I  1 24  ? 129.163 85.112  116.324 1.00 48.23  ? 24   ARG I O   1 
ATOM   6503  C CB  . ARG I  1 24  ? 126.899 87.115  117.066 1.00 46.24  ? 24   ARG I CB  1 
ATOM   6504  C CG  . ARG I  1 24  ? 127.049 88.253  117.982 1.00 45.83  ? 24   ARG I CG  1 
ATOM   6505  C CD  . ARG I  1 24  ? 126.719 87.825  119.383 1.00 41.63  ? 24   ARG I CD  1 
ATOM   6506  N NE  . ARG I  1 24  ? 127.468 88.655  120.309 1.00 45.62  ? 24   ARG I NE  1 
ATOM   6507  C CZ  . ARG I  1 24  ? 127.216 89.942  120.525 1.00 44.56  ? 24   ARG I CZ  1 
ATOM   6508  N NH1 . ARG I  1 24  ? 126.218 90.553  119.893 1.00 46.97  ? 24   ARG I NH1 1 
ATOM   6509  N NH2 . ARG I  1 24  ? 127.959 90.624  121.382 1.00 50.66  ? 24   ARG I NH2 1 
ATOM   6510  N N   . ALA I  1 25  ? 130.193 87.045  116.821 1.00 48.43  ? 25   ALA I N   1 
ATOM   6511  C CA  . ALA I  1 25  ? 131.495 86.397  117.044 1.00 50.07  ? 25   ALA I CA  1 
ATOM   6512  C C   . ALA I  1 25  ? 131.990 86.419  118.501 1.00 51.59  ? 25   ALA I C   1 
ATOM   6513  O O   . ALA I  1 25  ? 132.260 87.505  119.054 1.00 52.63  ? 25   ALA I O   1 
ATOM   6514  C CB  . ALA I  1 25  ? 132.540 87.003  116.110 1.00 50.04  ? 25   ALA I CB  1 
ATOM   6515  N N   . SER I  1 26  ? 132.126 85.239  119.118 1.00 53.02  ? 26   SER I N   1 
ATOM   6516  C CA  . SER I  1 26  ? 132.591 85.153  120.512 1.00 54.81  ? 26   SER I CA  1 
ATOM   6517  C C   . SER I  1 26  ? 133.532 86.308  120.873 1.00 55.38  ? 26   SER I C   1 
ATOM   6518  O O   . SER I  1 26  ? 133.414 86.901  121.948 1.00 56.58  ? 26   SER I O   1 
ATOM   6519  C CB  . SER I  1 26  ? 133.293 83.819  120.781 1.00 54.46  ? 26   SER I CB  1 
ATOM   6520  O OG  . SER I  1 26  ? 134.671 83.777  120.205 1.00 50.41  ? 26   SER I OG  1 
ATOM   6521  N N   . GLN I  1 27  ? 134.460 86.614  119.961 1.00 55.61  ? 27   GLN I N   1 
ATOM   6522  C CA  . GLN I  1 27  ? 135.440 87.697  120.128 1.00 55.05  ? 27   GLN I CA  1 
ATOM   6523  C C   . GLN I  1 27  ? 135.515 88.622  118.894 1.00 54.37  ? 27   GLN I C   1 
ATOM   6524  O O   . GLN I  1 27  ? 134.722 88.482  117.963 1.00 53.09  ? 27   GLN I O   1 
ATOM   6525  C CB  . GLN I  1 27  ? 136.823 87.119  120.466 1.00 55.17  ? 27   GLN I CB  1 
ATOM   6526  C CG  . GLN I  1 27  ? 137.594 86.560  119.261 1.00 53.23  ? 27   GLN I CG  1 
ATOM   6527  C CD  . GLN I  1 27  ? 139.056 86.312  119.575 1.00 58.12  ? 27   GLN I CD  1 
ATOM   6528  O OE1 . GLN I  1 27  ? 139.387 85.474  120.414 1.00 60.93  ? 27   GLN I OE1 1 
ATOM   6529  N NE2 . GLN I  1 27  ? 139.941 87.030  118.892 1.00 51.59  ? 27   GLN I NE2 1 
ATOM   6530  N N   . SER I  1 28  ? 136.473 89.555  118.889 1.00 53.33  ? 28   SER I N   1 
ATOM   6531  C CA  . SER I  1 28  ? 136.579 90.565  117.821 1.00 53.47  ? 28   SER I CA  1 
ATOM   6532  C C   . SER I  1 28  ? 137.320 90.044  116.585 1.00 53.48  ? 28   SER I C   1 
ATOM   6533  O O   . SER I  1 28  ? 138.464 89.583  116.685 1.00 54.88  ? 28   SER I O   1 
ATOM   6534  C CB  . SER I  1 28  ? 137.247 91.837  118.351 1.00 53.41  ? 28   SER I CB  1 
ATOM   6535  O OG  . SER I  1 28  ? 137.495 92.761  117.302 1.00 53.34  ? 28   SER I OG  1 
ATOM   6536  N N   . ILE I  1 29  ? 136.676 90.132  115.420 1.00 51.59  ? 29   ILE I N   1 
ATOM   6537  C CA  . ILE I  1 29  ? 137.177 89.426  114.230 1.00 50.73  ? 29   ILE I CA  1 
ATOM   6538  C C   . ILE I  1 29  ? 137.327 90.235  112.921 1.00 50.75  ? 29   ILE I C   1 
ATOM   6539  O O   . ILE I  1 29  ? 137.293 89.647  111.817 1.00 50.79  ? 29   ILE I O   1 
ATOM   6540  C CB  . ILE I  1 29  ? 136.392 88.089  113.971 1.00 50.36  ? 29   ILE I CB  1 
ATOM   6541  C CG1 . ILE I  1 29  ? 134.936 88.344  113.561 1.00 46.06  ? 29   ILE I CG1 1 
ATOM   6542  C CG2 . ILE I  1 29  ? 136.454 87.162  115.190 1.00 51.58  ? 29   ILE I CG2 1 
ATOM   6543  C CD1 . ILE I  1 29  ? 134.635 87.979  112.117 1.00 28.61  ? 29   ILE I CD1 1 
ATOM   6544  N N   . SER I  1 30  ? 137.520 91.554  113.034 1.00 50.83  ? 30   SER I N   1 
ATOM   6545  C CA  . SER I  1 30  ? 137.673 92.395  111.843 1.00 50.19  ? 30   SER I CA  1 
ATOM   6546  C C   . SER I  1 30  ? 136.632 92.069  110.781 1.00 49.85  ? 30   SER I C   1 
ATOM   6547  O O   . SER I  1 30  ? 135.439 92.279  110.997 1.00 50.40  ? 30   SER I O   1 
ATOM   6548  C CB  . SER I  1 30  ? 139.066 92.261  111.244 1.00 49.85  ? 30   SER I CB  1 
ATOM   6549  O OG  . SER I  1 30  ? 139.097 92.951  109.978 1.00 51.55  ? 30   SER I OG  1 
ATOM   6550  N N   . SER I  1 31  ? 137.081 91.528  109.649 1.00 49.01  ? 31   SER I N   1 
ATOM   6551  C CA  . SER I  1 31  ? 136.205 91.393  108.492 1.00 48.99  ? 31   SER I CA  1 
ATOM   6552  C C   . SER I  1 31  ? 136.520 90.197  107.582 1.00 50.27  ? 31   SER I C   1 
ATOM   6553  O O   . SER I  1 31  ? 136.857 90.361  106.389 1.00 49.96  ? 31   SER I O   1 
ATOM   6554  C CB  . SER I  1 31  ? 136.193 92.696  107.691 1.00 48.69  ? 31   SER I CB  1 
ATOM   6555  O OG  . SER I  1 31  ? 135.038 92.766  106.860 1.00 45.47  ? 31   SER I OG  1 
ATOM   6556  N N   . TYR I  1 32  ? 136.414 89.001  108.150 1.00 49.42  ? 32   TYR I N   1 
ATOM   6557  C CA  . TYR I  1 32  ? 136.580 87.794  107.366 1.00 49.54  ? 32   TYR I CA  1 
ATOM   6558  C C   . TYR I  1 32  ? 135.396 86.877  107.594 1.00 48.15  ? 32   TYR I C   1 
ATOM   6559  O O   . TYR I  1 32  ? 135.449 85.696  107.253 1.00 47.43  ? 32   TYR I O   1 
ATOM   6560  C CB  . TYR I  1 32  ? 137.891 87.094  107.722 1.00 51.33  ? 32   TYR I CB  1 
ATOM   6561  C CG  . TYR I  1 32  ? 139.129 87.866  107.321 1.00 55.85  ? 32   TYR I CG  1 
ATOM   6562  C CD1 . TYR I  1 32  ? 139.487 89.047  107.978 1.00 56.58  ? 32   TYR I CD1 1 
ATOM   6563  C CD2 . TYR I  1 32  ? 139.962 87.402  106.308 1.00 58.47  ? 32   TYR I CD2 1 
ATOM   6564  C CE1 . TYR I  1 32  ? 140.626 89.754  107.622 1.00 56.44  ? 32   TYR I CE1 1 
ATOM   6565  C CE2 . TYR I  1 32  ? 141.111 88.102  105.949 1.00 57.94  ? 32   TYR I CE2 1 
ATOM   6566  C CZ  . TYR I  1 32  ? 141.434 89.276  106.608 1.00 55.19  ? 32   TYR I CZ  1 
ATOM   6567  O OH  . TYR I  1 32  ? 142.565 89.974  106.252 1.00 55.69  ? 32   TYR I OH  1 
ATOM   6568  N N   . LEU I  1 33  ? 134.335 87.419  108.192 1.00 46.53  ? 33   LEU I N   1 
ATOM   6569  C CA  . LEU I  1 33  ? 133.089 86.680  108.303 1.00 44.92  ? 33   LEU I CA  1 
ATOM   6570  C C   . LEU I  1 33  ? 132.619 86.404  106.885 1.00 44.19  ? 33   LEU I C   1 
ATOM   6571  O O   . LEU I  1 33  ? 132.580 87.333  106.023 1.00 43.84  ? 33   LEU I O   1 
ATOM   6572  C CB  . LEU I  1 33  ? 132.033 87.444  109.119 1.00 45.13  ? 33   LEU I CB  1 
ATOM   6573  C CG  . LEU I  1 33  ? 130.576 86.948  109.248 1.00 46.87  ? 33   LEU I CG  1 
ATOM   6574  C CD1 . LEU I  1 33  ? 130.333 85.551  108.722 1.00 44.51  ? 33   LEU I CD1 1 
ATOM   6575  C CD2 . LEU I  1 33  ? 130.114 87.009  110.694 1.00 43.77  ? 33   LEU I CD2 1 
ATOM   6576  N N   . ASN I  1 34  ? 132.301 85.134  106.627 1.00 41.96  ? 34   ASN I N   1 
ATOM   6577  C CA  . ASN I  1 34  ? 131.848 84.728  105.307 1.00 40.88  ? 34   ASN I CA  1 
ATOM   6578  C C   . ASN I  1 34  ? 130.522 83.981  105.376 1.00 40.52  ? 34   ASN I C   1 
ATOM   6579  O O   . ASN I  1 34  ? 130.366 83.041  106.149 1.00 41.80  ? 34   ASN I O   1 
ATOM   6580  C CB  . ASN I  1 34  ? 132.904 83.875  104.562 1.00 40.32  ? 34   ASN I CB  1 
ATOM   6581  C CG  . ASN I  1 34  ? 134.325 84.052  105.117 1.00 43.16  ? 34   ASN I CG  1 
ATOM   6582  O OD1 . ASN I  1 34  ? 135.215 84.613  104.442 1.00 45.56  ? 34   ASN I OD1 1 
ATOM   6583  N ND2 . ASN I  1 34  ? 134.547 83.549  106.331 1.00 51.57  ? 34   ASN I ND2 1 
ATOM   6584  N N   . TRP I  1 35  ? 129.582 84.410  104.543 1.00 38.44  ? 35   TRP I N   1 
ATOM   6585  C CA  . TRP I  1 35  ? 128.255 83.813  104.470 1.00 36.79  ? 35   TRP I CA  1 
ATOM   6586  C C   . TRP I  1 35  ? 128.181 82.740  103.381 1.00 36.10  ? 35   TRP I C   1 
ATOM   6587  O O   . TRP I  1 35  ? 128.358 83.040  102.189 1.00 36.03  ? 35   TRP I O   1 
ATOM   6588  C CB  . TRP I  1 35  ? 127.224 84.907  104.184 1.00 39.18  ? 35   TRP I CB  1 
ATOM   6589  C CG  . TRP I  1 35  ? 127.120 85.973  105.249 1.00 38.31  ? 35   TRP I CG  1 
ATOM   6590  C CD1 . TRP I  1 35  ? 127.673 87.225  105.223 1.00 40.99  ? 35   TRP I CD1 1 
ATOM   6591  C CD2 . TRP I  1 35  ? 126.398 85.881  106.482 1.00 39.73  ? 35   TRP I CD2 1 
ATOM   6592  N NE1 . TRP I  1 35  ? 127.343 87.915  106.367 1.00 44.64  ? 35   TRP I NE1 1 
ATOM   6593  C CE2 . TRP I  1 35  ? 126.559 87.115  107.156 1.00 43.51  ? 35   TRP I CE2 1 
ATOM   6594  C CE3 . TRP I  1 35  ? 125.628 84.875  107.084 1.00 38.65  ? 35   TRP I CE3 1 
ATOM   6595  C CZ2 . TRP I  1 35  ? 125.985 87.365  108.408 1.00 39.78  ? 35   TRP I CZ2 1 
ATOM   6596  C CZ3 . TRP I  1 35  ? 125.054 85.126  108.325 1.00 41.41  ? 35   TRP I CZ3 1 
ATOM   6597  C CH2 . TRP I  1 35  ? 125.235 86.364  108.971 1.00 39.07  ? 35   TRP I CH2 1 
ATOM   6598  N N   . TYR I  1 36  ? 127.914 81.500  103.780 1.00 36.23  ? 36   TYR I N   1 
ATOM   6599  C CA  . TYR I  1 36  ? 127.773 80.402  102.826 1.00 35.56  ? 36   TYR I CA  1 
ATOM   6600  C C   . TYR I  1 36  ? 126.302 79.997  102.653 1.00 35.20  ? 36   TYR I C   1 
ATOM   6601  O O   . TYR I  1 36  ? 125.475 80.299  103.518 1.00 33.86  ? 36   TYR I O   1 
ATOM   6602  C CB  . TYR I  1 36  ? 128.598 79.209  103.293 1.00 34.97  ? 36   TYR I CB  1 
ATOM   6603  C CG  . TYR I  1 36  ? 130.063 79.261  102.922 1.00 34.32  ? 36   TYR I CG  1 
ATOM   6604  C CD1 . TYR I  1 36  ? 131.027 79.671  103.843 1.00 37.92  ? 36   TYR I CD1 1 
ATOM   6605  C CD2 . TYR I  1 36  ? 130.486 78.874  101.653 1.00 35.84  ? 36   TYR I CD2 1 
ATOM   6606  C CE1 . TYR I  1 36  ? 132.379 79.702  103.502 1.00 36.52  ? 36   TYR I CE1 1 
ATOM   6607  C CE2 . TYR I  1 36  ? 131.829 78.906  101.299 1.00 32.53  ? 36   TYR I CE2 1 
ATOM   6608  C CZ  . TYR I  1 36  ? 132.771 79.316  102.230 1.00 32.72  ? 36   TYR I CZ  1 
ATOM   6609  O OH  . TYR I  1 36  ? 134.104 79.342  101.880 1.00 29.29  ? 36   TYR I OH  1 
ATOM   6610  N N   . GLN I  1 37  ? 125.973 79.316  101.552 1.00 34.62  ? 37   GLN I N   1 
ATOM   6611  C CA  . GLN I  1 37  ? 124.577 78.937  101.252 1.00 35.74  ? 37   GLN I CA  1 
ATOM   6612  C C   . GLN I  1 37  ? 124.407 77.451  100.895 1.00 35.95  ? 37   GLN I C   1 
ATOM   6613  O O   . GLN I  1 37  ? 124.615 77.069  99.710  1.00 36.12  ? 37   GLN I O   1 
ATOM   6614  C CB  . GLN I  1 37  ? 124.018 79.804  100.098 1.00 34.38  ? 37   GLN I CB  1 
ATOM   6615  C CG  . GLN I  1 37  ? 122.471 79.964  100.087 1.00 33.28  ? 37   GLN I CG  1 
ATOM   6616  C CD  . GLN I  1 37  ? 121.890 80.523  98.772  1.00 34.46  ? 37   GLN I CD  1 
ATOM   6617  O OE1 . GLN I  1 37  ? 122.505 80.433  97.707  1.00 35.42  ? 37   GLN I OE1 1 
ATOM   6618  N NE2 . GLN I  1 37  ? 120.689 81.090  98.856  1.00 26.47  ? 37   GLN I NE2 1 
ATOM   6619  N N   . GLN I  1 38  ? 124.035 76.605  101.869 1.00 36.85  ? 38   GLN I N   1 
ATOM   6620  C CA  . GLN I  1 38  ? 123.756 75.231  101.466 1.00 38.45  ? 38   GLN I CA  1 
ATOM   6621  C C   . GLN I  1 38  ? 122.261 75.039  101.260 1.00 39.94  ? 38   GLN I C   1 
ATOM   6622  O O   . GLN I  1 38  ? 121.472 75.211  102.200 1.00 40.09  ? 38   GLN I O   1 
ATOM   6623  C CB  . GLN I  1 38  ? 124.265 74.231  102.493 1.00 37.99  ? 38   GLN I CB  1 
ATOM   6624  C CG  . GLN I  1 38  ? 124.354 72.834  101.955 1.00 31.10  ? 38   GLN I CG  1 
ATOM   6625  C CD  . GLN I  1 38  ? 124.996 71.929  102.957 1.00 30.04  ? 38   GLN I CD  1 
ATOM   6626  O OE1 . GLN I  1 38  ? 124.779 72.068  104.170 1.00 18.67  ? 38   GLN I OE1 1 
ATOM   6627  N NE2 . GLN I  1 38  ? 125.820 70.999  102.491 1.00 37.71  ? 38   GLN I NE2 1 
ATOM   6628  N N   . LYS I  1 39  ? 121.874 74.698  100.028 1.00 42.28  ? 39   LYS I N   1 
ATOM   6629  C CA  . LYS I  1 39  ? 120.514 74.222  99.731  1.00 44.72  ? 39   LYS I CA  1 
ATOM   6630  C C   . LYS I  1 39  ? 120.527 72.712  99.895  1.00 45.28  ? 39   LYS I C   1 
ATOM   6631  O O   . LYS I  1 39  ? 121.396 72.052  99.326  1.00 46.06  ? 39   LYS I O   1 
ATOM   6632  C CB  . LYS I  1 39  ? 120.080 74.518  98.291  1.00 45.70  ? 39   LYS I CB  1 
ATOM   6633  C CG  . LYS I  1 39  ? 120.634 75.783  97.654  1.00 45.03  ? 39   LYS I CG  1 
ATOM   6634  C CD  . LYS I  1 39  ? 119.614 76.316  96.639  1.00 45.73  ? 39   LYS I CD  1 
ATOM   6635  C CE  . LYS I  1 39  ? 118.386 76.852  97.355  1.00 43.66  ? 39   LYS I CE  1 
ATOM   6636  N NZ  . LYS I  1 39  ? 117.160 76.663  96.500  1.00 39.05  ? 39   LYS I NZ  1 
ATOM   6637  N N   . PRO I  1 40  ? 119.568 72.153  100.659 1.00 45.44  ? 40   PRO I N   1 
ATOM   6638  C CA  . PRO I  1 40  ? 119.552 70.728  101.018 1.00 45.87  ? 40   PRO I CA  1 
ATOM   6639  C C   . PRO I  1 40  ? 120.181 69.762  100.003 1.00 45.92  ? 40   PRO I C   1 
ATOM   6640  O O   . PRO I  1 40  ? 119.970 69.898  98.783  1.00 45.62  ? 40   PRO I O   1 
ATOM   6641  C CB  . PRO I  1 40  ? 118.058 70.429  101.159 1.00 45.09  ? 40   PRO I CB  1 
ATOM   6642  C CG  . PRO I  1 40  ? 117.457 71.741  101.613 1.00 45.56  ? 40   PRO I CG  1 
ATOM   6643  C CD  . PRO I  1 40  ? 118.418 72.862  101.252 1.00 44.40  ? 40   PRO I CD  1 
ATOM   6644  N N   . GLY I  1 41  ? 120.939 68.793  100.525 1.00 46.39  ? 41   GLY I N   1 
ATOM   6645  C CA  . GLY I  1 41  ? 121.592 67.756  99.715  1.00 46.48  ? 41   GLY I CA  1 
ATOM   6646  C C   . GLY I  1 41  ? 122.747 68.252  98.862  1.00 47.48  ? 41   GLY I C   1 
ATOM   6647  O O   . GLY I  1 41  ? 123.475 67.454  98.256  1.00 47.67  ? 41   GLY I O   1 
ATOM   6648  N N   . LYS I  1 42  ? 122.901 69.577  98.824  1.00 47.05  ? 42   LYS I N   1 
ATOM   6649  C CA  . LYS I  1 42  ? 123.899 70.242  97.979  1.00 45.23  ? 42   LYS I CA  1 
ATOM   6650  C C   . LYS I  1 42  ? 125.043 70.747  98.840  1.00 45.62  ? 42   LYS I C   1 
ATOM   6651  O O   . LYS I  1 42  ? 125.084 70.490  100.047 1.00 46.04  ? 42   LYS I O   1 
ATOM   6652  C CB  . LYS I  1 42  ? 123.274 71.440  97.234  1.00 44.83  ? 42   LYS I CB  1 
ATOM   6653  C CG  . LYS I  1 42  ? 122.387 71.041  96.006  1.00 42.34  ? 42   LYS I CG  1 
ATOM   6654  C CD  . LYS I  1 42  ? 123.193 70.287  94.949  1.00 39.25  ? 42   LYS I CD  1 
ATOM   6655  C CE  . LYS I  1 42  ? 122.278 69.785  93.836  1.00 37.74  ? 42   LYS I CE  1 
ATOM   6656  N NZ  . LYS I  1 42  ? 123.029 69.099  92.746  1.00 39.82  ? 42   LYS I NZ  1 
ATOM   6657  N N   . ALA I  1 43  ? 125.972 71.463  98.209  1.00 45.12  ? 43   ALA I N   1 
ATOM   6658  C CA  . ALA I  1 43  ? 127.189 71.949  98.852  1.00 44.54  ? 43   ALA I CA  1 
ATOM   6659  C C   . ALA I  1 43  ? 127.193 73.477  98.823  1.00 46.20  ? 43   ALA I C   1 
ATOM   6660  O O   . ALA I  1 43  ? 126.666 74.075  97.879  1.00 48.26  ? 43   ALA I O   1 
ATOM   6661  C CB  . ALA I  1 43  ? 128.409 71.396  98.136  1.00 45.43  ? 43   ALA I CB  1 
ATOM   6662  N N   . PRO I  1 44  ? 127.806 74.114  99.839  1.00 45.16  ? 44   PRO I N   1 
ATOM   6663  C CA  . PRO I  1 44  ? 127.460 75.507  99.992  1.00 44.53  ? 44   PRO I CA  1 
ATOM   6664  C C   . PRO I  1 44  ? 128.449 76.422  99.286  1.00 44.60  ? 44   PRO I C   1 
ATOM   6665  O O   . PRO I  1 44  ? 129.655 76.153  99.213  1.00 44.27  ? 44   PRO I O   1 
ATOM   6666  C CB  . PRO I  1 44  ? 127.502 75.718  101.518 1.00 44.55  ? 44   PRO I CB  1 
ATOM   6667  C CG  . PRO I  1 44  ? 128.535 74.677  102.000 1.00 44.23  ? 44   PRO I CG  1 
ATOM   6668  C CD  . PRO I  1 44  ? 128.798 73.697  100.858 1.00 46.12  ? 44   PRO I CD  1 
ATOM   6669  N N   . LYS I  1 45  ? 127.899 77.509  98.777  1.00 42.12  ? 45   LYS I N   1 
ATOM   6670  C CA  . LYS I  1 45  ? 128.591 78.380  97.864  1.00 38.38  ? 45   LYS I CA  1 
ATOM   6671  C C   . LYS I  1 45  ? 128.810 79.671  98.623  1.00 39.24  ? 45   LYS I C   1 
ATOM   6672  O O   . LYS I  1 45  ? 127.974 80.064  99.442  1.00 40.92  ? 45   LYS I O   1 
ATOM   6673  C CB  . LYS I  1 45  ? 127.704 78.606  96.634  1.00 37.63  ? 45   LYS I CB  1 
ATOM   6674  C CG  . LYS I  1 45  ? 127.181 77.300  96.008  1.00 37.90  ? 45   LYS I CG  1 
ATOM   6675  C CD  . LYS I  1 45  ? 125.779 77.446  95.417  1.00 32.11  ? 45   LYS I CD  1 
ATOM   6676  C CE  . LYS I  1 45  ? 125.253 76.111  94.883  1.00 19.91  ? 45   LYS I CE  1 
ATOM   6677  N NZ  . LYS I  1 45  ? 126.072 75.538  93.780  1.00 18.79  ? 45   LYS I NZ  1 
ATOM   6678  N N   . LEU I  1 46  ? 129.937 80.324  98.371  1.00 39.86  ? 46   LEU I N   1 
ATOM   6679  C CA  . LEU I  1 46  ? 130.227 81.588  99.024  1.00 39.38  ? 46   LEU I CA  1 
ATOM   6680  C C   . LEU I  1 46  ? 129.417 82.706  98.375  1.00 40.38  ? 46   LEU I C   1 
ATOM   6681  O O   . LEU I  1 46  ? 129.443 82.891  97.153  1.00 39.39  ? 46   LEU I O   1 
ATOM   6682  C CB  . LEU I  1 46  ? 131.723 81.887  98.963  1.00 38.98  ? 46   LEU I CB  1 
ATOM   6683  C CG  . LEU I  1 46  ? 132.399 82.627  100.119 1.00 40.70  ? 46   LEU I CG  1 
ATOM   6684  C CD1 . LEU I  1 46  ? 131.533 82.723  101.379 1.00 40.53  ? 46   LEU I CD1 1 
ATOM   6685  C CD2 . LEU I  1 46  ? 133.729 81.952  100.420 1.00 38.55  ? 46   LEU I CD2 1 
ATOM   6686  N N   . LEU I  1 47  ? 128.693 83.445  99.216  1.00 39.98  ? 47   LEU I N   1 
ATOM   6687  C CA  . LEU I  1 47  ? 127.780 84.497  98.775  1.00 38.81  ? 47   LEU I CA  1 
ATOM   6688  C C   . LEU I  1 47  ? 128.348 85.865  99.094  1.00 38.49  ? 47   LEU I C   1 
ATOM   6689  O O   . LEU I  1 47  ? 128.575 86.682  98.197  1.00 39.58  ? 47   LEU I O   1 
ATOM   6690  C CB  . LEU I  1 47  ? 126.433 84.367  99.484  1.00 38.02  ? 47   LEU I CB  1 
ATOM   6691  C CG  . LEU I  1 47  ? 125.615 83.076  99.417  1.00 35.60  ? 47   LEU I CG  1 
ATOM   6692  C CD1 . LEU I  1 47  ? 124.536 83.166  100.487 1.00 29.93  ? 47   LEU I CD1 1 
ATOM   6693  C CD2 . LEU I  1 47  ? 124.999 82.836  98.028  1.00 26.51  ? 47   LEU I CD2 1 
ATOM   6694  N N   . ILE I  1 48  ? 128.546 86.129  100.380 1.00 37.21  ? 48   ILE I N   1 
ATOM   6695  C CA  . ILE I  1 48  ? 129.273 87.313  100.770 1.00 36.92  ? 48   ILE I CA  1 
ATOM   6696  C C   . ILE I  1 48  ? 130.595 86.834  101.381 1.00 37.26  ? 48   ILE I C   1 
ATOM   6697  O O   . ILE I  1 48  ? 130.700 85.690  101.897 1.00 39.10  ? 48   ILE I O   1 
ATOM   6698  C CB  . ILE I  1 48  ? 128.460 88.204  101.743 1.00 36.17  ? 48   ILE I CB  1 
ATOM   6699  C CG1 . ILE I  1 48  ? 127.148 88.654  101.076 1.00 35.70  ? 48   ILE I CG1 1 
ATOM   6700  C CG2 . ILE I  1 48  ? 129.257 89.433  102.113 1.00 34.51  ? 48   ILE I CG2 1 
ATOM   6701  C CD1 . ILE I  1 48  ? 126.052 89.083  102.052 1.00 35.51  ? 48   ILE I CD1 1 
ATOM   6702  N N   . TYR I  1 49  ? 131.610 87.679  101.316 1.00 38.32  ? 49   TYR I N   1 
ATOM   6703  C CA  . TYR I  1 49  ? 132.809 87.381  102.065 1.00 39.91  ? 49   TYR I CA  1 
ATOM   6704  C C   . TYR I  1 49  ? 133.574 88.644  102.313 1.00 38.96  ? 49   TYR I C   1 
ATOM   6705  O O   . TYR I  1 49  ? 133.356 89.678  101.650 1.00 36.15  ? 49   TYR I O   1 
ATOM   6706  C CB  . TYR I  1 49  ? 133.694 86.390  101.324 1.00 43.65  ? 49   TYR I CB  1 
ATOM   6707  C CG  . TYR I  1 49  ? 134.293 86.950  100.066 1.00 45.24  ? 49   TYR I CG  1 
ATOM   6708  C CD1 . TYR I  1 49  ? 134.742 88.268  99.998  1.00 47.47  ? 49   TYR I CD1 1 
ATOM   6709  C CD2 . TYR I  1 49  ? 134.442 86.153  98.952  1.00 46.96  ? 49   TYR I CD2 1 
ATOM   6710  C CE1 . TYR I  1 49  ? 135.292 88.779  98.849  1.00 55.37  ? 49   TYR I CE1 1 
ATOM   6711  C CE2 . TYR I  1 49  ? 135.017 86.644  97.804  1.00 49.08  ? 49   TYR I CE2 1 
ATOM   6712  C CZ  . TYR I  1 49  ? 135.430 87.961  97.748  1.00 51.99  ? 49   TYR I CZ  1 
ATOM   6713  O OH  . TYR I  1 49  ? 135.990 88.443  96.585  1.00 52.88  ? 49   TYR I OH  1 
ATOM   6714  N N   . ALA I  1 50  ? 134.507 88.545  103.251 1.00 39.32  ? 50   ALA I N   1 
ATOM   6715  C CA  . ALA I  1 50  ? 135.040 89.717  103.896 1.00 38.36  ? 50   ALA I CA  1 
ATOM   6716  C C   . ALA I  1 50  ? 133.854 90.587  104.342 1.00 39.06  ? 50   ALA I C   1 
ATOM   6717  O O   . ALA I  1 50  ? 133.991 91.803  104.489 1.00 40.20  ? 50   ALA I O   1 
ATOM   6718  C CB  . ALA I  1 50  ? 135.979 90.476  102.958 1.00 38.14  ? 50   ALA I CB  1 
ATOM   6719  N N   . ALA I  1 51  ? 132.691 89.949  104.523 1.00 39.63  ? 51   ALA I N   1 
ATOM   6720  C CA  . ALA I  1 51  ? 131.499 90.561  105.133 1.00 39.96  ? 51   ALA I CA  1 
ATOM   6721  C C   . ALA I  1 51  ? 130.639 91.420  104.206 1.00 40.21  ? 51   ALA I C   1 
ATOM   6722  O O   . ALA I  1 51  ? 129.414 91.286  104.191 1.00 40.05  ? 51   ALA I O   1 
ATOM   6723  C CB  . ALA I  1 51  ? 131.876 91.354  106.402 1.00 39.90  ? 51   ALA I CB  1 
ATOM   6724  N N   . SER I  1 52  ? 131.281 92.309  103.460 1.00 38.76  ? 52   SER I N   1 
ATOM   6725  C CA  . SER I  1 52  ? 130.557 93.338  102.736 1.00 39.09  ? 52   SER I CA  1 
ATOM   6726  C C   . SER I  1 52  ? 130.644 93.135  101.231 1.00 39.24  ? 52   SER I C   1 
ATOM   6727  O O   . SER I  1 52  ? 129.684 93.406  100.500 1.00 39.67  ? 52   SER I O   1 
ATOM   6728  C CB  . SER I  1 52  ? 131.085 94.718  103.141 1.00 40.30  ? 52   SER I CB  1 
ATOM   6729  O OG  . SER I  1 52  ? 131.045 94.893  104.561 1.00 43.37  ? 52   SER I OG  1 
ATOM   6730  N N   . SER I  1 53  ? 131.798 92.647  100.784 1.00 39.30  ? 53   SER I N   1 
ATOM   6731  C CA  . SER I  1 53  ? 132.072 92.432  99.373  1.00 38.97  ? 53   SER I CA  1 
ATOM   6732  C C   . SER I  1 53  ? 131.205 91.298  98.850  1.00 38.51  ? 53   SER I C   1 
ATOM   6733  O O   . SER I  1 53  ? 131.301 90.163  99.326  1.00 36.70  ? 53   SER I O   1 
ATOM   6734  C CB  . SER I  1 53  ? 133.546 92.073  99.190  1.00 39.70  ? 53   SER I CB  1 
ATOM   6735  O OG  . SER I  1 53  ? 134.051 92.589  97.954  1.00 40.54  ? 53   SER I OG  1 
ATOM   6736  N N   . LEU I  1 54  ? 130.346 91.612  97.885  1.00 39.66  ? 54   LEU I N   1 
ATOM   6737  C CA  . LEU I  1 54  ? 129.578 90.581  97.202  1.00 39.95  ? 54   LEU I CA  1 
ATOM   6738  C C   . LEU I  1 54  ? 130.470 89.723  96.290  1.00 40.72  ? 54   LEU I C   1 
ATOM   6739  O O   . LEU I  1 54  ? 131.612 90.098  95.940  1.00 40.46  ? 54   LEU I O   1 
ATOM   6740  C CB  . LEU I  1 54  ? 128.391 91.181  96.421  1.00 39.26  ? 54   LEU I CB  1 
ATOM   6741  C CG  . LEU I  1 54  ? 126.961 91.113  96.986  1.00 39.12  ? 54   LEU I CG  1 
ATOM   6742  C CD1 . LEU I  1 54  ? 126.014 91.957  96.132  1.00 34.06  ? 54   LEU I CD1 1 
ATOM   6743  C CD2 . LEU I  1 54  ? 126.461 89.672  97.098  1.00 36.29  ? 54   LEU I CD2 1 
ATOM   6744  N N   . GLN I  1 55  ? 129.929 88.555  95.948  1.00 39.91  ? 55   GLN I N   1 
ATOM   6745  C CA  . GLN I  1 55  ? 130.491 87.614  94.996  1.00 38.35  ? 55   GLN I CA  1 
ATOM   6746  C C   . GLN I  1 55  ? 129.552 87.625  93.831  1.00 39.83  ? 55   GLN I C   1 
ATOM   6747  O O   . GLN I  1 55  ? 128.320 87.600  94.037  1.00 39.83  ? 55   GLN I O   1 
ATOM   6748  C CB  . GLN I  1 55  ? 130.398 86.203  95.564  1.00 38.21  ? 55   GLN I CB  1 
ATOM   6749  C CG  . GLN I  1 55  ? 131.370 85.918  96.652  1.00 34.43  ? 55   GLN I CG  1 
ATOM   6750  C CD  . GLN I  1 55  ? 132.734 86.308  96.201  1.00 31.22  ? 55   GLN I CD  1 
ATOM   6751  O OE1 . GLN I  1 55  ? 133.266 87.346  96.616  1.00 30.52  ? 55   GLN I OE1 1 
ATOM   6752  N NE2 . GLN I  1 55  ? 133.292 85.526  95.280  1.00 21.01  ? 55   GLN I NE2 1 
ATOM   6753  N N   . SER I  1 56  ? 130.074 87.663  92.606  1.00 40.58  ? 56   SER I N   1 
ATOM   6754  C CA  . SER I  1 56  ? 129.193 87.633  91.438  1.00 41.86  ? 56   SER I CA  1 
ATOM   6755  C C   . SER I  1 56  ? 128.396 86.333  91.395  1.00 43.50  ? 56   SER I C   1 
ATOM   6756  O O   . SER I  1 56  ? 128.713 85.366  92.098  1.00 45.21  ? 56   SER I O   1 
ATOM   6757  C CB  . SER I  1 56  ? 129.982 87.817  90.132  1.00 42.20  ? 56   SER I CB  1 
ATOM   6758  O OG  . SER I  1 56  ? 130.744 86.661  89.822  1.00 42.61  ? 56   SER I OG  1 
ATOM   6759  N N   . GLY I  1 57  ? 127.359 86.316  90.566  1.00 44.26  ? 57   GLY I N   1 
ATOM   6760  C CA  . GLY I  1 57  ? 126.540 85.126  90.430  1.00 45.74  ? 57   GLY I CA  1 
ATOM   6761  C C   . GLY I  1 57  ? 125.353 85.106  91.372  1.00 45.90  ? 57   GLY I C   1 
ATOM   6762  O O   . GLY I  1 57  ? 124.316 84.531  91.037  1.00 46.47  ? 57   GLY I O   1 
ATOM   6763  N N   . VAL I  1 58  ? 125.487 85.709  92.550  1.00 44.26  ? 58   VAL I N   1 
ATOM   6764  C CA  . VAL I  1 58  ? 124.307 85.912  93.386  1.00 43.45  ? 58   VAL I CA  1 
ATOM   6765  C C   . VAL I  1 58  ? 123.739 87.293  93.084  1.00 43.76  ? 58   VAL I C   1 
ATOM   6766  O O   . VAL I  1 58  ? 124.504 88.241  92.872  1.00 42.89  ? 58   VAL I O   1 
ATOM   6767  C CB  . VAL I  1 58  ? 124.570 85.713  94.915  1.00 42.40  ? 58   VAL I CB  1 
ATOM   6768  C CG1 . VAL I  1 58  ? 125.811 84.834  95.137  1.00 41.68  ? 58   VAL I CG1 1 
ATOM   6769  C CG2 . VAL I  1 58  ? 124.742 87.069  95.655  1.00 41.62  ? 58   VAL I CG2 1 
ATOM   6770  N N   . PRO I  1 59  ? 122.402 87.389  92.978  1.00 44.12  ? 59   PRO I N   1 
ATOM   6771  C CA  . PRO I  1 59  ? 121.669 88.645  92.891  1.00 44.40  ? 59   PRO I CA  1 
ATOM   6772  C C   . PRO I  1 59  ? 122.218 89.763  93.790  1.00 43.82  ? 59   PRO I C   1 
ATOM   6773  O O   . PRO I  1 59  ? 123.424 90.011  93.795  1.00 43.20  ? 59   PRO I O   1 
ATOM   6774  C CB  . PRO I  1 59  ? 120.237 88.256  93.268  1.00 44.92  ? 59   PRO I CB  1 
ATOM   6775  C CG  . PRO I  1 59  ? 120.192 86.752  93.241  1.00 43.33  ? 59   PRO I CG  1 
ATOM   6776  C CD  . PRO I  1 59  ? 121.512 86.227  92.820  1.00 44.41  ? 59   PRO I CD  1 
ATOM   6777  N N   . SER I  1 60  ? 121.355 90.447  94.533  1.00 43.53  ? 60   SER I N   1 
ATOM   6778  C CA  . SER I  1 60  ? 121.692 91.825  94.889  1.00 44.26  ? 60   SER I CA  1 
ATOM   6779  C C   . SER I  1 60  ? 121.312 92.272  96.301  1.00 45.41  ? 60   SER I C   1 
ATOM   6780  O O   . SER I  1 60  ? 121.910 93.201  96.850  1.00 46.23  ? 60   SER I O   1 
ATOM   6781  C CB  . SER I  1 60  ? 121.052 92.757  93.849  1.00 43.90  ? 60   SER I CB  1 
ATOM   6782  O OG  . SER I  1 60  ? 121.675 94.044  93.849  1.00 38.81  ? 60   SER I OG  1 
ATOM   6783  N N   . ARG I  1 61  ? 120.316 91.601  96.871  1.00 45.38  ? 61   ARG I N   1 
ATOM   6784  C CA  . ARG I  1 61  ? 119.783 91.920  98.195  1.00 45.57  ? 61   ARG I CA  1 
ATOM   6785  C C   . ARG I  1 61  ? 120.713 91.463  99.302  1.00 45.54  ? 61   ARG I C   1 
ATOM   6786  O O   . ARG I  1 61  ? 120.573 91.873  100.458 1.00 45.63  ? 61   ARG I O   1 
ATOM   6787  C CB  . ARG I  1 61  ? 118.400 91.289  98.386  1.00 46.04  ? 61   ARG I CB  1 
ATOM   6788  C CG  . ARG I  1 61  ? 118.261 89.878  97.862  1.00 46.09  ? 61   ARG I CG  1 
ATOM   6789  C CD  . ARG I  1 61  ? 117.853 89.884  96.402  1.00 48.69  ? 61   ARG I CD  1 
ATOM   6790  N NE  . ARG I  1 61  ? 118.373 88.705  95.725  1.00 50.75  ? 61   ARG I NE  1 
ATOM   6791  C CZ  . ARG I  1 61  ? 117.759 87.524  95.693  1.00 49.20  ? 61   ARG I CZ  1 
ATOM   6792  N NH1 . ARG I  1 61  ? 116.588 87.355  96.297  1.00 53.25  ? 61   ARG I NH1 1 
ATOM   6793  N NH2 . ARG I  1 61  ? 118.311 86.502  95.058  1.00 50.67  ? 61   ARG I NH2 1 
ATOM   6794  N N   . PHE I  1 62  ? 121.658 90.606  98.937  1.00 44.56  ? 62   PHE I N   1 
ATOM   6795  C CA  . PHE I  1 62  ? 122.684 90.168  99.861  1.00 43.56  ? 62   PHE I CA  1 
ATOM   6796  C C   . PHE I  1 62  ? 123.658 91.274  100.170 1.00 44.80  ? 62   PHE I C   1 
ATOM   6797  O O   . PHE I  1 62  ? 124.384 91.745  99.290  1.00 46.06  ? 62   PHE I O   1 
ATOM   6798  C CB  . PHE I  1 62  ? 123.408 88.959  99.296  1.00 40.11  ? 62   PHE I CB  1 
ATOM   6799  C CG  . PHE I  1 62  ? 122.488 87.851  98.979  1.00 37.63  ? 62   PHE I CG  1 
ATOM   6800  C CD1 . PHE I  1 62  ? 122.453 87.285  97.722  1.00 29.72  ? 62   PHE I CD1 1 
ATOM   6801  C CD2 . PHE I  1 62  ? 121.592 87.410  99.945  1.00 32.62  ? 62   PHE I CD2 1 
ATOM   6802  C CE1 . PHE I  1 62  ? 121.566 86.261  97.443  1.00 32.44  ? 62   PHE I CE1 1 
ATOM   6803  C CE2 . PHE I  1 62  ? 120.706 86.395  99.679  1.00 25.20  ? 62   PHE I CE2 1 
ATOM   6804  C CZ  . PHE I  1 62  ? 120.689 85.815  98.424  1.00 30.74  ? 62   PHE I CZ  1 
ATOM   6805  N N   . SER I  1 63  ? 123.653 91.708  101.420 1.00 46.19  ? 63   SER I N   1 
ATOM   6806  C CA  . SER I  1 63  ? 124.701 92.591  101.879 1.00 48.68  ? 63   SER I CA  1 
ATOM   6807  C C   . SER I  1 63  ? 124.937 92.406  103.353 1.00 48.80  ? 63   SER I C   1 
ATOM   6808  O O   . SER I  1 63  ? 123.995 92.280  104.145 1.00 51.87  ? 63   SER I O   1 
ATOM   6809  C CB  . SER I  1 63  ? 124.396 94.061  101.560 1.00 50.02  ? 63   SER I CB  1 
ATOM   6810  O OG  . SER I  1 63  ? 123.213 94.501  102.223 1.00 50.19  ? 63   SER I OG  1 
ATOM   6811  N N   . GLY I  1 64  ? 126.220 92.380  103.705 1.00 48.32  ? 64   GLY I N   1 
ATOM   6812  C CA  . GLY I  1 64  ? 126.616 92.216  105.078 1.00 45.86  ? 64   GLY I CA  1 
ATOM   6813  C C   . GLY I  1 64  ? 127.217 93.486  105.615 1.00 44.09  ? 64   GLY I C   1 
ATOM   6814  O O   . GLY I  1 64  ? 128.126 94.064  105.014 1.00 42.80  ? 64   GLY I O   1 
ATOM   6815  N N   . SER I  1 65  ? 126.696 93.921  106.752 1.00 43.21  ? 65   SER I N   1 
ATOM   6816  C CA  . SER I  1 65  ? 127.326 94.992  107.485 1.00 43.02  ? 65   SER I CA  1 
ATOM   6817  C C   . SER I  1 65  ? 128.079 94.435  108.686 1.00 42.67  ? 65   SER I C   1 
ATOM   6818  O O   . SER I  1 65  ? 128.218 93.216  108.852 1.00 40.30  ? 65   SER I O   1 
ATOM   6819  C CB  . SER I  1 65  ? 126.297 96.045  107.909 1.00 42.23  ? 65   SER I CB  1 
ATOM   6820  O OG  . SER I  1 65  ? 125.276 95.471  108.707 1.00 44.29  ? 65   SER I OG  1 
ATOM   6821  N N   . GLY I  1 66  ? 128.578 95.355  109.503 1.00 43.16  ? 66   GLY I N   1 
ATOM   6822  C CA  . GLY I  1 66  ? 129.267 95.029  110.739 1.00 40.44  ? 66   GLY I CA  1 
ATOM   6823  C C   . GLY I  1 66  ? 130.712 94.618  110.556 1.00 39.37  ? 66   GLY I C   1 
ATOM   6824  O O   . GLY I  1 66  ? 131.129 94.164  109.484 1.00 37.91  ? 66   GLY I O   1 
ATOM   6825  N N   . SER I  1 67  ? 131.472 94.813  111.628 1.00 37.73  ? 67   SER I N   1 
ATOM   6826  C CA  . SER I  1 67  ? 132.820 94.298  111.794 1.00 37.31  ? 67   SER I CA  1 
ATOM   6827  C C   . SER I  1 67  ? 132.956 94.062  113.291 1.00 36.27  ? 67   SER I C   1 
ATOM   6828  O O   . SER I  1 67  ? 132.179 94.613  114.076 1.00 35.86  ? 67   SER I O   1 
ATOM   6829  C CB  . SER I  1 67  ? 133.860 95.308  111.307 1.00 38.72  ? 67   SER I CB  1 
ATOM   6830  O OG  . SER I  1 67  ? 135.211 94.827  111.565 1.00 42.63  ? 67   SER I OG  1 
ATOM   6831  N N   . GLY I  1 68  ? 133.925 93.250  113.698 1.00 35.66  ? 68   GLY I N   1 
ATOM   6832  C CA  . GLY I  1 68  ? 134.138 93.006  115.122 1.00 35.25  ? 68   GLY I CA  1 
ATOM   6833  C C   . GLY I  1 68  ? 133.314 91.843  115.632 1.00 35.46  ? 68   GLY I C   1 
ATOM   6834  O O   . GLY I  1 68  ? 133.781 90.703  115.624 1.00 36.00  ? 68   GLY I O   1 
ATOM   6835  N N   . THR I  1 69  ? 132.089 92.119  116.071 1.00 35.13  ? 69   THR I N   1 
ATOM   6836  C CA  . THR I  1 69  ? 131.268 91.080  116.683 1.00 34.06  ? 69   THR I CA  1 
ATOM   6837  C C   . THR I  1 69  ? 129.949 90.848  115.943 1.00 33.97  ? 69   THR I C   1 
ATOM   6838  O O   . THR I  1 69  ? 129.617 89.704  115.640 1.00 34.53  ? 69   THR I O   1 
ATOM   6839  C CB  . THR I  1 69  ? 130.993 91.367  118.183 1.00 34.39  ? 69   THR I CB  1 
ATOM   6840  O OG1 . THR I  1 69  ? 132.111 92.094  118.743 1.00 37.98  ? 69   THR I OG1 1 
ATOM   6841  C CG2 . THR I  1 69  ? 130.789 90.055  118.961 1.00 30.67  ? 69   THR I CG2 1 
ATOM   6842  N N   . ASP I  1 70  ? 129.198 91.907  115.649 1.00 33.68  ? 70   ASP I N   1 
ATOM   6843  C CA  . ASP I  1 70  ? 127.900 91.723  114.986 1.00 33.06  ? 70   ASP I CA  1 
ATOM   6844  C C   . ASP I  1 70  ? 128.042 91.844  113.467 1.00 31.38  ? 70   ASP I C   1 
ATOM   6845  O O   . ASP I  1 70  ? 128.684 92.776  112.981 1.00 29.95  ? 70   ASP I O   1 
ATOM   6846  C CB  . ASP I  1 70  ? 126.860 92.732  115.513 1.00 32.79  ? 70   ASP I CB  1 
ATOM   6847  C CG  . ASP I  1 70  ? 126.916 92.902  117.032 1.00 36.08  ? 70   ASP I CG  1 
ATOM   6848  O OD1 . ASP I  1 70  ? 126.905 91.885  117.760 1.00 39.67  ? 70   ASP I OD1 1 
ATOM   6849  O OD2 . ASP I  1 70  ? 126.963 94.063  117.495 1.00 41.32  ? 70   ASP I OD2 1 
ATOM   6850  N N   . PHE I  1 71  ? 127.475 90.894  112.716 1.00 31.56  ? 71   PHE I N   1 
ATOM   6851  C CA  . PHE I  1 71  ? 127.398 91.025  111.245 1.00 33.24  ? 71   PHE I CA  1 
ATOM   6852  C C   . PHE I  1 71  ? 125.998 90.582  110.743 1.00 34.88  ? 71   PHE I C   1 
ATOM   6853  O O   . PHE I  1 71  ? 125.241 89.963  111.511 1.00 38.17  ? 71   PHE I O   1 
ATOM   6854  C CB  . PHE I  1 71  ? 128.539 90.230  110.532 1.00 33.45  ? 71   PHE I CB  1 
ATOM   6855  C CG  . PHE I  1 71  ? 129.917 90.406  111.171 1.00 35.66  ? 71   PHE I CG  1 
ATOM   6856  C CD1 . PHE I  1 71  ? 130.216 89.814  112.400 1.00 37.15  ? 71   PHE I CD1 1 
ATOM   6857  C CD2 . PHE I  1 71  ? 130.924 91.114  110.521 1.00 36.04  ? 71   PHE I CD2 1 
ATOM   6858  C CE1 . PHE I  1 71  ? 131.475 89.951  112.982 1.00 34.54  ? 71   PHE I CE1 1 
ATOM   6859  C CE2 . PHE I  1 71  ? 132.189 91.253  111.103 1.00 34.74  ? 71   PHE I CE2 1 
ATOM   6860  C CZ  . PHE I  1 71  ? 132.460 90.672  112.333 1.00 32.81  ? 71   PHE I CZ  1 
ATOM   6861  N N   . THR I  1 72  ? 125.642 90.892  109.488 1.00 35.49  ? 72   THR I N   1 
ATOM   6862  C CA  . THR I  1 72  ? 124.259 90.641  109.033 1.00 36.67  ? 72   THR I CA  1 
ATOM   6863  C C   . THR I  1 72  ? 124.087 90.099  107.617 1.00 37.69  ? 72   THR I C   1 
ATOM   6864  O O   . THR I  1 72  ? 124.655 90.619  106.657 1.00 38.60  ? 72   THR I O   1 
ATOM   6865  C CB  . THR I  1 72  ? 123.361 91.909  109.179 1.00 37.63  ? 72   THR I CB  1 
ATOM   6866  O OG1 . THR I  1 72  ? 123.569 92.509  110.464 1.00 38.69  ? 72   THR I OG1 1 
ATOM   6867  C CG2 . THR I  1 72  ? 121.877 91.565  109.027 1.00 35.78  ? 72   THR I CG2 1 
ATOM   6868  N N   . LEU I  1 73  ? 123.285 89.046  107.508 1.00 34.87  ? 73   LEU I N   1 
ATOM   6869  C CA  . LEU I  1 73  ? 122.709 88.683  106.239 1.00 33.59  ? 73   LEU I CA  1 
ATOM   6870  C C   . LEU I  1 73  ? 121.386 89.416  106.141 1.00 34.54  ? 73   LEU I C   1 
ATOM   6871  O O   . LEU I  1 73  ? 120.440 89.135  106.891 1.00 35.50  ? 73   LEU I O   1 
ATOM   6872  C CB  . LEU I  1 73  ? 122.503 87.172  106.125 1.00 34.76  ? 73   LEU I CB  1 
ATOM   6873  C CG  . LEU I  1 73  ? 122.118 86.720  104.713 1.00 26.96  ? 73   LEU I CG  1 
ATOM   6874  C CD1 . LEU I  1 73  ? 123.149 87.185  103.662 1.00 18.38  ? 73   LEU I CD1 1 
ATOM   6875  C CD2 . LEU I  1 73  ? 122.009 85.229  104.677 1.00 23.23  ? 73   LEU I CD2 1 
ATOM   6876  N N   . THR I  1 74  ? 121.355 90.395  105.251 1.00 34.41  ? 74   THR I N   1 
ATOM   6877  C CA  . THR I  1 74  ? 120.138 91.096  104.912 1.00 35.08  ? 74   THR I CA  1 
ATOM   6878  C C   . THR I  1 74  ? 119.792 90.547  103.545 1.00 36.21  ? 74   THR I C   1 
ATOM   6879  O O   . THR I  1 74  ? 120.706 90.170  102.779 1.00 36.61  ? 74   THR I O   1 
ATOM   6880  C CB  . THR I  1 74  ? 120.394 92.612  104.861 1.00 34.76  ? 74   THR I CB  1 
ATOM   6881  O OG1 . THR I  1 74  ? 120.800 93.061  106.168 1.00 39.49  ? 74   THR I OG1 1 
ATOM   6882  C CG2 . THR I  1 74  ? 119.139 93.380  104.428 1.00 33.73  ? 74   THR I CG2 1 
ATOM   6883  N N   . ILE I  1 75  ? 118.486 90.483  103.233 1.00 36.14  ? 75   ILE I N   1 
ATOM   6884  C CA  . ILE I  1 75  ? 118.062 89.909  101.963 1.00 37.84  ? 75   ILE I CA  1 
ATOM   6885  C C   . ILE I  1 75  ? 116.764 90.566  101.540 1.00 39.68  ? 75   ILE I C   1 
ATOM   6886  O O   . ILE I  1 75  ? 115.696 89.928  101.580 1.00 41.22  ? 75   ILE I O   1 
ATOM   6887  C CB  . ILE I  1 75  ? 117.805 88.367  102.057 1.00 37.15  ? 75   ILE I CB  1 
ATOM   6888  C CG1 . ILE I  1 75  ? 118.853 87.637  102.917 1.00 35.65  ? 75   ILE I CG1 1 
ATOM   6889  C CG2 . ILE I  1 75  ? 117.724 87.746  100.662 1.00 36.29  ? 75   ILE I CG2 1 
ATOM   6890  C CD1 . ILE I  1 75  ? 118.527 86.167  103.245 1.00 33.90  ? 75   ILE I CD1 1 
ATOM   6891  N N   . SER I  1 76  ? 116.848 91.848  101.149 1.00 41.35  ? 76   SER I N   1 
ATOM   6892  C CA  . SER I  1 76  ? 115.672 92.659  100.765 1.00 42.72  ? 76   SER I CA  1 
ATOM   6893  C C   . SER I  1 76  ? 114.546 91.953  99.990  1.00 45.33  ? 76   SER I C   1 
ATOM   6894  O O   . SER I  1 76  ? 113.373 92.317  100.147 1.00 44.54  ? 76   SER I O   1 
ATOM   6895  C CB  . SER I  1 76  ? 116.101 93.952  100.042 1.00 43.45  ? 76   SER I CB  1 
ATOM   6896  O OG  . SER I  1 76  ? 117.173 93.742  99.144  1.00 37.07  ? 76   SER I OG  1 
ATOM   6897  N N   . SER I  1 77  ? 114.886 90.968  99.163  1.00 47.50  ? 77   SER I N   1 
ATOM   6898  C CA  . SER I  1 77  ? 113.845 90.191  98.496  1.00 51.65  ? 77   SER I CA  1 
ATOM   6899  C C   . SER I  1 77  ? 114.124 88.697  98.463  1.00 53.38  ? 77   SER I C   1 
ATOM   6900  O O   . SER I  1 77  ? 115.277 88.260  98.562  1.00 51.91  ? 77   SER I O   1 
ATOM   6901  C CB  . SER I  1 77  ? 113.530 90.738  97.098  1.00 52.42  ? 77   SER I CB  1 
ATOM   6902  O OG  . SER I  1 77  ? 114.695 90.804  96.287  1.00 54.76  ? 77   SER I OG  1 
ATOM   6903  N N   . LEU I  1 78  ? 113.045 87.924  98.318  1.00 55.99  ? 78   LEU I N   1 
ATOM   6904  C CA  . LEU I  1 78  ? 113.115 86.497  98.562  1.00 57.73  ? 78   LEU I CA  1 
ATOM   6905  C C   . LEU I  1 78  ? 112.073 85.723  97.770  1.00 58.66  ? 78   LEU I C   1 
ATOM   6906  O O   . LEU I  1 78  ? 110.936 86.169  97.593  1.00 58.28  ? 78   LEU I O   1 
ATOM   6907  C CB  . LEU I  1 78  ? 112.940 86.227  100.059 1.00 57.70  ? 78   LEU I CB  1 
ATOM   6908  C CG  . LEU I  1 78  ? 113.362 84.858  100.621 1.00 59.46  ? 78   LEU I CG  1 
ATOM   6909  C CD1 . LEU I  1 78  ? 114.881 84.809  100.836 1.00 63.18  ? 78   LEU I CD1 1 
ATOM   6910  C CD2 . LEU I  1 78  ? 112.659 84.587  101.931 1.00 58.09  ? 78   LEU I CD2 1 
ATOM   6911  N N   . GLN I  1 79  ? 112.491 84.549  97.306  1.00 59.48  ? 79   GLN I N   1 
ATOM   6912  C CA  . GLN I  1 79  ? 111.673 83.671  96.474  1.00 60.31  ? 79   GLN I CA  1 
ATOM   6913  C C   . GLN I  1 79  ? 112.230 82.247  96.463  1.00 61.92  ? 79   GLN I C   1 
ATOM   6914  O O   . GLN I  1 79  ? 113.373 82.036  96.878  1.00 61.58  ? 79   GLN I O   1 
ATOM   6915  C CB  . GLN I  1 79  ? 111.535 84.217  95.054  1.00 59.96  ? 79   GLN I CB  1 
ATOM   6916  C CG  . GLN I  1 79  ? 112.573 85.230  94.606  1.00 59.81  ? 79   GLN I CG  1 
ATOM   6917  C CD  . GLN I  1 79  ? 112.035 86.041  93.462  1.00 63.30  ? 79   GLN I CD  1 
ATOM   6918  O OE1 . GLN I  1 79  ? 111.024 85.664  92.869  1.00 66.70  ? 79   GLN I OE1 1 
ATOM   6919  N NE2 . GLN I  1 79  ? 112.681 87.162  93.151  1.00 59.32  ? 79   GLN I NE2 1 
ATOM   6920  N N   . PRO I  1 80  ? 111.438 81.270  95.963  1.00 63.00  ? 80   PRO I N   1 
ATOM   6921  C CA  . PRO I  1 80  ? 111.712 79.862  96.272  1.00 63.25  ? 80   PRO I CA  1 
ATOM   6922  C C   . PRO I  1 80  ? 112.964 79.339  95.582  1.00 63.37  ? 80   PRO I C   1 
ATOM   6923  O O   . PRO I  1 80  ? 113.304 78.160  95.732  1.00 65.25  ? 80   PRO I O   1 
ATOM   6924  C CB  . PRO I  1 80  ? 110.452 79.114  95.763  1.00 63.48  ? 80   PRO I CB  1 
ATOM   6925  C CG  . PRO I  1 80  ? 109.481 80.194  95.367  1.00 64.37  ? 80   PRO I CG  1 
ATOM   6926  C CD  . PRO I  1 80  ? 110.292 81.396  95.044  1.00 62.61  ? 80   PRO I CD  1 
ATOM   6927  N N   . GLU I  1 81  ? 113.637 80.214  94.832  1.00 62.17  ? 81   GLU I N   1 
ATOM   6928  C CA  . GLU I  1 81  ? 115.031 79.962  94.495  1.00 59.87  ? 81   GLU I CA  1 
ATOM   6929  C C   . GLU I  1 81  ? 115.893 79.992  95.787  1.00 58.88  ? 81   GLU I C   1 
ATOM   6930  O O   . GLU I  1 81  ? 116.800 79.152  95.935  1.00 60.51  ? 81   GLU I O   1 
ATOM   6931  C CB  . GLU I  1 81  ? 115.551 80.890  93.367  1.00 60.54  ? 81   GLU I CB  1 
ATOM   6932  C CG  . GLU I  1 81  ? 116.078 82.273  93.771  1.00 60.63  ? 81   GLU I CG  1 
ATOM   6933  C CD  . GLU I  1 81  ? 117.025 82.880  92.734  1.00 62.25  ? 81   GLU I CD  1 
ATOM   6934  O OE1 . GLU I  1 81  ? 118.187 83.176  93.089  1.00 63.03  ? 81   GLU I OE1 1 
ATOM   6935  O OE2 . GLU I  1 81  ? 116.611 83.054  91.567  1.00 61.90  ? 81   GLU I OE2 1 
ATOM   6936  N N   . ASP I  1 82  ? 115.580 80.905  96.727  1.00 56.47  ? 82   ASP I N   1 
ATOM   6937  C CA  . ASP I  1 82  ? 116.353 81.092  97.995  1.00 53.62  ? 82   ASP I CA  1 
ATOM   6938  C C   . ASP I  1 82  ? 116.117 80.089  99.151  1.00 51.72  ? 82   ASP I C   1 
ATOM   6939  O O   . ASP I  1 82  ? 116.779 80.169  100.188 1.00 50.38  ? 82   ASP I O   1 
ATOM   6940  C CB  . ASP I  1 82  ? 116.140 82.506  98.563  1.00 53.66  ? 82   ASP I CB  1 
ATOM   6941  C CG  . ASP I  1 82  ? 116.231 83.601  97.510  1.00 52.73  ? 82   ASP I CG  1 
ATOM   6942  O OD1 . ASP I  1 82  ? 116.935 83.414  96.492  1.00 57.12  ? 82   ASP I OD1 1 
ATOM   6943  O OD2 . ASP I  1 82  ? 115.605 84.664  97.706  1.00 51.42  ? 82   ASP I OD2 1 
ATOM   6944  N N   . PHE I  1 83  ? 115.145 79.201  98.970  1.00 50.02  ? 83   PHE I N   1 
ATOM   6945  C CA  . PHE I  1 83  ? 114.764 78.104  99.876  1.00 48.86  ? 83   PHE I CA  1 
ATOM   6946  C C   . PHE I  1 83  ? 116.032 77.364  100.386 1.00 48.50  ? 83   PHE I C   1 
ATOM   6947  O O   . PHE I  1 83  ? 116.450 76.360  99.796  1.00 48.21  ? 83   PHE I O   1 
ATOM   6948  C CB  . PHE I  1 83  ? 113.857 77.221  98.995  1.00 46.69  ? 83   PHE I CB  1 
ATOM   6949  C CG  . PHE I  1 83  ? 113.010 76.201  99.709  1.00 44.09  ? 83   PHE I CG  1 
ATOM   6950  C CD1 . PHE I  1 83  ? 111.626 76.195  99.509  1.00 43.08  ? 83   PHE I CD1 1 
ATOM   6951  C CD2 . PHE I  1 83  ? 113.574 75.175  100.456 1.00 35.71  ? 83   PHE I CD2 1 
ATOM   6952  C CE1 . PHE I  1 83  ? 110.812 75.224  100.098 1.00 37.47  ? 83   PHE I CE1 1 
ATOM   6953  C CE2 . PHE I  1 83  ? 112.773 74.198  101.050 1.00 35.18  ? 83   PHE I CE2 1 
ATOM   6954  C CZ  . PHE I  1 83  ? 111.386 74.223  100.871 1.00 45.59  ? 83   PHE I CZ  1 
ATOM   6955  N N   . ALA I  1 84  ? 116.637 77.881  101.477 1.00 47.97  ? 84   ALA I N   1 
ATOM   6956  C CA  . ALA I  1 84  ? 118.048 77.509  101.829 1.00 47.04  ? 84   ALA I CA  1 
ATOM   6957  C C   . ALA I  1 84  ? 118.514 77.767  103.287 1.00 45.83  ? 84   ALA I C   1 
ATOM   6958  O O   . ALA I  1 84  ? 117.828 78.444  104.063 1.00 45.20  ? 84   ALA I O   1 
ATOM   6959  C CB  . ALA I  1 84  ? 119.046 78.170  100.830 1.00 47.01  ? 84   ALA I CB  1 
ATOM   6960  N N   . THR I  1 85  ? 119.703 77.244  103.617 1.00 45.47  ? 85   THR I N   1 
ATOM   6961  C CA  . THR I  1 85  ? 120.292 77.282  104.969 1.00 44.83  ? 85   THR I CA  1 
ATOM   6962  C C   . THR I  1 85  ? 121.544 78.188  105.061 1.00 44.64  ? 85   THR I C   1 
ATOM   6963  O O   . THR I  1 85  ? 122.657 77.786  104.632 1.00 44.03  ? 85   THR I O   1 
ATOM   6964  C CB  . THR I  1 85  ? 120.645 75.847  105.452 1.00 45.27  ? 85   THR I CB  1 
ATOM   6965  O OG1 . THR I  1 85  ? 119.548 74.962  105.187 1.00 44.60  ? 85   THR I OG1 1 
ATOM   6966  C CG2 . THR I  1 85  ? 120.958 75.828  106.947 1.00 45.94  ? 85   THR I CG2 1 
ATOM   6967  N N   . TYR I  1 86  ? 121.377 79.387  105.626 1.00 43.67  ? 86   TYR I N   1 
ATOM   6968  C CA  . TYR I  1 86  ? 122.467 80.368  105.614 1.00 43.19  ? 86   TYR I CA  1 
ATOM   6969  C C   . TYR I  1 86  ? 123.452 80.225  106.798 1.00 42.75  ? 86   TYR I C   1 
ATOM   6970  O O   . TYR I  1 86  ? 123.042 80.303  107.977 1.00 43.52  ? 86   TYR I O   1 
ATOM   6971  C CB  . TYR I  1 86  ? 121.893 81.785  105.469 1.00 42.42  ? 86   TYR I CB  1 
ATOM   6972  C CG  . TYR I  1 86  ? 121.095 81.982  104.180 1.00 44.37  ? 86   TYR I CG  1 
ATOM   6973  C CD1 . TYR I  1 86  ? 119.716 81.757  104.140 1.00 41.75  ? 86   TYR I CD1 1 
ATOM   6974  C CD2 . TYR I  1 86  ? 121.727 82.377  102.996 1.00 46.79  ? 86   TYR I CD2 1 
ATOM   6975  C CE1 . TYR I  1 86  ? 118.986 81.925  102.954 1.00 44.02  ? 86   TYR I CE1 1 
ATOM   6976  C CE2 . TYR I  1 86  ? 121.005 82.554  101.812 1.00 44.41  ? 86   TYR I CE2 1 
ATOM   6977  C CZ  . TYR I  1 86  ? 119.639 82.321  101.796 1.00 46.09  ? 86   TYR I CZ  1 
ATOM   6978  O OH  . TYR I  1 86  ? 118.931 82.495  100.627 1.00 37.19  ? 86   TYR I OH  1 
ATOM   6979  N N   . TYR I  1 87  ? 124.737 80.005  106.460 1.00 40.98  ? 87   TYR I N   1 
ATOM   6980  C CA  . TYR I  1 87  ? 125.828 79.807  107.439 1.00 40.90  ? 87   TYR I CA  1 
ATOM   6981  C C   . TYR I  1 87  ? 126.877 80.897  107.337 1.00 39.02  ? 87   TYR I C   1 
ATOM   6982  O O   . TYR I  1 87  ? 127.439 81.118  106.260 1.00 38.44  ? 87   TYR I O   1 
ATOM   6983  C CB  . TYR I  1 87  ? 126.578 78.497  107.171 1.00 42.19  ? 87   TYR I CB  1 
ATOM   6984  C CG  . TYR I  1 87  ? 125.792 77.256  107.441 1.00 45.87  ? 87   TYR I CG  1 
ATOM   6985  C CD1 . TYR I  1 87  ? 125.424 76.407  106.403 1.00 45.58  ? 87   TYR I CD1 1 
ATOM   6986  C CD2 . TYR I  1 87  ? 125.411 76.924  108.737 1.00 50.88  ? 87   TYR I CD2 1 
ATOM   6987  C CE1 . TYR I  1 87  ? 124.693 75.259  106.648 1.00 48.30  ? 87   TYR I CE1 1 
ATOM   6988  C CE2 . TYR I  1 87  ? 124.679 75.781  108.995 1.00 50.51  ? 87   TYR I CE2 1 
ATOM   6989  C CZ  . TYR I  1 87  ? 124.323 74.953  107.947 1.00 49.24  ? 87   TYR I CZ  1 
ATOM   6990  O OH  . TYR I  1 87  ? 123.596 73.814  108.198 1.00 48.79  ? 87   TYR I OH  1 
ATOM   6991  N N   . CYS I  1 88  ? 127.160 81.562  108.451 1.00 37.26  ? 88   CYS I N   1 
ATOM   6992  C CA  . CYS I  1 88  ? 128.327 82.430  108.531 1.00 37.30  ? 88   CYS I CA  1 
ATOM   6993  C C   . CYS I  1 88  ? 129.565 81.565  108.829 1.00 38.28  ? 88   CYS I C   1 
ATOM   6994  O O   . CYS I  1 88  ? 129.454 80.546  109.519 1.00 37.83  ? 88   CYS I O   1 
ATOM   6995  C CB  . CYS I  1 88  ? 128.118 83.529  109.588 1.00 38.84  ? 88   CYS I CB  1 
ATOM   6996  S SG  . CYS I  1 88  ? 127.580 82.979  111.255 1.00 33.95  ? 88   CYS I SG  1 
ATOM   6997  N N   . GLN I  1 89  ? 130.725 81.951  108.287 1.00 37.13  ? 89   GLN I N   1 
ATOM   6998  C CA  . GLN I  1 89  ? 132.013 81.271  108.552 1.00 38.89  ? 89   GLN I CA  1 
ATOM   6999  C C   . GLN I  1 89  ? 133.115 82.286  108.863 1.00 39.36  ? 89   GLN I C   1 
ATOM   7000  O O   . GLN I  1 89  ? 132.917 83.498  108.718 1.00 38.53  ? 89   GLN I O   1 
ATOM   7001  C CB  . GLN I  1 89  ? 132.449 80.379  107.368 1.00 38.38  ? 89   GLN I CB  1 
ATOM   7002  C CG  . GLN I  1 89  ? 133.658 79.449  107.673 1.00 37.13  ? 89   GLN I CG  1 
ATOM   7003  C CD  . GLN I  1 89  ? 134.504 79.117  106.440 1.00 39.85  ? 89   GLN I CD  1 
ATOM   7004  O OE1 . GLN I  1 89  ? 134.932 80.008  105.704 1.00 45.52  ? 89   GLN I OE1 1 
ATOM   7005  N NE2 . GLN I  1 89  ? 134.758 77.827  106.222 1.00 20.44  ? 89   GLN I NE2 1 
ATOM   7006  N N   . GLN I  1 90  ? 134.281 81.786  109.259 1.00 40.62  ? 90   GLN I N   1 
ATOM   7007  C CA  . GLN I  1 90  ? 135.352 82.656  109.710 1.00 42.29  ? 90   GLN I CA  1 
ATOM   7008  C C   . GLN I  1 90  ? 136.705 82.313  109.060 1.00 41.73  ? 90   GLN I C   1 
ATOM   7009  O O   . GLN I  1 90  ? 137.425 81.444  109.548 1.00 41.22  ? 90   GLN I O   1 
ATOM   7010  C CB  . GLN I  1 90  ? 135.391 82.602  111.241 1.00 43.55  ? 90   GLN I CB  1 
ATOM   7011  C CG  . GLN I  1 90  ? 136.455 83.431  111.893 1.00 47.96  ? 90   GLN I CG  1 
ATOM   7012  C CD  . GLN I  1 90  ? 137.478 82.587  112.625 1.00 50.03  ? 90   GLN I CD  1 
ATOM   7013  O OE1 . GLN I  1 90  ? 137.970 82.988  113.677 1.00 51.57  ? 90   GLN I OE1 1 
ATOM   7014  N NE2 . GLN I  1 90  ? 137.804 81.420  112.083 1.00 53.64  ? 90   GLN I NE2 1 
ATOM   7015  N N   . SER I  1 91  ? 137.033 82.995  107.952 1.00 43.06  ? 91   SER I N   1 
ATOM   7016  C CA  . SER I  1 91  ? 138.350 82.865  107.283 1.00 41.81  ? 91   SER I CA  1 
ATOM   7017  C C   . SER I  1 91  ? 139.392 83.474  108.202 1.00 40.31  ? 91   SER I C   1 
ATOM   7018  O O   . SER I  1 91  ? 140.578 83.571  107.869 1.00 39.64  ? 91   SER I O   1 
ATOM   7019  C CB  . SER I  1 91  ? 138.342 83.602  105.932 1.00 44.63  ? 91   SER I CB  1 
ATOM   7020  O OG  . SER I  1 91  ? 139.661 83.997  105.527 1.00 45.80  ? 91   SER I OG  1 
ATOM   7021  N N   . TYR I  1 92  ? 138.919 83.855  109.389 1.00 39.36  ? 92   TYR I N   1 
ATOM   7022  C CA  . TYR I  1 92  ? 139.647 84.752  110.271 1.00 39.57  ? 92   TYR I CA  1 
ATOM   7023  C C   . TYR I  1 92  ? 140.837 84.129  110.987 1.00 38.62  ? 92   TYR I C   1 
ATOM   7024  O O   . TYR I  1 92  ? 141.984 84.431  110.638 1.00 38.61  ? 92   TYR I O   1 
ATOM   7025  C CB  . TYR I  1 92  ? 138.711 85.466  111.263 1.00 38.78  ? 92   TYR I CB  1 
ATOM   7026  C CG  . TYR I  1 92  ? 139.430 86.503  112.092 1.00 38.15  ? 92   TYR I CG  1 
ATOM   7027  C CD1 . TYR I  1 92  ? 139.529 87.821  111.656 1.00 36.36  ? 92   TYR I CD1 1 
ATOM   7028  C CD2 . TYR I  1 92  ? 140.040 86.160  113.302 1.00 37.66  ? 92   TYR I CD2 1 
ATOM   7029  C CE1 . TYR I  1 92  ? 140.209 88.777  112.403 1.00 35.80  ? 92   TYR I CE1 1 
ATOM   7030  C CE2 . TYR I  1 92  ? 140.721 87.109  114.058 1.00 39.75  ? 92   TYR I CE2 1 
ATOM   7031  C CZ  . TYR I  1 92  ? 140.798 88.416  113.604 1.00 40.42  ? 92   TYR I CZ  1 
ATOM   7032  O OH  . TYR I  1 92  ? 141.467 89.366  114.343 1.00 39.16  ? 92   TYR I OH  1 
ATOM   7033  N N   . SER I  1 93  ? 140.593 83.292  111.989 1.00 39.20  ? 93   SER I N   1 
ATOM   7034  C CA  . SER I  1 93  ? 141.702 82.641  112.664 1.00 37.30  ? 93   SER I CA  1 
ATOM   7035  C C   . SER I  1 93  ? 141.600 81.162  112.438 1.00 36.64  ? 93   SER I C   1 
ATOM   7036  O O   . SER I  1 93  ? 140.657 80.532  112.921 1.00 34.53  ? 93   SER I O   1 
ATOM   7037  C CB  . SER I  1 93  ? 141.714 82.944  114.165 1.00 38.11  ? 93   SER I CB  1 
ATOM   7038  O OG  . SER I  1 93  ? 142.868 82.363  114.790 1.00 41.25  ? 93   SER I OG  1 
ATOM   7039  N N   . THR I  1 94  ? 142.556 80.620  111.685 1.00 36.31  ? 94   THR I N   1 
ATOM   7040  C CA  . THR I  1 94  ? 142.592 79.184  111.502 1.00 35.26  ? 94   THR I CA  1 
ATOM   7041  C C   . THR I  1 94  ? 142.538 78.614  112.919 1.00 34.81  ? 94   THR I C   1 
ATOM   7042  O O   . THR I  1 94  ? 143.397 78.917  113.761 1.00 32.02  ? 94   THR I O   1 
ATOM   7043  C CB  . THR I  1 94  ? 143.815 78.715  110.701 1.00 35.27  ? 94   THR I CB  1 
ATOM   7044  O OG1 . THR I  1 94  ? 145.027 79.093  111.399 1.00 40.17  ? 94   THR I OG1 1 
ATOM   7045  C CG2 . THR I  1 94  ? 143.792 79.358  109.302 1.00 28.16  ? 94   THR I CG2 1 
ATOM   7046  N N   . PRO I  1 95  ? 141.507 77.809  113.201 1.00 36.52  ? 95   PRO I N   1 
ATOM   7047  C CA  . PRO I  1 95  ? 140.659 77.267  112.162 1.00 37.83  ? 95   PRO I CA  1 
ATOM   7048  C C   . PRO I  1 95  ? 139.488 78.168  111.850 1.00 39.58  ? 95   PRO I C   1 
ATOM   7049  O O   . PRO I  1 95  ? 138.885 78.773  112.747 1.00 38.42  ? 95   PRO I O   1 
ATOM   7050  C CB  . PRO I  1 95  ? 140.157 75.956  112.775 1.00 38.05  ? 95   PRO I CB  1 
ATOM   7051  C CG  . PRO I  1 95  ? 140.356 76.100  114.276 1.00 37.19  ? 95   PRO I CG  1 
ATOM   7052  C CD  . PRO I  1 95  ? 141.055 77.407  114.543 1.00 37.46  ? 95   PRO I CD  1 
ATOM   7053  N N   . ASN I  1 96  ? 139.189 78.252  110.565 1.00 39.21  ? 96   ASN I N   1 
ATOM   7054  C CA  . ASN I  1 96  ? 137.950 78.826  110.106 1.00 38.68  ? 96   ASN I CA  1 
ATOM   7055  C C   . ASN I  1 96  ? 136.770 78.101  110.772 1.00 38.82  ? 96   ASN I C   1 
ATOM   7056  O O   . ASN I  1 96  ? 136.287 77.089  110.257 1.00 39.31  ? 96   ASN I O   1 
ATOM   7057  C CB  . ASN I  1 96  ? 137.873 78.715  108.577 1.00 38.72  ? 96   ASN I CB  1 
ATOM   7058  C CG  . ASN I  1 96  ? 139.246 78.540  107.935 1.00 41.09  ? 96   ASN I CG  1 
ATOM   7059  O OD1 . ASN I  1 96  ? 139.940 77.548  108.192 1.00 40.71  ? 96   ASN I OD1 1 
ATOM   7060  N ND2 . ASN I  1 96  ? 139.640 79.495  107.092 1.00 35.72  ? 96   ASN I ND2 1 
ATOM   7061  N N   . THR I  1 97  ? 136.334 78.608  111.932 1.00 38.02  ? 97   THR I N   1 
ATOM   7062  C CA  . THR I  1 97  ? 135.101 78.126  112.586 1.00 39.44  ? 97   THR I CA  1 
ATOM   7063  C C   . THR I  1 97  ? 133.819 78.520  111.806 1.00 39.22  ? 97   THR I C   1 
ATOM   7064  O O   . THR I  1 97  ? 133.891 79.326  110.874 1.00 39.33  ? 97   THR I O   1 
ATOM   7065  C CB  . THR I  1 97  ? 135.010 78.642  114.034 1.00 38.21  ? 97   THR I CB  1 
ATOM   7066  O OG1 . THR I  1 97  ? 135.287 80.055  114.058 1.00 38.92  ? 97   THR I OG1 1 
ATOM   7067  C CG2 . THR I  1 97  ? 136.015 77.913  114.919 1.00 38.85  ? 97   THR I CG2 1 
ATOM   7068  N N   . PHE I  1 98  ? 132.659 77.958  112.206 1.00 40.45  ? 98   PHE I N   1 
ATOM   7069  C CA  . PHE I  1 98  ? 131.329 78.107  111.527 1.00 40.80  ? 98   PHE I CA  1 
ATOM   7070  C C   . PHE I  1 98  ? 130.154 78.491  112.474 1.00 40.81  ? 98   PHE I C   1 
ATOM   7071  O O   . PHE I  1 98  ? 130.299 78.435  113.721 1.00 41.99  ? 98   PHE I O   1 
ATOM   7072  C CB  . PHE I  1 98  ? 130.911 76.771  110.914 1.00 40.19  ? 98   PHE I CB  1 
ATOM   7073  C CG  . PHE I  1 98  ? 131.097 76.661  109.428 1.00 41.46  ? 98   PHE I CG  1 
ATOM   7074  C CD1 . PHE I  1 98  ? 132.296 76.202  108.899 1.00 43.51  ? 98   PHE I CD1 1 
ATOM   7075  C CD2 . PHE I  1 98  ? 130.042 76.938  108.554 1.00 43.11  ? 98   PHE I CD2 1 
ATOM   7076  C CE1 . PHE I  1 98  ? 132.464 76.062  107.520 1.00 39.96  ? 98   PHE I CE1 1 
ATOM   7077  C CE2 . PHE I  1 98  ? 130.200 76.805  107.171 1.00 40.78  ? 98   PHE I CE2 1 
ATOM   7078  C CZ  . PHE I  1 98  ? 131.415 76.365  106.656 1.00 39.28  ? 98   PHE I CZ  1 
ATOM   7079  N N   . GLY I  1 99  ? 128.987 78.828  111.895 1.00 41.04  ? 99   GLY I N   1 
ATOM   7080  C CA  . GLY I  1 99  ? 127.743 79.111  112.661 1.00 39.89  ? 99   GLY I CA  1 
ATOM   7081  C C   . GLY I  1 99  ? 126.712 77.982  112.599 1.00 39.70  ? 99   GLY I C   1 
ATOM   7082  O O   . GLY I  1 99  ? 127.075 76.843  112.312 1.00 39.37  ? 99   GLY I O   1 
ATOM   7083  N N   . GLN I  1 100 ? 125.431 78.269  112.856 1.00 40.07  ? 100  GLN I N   1 
ATOM   7084  C CA  . GLN I  1 100 ? 124.412 77.199  112.756 1.00 41.05  ? 100  GLN I CA  1 
ATOM   7085  C C   . GLN I  1 100 ? 123.137 77.492  111.949 1.00 40.93  ? 100  GLN I C   1 
ATOM   7086  O O   . GLN I  1 100 ? 122.052 77.028  112.311 1.00 42.41  ? 100  GLN I O   1 
ATOM   7087  C CB  . GLN I  1 100 ? 124.067 76.574  114.123 1.00 42.47  ? 100  GLN I CB  1 
ATOM   7088  C CG  . GLN I  1 100 ? 123.785 77.553  115.247 1.00 45.50  ? 100  GLN I CG  1 
ATOM   7089  C CD  . GLN I  1 100 ? 124.948 77.667  116.210 1.00 44.81  ? 100  GLN I CD  1 
ATOM   7090  O OE1 . GLN I  1 100 ? 125.673 78.661  116.210 1.00 52.08  ? 100  GLN I OE1 1 
ATOM   7091  N NE2 . GLN I  1 100 ? 125.136 76.643  117.038 1.00 44.37  ? 100  GLN I NE2 1 
ATOM   7092  N N   . GLY I  1 101 ? 123.281 78.245  110.861 1.00 40.30  ? 101  GLY I N   1 
ATOM   7093  C CA  . GLY I  1 101 ? 122.277 78.279  109.788 1.00 41.13  ? 101  GLY I CA  1 
ATOM   7094  C C   . GLY I  1 101 ? 120.868 78.740  110.107 1.00 39.14  ? 101  GLY I C   1 
ATOM   7095  O O   . GLY I  1 101 ? 120.333 78.463  111.182 1.00 38.27  ? 101  GLY I O   1 
ATOM   7096  N N   . THR I  1 102 ? 120.249 79.435  109.159 1.00 38.56  ? 102  THR I N   1 
ATOM   7097  C CA  . THR I  1 102 ? 118.859 79.844  109.325 1.00 38.36  ? 102  THR I CA  1 
ATOM   7098  C C   . THR I  1 102 ? 117.974 79.241  108.230 1.00 38.72  ? 102  THR I C   1 
ATOM   7099  O O   . THR I  1 102 ? 118.119 79.566  107.045 1.00 37.69  ? 102  THR I O   1 
ATOM   7100  C CB  . THR I  1 102 ? 118.726 81.385  109.431 1.00 37.80  ? 102  THR I CB  1 
ATOM   7101  O OG1 . THR I  1 102 ? 119.086 81.803  110.764 1.00 40.37  ? 102  THR I OG1 1 
ATOM   7102  C CG2 . THR I  1 102 ? 117.297 81.839  109.136 1.00 36.51  ? 102  THR I CG2 1 
ATOM   7103  N N   . LYS I  1 103 ? 117.074 78.345  108.637 1.00 38.53  ? 103  LYS I N   1 
ATOM   7104  C CA  . LYS I  1 103 ? 116.254 77.582  107.690 1.00 39.18  ? 103  LYS I CA  1 
ATOM   7105  C C   . LYS I  1 103 ? 115.209 78.446  106.999 1.00 40.24  ? 103  LYS I C   1 
ATOM   7106  O O   . LYS I  1 103 ? 114.150 78.754  107.564 1.00 40.82  ? 103  LYS I O   1 
ATOM   7107  C CB  . LYS I  1 103 ? 115.607 76.355  108.346 1.00 38.92  ? 103  LYS I CB  1 
ATOM   7108  C CG  . LYS I  1 103 ? 116.578 75.173  108.542 1.00 36.52  ? 103  LYS I CG  1 
ATOM   7109  C CD  . LYS I  1 103 ? 115.830 73.885  108.855 1.00 34.40  ? 103  LYS I CD  1 
ATOM   7110  C CE  . LYS I  1 103 ? 116.761 72.839  109.477 1.00 34.33  ? 103  LYS I CE  1 
ATOM   7111  N NZ  . LYS I  1 103 ? 117.793 72.319  108.478 1.00 27.37  ? 103  LYS I NZ  1 
ATOM   7112  N N   . VAL I  1 104 ? 115.519 78.831  105.767 1.00 41.51  ? 104  VAL I N   1 
ATOM   7113  C CA  . VAL I  1 104 ? 114.639 79.711  105.026 1.00 42.93  ? 104  VAL I CA  1 
ATOM   7114  C C   . VAL I  1 104 ? 113.681 78.919  104.125 1.00 44.64  ? 104  VAL I C   1 
ATOM   7115  O O   . VAL I  1 104 ? 114.075 78.355  103.099 1.00 43.82  ? 104  VAL I O   1 
ATOM   7116  C CB  . VAL I  1 104 ? 115.430 80.805  104.263 1.00 42.99  ? 104  VAL I CB  1 
ATOM   7117  C CG1 . VAL I  1 104 ? 114.488 81.707  103.488 1.00 43.58  ? 104  VAL I CG1 1 
ATOM   7118  C CG2 . VAL I  1 104 ? 116.243 81.645  105.248 1.00 40.51  ? 104  VAL I CG2 1 
ATOM   7119  N N   . GLU I  1 105 ? 112.424 78.862  104.574 1.00 45.52  ? 105  GLU I N   1 
ATOM   7120  C CA  . GLU I  1 105 ? 111.265 78.402  103.786 1.00 47.41  ? 105  GLU I CA  1 
ATOM   7121  C C   . GLU I  1 105 ? 110.557 79.661  103.228 1.00 49.13  ? 105  GLU I C   1 
ATOM   7122  O O   . GLU I  1 105 ? 110.784 80.762  103.741 1.00 50.02  ? 105  GLU I O   1 
ATOM   7123  C CB  . GLU I  1 105 ? 110.306 77.566  104.661 1.00 48.46  ? 105  GLU I CB  1 
ATOM   7124  C CG  . GLU I  1 105 ? 110.944 76.329  105.379 1.00 44.18  ? 105  GLU I CG  1 
ATOM   7125  C CD  . GLU I  1 105 ? 110.934 75.049  104.523 1.00 48.30  ? 105  GLU I CD  1 
ATOM   7126  O OE1 . GLU I  1 105 ? 110.182 74.989  103.524 1.00 46.80  ? 105  GLU I OE1 1 
ATOM   7127  O OE2 . GLU I  1 105 ? 111.674 74.099  104.864 1.00 46.84  ? 105  GLU I OE2 1 
ATOM   7128  N N   . ILE I  1 106 ? 109.709 79.515  102.202 1.00 50.51  ? 106  ILE I N   1 
ATOM   7129  C CA  . ILE I  1 106 ? 109.229 80.688  101.422 1.00 49.60  ? 106  ILE I CA  1 
ATOM   7130  C C   . ILE I  1 106 ? 107.692 80.967  101.432 1.00 49.08  ? 106  ILE I C   1 
ATOM   7131  O O   . ILE I  1 106 ? 106.928 80.415  102.252 1.00 48.28  ? 106  ILE I O   1 
ATOM   7132  C CB  . ILE I  1 106 ? 109.736 80.639  99.946  1.00 51.18  ? 106  ILE I CB  1 
ATOM   7133  C CG1 . ILE I  1 106 ? 110.891 81.621  99.729  1.00 51.02  ? 106  ILE I CG1 1 
ATOM   7134  C CG2 . ILE I  1 106 ? 108.622 80.978  98.958  1.00 52.21  ? 106  ILE I CG2 1 
ATOM   7135  C CD1 . ILE I  1 106 ? 112.212 81.282  100.649 1.00 51.36  ? 106  ILE I CD1 1 
ATOM   7136  N N   . ASP J  1 1   ? 148.961 84.698  90.967  1.00 44.61  ? 1    ASP J N   1 
ATOM   7137  C CA  . ASP J  1 1   ? 150.307 85.304  90.688  1.00 44.78  ? 1    ASP J CA  1 
ATOM   7138  C C   . ASP J  1 1   ? 150.248 86.857  90.619  1.00 43.69  ? 1    ASP J C   1 
ATOM   7139  O O   . ASP J  1 1   ? 151.085 87.495  89.963  1.00 43.26  ? 1    ASP J O   1 
ATOM   7140  C CB  . ASP J  1 1   ? 150.912 84.690  89.403  1.00 44.77  ? 1    ASP J CB  1 
ATOM   7141  C CG  . ASP J  1 1   ? 152.419 84.954  89.254  1.00 45.83  ? 1    ASP J CG  1 
ATOM   7142  O OD1 . ASP J  1 1   ? 153.041 85.580  90.146  1.00 43.01  ? 1    ASP J OD1 1 
ATOM   7143  O OD2 . ASP J  1 1   ? 152.985 84.527  88.226  1.00 47.29  ? 1    ASP J OD2 1 
ATOM   7144  N N   . ILE J  1 2   ? 149.273 87.455  91.325  1.00 44.36  ? 2    ILE J N   1 
ATOM   7145  C CA  . ILE J  1 2   ? 148.981 88.923  91.319  1.00 44.64  ? 2    ILE J CA  1 
ATOM   7146  C C   . ILE J  1 2   ? 150.049 89.909  91.871  1.00 44.96  ? 2    ILE J C   1 
ATOM   7147  O O   . ILE J  1 2   ? 150.249 89.955  93.112  1.00 44.21  ? 2    ILE J O   1 
ATOM   7148  C CB  . ILE J  1 2   ? 147.698 89.220  92.183  1.00 44.00  ? 2    ILE J CB  1 
ATOM   7149  C CG1 . ILE J  1 2   ? 146.528 88.296  91.793  1.00 45.31  ? 2    ILE J CG1 1 
ATOM   7150  C CG2 . ILE J  1 2   ? 147.268 90.722  92.089  1.00 44.80  ? 2    ILE J CG2 1 
ATOM   7151  C CD1 . ILE J  1 2   ? 145.510 88.082  92.906  1.00 42.64  ? 2    ILE J CD1 1 
ATOM   7152  N N   . GLN J  1 3   ? 150.711 90.715  91.023  1.00 45.31  ? 3    GLN J N   1 
ATOM   7153  C CA  . GLN J  1 3   ? 151.683 91.730  91.538  1.00 45.41  ? 3    GLN J CA  1 
ATOM   7154  C C   . GLN J  1 3   ? 150.995 93.018  92.091  1.00 46.45  ? 3    GLN J C   1 
ATOM   7155  O O   . GLN J  1 3   ? 149.890 93.362  91.661  1.00 48.43  ? 3    GLN J O   1 
ATOM   7156  C CB  . GLN J  1 3   ? 152.774 92.114  90.494  1.00 44.41  ? 3    GLN J CB  1 
ATOM   7157  C CG  . GLN J  1 3   ? 153.443 90.979  89.629  1.00 45.73  ? 3    GLN J CG  1 
ATOM   7158  C CD  . GLN J  1 3   ? 154.737 90.374  90.237  1.00 45.94  ? 3    GLN J CD  1 
ATOM   7159  O OE1 . GLN J  1 3   ? 155.865 90.727  89.856  1.00 40.61  ? 3    GLN J OE1 1 
ATOM   7160  N NE2 . GLN J  1 3   ? 154.566 89.433  91.174  1.00 46.03  ? 3    GLN J NE2 1 
ATOM   7161  N N   . MET J  1 4   ? 151.648 93.709  93.044  1.00 45.94  ? 4    MET J N   1 
ATOM   7162  C CA  . MET J  1 4   ? 151.192 95.042  93.534  1.00 45.28  ? 4    MET J CA  1 
ATOM   7163  C C   . MET J  1 4   ? 152.067 96.197  93.021  1.00 44.75  ? 4    MET J C   1 
ATOM   7164  O O   . MET J  1 4   ? 153.289 96.058  92.912  1.00 44.50  ? 4    MET J O   1 
ATOM   7165  C CB  . MET J  1 4   ? 151.146 95.122  95.077  1.00 46.18  ? 4    MET J CB  1 
ATOM   7166  C CG  . MET J  1 4   ? 150.431 93.972  95.803  1.00 42.29  ? 4    MET J CG  1 
ATOM   7167  S SD  . MET J  1 4   ? 148.844 93.546  95.043  1.00 37.70  ? 4    MET J SD  1 
ATOM   7168  C CE  . MET J  1 4   ? 147.719 94.668  95.966  1.00 33.46  ? 4    MET J CE  1 
ATOM   7169  N N   . THR J  1 5   ? 151.430 97.327  92.713  1.00 41.76  ? 5    THR J N   1 
ATOM   7170  C CA  . THR J  1 5   ? 152.124 98.577  92.394  1.00 38.40  ? 5    THR J CA  1 
ATOM   7171  C C   . THR J  1 5   ? 151.868 99.585  93.496  1.00 37.34  ? 5    THR J C   1 
ATOM   7172  O O   . THR J  1 5   ? 150.781 100.172 93.571  1.00 37.24  ? 5    THR J O   1 
ATOM   7173  C CB  . THR J  1 5   ? 151.647 99.204  91.058  1.00 39.11  ? 5    THR J CB  1 
ATOM   7174  O OG1 . THR J  1 5   ? 150.247 98.936  90.871  1.00 38.06  ? 5    THR J OG1 1 
ATOM   7175  C CG2 . THR J  1 5   ? 152.425 98.607  89.873  1.00 34.47  ? 5    THR J CG2 1 
ATOM   7176  N N   . GLN J  1 6   ? 152.854 99.776  94.363  1.00 36.09  ? 6    GLN J N   1 
ATOM   7177  C CA  . GLN J  1 6   ? 152.693 100.787 95.383  1.00 37.40  ? 6    GLN J CA  1 
ATOM   7178  C C   . GLN J  1 6   ? 153.345 102.091 94.952  1.00 37.20  ? 6    GLN J C   1 
ATOM   7179  O O   . GLN J  1 6   ? 153.928 102.159 93.868  1.00 37.49  ? 6    GLN J O   1 
ATOM   7180  C CB  . GLN J  1 6   ? 153.204 100.319 96.733  1.00 37.47  ? 6    GLN J CB  1 
ATOM   7181  C CG  . GLN J  1 6   ? 152.532 101.088 97.840  1.00 38.00  ? 6    GLN J CG  1 
ATOM   7182  C CD  . GLN J  1 6   ? 152.855 100.582 99.207  1.00 38.88  ? 6    GLN J CD  1 
ATOM   7183  O OE1 . GLN J  1 6   ? 152.333 101.087 100.195 1.00 32.84  ? 6    GLN J OE1 1 
ATOM   7184  N NE2 . GLN J  1 6   ? 153.729 99.586  99.287  1.00 36.70  ? 6    GLN J NE2 1 
ATOM   7185  N N   . SER J  1 7   ? 153.231 103.129 95.784  1.00 36.61  ? 7    SER J N   1 
ATOM   7186  C CA  . SER J  1 7   ? 153.784 104.433 95.432  1.00 37.40  ? 7    SER J CA  1 
ATOM   7187  C C   . SER J  1 7   ? 153.443 105.538 96.424  1.00 37.23  ? 7    SER J C   1 
ATOM   7188  O O   . SER J  1 7   ? 152.315 105.597 96.937  1.00 36.15  ? 7    SER J O   1 
ATOM   7189  C CB  . SER J  1 7   ? 153.317 104.864 94.041  1.00 36.36  ? 7    SER J CB  1 
ATOM   7190  O OG  . SER J  1 7   ? 151.898 104.987 94.010  1.00 37.93  ? 7    SER J OG  1 
ATOM   7191  N N   . PRO J  1 8   ? 154.399 106.452 96.657  1.00 37.15  ? 8    PRO J N   1 
ATOM   7192  C CA  . PRO J  1 8   ? 155.700 106.510 95.988  1.00 37.98  ? 8    PRO J CA  1 
ATOM   7193  C C   . PRO J  1 8   ? 156.708 105.478 96.499  1.00 39.31  ? 8    PRO J C   1 
ATOM   7194  O O   . PRO J  1 8   ? 156.340 104.356 96.853  1.00 38.91  ? 8    PRO J O   1 
ATOM   7195  C CB  . PRO J  1 8   ? 156.196 107.924 96.317  1.00 37.48  ? 8    PRO J CB  1 
ATOM   7196  C CG  . PRO J  1 8   ? 155.037 108.619 96.962  1.00 38.42  ? 8    PRO J CG  1 
ATOM   7197  C CD  . PRO J  1 8   ? 154.244 107.560 97.611  1.00 36.68  ? 8    PRO J CD  1 
ATOM   7198  N N   . SER J  1 9   ? 157.982 105.878 96.521  1.00 41.25  ? 9    SER J N   1 
ATOM   7199  C CA  . SER J  1 9   ? 159.085 105.012 96.923  1.00 41.08  ? 9    SER J CA  1 
ATOM   7200  C C   . SER J  1 9   ? 160.073 105.819 97.757  1.00 42.35  ? 9    SER J C   1 
ATOM   7201  O O   . SER J  1 9   ? 160.802 105.262 98.586  1.00 42.99  ? 9    SER J O   1 
ATOM   7202  C CB  . SER J  1 9   ? 159.781 104.426 95.693  1.00 41.91  ? 9    SER J CB  1 
ATOM   7203  O OG  . SER J  1 9   ? 161.068 103.847 96.038  1.00 42.89  ? 9    SER J OG  1 
ATOM   7204  N N   . SER J  1 10  ? 160.122 107.126 97.517  1.00 42.92  ? 10   SER J N   1 
ATOM   7205  C CA  . SER J  1 10  ? 160.643 108.021 98.540  1.00 43.86  ? 10   SER J CA  1 
ATOM   7206  C C   . SER J  1 10  ? 159.711 109.160 98.906  1.00 44.44  ? 10   SER J C   1 
ATOM   7207  O O   . SER J  1 10  ? 158.931 109.657 98.089  1.00 46.03  ? 10   SER J O   1 
ATOM   7208  C CB  . SER J  1 10  ? 162.094 108.488 98.296  1.00 44.25  ? 10   SER J CB  1 
ATOM   7209  O OG  . SER J  1 10  ? 162.397 108.692 96.922  1.00 48.15  ? 10   SER J OG  1 
ATOM   7210  N N   . LEU J  1 11  ? 159.812 109.533 100.178 1.00 43.45  ? 11   LEU J N   1 
ATOM   7211  C CA  . LEU J  1 11  ? 158.948 110.507 100.821 1.00 42.82  ? 11   LEU J CA  1 
ATOM   7212  C C   . LEU J  1 11  ? 159.755 111.262 101.889 1.00 41.93  ? 11   LEU J C   1 
ATOM   7213  O O   . LEU J  1 11  ? 160.382 110.642 102.754 1.00 42.17  ? 11   LEU J O   1 
ATOM   7214  C CB  . LEU J  1 11  ? 157.757 109.778 101.471 1.00 41.77  ? 11   LEU J CB  1 
ATOM   7215  C CG  . LEU J  1 11  ? 156.310 110.318 101.425 1.00 46.00  ? 11   LEU J CG  1 
ATOM   7216  C CD1 . LEU J  1 11  ? 155.878 110.590 99.979  1.00 42.20  ? 11   LEU J CD1 1 
ATOM   7217  C CD2 . LEU J  1 11  ? 155.334 109.326 102.102 1.00 44.21  ? 11   LEU J CD2 1 
ATOM   7218  N N   . SER J  1 12  ? 159.765 112.596 101.803 1.00 39.04  ? 12   SER J N   1 
ATOM   7219  C CA  . SER J  1 12  ? 160.156 113.430 102.957 1.00 37.76  ? 12   SER J CA  1 
ATOM   7220  C C   . SER J  1 12  ? 159.011 114.368 103.327 1.00 36.21  ? 12   SER J C   1 
ATOM   7221  O O   . SER J  1 12  ? 158.648 115.261 102.561 1.00 30.30  ? 12   SER J O   1 
ATOM   7222  C CB  . SER J  1 12  ? 161.451 114.221 102.716 1.00 37.28  ? 12   SER J CB  1 
ATOM   7223  O OG  . SER J  1 12  ? 162.584 113.369 102.696 1.00 35.06  ? 12   SER J OG  1 
ATOM   7224  N N   . ALA J  1 13  ? 158.445 114.149 104.511 1.00 35.11  ? 13   ALA J N   1 
ATOM   7225  C CA  . ALA J  1 13  ? 157.326 114.950 104.994 1.00 35.16  ? 13   ALA J CA  1 
ATOM   7226  C C   . ALA J  1 13  ? 157.552 115.326 106.451 1.00 34.13  ? 13   ALA J C   1 
ATOM   7227  O O   . ALA J  1 13  ? 158.226 114.597 107.186 1.00 33.64  ? 13   ALA J O   1 
ATOM   7228  C CB  . ALA J  1 13  ? 156.026 114.177 104.848 1.00 34.48  ? 13   ALA J CB  1 
ATOM   7229  N N   . SER J  1 14  ? 156.985 116.453 106.878 1.00 33.50  ? 14   SER J N   1 
ATOM   7230  C CA  . SER J  1 14  ? 157.265 116.998 108.210 1.00 30.16  ? 14   SER J CA  1 
ATOM   7231  C C   . SER J  1 14  ? 156.324 116.483 109.298 1.00 27.91  ? 14   SER J C   1 
ATOM   7232  O O   . SER J  1 14  ? 155.232 115.970 109.002 1.00 27.94  ? 14   SER J O   1 
ATOM   7233  C CB  . SER J  1 14  ? 157.223 118.533 108.180 1.00 29.14  ? 14   SER J CB  1 
ATOM   7234  O OG  . SER J  1 14  ? 157.951 119.029 107.047 1.00 32.22  ? 14   SER J OG  1 
ATOM   7235  N N   . VAL J  1 15  ? 156.767 116.616 110.554 1.00 26.52  ? 15   VAL J N   1 
ATOM   7236  C CA  . VAL J  1 15  ? 155.933 116.300 111.717 1.00 23.69  ? 15   VAL J CA  1 
ATOM   7237  C C   . VAL J  1 15  ? 154.610 117.032 111.573 1.00 24.00  ? 15   VAL J C   1 
ATOM   7238  O O   . VAL J  1 15  ? 154.589 118.238 111.308 1.00 21.21  ? 15   VAL J O   1 
ATOM   7239  C CB  . VAL J  1 15  ? 156.601 116.713 113.067 1.00 24.75  ? 15   VAL J CB  1 
ATOM   7240  C CG1 . VAL J  1 15  ? 155.724 116.315 114.262 1.00 12.50  ? 15   VAL J CG1 1 
ATOM   7241  C CG2 . VAL J  1 15  ? 157.989 116.081 113.212 1.00 21.15  ? 15   VAL J CG2 1 
ATOM   7242  N N   . GLY J  1 16  ? 153.513 116.297 111.736 1.00 26.40  ? 16   GLY J N   1 
ATOM   7243  C CA  . GLY J  1 16  ? 152.183 116.906 111.652 1.00 30.00  ? 16   GLY J CA  1 
ATOM   7244  C C   . GLY J  1 16  ? 151.623 116.905 110.245 1.00 33.15  ? 16   GLY J C   1 
ATOM   7245  O O   . GLY J  1 16  ? 150.404 116.899 110.061 1.00 33.51  ? 16   GLY J O   1 
ATOM   7246  N N   . ASP J  1 17  ? 152.512 116.917 109.251 1.00 35.14  ? 17   ASP J N   1 
ATOM   7247  C CA  . ASP J  1 17  ? 152.083 116.883 107.859 1.00 36.77  ? 17   ASP J CA  1 
ATOM   7248  C C   . ASP J  1 17  ? 151.504 115.521 107.494 1.00 39.07  ? 17   ASP J C   1 
ATOM   7249  O O   . ASP J  1 17  ? 152.153 114.488 107.684 1.00 40.51  ? 17   ASP J O   1 
ATOM   7250  C CB  . ASP J  1 17  ? 153.244 117.247 106.929 1.00 37.38  ? 17   ASP J CB  1 
ATOM   7251  C CG  . ASP J  1 17  ? 153.307 118.736 106.618 1.00 36.49  ? 17   ASP J CG  1 
ATOM   7252  O OD1 . ASP J  1 17  ? 152.559 119.531 107.236 1.00 33.95  ? 17   ASP J OD1 1 
ATOM   7253  O OD2 . ASP J  1 17  ? 154.113 119.118 105.739 1.00 34.19  ? 17   ASP J OD2 1 
ATOM   7254  N N   . ARG J  1 18  ? 150.269 115.529 106.993 1.00 41.08  ? 18   ARG J N   1 
ATOM   7255  C CA  . ARG J  1 18  ? 149.652 114.321 106.472 1.00 41.54  ? 18   ARG J CA  1 
ATOM   7256  C C   . ARG J  1 18  ? 150.532 113.746 105.377 1.00 41.42  ? 18   ARG J C   1 
ATOM   7257  O O   . ARG J  1 18  ? 151.072 114.480 104.550 1.00 41.29  ? 18   ARG J O   1 
ATOM   7258  C CB  . ARG J  1 18  ? 148.264 114.602 105.896 1.00 42.87  ? 18   ARG J CB  1 
ATOM   7259  C CG  . ARG J  1 18  ? 147.727 113.427 105.094 1.00 43.38  ? 18   ARG J CG  1 
ATOM   7260  C CD  . ARG J  1 18  ? 146.990 113.854 103.855 1.00 47.00  ? 18   ARG J CD  1 
ATOM   7261  N NE  . ARG J  1 18  ? 145.564 113.603 104.003 1.00 53.09  ? 18   ARG J NE  1 
ATOM   7262  C CZ  . ARG J  1 18  ? 144.687 114.482 104.479 1.00 56.30  ? 18   ARG J CZ  1 
ATOM   7263  N NH1 . ARG J  1 18  ? 145.076 115.697 104.854 1.00 55.05  ? 18   ARG J NH1 1 
ATOM   7264  N NH2 . ARG J  1 18  ? 143.408 114.143 104.573 1.00 57.25  ? 18   ARG J NH2 1 
ATOM   7265  N N   . VAL J  1 19  ? 150.679 112.429 105.389 1.00 40.97  ? 19   VAL J N   1 
ATOM   7266  C CA  . VAL J  1 19  ? 151.319 111.714 104.297 1.00 40.01  ? 19   VAL J CA  1 
ATOM   7267  C C   . VAL J  1 19  ? 150.185 110.981 103.561 1.00 39.70  ? 19   VAL J C   1 
ATOM   7268  O O   . VAL J  1 19  ? 149.101 110.739 104.143 1.00 39.95  ? 19   VAL J O   1 
ATOM   7269  C CB  . VAL J  1 19  ? 152.399 110.740 104.872 1.00 39.30  ? 19   VAL J CB  1 
ATOM   7270  C CG1 . VAL J  1 19  ? 152.366 109.380 104.196 1.00 40.44  ? 19   VAL J CG1 1 
ATOM   7271  C CG2 . VAL J  1 19  ? 153.790 111.358 104.777 1.00 39.68  ? 19   VAL J CG2 1 
ATOM   7272  N N   . THR J  1 20  ? 150.414 110.645 102.290 1.00 39.02  ? 20   THR J N   1 
ATOM   7273  C CA  . THR J  1 20  ? 149.512 109.763 101.548 1.00 36.99  ? 20   THR J CA  1 
ATOM   7274  C C   . THR J  1 20  ? 150.316 108.742 100.746 1.00 37.23  ? 20   THR J C   1 
ATOM   7275  O O   . THR J  1 20  ? 151.314 109.092 100.099 1.00 35.55  ? 20   THR J O   1 
ATOM   7276  C CB  . THR J  1 20  ? 148.576 110.542 100.590 1.00 36.88  ? 20   THR J CB  1 
ATOM   7277  O OG1 . THR J  1 20  ? 147.518 111.166 101.336 1.00 35.63  ? 20   THR J OG1 1 
ATOM   7278  C CG2 . THR J  1 20  ? 147.989 109.607 99.504  1.00 32.09  ? 20   THR J CG2 1 
ATOM   7279  N N   . ILE J  1 21  ? 149.871 107.477 100.797 1.00 35.95  ? 21   ILE J N   1 
ATOM   7280  C CA  . ILE J  1 21  ? 150.443 106.396 99.966  1.00 34.94  ? 21   ILE J CA  1 
ATOM   7281  C C   . ILE J  1 21  ? 149.386 105.707 99.087  1.00 35.18  ? 21   ILE J C   1 
ATOM   7282  O O   . ILE J  1 21  ? 148.207 105.664 99.442  1.00 31.02  ? 21   ILE J O   1 
ATOM   7283  C CB  . ILE J  1 21  ? 151.170 105.316 100.819 1.00 34.59  ? 21   ILE J CB  1 
ATOM   7284  C CG1 . ILE J  1 21  ? 152.196 105.946 101.765 1.00 35.24  ? 21   ILE J CG1 1 
ATOM   7285  C CG2 . ILE J  1 21  ? 151.860 104.288 99.932  1.00 36.28  ? 21   ILE J CG2 1 
ATOM   7286  C CD1 . ILE J  1 21  ? 151.636 106.167 103.200 1.00 32.64  ? 21   ILE J CD1 1 
ATOM   7287  N N   . THR J  1 22  ? 149.825 105.161 97.950  1.00 35.23  ? 22   THR J N   1 
ATOM   7288  C CA  . THR J  1 22  ? 148.920 104.506 97.002  1.00 37.58  ? 22   THR J CA  1 
ATOM   7289  C C   . THR J  1 22  ? 149.272 103.065 96.664  1.00 38.03  ? 22   THR J C   1 
ATOM   7290  O O   . THR J  1 22  ? 150.406 102.766 96.277  1.00 36.50  ? 22   THR J O   1 
ATOM   7291  C CB  . THR J  1 22  ? 148.813 105.278 95.667  1.00 36.65  ? 22   THR J CB  1 
ATOM   7292  O OG1 . THR J  1 22  ? 150.010 106.037 95.445  1.00 41.49  ? 22   THR J OG1 1 
ATOM   7293  C CG2 . THR J  1 22  ? 147.619 106.229 95.697  1.00 34.81  ? 22   THR J CG2 1 
ATOM   7294  N N   . CYS J  1 23  ? 148.285 102.183 96.782  1.00 40.31  ? 23   CYS J N   1 
ATOM   7295  C CA  . CYS J  1 23  ? 148.438 100.827 96.285  1.00 43.27  ? 23   CYS J CA  1 
ATOM   7296  C C   . CYS J  1 23  ? 147.437 100.568 95.162  1.00 43.77  ? 23   CYS J C   1 
ATOM   7297  O O   . CYS J  1 23  ? 146.259 100.917 95.283  1.00 43.74  ? 23   CYS J O   1 
ATOM   7298  C CB  . CYS J  1 23  ? 148.234 99.811  97.416  1.00 43.37  ? 23   CYS J CB  1 
ATOM   7299  S SG  . CYS J  1 23  ? 148.904 98.164  97.085  1.00 42.41  ? 23   CYS J SG  1 
ATOM   7300  N N   . ARG J  1 24  ? 147.913 99.985  94.063  1.00 44.86  ? 24   ARG J N   1 
ATOM   7301  C CA  . ARG J  1 24  ? 147.020 99.306  93.111  1.00 44.57  ? 24   ARG J CA  1 
ATOM   7302  C C   . ARG J  1 24  ? 147.524 97.894  92.757  1.00 44.30  ? 24   ARG J C   1 
ATOM   7303  O O   . ARG J  1 24  ? 148.731 97.654  92.635  1.00 42.20  ? 24   ARG J O   1 
ATOM   7304  C CB  . ARG J  1 24  ? 146.697 100.149 91.852  1.00 43.42  ? 24   ARG J CB  1 
ATOM   7305  C CG  . ARG J  1 24  ? 145.442 101.061 91.987  1.00 47.60  ? 24   ARG J CG  1 
ATOM   7306  C CD  . ARG J  1 24  ? 144.506 101.030 90.741  1.00 44.40  ? 24   ARG J CD  1 
ATOM   7307  N NE  . ARG J  1 24  ? 143.289 101.843 90.908  1.00 44.79  ? 24   ARG J NE  1 
ATOM   7308  C CZ  . ARG J  1 24  ? 142.618 102.431 89.914  1.00 44.79  ? 24   ARG J CZ  1 
ATOM   7309  N NH1 . ARG J  1 24  ? 143.035 102.308 88.659  1.00 43.73  ? 24   ARG J NH1 1 
ATOM   7310  N NH2 . ARG J  1 24  ? 141.525 103.149 90.175  1.00 40.95  ? 24   ARG J NH2 1 
ATOM   7311  N N   . ALA J  1 25  ? 146.564 96.977  92.611  1.00 44.84  ? 25   ALA J N   1 
ATOM   7312  C CA  . ALA J  1 25  ? 146.834 95.557  92.396  1.00 45.11  ? 25   ALA J CA  1 
ATOM   7313  C C   . ALA J  1 25  ? 146.446 95.109  90.998  1.00 45.41  ? 25   ALA J C   1 
ATOM   7314  O O   . ALA J  1 25  ? 145.353 95.431  90.508  1.00 45.31  ? 25   ALA J O   1 
ATOM   7315  C CB  . ALA J  1 25  ? 146.094 94.724  93.417  1.00 45.51  ? 25   ALA J CB  1 
ATOM   7316  N N   . SER J  1 26  ? 147.351 94.348  90.377  1.00 45.21  ? 26   SER J N   1 
ATOM   7317  C CA  . SER J  1 26  ? 147.163 93.784  89.036  1.00 44.23  ? 26   SER J CA  1 
ATOM   7318  C C   . SER J  1 26  ? 145.750 93.286  88.746  1.00 43.57  ? 26   SER J C   1 
ATOM   7319  O O   . SER J  1 26  ? 145.242 93.467  87.626  1.00 45.63  ? 26   SER J O   1 
ATOM   7320  C CB  . SER J  1 26  ? 148.162 92.654  88.785  1.00 43.95  ? 26   SER J CB  1 
ATOM   7321  O OG  . SER J  1 26  ? 149.492 93.041  89.141  1.00 41.30  ? 26   SER J OG  1 
ATOM   7322  N N   . GLN J  1 27  ? 145.129 92.647  89.736  1.00 41.10  ? 27   GLN J N   1 
ATOM   7323  C CA  . GLN J  1 27  ? 143.730 92.240  89.634  1.00 40.07  ? 27   GLN J CA  1 
ATOM   7324  C C   . GLN J  1 27  ? 142.957 92.861  90.790  1.00 38.83  ? 27   GLN J C   1 
ATOM   7325  O O   . GLN J  1 27  ? 143.531 93.571  91.625  1.00 39.00  ? 27   GLN J O   1 
ATOM   7326  C CB  . GLN J  1 27  ? 143.611 90.712  89.644  1.00 41.16  ? 27   GLN J CB  1 
ATOM   7327  C CG  . GLN J  1 27  ? 142.182 90.160  89.532  1.00 40.03  ? 27   GLN J CG  1 
ATOM   7328  C CD  . GLN J  1 27  ? 142.132 88.679  89.845  1.00 41.29  ? 27   GLN J CD  1 
ATOM   7329  O OE1 . GLN J  1 27  ? 142.772 87.873  89.166  1.00 43.95  ? 27   GLN J OE1 1 
ATOM   7330  N NE2 . GLN J  1 27  ? 141.366 88.308  90.870  1.00 42.91  ? 27   GLN J NE2 1 
ATOM   7331  N N   . SER J  1 28  ? 141.657 92.569  90.849  1.00 36.62  ? 28   SER J N   1 
ATOM   7332  C CA  . SER J  1 28  ? 140.735 93.182  91.800  1.00 35.81  ? 28   SER J CA  1 
ATOM   7333  C C   . SER J  1 28  ? 140.580 92.320  93.057  1.00 36.64  ? 28   SER J C   1 
ATOM   7334  O O   . SER J  1 28  ? 139.900 91.288  93.034  1.00 37.84  ? 28   SER J O   1 
ATOM   7335  C CB  . SER J  1 28  ? 139.377 93.415  91.113  1.00 34.74  ? 28   SER J CB  1 
ATOM   7336  O OG  . SER J  1 28  ? 138.412 93.973  92.009  1.00 31.93  ? 28   SER J OG  1 
ATOM   7337  N N   . ILE J  1 29  ? 141.213 92.751  94.147  1.00 35.72  ? 29   ILE J N   1 
ATOM   7338  C CA  . ILE J  1 29  ? 141.397 91.882  95.317  1.00 34.53  ? 29   ILE J CA  1 
ATOM   7339  C C   . ILE J  1 29  ? 140.417 92.159  96.459  1.00 33.72  ? 29   ILE J C   1 
ATOM   7340  O O   . ILE J  1 29  ? 140.820 92.396  97.608  1.00 30.71  ? 29   ILE J O   1 
ATOM   7341  C CB  . ILE J  1 29  ? 142.842 91.953  95.860  1.00 34.33  ? 29   ILE J CB  1 
ATOM   7342  C CG1 . ILE J  1 29  ? 143.317 93.405  95.961  1.00 27.09  ? 29   ILE J CG1 1 
ATOM   7343  C CG2 . ILE J  1 29  ? 143.801 91.115  94.970  1.00 34.54  ? 29   ILE J CG2 1 
ATOM   7344  C CD1 . ILE J  1 29  ? 144.035 93.679  97.288  1.00 22.51  ? 29   ILE J CD1 1 
ATOM   7345  N N   . SER J  1 30  ? 139.127 92.075  96.127  1.00 35.14  ? 30   SER J N   1 
ATOM   7346  C CA  . SER J  1 30  ? 138.016 92.497  96.993  1.00 37.20  ? 30   SER J CA  1 
ATOM   7347  C C   . SER J  1 30  ? 138.388 93.548  98.026  1.00 37.91  ? 30   SER J C   1 
ATOM   7348  O O   . SER J  1 30  ? 138.316 94.741  97.747  1.00 39.95  ? 30   SER J O   1 
ATOM   7349  C CB  . SER J  1 30  ? 137.342 91.303  97.682  1.00 38.17  ? 30   SER J CB  1 
ATOM   7350  O OG  . SER J  1 30  ? 136.482 91.749  98.743  1.00 40.28  ? 30   SER J OG  1 
ATOM   7351  N N   . SER J  1 31  ? 138.774 93.100  99.215  1.00 36.35  ? 31   SER J N   1 
ATOM   7352  C CA  . SER J  1 31  ? 139.098 94.014  100.299 1.00 33.67  ? 31   SER J CA  1 
ATOM   7353  C C   . SER J  1 31  ? 140.313 93.505  101.041 1.00 33.76  ? 31   SER J C   1 
ATOM   7354  O O   . SER J  1 31  ? 140.647 93.990  102.123 1.00 34.96  ? 31   SER J O   1 
ATOM   7355  C CB  . SER J  1 31  ? 137.910 94.123  101.262 1.00 34.11  ? 31   SER J CB  1 
ATOM   7356  O OG  . SER J  1 31  ? 138.271 94.819  102.481 1.00 26.90  ? 31   SER J OG  1 
ATOM   7357  N N   . TYR J  1 32  ? 140.986 92.533  100.441 1.00 33.65  ? 32   TYR J N   1 
ATOM   7358  C CA  . TYR J  1 32  ? 142.064 91.838  101.115 1.00 31.10  ? 32   TYR J CA  1 
ATOM   7359  C C   . TYR J  1 32  ? 143.402 92.514  100.975 1.00 28.89  ? 32   TYR J C   1 
ATOM   7360  O O   . TYR J  1 32  ? 144.361 91.915  100.484 1.00 29.84  ? 32   TYR J O   1 
ATOM   7361  C CB  . TYR J  1 32  ? 142.188 90.424  100.582 1.00 31.81  ? 32   TYR J CB  1 
ATOM   7362  C CG  . TYR J  1 32  ? 141.212 89.481  101.195 1.00 31.14  ? 32   TYR J CG  1 
ATOM   7363  C CD1 . TYR J  1 32  ? 140.145 88.992  100.452 1.00 24.81  ? 32   TYR J CD1 1 
ATOM   7364  C CD2 . TYR J  1 32  ? 141.349 89.064  102.515 1.00 35.84  ? 32   TYR J CD2 1 
ATOM   7365  C CE1 . TYR J  1 32  ? 139.234 88.115  101.005 1.00 37.22  ? 32   TYR J CE1 1 
ATOM   7366  C CE2 . TYR J  1 32  ? 140.441 88.194  103.080 1.00 40.05  ? 32   TYR J CE2 1 
ATOM   7367  C CZ  . TYR J  1 32  ? 139.385 87.720  102.322 1.00 39.26  ? 32   TYR J CZ  1 
ATOM   7368  O OH  . TYR J  1 32  ? 138.475 86.846  102.878 1.00 40.64  ? 32   TYR J OH  1 
ATOM   7369  N N   . LEU J  1 33  ? 143.482 93.761  101.412 1.00 27.84  ? 33   LEU J N   1 
ATOM   7370  C CA  . LEU J  1 33  ? 144.767 94.426  101.443 1.00 27.38  ? 33   LEU J CA  1 
ATOM   7371  C C   . LEU J  1 33  ? 145.166 94.795  102.857 1.00 27.77  ? 33   LEU J C   1 
ATOM   7372  O O   . LEU J  1 33  ? 144.325 95.167  103.687 1.00 28.00  ? 33   LEU J O   1 
ATOM   7373  C CB  . LEU J  1 33  ? 144.791 95.663  100.543 1.00 24.37  ? 33   LEU J CB  1 
ATOM   7374  C CG  . LEU J  1 33  ? 146.218 96.141  100.208 1.00 20.53  ? 33   LEU J CG  1 
ATOM   7375  C CD1 . LEU J  1 33  ? 146.745 95.508  98.936  1.00 2.80   ? 33   LEU J CD1 1 
ATOM   7376  C CD2 . LEU J  1 33  ? 146.232 97.651  100.100 1.00 11.69  ? 33   LEU J CD2 1 
ATOM   7377  N N   . ASN J  1 34  ? 146.466 94.682  103.113 1.00 28.84  ? 34   ASN J N   1 
ATOM   7378  C CA  . ASN J  1 34  ? 147.030 95.100  104.377 1.00 29.85  ? 34   ASN J CA  1 
ATOM   7379  C C   . ASN J  1 34  ? 148.271 95.934  104.193 1.00 30.36  ? 34   ASN J C   1 
ATOM   7380  O O   . ASN J  1 34  ? 149.119 95.658  103.340 1.00 30.10  ? 34   ASN J O   1 
ATOM   7381  C CB  . ASN J  1 34  ? 147.396 93.894  105.239 1.00 29.48  ? 34   ASN J CB  1 
ATOM   7382  C CG  . ASN J  1 34  ? 146.389 92.783  105.141 1.00 30.60  ? 34   ASN J CG  1 
ATOM   7383  O OD1 . ASN J  1 34  ? 145.189 92.991  105.315 1.00 24.56  ? 34   ASN J OD1 1 
ATOM   7384  N ND2 . ASN J  1 34  ? 146.876 91.572  104.860 1.00 34.16  ? 34   ASN J ND2 1 
ATOM   7385  N N   . TRP J  1 35  ? 148.354 96.961  105.026 1.00 31.95  ? 35   TRP J N   1 
ATOM   7386  C CA  . TRP J  1 35  ? 149.557 97.746  105.183 1.00 31.13  ? 35   TRP J CA  1 
ATOM   7387  C C   . TRP J  1 35  ? 150.284 97.252  106.423 1.00 32.61  ? 35   TRP J C   1 
ATOM   7388  O O   . TRP J  1 35  ? 149.680 96.911  107.459 1.00 31.74  ? 35   TRP J O   1 
ATOM   7389  C CB  . TRP J  1 35  ? 149.237 99.238  105.287 1.00 29.89  ? 35   TRP J CB  1 
ATOM   7390  C CG  . TRP J  1 35  ? 148.340 99.704  104.184 1.00 29.72  ? 35   TRP J CG  1 
ATOM   7391  C CD1 . TRP J  1 35  ? 146.984 99.562  104.128 1.00 32.74  ? 35   TRP J CD1 1 
ATOM   7392  C CD2 . TRP J  1 35  ? 148.723 100.366 102.971 1.00 25.06  ? 35   TRP J CD2 1 
ATOM   7393  N NE1 . TRP J  1 35  ? 146.497 100.094 102.961 1.00 31.10  ? 35   TRP J NE1 1 
ATOM   7394  C CE2 . TRP J  1 35  ? 147.541 100.594 102.230 1.00 25.01  ? 35   TRP J CE2 1 
ATOM   7395  C CE3 . TRP J  1 35  ? 149.946 100.785 102.435 1.00 26.45  ? 35   TRP J CE3 1 
ATOM   7396  C CZ2 . TRP J  1 35  ? 147.544 101.229 100.988 1.00 29.83  ? 35   TRP J CZ2 1 
ATOM   7397  C CZ3 . TRP J  1 35  ? 149.945 101.419 101.203 1.00 28.83  ? 35   TRP J CZ3 1 
ATOM   7398  C CH2 . TRP J  1 35  ? 148.753 101.633 100.491 1.00 31.43  ? 35   TRP J CH2 1 
ATOM   7399  N N   . TYR J  1 36  ? 151.604 97.214  106.264 1.00 34.73  ? 36   TYR J N   1 
ATOM   7400  C CA  . TYR J  1 36  ? 152.559 96.735  107.241 1.00 36.33  ? 36   TYR J CA  1 
ATOM   7401  C C   . TYR J  1 36  ? 153.570 97.862  107.382 1.00 36.92  ? 36   TYR J C   1 
ATOM   7402  O O   . TYR J  1 36  ? 154.098 98.342  106.372 1.00 37.08  ? 36   TYR J O   1 
ATOM   7403  C CB  . TYR J  1 36  ? 153.301 95.516  106.677 1.00 35.57  ? 36   TYR J CB  1 
ATOM   7404  C CG  . TYR J  1 36  ? 152.583 94.198  106.812 1.00 35.32  ? 36   TYR J CG  1 
ATOM   7405  C CD1 . TYR J  1 36  ? 151.781 93.711  105.783 1.00 36.43  ? 36   TYR J CD1 1 
ATOM   7406  C CD2 . TYR J  1 36  ? 152.717 93.428  107.965 1.00 32.70  ? 36   TYR J CD2 1 
ATOM   7407  C CE1 . TYR J  1 36  ? 151.125 92.491  105.901 1.00 40.00  ? 36   TYR J CE1 1 
ATOM   7408  C CE2 . TYR J  1 36  ? 152.069 92.211  108.096 1.00 38.33  ? 36   TYR J CE2 1 
ATOM   7409  C CZ  . TYR J  1 36  ? 151.273 91.748  107.061 1.00 41.18  ? 36   TYR J CZ  1 
ATOM   7410  O OH  . TYR J  1 36  ? 150.623 90.543  107.191 1.00 37.85  ? 36   TYR J OH  1 
ATOM   7411  N N   . GLN J  1 37  ? 153.847 98.293  108.606 1.00 38.53  ? 37   GLN J N   1 
ATOM   7412  C CA  . GLN J  1 37  ? 154.938 99.242  108.819 1.00 39.69  ? 37   GLN J CA  1 
ATOM   7413  C C   . GLN J  1 37  ? 156.181 98.437  109.136 1.00 39.90  ? 37   GLN J C   1 
ATOM   7414  O O   . GLN J  1 37  ? 156.138 97.530  109.973 1.00 39.53  ? 37   GLN J O   1 
ATOM   7415  C CB  . GLN J  1 37  ? 154.617 100.188 109.978 1.00 39.09  ? 37   GLN J CB  1 
ATOM   7416  C CG  . GLN J  1 37  ? 155.700 101.204 110.326 1.00 38.84  ? 37   GLN J CG  1 
ATOM   7417  C CD  . GLN J  1 37  ? 155.494 101.852 111.689 1.00 40.83  ? 37   GLN J CD  1 
ATOM   7418  O OE1 . GLN J  1 37  ? 156.285 101.652 112.609 1.00 39.97  ? 37   GLN J OE1 1 
ATOM   7419  N NE2 . GLN J  1 37  ? 154.415 102.621 111.832 1.00 33.57  ? 37   GLN J NE2 1 
ATOM   7420  N N   . GLN J  1 38  ? 157.286 98.750  108.470 1.00 38.48  ? 38   GLN J N   1 
ATOM   7421  C CA  . GLN J  1 38  ? 158.561 98.165  108.863 1.00 37.88  ? 38   GLN J CA  1 
ATOM   7422  C C   . GLN J  1 38  ? 159.634 99.206  109.142 1.00 37.33  ? 38   GLN J C   1 
ATOM   7423  O O   . GLN J  1 38  ? 160.063 99.953  108.255 1.00 37.87  ? 38   GLN J O   1 
ATOM   7424  C CB  . GLN J  1 38  ? 159.062 97.131  107.848 1.00 37.77  ? 38   GLN J CB  1 
ATOM   7425  C CG  . GLN J  1 38  ? 160.505 96.734  108.135 1.00 38.07  ? 38   GLN J CG  1 
ATOM   7426  C CD  . GLN J  1 38  ? 161.050 95.775  107.124 1.00 39.52  ? 38   GLN J CD  1 
ATOM   7427  O OE1 . GLN J  1 38  ? 161.542 96.180  106.070 1.00 36.38  ? 38   GLN J OE1 1 
ATOM   7428  N NE2 . GLN J  1 38  ? 160.975 94.487  107.431 1.00 34.47  ? 38   GLN J NE2 1 
ATOM   7429  N N   . LYS J  1 39  ? 160.054 99.226  110.400 1.00 35.76  ? 39   LYS J N   1 
ATOM   7430  C CA  . LYS J  1 39  ? 161.103 100.102 110.870 1.00 35.34  ? 39   LYS J CA  1 
ATOM   7431  C C   . LYS J  1 39  ? 162.449 99.673  110.291 1.00 35.51  ? 39   LYS J C   1 
ATOM   7432  O O   . LYS J  1 39  ? 162.588 98.539  109.817 1.00 38.47  ? 39   LYS J O   1 
ATOM   7433  C CB  . LYS J  1 39  ? 161.154 100.050 112.400 1.00 35.57  ? 39   LYS J CB  1 
ATOM   7434  C CG  . LYS J  1 39  ? 159.894 100.547 113.107 1.00 35.56  ? 39   LYS J CG  1 
ATOM   7435  C CD  . LYS J  1 39  ? 159.835 102.085 113.084 1.00 35.90  ? 39   LYS J CD  1 
ATOM   7436  C CE  . LYS J  1 39  ? 158.795 102.594 114.080 1.00 34.49  ? 39   LYS J CE  1 
ATOM   7437  N NZ  . LYS J  1 39  ? 159.299 102.359 115.533 1.00 38.94  ? 39   LYS J NZ  1 
ATOM   7438  N N   . PRO J  1 40  ? 163.438 100.587 110.296 1.00 34.87  ? 40   PRO J N   1 
ATOM   7439  C CA  . PRO J  1 40  ? 164.842 100.284 110.030 1.00 33.58  ? 40   PRO J CA  1 
ATOM   7440  C C   . PRO J  1 40  ? 165.285 98.888  110.482 1.00 32.56  ? 40   PRO J C   1 
ATOM   7441  O O   . PRO J  1 40  ? 165.303 98.583  111.680 1.00 31.20  ? 40   PRO J O   1 
ATOM   7442  C CB  . PRO J  1 40  ? 165.585 101.372 110.815 1.00 33.63  ? 40   PRO J CB  1 
ATOM   7443  C CG  . PRO J  1 40  ? 164.575 102.481 111.040 1.00 32.98  ? 40   PRO J CG  1 
ATOM   7444  C CD  . PRO J  1 40  ? 163.235 102.041 110.503 1.00 35.03  ? 40   PRO J CD  1 
ATOM   7445  N N   . GLY J  1 41  ? 165.661 98.078  109.490 1.00 32.06  ? 41   GLY J N   1 
ATOM   7446  C CA  . GLY J  1 41  ? 166.002 96.646  109.660 1.00 33.45  ? 41   GLY J CA  1 
ATOM   7447  C C   . GLY J  1 41  ? 165.414 95.969  110.895 1.00 33.43  ? 41   GLY J C   1 
ATOM   7448  O O   . GLY J  1 41  ? 166.155 95.607  111.835 1.00 32.45  ? 41   GLY J O   1 
ATOM   7449  N N   . LYS J  1 42  ? 164.086 95.809  110.892 1.00 33.23  ? 42   LYS J N   1 
ATOM   7450  C CA  . LYS J  1 42  ? 163.341 95.111  111.956 1.00 31.30  ? 42   LYS J CA  1 
ATOM   7451  C C   . LYS J  1 42  ? 162.313 94.109  111.363 1.00 31.17  ? 42   LYS J C   1 
ATOM   7452  O O   . LYS J  1 42  ? 162.732 93.136  110.735 1.00 32.00  ? 42   LYS J O   1 
ATOM   7453  C CB  . LYS J  1 42  ? 162.734 96.110  112.964 1.00 32.60  ? 42   LYS J CB  1 
ATOM   7454  C CG  . LYS J  1 42  ? 163.752 96.669  113.980 1.00 28.61  ? 42   LYS J CG  1 
ATOM   7455  C CD  . LYS J  1 42  ? 164.157 95.629  115.051 1.00 35.92  ? 42   LYS J CD  1 
ATOM   7456  C CE  . LYS J  1 42  ? 165.301 96.136  115.957 1.00 32.27  ? 42   LYS J CE  1 
ATOM   7457  N NZ  . LYS J  1 42  ? 165.358 95.222  117.238 1.00 21.15  ? 42   LYS J NZ  1 
ATOM   7458  N N   . ALA J  1 43  ? 161.004 94.319  111.538 1.00 30.15  ? 43   ALA J N   1 
ATOM   7459  C CA  . ALA J  1 43  ? 160.003 93.362  111.020 1.00 30.65  ? 43   ALA J CA  1 
ATOM   7460  C C   . ALA J  1 43  ? 158.703 94.029  110.584 1.00 30.62  ? 43   ALA J C   1 
ATOM   7461  O O   . ALA J  1 43  ? 158.196 94.904  111.296 1.00 30.55  ? 43   ALA J O   1 
ATOM   7462  C CB  . ALA J  1 43  ? 159.712 92.288  112.058 1.00 28.48  ? 43   ALA J CB  1 
ATOM   7463  N N   . PRO J  1 44  ? 158.157 93.638  109.413 1.00 32.55  ? 44   PRO J N   1 
ATOM   7464  C CA  . PRO J  1 44  ? 156.864 94.218  109.061 1.00 33.03  ? 44   PRO J CA  1 
ATOM   7465  C C   . PRO J  1 44  ? 155.752 93.927  110.089 1.00 33.14  ? 44   PRO J C   1 
ATOM   7466  O O   . PRO J  1 44  ? 154.966 92.993  109.910 1.00 34.59  ? 44   PRO J O   1 
ATOM   7467  C CB  . PRO J  1 44  ? 156.548 93.579  107.699 1.00 32.21  ? 44   PRO J CB  1 
ATOM   7468  C CG  . PRO J  1 44  ? 157.869 93.159  107.158 1.00 34.36  ? 44   PRO J CG  1 
ATOM   7469  C CD  . PRO J  1 44  ? 158.654 92.731  108.361 1.00 32.86  ? 44   PRO J CD  1 
ATOM   7470  N N   . LYS J  1 45  ? 155.693 94.739  111.148 1.00 33.28  ? 45   LYS J N   1 
ATOM   7471  C CA  . LYS J  1 45  ? 154.594 94.686  112.113 1.00 33.42  ? 45   LYS J CA  1 
ATOM   7472  C C   . LYS J  1 45  ? 153.329 95.267  111.478 1.00 34.36  ? 45   LYS J C   1 
ATOM   7473  O O   . LYS J  1 45  ? 153.321 96.431  111.061 1.00 35.71  ? 45   LYS J O   1 
ATOM   7474  C CB  . LYS J  1 45  ? 154.951 95.474  113.375 1.00 32.36  ? 45   LYS J CB  1 
ATOM   7475  C CG  . LYS J  1 45  ? 156.297 95.118  113.996 1.00 33.72  ? 45   LYS J CG  1 
ATOM   7476  C CD  . LYS J  1 45  ? 156.354 95.642  115.444 1.00 35.54  ? 45   LYS J CD  1 
ATOM   7477  C CE  . LYS J  1 45  ? 157.817 95.490  115.969 1.00 38.44  ? 45   LYS J CE  1 
ATOM   7478  N NZ  . LYS J  1 45  ? 157.893 95.934  117.404 1.00 42.68  ? 45   LYS J NZ  1 
ATOM   7479  N N   . LEU J  1 46  ? 152.273 94.458  111.402 1.00 33.71  ? 46   LEU J N   1 
ATOM   7480  C CA  . LEU J  1 46  ? 151.054 94.855  110.699 1.00 34.27  ? 46   LEU J CA  1 
ATOM   7481  C C   . LEU J  1 46  ? 150.435 96.115  111.288 1.00 36.21  ? 46   LEU J C   1 
ATOM   7482  O O   . LEU J  1 46  ? 150.203 96.202  112.502 1.00 38.29  ? 46   LEU J O   1 
ATOM   7483  C CB  . LEU J  1 46  ? 150.018 93.722  110.710 1.00 33.76  ? 46   LEU J CB  1 
ATOM   7484  C CG  . LEU J  1 46  ? 148.729 93.942  109.908 1.00 33.28  ? 46   LEU J CG  1 
ATOM   7485  C CD1 . LEU J  1 46  ? 148.972 93.619  108.406 1.00 36.26  ? 46   LEU J CD1 1 
ATOM   7486  C CD2 . LEU J  1 46  ? 147.576 93.110  110.472 1.00 32.36  ? 46   LEU J CD2 1 
ATOM   7487  N N   . LEU J  1 47  ? 150.182 97.087  110.409 1.00 36.14  ? 47   LEU J N   1 
ATOM   7488  C CA  . LEU J  1 47  ? 149.370 98.250  110.760 1.00 33.41  ? 47   LEU J CA  1 
ATOM   7489  C C   . LEU J  1 47  ? 147.872 98.028  110.501 1.00 32.40  ? 47   LEU J C   1 
ATOM   7490  O O   . LEU J  1 47  ? 147.092 97.965  111.447 1.00 33.46  ? 47   LEU J O   1 
ATOM   7491  C CB  . LEU J  1 47  ? 149.846 99.503  110.022 1.00 34.49  ? 47   LEU J CB  1 
ATOM   7492  C CG  . LEU J  1 47  ? 151.220 100.116 110.292 1.00 34.54  ? 47   LEU J CG  1 
ATOM   7493  C CD1 . LEU J  1 47  ? 151.212 101.500 109.687 1.00 36.09  ? 47   LEU J CD1 1 
ATOM   7494  C CD2 . LEU J  1 47  ? 151.557 100.193 111.781 1.00 33.60  ? 47   LEU J CD2 1 
ATOM   7495  N N   . ILE J  1 48  ? 147.469 97.917  109.233 1.00 31.99  ? 48   ILE J N   1 
ATOM   7496  C CA  . ILE J  1 48  ? 146.037 97.888  108.863 1.00 33.79  ? 48   ILE J CA  1 
ATOM   7497  C C   . ILE J  1 48  ? 145.686 96.644  108.044 1.00 35.55  ? 48   ILE J C   1 
ATOM   7498  O O   . ILE J  1 48  ? 146.532 96.141  107.308 1.00 38.35  ? 48   ILE J O   1 
ATOM   7499  C CB  . ILE J  1 48  ? 145.656 99.167  108.064 1.00 32.02  ? 48   ILE J CB  1 
ATOM   7500  C CG1 . ILE J  1 48  ? 145.701 100.389 108.993 1.00 29.08  ? 48   ILE J CG1 1 
ATOM   7501  C CG2 . ILE J  1 48  ? 144.267 99.042  107.409 1.00 31.01  ? 48   ILE J CG2 1 
ATOM   7502  C CD1 . ILE J  1 48  ? 145.517 101.702 108.300 1.00 33.56  ? 48   ILE J CD1 1 
ATOM   7503  N N   . TYR J  1 49  ? 144.458 96.143  108.155 1.00 38.40  ? 49   TYR J N   1 
ATOM   7504  C CA  . TYR J  1 49  ? 144.070 94.995  107.329 1.00 43.43  ? 49   TYR J CA  1 
ATOM   7505  C C   . TYR J  1 49  ? 142.686 95.168  106.727 1.00 44.79  ? 49   TYR J C   1 
ATOM   7506  O O   . TYR J  1 49  ? 142.023 96.184  106.964 1.00 45.69  ? 49   TYR J O   1 
ATOM   7507  C CB  . TYR J  1 49  ? 144.118 93.706  108.144 1.00 45.58  ? 49   TYR J CB  1 
ATOM   7508  C CG  . TYR J  1 49  ? 143.341 93.838  109.410 1.00 46.91  ? 49   TYR J CG  1 
ATOM   7509  C CD1 . TYR J  1 49  ? 142.018 93.444  109.479 1.00 51.75  ? 49   TYR J CD1 1 
ATOM   7510  C CD2 . TYR J  1 49  ? 143.923 94.406  110.539 1.00 53.09  ? 49   TYR J CD2 1 
ATOM   7511  C CE1 . TYR J  1 49  ? 141.306 93.589  110.650 1.00 57.57  ? 49   TYR J CE1 1 
ATOM   7512  C CE2 . TYR J  1 49  ? 143.209 94.564  111.705 1.00 54.56  ? 49   TYR J CE2 1 
ATOM   7513  C CZ  . TYR J  1 49  ? 141.901 94.149  111.762 1.00 55.41  ? 49   TYR J CZ  1 
ATOM   7514  O OH  . TYR J  1 49  ? 141.188 94.295  112.930 1.00 53.24  ? 49   TYR J OH  1 
ATOM   7515  N N   . ALA J  1 50  ? 142.251 94.171  105.955 1.00 46.68  ? 50   ALA J N   1 
ATOM   7516  C CA  . ALA J  1 50  ? 140.919 94.191  105.362 1.00 49.04  ? 50   ALA J CA  1 
ATOM   7517  C C   . ALA J  1 50  ? 140.612 95.584  104.813 1.00 49.82  ? 50   ALA J C   1 
ATOM   7518  O O   . ALA J  1 50  ? 139.527 96.129  105.034 1.00 51.75  ? 50   ALA J O   1 
ATOM   7519  C CB  . ALA J  1 50  ? 139.874 93.760  106.392 1.00 49.00  ? 50   ALA J CB  1 
ATOM   7520  N N   . ALA J  1 51  ? 141.593 96.145  104.104 1.00 49.62  ? 51   ALA J N   1 
ATOM   7521  C CA  . ALA J  1 51  ? 141.557 97.517  103.582 1.00 49.72  ? 51   ALA J CA  1 
ATOM   7522  C C   . ALA J  1 51  ? 141.477 98.615  104.652 1.00 49.17  ? 51   ALA J C   1 
ATOM   7523  O O   . ALA J  1 51  ? 142.345 99.488  104.697 1.00 51.50  ? 51   ALA J O   1 
ATOM   7524  C CB  . ALA J  1 51  ? 140.449 97.685  102.524 1.00 50.26  ? 51   ALA J CB  1 
ATOM   7525  N N   . SER J  1 52  ? 140.452 98.572  105.503 1.00 46.23  ? 52   SER J N   1 
ATOM   7526  C CA  . SER J  1 52  ? 140.227 99.653  106.463 1.00 43.33  ? 52   SER J CA  1 
ATOM   7527  C C   . SER J  1 52  ? 140.363 99.269  107.935 1.00 43.59  ? 52   SER J C   1 
ATOM   7528  O O   . SER J  1 52  ? 140.666 100.134 108.768 1.00 42.25  ? 52   SER J O   1 
ATOM   7529  C CB  . SER J  1 52  ? 138.866 100.317 106.220 1.00 42.73  ? 52   SER J CB  1 
ATOM   7530  O OG  . SER J  1 52  ? 137.804 99.534  106.765 1.00 38.71  ? 52   SER J OG  1 
ATOM   7531  N N   . SER J  1 53  ? 140.130 97.991  108.261 1.00 43.55  ? 53   SER J N   1 
ATOM   7532  C CA  . SER J  1 53  ? 140.134 97.603  109.673 1.00 42.74  ? 53   SER J CA  1 
ATOM   7533  C C   . SER J  1 53  ? 141.487 97.831  110.338 1.00 42.89  ? 53   SER J C   1 
ATOM   7534  O O   . SER J  1 53  ? 142.543 97.570  109.752 1.00 41.27  ? 53   SER J O   1 
ATOM   7535  C CB  . SER J  1 53  ? 139.644 96.172  109.872 1.00 43.29  ? 53   SER J CB  1 
ATOM   7536  O OG  . SER J  1 53  ? 139.272 95.953  111.245 1.00 36.62  ? 53   SER J OG  1 
ATOM   7537  N N   . LEU J  1 54  ? 141.420 98.308  111.580 1.00 42.66  ? 54   LEU J N   1 
ATOM   7538  C CA  . LEU J  1 54  ? 142.540 98.985  112.228 1.00 42.85  ? 54   LEU J CA  1 
ATOM   7539  C C   . LEU J  1 54  ? 143.059 98.151  113.396 1.00 41.61  ? 54   LEU J C   1 
ATOM   7540  O O   . LEU J  1 54  ? 142.265 97.602  114.167 1.00 44.20  ? 54   LEU J O   1 
ATOM   7541  C CB  . LEU J  1 54  ? 142.058 100.357 112.720 1.00 42.01  ? 54   LEU J CB  1 
ATOM   7542  C CG  . LEU J  1 54  ? 143.027 101.508 113.044 1.00 41.50  ? 54   LEU J CG  1 
ATOM   7543  C CD1 . LEU J  1 54  ? 143.477 101.452 114.516 1.00 37.31  ? 54   LEU J CD1 1 
ATOM   7544  C CD2 . LEU J  1 54  ? 144.224 101.583 112.095 1.00 29.56  ? 54   LEU J CD2 1 
ATOM   7545  N N   . GLN J  1 55  ? 144.378 98.057  113.544 1.00 42.26  ? 55   GLN J N   1 
ATOM   7546  C CA  . GLN J  1 55  ? 144.937 97.148  114.551 1.00 42.82  ? 55   GLN J CA  1 
ATOM   7547  C C   . GLN J  1 55  ? 144.908 97.632  116.004 1.00 42.16  ? 55   GLN J C   1 
ATOM   7548  O O   . GLN J  1 55  ? 145.089 98.821  116.292 1.00 42.97  ? 55   GLN J O   1 
ATOM   7549  C CB  . GLN J  1 55  ? 146.340 96.646  114.170 1.00 41.89  ? 55   GLN J CB  1 
ATOM   7550  C CG  . GLN J  1 55  ? 146.335 95.381  113.306 1.00 47.22  ? 55   GLN J CG  1 
ATOM   7551  C CD  . GLN J  1 55  ? 145.644 94.198  113.985 1.00 49.47  ? 55   GLN J CD  1 
ATOM   7552  O OE1 . GLN J  1 55  ? 144.514 93.850  113.650 1.00 42.25  ? 55   GLN J OE1 1 
ATOM   7553  N NE2 . GLN J  1 55  ? 146.319 93.588  114.952 1.00 51.06  ? 55   GLN J NE2 1 
ATOM   7554  N N   . SER J  1 56  ? 144.637 96.679  116.899 1.00 40.88  ? 56   SER J N   1 
ATOM   7555  C CA  . SER J  1 56  ? 144.867 96.848  118.331 1.00 37.08  ? 56   SER J CA  1 
ATOM   7556  C C   . SER J  1 56  ? 146.329 97.179  118.548 1.00 35.68  ? 56   SER J C   1 
ATOM   7557  O O   . SER J  1 56  ? 147.219 96.465  118.068 1.00 34.74  ? 56   SER J O   1 
ATOM   7558  C CB  . SER J  1 56  ? 144.557 95.552  119.085 1.00 35.98  ? 56   SER J CB  1 
ATOM   7559  O OG  . SER J  1 56  ? 143.156 95.310  119.125 1.00 35.52  ? 56   SER J OG  1 
ATOM   7560  N N   . GLY J  1 57  ? 146.569 98.263  119.275 1.00 34.84  ? 57   GLY J N   1 
ATOM   7561  C CA  . GLY J  1 57  ? 147.920 98.717  119.556 1.00 36.19  ? 57   GLY J CA  1 
ATOM   7562  C C   . GLY J  1 57  ? 148.355 99.851  118.646 1.00 37.87  ? 57   GLY J C   1 
ATOM   7563  O O   . GLY J  1 57  ? 149.155 100.698 119.059 1.00 40.06  ? 57   GLY J O   1 
ATOM   7564  N N   . VAL J  1 58  ? 147.833 99.873  117.412 1.00 38.09  ? 58   VAL J N   1 
ATOM   7565  C CA  . VAL J  1 58  ? 148.297 100.864 116.429 1.00 38.93  ? 58   VAL J CA  1 
ATOM   7566  C C   . VAL J  1 58  ? 147.450 102.135 116.493 1.00 39.70  ? 58   VAL J C   1 
ATOM   7567  O O   . VAL J  1 58  ? 146.215 102.076 116.402 1.00 40.81  ? 58   VAL J O   1 
ATOM   7568  C CB  . VAL J  1 58  ? 148.387 100.284 114.976 1.00 40.90  ? 58   VAL J CB  1 
ATOM   7569  C CG1 . VAL J  1 58  ? 147.016 100.151 114.331 1.00 39.40  ? 58   VAL J CG1 1 
ATOM   7570  C CG2 . VAL J  1 58  ? 149.271 101.166 114.105 1.00 38.28  ? 58   VAL J CG2 1 
ATOM   7571  N N   . PRO J  1 59  ? 148.119 103.287 116.685 1.00 38.97  ? 59   PRO J N   1 
ATOM   7572  C CA  . PRO J  1 59  ? 147.521 104.607 116.745 1.00 37.80  ? 59   PRO J CA  1 
ATOM   7573  C C   . PRO J  1 59  ? 146.540 104.843 115.621 1.00 36.16  ? 59   PRO J C   1 
ATOM   7574  O O   . PRO J  1 59  ? 146.733 104.378 114.487 1.00 36.30  ? 59   PRO J O   1 
ATOM   7575  C CB  . PRO J  1 59  ? 148.727 105.550 116.595 1.00 38.30  ? 59   PRO J CB  1 
ATOM   7576  C CG  . PRO J  1 59  ? 149.891 104.678 116.229 1.00 37.57  ? 59   PRO J CG  1 
ATOM   7577  C CD  . PRO J  1 59  ? 149.574 103.368 116.867 1.00 39.03  ? 59   PRO J CD  1 
ATOM   7578  N N   . SER J  1 60  ? 145.515 105.615 115.946 1.00 34.16  ? 60   SER J N   1 
ATOM   7579  C CA  . SER J  1 60  ? 144.336 105.769 115.122 1.00 33.80  ? 60   SER J CA  1 
ATOM   7580  C C   . SER J  1 60  ? 144.457 106.862 114.070 1.00 33.33  ? 60   SER J C   1 
ATOM   7581  O O   . SER J  1 60  ? 143.459 107.235 113.448 1.00 31.30  ? 60   SER J O   1 
ATOM   7582  C CB  . SER J  1 60  ? 143.145 106.065 116.030 1.00 34.82  ? 60   SER J CB  1 
ATOM   7583  O OG  . SER J  1 60  ? 143.502 107.064 117.008 1.00 35.02  ? 60   SER J OG  1 
ATOM   7584  N N   . ARG J  1 61  ? 145.661 107.374 113.856 1.00 31.63  ? 61   ARG J N   1 
ATOM   7585  C CA  . ARG J  1 61  ? 145.854 108.406 112.842 1.00 29.22  ? 61   ARG J CA  1 
ATOM   7586  C C   . ARG J  1 61  ? 146.282 107.803 111.499 1.00 28.13  ? 61   ARG J C   1 
ATOM   7587  O O   . ARG J  1 61  ? 146.410 108.530 110.485 1.00 25.79  ? 61   ARG J O   1 
ATOM   7588  C CB  . ARG J  1 61  ? 146.879 109.415 113.327 1.00 29.30  ? 61   ARG J CB  1 
ATOM   7589  C CG  . ARG J  1 61  ? 148.116 108.695 113.824 1.00 30.03  ? 61   ARG J CG  1 
ATOM   7590  C CD  . ARG J  1 61  ? 149.326 109.528 113.495 1.00 29.49  ? 61   ARG J CD  1 
ATOM   7591  N NE  . ARG J  1 61  ? 150.483 108.720 113.840 1.00 33.04  ? 61   ARG J NE  1 
ATOM   7592  C CZ  . ARG J  1 61  ? 151.177 108.848 114.967 1.00 31.88  ? 61   ARG J CZ  1 
ATOM   7593  N NH1 . ARG J  1 61  ? 150.848 109.784 115.868 1.00 31.88  ? 61   ARG J NH1 1 
ATOM   7594  N NH2 . ARG J  1 61  ? 152.213 108.052 115.191 1.00 21.86  ? 61   ARG J NH2 1 
ATOM   7595  N N   . PHE J  1 62  ? 146.512 106.485 111.514 1.00 25.31  ? 62   PHE J N   1 
ATOM   7596  C CA  . PHE J  1 62  ? 146.782 105.734 110.302 1.00 23.29  ? 62   PHE J CA  1 
ATOM   7597  C C   . PHE J  1 62  ? 145.412 105.230 109.853 1.00 23.91  ? 62   PHE J C   1 
ATOM   7598  O O   . PHE J  1 62  ? 144.589 104.853 110.707 1.00 22.21  ? 62   PHE J O   1 
ATOM   7599  C CB  . PHE J  1 62  ? 147.671 104.525 110.639 1.00 21.24  ? 62   PHE J CB  1 
ATOM   7600  C CG  . PHE J  1 62  ? 149.056 104.881 111.161 1.00 12.97  ? 62   PHE J CG  1 
ATOM   7601  C CD1 . PHE J  1 62  ? 149.285 105.101 112.522 1.00 13.11  ? 62   PHE J CD1 1 
ATOM   7602  C CD2 . PHE J  1 62  ? 150.142 104.940 110.289 1.00 9.71   ? 62   PHE J CD2 1 
ATOM   7603  C CE1 . PHE J  1 62  ? 150.574 105.410 112.996 1.00 7.05   ? 62   PHE J CE1 1 
ATOM   7604  C CE2 . PHE J  1 62  ? 151.430 105.246 110.757 1.00 9.95   ? 62   PHE J CE2 1 
ATOM   7605  C CZ  . PHE J  1 62  ? 151.645 105.479 112.110 1.00 6.65   ? 62   PHE J CZ  1 
ATOM   7606  N N   . SER J  1 63  ? 145.143 105.217 108.547 1.00 25.31  ? 63   SER J N   1 
ATOM   7607  C CA  . SER J  1 63  ? 143.925 104.545 108.093 1.00 26.56  ? 63   SER J CA  1 
ATOM   7608  C C   . SER J  1 63  ? 143.770 104.179 106.617 1.00 27.60  ? 63   SER J C   1 
ATOM   7609  O O   . SER J  1 63  ? 144.642 104.428 105.781 1.00 27.79  ? 63   SER J O   1 
ATOM   7610  C CB  . SER J  1 63  ? 142.642 105.218 108.654 1.00 27.01  ? 63   SER J CB  1 
ATOM   7611  O OG  . SER J  1 63  ? 142.106 106.168 107.747 1.00 32.33  ? 63   SER J OG  1 
ATOM   7612  N N   . GLY J  1 64  ? 142.598 103.607 106.345 1.00 30.50  ? 64   GLY J N   1 
ATOM   7613  C CA  . GLY J  1 64  ? 142.409 102.720 105.192 1.00 31.22  ? 64   GLY J CA  1 
ATOM   7614  C C   . GLY J  1 64  ? 141.094 103.004 104.507 1.00 34.97  ? 64   GLY J C   1 
ATOM   7615  O O   . GLY J  1 64  ? 140.073 103.310 105.144 1.00 33.87  ? 64   GLY J O   1 
ATOM   7616  N N   . SER J  1 65  ? 141.146 102.866 103.187 1.00 37.17  ? 65   SER J N   1 
ATOM   7617  C CA  . SER J  1 65  ? 140.181 103.445 102.275 1.00 37.95  ? 65   SER J CA  1 
ATOM   7618  C C   . SER J  1 65  ? 140.027 102.565 101.044 1.00 39.85  ? 65   SER J C   1 
ATOM   7619  O O   . SER J  1 65  ? 140.974 101.888 100.636 1.00 41.72  ? 65   SER J O   1 
ATOM   7620  C CB  . SER J  1 65  ? 140.695 104.824 101.825 1.00 39.00  ? 65   SER J CB  1 
ATOM   7621  O OG  . SER J  1 65  ? 141.963 104.702 101.184 1.00 35.41  ? 65   SER J OG  1 
ATOM   7622  N N   . GLY J  1 66  ? 138.830 102.597 100.449 1.00 42.05  ? 66   GLY J N   1 
ATOM   7623  C CA  . GLY J  1 66  ? 138.531 101.936 99.167  1.00 43.62  ? 66   GLY J CA  1 
ATOM   7624  C C   . GLY J  1 66  ? 138.946 100.491 98.938  1.00 44.27  ? 66   GLY J C   1 
ATOM   7625  O O   . GLY J  1 66  ? 139.310 99.775  99.879  1.00 42.33  ? 66   GLY J O   1 
ATOM   7626  N N   . SER J  1 67  ? 138.870 100.075 97.667  1.00 45.80  ? 67   SER J N   1 
ATOM   7627  C CA  . SER J  1 67  ? 139.256 98.726  97.225  1.00 46.83  ? 67   SER J CA  1 
ATOM   7628  C C   . SER J  1 67  ? 139.055 98.436  95.735  1.00 48.22  ? 67   SER J C   1 
ATOM   7629  O O   . SER J  1 67  ? 139.210 99.317  94.874  1.00 48.13  ? 67   SER J O   1 
ATOM   7630  C CB  . SER J  1 67  ? 138.502 97.658  98.029  1.00 47.14  ? 67   SER J CB  1 
ATOM   7631  O OG  . SER J  1 67  ? 137.168 97.497  97.554  1.00 46.73  ? 67   SER J OG  1 
ATOM   7632  N N   . GLY J  1 68  ? 138.686 97.179  95.472  1.00 48.32  ? 68   GLY J N   1 
ATOM   7633  C CA  . GLY J  1 68  ? 138.604 96.637  94.128  1.00 48.90  ? 68   GLY J CA  1 
ATOM   7634  C C   . GLY J  1 68  ? 140.026 96.541  93.643  1.00 50.35  ? 68   GLY J C   1 
ATOM   7635  O O   . GLY J  1 68  ? 140.647 95.479  93.691  1.00 50.23  ? 68   GLY J O   1 
ATOM   7636  N N   . THR J  1 69  ? 140.552 97.683  93.224  1.00 50.69  ? 69   THR J N   1 
ATOM   7637  C CA  . THR J  1 69  ? 141.877 97.738  92.653  1.00 50.01  ? 69   THR J CA  1 
ATOM   7638  C C   . THR J  1 69  ? 142.723 98.867  93.268  1.00 49.02  ? 69   THR J C   1 
ATOM   7639  O O   . THR J  1 69  ? 143.939 98.883  93.108  1.00 48.77  ? 69   THR J O   1 
ATOM   7640  C CB  . THR J  1 69  ? 141.784 97.820  91.106  1.00 50.06  ? 69   THR J CB  1 
ATOM   7641  O OG1 . THR J  1 69  ? 140.836 96.848  90.631  1.00 51.48  ? 69   THR J OG1 1 
ATOM   7642  C CG2 . THR J  1 69  ? 143.124 97.560  90.445  1.00 52.24  ? 69   THR J CG2 1 
ATOM   7643  N N   . ASP J  1 70  ? 142.078 99.760  94.028  1.00 47.26  ? 70   ASP J N   1 
ATOM   7644  C CA  . ASP J  1 70  ? 142.729 100.981 94.525  1.00 45.75  ? 70   ASP J CA  1 
ATOM   7645  C C   . ASP J  1 70  ? 142.532 101.203 96.029  1.00 43.42  ? 70   ASP J C   1 
ATOM   7646  O O   . ASP J  1 70  ? 141.398 101.249 96.516  1.00 42.43  ? 70   ASP J O   1 
ATOM   7647  C CB  . ASP J  1 70  ? 142.205 102.196 93.744  1.00 47.21  ? 70   ASP J CB  1 
ATOM   7648  C CG  . ASP J  1 70  ? 142.855 103.504 94.172  1.00 49.52  ? 70   ASP J CG  1 
ATOM   7649  O OD1 . ASP J  1 70  ? 142.127 104.384 94.685  1.00 47.11  ? 70   ASP J OD1 1 
ATOM   7650  O OD2 . ASP J  1 70  ? 144.085 103.655 93.998  1.00 44.15  ? 70   ASP J OD2 1 
ATOM   7651  N N   . PHE J  1 71  ? 143.641 101.347 96.751  1.00 40.44  ? 71   PHE J N   1 
ATOM   7652  C CA  . PHE J  1 71  ? 143.604 101.567 98.198  1.00 38.73  ? 71   PHE J CA  1 
ATOM   7653  C C   . PHE J  1 71  ? 144.515 102.716 98.599  1.00 37.26  ? 71   PHE J C   1 
ATOM   7654  O O   . PHE J  1 71  ? 145.558 102.945 97.968  1.00 37.26  ? 71   PHE J O   1 
ATOM   7655  C CB  . PHE J  1 71  ? 144.060 100.318 98.961  1.00 39.28  ? 71   PHE J CB  1 
ATOM   7656  C CG  . PHE J  1 71  ? 143.353 99.053  98.566  1.00 37.80  ? 71   PHE J CG  1 
ATOM   7657  C CD1 . PHE J  1 71  ? 143.740 98.352  97.427  1.00 30.99  ? 71   PHE J CD1 1 
ATOM   7658  C CD2 . PHE J  1 71  ? 142.330 98.538  99.354  1.00 41.51  ? 71   PHE J CD2 1 
ATOM   7659  C CE1 . PHE J  1 71  ? 143.098 97.180  97.059  1.00 33.89  ? 71   PHE J CE1 1 
ATOM   7660  C CE2 . PHE J  1 71  ? 141.690 97.356  99.002  1.00 41.68  ? 71   PHE J CE2 1 
ATOM   7661  C CZ  . PHE J  1 71  ? 142.071 96.678  97.848  1.00 39.99  ? 71   PHE J CZ  1 
ATOM   7662  N N   . THR J  1 72  ? 144.131 103.421 99.667  1.00 35.31  ? 72   THR J N   1 
ATOM   7663  C CA  . THR J  1 72  ? 145.048 104.409 100.251 1.00 33.68  ? 72   THR J CA  1 
ATOM   7664  C C   . THR J  1 72  ? 145.227 104.333 101.765 1.00 33.09  ? 72   THR J C   1 
ATOM   7665  O O   . THR J  1 72  ? 144.267 104.437 102.549 1.00 30.38  ? 72   THR J O   1 
ATOM   7666  C CB  . THR J  1 72  ? 144.679 105.860 99.843  1.00 34.44  ? 72   THR J CB  1 
ATOM   7667  O OG1 . THR J  1 72  ? 144.430 105.916 98.434  1.00 32.25  ? 72   THR J OG1 1 
ATOM   7668  C CG2 . THR J  1 72  ? 145.820 106.838 100.177 1.00 37.84  ? 72   THR J CG2 1 
ATOM   7669  N N   . LEU J  1 73  ? 146.491 104.130 102.138 1.00 32.81  ? 73   LEU J N   1 
ATOM   7670  C CA  . LEU J  1 73  ? 146.948 104.388 103.479 1.00 32.83  ? 73   LEU J CA  1 
ATOM   7671  C C   . LEU J  1 73  ? 146.976 105.901 103.602 1.00 33.86  ? 73   LEU J C   1 
ATOM   7672  O O   . LEU J  1 73  ? 147.678 106.597 102.839 1.00 33.19  ? 73   LEU J O   1 
ATOM   7673  C CB  . LEU J  1 73  ? 148.363 103.807 103.694 1.00 32.53  ? 73   LEU J CB  1 
ATOM   7674  C CG  . LEU J  1 73  ? 148.835 103.773 105.174 1.00 33.63  ? 73   LEU J CG  1 
ATOM   7675  C CD1 . LEU J  1 73  ? 147.741 103.277 106.130 1.00 29.92  ? 73   LEU J CD1 1 
ATOM   7676  C CD2 . LEU J  1 73  ? 150.098 102.945 105.348 1.00 32.27  ? 73   LEU J CD2 1 
ATOM   7677  N N   . THR J  1 74  ? 146.193 106.419 104.533 1.00 34.33  ? 74   THR J N   1 
ATOM   7678  C CA  . THR J  1 74  ? 146.354 107.807 104.889 1.00 34.02  ? 74   THR J CA  1 
ATOM   7679  C C   . THR J  1 74  ? 146.833 107.904 106.323 1.00 32.74  ? 74   THR J C   1 
ATOM   7680  O O   . THR J  1 74  ? 146.205 107.376 107.252 1.00 32.20  ? 74   THR J O   1 
ATOM   7681  C CB  . THR J  1 74  ? 145.075 108.656 104.628 1.00 34.38  ? 74   THR J CB  1 
ATOM   7682  O OG1 . THR J  1 74  ? 144.514 108.297 103.355 1.00 35.03  ? 74   THR J OG1 1 
ATOM   7683  C CG2 . THR J  1 74  ? 145.401 110.160 104.639 1.00 31.51  ? 74   THR J CG2 1 
ATOM   7684  N N   . ILE J  1 75  ? 147.984 108.541 106.482 1.00 29.66  ? 75   ILE J N   1 
ATOM   7685  C CA  . ILE J  1 75  ? 148.463 108.924 107.791 1.00 29.80  ? 75   ILE J CA  1 
ATOM   7686  C C   . ILE J  1 75  ? 148.110 110.387 107.974 1.00 30.03  ? 75   ILE J C   1 
ATOM   7687  O O   . ILE J  1 75  ? 148.691 111.263 107.326 1.00 29.81  ? 75   ILE J O   1 
ATOM   7688  C CB  . ILE J  1 75  ? 149.978 108.731 107.926 1.00 29.63  ? 75   ILE J CB  1 
ATOM   7689  C CG1 . ILE J  1 75  ? 150.438 107.530 107.082 1.00 26.53  ? 75   ILE J CG1 1 
ATOM   7690  C CG2 . ILE J  1 75  ? 150.364 108.596 109.408 1.00 28.43  ? 75   ILE J CG2 1 
ATOM   7691  C CD1 . ILE J  1 75  ? 151.957 107.230 107.200 1.00 25.88  ? 75   ILE J CD1 1 
ATOM   7692  N N   . SER J  1 76  ? 147.147 110.641 108.848 1.00 29.99  ? 76   SER J N   1 
ATOM   7693  C CA  . SER J  1 76  ? 146.681 111.995 109.089 1.00 30.41  ? 76   SER J CA  1 
ATOM   7694  C C   . SER J  1 76  ? 147.790 112.953 109.509 1.00 28.72  ? 76   SER J C   1 
ATOM   7695  O O   . SER J  1 76  ? 147.768 114.126 109.113 1.00 31.35  ? 76   SER J O   1 
ATOM   7696  C CB  . SER J  1 76  ? 145.562 112.008 110.131 1.00 30.77  ? 76   SER J CB  1 
ATOM   7697  O OG  . SER J  1 76  ? 145.826 111.081 111.169 1.00 36.36  ? 76   SER J OG  1 
ATOM   7698  N N   . SER J  1 77  ? 148.752 112.486 110.294 1.00 28.54  ? 77   SER J N   1 
ATOM   7699  C CA  . SER J  1 77  ? 149.696 113.430 110.874 1.00 28.16  ? 77   SER J CA  1 
ATOM   7700  C C   . SER J  1 77  ? 151.002 112.746 111.211 1.00 27.09  ? 77   SER J C   1 
ATOM   7701  O O   . SER J  1 77  ? 151.098 112.029 112.228 1.00 25.84  ? 77   SER J O   1 
ATOM   7702  C CB  . SER J  1 77  ? 149.086 114.063 112.134 1.00 27.78  ? 77   SER J CB  1 
ATOM   7703  O OG  . SER J  1 77  ? 150.085 114.646 112.964 1.00 28.06  ? 77   SER J OG  1 
ATOM   7704  N N   . LEU J  1 78  ? 152.011 112.966 110.375 1.00 27.87  ? 78   LEU J N   1 
ATOM   7705  C CA  . LEU J  1 78  ? 153.293 112.314 110.583 1.00 29.47  ? 78   LEU J CA  1 
ATOM   7706  C C   . LEU J  1 78  ? 153.858 112.585 111.994 1.00 30.30  ? 78   LEU J C   1 
ATOM   7707  O O   . LEU J  1 78  ? 153.418 113.538 112.701 1.00 30.70  ? 78   LEU J O   1 
ATOM   7708  C CB  . LEU J  1 78  ? 154.291 112.725 109.496 1.00 27.52  ? 78   LEU J CB  1 
ATOM   7709  C CG  . LEU J  1 78  ? 155.202 111.585 109.023 1.00 33.39  ? 78   LEU J CG  1 
ATOM   7710  C CD1 . LEU J  1 78  ? 154.401 110.392 108.436 1.00 38.63  ? 78   LEU J CD1 1 
ATOM   7711  C CD2 . LEU J  1 78  ? 156.218 112.075 107.984 1.00 28.24  ? 78   LEU J CD2 1 
ATOM   7712  N N   . GLN J  1 79  ? 154.810 111.729 112.397 1.00 31.33  ? 79   GLN J N   1 
ATOM   7713  C CA  . GLN J  1 79  ? 155.574 111.841 113.651 1.00 31.78  ? 79   GLN J CA  1 
ATOM   7714  C C   . GLN J  1 79  ? 156.953 111.256 113.353 1.00 32.24  ? 79   GLN J C   1 
ATOM   7715  O O   . GLN J  1 79  ? 157.115 110.595 112.317 1.00 31.99  ? 79   GLN J O   1 
ATOM   7716  C CB  . GLN J  1 79  ? 154.928 111.032 114.777 1.00 31.10  ? 79   GLN J CB  1 
ATOM   7717  C CG  . GLN J  1 79  ? 153.504 111.416 115.112 1.00 30.27  ? 79   GLN J CG  1 
ATOM   7718  C CD  . GLN J  1 79  ? 153.378 112.840 115.605 1.00 27.78  ? 79   GLN J CD  1 
ATOM   7719  O OE1 . GLN J  1 79  ? 152.328 113.463 115.451 1.00 19.24  ? 79   GLN J OE1 1 
ATOM   7720  N NE2 . GLN J  1 79  ? 154.443 113.369 116.206 1.00 19.03  ? 79   GLN J NE2 1 
ATOM   7721  N N   . PRO J  1 80  ? 157.956 111.465 114.239 1.00 33.61  ? 80   PRO J N   1 
ATOM   7722  C CA  . PRO J  1 80  ? 159.275 110.885 113.927 1.00 36.83  ? 80   PRO J CA  1 
ATOM   7723  C C   . PRO J  1 80  ? 159.415 109.448 114.435 1.00 38.38  ? 80   PRO J C   1 
ATOM   7724  O O   . PRO J  1 80  ? 160.506 108.993 114.798 1.00 38.89  ? 80   PRO J O   1 
ATOM   7725  C CB  . PRO J  1 80  ? 160.260 111.838 114.617 1.00 36.08  ? 80   PRO J CB  1 
ATOM   7726  C CG  . PRO J  1 80  ? 159.421 112.688 115.593 1.00 35.08  ? 80   PRO J CG  1 
ATOM   7727  C CD  . PRO J  1 80  ? 157.979 112.195 115.517 1.00 34.13  ? 80   PRO J CD  1 
ATOM   7728  N N   . GLU J  1 81  ? 158.277 108.761 114.440 1.00 40.11  ? 81   GLU J N   1 
ATOM   7729  C CA  . GLU J  1 81  ? 158.139 107.368 114.849 1.00 42.23  ? 81   GLU J CA  1 
ATOM   7730  C C   . GLU J  1 81  ? 157.257 106.654 113.822 1.00 43.26  ? 81   GLU J C   1 
ATOM   7731  O O   . GLU J  1 81  ? 156.861 105.495 114.008 1.00 44.44  ? 81   GLU J O   1 
ATOM   7732  C CB  . GLU J  1 81  ? 157.511 107.312 116.238 1.00 41.42  ? 81   GLU J CB  1 
ATOM   7733  C CG  . GLU J  1 81  ? 156.815 108.613 116.634 1.00 40.99  ? 81   GLU J CG  1 
ATOM   7734  C CD  . GLU J  1 81  ? 155.774 108.410 117.701 1.00 40.23  ? 81   GLU J CD  1 
ATOM   7735  O OE1 . GLU J  1 81  ? 155.003 107.423 117.610 1.00 42.38  ? 81   GLU J OE1 1 
ATOM   7736  O OE2 . GLU J  1 81  ? 155.713 109.236 118.639 1.00 39.33  ? 81   GLU J OE2 1 
ATOM   7737  N N   . ASP J  1 82  ? 156.969 107.388 112.734 1.00 43.55  ? 82   ASP J N   1 
ATOM   7738  C CA  . ASP J  1 82  ? 156.174 106.874 111.627 1.00 43.64  ? 82   ASP J CA  1 
ATOM   7739  C C   . ASP J  1 82  ? 157.251 106.785 110.565 1.00 44.23  ? 82   ASP J C   1 
ATOM   7740  O O   . ASP J  1 82  ? 156.991 106.596 109.370 1.00 44.89  ? 82   ASP J O   1 
ATOM   7741  C CB  . ASP J  1 82  ? 155.081 107.898 111.272 1.00 42.72  ? 82   ASP J CB  1 
ATOM   7742  C CG  . ASP J  1 82  ? 154.103 108.141 112.431 1.00 40.89  ? 82   ASP J CG  1 
ATOM   7743  O OD1 . ASP J  1 82  ? 154.499 107.992 113.610 1.00 30.56  ? 82   ASP J OD1 1 
ATOM   7744  O OD2 . ASP J  1 82  ? 152.930 108.491 112.157 1.00 43.68  ? 82   ASP J OD2 1 
ATOM   7745  N N   . PHE J  1 83  ? 158.486 106.920 111.069 1.00 43.65  ? 83   PHE J N   1 
ATOM   7746  C CA  . PHE J  1 83  ? 159.699 106.785 110.286 1.00 44.78  ? 83   PHE J CA  1 
ATOM   7747  C C   . PHE J  1 83  ? 159.849 105.307 110.022 1.00 45.03  ? 83   PHE J C   1 
ATOM   7748  O O   . PHE J  1 83  ? 160.387 104.561 110.846 1.00 46.38  ? 83   PHE J O   1 
ATOM   7749  C CB  . PHE J  1 83  ? 160.911 107.301 111.070 1.00 45.41  ? 83   PHE J CB  1 
ATOM   7750  C CG  . PHE J  1 83  ? 162.215 107.174 110.326 1.00 47.58  ? 83   PHE J CG  1 
ATOM   7751  C CD1 . PHE J  1 83  ? 162.690 108.224 109.550 1.00 50.21  ? 83   PHE J CD1 1 
ATOM   7752  C CD2 . PHE J  1 83  ? 162.973 106.003 110.401 1.00 45.05  ? 83   PHE J CD2 1 
ATOM   7753  C CE1 . PHE J  1 83  ? 163.892 108.112 108.857 1.00 47.87  ? 83   PHE J CE1 1 
ATOM   7754  C CE2 . PHE J  1 83  ? 164.177 105.882 109.708 1.00 44.15  ? 83   PHE J CE2 1 
ATOM   7755  C CZ  . PHE J  1 83  ? 164.636 106.940 108.935 1.00 47.71  ? 83   PHE J CZ  1 
ATOM   7756  N N   . ALA J  1 84  ? 159.329 104.885 108.880 1.00 45.83  ? 84   ALA J N   1 
ATOM   7757  C CA  . ALA J  1 84  ? 159.372 103.493 108.483 1.00 46.48  ? 84   ALA J CA  1 
ATOM   7758  C C   . ALA J  1 84  ? 158.870 103.375 107.065 1.00 47.13  ? 84   ALA J C   1 
ATOM   7759  O O   . ALA J  1 84  ? 158.223 104.287 106.544 1.00 48.67  ? 84   ALA J O   1 
ATOM   7760  C CB  . ALA J  1 84  ? 158.521 102.646 109.415 1.00 45.92  ? 84   ALA J CB  1 
ATOM   7761  N N   . THR J  1 85  ? 159.183 102.249 106.438 1.00 46.91  ? 85   THR J N   1 
ATOM   7762  C CA  . THR J  1 85  ? 158.611 101.931 105.150 1.00 45.07  ? 85   THR J CA  1 
ATOM   7763  C C   . THR J  1 85  ? 157.306 101.197 105.359 1.00 42.94  ? 85   THR J C   1 
ATOM   7764  O O   . THR J  1 85  ? 157.165 100.347 106.246 1.00 44.08  ? 85   THR J O   1 
ATOM   7765  C CB  . THR J  1 85  ? 159.537 101.082 104.277 1.00 45.86  ? 85   THR J CB  1 
ATOM   7766  O OG1 . THR J  1 85  ? 160.875 101.575 104.380 1.00 46.37  ? 85   THR J OG1 1 
ATOM   7767  C CG2 . THR J  1 85  ? 159.099 101.129 102.818 1.00 47.43  ? 85   THR J CG2 1 
ATOM   7768  N N   . TYR J  1 86  ? 156.362 101.552 104.500 1.00 41.37  ? 86   TYR J N   1 
ATOM   7769  C CA  . TYR J  1 86  ? 155.010 101.072 104.543 1.00 36.96  ? 86   TYR J CA  1 
ATOM   7770  C C   . TYR J  1 86  ? 154.800 100.337 103.236 1.00 36.94  ? 86   TYR J C   1 
ATOM   7771  O O   . TYR J  1 86  ? 155.109 100.854 102.154 1.00 34.47  ? 86   TYR J O   1 
ATOM   7772  C CB  . TYR J  1 86  ? 154.065 102.269 104.624 1.00 37.79  ? 86   TYR J CB  1 
ATOM   7773  C CG  . TYR J  1 86  ? 154.169 102.998 105.935 1.00 37.59  ? 86   TYR J CG  1 
ATOM   7774  C CD1 . TYR J  1 86  ? 154.984 104.117 106.081 1.00 36.47  ? 86   TYR J CD1 1 
ATOM   7775  C CD2 . TYR J  1 86  ? 153.459 102.555 107.041 1.00 42.30  ? 86   TYR J CD2 1 
ATOM   7776  C CE1 . TYR J  1 86  ? 155.076 104.780 107.300 1.00 35.55  ? 86   TYR J CE1 1 
ATOM   7777  C CE2 . TYR J  1 86  ? 153.543 103.207 108.251 1.00 42.24  ? 86   TYR J CE2 1 
ATOM   7778  C CZ  . TYR J  1 86  ? 154.351 104.314 108.379 1.00 37.61  ? 86   TYR J CZ  1 
ATOM   7779  O OH  . TYR J  1 86  ? 154.425 104.954 109.597 1.00 36.65  ? 86   TYR J OH  1 
ATOM   7780  N N   . TYR J  1 87  ? 154.264 99.125  103.352 1.00 36.49  ? 87   TYR J N   1 
ATOM   7781  C CA  . TYR J  1 87  ? 154.166 98.162  102.266 1.00 34.12  ? 87   TYR J CA  1 
ATOM   7782  C C   . TYR J  1 87  ? 152.726 97.665  102.168 1.00 34.42  ? 87   TYR J C   1 
ATOM   7783  O O   . TYR J  1 87  ? 152.166 97.248  103.183 1.00 34.42  ? 87   TYR J O   1 
ATOM   7784  C CB  . TYR J  1 87  ? 155.012 96.940  102.636 1.00 33.12  ? 87   TYR J CB  1 
ATOM   7785  C CG  . TYR J  1 87  ? 156.484 96.994  102.310 1.00 32.36  ? 87   TYR J CG  1 
ATOM   7786  C CD1 . TYR J  1 87  ? 157.444 97.163  103.322 1.00 30.31  ? 87   TYR J CD1 1 
ATOM   7787  C CD2 . TYR J  1 87  ? 156.922 96.828  100.998 1.00 33.09  ? 87   TYR J CD2 1 
ATOM   7788  C CE1 . TYR J  1 87  ? 158.805 97.192  103.018 1.00 24.26  ? 87   TYR J CE1 1 
ATOM   7789  C CE2 . TYR J  1 87  ? 158.274 96.856  100.690 1.00 31.50  ? 87   TYR J CE2 1 
ATOM   7790  C CZ  . TYR J  1 87  ? 159.208 97.031  101.696 1.00 26.17  ? 87   TYR J CZ  1 
ATOM   7791  O OH  . TYR J  1 87  ? 160.549 97.049  101.371 1.00 28.14  ? 87   TYR J OH  1 
ATOM   7792  N N   . CYS J  1 88  ? 152.104 97.680  100.995 1.00 34.72  ? 88   CYS J N   1 
ATOM   7793  C CA  . CYS J  1 88  ? 150.756 97.092  100.908 1.00 35.95  ? 88   CYS J CA  1 
ATOM   7794  C C   . CYS J  1 88  ? 150.841 95.622  100.500 1.00 35.35  ? 88   CYS J C   1 
ATOM   7795  O O   . CYS J  1 88  ? 151.434 95.302  99.467  1.00 32.49  ? 88   CYS J O   1 
ATOM   7796  C CB  . CYS J  1 88  ? 149.857 97.883  99.952  1.00 35.11  ? 88   CYS J CB  1 
ATOM   7797  S SG  . CYS J  1 88  ? 150.541 98.068  98.293  1.00 37.81  ? 88   CYS J SG  1 
ATOM   7798  N N   . GLN J  1 89  ? 150.275 94.727  101.310 1.00 34.49  ? 89   GLN J N   1 
ATOM   7799  C CA  . GLN J  1 89  ? 150.283 93.299  100.990 1.00 34.73  ? 89   GLN J CA  1 
ATOM   7800  C C   . GLN J  1 89  ? 148.935 92.821  100.475 1.00 34.02  ? 89   GLN J C   1 
ATOM   7801  O O   . GLN J  1 89  ? 147.878 93.133  101.049 1.00 32.96  ? 89   GLN J O   1 
ATOM   7802  C CB  . GLN J  1 89  ? 150.703 92.452  102.198 1.00 34.71  ? 89   GLN J CB  1 
ATOM   7803  C CG  . GLN J  1 89  ? 149.698 91.340  102.515 1.00 37.39  ? 89   GLN J CG  1 
ATOM   7804  C CD  . GLN J  1 89  ? 150.312 90.100  103.102 1.00 34.98  ? 89   GLN J CD  1 
ATOM   7805  O OE1 . GLN J  1 89  ? 149.815 89.563  104.092 1.00 40.96  ? 89   GLN J OE1 1 
ATOM   7806  N NE2 . GLN J  1 89  ? 151.397 89.624  102.498 1.00 29.34  ? 89   GLN J NE2 1 
ATOM   7807  N N   . GLN J  1 90  ? 148.982 92.066  99.384  1.00 34.02  ? 90   GLN J N   1 
ATOM   7808  C CA  . GLN J  1 90  ? 147.808 91.415  98.831  1.00 33.68  ? 90   GLN J CA  1 
ATOM   7809  C C   . GLN J  1 90  ? 147.557 90.139  99.640  1.00 33.20  ? 90   GLN J C   1 
ATOM   7810  O O   . GLN J  1 90  ? 148.449 89.302  99.747  1.00 31.80  ? 90   GLN J O   1 
ATOM   7811  C CB  . GLN J  1 90  ? 148.082 91.077  97.367  1.00 31.84  ? 90   GLN J CB  1 
ATOM   7812  C CG  . GLN J  1 90  ? 147.366 89.845  96.867  1.00 35.54  ? 90   GLN J CG  1 
ATOM   7813  C CD  . GLN J  1 90  ? 148.331 88.807  96.356  1.00 33.68  ? 90   GLN J CD  1 
ATOM   7814  O OE1 . GLN J  1 90  ? 149.450 89.124  95.952  1.00 44.37  ? 90   GLN J OE1 1 
ATOM   7815  N NE2 . GLN J  1 90  ? 147.903 87.552  96.361  1.00 28.62  ? 90   GLN J NE2 1 
ATOM   7816  N N   . SER J  1 91  ? 146.371 89.985  100.227 1.00 33.87  ? 91   SER J N   1 
ATOM   7817  C CA  . SER J  1 91  ? 146.097 88.780  101.026 1.00 35.91  ? 91   SER J CA  1 
ATOM   7818  C C   . SER J  1 91  ? 145.258 87.720  100.294 1.00 37.30  ? 91   SER J C   1 
ATOM   7819  O O   . SER J  1 91  ? 144.752 86.765  100.910 1.00 37.15  ? 91   SER J O   1 
ATOM   7820  C CB  . SER J  1 91  ? 145.437 89.135  102.366 1.00 35.64  ? 91   SER J CB  1 
ATOM   7821  O OG  . SER J  1 91  ? 145.315 87.992  103.196 1.00 38.65  ? 91   SER J OG  1 
ATOM   7822  N N   . TYR J  1 92  ? 145.174 87.844  98.977  1.00 37.93  ? 92   TYR J N   1 
ATOM   7823  C CA  . TYR J  1 92  ? 144.001 87.384  98.246  1.00 39.32  ? 92   TYR J CA  1 
ATOM   7824  C C   . TYR J  1 92  ? 144.125 86.054  97.507  1.00 39.73  ? 92   TYR J C   1 
ATOM   7825  O O   . TYR J  1 92  ? 143.161 85.274  97.442  1.00 39.72  ? 92   TYR J O   1 
ATOM   7826  C CB  . TYR J  1 92  ? 143.638 88.480  97.264  1.00 38.71  ? 92   TYR J CB  1 
ATOM   7827  C CG  . TYR J  1 92  ? 142.351 88.268  96.561  1.00 36.94  ? 92   TYR J CG  1 
ATOM   7828  C CD1 . TYR J  1 92  ? 141.178 88.807  97.062  1.00 32.36  ? 92   TYR J CD1 1 
ATOM   7829  C CD2 . TYR J  1 92  ? 142.304 87.541  95.378  1.00 36.71  ? 92   TYR J CD2 1 
ATOM   7830  C CE1 . TYR J  1 92  ? 139.987 88.625  96.409  1.00 32.63  ? 92   TYR J CE1 1 
ATOM   7831  C CE2 . TYR J  1 92  ? 141.119 87.340  94.721  1.00 34.61  ? 92   TYR J CE2 1 
ATOM   7832  C CZ  . TYR J  1 92  ? 139.962 87.889  95.241  1.00 32.58  ? 92   TYR J CZ  1 
ATOM   7833  O OH  . TYR J  1 92  ? 138.768 87.698  94.589  1.00 36.96  ? 92   TYR J OH  1 
ATOM   7834  N N   . SER J  1 93  ? 145.295 85.853  96.903  1.00 40.79  ? 93   SER J N   1 
ATOM   7835  C CA  . SER J  1 93  ? 145.711 84.586  96.321  1.00 40.89  ? 93   SER J CA  1 
ATOM   7836  C C   . SER J  1 93  ? 147.125 84.276  96.782  1.00 40.67  ? 93   SER J C   1 
ATOM   7837  O O   . SER J  1 93  ? 147.764 85.088  97.460  1.00 37.65  ? 93   SER J O   1 
ATOM   7838  C CB  . SER J  1 93  ? 145.612 84.600  94.794  1.00 41.28  ? 93   SER J CB  1 
ATOM   7839  O OG  . SER J  1 93  ? 145.824 83.297  94.258  1.00 45.01  ? 93   SER J OG  1 
ATOM   7840  N N   . THR J  1 94  ? 147.607 83.099  96.418  1.00 41.65  ? 94   THR J N   1 
ATOM   7841  C CA  . THR J  1 94  ? 148.879 82.634  96.920  1.00 42.43  ? 94   THR J CA  1 
ATOM   7842  C C   . THR J  1 94  ? 149.893 82.437  95.790  1.00 44.13  ? 94   THR J C   1 
ATOM   7843  O O   . THR J  1 94  ? 149.554 81.873  94.735  1.00 44.94  ? 94   THR J O   1 
ATOM   7844  C CB  . THR J  1 94  ? 148.694 81.380  97.795  1.00 41.27  ? 94   THR J CB  1 
ATOM   7845  O OG1 . THR J  1 94  ? 147.366 80.820  97.564  1.00 40.05  ? 94   THR J OG1 1 
ATOM   7846  C CG2 . THR J  1 94  ? 148.803 81.768  99.267  1.00 38.99  ? 94   THR J CG2 1 
ATOM   7847  N N   . PRO J  1 95  ? 151.137 82.915  95.993  1.00 45.38  ? 95   PRO J N   1 
ATOM   7848  C CA  . PRO J  1 95  ? 151.614 83.510  97.241  1.00 47.16  ? 95   PRO J CA  1 
ATOM   7849  C C   . PRO J  1 95  ? 151.117 84.946  97.380  1.00 48.29  ? 95   PRO J C   1 
ATOM   7850  O O   . PRO J  1 95  ? 150.905 85.615  96.364  1.00 48.30  ? 95   PRO J O   1 
ATOM   7851  C CB  . PRO J  1 95  ? 153.134 83.484  97.073  1.00 47.22  ? 95   PRO J CB  1 
ATOM   7852  C CG  . PRO J  1 95  ? 153.321 83.684  95.581  1.00 45.71  ? 95   PRO J CG  1 
ATOM   7853  C CD  . PRO J  1 95  ? 152.181 82.927  94.943  1.00 46.19  ? 95   PRO J CD  1 
ATOM   7854  N N   . ASN J  1 96  ? 150.900 85.416  98.605  1.00 49.68  ? 96   ASN J N   1 
ATOM   7855  C CA  . ASN J  1 96  ? 150.565 86.828  98.787  1.00 52.80  ? 96   ASN J CA  1 
ATOM   7856  C C   . ASN J  1 96  ? 151.761 87.668  98.375  1.00 54.82  ? 96   ASN J C   1 
ATOM   7857  O O   . ASN J  1 96  ? 152.891 87.376  98.788  1.00 56.53  ? 96   ASN J O   1 
ATOM   7858  C CB  . ASN J  1 96  ? 150.204 87.127  100.241 1.00 52.17  ? 96   ASN J CB  1 
ATOM   7859  C CG  . ASN J  1 96  ? 149.049 86.286  100.736 1.00 51.27  ? 96   ASN J CG  1 
ATOM   7860  O OD1 . ASN J  1 96  ? 147.919 86.405  100.258 1.00 54.95  ? 96   ASN J OD1 1 
ATOM   7861  N ND2 . ASN J  1 96  ? 149.332 85.420  101.706 1.00 52.33  ? 96   ASN J ND2 1 
ATOM   7862  N N   . THR J  1 97  ? 151.538 88.691  97.557  1.00 55.57  ? 97   THR J N   1 
ATOM   7863  C CA  . THR J  1 97  ? 152.658 89.538  97.168  1.00 56.78  ? 97   THR J CA  1 
ATOM   7864  C C   . THR J  1 97  ? 152.571 90.907  97.806  1.00 56.51  ? 97   THR J C   1 
ATOM   7865  O O   . THR J  1 97  ? 151.485 91.496  97.911  1.00 56.96  ? 97   THR J O   1 
ATOM   7866  C CB  . THR J  1 97  ? 152.846 89.643  95.644  1.00 57.58  ? 97   THR J CB  1 
ATOM   7867  O OG1 . THR J  1 97  ? 151.652 90.144  95.037  1.00 57.47  ? 97   THR J OG1 1 
ATOM   7868  C CG2 . THR J  1 97  ? 153.204 88.284  95.049  1.00 58.41  ? 97   THR J CG2 1 
ATOM   7869  N N   . PHE J  1 98  ? 153.729 91.393  98.242  1.00 54.20  ? 98   PHE J N   1 
ATOM   7870  C CA  . PHE J  1 98  ? 153.800 92.637  98.978  1.00 53.48  ? 98   PHE J CA  1 
ATOM   7871  C C   . PHE J  1 98  ? 153.640 93.830  98.045  1.00 54.10  ? 98   PHE J C   1 
ATOM   7872  O O   . PHE J  1 98  ? 153.256 93.679  96.873  1.00 53.70  ? 98   PHE J O   1 
ATOM   7873  C CB  . PHE J  1 98  ? 155.131 92.721  99.726  1.00 53.34  ? 98   PHE J CB  1 
ATOM   7874  C CG  . PHE J  1 98  ? 155.139 91.999  101.044 1.00 51.51  ? 98   PHE J CG  1 
ATOM   7875  C CD1 . PHE J  1 98  ? 155.804 90.791  101.186 1.00 53.26  ? 98   PHE J CD1 1 
ATOM   7876  C CD2 . PHE J  1 98  ? 154.497 92.539  102.155 1.00 51.99  ? 98   PHE J CD2 1 
ATOM   7877  C CE1 . PHE J  1 98  ? 155.822 90.134  102.412 1.00 52.55  ? 98   PHE J CE1 1 
ATOM   7878  C CE2 . PHE J  1 98  ? 154.507 91.884  103.379 1.00 56.90  ? 98   PHE J CE2 1 
ATOM   7879  C CZ  . PHE J  1 98  ? 155.170 90.676  103.506 1.00 55.21  ? 98   PHE J CZ  1 
ATOM   7880  N N   . GLY J  1 99  ? 153.931 95.016  98.575  1.00 53.14  ? 99   GLY J N   1 
ATOM   7881  C CA  . GLY J  1 99  ? 154.030 96.196  97.746  1.00 51.04  ? 99   GLY J CA  1 
ATOM   7882  C C   . GLY J  1 99  ? 155.470 96.328  97.295  1.00 50.73  ? 99   GLY J C   1 
ATOM   7883  O O   . GLY J  1 99  ? 156.097 95.365  96.836  1.00 51.99  ? 99   GLY J O   1 
ATOM   7884  N N   . GLN J  1 100 ? 155.992 97.537  97.447  1.00 50.06  ? 100  GLN J N   1 
ATOM   7885  C CA  . GLN J  1 100 ? 157.327 97.887  96.991  1.00 47.43  ? 100  GLN J CA  1 
ATOM   7886  C C   . GLN J  1 100 ? 157.888 98.795  98.056  1.00 47.80  ? 100  GLN J C   1 
ATOM   7887  O O   . GLN J  1 100 ? 159.097 99.032  98.134  1.00 47.30  ? 100  GLN J O   1 
ATOM   7888  C CB  . GLN J  1 100 ? 157.255 98.671  95.680  1.00 46.90  ? 100  GLN J CB  1 
ATOM   7889  C CG  . GLN J  1 100 ? 156.052 98.376  94.797  1.00 44.50  ? 100  GLN J CG  1 
ATOM   7890  C CD  . GLN J  1 100 ? 156.077 99.187  93.525  1.00 46.57  ? 100  GLN J CD  1 
ATOM   7891  O OE1 . GLN J  1 100 ? 155.452 100.241 93.432  1.00 49.54  ? 100  GLN J OE1 1 
ATOM   7892  N NE2 . GLN J  1 100 ? 156.828 98.717  92.537  1.00 47.17  ? 100  GLN J NE2 1 
ATOM   7893  N N   . GLY J  1 101 ? 156.976 99.302  98.879  1.00 47.48  ? 101  GLY J N   1 
ATOM   7894  C CA  . GLY J  1 101 ? 157.321 100.238 99.917  1.00 46.31  ? 101  GLY J CA  1 
ATOM   7895  C C   . GLY J  1 101 ? 157.301 101.664 99.420  1.00 45.16  ? 101  GLY J C   1 
ATOM   7896  O O   . GLY J  1 101 ? 157.623 101.955 98.263  1.00 45.52  ? 101  GLY J O   1 
ATOM   7897  N N   . THR J  1 102 ? 156.898 102.544 100.327 1.00 45.49  ? 102  THR J N   1 
ATOM   7898  C CA  . THR J  1 102 ? 157.008 103.976 100.176 1.00 44.06  ? 102  THR J CA  1 
ATOM   7899  C C   . THR J  1 102 ? 157.815 104.376 101.405 1.00 43.13  ? 102  THR J C   1 
ATOM   7900  O O   . THR J  1 102 ? 157.266 104.436 102.509 1.00 44.06  ? 102  THR J O   1 
ATOM   7901  C CB  . THR J  1 102 ? 155.606 104.620 100.219 1.00 44.85  ? 102  THR J CB  1 
ATOM   7902  O OG1 . THR J  1 102 ? 154.948 104.407 98.960  1.00 46.04  ? 102  THR J OG1 1 
ATOM   7903  C CG2 . THR J  1 102 ? 155.689 106.136 100.493 1.00 46.77  ? 102  THR J CG2 1 
ATOM   7904  N N   . LYS J  1 103 ? 159.118 104.609 101.230 1.00 42.67  ? 103  LYS J N   1 
ATOM   7905  C CA  . LYS J  1 103 ? 160.058 104.769 102.362 1.00 42.75  ? 103  LYS J CA  1 
ATOM   7906  C C   . LYS J  1 103 ? 159.909 106.081 103.142 1.00 42.17  ? 103  LYS J C   1 
ATOM   7907  O O   . LYS J  1 103 ? 160.468 107.112 102.739 1.00 42.82  ? 103  LYS J O   1 
ATOM   7908  C CB  . LYS J  1 103 ? 161.509 104.622 101.871 1.00 42.05  ? 103  LYS J CB  1 
ATOM   7909  C CG  . LYS J  1 103 ? 161.965 103.185 101.669 1.00 42.06  ? 103  LYS J CG  1 
ATOM   7910  C CD  . LYS J  1 103 ? 163.270 103.118 100.867 1.00 43.51  ? 103  LYS J CD  1 
ATOM   7911  C CE  . LYS J  1 103 ? 163.765 101.674 100.789 1.00 44.84  ? 103  LYS J CE  1 
ATOM   7912  N NZ  . LYS J  1 103 ? 164.957 101.558 99.857  1.00 41.78  ? 103  LYS J NZ  1 
ATOM   7913  N N   . VAL J  1 104 ? 159.190 106.046 104.266 1.00 42.10  ? 104  VAL J N   1 
ATOM   7914  C CA  . VAL J  1 104 ? 158.878 107.299 104.978 1.00 41.38  ? 104  VAL J CA  1 
ATOM   7915  C C   . VAL J  1 104 ? 159.948 107.775 105.978 1.00 41.90  ? 104  VAL J C   1 
ATOM   7916  O O   . VAL J  1 104 ? 159.861 107.505 107.187 1.00 41.51  ? 104  VAL J O   1 
ATOM   7917  C CB  . VAL J  1 104 ? 157.476 107.285 105.624 1.00 41.20  ? 104  VAL J CB  1 
ATOM   7918  C CG1 . VAL J  1 104 ? 157.035 108.706 106.002 1.00 37.51  ? 104  VAL J CG1 1 
ATOM   7919  C CG2 . VAL J  1 104 ? 156.472 106.648 104.683 1.00 34.77  ? 104  VAL J CG2 1 
ATOM   7920  N N   . GLU J  1 105 ? 160.951 108.482 105.441 1.00 43.81  ? 105  GLU J N   1 
ATOM   7921  C CA  . GLU J  1 105 ? 161.913 109.263 106.241 1.00 44.85  ? 105  GLU J CA  1 
ATOM   7922  C C   . GLU J  1 105 ? 161.283 110.614 106.641 1.00 44.93  ? 105  GLU J C   1 
ATOM   7923  O O   . GLU J  1 105 ? 160.211 110.963 106.128 1.00 44.69  ? 105  GLU J O   1 
ATOM   7924  C CB  . GLU J  1 105 ? 163.270 109.414 105.510 1.00 43.90  ? 105  GLU J CB  1 
ATOM   7925  C CG  . GLU J  1 105 ? 163.509 110.786 104.805 1.00 46.68  ? 105  GLU J CG  1 
ATOM   7926  C CD  . GLU J  1 105 ? 165.005 111.117 104.682 1.00 46.88  ? 105  GLU J CD  1 
ATOM   7927  O OE1 . GLU J  1 105 ? 165.357 112.314 104.779 1.00 45.69  ? 105  GLU J OE1 1 
ATOM   7928  O OE2 . GLU J  1 105 ? 165.830 110.192 104.486 1.00 47.31  ? 105  GLU J OE2 1 
ATOM   7929  N N   . ILE J  1 106 ? 161.939 111.370 107.530 1.00 46.09  ? 106  ILE J N   1 
ATOM   7930  C CA  . ILE J  1 106 ? 161.206 112.366 108.337 1.00 47.37  ? 106  ILE J CA  1 
ATOM   7931  C C   . ILE J  1 106 ? 161.814 113.789 108.351 1.00 46.94  ? 106  ILE J C   1 
ATOM   7932  O O   . ILE J  1 106 ? 161.048 114.775 108.237 1.00 45.63  ? 106  ILE J O   1 
ATOM   7933  C CB  . ILE J  1 106 ? 160.965 111.793 109.789 1.00 47.39  ? 106  ILE J CB  1 
ATOM   7934  C CG1 . ILE J  1 106 ? 159.878 112.563 110.564 1.00 48.63  ? 106  ILE J CG1 1 
ATOM   7935  C CG2 . ILE J  1 106 ? 162.292 111.605 110.567 1.00 47.25  ? 106  ILE J CG2 1 
ATOM   7936  C CD1 . ILE J  1 106 ? 160.370 113.848 111.308 1.00 54.46  ? 106  ILE J CD1 1 
ATOM   7937  N N   . ASP K  1 1   ? 146.035 137.231 107.139 1.00 36.22  ? 1    ASP K N   1 
ATOM   7938  C CA  . ASP K  1 1   ? 146.955 136.422 106.276 1.00 35.77  ? 1    ASP K CA  1 
ATOM   7939  C C   . ASP K  1 1   ? 146.601 134.930 106.318 1.00 35.25  ? 1    ASP K C   1 
ATOM   7940  O O   . ASP K  1 1   ? 146.186 134.406 107.360 1.00 35.79  ? 1    ASP K O   1 
ATOM   7941  C CB  . ASP K  1 1   ? 148.413 136.662 106.681 1.00 36.27  ? 1    ASP K CB  1 
ATOM   7942  C CG  . ASP K  1 1   ? 149.403 136.101 105.677 1.00 42.10  ? 1    ASP K CG  1 
ATOM   7943  O OD1 . ASP K  1 1   ? 149.494 134.860 105.538 1.00 50.67  ? 1    ASP K OD1 1 
ATOM   7944  O OD2 . ASP K  1 1   ? 150.115 136.903 105.040 1.00 47.60  ? 1    ASP K OD2 1 
ATOM   7945  N N   . ILE K  1 2   ? 146.782 134.261 105.179 1.00 33.60  ? 2    ILE K N   1 
ATOM   7946  C CA  . ILE K  1 2   ? 146.310 132.891 104.957 1.00 34.39  ? 2    ILE K CA  1 
ATOM   7947  C C   . ILE K  1 2   ? 147.515 131.951 104.772 1.00 33.80  ? 2    ILE K C   1 
ATOM   7948  O O   . ILE K  1 2   ? 148.371 132.212 103.918 1.00 35.04  ? 2    ILE K O   1 
ATOM   7949  C CB  . ILE K  1 2   ? 145.388 132.833 103.692 1.00 34.62  ? 2    ILE K CB  1 
ATOM   7950  C CG1 . ILE K  1 2   ? 144.742 134.207 103.374 1.00 37.27  ? 2    ILE K CG1 1 
ATOM   7951  C CG2 . ILE K  1 2   ? 144.357 131.707 103.812 1.00 33.44  ? 2    ILE K CG2 1 
ATOM   7952  C CD1 . ILE K  1 2   ? 143.627 134.680 104.333 1.00 40.08  ? 2    ILE K CD1 1 
ATOM   7953  N N   . GLN K  1 3   ? 147.603 130.878 105.559 1.00 33.72  ? 3    GLN K N   1 
ATOM   7954  C CA  . GLN K  1 3   ? 148.803 130.026 105.500 1.00 33.90  ? 3    GLN K CA  1 
ATOM   7955  C C   . GLN K  1 3   ? 148.573 128.590 105.018 1.00 31.90  ? 3    GLN K C   1 
ATOM   7956  O O   . GLN K  1 3   ? 147.753 127.849 105.566 1.00 32.66  ? 3    GLN K O   1 
ATOM   7957  C CB  . GLN K  1 3   ? 149.619 130.107 106.804 1.00 33.62  ? 3    GLN K CB  1 
ATOM   7958  C CG  . GLN K  1 3   ? 150.743 131.164 106.736 1.00 34.17  ? 3    GLN K CG  1 
ATOM   7959  C CD  . GLN K  1 3   ? 151.100 131.799 108.083 1.00 39.84  ? 3    GLN K CD  1 
ATOM   7960  O OE1 . GLN K  1 3   ? 150.247 131.973 108.956 1.00 45.58  ? 3    GLN K OE1 1 
ATOM   7961  N NE2 . GLN K  1 3   ? 152.370 132.162 108.245 1.00 44.81  ? 3    GLN K NE2 1 
ATOM   7962  N N   . MET K  1 4   ? 149.321 128.232 103.972 1.00 29.63  ? 4    MET K N   1 
ATOM   7963  C CA  . MET K  1 4   ? 149.173 126.972 103.234 1.00 29.58  ? 4    MET K CA  1 
ATOM   7964  C C   . MET K  1 4   ? 150.120 125.883 103.715 1.00 28.50  ? 4    MET K C   1 
ATOM   7965  O O   . MET K  1 4   ? 151.166 126.190 104.335 1.00 30.44  ? 4    MET K O   1 
ATOM   7966  C CB  . MET K  1 4   ? 149.421 127.213 101.741 1.00 29.78  ? 4    MET K CB  1 
ATOM   7967  C CG  . MET K  1 4   ? 148.537 128.294 101.130 1.00 30.40  ? 4    MET K CG  1 
ATOM   7968  S SD  . MET K  1 4   ? 146.795 128.101 101.593 1.00 31.46  ? 4    MET K SD  1 
ATOM   7969  C CE  . MET K  1 4   ? 146.352 126.669 100.592 1.00 10.37  ? 4    MET K CE  1 
ATOM   7970  N N   . THR K  1 5   ? 149.794 124.622 103.419 1.00 28.11  ? 5    THR K N   1 
ATOM   7971  C CA  . THR K  1 5   ? 150.608 123.519 103.937 1.00 29.61  ? 5    THR K CA  1 
ATOM   7972  C C   . THR K  1 5   ? 150.690 122.299 102.994 1.00 29.63  ? 5    THR K C   1 
ATOM   7973  O O   . THR K  1 5   ? 149.690 121.610 102.761 1.00 29.05  ? 5    THR K O   1 
ATOM   7974  C CB  . THR K  1 5   ? 150.151 123.140 105.365 1.00 30.27  ? 5    THR K CB  1 
ATOM   7975  O OG1 . THR K  1 5   ? 149.698 124.320 106.061 1.00 34.16  ? 5    THR K OG1 1 
ATOM   7976  C CG2 . THR K  1 5   ? 151.288 122.517 106.145 1.00 30.45  ? 5    THR K CG2 1 
ATOM   7977  N N   . GLN K  1 6   ? 151.893 122.035 102.476 1.00 29.59  ? 6    GLN K N   1 
ATOM   7978  C CA  . GLN K  1 6   ? 152.067 121.098 101.361 1.00 30.12  ? 6    GLN K CA  1 
ATOM   7979  C C   . GLN K  1 6   ? 152.846 119.813 101.689 1.00 30.27  ? 6    GLN K C   1 
ATOM   7980  O O   . GLN K  1 6   ? 154.061 119.861 102.043 1.00 28.94  ? 6    GLN K O   1 
ATOM   7981  C CB  . GLN K  1 6   ? 152.693 121.827 100.161 1.00 30.10  ? 6    GLN K CB  1 
ATOM   7982  C CG  . GLN K  1 6   ? 152.986 120.920 98.973  1.00 29.77  ? 6    GLN K CG  1 
ATOM   7983  C CD  . GLN K  1 6   ? 152.759 121.616 97.652  1.00 39.54  ? 6    GLN K CD  1 
ATOM   7984  O OE1 . GLN K  1 6   ? 152.848 122.841 97.551  1.00 46.99  ? 6    GLN K OE1 1 
ATOM   7985  N NE2 . GLN K  1 6   ? 152.452 120.834 96.624  1.00 40.47  ? 6    GLN K NE2 1 
ATOM   7986  N N   . SER K  1 7   ? 152.135 118.673 101.552 1.00 29.53  ? 7    SER K N   1 
ATOM   7987  C CA  . SER K  1 7   ? 152.767 117.385 101.851 1.00 30.48  ? 7    SER K CA  1 
ATOM   7988  C C   . SER K  1 7   ? 152.816 116.426 100.658 1.00 29.92  ? 7    SER K C   1 
ATOM   7989  O O   . SER K  1 7   ? 151.817 116.256 99.953  1.00 25.30  ? 7    SER K O   1 
ATOM   7990  C CB  . SER K  1 7   ? 152.095 116.718 103.054 1.00 30.22  ? 7    SER K CB  1 
ATOM   7991  O OG  . SER K  1 7   ? 150.705 116.524 102.821 1.00 33.01  ? 7    SER K OG  1 
ATOM   7992  N N   . PRO K  1 8   ? 153.985 115.786 100.446 1.00 30.91  ? 8    PRO K N   1 
ATOM   7993  C CA  . PRO K  1 8   ? 155.173 115.970 101.289 1.00 31.63  ? 8    PRO K CA  1 
ATOM   7994  C C   . PRO K  1 8   ? 156.176 116.939 100.648 1.00 33.04  ? 8    PRO K C   1 
ATOM   7995  O O   . PRO K  1 8   ? 155.771 117.795 99.861  1.00 34.75  ? 8    PRO K O   1 
ATOM   7996  C CB  . PRO K  1 8   ? 155.754 114.559 101.337 1.00 30.98  ? 8    PRO K CB  1 
ATOM   7997  C CG  . PRO K  1 8   ? 155.417 113.993 99.946  1.00 32.25  ? 8    PRO K CG  1 
ATOM   7998  C CD  . PRO K  1 8   ? 154.252 114.797 99.383  1.00 29.21  ? 8    PRO K CD  1 
ATOM   7999  N N   . SER K  1 9   ? 157.460 116.820 100.988 1.00 34.05  ? 9    SER K N   1 
ATOM   8000  C CA  . SER K  1 9   ? 158.505 117.533 100.258 1.00 36.62  ? 9    SER K CA  1 
ATOM   8001  C C   . SER K  1 9   ? 159.111 116.589 99.228  1.00 38.89  ? 9    SER K C   1 
ATOM   8002  O O   . SER K  1 9   ? 158.768 116.653 98.047  1.00 39.57  ? 9    SER K O   1 
ATOM   8003  C CB  . SER K  1 9   ? 159.597 118.076 101.196 1.00 37.13  ? 9    SER K CB  1 
ATOM   8004  O OG  . SER K  1 9   ? 159.033 118.915 102.211 1.00 36.28  ? 9    SER K OG  1 
ATOM   8005  N N   . SER K  1 10  ? 160.011 115.718 99.681  1.00 40.45  ? 10   SER K N   1 
ATOM   8006  C CA  . SER K  1 10  ? 160.714 114.824 98.768  1.00 41.52  ? 10   SER K CA  1 
ATOM   8007  C C   . SER K  1 10  ? 159.787 113.702 98.341  1.00 40.97  ? 10   SER K C   1 
ATOM   8008  O O   . SER K  1 10  ? 159.132 113.069 99.170  1.00 39.73  ? 10   SER K O   1 
ATOM   8009  C CB  . SER K  1 10  ? 161.994 114.261 99.396  1.00 42.51  ? 10   SER K CB  1 
ATOM   8010  O OG  . SER K  1 10  ? 161.714 113.087 100.194 1.00 45.38  ? 10   SER K OG  1 
ATOM   8011  N N   . LEU K  1 11  ? 159.725 113.487 97.033  1.00 42.11  ? 11   LEU K N   1 
ATOM   8012  C CA  . LEU K  1 11  ? 158.931 112.420 96.448  1.00 43.31  ? 11   LEU K CA  1 
ATOM   8013  C C   . LEU K  1 11  ? 159.787 111.745 95.378  1.00 45.47  ? 11   LEU K C   1 
ATOM   8014  O O   . LEU K  1 11  ? 160.643 112.395 94.777  1.00 46.97  ? 11   LEU K O   1 
ATOM   8015  C CB  . LEU K  1 11  ? 157.657 113.016 95.828  1.00 41.93  ? 11   LEU K CB  1 
ATOM   8016  C CG  . LEU K  1 11  ? 156.364 112.204 95.673  1.00 40.67  ? 11   LEU K CG  1 
ATOM   8017  C CD1 . LEU K  1 11  ? 156.114 111.365 96.918  1.00 44.57  ? 11   LEU K CD1 1 
ATOM   8018  C CD2 . LEU K  1 11  ? 155.140 113.157 95.401  1.00 40.09  ? 11   LEU K CD2 1 
ATOM   8019  N N   . SER K  1 12  ? 159.578 110.443 95.163  1.00 45.45  ? 12   SER K N   1 
ATOM   8020  C CA  . SER K  1 12  ? 160.144 109.742 93.995  1.00 46.66  ? 12   SER K CA  1 
ATOM   8021  C C   . SER K  1 12  ? 159.314 108.537 93.567  1.00 47.98  ? 12   SER K C   1 
ATOM   8022  O O   . SER K  1 12  ? 158.838 107.769 94.407  1.00 47.09  ? 12   SER K O   1 
ATOM   8023  C CB  . SER K  1 12  ? 161.605 109.315 94.220  1.00 45.64  ? 12   SER K CB  1 
ATOM   8024  O OG  . SER K  1 12  ? 161.684 108.003 94.753  1.00 46.93  ? 12   SER K OG  1 
ATOM   8025  N N   . ALA K  1 13  ? 159.165 108.379 92.252  1.00 48.68  ? 13   ALA K N   1 
ATOM   8026  C CA  . ALA K  1 13  ? 158.405 107.272 91.685  1.00 49.89  ? 13   ALA K CA  1 
ATOM   8027  C C   . ALA K  1 13  ? 158.842 106.957 90.264  1.00 50.47  ? 13   ALA K C   1 
ATOM   8028  O O   . ALA K  1 13  ? 159.852 107.472 89.779  1.00 52.10  ? 13   ALA K O   1 
ATOM   8029  C CB  . ALA K  1 13  ? 156.909 107.565 91.731  1.00 50.29  ? 13   ALA K CB  1 
ATOM   8030  N N   . SER K  1 14  ? 158.070 106.101 89.604  1.00 49.78  ? 14   SER K N   1 
ATOM   8031  C CA  . SER K  1 14  ? 158.423 105.647 88.278  1.00 50.12  ? 14   SER K CA  1 
ATOM   8032  C C   . SER K  1 14  ? 157.312 105.972 87.303  1.00 50.38  ? 14   SER K C   1 
ATOM   8033  O O   . SER K  1 14  ? 156.300 106.578 87.669  1.00 51.32  ? 14   SER K O   1 
ATOM   8034  C CB  . SER K  1 14  ? 158.710 104.144 88.289  1.00 49.84  ? 14   SER K CB  1 
ATOM   8035  O OG  . SER K  1 14  ? 159.269 103.721 87.056  1.00 48.58  ? 14   SER K OG  1 
ATOM   8036  N N   . VAL K  1 15  ? 157.505 105.559 86.058  1.00 49.49  ? 15   VAL K N   1 
ATOM   8037  C CA  . VAL K  1 15  ? 156.523 105.834 85.029  1.00 49.32  ? 15   VAL K CA  1 
ATOM   8038  C C   . VAL K  1 15  ? 155.210 105.106 85.287  1.00 47.82  ? 15   VAL K C   1 
ATOM   8039  O O   . VAL K  1 15  ? 155.116 103.875 85.183  1.00 48.24  ? 15   VAL K O   1 
ATOM   8040  C CB  . VAL K  1 15  ? 157.066 105.559 83.608  1.00 49.73  ? 15   VAL K CB  1 
ATOM   8041  C CG1 . VAL K  1 15  ? 155.977 105.771 82.549  1.00 47.60  ? 15   VAL K CG1 1 
ATOM   8042  C CG2 . VAL K  1 15  ? 158.258 106.469 83.312  1.00 49.28  ? 15   VAL K CG2 1 
ATOM   8043  N N   . GLY K  1 16  ? 154.204 105.908 85.647  1.00 46.61  ? 16   GLY K N   1 
ATOM   8044  C CA  . GLY K  1 16  ? 152.820 105.371 85.698  1.00 45.10  ? 16   GLY K CA  1 
ATOM   8045  C C   . GLY K  1 16  ? 152.336 105.266 87.126  1.00 44.54  ? 16   GLY K C   1 
ATOM   8046  O O   . GLY K  1 16  ? 151.127 105.175 87.364  1.00 43.99  ? 16   GLY K O   1 
ATOM   8047  N N   . ASP K  1 17  ? 153.278 105.267 88.076  1.00 43.19  ? 17   ASP K N   1 
ATOM   8048  C CA  . ASP K  1 17  ? 152.881 105.308 89.466  1.00 42.32  ? 17   ASP K CA  1 
ATOM   8049  C C   . ASP K  1 17  ? 152.049 106.548 89.728  1.00 39.78  ? 17   ASP K C   1 
ATOM   8050  O O   . ASP K  1 17  ? 152.184 107.581 89.036  1.00 37.24  ? 17   ASP K O   1 
ATOM   8051  C CB  . ASP K  1 17  ? 154.087 105.220 90.401  1.00 43.67  ? 17   ASP K CB  1 
ATOM   8052  C CG  . ASP K  1 17  ? 154.629 103.811 90.504  1.00 47.62  ? 17   ASP K CG  1 
ATOM   8053  O OD1 . ASP K  1 17  ? 155.503 103.448 89.689  1.00 43.89  ? 17   ASP K OD1 1 
ATOM   8054  O OD2 . ASP K  1 17  ? 154.185 103.065 91.399  1.00 54.93  ? 17   ASP K OD2 1 
ATOM   8055  N N   . ARG K  1 18  ? 151.159 106.410 90.710  1.00 38.66  ? 18   ARG K N   1 
ATOM   8056  C CA  . ARG K  1 18  ? 150.220 107.463 91.013  1.00 37.82  ? 18   ARG K CA  1 
ATOM   8057  C C   . ARG K  1 18  ? 150.849 108.300 92.088  1.00 37.50  ? 18   ARG K C   1 
ATOM   8058  O O   . ARG K  1 18  ? 151.410 107.780 93.067  1.00 37.00  ? 18   ARG K O   1 
ATOM   8059  C CB  . ARG K  1 18  ? 148.902 106.895 91.528  1.00 37.62  ? 18   ARG K CB  1 
ATOM   8060  C CG  . ARG K  1 18  ? 147.707 107.499 90.832  1.00 37.59  ? 18   ARG K CG  1 
ATOM   8061  C CD  . ARG K  1 18  ? 146.621 107.978 91.775  1.00 46.12  ? 18   ARG K CD  1 
ATOM   8062  N NE  . ARG K  1 18  ? 145.483 108.433 90.974  1.00 49.78  ? 18   ARG K NE  1 
ATOM   8063  C CZ  . ARG K  1 18  ? 144.225 108.027 91.127  1.00 50.87  ? 18   ARG K CZ  1 
ATOM   8064  N NH1 . ARG K  1 18  ? 143.899 107.171 92.101  1.00 51.80  ? 18   ARG K NH1 1 
ATOM   8065  N NH2 . ARG K  1 18  ? 143.281 108.512 90.310  1.00 47.35  ? 18   ARG K NH2 1 
ATOM   8066  N N   . VAL K  1 19  ? 150.751 109.607 91.899  1.00 35.65  ? 19   VAL K N   1 
ATOM   8067  C CA  . VAL K  1 19  ? 151.302 110.567 92.834  1.00 33.33  ? 19   VAL K CA  1 
ATOM   8068  C C   . VAL K  1 19  ? 150.178 111.446 93.395  1.00 33.97  ? 19   VAL K C   1 
ATOM   8069  O O   . VAL K  1 19  ? 149.483 112.150 92.655  1.00 34.10  ? 19   VAL K O   1 
ATOM   8070  C CB  . VAL K  1 19  ? 152.455 111.380 92.175  1.00 32.52  ? 19   VAL K CB  1 
ATOM   8071  C CG1 . VAL K  1 19  ? 152.764 112.670 92.965  1.00 30.08  ? 19   VAL K CG1 1 
ATOM   8072  C CG2 . VAL K  1 19  ? 153.709 110.513 92.059  1.00 29.40  ? 19   VAL K CG2 1 
ATOM   8073  N N   . THR K  1 20  ? 149.999 111.358 94.711  1.00 34.90  ? 20   THR K N   1 
ATOM   8074  C CA  . THR K  1 20  ? 148.999 112.124 95.450  1.00 36.66  ? 20   THR K CA  1 
ATOM   8075  C C   . THR K  1 20  ? 149.707 113.170 96.308  1.00 37.19  ? 20   THR K C   1 
ATOM   8076  O O   . THR K  1 20  ? 150.446 112.826 97.235  1.00 35.10  ? 20   THR K O   1 
ATOM   8077  C CB  . THR K  1 20  ? 148.164 111.202 96.375  1.00 39.63  ? 20   THR K CB  1 
ATOM   8078  O OG1 . THR K  1 20  ? 147.802 109.996 95.678  1.00 40.73  ? 20   THR K OG1 1 
ATOM   8079  C CG2 . THR K  1 20  ? 146.887 111.893 96.858  1.00 32.51  ? 20   THR K CG2 1 
ATOM   8080  N N   . ILE K  1 21  ? 149.487 114.444 95.989  1.00 37.69  ? 21   ILE K N   1 
ATOM   8081  C CA  . ILE K  1 21  ? 150.053 115.534 96.780  1.00 36.84  ? 21   ILE K CA  1 
ATOM   8082  C C   . ILE K  1 21  ? 148.933 116.304 97.487  1.00 37.22  ? 21   ILE K C   1 
ATOM   8083  O O   . ILE K  1 21  ? 147.889 116.604 96.889  1.00 36.62  ? 21   ILE K O   1 
ATOM   8084  C CB  . ILE K  1 21  ? 150.940 116.483 95.927  1.00 36.16  ? 21   ILE K CB  1 
ATOM   8085  C CG1 . ILE K  1 21  ? 151.723 115.680 94.872  1.00 36.77  ? 21   ILE K CG1 1 
ATOM   8086  C CG2 . ILE K  1 21  ? 151.907 117.271 96.833  1.00 35.30  ? 21   ILE K CG2 1 
ATOM   8087  C CD1 . ILE K  1 21  ? 152.610 116.583 93.941  1.00 34.60  ? 21   ILE K CD1 1 
ATOM   8088  N N   . THR K  1 22  ? 149.167 116.606 98.766  1.00 36.11  ? 22   THR K N   1 
ATOM   8089  C CA  . THR K  1 22  ? 148.173 117.235 99.639  1.00 36.23  ? 22   THR K CA  1 
ATOM   8090  C C   . THR K  1 22  ? 148.582 118.642 100.045 1.00 37.00  ? 22   THR K C   1 
ATOM   8091  O O   . THR K  1 22  ? 149.680 118.870 100.559 1.00 36.71  ? 22   THR K O   1 
ATOM   8092  C CB  . THR K  1 22  ? 147.964 116.432 100.944 1.00 36.77  ? 22   THR K CB  1 
ATOM   8093  O OG1 . THR K  1 22  ? 147.715 115.051 100.635 1.00 33.29  ? 22   THR K OG1 1 
ATOM   8094  C CG2 . THR K  1 22  ? 146.779 116.981 101.748 1.00 33.77  ? 22   THR K CG2 1 
ATOM   8095  N N   . CYS K  1 23  ? 147.666 119.571 99.811  1.00 38.30  ? 23   CYS K N   1 
ATOM   8096  C CA  . CYS K  1 23  ? 147.780 120.940 100.256 1.00 37.14  ? 23   CYS K CA  1 
ATOM   8097  C C   . CYS K  1 23  ? 146.588 121.197 101.166 1.00 36.56  ? 23   CYS K C   1 
ATOM   8098  O O   . CYS K  1 23  ? 145.565 120.509 101.074 1.00 34.48  ? 23   CYS K O   1 
ATOM   8099  C CB  . CYS K  1 23  ? 147.714 121.873 99.061  1.00 36.27  ? 23   CYS K CB  1 
ATOM   8100  S SG  . CYS K  1 23  ? 147.899 123.617 99.468  1.00 40.40  ? 23   CYS K SG  1 
ATOM   8101  N N   . ARG K  1 24  ? 146.712 122.215 102.027 1.00 38.30  ? 24   ARG K N   1 
ATOM   8102  C CA  . ARG K  1 24  ? 145.780 122.404 103.134 1.00 39.21  ? 24   ARG K CA  1 
ATOM   8103  C C   . ARG K  1 24  ? 145.907 123.843 103.649 1.00 39.31  ? 24   ARG K C   1 
ATOM   8104  O O   . ARG K  1 24  ? 146.994 124.261 104.068 1.00 38.19  ? 24   ARG K O   1 
ATOM   8105  C CB  . ARG K  1 24  ? 146.110 121.433 104.283 1.00 40.15  ? 24   ARG K CB  1 
ATOM   8106  C CG  . ARG K  1 24  ? 145.750 119.963 104.051 1.00 38.92  ? 24   ARG K CG  1 
ATOM   8107  C CD  . ARG K  1 24  ? 145.130 119.374 105.304 1.00 43.74  ? 24   ARG K CD  1 
ATOM   8108  N NE  . ARG K  1 24  ? 144.028 120.225 105.748 1.00 40.99  ? 24   ARG K NE  1 
ATOM   8109  C CZ  . ARG K  1 24  ? 143.253 119.994 106.803 1.00 26.05  ? 24   ARG K CZ  1 
ATOM   8110  N NH1 . ARG K  1 24  ? 143.442 118.922 107.564 1.00 16.10  ? 24   ARG K NH1 1 
ATOM   8111  N NH2 . ARG K  1 24  ? 142.282 120.847 107.102 1.00 28.05  ? 24   ARG K NH2 1 
ATOM   8112  N N   . ALA K  1 25  ? 144.800 124.589 103.611 1.00 40.24  ? 25   ALA K N   1 
ATOM   8113  C CA  . ALA K  1 25  ? 144.749 125.986 104.063 1.00 38.18  ? 25   ALA K CA  1 
ATOM   8114  C C   . ALA K  1 25  ? 144.366 126.113 105.541 1.00 37.06  ? 25   ALA K C   1 
ATOM   8115  O O   . ALA K  1 25  ? 143.740 125.204 106.103 1.00 35.74  ? 25   ALA K O   1 
ATOM   8116  C CB  . ALA K  1 25  ? 143.770 126.778 103.205 1.00 37.53  ? 25   ALA K CB  1 
ATOM   8117  N N   . SER K  1 26  ? 144.726 127.254 106.146 1.00 38.41  ? 26   SER K N   1 
ATOM   8118  C CA  . SER K  1 26  ? 144.464 127.563 107.571 1.00 37.44  ? 26   SER K CA  1 
ATOM   8119  C C   . SER K  1 26  ? 143.065 128.120 107.902 1.00 38.97  ? 26   SER K C   1 
ATOM   8120  O O   . SER K  1 26  ? 142.727 128.327 109.088 1.00 39.90  ? 26   SER K O   1 
ATOM   8121  C CB  . SER K  1 26  ? 145.505 128.570 108.092 1.00 36.75  ? 26   SER K CB  1 
ATOM   8122  O OG  . SER K  1 26  ? 145.418 129.820 107.391 1.00 37.79  ? 26   SER K OG  1 
ATOM   8123  N N   . GLN K  1 27  ? 142.256 128.387 106.880 1.00 38.56  ? 27   GLN K N   1 
ATOM   8124  C CA  . GLN K  1 27  ? 140.846 128.766 107.070 1.00 38.11  ? 27   GLN K CA  1 
ATOM   8125  C C   . GLN K  1 27  ? 140.092 128.495 105.777 1.00 39.54  ? 27   GLN K C   1 
ATOM   8126  O O   . GLN K  1 27  ? 140.686 128.577 104.701 1.00 40.72  ? 27   GLN K O   1 
ATOM   8127  C CB  . GLN K  1 27  ? 140.706 130.238 107.481 1.00 37.19  ? 27   GLN K CB  1 
ATOM   8128  C CG  . GLN K  1 27  ? 141.246 131.238 106.468 1.00 37.31  ? 27   GLN K CG  1 
ATOM   8129  C CD  . GLN K  1 27  ? 141.547 132.583 107.087 1.00 35.05  ? 27   GLN K CD  1 
ATOM   8130  O OE1 . GLN K  1 27  ? 142.492 132.724 107.865 1.00 34.89  ? 27   GLN K OE1 1 
ATOM   8131  N NE2 . GLN K  1 27  ? 140.752 133.587 106.737 1.00 33.49  ? 27   GLN K NE2 1 
ATOM   8132  N N   . SER K  1 28  ? 138.803 128.157 105.867 1.00 40.40  ? 28   SER K N   1 
ATOM   8133  C CA  . SER K  1 28  ? 138.022 127.876 104.659 1.00 41.04  ? 28   SER K CA  1 
ATOM   8134  C C   . SER K  1 28  ? 138.359 128.896 103.566 1.00 41.27  ? 28   SER K C   1 
ATOM   8135  O O   . SER K  1 28  ? 138.139 130.121 103.756 1.00 39.41  ? 28   SER K O   1 
ATOM   8136  C CB  . SER K  1 28  ? 136.520 127.889 104.963 1.00 41.58  ? 28   SER K CB  1 
ATOM   8137  O OG  . SER K  1 28  ? 135.762 127.533 103.816 1.00 42.64  ? 28   SER K OG  1 
ATOM   8138  N N   . ILE K  1 29  ? 138.930 128.415 102.452 1.00 42.36  ? 29   ILE K N   1 
ATOM   8139  C CA  . ILE K  1 29  ? 139.209 129.311 101.319 1.00 42.77  ? 29   ILE K CA  1 
ATOM   8140  C C   . ILE K  1 29  ? 138.253 129.098 100.141 1.00 43.71  ? 29   ILE K C   1 
ATOM   8141  O O   . ILE K  1 29  ? 138.673 129.043 98.978  1.00 43.53  ? 29   ILE K O   1 
ATOM   8142  C CB  . ILE K  1 29  ? 140.728 129.363 100.889 1.00 42.89  ? 29   ILE K CB  1 
ATOM   8143  C CG1 . ILE K  1 29  ? 141.203 128.041 100.244 1.00 39.39  ? 29   ILE K CG1 1 
ATOM   8144  C CG2 . ILE K  1 29  ? 141.613 129.774 102.063 1.00 42.85  ? 29   ILE K CG2 1 
ATOM   8145  C CD1 . ILE K  1 29  ? 142.465 128.194 99.343  1.00 41.57  ? 29   ILE K CD1 1 
ATOM   8146  N N   . SER K  1 30  ? 136.962 129.028 100.473 1.00 44.99  ? 30   SER K N   1 
ATOM   8147  C CA  . SER K  1 30  ? 135.924 128.740 99.503  1.00 45.38  ? 30   SER K CA  1 
ATOM   8148  C C   . SER K  1 30  ? 136.457 127.637 98.624  1.00 46.06  ? 30   SER K C   1 
ATOM   8149  O O   . SER K  1 30  ? 136.377 126.456 98.973  1.00 47.43  ? 30   SER K O   1 
ATOM   8150  C CB  . SER K  1 30  ? 135.621 129.973 98.656  1.00 45.18  ? 30   SER K CB  1 
ATOM   8151  O OG  . SER K  1 30  ? 134.883 129.596 97.499  1.00 43.48  ? 30   SER K OG  1 
ATOM   8152  N N   . SER K  1 31  ? 137.055 128.036 97.504  1.00 45.30  ? 31   SER K N   1 
ATOM   8153  C CA  . SER K  1 31  ? 137.610 127.119 96.523  1.00 45.52  ? 31   SER K CA  1 
ATOM   8154  C C   . SER K  1 31  ? 138.493 127.895 95.538  1.00 46.54  ? 31   SER K C   1 
ATOM   8155  O O   . SER K  1 31  ? 138.468 127.650 94.326  1.00 47.61  ? 31   SER K O   1 
ATOM   8156  C CB  . SER K  1 31  ? 136.470 126.398 95.792  1.00 45.38  ? 31   SER K CB  1 
ATOM   8157  O OG  . SER K  1 31  ? 136.973 125.458 94.856  1.00 45.13  ? 31   SER K OG  1 
ATOM   8158  N N   . TYR K  1 32  ? 139.272 128.832 96.078  1.00 44.65  ? 32   TYR K N   1 
ATOM   8159  C CA  . TYR K  1 32  ? 140.126 129.707 95.282  1.00 42.05  ? 32   TYR K CA  1 
ATOM   8160  C C   . TYR K  1 32  ? 141.569 129.211 95.347  1.00 39.09  ? 32   TYR K C   1 
ATOM   8161  O O   . TYR K  1 32  ? 142.428 129.848 95.966  1.00 38.60  ? 32   TYR K O   1 
ATOM   8162  C CB  . TYR K  1 32  ? 140.056 131.143 95.816  1.00 43.82  ? 32   TYR K CB  1 
ATOM   8163  C CG  . TYR K  1 32  ? 138.863 131.973 95.379  1.00 46.34  ? 32   TYR K CG  1 
ATOM   8164  C CD1 . TYR K  1 32  ? 137.934 132.443 96.310  1.00 49.48  ? 32   TYR K CD1 1 
ATOM   8165  C CD2 . TYR K  1 32  ? 138.684 132.320 94.043  1.00 45.14  ? 32   TYR K CD2 1 
ATOM   8166  C CE1 . TYR K  1 32  ? 136.846 133.221 95.917  1.00 47.09  ? 32   TYR K CE1 1 
ATOM   8167  C CE2 . TYR K  1 32  ? 137.603 133.095 93.641  1.00 46.64  ? 32   TYR K CE2 1 
ATOM   8168  C CZ  . TYR K  1 32  ? 136.688 133.542 94.580  1.00 46.39  ? 32   TYR K CZ  1 
ATOM   8169  O OH  . TYR K  1 32  ? 135.615 134.310 94.182  1.00 47.00  ? 32   TYR K OH  1 
ATOM   8170  N N   . LEU K  1 33  ? 141.832 128.065 94.714  1.00 36.38  ? 33   LEU K N   1 
ATOM   8171  C CA  . LEU K  1 33  ? 143.154 127.425 94.794  1.00 34.71  ? 33   LEU K CA  1 
ATOM   8172  C C   . LEU K  1 33  ? 143.770 127.015 93.457  1.00 34.07  ? 33   LEU K C   1 
ATOM   8173  O O   . LEU K  1 33  ? 143.123 126.383 92.611  1.00 36.47  ? 33   LEU K O   1 
ATOM   8174  C CB  . LEU K  1 33  ? 143.138 126.226 95.752  1.00 32.72  ? 33   LEU K CB  1 
ATOM   8175  C CG  . LEU K  1 33  ? 144.529 125.689 96.129  1.00 33.82  ? 33   LEU K CG  1 
ATOM   8176  C CD1 . LEU K  1 33  ? 144.646 125.444 97.645  1.00 33.46  ? 33   LEU K CD1 1 
ATOM   8177  C CD2 . LEU K  1 33  ? 144.871 124.401 95.384  1.00 30.40  ? 33   LEU K CD2 1 
ATOM   8178  N N   . ASN K  1 34  ? 145.047 127.362 93.313  1.00 33.43  ? 34   ASN K N   1 
ATOM   8179  C CA  . ASN K  1 34  ? 145.835 127.046 92.138  1.00 29.48  ? 34   ASN K CA  1 
ATOM   8180  C C   . ASN K  1 34  ? 146.902 126.022 92.400  1.00 27.07  ? 34   ASN K C   1 
ATOM   8181  O O   . ASN K  1 34  ? 147.335 125.819 93.547  1.00 22.86  ? 34   ASN K O   1 
ATOM   8182  C CB  . ASN K  1 34  ? 146.523 128.307 91.642  1.00 28.04  ? 34   ASN K CB  1 
ATOM   8183  C CG  . ASN K  1 34  ? 145.538 129.359 91.308  1.00 27.14  ? 34   ASN K CG  1 
ATOM   8184  O OD1 . ASN K  1 34  ? 144.776 129.237 90.332  1.00 25.75  ? 34   ASN K OD1 1 
ATOM   8185  N ND2 . ASN K  1 34  ? 145.472 130.402 92.130  1.00 20.80  ? 34   ASN K ND2 1 
ATOM   8186  N N   . TRP K  1 35  ? 147.348 125.396 91.317  1.00 26.10  ? 35   TRP K N   1 
ATOM   8187  C CA  . TRP K  1 35  ? 148.451 124.456 91.350  1.00 28.02  ? 35   TRP K CA  1 
ATOM   8188  C C   . TRP K  1 35  ? 149.492 124.830 90.315  1.00 27.36  ? 35   TRP K C   1 
ATOM   8189  O O   . TRP K  1 35  ? 149.183 124.922 89.129  1.00 30.85  ? 35   TRP K O   1 
ATOM   8190  C CB  . TRP K  1 35  ? 147.946 123.041 91.094  1.00 27.90  ? 35   TRP K CB  1 
ATOM   8191  C CG  . TRP K  1 35  ? 147.283 122.490 92.282  1.00 25.50  ? 35   TRP K CG  1 
ATOM   8192  C CD1 . TRP K  1 35  ? 145.954 122.515 92.560  1.00 27.04  ? 35   TRP K CD1 1 
ATOM   8193  C CD2 . TRP K  1 35  ? 147.919 121.857 93.389  1.00 28.00  ? 35   TRP K CD2 1 
ATOM   8194  N NE1 . TRP K  1 35  ? 145.714 121.917 93.772  1.00 27.87  ? 35   TRP K NE1 1 
ATOM   8195  C CE2 . TRP K  1 35  ? 146.908 121.508 94.305  1.00 29.25  ? 35   TRP K CE2 1 
ATOM   8196  C CE3 . TRP K  1 35  ? 149.249 121.545 93.696  1.00 19.99  ? 35   TRP K CE3 1 
ATOM   8197  C CZ2 . TRP K  1 35  ? 147.179 120.858 95.510  1.00 31.56  ? 35   TRP K CZ2 1 
ATOM   8198  C CZ3 . TRP K  1 35  ? 149.520 120.901 94.891  1.00 25.64  ? 35   TRP K CZ3 1 
ATOM   8199  C CH2 . TRP K  1 35  ? 148.490 120.563 95.783  1.00 27.32  ? 35   TRP K CH2 1 
ATOM   8200  N N   . TYR K  1 36  ? 150.726 125.049 90.756  1.00 29.97  ? 36   TYR K N   1 
ATOM   8201  C CA  . TYR K  1 36  ? 151.804 125.400 89.837  1.00 29.24  ? 36   TYR K CA  1 
ATOM   8202  C C   . TYR K  1 36  ? 152.872 124.315 89.761  1.00 31.76  ? 36   TYR K C   1 
ATOM   8203  O O   . TYR K  1 36  ? 153.220 123.704 90.771  1.00 34.08  ? 36   TYR K O   1 
ATOM   8204  C CB  . TYR K  1 36  ? 152.455 126.718 90.249  1.00 26.66  ? 36   TYR K CB  1 
ATOM   8205  C CG  . TYR K  1 36  ? 151.613 127.946 89.999  1.00 17.76  ? 36   TYR K CG  1 
ATOM   8206  C CD1 . TYR K  1 36  ? 150.800 128.463 91.003  1.00 14.01  ? 36   TYR K CD1 1 
ATOM   8207  C CD2 . TYR K  1 36  ? 151.651 128.609 88.775  1.00 21.77  ? 36   TYR K CD2 1 
ATOM   8208  C CE1 . TYR K  1 36  ? 150.031 129.595 90.798  1.00 8.04   ? 36   TYR K CE1 1 
ATOM   8209  C CE2 . TYR K  1 36  ? 150.884 129.747 88.555  1.00 25.91  ? 36   TYR K CE2 1 
ATOM   8210  C CZ  . TYR K  1 36  ? 150.075 130.231 89.573  1.00 21.01  ? 36   TYR K CZ  1 
ATOM   8211  O OH  . TYR K  1 36  ? 149.304 131.356 89.367  1.00 29.89  ? 36   TYR K OH  1 
ATOM   8212  N N   . GLN K  1 37  ? 153.381 124.088 88.550  1.00 33.45  ? 37   GLN K N   1 
ATOM   8213  C CA  . GLN K  1 37  ? 154.510 123.192 88.296  1.00 34.14  ? 37   GLN K CA  1 
ATOM   8214  C C   . GLN K  1 37  ? 155.659 124.075 87.867  1.00 34.67  ? 37   GLN K C   1 
ATOM   8215  O O   . GLN K  1 37  ? 155.448 125.050 87.142  1.00 37.25  ? 37   GLN K O   1 
ATOM   8216  C CB  . GLN K  1 37  ? 154.168 122.226 87.143  1.00 34.60  ? 37   GLN K CB  1 
ATOM   8217  C CG  . GLN K  1 37  ? 155.317 121.313 86.664  1.00 34.52  ? 37   GLN K CG  1 
ATOM   8218  C CD  . GLN K  1 37  ? 154.949 120.507 85.419  1.00 35.94  ? 37   GLN K CD  1 
ATOM   8219  O OE1 . GLN K  1 37  ? 155.320 120.870 84.294  1.00 41.53  ? 37   GLN K OE1 1 
ATOM   8220  N NE2 . GLN K  1 37  ? 154.206 119.424 85.608  1.00 41.47  ? 37   GLN K NE2 1 
ATOM   8221  N N   . GLN K  1 38  ? 156.871 123.754 88.295  1.00 35.60  ? 38   GLN K N   1 
ATOM   8222  C CA  . GLN K  1 38  ? 158.030 124.410 87.706  1.00 35.22  ? 38   GLN K CA  1 
ATOM   8223  C C   . GLN K  1 38  ? 159.185 123.442 87.552  1.00 35.99  ? 38   GLN K C   1 
ATOM   8224  O O   . GLN K  1 38  ? 159.660 122.851 88.527  1.00 35.39  ? 38   GLN K O   1 
ATOM   8225  C CB  . GLN K  1 38  ? 158.436 125.662 88.478  1.00 33.14  ? 38   GLN K CB  1 
ATOM   8226  C CG  . GLN K  1 38  ? 158.735 125.439 89.936  1.00 31.30  ? 38   GLN K CG  1 
ATOM   8227  C CD  . GLN K  1 38  ? 159.745 126.433 90.455  1.00 37.57  ? 38   GLN K CD  1 
ATOM   8228  O OE1 . GLN K  1 38  ? 160.340 126.215 91.509  1.00 39.95  ? 38   GLN K OE1 1 
ATOM   8229  N NE2 . GLN K  1 38  ? 159.965 127.519 89.715  1.00 31.63  ? 38   GLN K NE2 1 
ATOM   8230  N N   . LYS K  1 39  ? 159.612 123.273 86.306  1.00 36.86  ? 39   LYS K N   1 
ATOM   8231  C CA  . LYS K  1 39  ? 160.651 122.311 85.968  1.00 39.06  ? 39   LYS K CA  1 
ATOM   8232  C C   . LYS K  1 39  ? 162.009 122.829 86.436  1.00 42.29  ? 39   LYS K C   1 
ATOM   8233  O O   . LYS K  1 39  ? 162.271 124.031 86.318  1.00 44.46  ? 39   LYS K O   1 
ATOM   8234  C CB  . LYS K  1 39  ? 160.660 122.039 84.460  1.00 38.54  ? 39   LYS K CB  1 
ATOM   8235  C CG  . LYS K  1 39  ? 159.634 121.007 84.009  1.00 35.19  ? 39   LYS K CG  1 
ATOM   8236  C CD  . LYS K  1 39  ? 159.884 120.594 82.564  1.00 36.83  ? 39   LYS K CD  1 
ATOM   8237  C CE  . LYS K  1 39  ? 159.467 119.151 82.308  1.00 28.89  ? 39   LYS K CE  1 
ATOM   8238  N NZ  . LYS K  1 39  ? 160.363 118.166 82.987  1.00 18.79  ? 39   LYS K NZ  1 
ATOM   8239  N N   . PRO K  1 40  ? 162.875 121.934 86.964  1.00 44.45  ? 40   PRO K N   1 
ATOM   8240  C CA  . PRO K  1 40  ? 164.070 122.518 87.579  1.00 45.92  ? 40   PRO K CA  1 
ATOM   8241  C C   . PRO K  1 40  ? 164.743 123.480 86.598  1.00 47.58  ? 40   PRO K C   1 
ATOM   8242  O O   . PRO K  1 40  ? 165.173 123.054 85.512  1.00 49.40  ? 40   PRO K O   1 
ATOM   8243  C CB  . PRO K  1 40  ? 164.965 121.304 87.851  1.00 46.62  ? 40   PRO K CB  1 
ATOM   8244  C CG  . PRO K  1 40  ? 164.013 120.129 87.922  1.00 44.53  ? 40   PRO K CG  1 
ATOM   8245  C CD  . PRO K  1 40  ? 162.881 120.453 86.995  1.00 45.29  ? 40   PRO K CD  1 
ATOM   8246  N N   . GLY K  1 41  ? 164.793 124.766 86.952  1.00 47.32  ? 41   GLY K N   1 
ATOM   8247  C CA  . GLY K  1 41  ? 165.408 125.781 86.093  1.00 46.25  ? 41   GLY K CA  1 
ATOM   8248  C C   . GLY K  1 41  ? 164.455 126.738 85.392  1.00 45.06  ? 41   GLY K C   1 
ATOM   8249  O O   . GLY K  1 41  ? 164.895 127.721 84.792  1.00 43.95  ? 41   GLY K O   1 
ATOM   8250  N N   . LYS K  1 42  ? 163.155 126.457 85.460  1.00 44.35  ? 42   LYS K N   1 
ATOM   8251  C CA  . LYS K  1 42  ? 162.146 127.317 84.836  1.00 42.11  ? 42   LYS K CA  1 
ATOM   8252  C C   . LYS K  1 42  ? 161.434 128.201 85.873  1.00 41.73  ? 42   LYS K C   1 
ATOM   8253  O O   . LYS K  1 42  ? 161.990 128.474 86.940  1.00 39.58  ? 42   LYS K O   1 
ATOM   8254  C CB  . LYS K  1 42  ? 161.155 126.479 84.012  1.00 42.33  ? 42   LYS K CB  1 
ATOM   8255  C CG  . LYS K  1 42  ? 161.743 125.922 82.709  1.00 39.53  ? 42   LYS K CG  1 
ATOM   8256  C CD  . LYS K  1 42  ? 162.012 127.027 81.688  1.00 37.13  ? 42   LYS K CD  1 
ATOM   8257  C CE  . LYS K  1 42  ? 163.021 126.594 80.632  1.00 39.60  ? 42   LYS K CE  1 
ATOM   8258  N NZ  . LYS K  1 42  ? 162.442 125.633 79.645  1.00 42.45  ? 42   LYS K NZ  1 
ATOM   8259  N N   . ALA K  1 43  ? 160.223 128.663 85.548  1.00 42.64  ? 43   ALA K N   1 
ATOM   8260  C CA  . ALA K  1 43  ? 159.376 129.444 86.474  1.00 43.52  ? 43   ALA K CA  1 
ATOM   8261  C C   . ALA K  1 43  ? 157.966 128.832 86.525  1.00 44.11  ? 43   ALA K C   1 
ATOM   8262  O O   . ALA K  1 43  ? 157.461 128.378 85.492  1.00 45.35  ? 43   ALA K O   1 
ATOM   8263  C CB  . ALA K  1 43  ? 159.298 130.899 86.012  1.00 44.43  ? 43   ALA K CB  1 
ATOM   8264  N N   . PRO K  1 44  ? 157.322 128.817 87.719  1.00 43.70  ? 44   PRO K N   1 
ATOM   8265  C CA  . PRO K  1 44  ? 156.063 128.071 87.905  1.00 43.64  ? 44   PRO K CA  1 
ATOM   8266  C C   . PRO K  1 44  ? 154.933 128.319 86.901  1.00 44.10  ? 44   PRO K C   1 
ATOM   8267  O O   . PRO K  1 44  ? 154.326 129.396 86.865  1.00 45.03  ? 44   PRO K O   1 
ATOM   8268  C CB  . PRO K  1 44  ? 155.632 128.444 89.330  1.00 42.01  ? 44   PRO K CB  1 
ATOM   8269  C CG  . PRO K  1 44  ? 156.929 128.732 90.039  1.00 43.24  ? 44   PRO K CG  1 
ATOM   8270  C CD  . PRO K  1 44  ? 157.746 129.465 88.982  1.00 44.11  ? 44   PRO K CD  1 
ATOM   8271  N N   . LYS K  1 45  ? 154.662 127.289 86.101  1.00 41.99  ? 45   LYS K N   1 
ATOM   8272  C CA  . LYS K  1 45  ? 153.580 127.325 85.137  1.00 41.02  ? 45   LYS K CA  1 
ATOM   8273  C C   . LYS K  1 45  ? 152.286 126.878 85.801  1.00 39.10  ? 45   LYS K C   1 
ATOM   8274  O O   . LYS K  1 45  ? 152.267 125.890 86.544  1.00 38.20  ? 45   LYS K O   1 
ATOM   8275  C CB  . LYS K  1 45  ? 153.896 126.443 83.921  1.00 40.84  ? 45   LYS K CB  1 
ATOM   8276  C CG  . LYS K  1 45  ? 154.969 127.005 82.991  1.00 40.93  ? 45   LYS K CG  1 
ATOM   8277  C CD  . LYS K  1 45  ? 154.818 126.440 81.579  1.00 43.22  ? 45   LYS K CD  1 
ATOM   8278  C CE  . LYS K  1 45  ? 155.946 126.909 80.658  1.00 45.01  ? 45   LYS K CE  1 
ATOM   8279  N NZ  . LYS K  1 45  ? 157.283 126.334 81.053  1.00 44.78  ? 45   LYS K NZ  1 
ATOM   8280  N N   . LEU K  1 46  ? 151.208 127.625 85.527  1.00 38.61  ? 46   LEU K N   1 
ATOM   8281  C CA  . LEU K  1 46  ? 149.887 127.263 86.064  1.00 38.21  ? 46   LEU K CA  1 
ATOM   8282  C C   . LEU K  1 46  ? 149.339 125.969 85.475  1.00 38.77  ? 46   LEU K C   1 
ATOM   8283  O O   . LEU K  1 46  ? 149.084 125.881 84.268  1.00 40.17  ? 46   LEU K O   1 
ATOM   8284  C CB  . LEU K  1 46  ? 148.871 128.397 85.868  1.00 38.26  ? 46   LEU K CB  1 
ATOM   8285  C CG  . LEU K  1 46  ? 147.634 128.332 86.775  1.00 38.30  ? 46   LEU K CG  1 
ATOM   8286  C CD1 . LEU K  1 46  ? 147.952 127.652 88.148  1.00 36.34  ? 46   LEU K CD1 1 
ATOM   8287  C CD2 . LEU K  1 46  ? 147.149 129.778 86.967  1.00 30.33  ? 46   LEU K CD2 1 
ATOM   8288  N N   . LEU K  1 47  ? 149.166 124.977 86.349  1.00 38.88  ? 47   LEU K N   1 
ATOM   8289  C CA  . LEU K  1 47  ? 148.542 123.711 85.976  1.00 37.84  ? 47   LEU K CA  1 
ATOM   8290  C C   . LEU K  1 47  ? 147.020 123.770 86.029  1.00 39.50  ? 47   LEU K C   1 
ATOM   8291  O O   . LEU K  1 47  ? 146.347 123.232 85.134  1.00 41.73  ? 47   LEU K O   1 
ATOM   8292  C CB  . LEU K  1 47  ? 149.001 122.588 86.911  1.00 37.25  ? 47   LEU K CB  1 
ATOM   8293  C CG  . LEU K  1 47  ? 150.483 122.257 87.060  1.00 29.13  ? 47   LEU K CG  1 
ATOM   8294  C CD1 . LEU K  1 47  ? 150.714 121.530 88.374  1.00 25.69  ? 47   LEU K CD1 1 
ATOM   8295  C CD2 . LEU K  1 47  ? 150.972 121.426 85.881  1.00 17.10  ? 47   LEU K CD2 1 
ATOM   8296  N N   . ILE K  1 48  ? 146.477 124.411 87.069  1.00 38.88  ? 48   ILE K N   1 
ATOM   8297  C CA  . ILE K  1 48  ? 145.084 124.167 87.426  1.00 38.76  ? 48   ILE K CA  1 
ATOM   8298  C C   . ILE K  1 48  ? 144.439 125.339 88.133  1.00 40.43  ? 48   ILE K C   1 
ATOM   8299  O O   . ILE K  1 48  ? 145.112 126.246 88.641  1.00 41.74  ? 48   ILE K O   1 
ATOM   8300  C CB  . ILE K  1 48  ? 144.949 122.890 88.300  1.00 37.94  ? 48   ILE K CB  1 
ATOM   8301  C CG1 . ILE K  1 48  ? 145.115 121.630 87.437  1.00 28.30  ? 48   ILE K CG1 1 
ATOM   8302  C CG2 . ILE K  1 48  ? 143.598 122.826 89.021  1.00 40.02  ? 48   ILE K CG2 1 
ATOM   8303  C CD1 . ILE K  1 48  ? 145.120 120.338 88.262  1.00 2.24   ? 48   ILE K CD1 1 
ATOM   8304  N N   . TYR K  1 49  ? 143.118 125.255 88.234  1.00 44.24  ? 49   TYR K N   1 
ATOM   8305  C CA  . TYR K  1 49  ? 142.289 126.425 88.223  1.00 48.31  ? 49   TYR K CA  1 
ATOM   8306  C C   . TYR K  1 49  ? 141.007 126.303 89.022  1.00 47.99  ? 49   TYR K C   1 
ATOM   8307  O O   . TYR K  1 49  ? 140.219 125.388 88.794  1.00 48.21  ? 49   TYR K O   1 
ATOM   8308  C CB  . TYR K  1 49  ? 141.982 126.747 86.758  1.00 51.86  ? 49   TYR K CB  1 
ATOM   8309  C CG  . TYR K  1 49  ? 142.659 128.000 86.377  1.00 55.72  ? 49   TYR K CG  1 
ATOM   8310  C CD1 . TYR K  1 49  ? 142.160 128.825 85.378  1.00 59.31  ? 49   TYR K CD1 1 
ATOM   8311  C CD2 . TYR K  1 49  ? 143.754 128.425 87.103  1.00 59.45  ? 49   TYR K CD2 1 
ATOM   8312  C CE1 . TYR K  1 49  ? 142.789 130.016 85.083  1.00 61.96  ? 49   TYR K CE1 1 
ATOM   8313  C CE2 . TYR K  1 49  ? 144.367 129.584 86.831  1.00 62.52  ? 49   TYR K CE2 1 
ATOM   8314  C CZ  . TYR K  1 49  ? 143.901 130.373 85.827  1.00 61.22  ? 49   TYR K CZ  1 
ATOM   8315  O OH  . TYR K  1 49  ? 144.589 131.525 85.617  1.00 61.50  ? 49   TYR K OH  1 
ATOM   8316  N N   . ALA K  1 50  ? 140.802 127.230 89.958  1.00 47.16  ? 50   ALA K N   1 
ATOM   8317  C CA  . ALA K  1 50  ? 139.634 127.206 90.849  1.00 46.96  ? 50   ALA K CA  1 
ATOM   8318  C C   . ALA K  1 50  ? 139.391 125.828 91.502  1.00 47.99  ? 50   ALA K C   1 
ATOM   8319  O O   . ALA K  1 50  ? 138.283 125.531 91.966  1.00 46.19  ? 50   ALA K O   1 
ATOM   8320  C CB  . ALA K  1 50  ? 138.385 127.718 90.121  1.00 46.30  ? 50   ALA K CB  1 
ATOM   8321  N N   . ALA K  1 51  ? 140.444 124.999 91.480  1.00 48.22  ? 51   ALA K N   1 
ATOM   8322  C CA  . ALA K  1 51  ? 140.615 123.802 92.334  1.00 46.86  ? 51   ALA K CA  1 
ATOM   8323  C C   . ALA K  1 51  ? 140.264 122.472 91.668  1.00 46.39  ? 51   ALA K C   1 
ATOM   8324  O O   . ALA K  1 51  ? 140.015 121.476 92.353  1.00 46.89  ? 51   ALA K O   1 
ATOM   8325  C CB  . ALA K  1 51  ? 139.882 123.959 93.681  1.00 46.59  ? 51   ALA K CB  1 
ATOM   8326  N N   . SER K  1 52  ? 140.285 122.454 90.337  1.00 45.54  ? 52   SER K N   1 
ATOM   8327  C CA  . SER K  1 52  ? 139.752 121.337 89.569  1.00 44.12  ? 52   SER K CA  1 
ATOM   8328  C C   . SER K  1 52  ? 139.797 121.671 88.092  1.00 43.12  ? 52   SER K C   1 
ATOM   8329  O O   . SER K  1 52  ? 140.500 121.017 87.316  1.00 40.81  ? 52   SER K O   1 
ATOM   8330  C CB  . SER K  1 52  ? 138.293 121.084 89.973  1.00 42.97  ? 52   SER K CB  1 
ATOM   8331  O OG  . SER K  1 52  ? 137.547 122.344 89.966  1.00 42.85  ? 52   SER K OG  1 
ATOM   8332  N N   . SER K  1 53  ? 139.004 122.680 87.721  1.00 44.08  ? 53   SER K N   1 
ATOM   8333  C CA  . SER K  1 53  ? 139.036 123.298 86.400  1.00 45.20  ? 53   SER K CA  1 
ATOM   8334  C C   . SER K  1 53  ? 140.447 123.263 85.832  1.00 45.84  ? 53   SER K C   1 
ATOM   8335  O O   . SER K  1 53  ? 141.324 124.023 86.251  1.00 44.85  ? 53   SER K O   1 
ATOM   8336  C CB  . SER K  1 53  ? 138.500 124.735 86.468  1.00 45.30  ? 53   SER K CB  1 
ATOM   8337  O OG  . SER K  1 53  ? 138.709 125.439 85.256  1.00 44.18  ? 53   SER K OG  1 
ATOM   8338  N N   . LEU K  1 54  ? 140.649 122.336 84.898  1.00 45.58  ? 54   LEU K N   1 
ATOM   8339  C CA  . LEU K  1 54  ? 141.936 122.090 84.255  1.00 46.06  ? 54   LEU K CA  1 
ATOM   8340  C C   . LEU K  1 54  ? 142.478 123.319 83.557  1.00 47.00  ? 54   LEU K C   1 
ATOM   8341  O O   . LEU K  1 54  ? 141.967 124.429 83.738  1.00 48.09  ? 54   LEU K O   1 
ATOM   8342  C CB  . LEU K  1 54  ? 141.804 120.949 83.240  1.00 45.58  ? 54   LEU K CB  1 
ATOM   8343  C CG  . LEU K  1 54  ? 142.236 119.559 83.712  1.00 44.38  ? 54   LEU K CG  1 
ATOM   8344  C CD1 . LEU K  1 54  ? 141.793 118.477 82.722  1.00 37.75  ? 54   LEU K CD1 1 
ATOM   8345  C CD2 . LEU K  1 54  ? 143.740 119.492 83.957  1.00 45.20  ? 54   LEU K CD2 1 
ATOM   8346  N N   . GLN K  1 55  ? 143.512 123.127 82.749  1.00 47.50  ? 55   GLN K N   1 
ATOM   8347  C CA  . GLN K  1 55  ? 144.013 124.234 81.967  1.00 48.96  ? 55   GLN K CA  1 
ATOM   8348  C C   . GLN K  1 55  ? 144.453 123.847 80.576  1.00 49.38  ? 55   GLN K C   1 
ATOM   8349  O O   . GLN K  1 55  ? 144.994 122.763 80.347  1.00 49.97  ? 55   GLN K O   1 
ATOM   8350  C CB  . GLN K  1 55  ? 145.126 124.976 82.702  1.00 49.29  ? 55   GLN K CB  1 
ATOM   8351  C CG  . GLN K  1 55  ? 145.256 126.435 82.296  1.00 50.40  ? 55   GLN K CG  1 
ATOM   8352  C CD  . GLN K  1 55  ? 144.122 127.303 82.827  1.00 52.60  ? 55   GLN K CD  1 
ATOM   8353  O OE1 . GLN K  1 55  ? 143.104 126.813 83.316  1.00 53.26  ? 55   GLN K OE1 1 
ATOM   8354  N NE2 . GLN K  1 55  ? 144.301 128.615 82.727  1.00 45.22  ? 55   GLN K NE2 1 
ATOM   8355  N N   . SER K  1 56  ? 144.201 124.761 79.646  1.00 49.81  ? 56   SER K N   1 
ATOM   8356  C CA  . SER K  1 56  ? 144.606 124.578 78.267  1.00 49.34  ? 56   SER K CA  1 
ATOM   8357  C C   . SER K  1 56  ? 146.095 124.252 78.229  1.00 49.31  ? 56   SER K C   1 
ATOM   8358  O O   . SER K  1 56  ? 146.890 124.808 78.999  1.00 49.86  ? 56   SER K O   1 
ATOM   8359  C CB  . SER K  1 56  ? 144.282 125.828 77.442  1.00 48.94  ? 56   SER K CB  1 
ATOM   8360  O OG  . SER K  1 56  ? 142.872 126.059 77.395  1.00 48.19  ? 56   SER K OG  1 
ATOM   8361  N N   . GLY K  1 57  ? 146.459 123.324 77.350  1.00 48.47  ? 57   GLY K N   1 
ATOM   8362  C CA  . GLY K  1 57  ? 147.832 122.842 77.254  1.00 47.57  ? 57   GLY K CA  1 
ATOM   8363  C C   . GLY K  1 57  ? 148.093 121.677 78.190  1.00 47.23  ? 57   GLY K C   1 
ATOM   8364  O O   . GLY K  1 57  ? 148.685 120.672 77.785  1.00 47.03  ? 57   GLY K O   1 
ATOM   8365  N N   . VAL K  1 58  ? 147.640 121.813 79.439  1.00 47.94  ? 58   VAL K N   1 
ATOM   8366  C CA  . VAL K  1 58  ? 147.893 120.820 80.488  1.00 46.66  ? 58   VAL K CA  1 
ATOM   8367  C C   . VAL K  1 58  ? 147.074 119.546 80.252  1.00 45.20  ? 58   VAL K C   1 
ATOM   8368  O O   . VAL K  1 58  ? 145.844 119.604 80.126  1.00 43.66  ? 58   VAL K O   1 
ATOM   8369  C CB  . VAL K  1 58  ? 147.698 121.412 81.933  1.00 46.83  ? 58   VAL K CB  1 
ATOM   8370  C CG1 . VAL K  1 58  ? 146.306 121.140 82.484  1.00 49.82  ? 58   VAL K CG1 1 
ATOM   8371  C CG2 . VAL K  1 58  ? 148.745 120.855 82.889  1.00 46.18  ? 58   VAL K CG2 1 
ATOM   8372  N N   . PRO K  1 59  ? 147.776 118.400 80.126  1.00 45.50  ? 59   PRO K N   1 
ATOM   8373  C CA  . PRO K  1 59  ? 147.282 117.030 80.019  1.00 44.85  ? 59   PRO K CA  1 
ATOM   8374  C C   . PRO K  1 59  ? 146.118 116.711 80.949  1.00 44.30  ? 59   PRO K C   1 
ATOM   8375  O O   . PRO K  1 59  ? 145.915 117.392 81.958  1.00 42.78  ? 59   PRO K O   1 
ATOM   8376  C CB  . PRO K  1 59  ? 148.501 116.206 80.429  1.00 44.18  ? 59   PRO K CB  1 
ATOM   8377  C CG  . PRO K  1 59  ? 149.636 116.989 79.902  1.00 45.67  ? 59   PRO K CG  1 
ATOM   8378  C CD  . PRO K  1 59  ? 149.248 118.437 80.031  1.00 45.12  ? 59   PRO K CD  1 
ATOM   8379  N N   . SER K  1 60  ? 145.379 115.660 80.611  1.00 44.34  ? 60   SER K N   1 
ATOM   8380  C CA  . SER K  1 60  ? 144.137 115.323 81.299  1.00 43.16  ? 60   SER K CA  1 
ATOM   8381  C C   . SER K  1 60  ? 144.312 114.574 82.625  1.00 42.24  ? 60   SER K C   1 
ATOM   8382  O O   . SER K  1 60  ? 143.343 114.426 83.378  1.00 40.86  ? 60   SER K O   1 
ATOM   8383  C CB  . SER K  1 60  ? 143.211 114.544 80.357  1.00 42.30  ? 60   SER K CB  1 
ATOM   8384  O OG  . SER K  1 60  ? 143.917 113.503 79.698  1.00 48.35  ? 60   SER K OG  1 
ATOM   8385  N N   . ARG K  1 61  ? 145.525 114.107 82.919  1.00 41.47  ? 61   ARG K N   1 
ATOM   8386  C CA  . ARG K  1 61  ? 145.774 113.442 84.204  1.00 42.03  ? 61   ARG K CA  1 
ATOM   8387  C C   . ARG K  1 61  ? 145.748 114.438 85.356  1.00 42.13  ? 61   ARG K C   1 
ATOM   8388  O O   . ARG K  1 61  ? 144.741 114.504 86.064  1.00 42.23  ? 61   ARG K O   1 
ATOM   8389  C CB  . ARG K  1 61  ? 147.058 112.599 84.201  1.00 42.43  ? 61   ARG K CB  1 
ATOM   8390  C CG  . ARG K  1 61  ? 148.291 113.295 83.712  1.00 43.25  ? 61   ARG K CG  1 
ATOM   8391  C CD  . ARG K  1 61  ? 148.481 113.069 82.234  1.00 46.85  ? 61   ARG K CD  1 
ATOM   8392  N NE  . ARG K  1 61  ? 149.639 113.813 81.768  1.00 49.05  ? 61   ARG K NE  1 
ATOM   8393  C CZ  . ARG K  1 61  ? 150.895 113.419 81.938  1.00 47.54  ? 61   ARG K CZ  1 
ATOM   8394  N NH1 . ARG K  1 61  ? 151.167 112.270 82.554  1.00 43.78  ? 61   ARG K NH1 1 
ATOM   8395  N NH2 . ARG K  1 61  ? 151.890 114.168 81.484  1.00 40.41  ? 61   ARG K NH2 1 
ATOM   8396  N N   . PHE K  1 62  ? 146.845 115.190 85.532  1.00 40.82  ? 62   PHE K N   1 
ATOM   8397  C CA  . PHE K  1 62  ? 146.863 116.355 86.427  1.00 40.43  ? 62   PHE K CA  1 
ATOM   8398  C C   . PHE K  1 62  ? 145.433 116.748 86.826  1.00 38.90  ? 62   PHE K C   1 
ATOM   8399  O O   . PHE K  1 62  ? 144.760 117.553 86.157  1.00 39.77  ? 62   PHE K O   1 
ATOM   8400  C CB  . PHE K  1 62  ? 147.617 117.528 85.768  1.00 39.87  ? 62   PHE K CB  1 
ATOM   8401  C CG  . PHE K  1 62  ? 149.115 117.312 85.653  1.00 41.21  ? 62   PHE K CG  1 
ATOM   8402  C CD1 . PHE K  1 62  ? 149.714 117.069 84.415  1.00 42.24  ? 62   PHE K CD1 1 
ATOM   8403  C CD2 . PHE K  1 62  ? 149.926 117.360 86.785  1.00 41.83  ? 62   PHE K CD2 1 
ATOM   8404  C CE1 . PHE K  1 62  ? 151.100 116.867 84.315  1.00 41.04  ? 62   PHE K CE1 1 
ATOM   8405  C CE2 . PHE K  1 62  ? 151.306 117.163 86.690  1.00 40.79  ? 62   PHE K CE2 1 
ATOM   8406  C CZ  . PHE K  1 62  ? 151.893 116.920 85.453  1.00 40.64  ? 62   PHE K CZ  1 
ATOM   8407  N N   . SER K  1 63  ? 144.960 116.092 87.887  1.00 35.73  ? 63   SER K N   1 
ATOM   8408  C CA  . SER K  1 63  ? 143.665 116.369 88.510  1.00 34.92  ? 63   SER K CA  1 
ATOM   8409  C C   . SER K  1 63  ? 143.840 116.799 89.962  1.00 33.72  ? 63   SER K C   1 
ATOM   8410  O O   . SER K  1 63  ? 144.588 116.201 90.732  1.00 31.79  ? 63   SER K O   1 
ATOM   8411  C CB  . SER K  1 63  ? 142.738 115.152 88.423  1.00 34.91  ? 63   SER K CB  1 
ATOM   8412  O OG  . SER K  1 63  ? 143.413 113.925 88.962  1.00 33.91  ? 63   SER K OG  1 
ATOM   8413  N N   . GLY K  1 64  ? 143.115 117.859 90.301  1.00 32.54  ? 64   GLY K N   1 
ATOM   8414  C CA  . GLY K  1 64  ? 143.175 118.488 91.601  1.00 32.23  ? 64   GLY K CA  1 
ATOM   8415  C C   . GLY K  1 64  ? 141.721 118.710 91.970  1.00 33.20  ? 64   GLY K C   1 
ATOM   8416  O O   . GLY K  1 64  ? 140.870 118.934 91.095  1.00 34.32  ? 64   GLY K O   1 
ATOM   8417  N N   . SER K  1 65  ? 141.448 118.654 93.279  1.00 33.97  ? 65   SER K N   1 
ATOM   8418  C CA  . SER K  1 65  ? 140.086 118.576 93.805  1.00 33.51  ? 65   SER K CA  1 
ATOM   8419  C C   . SER K  1 65  ? 140.149 119.134 95.230  1.00 32.28  ? 65   SER K C   1 
ATOM   8420  O O   . SER K  1 65  ? 141.243 119.222 95.818  1.00 30.57  ? 65   SER K O   1 
ATOM   8421  C CB  . SER K  1 65  ? 139.643 117.112 93.882  1.00 33.37  ? 65   SER K CB  1 
ATOM   8422  O OG  . SER K  1 65  ? 140.274 116.459 95.008  1.00 35.67  ? 65   SER K OG  1 
ATOM   8423  N N   . GLY K  1 66  ? 138.979 119.467 95.802  1.00 30.52  ? 66   GLY K N   1 
ATOM   8424  C CA  . GLY K  1 66  ? 138.975 120.209 97.091  1.00 32.56  ? 66   GLY K CA  1 
ATOM   8425  C C   . GLY K  1 66  ? 138.007 121.383 97.132  1.00 33.47  ? 66   GLY K C   1 
ATOM   8426  O O   . GLY K  1 66  ? 137.724 122.014 96.109  1.00 34.23  ? 66   GLY K O   1 
ATOM   8427  N N   . SER K  1 67  ? 137.501 121.651 98.338  1.00 34.13  ? 67   SER K N   1 
ATOM   8428  C CA  . SER K  1 67  ? 136.643 122.805 98.646  1.00 34.52  ? 67   SER K CA  1 
ATOM   8429  C C   . SER K  1 67  ? 136.703 123.163 100.140 1.00 35.00  ? 67   SER K C   1 
ATOM   8430  O O   . SER K  1 67  ? 136.288 122.371 100.997 1.00 32.17  ? 67   SER K O   1 
ATOM   8431  C CB  . SER K  1 67  ? 135.181 122.549 98.223  1.00 36.44  ? 67   SER K CB  1 
ATOM   8432  O OG  . SER K  1 67  ? 134.348 123.656 98.534  1.00 34.33  ? 67   SER K OG  1 
ATOM   8433  N N   . GLY K  1 68  ? 137.237 124.350 100.429 1.00 36.33  ? 68   GLY K N   1 
ATOM   8434  C CA  . GLY K  1 68  ? 137.183 124.894 101.787 1.00 36.44  ? 68   GLY K CA  1 
ATOM   8435  C C   . GLY K  1 68  ? 138.519 124.709 102.466 1.00 37.93  ? 68   GLY K C   1 
ATOM   8436  O O   . GLY K  1 68  ? 139.461 125.493 102.243 1.00 37.63  ? 68   GLY K O   1 
ATOM   8437  N N   . THR K  1 69  ? 138.625 123.666 103.276 1.00 38.98  ? 69   THR K N   1 
ATOM   8438  C CA  . THR K  1 69  ? 139.813 123.571 104.088 1.00 39.64  ? 69   THR K CA  1 
ATOM   8439  C C   . THR K  1 69  ? 140.940 122.724 103.495 1.00 40.28  ? 69   THR K C   1 
ATOM   8440  O O   . THR K  1 69  ? 142.104 122.876 103.888 1.00 41.93  ? 69   THR K O   1 
ATOM   8441  C CB  . THR K  1 69  ? 139.500 123.137 105.530 1.00 37.59  ? 69   THR K CB  1 
ATOM   8442  O OG1 . THR K  1 69  ? 140.727 123.090 106.288 1.00 37.44  ? 69   THR K OG1 1 
ATOM   8443  C CG2 . THR K  1 69  ? 138.829 121.762 105.558 1.00 39.43  ? 69   THR K CG2 1 
ATOM   8444  N N   . ASP K  1 70  ? 140.609 121.860 102.540 1.00 39.51  ? 70   ASP K N   1 
ATOM   8445  C CA  . ASP K  1 70  ? 141.493 120.761 102.172 1.00 39.50  ? 70   ASP K CA  1 
ATOM   8446  C C   . ASP K  1 70  ? 141.612 120.531 100.665 1.00 39.13  ? 70   ASP K C   1 
ATOM   8447  O O   . ASP K  1 70  ? 140.600 120.414 99.967  1.00 40.27  ? 70   ASP K O   1 
ATOM   8448  C CB  . ASP K  1 70  ? 140.981 119.486 102.836 1.00 40.24  ? 70   ASP K CB  1 
ATOM   8449  C CG  . ASP K  1 70  ? 142.012 118.382 102.857 1.00 38.86  ? 70   ASP K CG  1 
ATOM   8450  O OD1 . ASP K  1 70  ? 142.691 118.145 101.826 1.00 31.02  ? 70   ASP K OD1 1 
ATOM   8451  O OD2 . ASP K  1 70  ? 142.146 117.727 103.912 1.00 36.96  ? 70   ASP K OD2 1 
ATOM   8452  N N   . PHE K  1 71  ? 142.847 120.441 100.168 1.00 38.11  ? 71   PHE K N   1 
ATOM   8453  C CA  . PHE K  1 71  ? 143.085 120.320 98.724  1.00 36.59  ? 71   PHE K CA  1 
ATOM   8454  C C   . PHE K  1 71  ? 144.171 119.304 98.326  1.00 37.61  ? 71   PHE K C   1 
ATOM   8455  O O   . PHE K  1 71  ? 145.177 119.133 99.020  1.00 38.26  ? 71   PHE K O   1 
ATOM   8456  C CB  . PHE K  1 71  ? 143.392 121.693 98.100  1.00 34.18  ? 71   PHE K CB  1 
ATOM   8457  C CG  . PHE K  1 71  ? 142.339 122.758 98.362  1.00 34.76  ? 71   PHE K CG  1 
ATOM   8458  C CD1 . PHE K  1 71  ? 142.340 123.483 99.554  1.00 20.41  ? 71   PHE K CD1 1 
ATOM   8459  C CD2 . PHE K  1 71  ? 141.381 123.070 97.395  1.00 35.12  ? 71   PHE K CD2 1 
ATOM   8460  C CE1 . PHE K  1 71  ? 141.387 124.477 99.794  1.00 19.66  ? 71   PHE K CE1 1 
ATOM   8461  C CE2 . PHE K  1 71  ? 140.421 124.068 97.625  1.00 28.78  ? 71   PHE K CE2 1 
ATOM   8462  C CZ  . PHE K  1 71  ? 140.425 124.774 98.826  1.00 19.53  ? 71   PHE K CZ  1 
ATOM   8463  N N   . THR K  1 72  ? 143.943 118.642 97.195  1.00 36.99  ? 72   THR K N   1 
ATOM   8464  C CA  . THR K  1 72  ? 144.824 117.584 96.728  1.00 36.99  ? 72   THR K CA  1 
ATOM   8465  C C   . THR K  1 72  ? 145.018 117.674 95.227  1.00 36.62  ? 72   THR K C   1 
ATOM   8466  O O   . THR K  1 72  ? 144.063 117.895 94.477  1.00 35.52  ? 72   THR K O   1 
ATOM   8467  C CB  . THR K  1 72  ? 144.262 116.181 97.052  1.00 35.98  ? 72   THR K CB  1 
ATOM   8468  O OG1 . THR K  1 72  ? 142.988 116.012 96.412  1.00 39.87  ? 72   THR K OG1 1 
ATOM   8469  C CG2 . THR K  1 72  ? 144.118 115.961 98.559  1.00 37.32  ? 72   THR K CG2 1 
ATOM   8470  N N   . LEU K  1 73  ? 146.266 117.517 94.801  1.00 36.29  ? 73   LEU K N   1 
ATOM   8471  C CA  . LEU K  1 73  ? 146.552 117.366 93.394  1.00 37.20  ? 73   LEU K CA  1 
ATOM   8472  C C   . LEU K  1 73  ? 146.902 115.915 93.191  1.00 37.85  ? 73   LEU K C   1 
ATOM   8473  O O   . LEU K  1 73  ? 147.868 115.412 93.770  1.00 39.78  ? 73   LEU K O   1 
ATOM   8474  C CB  . LEU K  1 73  ? 147.737 118.241 92.994  1.00 35.52  ? 73   LEU K CB  1 
ATOM   8475  C CG  . LEU K  1 73  ? 148.184 118.099 91.532  1.00 30.89  ? 73   LEU K CG  1 
ATOM   8476  C CD1 . LEU K  1 73  ? 147.537 119.169 90.672  1.00 11.43  ? 73   LEU K CD1 1 
ATOM   8477  C CD2 . LEU K  1 73  ? 149.718 118.212 91.457  1.00 31.62  ? 73   LEU K CD2 1 
ATOM   8478  N N   . THR K  1 74  ? 146.110 115.230 92.388  1.00 38.76  ? 74   THR K N   1 
ATOM   8479  C CA  . THR K  1 74  ? 146.434 113.868 92.057  1.00 37.32  ? 74   THR K CA  1 
ATOM   8480  C C   . THR K  1 74  ? 147.098 113.886 90.690  1.00 38.16  ? 74   THR K C   1 
ATOM   8481  O O   . THR K  1 74  ? 146.574 114.492 89.752  1.00 36.22  ? 74   THR K O   1 
ATOM   8482  C CB  . THR K  1 74  ? 145.172 112.989 92.031  1.00 37.40  ? 74   THR K CB  1 
ATOM   8483  O OG1 . THR K  1 74  ? 144.172 113.551 92.897  1.00 28.65  ? 74   THR K OG1 1 
ATOM   8484  C CG2 . THR K  1 74  ? 145.499 111.572 92.485  1.00 37.06  ? 74   THR K CG2 1 
ATOM   8485  N N   . ILE K  1 75  ? 148.266 113.257 90.570  1.00 38.60  ? 75   ILE K N   1 
ATOM   8486  C CA  . ILE K  1 75  ? 148.737 112.926 89.229  1.00 39.86  ? 75   ILE K CA  1 
ATOM   8487  C C   . ILE K  1 75  ? 148.396 111.472 88.955  1.00 39.88  ? 75   ILE K C   1 
ATOM   8488  O O   . ILE K  1 75  ? 149.099 110.559 89.428  1.00 40.31  ? 75   ILE K O   1 
ATOM   8489  C CB  . ILE K  1 75  ? 150.253 113.159 88.981  1.00 39.24  ? 75   ILE K CB  1 
ATOM   8490  C CG1 . ILE K  1 75  ? 150.803 114.294 89.862  1.00 39.46  ? 75   ILE K CG1 1 
ATOM   8491  C CG2 . ILE K  1 75  ? 150.509 113.404 87.480  1.00 37.76  ? 75   ILE K CG2 1 
ATOM   8492  C CD1 . ILE K  1 75  ? 152.323 114.493 89.756  1.00 36.99  ? 75   ILE K CD1 1 
ATOM   8493  N N   . SER K  1 76  ? 147.306 111.266 88.206  1.00 39.63  ? 76   SER K N   1 
ATOM   8494  C CA  . SER K  1 76  ? 146.937 109.920 87.772  1.00 41.45  ? 76   SER K CA  1 
ATOM   8495  C C   . SER K  1 76  ? 148.089 109.185 87.082  1.00 39.92  ? 76   SER K C   1 
ATOM   8496  O O   . SER K  1 76  ? 148.297 108.001 87.355  1.00 39.05  ? 76   SER K O   1 
ATOM   8497  C CB  . SER K  1 76  ? 145.685 109.931 86.883  1.00 43.20  ? 76   SER K CB  1 
ATOM   8498  O OG  . SER K  1 76  ? 145.998 110.306 85.544  1.00 49.83  ? 76   SER K OG  1 
ATOM   8499  N N   . SER K  1 77  ? 148.850 109.851 86.213  1.00 40.62  ? 77   SER K N   1 
ATOM   8500  C CA  . SER K  1 77  ? 149.877 109.099 85.479  1.00 42.47  ? 77   SER K CA  1 
ATOM   8501  C C   . SER K  1 77  ? 151.230 109.780 85.284  1.00 43.27  ? 77   SER K C   1 
ATOM   8502  O O   . SER K  1 77  ? 151.338 110.854 84.664  1.00 43.18  ? 77   SER K O   1 
ATOM   8503  C CB  . SER K  1 77  ? 149.337 108.600 84.135  1.00 42.86  ? 77   SER K CB  1 
ATOM   8504  O OG  . SER K  1 77  ? 150.199 107.613 83.580  1.00 37.80  ? 77   SER K OG  1 
ATOM   8505  N N   . LEU K  1 78  ? 152.267 109.110 85.774  1.00 44.75  ? 78   LEU K N   1 
ATOM   8506  C CA  . LEU K  1 78  ? 153.593 109.691 85.837  1.00 44.50  ? 78   LEU K CA  1 
ATOM   8507  C C   . LEU K  1 78  ? 154.424 109.437 84.587  1.00 45.77  ? 78   LEU K C   1 
ATOM   8508  O O   . LEU K  1 78  ? 154.966 108.346 84.394  1.00 45.00  ? 78   LEU K O   1 
ATOM   8509  C CB  . LEU K  1 78  ? 154.330 109.187 87.081  1.00 44.77  ? 78   LEU K CB  1 
ATOM   8510  C CG  . LEU K  1 78  ? 155.152 110.232 87.837  1.00 45.51  ? 78   LEU K CG  1 
ATOM   8511  C CD1 . LEU K  1 78  ? 154.249 111.275 88.512  1.00 43.34  ? 78   LEU K CD1 1 
ATOM   8512  C CD2 . LEU K  1 78  ? 156.045 109.555 88.869  1.00 44.43  ? 78   LEU K CD2 1 
ATOM   8513  N N   . GLN K  1 79  ? 154.513 110.451 83.739  1.00 47.58  ? 79   GLN K N   1 
ATOM   8514  C CA  . GLN K  1 79  ? 155.524 110.463 82.700  1.00 47.91  ? 79   GLN K CA  1 
ATOM   8515  C C   . GLN K  1 79  ? 156.760 111.167 83.282  1.00 48.72  ? 79   GLN K C   1 
ATOM   8516  O O   . GLN K  1 79  ? 156.656 111.803 84.367  1.00 48.62  ? 79   GLN K O   1 
ATOM   8517  C CB  . GLN K  1 79  ? 154.969 111.139 81.451  1.00 48.10  ? 79   GLN K CB  1 
ATOM   8518  C CG  . GLN K  1 79  ? 153.965 110.256 80.705  1.00 48.75  ? 79   GLN K CG  1 
ATOM   8519  C CD  . GLN K  1 79  ? 154.427 108.805 80.578  1.00 48.42  ? 79   GLN K CD  1 
ATOM   8520  O OE1 . GLN K  1 79  ? 153.610 107.883 80.532  1.00 45.12  ? 79   GLN K OE1 1 
ATOM   8521  N NE2 . GLN K  1 79  ? 155.738 108.599 80.527  1.00 40.59  ? 79   GLN K NE2 1 
ATOM   8522  N N   . PRO K  1 80  ? 157.937 111.061 82.623  1.00 49.56  ? 80   PRO K N   1 
ATOM   8523  C CA  . PRO K  1 80  ? 159.020 111.736 83.333  1.00 50.07  ? 80   PRO K CA  1 
ATOM   8524  C C   . PRO K  1 80  ? 159.173 113.220 82.976  1.00 50.07  ? 80   PRO K C   1 
ATOM   8525  O O   . PRO K  1 80  ? 159.966 113.919 83.615  1.00 49.68  ? 80   PRO K O   1 
ATOM   8526  C CB  . PRO K  1 80  ? 160.258 110.935 82.921  1.00 50.25  ? 80   PRO K CB  1 
ATOM   8527  C CG  . PRO K  1 80  ? 159.943 110.470 81.517  1.00 50.39  ? 80   PRO K CG  1 
ATOM   8528  C CD  . PRO K  1 80  ? 158.424 110.405 81.387  1.00 50.12  ? 80   PRO K CD  1 
ATOM   8529  N N   . GLU K  1 81  ? 158.424 113.685 81.964  1.00 49.46  ? 81   GLU K N   1 
ATOM   8530  C CA  . GLU K  1 81  ? 158.244 115.131 81.718  1.00 47.62  ? 81   GLU K CA  1 
ATOM   8531  C C   . GLU K  1 81  ? 157.625 115.829 82.929  1.00 46.99  ? 81   GLU K C   1 
ATOM   8532  O O   . GLU K  1 81  ? 157.234 116.998 82.861  1.00 45.48  ? 81   GLU K O   1 
ATOM   8533  C CB  . GLU K  1 81  ? 157.340 115.381 80.493  1.00 47.88  ? 81   GLU K CB  1 
ATOM   8534  C CG  . GLU K  1 81  ? 156.194 114.382 80.317  1.00 47.39  ? 81   GLU K CG  1 
ATOM   8535  C CD  . GLU K  1 81  ? 156.439 113.431 79.158  1.00 50.81  ? 81   GLU K CD  1 
ATOM   8536  O OE1 . GLU K  1 81  ? 156.787 113.916 78.059  1.00 48.19  ? 81   GLU K OE1 1 
ATOM   8537  O OE2 . GLU K  1 81  ? 156.285 112.203 79.329  1.00 51.09  ? 81   GLU K OE2 1 
ATOM   8538  N N   . ASP K  1 82  ? 157.534 115.091 84.032  1.00 46.95  ? 82   ASP K N   1 
ATOM   8539  C CA  . ASP K  1 82  ? 156.844 115.544 85.232  1.00 46.91  ? 82   ASP K CA  1 
ATOM   8540  C C   . ASP K  1 82  ? 157.769 115.719 86.433  1.00 45.53  ? 82   ASP K C   1 
ATOM   8541  O O   . ASP K  1 82  ? 157.414 116.417 87.395  1.00 44.19  ? 82   ASP K O   1 
ATOM   8542  C CB  . ASP K  1 82  ? 155.682 114.606 85.557  1.00 48.49  ? 82   ASP K CB  1 
ATOM   8543  C CG  . ASP K  1 82  ? 154.517 114.779 84.600  1.00 54.51  ? 82   ASP K CG  1 
ATOM   8544  O OD1 . ASP K  1 82  ? 154.552 115.711 83.761  1.00 60.49  ? 82   ASP K OD1 1 
ATOM   8545  O OD2 . ASP K  1 82  ? 153.554 113.988 84.689  1.00 61.79  ? 82   ASP K OD2 1 
ATOM   8546  N N   . PHE K  1 83  ? 158.938 115.055 86.376  1.00 43.80  ? 83   PHE K N   1 
ATOM   8547  C CA  . PHE K  1 83  ? 160.085 115.471 87.192  1.00 41.17  ? 83   PHE K CA  1 
ATOM   8548  C C   . PHE K  1 83  ? 159.977 116.977 87.266  1.00 39.64  ? 83   PHE K C   1 
ATOM   8549  O O   . PHE K  1 83  ? 160.207 117.692 86.248  1.00 39.85  ? 83   PHE K O   1 
ATOM   8550  C CB  . PHE K  1 83  ? 161.395 115.140 86.465  1.00 43.14  ? 83   PHE K CB  1 
ATOM   8551  C CG  . PHE K  1 83  ? 162.591 115.056 87.373  1.00 44.48  ? 83   PHE K CG  1 
ATOM   8552  C CD1 . PHE K  1 83  ? 163.039 113.814 87.806  1.00 46.26  ? 83   PHE K CD1 1 
ATOM   8553  C CD2 . PHE K  1 83  ? 163.278 116.201 87.788  1.00 45.52  ? 83   PHE K CD2 1 
ATOM   8554  C CE1 . PHE K  1 83  ? 164.141 113.698 88.642  1.00 47.85  ? 83   PHE K CE1 1 
ATOM   8555  C CE2 . PHE K  1 83  ? 164.391 116.094 88.627  1.00 48.49  ? 83   PHE K CE2 1 
ATOM   8556  C CZ  . PHE K  1 83  ? 164.821 114.838 89.055  1.00 48.26  ? 83   PHE K CZ  1 
ATOM   8557  N N   . ALA K  1 84  ? 159.611 117.457 88.458  1.00 36.37  ? 84   ALA K N   1 
ATOM   8558  C CA  . ALA K  1 84  ? 159.295 118.866 88.649  1.00 33.65  ? 84   ALA K CA  1 
ATOM   8559  C C   . ALA K  1 84  ? 158.784 119.068 90.053  1.00 33.29  ? 84   ALA K C   1 
ATOM   8560  O O   . ALA K  1 84  ? 158.556 118.114 90.804  1.00 33.24  ? 84   ALA K O   1 
ATOM   8561  C CB  . ALA K  1 84  ? 158.239 119.340 87.642  1.00 33.65  ? 84   ALA K CB  1 
ATOM   8562  N N   . THR K  1 85  ? 158.598 120.336 90.383  1.00 31.32  ? 85   THR K N   1 
ATOM   8563  C CA  . THR K  1 85  ? 158.163 120.754 91.690  1.00 25.84  ? 85   THR K CA  1 
ATOM   8564  C C   . THR K  1 85  ? 156.792 121.369 91.544  1.00 26.57  ? 85   THR K C   1 
ATOM   8565  O O   . THR K  1 85  ? 156.555 122.189 90.649  1.00 26.48  ? 85   THR K O   1 
ATOM   8566  C CB  . THR K  1 85  ? 159.143 121.782 92.244  1.00 25.98  ? 85   THR K CB  1 
ATOM   8567  O OG1 . THR K  1 85  ? 160.425 121.158 92.397  1.00 24.04  ? 85   THR K OG1 1 
ATOM   8568  C CG2 . THR K  1 85  ? 158.683 122.286 93.613  1.00 20.21  ? 85   THR K CG2 1 
ATOM   8569  N N   . TYR K  1 86  ? 155.895 120.971 92.441  1.00 25.06  ? 86   TYR K N   1 
ATOM   8570  C CA  . TYR K  1 86  ? 154.472 121.257 92.312  1.00 25.25  ? 86   TYR K CA  1 
ATOM   8571  C C   . TYR K  1 86  ? 153.961 122.078 93.506  1.00 26.42  ? 86   TYR K C   1 
ATOM   8572  O O   . TYR K  1 86  ? 154.063 121.641 94.659  1.00 26.77  ? 86   TYR K O   1 
ATOM   8573  C CB  . TYR K  1 86  ? 153.713 119.935 92.115  1.00 25.63  ? 86   TYR K CB  1 
ATOM   8574  C CG  . TYR K  1 86  ? 154.111 119.254 90.818  1.00 28.07  ? 86   TYR K CG  1 
ATOM   8575  C CD1 . TYR K  1 86  ? 155.265 118.471 90.733  1.00 34.03  ? 86   TYR K CD1 1 
ATOM   8576  C CD2 . TYR K  1 86  ? 153.356 119.430 89.665  1.00 36.13  ? 86   TYR K CD2 1 
ATOM   8577  C CE1 . TYR K  1 86  ? 155.638 117.870 89.539  1.00 34.86  ? 86   TYR K CE1 1 
ATOM   8578  C CE2 . TYR K  1 86  ? 153.722 118.828 88.470  1.00 34.62  ? 86   TYR K CE2 1 
ATOM   8579  C CZ  . TYR K  1 86  ? 154.865 118.056 88.411  1.00 34.39  ? 86   TYR K CZ  1 
ATOM   8580  O OH  . TYR K  1 86  ? 155.219 117.461 87.224  1.00 32.98  ? 86   TYR K OH  1 
ATOM   8581  N N   . TYR K  1 87  ? 153.424 123.272 93.221  1.00 25.90  ? 87   TYR K N   1 
ATOM   8582  C CA  . TYR K  1 87  ? 153.082 124.303 94.233  1.00 25.51  ? 87   TYR K CA  1 
ATOM   8583  C C   . TYR K  1 87  ? 151.585 124.606 94.368  1.00 27.66  ? 87   TYR K C   1 
ATOM   8584  O O   . TYR K  1 87  ? 150.893 124.792 93.334  1.00 30.41  ? 87   TYR K O   1 
ATOM   8585  C CB  . TYR K  1 87  ? 153.757 125.634 93.870  1.00 25.17  ? 87   TYR K CB  1 
ATOM   8586  C CG  . TYR K  1 87  ? 155.212 125.745 94.246  1.00 20.73  ? 87   TYR K CG  1 
ATOM   8587  C CD1 . TYR K  1 87  ? 156.210 125.440 93.321  1.00 23.60  ? 87   TYR K CD1 1 
ATOM   8588  C CD2 . TYR K  1 87  ? 155.593 126.167 95.517  1.00 13.78  ? 87   TYR K CD2 1 
ATOM   8589  C CE1 . TYR K  1 87  ? 157.555 125.544 93.651  1.00 12.35  ? 87   TYR K CE1 1 
ATOM   8590  C CE2 . TYR K  1 87  ? 156.939 126.269 95.859  1.00 20.90  ? 87   TYR K CE2 1 
ATOM   8591  C CZ  . TYR K  1 87  ? 157.912 125.958 94.920  1.00 22.00  ? 87   TYR K CZ  1 
ATOM   8592  O OH  . TYR K  1 87  ? 159.248 126.059 95.249  1.00 26.72  ? 87   TYR K OH  1 
ATOM   8593  N N   . CYS K  1 88  ? 151.074 124.692 95.599  1.00 27.23  ? 88   CYS K N   1 
ATOM   8594  C CA  . CYS K  1 88  ? 149.696 125.168 95.776  1.00 28.81  ? 88   CYS K CA  1 
ATOM   8595  C C   . CYS K  1 88  ? 149.639 126.620 96.245  1.00 29.51  ? 88   CYS K C   1 
ATOM   8596  O O   . CYS K  1 88  ? 149.713 126.919 97.442  1.00 31.26  ? 88   CYS K O   1 
ATOM   8597  C CB  . CYS K  1 88  ? 148.873 124.252 96.697  1.00 28.63  ? 88   CYS K CB  1 
ATOM   8598  S SG  . CYS K  1 88  ? 149.559 124.150 98.401  1.00 34.33  ? 88   CYS K SG  1 
ATOM   8599  N N   . GLN K  1 89  ? 149.523 127.524 95.283  1.00 30.22  ? 89   GLN K N   1 
ATOM   8600  C CA  . GLN K  1 89  ? 149.262 128.911 95.578  1.00 30.23  ? 89   GLN K CA  1 
ATOM   8601  C C   . GLN K  1 89  ? 147.783 129.026 95.888  1.00 32.81  ? 89   GLN K C   1 
ATOM   8602  O O   . GLN K  1 89  ? 147.036 128.029 95.831  1.00 33.55  ? 89   GLN K O   1 
ATOM   8603  C CB  . GLN K  1 89  ? 149.577 129.750 94.342  1.00 30.29  ? 89   GLN K CB  1 
ATOM   8604  C CG  . GLN K  1 89  ? 150.227 131.081 94.671  1.00 35.07  ? 89   GLN K CG  1 
ATOM   8605  C CD  . GLN K  1 89  ? 149.868 132.179 93.674  1.00 34.63  ? 89   GLN K CD  1 
ATOM   8606  O OE1 . GLN K  1 89  ? 148.764 132.210 93.122  1.00 27.96  ? 89   GLN K OE1 1 
ATOM   8607  N NE2 . GLN K  1 89  ? 150.803 133.107 93.455  1.00 29.65  ? 89   GLN K NE2 1 
ATOM   8608  N N   . GLN K  1 90  ? 147.351 130.241 96.199  1.00 33.66  ? 90   GLN K N   1 
ATOM   8609  C CA  . GLN K  1 90  ? 145.935 130.544 96.301  1.00 32.32  ? 90   GLN K CA  1 
ATOM   8610  C C   . GLN K  1 90  ? 145.675 131.971 95.814  1.00 33.44  ? 90   GLN K C   1 
ATOM   8611  O O   . GLN K  1 90  ? 146.614 132.802 95.753  1.00 34.88  ? 90   GLN K O   1 
ATOM   8612  C CB  . GLN K  1 90  ? 145.481 130.444 97.746  1.00 31.15  ? 90   GLN K CB  1 
ATOM   8613  C CG  . GLN K  1 90  ? 145.578 131.823 98.388  1.00 23.96  ? 90   GLN K CG  1 
ATOM   8614  C CD  . GLN K  1 90  ? 145.264 131.765 99.826  1.00 17.93  ? 90   GLN K CD  1 
ATOM   8615  O OE1 . GLN K  1 90  ? 144.516 132.594 100.339 1.00 16.72  ? 90   GLN K OE1 1 
ATOM   8616  N NE2 . GLN K  1 90  ? 145.826 130.781 100.518 1.00 6.10   ? 90   GLN K NE2 1 
ATOM   8617  N N   . SER K  1 91  ? 144.407 132.260 95.483  1.00 34.71  ? 91   SER K N   1 
ATOM   8618  C CA  . SER K  1 91  ? 143.996 133.603 95.055  1.00 35.53  ? 91   SER K CA  1 
ATOM   8619  C C   . SER K  1 91  ? 142.884 134.190 95.933  1.00 34.43  ? 91   SER K C   1 
ATOM   8620  O O   . SER K  1 91  ? 142.250 135.197 95.539  1.00 32.31  ? 91   SER K O   1 
ATOM   8621  C CB  . SER K  1 91  ? 143.498 133.553 93.602  1.00 36.94  ? 91   SER K CB  1 
ATOM   8622  O OG  . SER K  1 91  ? 144.430 132.907 92.751  1.00 41.83  ? 91   SER K OG  1 
ATOM   8623  N N   . TYR K  1 92  ? 142.650 133.571 97.104  1.00 33.55  ? 92   TYR K N   1 
ATOM   8624  C CA  . TYR K  1 92  ? 141.392 133.860 97.848  1.00 35.58  ? 92   TYR K CA  1 
ATOM   8625  C C   . TYR K  1 92  ? 141.546 135.139 98.659  1.00 36.24  ? 92   TYR K C   1 
ATOM   8626  O O   . TYR K  1 92  ? 140.556 135.718 99.143  1.00 37.09  ? 92   TYR K O   1 
ATOM   8627  C CB  . TYR K  1 92  ? 140.998 132.636 98.721  1.00 34.02  ? 92   TYR K CB  1 
ATOM   8628  C CG  . TYR K  1 92  ? 139.825 132.804 99.691  1.00 34.61  ? 92   TYR K CG  1 
ATOM   8629  C CD1 . TYR K  1 92  ? 138.629 132.094 99.527  1.00 33.42  ? 92   TYR K CD1 1 
ATOM   8630  C CD2 . TYR K  1 92  ? 139.935 133.655 100.796 1.00 37.03  ? 92   TYR K CD2 1 
ATOM   8631  C CE1 . TYR K  1 92  ? 137.566 132.243 100.435 1.00 30.33  ? 92   TYR K CE1 1 
ATOM   8632  C CE2 . TYR K  1 92  ? 138.891 133.812 101.696 1.00 35.69  ? 92   TYR K CE2 1 
ATOM   8633  C CZ  . TYR K  1 92  ? 137.711 133.103 101.516 1.00 32.58  ? 92   TYR K CZ  1 
ATOM   8634  O OH  . TYR K  1 92  ? 136.685 133.262 102.431 1.00 23.59  ? 92   TYR K OH  1 
ATOM   8635  N N   . SER K  1 93  ? 142.797 135.590 98.772  1.00 37.91  ? 93   SER K N   1 
ATOM   8636  C CA  . SER K  1 93  ? 143.115 136.761 99.571  1.00 37.47  ? 93   SER K CA  1 
ATOM   8637  C C   . SER K  1 93  ? 144.565 137.164 99.413  1.00 37.30  ? 93   SER K C   1 
ATOM   8638  O O   . SER K  1 93  ? 145.393 136.406 98.901  1.00 37.72  ? 93   SER K O   1 
ATOM   8639  C CB  . SER K  1 93  ? 142.820 136.494 101.048 1.00 36.75  ? 93   SER K CB  1 
ATOM   8640  O OG  . SER K  1 93  ? 142.998 137.676 101.820 1.00 38.94  ? 93   SER K OG  1 
ATOM   8641  N N   . THR K  1 94  ? 144.853 138.373 99.871  1.00 36.36  ? 94   THR K N   1 
ATOM   8642  C CA  . THR K  1 94  ? 146.179 138.924 99.766  1.00 36.08  ? 94   THR K CA  1 
ATOM   8643  C C   . THR K  1 94  ? 146.848 139.100 101.129 1.00 36.63  ? 94   THR K C   1 
ATOM   8644  O O   . THR K  1 94  ? 146.246 139.629 102.067 1.00 35.09  ? 94   THR K O   1 
ATOM   8645  C CB  . THR K  1 94  ? 146.203 140.208 98.907  1.00 36.38  ? 94   THR K CB  1 
ATOM   8646  O OG1 . THR K  1 94  ? 144.934 140.868 98.994  1.00 36.95  ? 94   THR K OG1 1 
ATOM   8647  C CG2 . THR K  1 94  ? 146.418 139.830 97.445  1.00 35.91  ? 94   THR K CG2 1 
ATOM   8648  N N   . PRO K  1 95  ? 148.108 138.640 101.229 1.00 37.36  ? 95   PRO K N   1 
ATOM   8649  C CA  . PRO K  1 95  ? 148.809 137.991 100.103 1.00 38.16  ? 95   PRO K CA  1 
ATOM   8650  C C   . PRO K  1 95  ? 148.346 136.609 99.642  1.00 37.49  ? 95   PRO K C   1 
ATOM   8651  O O   . PRO K  1 95  ? 148.141 135.702 100.477 1.00 36.31  ? 95   PRO K O   1 
ATOM   8652  C CB  . PRO K  1 95  ? 150.265 137.909 100.595 1.00 37.72  ? 95   PRO K CB  1 
ATOM   8653  C CG  . PRO K  1 95  ? 150.175 137.939 102.062 1.00 39.08  ? 95   PRO K CG  1 
ATOM   8654  C CD  . PRO K  1 95  ? 148.994 138.798 102.408 1.00 36.65  ? 95   PRO K CD  1 
ATOM   8655  N N   . ASN K  1 96  ? 148.187 136.453 98.321  1.00 37.40  ? 96   ASN K N   1 
ATOM   8656  C CA  . ASN K  1 96  ? 148.264 135.132 97.719  1.00 35.71  ? 96   ASN K CA  1 
ATOM   8657  C C   . ASN K  1 96  ? 149.634 134.615 98.186  1.00 36.99  ? 96   ASN K C   1 
ATOM   8658  O O   . ASN K  1 96  ? 150.612 135.375 98.194  1.00 37.21  ? 96   ASN K O   1 
ATOM   8659  C CB  . ASN K  1 96  ? 148.240 135.167 96.177  1.00 36.83  ? 96   ASN K CB  1 
ATOM   8660  C CG  . ASN K  1 96  ? 147.211 136.156 95.584  1.00 34.31  ? 96   ASN K CG  1 
ATOM   8661  O OD1 . ASN K  1 96  ? 146.117 136.374 96.124  1.00 38.47  ? 96   ASN K OD1 1 
ATOM   8662  N ND2 . ASN K  1 96  ? 147.574 136.733 94.431  1.00 27.08  ? 96   ASN K ND2 1 
ATOM   8663  N N   . THR K  1 97  ? 149.711 133.330 98.555  1.00 35.60  ? 97   THR K N   1 
ATOM   8664  C CA  . THR K  1 97  ? 150.885 132.728 99.220  1.00 33.27  ? 97   THR K CA  1 
ATOM   8665  C C   . THR K  1 97  ? 151.064 131.288 98.746  1.00 30.67  ? 97   THR K C   1 
ATOM   8666  O O   . THR K  1 97  ? 150.157 130.748 98.084  1.00 29.68  ? 97   THR K O   1 
ATOM   8667  C CB  . THR K  1 97  ? 150.613 132.595 100.718 1.00 33.93  ? 97   THR K CB  1 
ATOM   8668  O OG1 . THR K  1 97  ? 149.238 132.164 100.914 1.00 35.76  ? 97   THR K OG1 1 
ATOM   8669  C CG2 . THR K  1 97  ? 150.858 133.926 101.438 1.00 35.72  ? 97   THR K CG2 1 
ATOM   8670  N N   . PHE K  1 98  ? 152.164 130.626 99.122  1.00 27.54  ? 98   PHE K N   1 
ATOM   8671  C CA  . PHE K  1 98  ? 152.482 129.281 98.598  1.00 24.19  ? 98   PHE K CA  1 
ATOM   8672  C C   . PHE K  1 98  ? 152.553 128.141 99.634  1.00 25.08  ? 98   PHE K C   1 
ATOM   8673  O O   . PHE K  1 98  ? 152.845 128.375 100.816 1.00 26.40  ? 98   PHE K O   1 
ATOM   8674  C CB  . PHE K  1 98  ? 153.806 129.327 97.819  1.00 22.03  ? 98   PHE K CB  1 
ATOM   8675  C CG  . PHE K  1 98  ? 153.730 130.069 96.504  1.00 19.57  ? 98   PHE K CG  1 
ATOM   8676  C CD1 . PHE K  1 98  ? 153.629 131.464 96.472  1.00 12.59  ? 98   PHE K CD1 1 
ATOM   8677  C CD2 . PHE K  1 98  ? 153.791 129.377 95.294  1.00 12.51  ? 98   PHE K CD2 1 
ATOM   8678  C CE1 . PHE K  1 98  ? 153.570 132.149 95.259  1.00 16.53  ? 98   PHE K CE1 1 
ATOM   8679  C CE2 . PHE K  1 98  ? 153.728 130.059 94.073  1.00 21.48  ? 98   PHE K CE2 1 
ATOM   8680  C CZ  . PHE K  1 98  ? 153.624 131.450 94.058  1.00 22.73  ? 98   PHE K CZ  1 
ATOM   8681  N N   . GLY K  1 99  ? 152.281 126.916 99.185  1.00 26.73  ? 99   GLY K N   1 
ATOM   8682  C CA  . GLY K  1 99  ? 152.712 125.729 99.926  1.00 27.06  ? 99   GLY K CA  1 
ATOM   8683  C C   . GLY K  1 99  ? 154.221 125.652 99.765  1.00 26.64  ? 99   GLY K C   1 
ATOM   8684  O O   . GLY K  1 99  ? 154.794 126.377 98.943  1.00 24.90  ? 99   GLY K O   1 
ATOM   8685  N N   . GLN K  1 100 ? 154.875 124.779 100.531 1.00 27.01  ? 100  GLN K N   1 
ATOM   8686  C CA  . GLN K  1 100 ? 156.329 124.624 100.401 1.00 28.97  ? 100  GLN K CA  1 
ATOM   8687  C C   . GLN K  1 100 ? 156.721 123.757 99.201  1.00 28.74  ? 100  GLN K C   1 
ATOM   8688  O O   . GLN K  1 100 ? 157.869 123.317 99.095  1.00 25.70  ? 100  GLN K O   1 
ATOM   8689  C CB  . GLN K  1 100 ? 156.976 124.102 101.693 1.00 30.63  ? 100  GLN K CB  1 
ATOM   8690  C CG  . GLN K  1 100 ? 156.179 123.043 102.448 1.00 30.82  ? 100  GLN K CG  1 
ATOM   8691  C CD  . GLN K  1 100 ? 155.441 123.620 103.641 1.00 32.83  ? 100  GLN K CD  1 
ATOM   8692  O OE1 . GLN K  1 100 ? 154.279 123.292 103.883 1.00 26.14  ? 100  GLN K OE1 1 
ATOM   8693  N NE2 . GLN K  1 100 ? 156.114 124.486 104.396 1.00 33.35  ? 100  GLN K NE2 1 
ATOM   8694  N N   . GLY K  1 101 ? 155.767 123.520 98.301  1.00 30.74  ? 101  GLY K N   1 
ATOM   8695  C CA  . GLY K  1 101 ? 156.024 122.795 97.050  1.00 31.54  ? 101  GLY K CA  1 
ATOM   8696  C C   . GLY K  1 101 ? 156.302 121.312 97.233  1.00 30.71  ? 101  GLY K C   1 
ATOM   8697  O O   . GLY K  1 101 ? 156.296 120.810 98.361  1.00 32.63  ? 101  GLY K O   1 
ATOM   8698  N N   . THR K  1 102 ? 156.549 120.608 96.124  1.00 27.20  ? 102  THR K N   1 
ATOM   8699  C CA  . THR K  1 102 ? 156.944 119.182 96.159  1.00 24.41  ? 102  THR K CA  1 
ATOM   8700  C C   . THR K  1 102 ? 157.859 118.743 94.994  1.00 23.92  ? 102  THR K C   1 
ATOM   8701  O O   . THR K  1 102 ? 157.419 118.657 93.842  1.00 19.58  ? 102  THR K O   1 
ATOM   8702  C CB  . THR K  1 102 ? 155.704 118.220 96.287  1.00 24.68  ? 102  THR K CB  1 
ATOM   8703  O OG1 . THR K  1 102 ? 155.047 118.447 97.540  1.00 14.95  ? 102  THR K OG1 1 
ATOM   8704  C CG2 . THR K  1 102 ? 156.124 116.752 96.195  1.00 19.38  ? 102  THR K CG2 1 
ATOM   8705  N N   . LYS K  1 103 ? 159.126 118.462 95.331  1.00 27.58  ? 103  LYS K N   1 
ATOM   8706  C CA  . LYS K  1 103 ? 160.077 117.815 94.401  1.00 31.56  ? 103  LYS K CA  1 
ATOM   8707  C C   . LYS K  1 103 ? 159.639 116.394 94.028  1.00 33.55  ? 103  LYS K C   1 
ATOM   8708  O O   . LYS K  1 103 ? 160.154 115.404 94.564  1.00 35.21  ? 103  LYS K O   1 
ATOM   8709  C CB  . LYS K  1 103 ? 161.486 117.760 95.010  1.00 30.60  ? 103  LYS K CB  1 
ATOM   8710  C CG  . LYS K  1 103 ? 161.943 119.009 95.758  1.00 32.43  ? 103  LYS K CG  1 
ATOM   8711  C CD  . LYS K  1 103 ? 163.300 118.793 96.446  1.00 32.37  ? 103  LYS K CD  1 
ATOM   8712  C CE  . LYS K  1 103 ? 164.456 119.056 95.453  1.00 29.29  ? 103  LYS K CE  1 
ATOM   8713  N NZ  . LYS K  1 103 ? 165.787 118.638 96.073  1.00 30.59  ? 103  LYS K NZ  1 
ATOM   8714  N N   . VAL K  1 104 ? 158.680 116.311 93.113  1.00 34.84  ? 104  VAL K N   1 
ATOM   8715  C CA  . VAL K  1 104 ? 158.234 115.052 92.533  1.00 37.68  ? 104  VAL K CA  1 
ATOM   8716  C C   . VAL K  1 104 ? 159.383 114.419 91.723  1.00 39.36  ? 104  VAL K C   1 
ATOM   8717  O O   . VAL K  1 104 ? 159.822 115.010 90.728  1.00 39.86  ? 104  VAL K O   1 
ATOM   8718  C CB  . VAL K  1 104 ? 156.966 115.316 91.640  1.00 37.08  ? 104  VAL K CB  1 
ATOM   8719  C CG1 . VAL K  1 104 ? 156.900 114.407 90.377  1.00 35.66  ? 104  VAL K CG1 1 
ATOM   8720  C CG2 . VAL K  1 104 ? 155.695 115.182 92.462  1.00 35.43  ? 104  VAL K CG2 1 
ATOM   8721  N N   . GLU K  1 105 ? 159.890 113.247 92.143  1.00 39.45  ? 105  GLU K N   1 
ATOM   8722  C CA  . GLU K  1 105 ? 160.976 112.578 91.358  1.00 39.79  ? 105  GLU K CA  1 
ATOM   8723  C C   . GLU K  1 105 ? 160.553 111.482 90.360  1.00 40.29  ? 105  GLU K C   1 
ATOM   8724  O O   . GLU K  1 105 ? 159.360 111.175 90.212  1.00 40.34  ? 105  GLU K O   1 
ATOM   8725  C CB  . GLU K  1 105 ? 162.154 112.092 92.236  1.00 40.11  ? 105  GLU K CB  1 
ATOM   8726  C CG  . GLU K  1 105 ? 163.444 112.901 92.086  1.00 37.13  ? 105  GLU K CG  1 
ATOM   8727  C CD  . GLU K  1 105 ? 164.698 112.032 92.061  1.00 33.69  ? 105  GLU K CD  1 
ATOM   8728  O OE1 . GLU K  1 105 ? 164.848 111.219 91.121  1.00 28.23  ? 105  GLU K OE1 1 
ATOM   8729  O OE2 . GLU K  1 105 ? 165.538 112.169 92.976  1.00 24.73  ? 105  GLU K OE2 1 
ATOM   8730  N N   . ILE K  1 106 ? 161.568 110.905 89.700  1.00 40.09  ? 106  ILE K N   1 
ATOM   8731  C CA  . ILE K  1 106 ? 161.430 110.043 88.517  1.00 40.53  ? 106  ILE K CA  1 
ATOM   8732  C C   . ILE K  1 106 ? 162.768 109.381 88.182  1.00 40.51  ? 106  ILE K C   1 
ATOM   8733  O O   . ILE K  1 106 ? 163.266 108.533 88.925  1.00 41.10  ? 106  ILE K O   1 
ATOM   8734  C CB  . ILE K  1 106 ? 160.961 110.836 87.266  1.00 41.20  ? 106  ILE K CB  1 
ATOM   8735  C CG1 . ILE K  1 106 ? 159.564 110.395 86.827  1.00 37.37  ? 106  ILE K CG1 1 
ATOM   8736  C CG2 . ILE K  1 106 ? 161.925 110.647 86.097  1.00 42.82  ? 106  ILE K CG2 1 
ATOM   8737  C CD1 . ILE K  1 106 ? 158.485 111.449 87.152  1.00 34.14  ? 106  ILE K CD1 1 
ATOM   8738  N N   . ASP L  1 1   ? 137.703 141.898 75.763  1.00 46.89  ? 1    ASP L N   1 
ATOM   8739  C CA  . ASP L  1 1   ? 137.256 141.893 77.198  1.00 45.97  ? 1    ASP L CA  1 
ATOM   8740  C C   . ASP L  1 1   ? 135.991 141.039 77.375  1.00 45.60  ? 1    ASP L C   1 
ATOM   8741  O O   . ASP L  1 1   ? 135.524 140.412 76.416  1.00 46.26  ? 1    ASP L O   1 
ATOM   8742  C CB  . ASP L  1 1   ? 137.037 143.328 77.688  1.00 46.94  ? 1    ASP L CB  1 
ATOM   8743  C CG  . ASP L  1 1   ? 135.798 143.968 77.085  1.00 48.97  ? 1    ASP L CG  1 
ATOM   8744  O OD1 . ASP L  1 1   ? 134.992 144.533 77.857  1.00 49.09  ? 1    ASP L OD1 1 
ATOM   8745  O OD2 . ASP L  1 1   ? 135.620 143.904 75.849  1.00 49.50  ? 1    ASP L OD2 1 
ATOM   8746  N N   . ILE L  1 2   ? 135.435 141.023 78.591  1.00 43.98  ? 2    ILE L N   1 
ATOM   8747  C CA  . ILE L  1 2   ? 134.410 140.030 78.969  1.00 44.41  ? 2    ILE L CA  1 
ATOM   8748  C C   . ILE L  1 2   ? 132.976 140.579 79.070  1.00 45.26  ? 2    ILE L C   1 
ATOM   8749  O O   . ILE L  1 2   ? 132.752 141.726 79.463  1.00 45.24  ? 2    ILE L O   1 
ATOM   8750  C CB  . ILE L  1 2   ? 134.789 139.275 80.294  1.00 45.79  ? 2    ILE L CB  1 
ATOM   8751  C CG1 . ILE L  1 2   ? 136.302 138.974 80.372  1.00 43.98  ? 2    ILE L CG1 1 
ATOM   8752  C CG2 . ILE L  1 2   ? 133.941 138.000 80.465  1.00 43.19  ? 2    ILE L CG2 1 
ATOM   8753  C CD1 . ILE L  1 2   ? 136.914 138.209 79.194  1.00 39.20  ? 2    ILE L CD1 1 
ATOM   8754  N N   . GLN L  1 3   ? 132.022 139.719 78.721  1.00 45.13  ? 3    GLN L N   1 
ATOM   8755  C CA  . GLN L  1 3   ? 130.620 140.102 78.570  1.00 45.38  ? 3    GLN L CA  1 
ATOM   8756  C C   . GLN L  1 3   ? 129.720 139.290 79.482  1.00 45.45  ? 3    GLN L C   1 
ATOM   8757  O O   . GLN L  1 3   ? 129.798 138.051 79.490  1.00 46.18  ? 3    GLN L O   1 
ATOM   8758  C CB  . GLN L  1 3   ? 130.161 139.849 77.127  1.00 46.59  ? 3    GLN L CB  1 
ATOM   8759  C CG  . GLN L  1 3   ? 130.423 141.030 76.164  1.00 46.98  ? 3    GLN L CG  1 
ATOM   8760  C CD  . GLN L  1 3   ? 129.961 142.350 76.759  1.00 49.93  ? 3    GLN L CD  1 
ATOM   8761  O OE1 . GLN L  1 3   ? 129.002 142.414 77.543  1.00 48.18  ? 3    GLN L OE1 1 
ATOM   8762  N NE2 . GLN L  1 3   ? 130.644 143.423 76.380  1.00 51.88  ? 3    GLN L NE2 1 
ATOM   8763  N N   . MET L  1 4   ? 128.847 139.966 80.228  1.00 45.19  ? 4    MET L N   1 
ATOM   8764  C CA  . MET L  1 4   ? 127.897 139.255 81.095  1.00 46.13  ? 4    MET L CA  1 
ATOM   8765  C C   . MET L  1 4   ? 126.435 139.413 80.658  1.00 45.25  ? 4    MET L C   1 
ATOM   8766  O O   . MET L  1 4   ? 125.936 140.538 80.551  1.00 42.65  ? 4    MET L O   1 
ATOM   8767  C CB  . MET L  1 4   ? 128.075 139.663 82.561  1.00 48.06  ? 4    MET L CB  1 
ATOM   8768  C CG  . MET L  1 4   ? 129.428 139.275 83.166  1.00 49.06  ? 4    MET L CG  1 
ATOM   8769  S SD  . MET L  1 4   ? 130.030 137.633 82.670  1.00 55.03  ? 4    MET L SD  1 
ATOM   8770  C CE  . MET L  1 4   ? 128.898 136.559 83.556  1.00 53.68  ? 4    MET L CE  1 
ATOM   8771  N N   . THR L  1 5   ? 125.750 138.291 80.409  1.00 44.68  ? 5    THR L N   1 
ATOM   8772  C CA  . THR L  1 5   ? 124.358 138.358 79.924  1.00 44.26  ? 5    THR L CA  1 
ATOM   8773  C C   . THR L  1 5   ? 123.293 137.541 80.696  1.00 42.38  ? 5    THR L C   1 
ATOM   8774  O O   . THR L  1 5   ? 123.181 136.314 80.528  1.00 43.00  ? 5    THR L O   1 
ATOM   8775  C CB  . THR L  1 5   ? 124.248 138.131 78.393  1.00 46.64  ? 5    THR L CB  1 
ATOM   8776  O OG1 . THR L  1 5   ? 125.084 137.046 77.979  1.00 45.99  ? 5    THR L OG1 1 
ATOM   8777  C CG2 . THR L  1 5   ? 124.579 139.417 77.614  1.00 44.29  ? 5    THR L CG2 1 
ATOM   8778  N N   . GLN L  1 6   ? 122.498 138.242 81.516  1.00 40.29  ? 6    GLN L N   1 
ATOM   8779  C CA  . GLN L  1 6   ? 121.515 137.593 82.408  1.00 38.40  ? 6    GLN L CA  1 
ATOM   8780  C C   . GLN L  1 6   ? 120.021 137.771 82.068  1.00 37.14  ? 6    GLN L C   1 
ATOM   8781  O O   . GLN L  1 6   ? 119.581 138.830 81.611  1.00 34.58  ? 6    GLN L O   1 
ATOM   8782  C CB  . GLN L  1 6   ? 121.788 137.932 83.884  1.00 37.48  ? 6    GLN L CB  1 
ATOM   8783  C CG  . GLN L  1 6   ? 121.563 139.380 84.281  1.00 33.20  ? 6    GLN L CG  1 
ATOM   8784  C CD  . GLN L  1 6   ? 121.816 139.617 85.757  1.00 28.25  ? 6    GLN L CD  1 
ATOM   8785  O OE1 . GLN L  1 6   ? 122.759 140.315 86.127  1.00 24.55  ? 6    GLN L OE1 1 
ATOM   8786  N NE2 . GLN L  1 6   ? 120.979 139.032 86.609  1.00 29.74  ? 6    GLN L NE2 1 
ATOM   8787  N N   . SER L  1 7   ? 119.269 136.702 82.331  1.00 39.51  ? 7    SER L N   1 
ATOM   8788  C CA  . SER L  1 7   ? 117.855 136.567 82.000  1.00 42.42  ? 7    SER L CA  1 
ATOM   8789  C C   . SER L  1 7   ? 117.190 135.694 83.066  1.00 43.89  ? 7    SER L C   1 
ATOM   8790  O O   . SER L  1 7   ? 117.780 134.693 83.487  1.00 44.05  ? 7    SER L O   1 
ATOM   8791  C CB  . SER L  1 7   ? 117.716 135.877 80.642  1.00 42.44  ? 7    SER L CB  1 
ATOM   8792  O OG  . SER L  1 7   ? 118.386 134.601 80.647  1.00 44.41  ? 7    SER L OG  1 
ATOM   8793  N N   . PRO L  1 8   ? 115.952 136.025 83.481  1.00 45.60  ? 8    PRO L N   1 
ATOM   8794  C CA  . PRO L  1 8   ? 115.084 137.052 82.921  1.00 45.50  ? 8    PRO L CA  1 
ATOM   8795  C C   . PRO L  1 8   ? 115.600 138.429 83.277  1.00 45.17  ? 8    PRO L C   1 
ATOM   8796  O O   . PRO L  1 8   ? 116.313 138.587 84.272  1.00 45.41  ? 8    PRO L O   1 
ATOM   8797  C CB  . PRO L  1 8   ? 113.732 136.792 83.623  1.00 45.20  ? 8    PRO L CB  1 
ATOM   8798  C CG  . PRO L  1 8   ? 113.878 135.438 84.264  1.00 46.36  ? 8    PRO L CG  1 
ATOM   8799  C CD  . PRO L  1 8   ? 115.314 135.357 84.626  1.00 46.34  ? 8    PRO L CD  1 
ATOM   8800  N N   . SER L  1 9   ? 115.252 139.417 82.466  1.00 44.39  ? 9    SER L N   1 
ATOM   8801  C CA  . SER L  1 9   ? 115.619 140.776 82.794  1.00 43.07  ? 9    SER L CA  1 
ATOM   8802  C C   . SER L  1 9   ? 114.688 141.342 83.857  1.00 44.42  ? 9    SER L C   1 
ATOM   8803  O O   . SER L  1 9   ? 114.830 142.528 84.219  1.00 46.30  ? 9    SER L O   1 
ATOM   8804  C CB  . SER L  1 9   ? 115.611 141.670 81.549  1.00 42.56  ? 9    SER L CB  1 
ATOM   8805  O OG  . SER L  1 9   ? 115.969 143.045 81.878  1.00 30.28  ? 9    SER L OG  1 
ATOM   8806  N N   . SER L  1 10  ? 113.757 140.518 84.364  1.00 43.12  ? 10   SER L N   1 
ATOM   8807  C CA  . SER L  1 10  ? 112.802 141.016 85.358  1.00 42.46  ? 10   SER L CA  1 
ATOM   8808  C C   . SER L  1 10  ? 111.675 140.029 85.670  1.00 42.00  ? 10   SER L C   1 
ATOM   8809  O O   . SER L  1 10  ? 111.244 139.246 84.821  1.00 39.95  ? 10   SER L O   1 
ATOM   8810  C CB  . SER L  1 10  ? 112.249 142.393 84.925  1.00 41.49  ? 10   SER L CB  1 
ATOM   8811  O OG  . SER L  1 10  ? 111.055 142.746 85.809  1.00 46.76  ? 10   SER L OG  1 
ATOM   8812  N N   . LEU L  1 11  ? 111.217 140.114 86.914  1.00 41.88  ? 11   LEU L N   1 
ATOM   8813  C CA  . LEU L  1 11  ? 110.554 139.022 87.605  1.00 41.80  ? 11   LEU L CA  1 
ATOM   8814  C C   . LEU L  1 11  ? 109.560 139.553 88.613  1.00 42.29  ? 11   LEU L C   1 
ATOM   8815  O O   . LEU L  1 11  ? 109.827 140.542 89.302  1.00 43.95  ? 11   LEU L O   1 
ATOM   8816  C CB  . LEU L  1 11  ? 111.606 138.234 88.392  1.00 42.32  ? 11   LEU L CB  1 
ATOM   8817  C CG  . LEU L  1 11  ? 111.984 136.770 88.130  1.00 41.99  ? 11   LEU L CG  1 
ATOM   8818  C CD1 . LEU L  1 11  ? 111.466 136.252 86.774  1.00 31.76  ? 11   LEU L CD1 1 
ATOM   8819  C CD2 . LEU L  1 11  ? 113.506 136.584 88.273  1.00 33.79  ? 11   LEU L CD2 1 
ATOM   8820  N N   . SER L  1 12  ? 108.417 138.884 88.708  1.00 42.97  ? 12   SER L N   1 
ATOM   8821  C CA  . SER L  1 12  ? 107.525 139.073 89.842  1.00 41.91  ? 12   SER L CA  1 
ATOM   8822  C C   . SER L  1 12  ? 106.826 137.753 90.155  1.00 40.91  ? 12   SER L C   1 
ATOM   8823  O O   . SER L  1 12  ? 106.163 137.185 89.290  1.00 40.29  ? 12   SER L O   1 
ATOM   8824  C CB  . SER L  1 12  ? 106.496 140.181 89.581  1.00 41.84  ? 12   SER L CB  1 
ATOM   8825  O OG  . SER L  1 12  ? 107.071 141.272 88.860  1.00 43.46  ? 12   SER L OG  1 
ATOM   8826  N N   . ALA L  1 13  ? 106.999 137.265 91.381  1.00 40.28  ? 13   ALA L N   1 
ATOM   8827  C CA  . ALA L  1 13  ? 106.230 136.119 91.882  1.00 40.49  ? 13   ALA L CA  1 
ATOM   8828  C C   . ALA L  1 13  ? 105.710 136.403 93.297  1.00 41.22  ? 13   ALA L C   1 
ATOM   8829  O O   . ALA L  1 13  ? 105.465 137.562 93.645  1.00 42.48  ? 13   ALA L O   1 
ATOM   8830  C CB  . ALA L  1 13  ? 107.081 134.839 91.842  1.00 39.55  ? 13   ALA L CB  1 
ATOM   8831  N N   . SER L  1 14  ? 105.540 135.359 94.106  1.00 40.84  ? 14   SER L N   1 
ATOM   8832  C CA  . SER L  1 14  ? 105.056 135.535 95.475  1.00 39.69  ? 14   SER L CA  1 
ATOM   8833  C C   . SER L  1 14  ? 105.769 134.622 96.470  1.00 38.33  ? 14   SER L C   1 
ATOM   8834  O O   . SER L  1 14  ? 106.537 133.731 96.077  1.00 38.39  ? 14   SER L O   1 
ATOM   8835  C CB  . SER L  1 14  ? 103.530 135.341 95.535  1.00 40.81  ? 14   SER L CB  1 
ATOM   8836  O OG  . SER L  1 14  ? 103.131 133.932 95.419  1.00 41.34  ? 14   SER L OG  1 
ATOM   8837  N N   . VAL L  1 15  ? 105.507 134.867 97.755  1.00 36.91  ? 15   VAL L N   1 
ATOM   8838  C CA  . VAL L  1 15  ? 106.026 134.079 98.886  1.00 34.03  ? 15   VAL L CA  1 
ATOM   8839  C C   . VAL L  1 15  ? 106.013 132.570 98.613  1.00 32.58  ? 15   VAL L C   1 
ATOM   8840  O O   . VAL L  1 15  ? 105.122 132.064 97.916  1.00 31.40  ? 15   VAL L O   1 
ATOM   8841  C CB  . VAL L  1 15  ? 105.201 134.374 100.183 1.00 31.95  ? 15   VAL L CB  1 
ATOM   8842  C CG1 . VAL L  1 15  ? 105.748 133.597 101.385 1.00 32.99  ? 15   VAL L CG1 1 
ATOM   8843  C CG2 . VAL L  1 15  ? 105.211 135.864 100.501 1.00 29.79  ? 15   VAL L CG2 1 
ATOM   8844  N N   . GLY L  1 16  ? 107.005 131.865 99.164  1.00 33.67  ? 16   GLY L N   1 
ATOM   8845  C CA  . GLY L  1 16  ? 107.101 130.409 99.046  1.00 34.68  ? 16   GLY L CA  1 
ATOM   8846  C C   . GLY L  1 16  ? 107.280 129.919 97.623  1.00 37.82  ? 16   GLY L C   1 
ATOM   8847  O O   . GLY L  1 16  ? 107.127 128.726 97.350  1.00 36.77  ? 16   GLY L O   1 
ATOM   8848  N N   . ASP L  1 17  ? 107.605 130.837 96.714  1.00 38.60  ? 17   ASP L N   1 
ATOM   8849  C CA  . ASP L  1 17  ? 107.781 130.463 95.316  1.00 40.95  ? 17   ASP L CA  1 
ATOM   8850  C C   . ASP L  1 17  ? 109.256 130.405 94.900  1.00 42.29  ? 17   ASP L C   1 
ATOM   8851  O O   . ASP L  1 17  ? 110.111 131.018 95.544  1.00 45.25  ? 17   ASP L O   1 
ATOM   8852  C CB  . ASP L  1 17  ? 106.989 131.384 94.387  1.00 39.68  ? 17   ASP L CB  1 
ATOM   8853  C CG  . ASP L  1 17  ? 106.680 130.725 93.054  1.00 44.73  ? 17   ASP L CG  1 
ATOM   8854  O OD1 . ASP L  1 17  ? 106.668 131.435 92.021  1.00 45.21  ? 17   ASP L OD1 1 
ATOM   8855  O OD2 . ASP L  1 17  ? 106.455 129.484 93.009  1.00 37.37  ? 17   ASP L OD2 1 
ATOM   8856  N N   . ARG L  1 18  ? 109.542 129.670 93.819  1.00 42.93  ? 18   ARG L N   1 
ATOM   8857  C CA  . ARG L  1 18  ? 110.922 129.490 93.322  1.00 42.92  ? 18   ARG L CA  1 
ATOM   8858  C C   . ARG L  1 18  ? 111.329 130.374 92.126  1.00 43.72  ? 18   ARG L C   1 
ATOM   8859  O O   . ARG L  1 18  ? 110.825 130.195 90.994  1.00 43.79  ? 18   ARG L O   1 
ATOM   8860  C CB  . ARG L  1 18  ? 111.217 128.020 92.978  1.00 42.22  ? 18   ARG L CB  1 
ATOM   8861  C CG  . ARG L  1 18  ? 112.670 127.842 92.539  1.00 44.52  ? 18   ARG L CG  1 
ATOM   8862  C CD  . ARG L  1 18  ? 112.841 126.971 91.308  1.00 49.34  ? 18   ARG L CD  1 
ATOM   8863  N NE  . ARG L  1 18  ? 113.549 125.736 91.629  1.00 47.06  ? 18   ARG L NE  1 
ATOM   8864  C CZ  . ARG L  1 18  ? 112.952 124.590 91.946  1.00 48.19  ? 18   ARG L CZ  1 
ATOM   8865  N NH1 . ARG L  1 18  ? 111.625 124.507 91.987  1.00 49.91  ? 18   ARG L NH1 1 
ATOM   8866  N NH2 . ARG L  1 18  ? 113.684 123.520 92.223  1.00 39.90  ? 18   ARG L NH2 1 
ATOM   8867  N N   . VAL L  1 19  ? 112.272 131.290 92.374  1.00 43.51  ? 19   VAL L N   1 
ATOM   8868  C CA  . VAL L  1 19  ? 112.773 132.218 91.342  1.00 42.34  ? 19   VAL L CA  1 
ATOM   8869  C C   . VAL L  1 19  ? 114.095 131.772 90.710  1.00 43.05  ? 19   VAL L C   1 
ATOM   8870  O O   . VAL L  1 19  ? 115.084 131.504 91.407  1.00 43.60  ? 19   VAL L O   1 
ATOM   8871  C CB  . VAL L  1 19  ? 112.932 133.655 91.892  1.00 41.26  ? 19   VAL L CB  1 
ATOM   8872  C CG1 . VAL L  1 19  ? 113.134 134.638 90.749  1.00 40.07  ? 19   VAL L CG1 1 
ATOM   8873  C CG2 . VAL L  1 19  ? 111.711 134.051 92.708  1.00 40.03  ? 19   VAL L CG2 1 
ATOM   8874  N N   . THR L  1 20  ? 114.097 131.718 89.383  1.00 41.76  ? 20   THR L N   1 
ATOM   8875  C CA  . THR L  1 20  ? 115.233 131.186 88.664  1.00 41.66  ? 20   THR L CA  1 
ATOM   8876  C C   . THR L  1 20  ? 115.782 132.197 87.661  1.00 42.70  ? 20   THR L C   1 
ATOM   8877  O O   . THR L  1 20  ? 115.097 132.596 86.706  1.00 42.90  ? 20   THR L O   1 
ATOM   8878  C CB  . THR L  1 20  ? 114.878 129.829 88.016  1.00 42.27  ? 20   THR L CB  1 
ATOM   8879  O OG1 . THR L  1 20  ? 114.213 129.003 88.986  1.00 41.65  ? 20   THR L OG1 1 
ATOM   8880  C CG2 . THR L  1 20  ? 116.133 129.113 87.531  1.00 40.48  ? 20   THR L CG2 1 
ATOM   8881  N N   . ILE L  1 21  ? 117.015 132.626 87.924  1.00 42.35  ? 21   ILE L N   1 
ATOM   8882  C CA  . ILE L  1 21  ? 117.741 133.496 87.015  1.00 41.43  ? 21   ILE L CA  1 
ATOM   8883  C C   . ILE L  1 21  ? 119.024 132.831 86.548  1.00 42.75  ? 21   ILE L C   1 
ATOM   8884  O O   . ILE L  1 21  ? 119.726 132.146 87.302  1.00 44.52  ? 21   ILE L O   1 
ATOM   8885  C CB  . ILE L  1 21  ? 118.074 134.884 87.625  1.00 40.32  ? 21   ILE L CB  1 
ATOM   8886  C CG1 . ILE L  1 21  ? 116.905 135.391 88.485  1.00 36.86  ? 21   ILE L CG1 1 
ATOM   8887  C CG2 . ILE L  1 21  ? 118.437 135.896 86.517  1.00 38.53  ? 21   ILE L CG2 1 
ATOM   8888  C CD1 . ILE L  1 21  ? 117.300 136.525 89.458  1.00 28.38  ? 21   ILE L CD1 1 
ATOM   8889  N N   . THR L  1 22  ? 119.293 133.076 85.273  1.00 42.40  ? 22   THR L N   1 
ATOM   8890  C CA  . THR L  1 22  ? 120.421 132.564 84.530  1.00 43.20  ? 22   THR L CA  1 
ATOM   8891  C C   . THR L  1 22  ? 121.287 133.737 84.100  1.00 43.98  ? 22   THR L C   1 
ATOM   8892  O O   . THR L  1 22  ? 120.786 134.837 83.861  1.00 44.28  ? 22   THR L O   1 
ATOM   8893  C CB  . THR L  1 22  ? 119.936 131.829 83.266  1.00 43.87  ? 22   THR L CB  1 
ATOM   8894  O OG1 . THR L  1 22  ? 118.733 132.452 82.773  1.00 44.18  ? 22   THR L OG1 1 
ATOM   8895  C CG2 . THR L  1 22  ? 119.658 130.363 83.575  1.00 42.07  ? 22   THR L CG2 1 
ATOM   8896  N N   . CYS L  1 23  ? 122.584 133.488 84.000  1.00 43.86  ? 23   CYS L N   1 
ATOM   8897  C CA  . CYS L  1 23  ? 123.555 134.497 83.630  1.00 42.61  ? 23   CYS L CA  1 
ATOM   8898  C C   . CYS L  1 23  ? 124.640 133.732 82.909  1.00 42.73  ? 23   CYS L C   1 
ATOM   8899  O O   . CYS L  1 23  ? 124.953 132.592 83.276  1.00 41.71  ? 23   CYS L O   1 
ATOM   8900  C CB  . CYS L  1 23  ? 124.093 135.172 84.893  1.00 42.71  ? 23   CYS L CB  1 
ATOM   8901  S SG  . CYS L  1 23  ? 125.629 136.114 84.758  1.00 44.83  ? 23   CYS L SG  1 
ATOM   8902  N N   . ARG L  1 24  ? 125.212 134.340 81.879  1.00 42.06  ? 24   ARG L N   1 
ATOM   8903  C CA  . ARG L  1 24  ? 126.180 133.634 81.062  1.00 41.80  ? 24   ARG L CA  1 
ATOM   8904  C C   . ARG L  1 24  ? 127.192 134.544 80.393  1.00 42.15  ? 24   ARG L C   1 
ATOM   8905  O O   . ARG L  1 24  ? 126.900 135.703 80.082  1.00 43.57  ? 24   ARG L O   1 
ATOM   8906  C CB  . ARG L  1 24  ? 125.455 132.817 79.998  1.00 41.99  ? 24   ARG L CB  1 
ATOM   8907  C CG  . ARG L  1 24  ? 126.392 132.137 79.050  1.00 39.46  ? 24   ARG L CG  1 
ATOM   8908  C CD  . ARG L  1 24  ? 125.649 131.220 78.154  1.00 45.76  ? 24   ARG L CD  1 
ATOM   8909  N NE  . ARG L  1 24  ? 126.578 130.423 77.370  1.00 50.09  ? 24   ARG L NE  1 
ATOM   8910  C CZ  . ARG L  1 24  ? 126.208 129.426 76.576  1.00 46.61  ? 24   ARG L CZ  1 
ATOM   8911  N NH1 . ARG L  1 24  ? 124.922 129.099 76.462  1.00 41.77  ? 24   ARG L NH1 1 
ATOM   8912  N NH2 . ARG L  1 24  ? 127.120 128.751 75.892  1.00 48.45  ? 24   ARG L NH2 1 
ATOM   8913  N N   . ALA L  1 25  ? 128.376 133.988 80.146  1.00 43.03  ? 25   ALA L N   1 
ATOM   8914  C CA  . ALA L  1 25  ? 129.485 134.747 79.594  1.00 42.78  ? 25   ALA L CA  1 
ATOM   8915  C C   . ALA L  1 25  ? 129.771 134.485 78.117  1.00 42.91  ? 25   ALA L C   1 
ATOM   8916  O O   . ALA L  1 25  ? 129.567 133.371 77.603  1.00 41.88  ? 25   ALA L O   1 
ATOM   8917  C CB  . ALA L  1 25  ? 130.743 134.503 80.426  1.00 43.46  ? 25   ALA L CB  1 
ATOM   8918  N N   . SER L  1 26  ? 130.231 135.542 77.452  1.00 42.45  ? 26   SER L N   1 
ATOM   8919  C CA  . SER L  1 26  ? 130.978 135.406 76.222  1.00 41.26  ? 26   SER L CA  1 
ATOM   8920  C C   . SER L  1 26  ? 132.220 134.575 76.534  1.00 39.72  ? 26   SER L C   1 
ATOM   8921  O O   . SER L  1 26  ? 132.615 133.722 75.737  1.00 41.28  ? 26   SER L O   1 
ATOM   8922  C CB  . SER L  1 26  ? 131.408 136.780 75.715  1.00 39.59  ? 26   SER L CB  1 
ATOM   8923  O OG  . SER L  1 26  ? 132.237 137.436 76.684  1.00 43.70  ? 26   SER L OG  1 
ATOM   8924  N N   . GLN L  1 27  ? 132.826 134.810 77.699  1.00 36.79  ? 27   GLN L N   1 
ATOM   8925  C CA  . GLN L  1 27  ? 134.106 134.184 78.007  1.00 35.81  ? 27   GLN L CA  1 
ATOM   8926  C C   . GLN L  1 27  ? 134.049 133.114 79.102  1.00 35.40  ? 27   GLN L C   1 
ATOM   8927  O O   . GLN L  1 27  ? 133.660 133.377 80.260  1.00 32.42  ? 27   GLN L O   1 
ATOM   8928  C CB  . GLN L  1 27  ? 135.179 135.264 78.334  1.00 35.45  ? 27   GLN L CB  1 
ATOM   8929  C CG  . GLN L  1 27  ? 136.487 134.681 78.879  1.00 35.84  ? 27   GLN L CG  1 
ATOM   8930  C CD  . GLN L  1 27  ? 137.596 134.574 77.839  1.00 32.75  ? 27   GLN L CD  1 
ATOM   8931  O OE1 . GLN L  1 27  ? 137.491 135.094 76.726  1.00 34.11  ? 27   GLN L OE1 1 
ATOM   8932  N NE2 . GLN L  1 27  ? 138.682 133.904 78.212  1.00 13.61  ? 27   GLN L NE2 1 
ATOM   8933  N N   . SER L  1 28  ? 134.457 131.911 78.690  1.00 35.86  ? 28   SER L N   1 
ATOM   8934  C CA  . SER L  1 28  ? 134.495 130.718 79.531  1.00 35.73  ? 28   SER L CA  1 
ATOM   8935  C C   . SER L  1 28  ? 135.199 131.072 80.838  1.00 36.27  ? 28   SER L C   1 
ATOM   8936  O O   . SER L  1 28  ? 136.427 130.988 80.962  1.00 35.90  ? 28   SER L O   1 
ATOM   8937  C CB  . SER L  1 28  ? 135.198 129.571 78.791  1.00 36.31  ? 28   SER L CB  1 
ATOM   8938  O OG  . SER L  1 28  ? 136.474 129.990 78.322  1.00 37.15  ? 28   SER L OG  1 
ATOM   8939  N N   . ILE L  1 29  ? 134.371 131.473 81.802  1.00 35.35  ? 29   ILE L N   1 
ATOM   8940  C CA  . ILE L  1 29  ? 134.796 132.270 82.949  1.00 35.45  ? 29   ILE L CA  1 
ATOM   8941  C C   . ILE L  1 29  ? 135.358 131.366 84.022  1.00 36.15  ? 29   ILE L C   1 
ATOM   8942  O O   . ILE L  1 29  ? 135.474 131.750 85.190  1.00 38.09  ? 29   ILE L O   1 
ATOM   8943  C CB  . ILE L  1 29  ? 133.600 133.116 83.477  1.00 36.57  ? 29   ILE L CB  1 
ATOM   8944  C CG1 . ILE L  1 29  ? 134.080 134.454 84.063  1.00 33.45  ? 29   ILE L CG1 1 
ATOM   8945  C CG2 . ILE L  1 29  ? 132.708 132.315 84.444  1.00 32.72  ? 29   ILE L CG2 1 
ATOM   8946  C CD1 . ILE L  1 29  ? 132.852 135.354 84.347  1.00 35.56  ? 29   ILE L CD1 1 
ATOM   8947  N N   . SER L  1 30  ? 135.723 130.162 83.595  1.00 36.58  ? 30   SER L N   1 
ATOM   8948  C CA  . SER L  1 30  ? 136.179 129.121 84.493  1.00 37.56  ? 30   SER L CA  1 
ATOM   8949  C C   . SER L  1 30  ? 135.284 128.919 85.727  1.00 36.59  ? 30   SER L C   1 
ATOM   8950  O O   . SER L  1 30  ? 134.830 127.786 85.956  1.00 37.43  ? 30   SER L O   1 
ATOM   8951  C CB  . SER L  1 30  ? 137.664 129.311 84.857  1.00 37.00  ? 30   SER L CB  1 
ATOM   8952  O OG  . SER L  1 30  ? 137.994 128.451 86.006  1.00 43.86  ? 30   SER L OG  1 
ATOM   8953  N N   . SER L  1 31  ? 135.010 129.966 86.514  1.00 36.11  ? 31   SER L N   1 
ATOM   8954  C CA  . SER L  1 31  ? 134.085 129.795 87.650  1.00 37.42  ? 31   SER L CA  1 
ATOM   8955  C C   . SER L  1 31  ? 133.942 130.960 88.607  1.00 36.62  ? 31   SER L C   1 
ATOM   8956  O O   . SER L  1 31  ? 132.977 131.002 89.382  1.00 35.41  ? 31   SER L O   1 
ATOM   8957  C CB  . SER L  1 31  ? 134.485 128.570 88.484  1.00 37.97  ? 31   SER L CB  1 
ATOM   8958  O OG  . SER L  1 31  ? 133.582 128.359 89.570  1.00 41.30  ? 31   SER L OG  1 
ATOM   8959  N N   . TYR L  1 32  ? 134.909 131.873 88.598  1.00 36.35  ? 32   TYR L N   1 
ATOM   8960  C CA  . TYR L  1 32  ? 134.835 133.009 89.494  1.00 35.91  ? 32   TYR L CA  1 
ATOM   8961  C C   . TYR L  1 32  ? 133.615 133.818 89.068  1.00 36.27  ? 32   TYR L C   1 
ATOM   8962  O O   . TYR L  1 32  ? 133.747 134.932 88.551  1.00 37.50  ? 32   TYR L O   1 
ATOM   8963  C CB  . TYR L  1 32  ? 136.101 133.880 89.445  1.00 37.48  ? 32   TYR L CB  1 
ATOM   8964  C CG  . TYR L  1 32  ? 137.443 133.164 89.399  1.00 34.96  ? 32   TYR L CG  1 
ATOM   8965  C CD1 . TYR L  1 32  ? 137.965 132.720 88.191  1.00 27.49  ? 32   TYR L CD1 1 
ATOM   8966  C CD2 . TYR L  1 32  ? 138.211 132.980 90.549  1.00 38.83  ? 32   TYR L CD2 1 
ATOM   8967  C CE1 . TYR L  1 32  ? 139.194 132.084 88.119  1.00 33.94  ? 32   TYR L CE1 1 
ATOM   8968  C CE2 . TYR L  1 32  ? 139.451 132.339 90.492  1.00 41.90  ? 32   TYR L CE2 1 
ATOM   8969  C CZ  . TYR L  1 32  ? 139.935 131.896 89.272  1.00 37.26  ? 32   TYR L CZ  1 
ATOM   8970  O OH  . TYR L  1 32  ? 141.159 131.263 89.205  1.00 34.20  ? 32   TYR L OH  1 
ATOM   8971  N N   . LEU L  1 33  ? 132.430 133.240 89.237  1.00 35.38  ? 33   LEU L N   1 
ATOM   8972  C CA  . LEU L  1 33  ? 131.208 133.997 89.053  1.00 33.19  ? 33   LEU L CA  1 
ATOM   8973  C C   . LEU L  1 33  ? 130.586 134.281 90.408  1.00 31.89  ? 33   LEU L C   1 
ATOM   8974  O O   . LEU L  1 33  ? 130.348 133.368 91.204  1.00 29.49  ? 33   LEU L O   1 
ATOM   8975  C CB  . LEU L  1 33  ? 130.204 133.289 88.141  1.00 33.71  ? 33   LEU L CB  1 
ATOM   8976  C CG  . LEU L  1 33  ? 128.856 134.053 88.064  1.00 29.79  ? 33   LEU L CG  1 
ATOM   8977  C CD1 . LEU L  1 33  ? 128.824 135.082 86.933  1.00 25.56  ? 33   LEU L CD1 1 
ATOM   8978  C CD2 . LEU L  1 33  ? 127.691 133.087 87.862  1.00 24.77  ? 33   LEU L CD2 1 
ATOM   8979  N N   . ASN L  1 34  ? 130.328 135.564 90.652  1.00 31.74  ? 34   ASN L N   1 
ATOM   8980  C CA  . ASN L  1 34  ? 129.818 136.038 91.935  1.00 32.40  ? 34   ASN L CA  1 
ATOM   8981  C C   . ASN L  1 34  ? 128.398 136.531 91.814  1.00 31.89  ? 34   ASN L C   1 
ATOM   8982  O O   . ASN L  1 34  ? 128.094 137.401 90.988  1.00 33.04  ? 34   ASN L O   1 
ATOM   8983  C CB  . ASN L  1 34  ? 130.643 137.210 92.459  1.00 31.61  ? 34   ASN L CB  1 
ATOM   8984  C CG  . ASN L  1 34  ? 132.108 136.899 92.563  1.00 29.24  ? 34   ASN L CG  1 
ATOM   8985  O OD1 . ASN L  1 34  ? 132.691 136.958 93.654  1.00 36.63  ? 34   ASN L OD1 1 
ATOM   8986  N ND2 . ASN L  1 34  ? 132.734 136.576 91.437  1.00 28.94  ? 34   ASN L ND2 1 
ATOM   8987  N N   . TRP L  1 35  ? 127.528 136.018 92.674  1.00 30.93  ? 35   TRP L N   1 
ATOM   8988  C CA  . TRP L  1 35  ? 126.107 136.311 92.594  1.00 27.80  ? 35   TRP L CA  1 
ATOM   8989  C C   . TRP L  1 35  ? 125.718 137.369 93.666  1.00 27.47  ? 35   TRP L C   1 
ATOM   8990  O O   . TRP L  1 35  ? 125.742 137.077 94.867  1.00 30.26  ? 35   TRP L O   1 
ATOM   8991  C CB  . TRP L  1 35  ? 125.303 134.984 92.706  1.00 25.50  ? 35   TRP L CB  1 
ATOM   8992  C CG  . TRP L  1 35  ? 125.171 134.137 91.386  1.00 17.66  ? 35   TRP L CG  1 
ATOM   8993  C CD1 . TRP L  1 35  ? 125.783 132.941 91.072  1.00 19.83  ? 35   TRP L CD1 1 
ATOM   8994  C CD2 . TRP L  1 35  ? 124.355 134.465 90.259  1.00 8.13   ? 35   TRP L CD2 1 
ATOM   8995  N NE1 . TRP L  1 35  ? 125.391 132.517 89.813  1.00 19.68  ? 35   TRP L NE1 1 
ATOM   8996  C CE2 . TRP L  1 35  ? 124.516 133.435 89.296  1.00 15.55  ? 35   TRP L CE2 1 
ATOM   8997  C CE3 . TRP L  1 35  ? 123.502 135.536 89.972  1.00 18.04  ? 35   TRP L CE3 1 
ATOM   8998  C CZ2 . TRP L  1 35  ? 123.858 133.464 88.065  1.00 6.45   ? 35   TRP L CZ2 1 
ATOM   8999  C CZ3 . TRP L  1 35  ? 122.848 135.561 88.758  1.00 20.01  ? 35   TRP L CZ3 1 
ATOM   9000  C CH2 . TRP L  1 35  ? 123.023 134.534 87.815  1.00 18.11  ? 35   TRP L CH2 1 
ATOM   9001  N N   . TYR L  1 36  ? 125.374 138.594 93.236  1.00 26.32  ? 36   TYR L N   1 
ATOM   9002  C CA  . TYR L  1 36  ? 125.011 139.662 94.202  1.00 26.33  ? 36   TYR L CA  1 
ATOM   9003  C C   . TYR L  1 36  ? 123.514 139.884 94.391  1.00 26.73  ? 36   TYR L C   1 
ATOM   9004  O O   . TYR L  1 36  ? 122.668 139.144 93.878  1.00 25.70  ? 36   TYR L O   1 
ATOM   9005  C CB  . TYR L  1 36  ? 125.672 141.019 93.859  1.00 26.56  ? 36   TYR L CB  1 
ATOM   9006  C CG  . TYR L  1 36  ? 127.162 141.074 94.099  1.00 29.51  ? 36   TYR L CG  1 
ATOM   9007  C CD1 . TYR L  1 36  ? 128.049 140.645 93.116  1.00 25.81  ? 36   TYR L CD1 1 
ATOM   9008  C CD2 . TYR L  1 36  ? 127.693 141.575 95.294  1.00 29.45  ? 36   TYR L CD2 1 
ATOM   9009  C CE1 . TYR L  1 36  ? 129.427 140.695 93.308  1.00 34.55  ? 36   TYR L CE1 1 
ATOM   9010  C CE2 . TYR L  1 36  ? 129.078 141.633 95.500  1.00 29.34  ? 36   TYR L CE2 1 
ATOM   9011  C CZ  . TYR L  1 36  ? 129.936 141.190 94.500  1.00 34.41  ? 36   TYR L CZ  1 
ATOM   9012  O OH  . TYR L  1 36  ? 131.305 141.238 94.694  1.00 31.71  ? 36   TYR L OH  1 
ATOM   9013  N N   . GLN L  1 37  ? 123.230 140.938 95.147  1.00 26.69  ? 37   GLN L N   1 
ATOM   9014  C CA  . GLN L  1 37  ? 121.906 141.289 95.590  1.00 27.05  ? 37   GLN L CA  1 
ATOM   9015  C C   . GLN L  1 37  ? 122.014 142.739 95.968  1.00 29.99  ? 37   GLN L C   1 
ATOM   9016  O O   . GLN L  1 37  ? 122.839 143.111 96.800  1.00 33.08  ? 37   GLN L O   1 
ATOM   9017  C CB  . GLN L  1 37  ? 121.529 140.483 96.847  1.00 27.46  ? 37   GLN L CB  1 
ATOM   9018  C CG  . GLN L  1 37  ? 120.256 140.980 97.543  1.00 28.25  ? 37   GLN L CG  1 
ATOM   9019  C CD  . GLN L  1 37  ? 119.675 139.948 98.492  1.00 24.83  ? 37   GLN L CD  1 
ATOM   9020  O OE1 . GLN L  1 37  ? 119.181 140.276 99.574  1.00 18.92  ? 37   GLN L OE1 1 
ATOM   9021  N NE2 . GLN L  1 37  ? 119.739 138.678 98.089  1.00 25.17  ? 37   GLN L NE2 1 
ATOM   9022  N N   . GLN L  1 38  ? 121.168 143.558 95.370  1.00 28.17  ? 38   GLN L N   1 
ATOM   9023  C CA  . GLN L  1 38  ? 121.125 144.945 95.771  1.00 28.13  ? 38   GLN L CA  1 
ATOM   9024  C C   . GLN L  1 38  ? 119.732 145.334 96.259  1.00 29.08  ? 38   GLN L C   1 
ATOM   9025  O O   . GLN L  1 38  ? 118.792 145.468 95.418  1.00 27.65  ? 38   GLN L O   1 
ATOM   9026  C CB  . GLN L  1 38  ? 121.579 145.831 94.607  1.00 30.34  ? 38   GLN L CB  1 
ATOM   9027  C CG  . GLN L  1 38  ? 122.128 147.193 95.028  1.00 27.04  ? 38   GLN L CG  1 
ATOM   9028  C CD  . GLN L  1 38  ? 122.675 147.987 93.853  1.00 26.54  ? 38   GLN L CD  1 
ATOM   9029  O OE1 . GLN L  1 38  ? 121.972 148.225 92.871  1.00 31.17  ? 38   GLN L OE1 1 
ATOM   9030  N NE2 . GLN L  1 38  ? 123.931 148.413 93.953  1.00 24.95  ? 38   GLN L NE2 1 
ATOM   9031  N N   . LYS L  1 39  ? 119.587 145.483 97.590  1.00 30.79  ? 39   LYS L N   1 
ATOM   9032  C CA  . LYS L  1 39  ? 118.416 146.189 98.146  1.00 35.94  ? 39   LYS L CA  1 
ATOM   9033  C C   . LYS L  1 39  ? 118.196 147.480 97.366  1.00 37.83  ? 39   LYS L C   1 
ATOM   9034  O O   . LYS L  1 39  ? 119.143 148.016 96.782  1.00 39.43  ? 39   LYS L O   1 
ATOM   9035  C CB  . LYS L  1 39  ? 118.641 146.586 99.613  1.00 35.83  ? 39   LYS L CB  1 
ATOM   9036  C CG  . LYS L  1 39  ? 119.232 145.533 100.542 1.00 38.10  ? 39   LYS L CG  1 
ATOM   9037  C CD  . LYS L  1 39  ? 118.162 144.609 101.097 1.00 29.62  ? 39   LYS L CD  1 
ATOM   9038  C CE  . LYS L  1 39  ? 117.918 143.422 100.168 1.00 29.52  ? 39   LYS L CE  1 
ATOM   9039  N NZ  . LYS L  1 39  ? 116.972 142.445 100.783 1.00 39.17  ? 39   LYS L NZ  1 
ATOM   9040  N N   . PRO L  1 40  ? 116.961 148.007 97.382  1.00 39.60  ? 40   PRO L N   1 
ATOM   9041  C CA  . PRO L  1 40  ? 116.643 149.164 96.549  1.00 40.21  ? 40   PRO L CA  1 
ATOM   9042  C C   . PRO L  1 40  ? 117.400 150.436 96.953  1.00 41.70  ? 40   PRO L C   1 
ATOM   9043  O O   . PRO L  1 40  ? 116.806 151.354 97.527  1.00 40.98  ? 40   PRO L O   1 
ATOM   9044  C CB  . PRO L  1 40  ? 115.125 149.337 96.751  1.00 40.46  ? 40   PRO L CB  1 
ATOM   9045  C CG  . PRO L  1 40  ? 114.658 148.018 97.302  1.00 38.85  ? 40   PRO L CG  1 
ATOM   9046  C CD  . PRO L  1 40  ? 115.789 147.565 98.156  1.00 40.33  ? 40   PRO L CD  1 
ATOM   9047  N N   . GLY L  1 41  ? 118.701 150.488 96.646  1.00 42.67  ? 41   GLY L N   1 
ATOM   9048  C CA  . GLY L  1 41  ? 119.500 151.701 96.892  1.00 43.35  ? 41   GLY L CA  1 
ATOM   9049  C C   . GLY L  1 41  ? 120.549 151.564 97.985  1.00 43.79  ? 41   GLY L C   1 
ATOM   9050  O O   . GLY L  1 41  ? 121.486 152.371 98.070  1.00 42.25  ? 41   GLY L O   1 
ATOM   9051  N N   . LYS L  1 42  ? 120.348 150.567 98.849  1.00 44.29  ? 42   LYS L N   1 
ATOM   9052  C CA  . LYS L  1 42  ? 121.407 150.037 99.691  1.00 43.81  ? 42   LYS L CA  1 
ATOM   9053  C C   . LYS L  1 42  ? 122.462 149.554 98.705  1.00 44.16  ? 42   LYS L C   1 
ATOM   9054  O O   . LYS L  1 42  ? 122.734 150.219 97.698  1.00 43.87  ? 42   LYS L O   1 
ATOM   9055  C CB  . LYS L  1 42  ? 120.891 148.875 100.561 1.00 44.61  ? 42   LYS L CB  1 
ATOM   9056  C CG  . LYS L  1 42  ? 120.024 149.290 101.759 1.00 43.43  ? 42   LYS L CG  1 
ATOM   9057  C CD  . LYS L  1 42  ? 120.866 149.512 103.015 1.00 42.75  ? 42   LYS L CD  1 
ATOM   9058  C CE  . LYS L  1 42  ? 120.051 150.112 104.162 1.00 45.54  ? 42   LYS L CE  1 
ATOM   9059  N NZ  . LYS L  1 42  ? 118.983 149.149 104.704 1.00 41.90  ? 42   LYS L NZ  1 
ATOM   9060  N N   . ALA L  1 43  ? 123.058 148.401 98.951  1.00 45.68  ? 43   ALA L N   1 
ATOM   9061  C CA  . ALA L  1 43  ? 124.166 148.023 98.099  1.00 46.32  ? 43   ALA L CA  1 
ATOM   9062  C C   . ALA L  1 43  ? 124.204 146.533 97.768  1.00 46.51  ? 43   ALA L C   1 
ATOM   9063  O O   . ALA L  1 43  ? 123.439 145.744 98.327  1.00 47.06  ? 43   ALA L O   1 
ATOM   9064  C CB  . ALA L  1 43  ? 125.515 148.507 98.741  1.00 45.49  ? 43   ALA L CB  1 
ATOM   9065  N N   . PRO L  1 44  ? 125.097 146.159 96.834  1.00 45.88  ? 44   PRO L N   1 
ATOM   9066  C CA  . PRO L  1 44  ? 125.310 144.807 96.348  1.00 45.97  ? 44   PRO L CA  1 
ATOM   9067  C C   . PRO L  1 44  ? 125.856 143.895 97.439  1.00 46.34  ? 44   PRO L C   1 
ATOM   9068  O O   . PRO L  1 44  ? 127.076 143.722 97.551  1.00 46.02  ? 44   PRO L O   1 
ATOM   9069  C CB  . PRO L  1 44  ? 126.368 144.994 95.242  1.00 46.16  ? 44   PRO L CB  1 
ATOM   9070  C CG  . PRO L  1 44  ? 126.290 146.424 94.875  1.00 46.13  ? 44   PRO L CG  1 
ATOM   9071  C CD  . PRO L  1 44  ? 125.998 147.108 96.156  1.00 45.12  ? 44   PRO L CD  1 
ATOM   9072  N N   . LYS L  1 45  ? 124.967 143.320 98.243  1.00 45.32  ? 45   LYS L N   1 
ATOM   9073  C CA  . LYS L  1 45  ? 125.404 142.399 99.288  1.00 45.71  ? 45   LYS L CA  1 
ATOM   9074  C C   . LYS L  1 45  ? 125.646 141.000 98.701  1.00 44.11  ? 45   LYS L C   1 
ATOM   9075  O O   . LYS L  1 45  ? 124.741 140.392 98.125  1.00 44.68  ? 45   LYS L O   1 
ATOM   9076  C CB  . LYS L  1 45  ? 124.416 142.387 100.465 1.00 45.94  ? 45   LYS L CB  1 
ATOM   9077  C CG  . LYS L  1 45  ? 123.913 143.785 100.864 1.00 46.30  ? 45   LYS L CG  1 
ATOM   9078  C CD  . LYS L  1 45  ? 123.698 143.951 102.373 1.00 47.00  ? 45   LYS L CD  1 
ATOM   9079  C CE  . LYS L  1 45  ? 122.551 143.066 102.877 1.00 51.37  ? 45   LYS L CE  1 
ATOM   9080  N NZ  . LYS L  1 45  ? 122.591 142.887 104.395 1.00 52.91  ? 45   LYS L NZ  1 
ATOM   9081  N N   . LEU L  1 46  ? 126.884 140.514 98.834  1.00 42.87  ? 46   LEU L N   1 
ATOM   9082  C CA  . LEU L  1 46  ? 127.311 139.239 98.233  1.00 42.16  ? 46   LEU L CA  1 
ATOM   9083  C C   . LEU L  1 46  ? 126.652 138.003 98.860  1.00 41.93  ? 46   LEU L C   1 
ATOM   9084  O O   . LEU L  1 46  ? 126.399 137.971 100.068 1.00 40.44  ? 46   LEU L O   1 
ATOM   9085  C CB  . LEU L  1 46  ? 128.837 139.108 98.295  1.00 41.25  ? 46   LEU L CB  1 
ATOM   9086  C CG  . LEU L  1 46  ? 129.468 137.898 97.590  1.00 41.64  ? 46   LEU L CG  1 
ATOM   9087  C CD1 . LEU L  1 46  ? 129.472 138.090 96.076  1.00 42.76  ? 46   LEU L CD1 1 
ATOM   9088  C CD2 . LEU L  1 46  ? 130.882 137.671 98.102  1.00 38.46  ? 46   LEU L CD2 1 
ATOM   9089  N N   . LEU L  1 47  ? 126.393 136.989 98.031  1.00 40.30  ? 47   LEU L N   1 
ATOM   9090  C CA  . LEU L  1 47  ? 125.694 135.770 98.456  1.00 39.51  ? 47   LEU L CA  1 
ATOM   9091  C C   . LEU L  1 47  ? 126.455 134.505 98.041  1.00 38.14  ? 47   LEU L C   1 
ATOM   9092  O O   . LEU L  1 47  ? 126.611 133.567 98.840  1.00 36.21  ? 47   LEU L O   1 
ATOM   9093  C CB  . LEU L  1 47  ? 124.278 135.717 97.861  1.00 40.22  ? 47   LEU L CB  1 
ATOM   9094  C CG  . LEU L  1 47  ? 123.463 136.994 97.598  1.00 45.57  ? 47   LEU L CG  1 
ATOM   9095  C CD1 . LEU L  1 47  ? 122.268 136.680 96.705  1.00 46.26  ? 47   LEU L CD1 1 
ATOM   9096  C CD2 . LEU L  1 47  ? 123.016 137.652 98.901  1.00 45.90  ? 47   LEU L CD2 1 
ATOM   9097  N N   . ILE L  1 48  ? 126.897 134.486 96.780  1.00 37.50  ? 48   ILE L N   1 
ATOM   9098  C CA  . ILE L  1 48  ? 127.714 133.410 96.203  1.00 37.53  ? 48   ILE L CA  1 
ATOM   9099  C C   . ILE L  1 48  ? 128.975 133.993 95.544  1.00 37.56  ? 48   ILE L C   1 
ATOM   9100  O O   . ILE L  1 48  ? 129.009 135.159 95.151  1.00 38.14  ? 48   ILE L O   1 
ATOM   9101  C CB  . ILE L  1 48  ? 126.942 132.604 95.096  1.00 36.10  ? 48   ILE L CB  1 
ATOM   9102  C CG1 . ILE L  1 48  ? 125.476 132.280 95.481  1.00 37.82  ? 48   ILE L CG1 1 
ATOM   9103  C CG2 . ILE L  1 48  ? 127.672 131.325 94.710  1.00 34.88  ? 48   ILE L CG2 1 
ATOM   9104  C CD1 . ILE L  1 48  ? 125.457 131.284 96.854  1.00 45.15  ? 48   ILE L CD1 1 
ATOM   9105  N N   . TYR L  1 49  ? 129.996 133.150 95.434  1.00 38.17  ? 49   TYR L N   1 
ATOM   9106  C CA  . TYR L  1 49  ? 131.168 133.350 94.582  1.00 39.29  ? 49   TYR L CA  1 
ATOM   9107  C C   . TYR L  1 49  ? 131.588 131.902 94.318  1.00 39.10  ? 49   TYR L C   1 
ATOM   9108  O O   . TYR L  1 49  ? 130.819 130.985 94.642  1.00 39.13  ? 49   TYR L O   1 
ATOM   9109  C CB  . TYR L  1 49  ? 132.260 134.111 95.327  1.00 40.45  ? 49   TYR L CB  1 
ATOM   9110  C CG  . TYR L  1 49  ? 132.510 133.453 96.635  1.00 44.23  ? 49   TYR L CG  1 
ATOM   9111  C CD1 . TYR L  1 49  ? 133.473 132.467 96.761  1.00 40.11  ? 49   TYR L CD1 1 
ATOM   9112  C CD2 . TYR L  1 49  ? 131.712 133.745 97.733  1.00 48.68  ? 49   TYR L CD2 1 
ATOM   9113  C CE1 . TYR L  1 49  ? 133.661 131.827 97.950  1.00 48.38  ? 49   TYR L CE1 1 
ATOM   9114  C CE2 . TYR L  1 49  ? 131.893 133.100 98.927  1.00 47.57  ? 49   TYR L CE2 1 
ATOM   9115  C CZ  . TYR L  1 49  ? 132.875 132.146 99.035  1.00 48.46  ? 49   TYR L CZ  1 
ATOM   9116  O OH  . TYR L  1 49  ? 133.074 131.501 100.235 1.00 49.88  ? 49   TYR L OH  1 
ATOM   9117  N N   . ALA L  1 50  ? 132.791 131.673 93.772  1.00 38.01  ? 50   ALA L N   1 
ATOM   9118  C CA  . ALA L  1 50  ? 133.164 130.310 93.346  1.00 38.96  ? 50   ALA L CA  1 
ATOM   9119  C C   . ALA L  1 50  ? 131.963 129.570 92.744  1.00 38.64  ? 50   ALA L C   1 
ATOM   9120  O O   . ALA L  1 50  ? 131.764 128.377 92.999  1.00 37.10  ? 50   ALA L O   1 
ATOM   9121  C CB  . ALA L  1 50  ? 133.778 129.518 94.509  1.00 39.46  ? 50   ALA L CB  1 
ATOM   9122  N N   . ALA L  1 51  ? 131.173 130.307 91.952  1.00 39.64  ? 51   ALA L N   1 
ATOM   9123  C CA  . ALA L  1 51  ? 129.949 129.816 91.290  1.00 39.82  ? 51   ALA L CA  1 
ATOM   9124  C C   . ALA L  1 51  ? 128.874 129.259 92.238  1.00 40.99  ? 51   ALA L C   1 
ATOM   9125  O O   . ALA L  1 51  ? 127.687 129.188 91.881  1.00 41.82  ? 51   ALA L O   1 
ATOM   9126  C CB  . ALA L  1 51  ? 130.304 128.764 90.222  1.00 40.96  ? 51   ALA L CB  1 
ATOM   9127  N N   . SER L  1 52  ? 129.293 128.901 93.460  1.00 39.54  ? 52   SER L N   1 
ATOM   9128  C CA  . SER L  1 52  ? 128.646 127.774 94.157  1.00 38.53  ? 52   SER L CA  1 
ATOM   9129  C C   . SER L  1 52  ? 128.615 127.869 95.685  1.00 39.19  ? 52   SER L C   1 
ATOM   9130  O O   . SER L  1 52  ? 127.645 127.432 96.312  1.00 40.14  ? 52   SER L O   1 
ATOM   9131  C CB  . SER L  1 52  ? 129.377 126.469 93.772  1.00 38.57  ? 52   SER L CB  1 
ATOM   9132  O OG  . SER L  1 52  ? 130.677 126.442 94.373  1.00 34.03  ? 52   SER L OG  1 
ATOM   9133  N N   . SER L  1 53  ? 129.672 128.413 96.288  1.00 38.87  ? 53   SER L N   1 
ATOM   9134  C CA  . SER L  1 53  ? 129.689 128.512 97.746  1.00 39.29  ? 53   SER L CA  1 
ATOM   9135  C C   . SER L  1 53  ? 128.864 129.696 98.235  1.00 40.44  ? 53   SER L C   1 
ATOM   9136  O O   . SER L  1 53  ? 128.833 130.767 97.617  1.00 38.84  ? 53   SER L O   1 
ATOM   9137  C CB  . SER L  1 53  ? 131.119 128.536 98.300  1.00 38.98  ? 53   SER L CB  1 
ATOM   9138  O OG  . SER L  1 53  ? 131.463 129.811 98.800  1.00 38.96  ? 53   SER L OG  1 
ATOM   9139  N N   . LEU L  1 54  ? 128.194 129.462 99.356  1.00 41.69  ? 54   LEU L N   1 
ATOM   9140  C CA  . LEU L  1 54  ? 127.347 130.438 100.000 1.00 41.92  ? 54   LEU L CA  1 
ATOM   9141  C C   . LEU L  1 54  ? 128.133 131.109 101.115 1.00 43.03  ? 54   LEU L C   1 
ATOM   9142  O O   . LEU L  1 54  ? 129.145 130.578 101.584 1.00 44.34  ? 54   LEU L O   1 
ATOM   9143  C CB  . LEU L  1 54  ? 126.131 129.721 100.573 1.00 40.51  ? 54   LEU L CB  1 
ATOM   9144  C CG  . LEU L  1 54  ? 124.984 130.531 101.175 1.00 38.97  ? 54   LEU L CG  1 
ATOM   9145  C CD1 . LEU L  1 54  ? 124.106 131.055 100.057 1.00 38.55  ? 54   LEU L CD1 1 
ATOM   9146  C CD2 . LEU L  1 54  ? 124.192 129.608 102.083 1.00 39.66  ? 54   LEU L CD2 1 
ATOM   9147  N N   . GLN L  1 55  ? 127.654 132.268 101.554 1.00 43.66  ? 55   GLN L N   1 
ATOM   9148  C CA  . GLN L  1 55  ? 128.335 133.064 102.567 1.00 45.09  ? 55   GLN L CA  1 
ATOM   9149  C C   . GLN L  1 55  ? 127.681 132.917 103.946 1.00 45.75  ? 55   GLN L C   1 
ATOM   9150  O O   . GLN L  1 55  ? 126.619 132.300 104.080 1.00 46.82  ? 55   GLN L O   1 
ATOM   9151  C CB  . GLN L  1 55  ? 128.355 134.537 102.135 1.00 45.86  ? 55   GLN L CB  1 
ATOM   9152  C CG  . GLN L  1 55  ? 129.193 134.831 100.887 1.00 43.35  ? 55   GLN L CG  1 
ATOM   9153  C CD  . GLN L  1 55  ? 130.634 135.199 101.213 1.00 41.69  ? 55   GLN L CD  1 
ATOM   9154  O OE1 . GLN L  1 55  ? 131.439 135.524 100.303 1.00 41.96  ? 55   GLN L OE1 1 
ATOM   9155  N NE2 . GLN L  1 55  ? 130.964 135.178 102.513 1.00 30.17  ? 55   GLN L NE2 1 
ATOM   9156  N N   . SER L  1 56  ? 128.337 133.471 104.969 1.00 45.57  ? 56   SER L N   1 
ATOM   9157  C CA  . SER L  1 56  ? 127.737 133.607 106.297 1.00 46.58  ? 56   SER L CA  1 
ATOM   9158  C C   . SER L  1 56  ? 126.770 134.785 106.299 1.00 47.58  ? 56   SER L C   1 
ATOM   9159  O O   . SER L  1 56  ? 127.115 135.892 105.874 1.00 47.62  ? 56   SER L O   1 
ATOM   9160  C CB  . SER L  1 56  ? 128.806 133.782 107.379 1.00 46.72  ? 56   SER L CB  1 
ATOM   9161  O OG  . SER L  1 56  ? 129.356 132.526 107.766 1.00 48.74  ? 56   SER L OG  1 
ATOM   9162  N N   . GLY L  1 57  ? 125.559 134.531 106.783 1.00 46.37  ? 57   GLY L N   1 
ATOM   9163  C CA  . GLY L  1 57  ? 124.464 135.483 106.681 1.00 45.02  ? 57   GLY L CA  1 
ATOM   9164  C C   . GLY L  1 57  ? 123.438 134.982 105.681 1.00 44.61  ? 57   GLY L C   1 
ATOM   9165  O O   . GLY L  1 57  ? 122.269 134.795 106.026 1.00 41.48  ? 57   GLY L O   1 
ATOM   9166  N N   . VAL L  1 58  ? 123.882 134.754 104.446 1.00 45.20  ? 58   VAL L N   1 
ATOM   9167  C CA  . VAL L  1 58  ? 122.972 134.353 103.372 1.00 45.86  ? 58   VAL L CA  1 
ATOM   9168  C C   . VAL L  1 58  ? 122.349 132.966 103.628 1.00 45.69  ? 58   VAL L C   1 
ATOM   9169  O O   . VAL L  1 58  ? 123.065 131.961 103.712 1.00 44.59  ? 58   VAL L O   1 
ATOM   9170  C CB  . VAL L  1 58  ? 123.611 134.532 101.954 1.00 45.87  ? 58   VAL L CB  1 
ATOM   9171  C CG1 . VAL L  1 58  ? 125.039 134.083 101.930 1.00 49.97  ? 58   VAL L CG1 1 
ATOM   9172  C CG2 . VAL L  1 58  ? 122.774 133.868 100.857 1.00 43.22  ? 58   VAL L CG2 1 
ATOM   9173  N N   . PRO L  1 59  ? 121.006 132.935 103.791 1.00 45.57  ? 59   PRO L N   1 
ATOM   9174  C CA  . PRO L  1 59  ? 120.216 131.739 104.069 1.00 45.25  ? 59   PRO L CA  1 
ATOM   9175  C C   . PRO L  1 59  ? 120.563 130.612 103.115 1.00 45.72  ? 59   PRO L C   1 
ATOM   9176  O O   . PRO L  1 59  ? 121.106 130.852 102.028 1.00 46.39  ? 59   PRO L O   1 
ATOM   9177  C CB  . PRO L  1 59  ? 118.782 132.200 103.802 1.00 46.31  ? 59   PRO L CB  1 
ATOM   9178  C CG  . PRO L  1 59  ? 118.811 133.630 104.118 1.00 43.89  ? 59   PRO L CG  1 
ATOM   9179  C CD  . PRO L  1 59  ? 120.149 134.140 103.702 1.00 44.69  ? 59   PRO L CD  1 
ATOM   9180  N N   . SER L  1 60  ? 120.228 129.390 103.508 1.00 45.43  ? 60   SER L N   1 
ATOM   9181  C CA  . SER L  1 60  ? 120.612 128.200 102.755 1.00 44.00  ? 60   SER L CA  1 
ATOM   9182  C C   . SER L  1 60  ? 119.611 127.799 101.653 1.00 44.91  ? 60   SER L C   1 
ATOM   9183  O O   . SER L  1 60  ? 119.256 126.622 101.523 1.00 46.56  ? 60   SER L O   1 
ATOM   9184  C CB  . SER L  1 60  ? 120.881 127.037 103.721 1.00 44.77  ? 60   SER L CB  1 
ATOM   9185  O OG  . SER L  1 60  ? 119.797 126.849 104.616 1.00 47.92  ? 60   SER L OG  1 
ATOM   9186  N N   . ARG L  1 61  ? 119.178 128.781 100.858 1.00 43.80  ? 61   ARG L N   1 
ATOM   9187  C CA  . ARG L  1 61  ? 118.235 128.556 99.746  1.00 41.78  ? 61   ARG L CA  1 
ATOM   9188  C C   . ARG L  1 61  ? 118.620 129.337 98.492  1.00 40.83  ? 61   ARG L C   1 
ATOM   9189  O O   . ARG L  1 61  ? 117.936 129.279 97.451  1.00 37.30  ? 61   ARG L O   1 
ATOM   9190  C CB  . ARG L  1 61  ? 116.825 128.939 100.166 1.00 42.08  ? 61   ARG L CB  1 
ATOM   9191  C CG  . ARG L  1 61  ? 116.597 130.423 100.179 1.00 41.43  ? 61   ARG L CG  1 
ATOM   9192  C CD  . ARG L  1 61  ? 116.092 130.801 101.532 1.00 40.29  ? 61   ARG L CD  1 
ATOM   9193  N NE  . ARG L  1 61  ? 116.557 132.134 101.874 1.00 44.26  ? 61   ARG L NE  1 
ATOM   9194  C CZ  . ARG L  1 61  ? 115.866 133.242 101.638 1.00 45.96  ? 61   ARG L CZ  1 
ATOM   9195  N NH1 . ARG L  1 61  ? 114.670 133.180 101.060 1.00 41.69  ? 61   ARG L NH1 1 
ATOM   9196  N NH2 . ARG L  1 61  ? 116.363 134.421 101.982 1.00 44.41  ? 61   ARG L NH2 1 
ATOM   9197  N N   . PHE L  1 62  ? 119.718 130.081 98.624  1.00 39.83  ? 62   PHE L N   1 
ATOM   9198  C CA  . PHE L  1 62  ? 120.345 130.715 97.501  1.00 39.10  ? 62   PHE L CA  1 
ATOM   9199  C C   . PHE L  1 62  ? 121.431 129.738 97.090  1.00 39.21  ? 62   PHE L C   1 
ATOM   9200  O O   . PHE L  1 62  ? 122.315 129.419 97.896  1.00 41.48  ? 62   PHE L O   1 
ATOM   9201  C CB  . PHE L  1 62  ? 120.996 132.021 97.960  1.00 38.13  ? 62   PHE L CB  1 
ATOM   9202  C CG  . PHE L  1 62  ? 120.058 133.196 98.027  1.00 37.22  ? 62   PHE L CG  1 
ATOM   9203  C CD1 . PHE L  1 62  ? 119.645 133.706 99.257  1.00 39.76  ? 62   PHE L CD1 1 
ATOM   9204  C CD2 . PHE L  1 62  ? 119.638 133.836 96.866  1.00 37.40  ? 62   PHE L CD2 1 
ATOM   9205  C CE1 . PHE L  1 62  ? 118.797 134.818 99.327  1.00 37.82  ? 62   PHE L CE1 1 
ATOM   9206  C CE2 . PHE L  1 62  ? 118.791 134.943 96.927  1.00 38.45  ? 62   PHE L CE2 1 
ATOM   9207  C CZ  . PHE L  1 62  ? 118.369 135.439 98.158  1.00 36.59  ? 62   PHE L CZ  1 
ATOM   9208  N N   . SER L  1 63  ? 121.365 129.231 95.859  1.00 39.55  ? 63   SER L N   1 
ATOM   9209  C CA  . SER L  1 63  ? 122.476 128.424 95.338  1.00 39.83  ? 63   SER L CA  1 
ATOM   9210  C C   . SER L  1 63  ? 122.877 128.763 93.904  1.00 40.67  ? 63   SER L C   1 
ATOM   9211  O O   . SER L  1 63  ? 122.174 129.477 93.182  1.00 38.18  ? 63   SER L O   1 
ATOM   9212  C CB  . SER L  1 63  ? 122.226 126.913 95.497  1.00 39.22  ? 63   SER L CB  1 
ATOM   9213  O OG  . SER L  1 63  ? 120.812 126.584 94.967  1.00 40.55  ? 63   SER L OG  1 
ATOM   9214  N N   . GLY L  1 64  ? 124.034 128.224 93.532  1.00 42.00  ? 64   GLY L N   1 
ATOM   9215  C CA  . GLY L  1 64  ? 124.685 128.514 92.268  1.00 42.85  ? 64   GLY L CA  1 
ATOM   9216  C C   . GLY L  1 64  ? 125.230 127.235 91.672  1.00 44.85  ? 64   GLY L C   1 
ATOM   9217  O O   . GLY L  1 64  ? 126.275 126.721 92.081  1.00 44.42  ? 64   GLY L O   1 
ATOM   9218  N N   . SER L  1 65  ? 124.475 126.715 90.717  1.00 45.39  ? 65   SER L N   1 
ATOM   9219  C CA  . SER L  1 65  ? 124.904 125.641 89.849  1.00 45.26  ? 65   SER L CA  1 
ATOM   9220  C C   . SER L  1 65  ? 125.747 126.269 88.744  1.00 46.18  ? 65   SER L C   1 
ATOM   9221  O O   . SER L  1 65  ? 125.746 127.495 88.590  1.00 48.78  ? 65   SER L O   1 
ATOM   9222  C CB  . SER L  1 65  ? 123.651 125.031 89.214  1.00 46.17  ? 65   SER L CB  1 
ATOM   9223  O OG  . SER L  1 65  ? 122.777 126.084 88.761  1.00 46.14  ? 65   SER L OG  1 
ATOM   9224  N N   . GLY L  1 66  ? 126.466 125.448 87.972  1.00 44.80  ? 66   GLY L N   1 
ATOM   9225  C CA  . GLY L  1 66  ? 126.994 125.914 86.669  1.00 42.78  ? 66   GLY L CA  1 
ATOM   9226  C C   . GLY L  1 66  ? 128.480 125.752 86.357  1.00 42.41  ? 66   GLY L C   1 
ATOM   9227  O O   . GLY L  1 66  ? 129.335 126.134 87.165  1.00 43.02  ? 66   GLY L O   1 
ATOM   9228  N N   . SER L  1 67  ? 128.788 125.219 85.170  1.00 38.92  ? 67   SER L N   1 
ATOM   9229  C CA  . SER L  1 67  ? 130.179 124.908 84.782  1.00 36.04  ? 67   SER L CA  1 
ATOM   9230  C C   . SER L  1 67  ? 130.836 125.909 83.807  1.00 35.82  ? 67   SER L C   1 
ATOM   9231  O O   . SER L  1 67  ? 131.030 125.622 82.622  1.00 33.09  ? 67   SER L O   1 
ATOM   9232  C CB  . SER L  1 67  ? 130.298 123.470 84.251  1.00 37.11  ? 67   SER L CB  1 
ATOM   9233  O OG  . SER L  1 67  ? 131.657 123.139 83.982  1.00 27.05  ? 67   SER L OG  1 
ATOM   9234  N N   . GLY L  1 68  ? 131.171 127.081 84.344  1.00 34.40  ? 68   GLY L N   1 
ATOM   9235  C CA  . GLY L  1 68  ? 131.998 128.108 83.649  1.00 33.71  ? 68   GLY L CA  1 
ATOM   9236  C C   . GLY L  1 68  ? 131.652 128.828 82.345  1.00 34.32  ? 68   GLY L C   1 
ATOM   9237  O O   . GLY L  1 68  ? 132.561 129.385 81.732  1.00 31.47  ? 68   GLY L O   1 
ATOM   9238  N N   . THR L  1 69  ? 130.391 128.857 81.902  1.00 35.38  ? 69   THR L N   1 
ATOM   9239  C CA  . THR L  1 69  ? 130.033 129.714 80.742  1.00 35.28  ? 69   THR L CA  1 
ATOM   9240  C C   . THR L  1 69  ? 128.560 130.130 80.650  1.00 35.91  ? 69   THR L C   1 
ATOM   9241  O O   . THR L  1 69  ? 128.237 131.152 80.051  1.00 34.19  ? 69   THR L O   1 
ATOM   9242  C CB  . THR L  1 69  ? 130.564 129.175 79.378  1.00 35.34  ? 69   THR L CB  1 
ATOM   9243  O OG1 . THR L  1 69  ? 130.456 130.203 78.382  1.00 40.24  ? 69   THR L OG1 1 
ATOM   9244  C CG2 . THR L  1 69  ? 129.795 127.937 78.925  1.00 34.45  ? 69   THR L CG2 1 
ATOM   9245  N N   . ASP L  1 70  ? 127.700 129.287 81.211  1.00 37.58  ? 70   ASP L N   1 
ATOM   9246  C CA  . ASP L  1 70  ? 126.379 129.658 81.690  1.00 37.79  ? 70   ASP L CA  1 
ATOM   9247  C C   . ASP L  1 70  ? 126.344 129.170 83.125  1.00 37.03  ? 70   ASP L C   1 
ATOM   9248  O O   . ASP L  1 70  ? 126.898 128.115 83.449  1.00 38.98  ? 70   ASP L O   1 
ATOM   9249  C CB  . ASP L  1 70  ? 125.262 128.982 80.881  1.00 37.95  ? 70   ASP L CB  1 
ATOM   9250  C CG  . ASP L  1 70  ? 125.562 127.521 80.575  1.00 42.88  ? 70   ASP L CG  1 
ATOM   9251  O OD1 . ASP L  1 70  ? 126.605 127.241 79.935  1.00 45.37  ? 70   ASP L OD1 1 
ATOM   9252  O OD2 . ASP L  1 70  ? 124.748 126.647 80.958  1.00 42.84  ? 70   ASP L OD2 1 
ATOM   9253  N N   . PHE L  1 71  ? 125.712 129.953 83.987  1.00 35.58  ? 71   PHE L N   1 
ATOM   9254  C CA  . PHE L  1 71  ? 125.467 129.550 85.355  1.00 34.18  ? 71   PHE L CA  1 
ATOM   9255  C C   . PHE L  1 71  ? 124.001 129.843 85.594  1.00 34.62  ? 71   PHE L C   1 
ATOM   9256  O O   . PHE L  1 71  ? 123.283 130.240 84.670  1.00 35.42  ? 71   PHE L O   1 
ATOM   9257  C CB  . PHE L  1 71  ? 126.343 130.354 86.319  1.00 35.22  ? 71   PHE L CB  1 
ATOM   9258  C CG  . PHE L  1 71  ? 127.817 130.191 86.085  1.00 34.17  ? 71   PHE L CG  1 
ATOM   9259  C CD1 . PHE L  1 71  ? 128.397 130.641 84.902  1.00 37.47  ? 71   PHE L CD1 1 
ATOM   9260  C CD2 . PHE L  1 71  ? 128.628 129.608 87.052  1.00 38.49  ? 71   PHE L CD2 1 
ATOM   9261  C CE1 . PHE L  1 71  ? 129.739 130.500 84.677  1.00 37.53  ? 71   PHE L CE1 1 
ATOM   9262  C CE2 . PHE L  1 71  ? 129.986 129.467 86.830  1.00 40.57  ? 71   PHE L CE2 1 
ATOM   9263  C CZ  . PHE L  1 71  ? 130.540 129.918 85.645  1.00 38.68  ? 71   PHE L CZ  1 
ATOM   9264  N N   . THR L  1 72  ? 123.558 129.647 86.831  1.00 33.12  ? 72   THR L N   1 
ATOM   9265  C CA  . THR L  1 72  ? 122.180 129.926 87.204  1.00 31.78  ? 72   THR L CA  1 
ATOM   9266  C C   . THR L  1 72  ? 122.014 130.022 88.725  1.00 33.85  ? 72   THR L C   1 
ATOM   9267  O O   . THR L  1 72  ? 122.290 129.059 89.450  1.00 33.52  ? 72   THR L O   1 
ATOM   9268  C CB  . THR L  1 72  ? 121.175 128.904 86.567  1.00 34.32  ? 72   THR L CB  1 
ATOM   9269  O OG1 . THR L  1 72  ? 119.899 128.980 87.217  1.00 37.44  ? 72   THR L OG1 1 
ATOM   9270  C CG2 . THR L  1 72  ? 121.687 127.458 86.615  1.00 18.86  ? 72   THR L CG2 1 
ATOM   9271  N N   . LEU L  1 73  ? 121.593 131.198 89.200  1.00 36.17  ? 73   LEU L N   1 
ATOM   9272  C CA  . LEU L  1 73  ? 121.211 131.405 90.602  1.00 38.70  ? 73   LEU L CA  1 
ATOM   9273  C C   . LEU L  1 73  ? 119.796 130.883 90.825  1.00 39.82  ? 73   LEU L C   1 
ATOM   9274  O O   . LEU L  1 73  ? 118.834 131.431 90.245  1.00 40.44  ? 73   LEU L O   1 
ATOM   9275  C CB  . LEU L  1 73  ? 121.277 132.905 90.974  1.00 38.74  ? 73   LEU L CB  1 
ATOM   9276  C CG  . LEU L  1 73  ? 120.268 133.525 91.969  1.00 35.97  ? 73   LEU L CG  1 
ATOM   9277  C CD1 . LEU L  1 73  ? 120.927 134.594 92.844  1.00 39.07  ? 73   LEU L CD1 1 
ATOM   9278  C CD2 . LEU L  1 73  ? 119.036 134.097 91.267  1.00 32.28  ? 73   LEU L CD2 1 
ATOM   9279  N N   . THR L  1 74  ? 119.624 129.822 91.605  1.00 42.10  ? 74   THR L N   1 
ATOM   9280  C CA  . THR L  1 74  ? 118.255 129.466 92.000  1.00 43.21  ? 74   THR L CA  1 
ATOM   9281  C C   . THR L  1 74  ? 117.944 130.035 93.368  1.00 42.20  ? 74   THR L C   1 
ATOM   9282  O O   . THR L  1 74  ? 118.746 129.912 94.295  1.00 42.84  ? 74   THR L O   1 
ATOM   9283  C CB  . THR L  1 74  ? 117.965 127.941 92.018  1.00 42.80  ? 74   THR L CB  1 
ATOM   9284  O OG1 . THR L  1 74  ? 117.274 127.612 93.254  1.00 44.59  ? 74   THR L OG1 1 
ATOM   9285  C CG2 . THR L  1 74  ? 119.251 127.123 91.927  1.00 45.61  ? 74   THR L CG2 1 
ATOM   9286  N N   . ILE L  1 75  ? 116.774 130.652 93.492  1.00 42.12  ? 75   ILE L N   1 
ATOM   9287  C CA  . ILE L  1 75  ? 116.247 131.070 94.789  1.00 41.07  ? 75   ILE L CA  1 
ATOM   9288  C C   . ILE L  1 75  ? 115.042 130.169 95.039  1.00 41.83  ? 75   ILE L C   1 
ATOM   9289  O O   . ILE L  1 75  ? 114.224 129.973 94.138  1.00 43.31  ? 75   ILE L O   1 
ATOM   9290  C CB  . ILE L  1 75  ? 115.825 132.551 94.770  1.00 40.83  ? 75   ILE L CB  1 
ATOM   9291  C CG1 . ILE L  1 75  ? 116.993 133.430 94.307  1.00 38.44  ? 75   ILE L CG1 1 
ATOM   9292  C CG2 . ILE L  1 75  ? 115.324 132.989 96.158  1.00 41.88  ? 75   ILE L CG2 1 
ATOM   9293  C CD1 . ILE L  1 75  ? 116.579 134.832 93.876  1.00 38.99  ? 75   ILE L CD1 1 
ATOM   9294  N N   . SER L  1 76  ? 114.930 129.628 96.255  1.00 43.38  ? 76   SER L N   1 
ATOM   9295  C CA  . SER L  1 76  ? 114.035 128.487 96.497  1.00 43.89  ? 76   SER L CA  1 
ATOM   9296  C C   . SER L  1 76  ? 112.641 128.845 96.999  1.00 44.37  ? 76   SER L C   1 
ATOM   9297  O O   . SER L  1 76  ? 111.633 128.266 96.566  1.00 44.31  ? 76   SER L O   1 
ATOM   9298  C CB  . SER L  1 76  ? 114.690 127.522 97.489  1.00 42.87  ? 76   SER L CB  1 
ATOM   9299  O OG  . SER L  1 76  ? 115.611 126.659 96.818  1.00 45.32  ? 76   SER L OG  1 
ATOM   9300  N N   . SER L  1 77  ? 112.617 129.786 97.934  1.00 44.24  ? 77   SER L N   1 
ATOM   9301  C CA  . SER L  1 77  ? 111.424 130.173 98.647  1.00 43.71  ? 77   SER L CA  1 
ATOM   9302  C C   . SER L  1 77  ? 111.653 131.636 98.920  1.00 41.89  ? 77   SER L C   1 
ATOM   9303  O O   . SER L  1 77  ? 112.612 132.017 99.607  1.00 41.62  ? 77   SER L O   1 
ATOM   9304  C CB  . SER L  1 77  ? 111.309 129.401 99.963  1.00 44.13  ? 77   SER L CB  1 
ATOM   9305  O OG  . SER L  1 77  ? 110.213 129.860 100.733 1.00 48.75  ? 77   SER L OG  1 
ATOM   9306  N N   . LEU L  1 78  ? 110.764 132.451 98.360  1.00 41.00  ? 78   LEU L N   1 
ATOM   9307  C CA  . LEU L  1 78  ? 110.970 133.871 98.306  1.00 40.99  ? 78   LEU L CA  1 
ATOM   9308  C C   . LEU L  1 78  ? 110.221 134.523 99.449  1.00 42.14  ? 78   LEU L C   1 
ATOM   9309  O O   . LEU L  1 78  ? 109.314 133.933 100.051 1.00 42.12  ? 78   LEU L O   1 
ATOM   9310  C CB  . LEU L  1 78  ? 110.457 134.383 96.966  1.00 41.65  ? 78   LEU L CB  1 
ATOM   9311  C CG  . LEU L  1 78  ? 110.831 135.776 96.476  1.00 38.15  ? 78   LEU L CG  1 
ATOM   9312  C CD1 . LEU L  1 78  ? 112.290 135.783 95.856  1.00 41.41  ? 78   LEU L CD1 1 
ATOM   9313  C CD2 . LEU L  1 78  ? 109.796 136.178 95.416  1.00 36.89  ? 78   LEU L CD2 1 
ATOM   9314  N N   . GLN L  1 79  ? 110.599 135.766 99.722  1.00 42.13  ? 79   GLN L N   1 
ATOM   9315  C CA  . GLN L  1 79  ? 110.216 136.441 100.937 1.00 42.09  ? 79   GLN L CA  1 
ATOM   9316  C C   . GLN L  1 79  ? 110.147 137.914 100.613 1.00 42.12  ? 79   GLN L C   1 
ATOM   9317  O O   . GLN L  1 79  ? 110.957 138.404 99.819  1.00 41.79  ? 79   GLN L O   1 
ATOM   9318  C CB  . GLN L  1 79  ? 111.317 136.248 101.985 1.00 42.56  ? 79   GLN L CB  1 
ATOM   9319  C CG  . GLN L  1 79  ? 111.526 134.819 102.428 1.00 44.41  ? 79   GLN L CG  1 
ATOM   9320  C CD  . GLN L  1 79  ? 110.484 134.352 103.425 1.00 48.37  ? 79   GLN L CD  1 
ATOM   9321  O OE1 . GLN L  1 79  ? 110.583 133.247 103.957 1.00 55.46  ? 79   GLN L OE1 1 
ATOM   9322  N NE2 . GLN L  1 79  ? 109.484 135.189 103.694 1.00 44.62  ? 79   GLN L NE2 1 
ATOM   9323  N N   . PRO L  1 80  ? 109.170 138.630 101.200 1.00 42.19  ? 80   PRO L N   1 
ATOM   9324  C CA  . PRO L  1 80  ? 109.139 140.096 101.147 1.00 41.80  ? 80   PRO L CA  1 
ATOM   9325  C C   . PRO L  1 80  ? 110.509 140.764 101.370 1.00 41.53  ? 80   PRO L C   1 
ATOM   9326  O O   . PRO L  1 80  ? 110.787 141.804 100.760 1.00 42.32  ? 80   PRO L O   1 
ATOM   9327  C CB  . PRO L  1 80  ? 108.162 140.453 102.268 1.00 40.72  ? 80   PRO L CB  1 
ATOM   9328  C CG  . PRO L  1 80  ? 107.176 139.317 102.257 1.00 41.70  ? 80   PRO L CG  1 
ATOM   9329  C CD  . PRO L  1 80  ? 107.991 138.086 101.915 1.00 42.06  ? 80   PRO L CD  1 
ATOM   9330  N N   . GLU L  1 81  ? 111.348 140.161 102.221 1.00 41.42  ? 81   GLU L N   1 
ATOM   9331  C CA  . GLU L  1 81  ? 112.747 140.602 102.415 1.00 41.38  ? 81   GLU L CA  1 
ATOM   9332  C C   . GLU L  1 81  ? 113.707 140.294 101.243 1.00 42.12  ? 81   GLU L C   1 
ATOM   9333  O O   . GLU L  1 81  ? 114.820 140.829 101.197 1.00 41.64  ? 81   GLU L O   1 
ATOM   9334  C CB  . GLU L  1 81  ? 113.313 140.062 103.742 1.00 41.13  ? 81   GLU L CB  1 
ATOM   9335  C CG  . GLU L  1 81  ? 112.927 138.617 104.077 1.00 38.48  ? 81   GLU L CG  1 
ATOM   9336  C CD  . GLU L  1 81  ? 113.991 137.608 103.684 1.00 38.24  ? 81   GLU L CD  1 
ATOM   9337  O OE1 . GLU L  1 81  ? 114.435 137.620 102.518 1.00 29.99  ? 81   GLU L OE1 1 
ATOM   9338  O OE2 . GLU L  1 81  ? 114.384 136.793 104.553 1.00 43.82  ? 81   GLU L OE2 1 
ATOM   9339  N N   . ASP L  1 82  ? 113.278 139.435 100.313 1.00 41.44  ? 82   ASP L N   1 
ATOM   9340  C CA  . ASP L  1 82  ? 114.028 139.152 99.075  1.00 41.28  ? 82   ASP L CA  1 
ATOM   9341  C C   . ASP L  1 82  ? 113.598 140.034 97.891  1.00 40.61  ? 82   ASP L C   1 
ATOM   9342  O O   . ASP L  1 82  ? 114.116 139.861 96.777  1.00 39.52  ? 82   ASP L O   1 
ATOM   9343  C CB  . ASP L  1 82  ? 113.907 137.667 98.653  1.00 41.62  ? 82   ASP L CB  1 
ATOM   9344  C CG  . ASP L  1 82  ? 114.796 136.733 99.498  1.00 43.53  ? 82   ASP L CG  1 
ATOM   9345  O OD1 . ASP L  1 82  ? 115.155 137.071 100.664 1.00 45.12  ? 82   ASP L OD1 1 
ATOM   9346  O OD2 . ASP L  1 82  ? 115.133 135.640 98.995  1.00 46.14  ? 82   ASP L OD2 1 
ATOM   9347  N N   . PHE L  1 83  ? 112.649 140.950 98.107  1.00 40.99  ? 83   PHE L N   1 
ATOM   9348  C CA  . PHE L  1 83  ? 112.344 141.953 97.076  1.00 42.66  ? 83   PHE L CA  1 
ATOM   9349  C C   . PHE L  1 83  ? 113.604 142.807 96.932  1.00 43.24  ? 83   PHE L C   1 
ATOM   9350  O O   . PHE L  1 83  ? 113.935 143.613 97.808  1.00 42.25  ? 83   PHE L O   1 
ATOM   9351  C CB  . PHE L  1 83  ? 111.049 142.757 97.395  1.00 42.72  ? 83   PHE L CB  1 
ATOM   9352  C CG  . PHE L  1 83  ? 111.042 144.189 96.862  1.00 44.25  ? 83   PHE L CG  1 
ATOM   9353  C CD1 . PHE L  1 83  ? 110.386 144.524 95.673  1.00 45.85  ? 83   PHE L CD1 1 
ATOM   9354  C CD2 . PHE L  1 83  ? 111.653 145.212 97.590  1.00 44.08  ? 83   PHE L CD2 1 
ATOM   9355  C CE1 . PHE L  1 83  ? 110.373 145.852 95.206  1.00 49.99  ? 83   PHE L CE1 1 
ATOM   9356  C CE2 . PHE L  1 83  ? 111.646 146.531 97.132  1.00 44.15  ? 83   PHE L CE2 1 
ATOM   9357  C CZ  . PHE L  1 83  ? 111.006 146.855 95.941  1.00 45.56  ? 83   PHE L CZ  1 
ATOM   9358  N N   . ALA L  1 84  ? 114.338 142.548 95.852  1.00 44.57  ? 84   ALA L N   1 
ATOM   9359  C CA  . ALA L  1 84  ? 115.603 143.219 95.551  1.00 45.91  ? 84   ALA L CA  1 
ATOM   9360  C C   . ALA L  1 84  ? 115.934 143.066 94.067  1.00 47.14  ? 84   ALA L C   1 
ATOM   9361  O O   . ALA L  1 84  ? 115.181 142.446 93.313  1.00 48.26  ? 84   ALA L O   1 
ATOM   9362  C CB  . ALA L  1 84  ? 116.736 142.640 96.412  1.00 45.86  ? 84   ALA L CB  1 
ATOM   9363  N N   . THR L  1 85  ? 117.063 143.641 93.655  1.00 47.27  ? 85   THR L N   1 
ATOM   9364  C CA  . THR L  1 85  ? 117.581 143.443 92.305  1.00 46.33  ? 85   THR L CA  1 
ATOM   9365  C C   . THR L  1 85  ? 118.875 142.668 92.337  1.00 46.30  ? 85   THR L C   1 
ATOM   9366  O O   . THR L  1 85  ? 119.845 143.049 93.017  1.00 44.75  ? 85   THR L O   1 
ATOM   9367  C CB  . THR L  1 85  ? 117.851 144.753 91.571  1.00 46.61  ? 85   THR L CB  1 
ATOM   9368  O OG1 . THR L  1 85  ? 116.706 145.600 91.664  1.00 45.90  ? 85   THR L OG1 1 
ATOM   9369  C CG2 . THR L  1 85  ? 118.180 144.496 90.101  1.00 45.02  ? 85   THR L CG2 1 
ATOM   9370  N N   . TYR L  1 86  ? 118.891 141.599 91.558  1.00 46.48  ? 86   TYR L N   1 
ATOM   9371  C CA  . TYR L  1 86  ? 120.002 140.685 91.567  1.00 46.11  ? 86   TYR L CA  1 
ATOM   9372  C C   . TYR L  1 86  ? 120.963 140.961 90.406  1.00 45.21  ? 86   TYR L C   1 
ATOM   9373  O O   . TYR L  1 86  ? 120.578 141.536 89.378  1.00 45.78  ? 86   TYR L O   1 
ATOM   9374  C CB  . TYR L  1 86  ? 119.450 139.257 91.598  1.00 46.79  ? 86   TYR L CB  1 
ATOM   9375  C CG  . TYR L  1 86  ? 118.770 138.934 92.924  1.00 47.46  ? 86   TYR L CG  1 
ATOM   9376  C CD1 . TYR L  1 86  ? 117.705 139.711 93.408  1.00 48.29  ? 86   TYR L CD1 1 
ATOM   9377  C CD2 . TYR L  1 86  ? 119.198 137.862 93.702  1.00 50.44  ? 86   TYR L CD2 1 
ATOM   9378  C CE1 . TYR L  1 86  ? 117.098 139.430 94.629  1.00 46.36  ? 86   TYR L CE1 1 
ATOM   9379  C CE2 . TYR L  1 86  ? 118.591 137.571 94.922  1.00 52.18  ? 86   TYR L CE2 1 
ATOM   9380  C CZ  . TYR L  1 86  ? 117.545 138.355 95.380  1.00 48.15  ? 86   TYR L CZ  1 
ATOM   9381  O OH  . TYR L  1 86  ? 116.946 138.060 96.586  1.00 46.51  ? 86   TYR L OH  1 
ATOM   9382  N N   . TYR L  1 87  ? 122.221 140.593 90.614  1.00 41.93  ? 87   TYR L N   1 
ATOM   9383  C CA  . TYR L  1 87  ? 123.254 140.744 89.613  1.00 39.37  ? 87   TYR L CA  1 
ATOM   9384  C C   . TYR L  1 87  ? 124.176 139.543 89.741  1.00 42.10  ? 87   TYR L C   1 
ATOM   9385  O O   . TYR L  1 87  ? 124.192 138.857 90.773  1.00 43.51  ? 87   TYR L O   1 
ATOM   9386  C CB  . TYR L  1 87  ? 124.052 142.030 89.847  1.00 36.15  ? 87   TYR L CB  1 
ATOM   9387  C CG  . TYR L  1 87  ? 123.329 143.315 89.507  1.00 32.30  ? 87   TYR L CG  1 
ATOM   9388  C CD1 . TYR L  1 87  ? 122.563 143.981 90.463  1.00 25.06  ? 87   TYR L CD1 1 
ATOM   9389  C CD2 . TYR L  1 87  ? 123.440 143.885 88.243  1.00 22.72  ? 87   TYR L CD2 1 
ATOM   9390  C CE1 . TYR L  1 87  ? 121.908 145.167 90.161  1.00 19.21  ? 87   TYR L CE1 1 
ATOM   9391  C CE2 . TYR L  1 87  ? 122.788 145.068 87.931  1.00 23.26  ? 87   TYR L CE2 1 
ATOM   9392  C CZ  . TYR L  1 87  ? 122.027 145.704 88.893  1.00 22.52  ? 87   TYR L CZ  1 
ATOM   9393  O OH  . TYR L  1 87  ? 121.381 146.879 88.586  1.00 20.31  ? 87   TYR L OH  1 
ATOM   9394  N N   . CYS L  1 88  ? 124.928 139.291 88.673  1.00 42.14  ? 88   CYS L N   1 
ATOM   9395  C CA  . CYS L  1 88  ? 125.953 138.264 88.645  1.00 41.31  ? 88   CYS L CA  1 
ATOM   9396  C C   . CYS L  1 88  ? 127.200 138.995 88.212  1.00 42.59  ? 88   CYS L C   1 
ATOM   9397  O O   . CYS L  1 88  ? 127.115 139.958 87.445  1.00 41.79  ? 88   CYS L O   1 
ATOM   9398  C CB  . CYS L  1 88  ? 125.612 137.170 87.628  1.00 41.35  ? 88   CYS L CB  1 
ATOM   9399  S SG  . CYS L  1 88  ? 125.292 137.751 85.927  1.00 39.04  ? 88   CYS L SG  1 
ATOM   9400  N N   . GLN L  1 89  ? 128.353 138.546 88.698  1.00 43.79  ? 89   GLN L N   1 
ATOM   9401  C CA  . GLN L  1 89  ? 129.613 139.217 88.412  1.00 44.80  ? 89   GLN L CA  1 
ATOM   9402  C C   . GLN L  1 89  ? 130.691 138.197 88.073  1.00 45.46  ? 89   GLN L C   1 
ATOM   9403  O O   . GLN L  1 89  ? 130.499 136.993 88.274  1.00 45.20  ? 89   GLN L O   1 
ATOM   9404  C CB  . GLN L  1 89  ? 130.025 140.101 89.601  1.00 44.22  ? 89   GLN L CB  1 
ATOM   9405  C CG  . GLN L  1 89  ? 131.024 141.204 89.255  1.00 46.61  ? 89   GLN L CG  1 
ATOM   9406  C CD  . GLN L  1 89  ? 132.374 141.021 89.915  1.00 52.58  ? 89   GLN L CD  1 
ATOM   9407  O OE1 . GLN L  1 89  ? 132.931 139.923 89.927  1.00 51.32  ? 89   GLN L OE1 1 
ATOM   9408  N NE2 . GLN L  1 89  ? 132.909 142.102 90.474  1.00 53.21  ? 89   GLN L NE2 1 
ATOM   9409  N N   . GLN L  1 90  ? 131.829 138.685 87.568  1.00 45.24  ? 90   GLN L N   1 
ATOM   9410  C CA  . GLN L  1 90  ? 132.930 137.837 87.110  1.00 45.29  ? 90   GLN L CA  1 
ATOM   9411  C C   . GLN L  1 90  ? 134.303 138.296 87.609  1.00 46.79  ? 90   GLN L C   1 
ATOM   9412  O O   . GLN L  1 90  ? 134.548 139.501 87.805  1.00 47.44  ? 90   GLN L O   1 
ATOM   9413  C CB  . GLN L  1 90  ? 132.949 137.778 85.580  1.00 45.67  ? 90   GLN L CB  1 
ATOM   9414  C CG  . GLN L  1 90  ? 133.393 139.059 84.867  1.00 38.68  ? 90   GLN L CG  1 
ATOM   9415  C CD  . GLN L  1 90  ? 134.883 139.105 84.507  1.00 32.11  ? 90   GLN L CD  1 
ATOM   9416  O OE1 . GLN L  1 90  ? 135.640 138.155 84.746  1.00 29.57  ? 90   GLN L OE1 1 
ATOM   9417  N NE2 . GLN L  1 90  ? 135.299 140.223 83.918  1.00 27.33  ? 90   GLN L NE2 1 
ATOM   9418  N N   . SER L  1 91  ? 135.204 137.329 87.775  1.00 48.59  ? 91   SER L N   1 
ATOM   9419  C CA  . SER L  1 91  ? 136.564 137.594 88.244  1.00 50.94  ? 91   SER L CA  1 
ATOM   9420  C C   . SER L  1 91  ? 137.672 137.035 87.338  1.00 51.48  ? 91   SER L C   1 
ATOM   9421  O O   . SER L  1 91  ? 138.855 137.157 87.676  1.00 51.08  ? 91   SER L O   1 
ATOM   9422  C CB  . SER L  1 91  ? 136.753 137.065 89.674  1.00 51.62  ? 91   SER L CB  1 
ATOM   9423  O OG  . SER L  1 91  ? 135.944 137.777 90.609  1.00 56.86  ? 91   SER L OG  1 
ATOM   9424  N N   . TYR L  1 92  ? 137.307 136.433 86.203  1.00 50.85  ? 92   TYR L N   1 
ATOM   9425  C CA  . TYR L  1 92  ? 138.316 135.850 85.302  1.00 50.14  ? 92   TYR L CA  1 
ATOM   9426  C C   . TYR L  1 92  ? 139.355 136.901 84.835  1.00 50.88  ? 92   TYR L C   1 
ATOM   9427  O O   . TYR L  1 92  ? 140.537 136.759 85.160  1.00 52.81  ? 92   TYR L O   1 
ATOM   9428  C CB  . TYR L  1 92  ? 137.667 135.042 84.151  1.00 49.75  ? 92   TYR L CB  1 
ATOM   9429  C CG  . TYR L  1 92  ? 138.574 134.008 83.475  1.00 46.42  ? 92   TYR L CG  1 
ATOM   9430  C CD1 . TYR L  1 92  ? 138.828 132.753 84.045  1.00 46.40  ? 92   TYR L CD1 1 
ATOM   9431  C CD2 . TYR L  1 92  ? 139.154 134.290 82.243  1.00 44.86  ? 92   TYR L CD2 1 
ATOM   9432  C CE1 . TYR L  1 92  ? 139.663 131.820 83.399  1.00 46.91  ? 92   TYR L CE1 1 
ATOM   9433  C CE2 . TYR L  1 92  ? 139.983 133.374 81.598  1.00 43.60  ? 92   TYR L CE2 1 
ATOM   9434  C CZ  . TYR L  1 92  ? 140.234 132.144 82.175  1.00 46.27  ? 92   TYR L CZ  1 
ATOM   9435  O OH  . TYR L  1 92  ? 141.055 131.246 81.519  1.00 43.72  ? 92   TYR L OH  1 
ATOM   9436  N N   . SER L  1 93  ? 138.943 137.947 84.111  1.00 49.98  ? 93   SER L N   1 
ATOM   9437  C CA  . SER L  1 93  ? 139.879 139.051 83.786  1.00 48.55  ? 93   SER L CA  1 
ATOM   9438  C C   . SER L  1 93  ? 139.372 140.443 84.175  1.00 47.74  ? 93   SER L C   1 
ATOM   9439  O O   . SER L  1 93  ? 138.167 140.643 84.365  1.00 47.15  ? 93   SER L O   1 
ATOM   9440  C CB  . SER L  1 93  ? 140.332 139.023 82.315  1.00 49.40  ? 93   SER L CB  1 
ATOM   9441  O OG  . SER L  1 93  ? 139.313 138.524 81.443  1.00 44.12  ? 93   SER L OG  1 
ATOM   9442  N N   . THR L  1 94  ? 140.299 141.388 84.313  1.00 46.53  ? 94   THR L N   1 
ATOM   9443  C CA  . THR L  1 94  ? 139.934 142.757 84.648  1.00 44.20  ? 94   THR L CA  1 
ATOM   9444  C C   . THR L  1 94  ? 139.743 143.559 83.366  1.00 44.16  ? 94   THR L C   1 
ATOM   9445  O O   . THR L  1 94  ? 140.413 143.275 82.349  1.00 45.22  ? 94   THR L O   1 
ATOM   9446  C CB  . THR L  1 94  ? 140.998 143.397 85.549  1.00 43.33  ? 94   THR L CB  1 
ATOM   9447  O OG1 . THR L  1 94  ? 142.185 142.587 85.529  1.00 37.97  ? 94   THR L OG1 1 
ATOM   9448  C CG2 . THR L  1 94  ? 140.481 143.456 86.976  1.00 43.89  ? 94   THR L CG2 1 
ATOM   9449  N N   . PRO L  1 95  ? 138.818 144.539 83.368  1.00 42.01  ? 95   PRO L N   1 
ATOM   9450  C CA  . PRO L  1 95  ? 137.827 144.901 84.379  1.00 39.64  ? 95   PRO L CA  1 
ATOM   9451  C C   . PRO L  1 95  ? 136.911 143.771 84.816  1.00 39.24  ? 95   PRO L C   1 
ATOM   9452  O O   . PRO L  1 95  ? 136.554 142.894 84.017  1.00 37.57  ? 95   PRO L O   1 
ATOM   9453  C CB  . PRO L  1 95  ? 136.967 145.962 83.667  1.00 39.09  ? 95   PRO L CB  1 
ATOM   9454  C CG  . PRO L  1 95  ? 137.321 145.862 82.221  1.00 39.64  ? 95   PRO L CG  1 
ATOM   9455  C CD  . PRO L  1 95  ? 138.753 145.457 82.220  1.00 40.82  ? 95   PRO L CD  1 
ATOM   9456  N N   . ASN L  1 96  ? 136.553 143.816 86.096  1.00 39.77  ? 96   ASN L N   1 
ATOM   9457  C CA  . ASN L  1 96  ? 135.385 143.120 86.615  1.00 40.87  ? 96   ASN L CA  1 
ATOM   9458  C C   . ASN L  1 96  ? 134.142 143.667 85.897  1.00 41.19  ? 96   ASN L C   1 
ATOM   9459  O O   . ASN L  1 96  ? 133.950 144.888 85.809  1.00 42.38  ? 96   ASN L O   1 
ATOM   9460  C CB  . ASN L  1 96  ? 135.267 143.333 88.138  1.00 40.54  ? 96   ASN L CB  1 
ATOM   9461  C CG  . ASN L  1 96  ? 136.256 142.474 88.943  1.00 39.98  ? 96   ASN L CG  1 
ATOM   9462  O OD1 . ASN L  1 96  ? 136.918 141.583 88.404  1.00 43.66  ? 96   ASN L OD1 1 
ATOM   9463  N ND2 . ASN L  1 96  ? 136.344 142.739 90.246  1.00 25.29  ? 96   ASN L ND2 1 
ATOM   9464  N N   . THR L  1 97  ? 133.321 142.757 85.370  1.00 40.82  ? 97   THR L N   1 
ATOM   9465  C CA  . THR L  1 97  ? 132.117 143.104 84.599  1.00 40.98  ? 97   THR L CA  1 
ATOM   9466  C C   . THR L  1 97  ? 130.832 142.582 85.235  1.00 41.41  ? 97   THR L C   1 
ATOM   9467  O O   . THR L  1 97  ? 130.793 141.436 85.727  1.00 40.58  ? 97   THR L O   1 
ATOM   9468  C CB  . THR L  1 97  ? 132.170 142.543 83.156  1.00 41.80  ? 97   THR L CB  1 
ATOM   9469  O OG1 . THR L  1 97  ? 132.594 141.173 83.183  1.00 42.37  ? 97   THR L OG1 1 
ATOM   9470  C CG2 . THR L  1 97  ? 133.143 143.374 82.294  1.00 43.44  ? 97   THR L CG2 1 
ATOM   9471  N N   . PHE L  1 98  ? 129.780 143.418 85.197  1.00 40.81  ? 98   PHE L N   1 
ATOM   9472  C CA  . PHE L  1 98  ? 128.470 143.073 85.798  1.00 41.77  ? 98   PHE L CA  1 
ATOM   9473  C C   . PHE L  1 98  ? 127.340 142.837 84.783  1.00 43.76  ? 98   PHE L C   1 
ATOM   9474  O O   . PHE L  1 98  ? 127.256 143.525 83.763  1.00 46.57  ? 98   PHE L O   1 
ATOM   9475  C CB  . PHE L  1 98  ? 128.043 144.133 86.838  1.00 41.71  ? 98   PHE L CB  1 
ATOM   9476  C CG  . PHE L  1 98  ? 128.957 144.209 88.041  1.00 38.42  ? 98   PHE L CG  1 
ATOM   9477  C CD1 . PHE L  1 98  ? 130.305 144.520 87.886  1.00 38.06  ? 98   PHE L CD1 1 
ATOM   9478  C CD2 . PHE L  1 98  ? 128.468 143.986 89.325  1.00 36.28  ? 98   PHE L CD2 1 
ATOM   9479  C CE1 . PHE L  1 98  ? 131.152 144.589 88.978  1.00 42.40  ? 98   PHE L CE1 1 
ATOM   9480  C CE2 . PHE L  1 98  ? 129.309 144.061 90.430  1.00 34.66  ? 98   PHE L CE2 1 
ATOM   9481  C CZ  . PHE L  1 98  ? 130.654 144.366 90.252  1.00 40.03  ? 98   PHE L CZ  1 
ATOM   9482  N N   . GLY L  1 99  ? 126.480 141.856 85.083  1.00 42.24  ? 99   GLY L N   1 
ATOM   9483  C CA  . GLY L  1 99  ? 125.298 141.540 84.253  1.00 39.13  ? 99   GLY L CA  1 
ATOM   9484  C C   . GLY L  1 99  ? 124.152 142.529 84.397  1.00 36.41  ? 99   GLY L C   1 
ATOM   9485  O O   . GLY L  1 99  ? 124.042 143.208 85.418  1.00 36.67  ? 99   GLY L O   1 
ATOM   9486  N N   . GLN L  1 100 ? 123.289 142.595 83.375  1.00 33.94  ? 100  GLN L N   1 
ATOM   9487  C CA  . GLN L  1 100 ? 122.312 143.698 83.262  1.00 28.89  ? 100  GLN L CA  1 
ATOM   9488  C C   . GLN L  1 100 ? 121.332 143.794 84.435  1.00 25.46  ? 100  GLN L C   1 
ATOM   9489  O O   . GLN L  1 100 ? 120.634 144.810 84.597  1.00 24.55  ? 100  GLN L O   1 
ATOM   9490  C CB  . GLN L  1 100 ? 121.583 143.727 81.897  1.00 29.24  ? 100  GLN L CB  1 
ATOM   9491  C CG  . GLN L  1 100 ? 121.334 142.384 81.202  1.00 29.58  ? 100  GLN L CG  1 
ATOM   9492  C CD  . GLN L  1 100 ? 122.558 141.858 80.467  1.00 38.41  ? 100  GLN L CD  1 
ATOM   9493  O OE1 . GLN L  1 100 ? 123.125 140.842 80.854  1.00 37.88  ? 100  GLN L OE1 1 
ATOM   9494  N NE2 . GLN L  1 100 ? 122.973 142.552 79.410  1.00 38.72  ? 100  GLN L NE2 1 
ATOM   9495  N N   . GLY L  1 101 ? 121.312 142.749 85.261  1.00 25.19  ? 101  GLY L N   1 
ATOM   9496  C CA  . GLY L  1 101 ? 120.523 142.738 86.505  1.00 22.40  ? 101  GLY L CA  1 
ATOM   9497  C C   . GLY L  1 101 ? 119.245 141.927 86.358  1.00 22.56  ? 101  GLY L C   1 
ATOM   9498  O O   . GLY L  1 101 ? 118.993 141.325 85.294  1.00 20.70  ? 101  GLY L O   1 
ATOM   9499  N N   . THR L  1 102 ? 118.429 141.916 87.423  1.00 24.37  ? 102  THR L N   1 
ATOM   9500  C CA  . THR L  1 102 ? 117.104 141.257 87.434  1.00 23.31  ? 102  THR L CA  1 
ATOM   9501  C C   . THR L  1 102 ? 116.218 141.775 88.583  1.00 28.27  ? 102  THR L C   1 
ATOM   9502  O O   . THR L  1 102 ? 116.476 141.479 89.758  1.00 31.09  ? 102  THR L O   1 
ATOM   9503  C CB  . THR L  1 102 ? 117.220 139.721 87.553  1.00 20.66  ? 102  THR L CB  1 
ATOM   9504  O OG1 . THR L  1 102 ? 117.916 139.198 86.416  1.00 18.03  ? 102  THR L OG1 1 
ATOM   9505  C CG2 . THR L  1 102 ? 115.846 139.098 87.611  1.00 18.07  ? 102  THR L CG2 1 
ATOM   9506  N N   . LYS L  1 103 ? 115.184 142.539 88.250  1.00 29.21  ? 103  LYS L N   1 
ATOM   9507  C CA  . LYS L  1 103 ? 114.374 143.167 89.293  1.00 32.35  ? 103  LYS L CA  1 
ATOM   9508  C C   . LYS L  1 103 ? 113.370 142.171 89.871  1.00 35.73  ? 103  LYS L C   1 
ATOM   9509  O O   . LYS L  1 103 ? 112.204 142.150 89.458  1.00 36.00  ? 103  LYS L O   1 
ATOM   9510  C CB  . LYS L  1 103 ? 113.672 144.428 88.763  1.00 32.50  ? 103  LYS L CB  1 
ATOM   9511  C CG  . LYS L  1 103 ? 113.335 145.457 89.847  1.00 38.24  ? 103  LYS L CG  1 
ATOM   9512  C CD  . LYS L  1 103 ? 114.354 146.589 89.866  1.00 38.14  ? 103  LYS L CD  1 
ATOM   9513  C CE  . LYS L  1 103 ? 114.217 147.406 91.212  1.00 31.67  ? 103  LYS L CE  1 
ATOM   9514  N NZ  . LYS L  1 103 ? 115.390 148.415 91.247  1.00 43.18  ? 103  LYS L NZ  1 
ATOM   9515  N N   . VAL L  1 104 ? 113.820 141.349 90.823  1.00 37.10  ? 104  VAL L N   1 
ATOM   9516  C CA  . VAL L  1 104 ? 112.879 140.452 91.511  1.00 37.67  ? 104  VAL L CA  1 
ATOM   9517  C C   . VAL L  1 104 ? 112.063 141.202 92.560  1.00 37.68  ? 104  VAL L C   1 
ATOM   9518  O O   . VAL L  1 104 ? 112.606 141.858 93.453  1.00 37.36  ? 104  VAL L O   1 
ATOM   9519  C CB  . VAL L  1 104 ? 113.550 139.221 92.145  1.00 36.67  ? 104  VAL L CB  1 
ATOM   9520  C CG1 . VAL L  1 104 ? 112.534 138.061 92.213  1.00 37.14  ? 104  VAL L CG1 1 
ATOM   9521  C CG2 . VAL L  1 104 ? 114.780 138.802 91.342  1.00 37.38  ? 104  VAL L CG2 1 
ATOM   9522  N N   . GLU L  1 105 ? 110.747 141.082 92.433  1.00 38.79  ? 105  GLU L N   1 
ATOM   9523  C CA  . GLU L  1 105 ? 109.803 141.818 93.258  1.00 39.36  ? 105  GLU L CA  1 
ATOM   9524  C C   . GLU L  1 105 ? 108.609 140.944 93.636  1.00 39.08  ? 105  GLU L C   1 
ATOM   9525  O O   . GLU L  1 105 ? 108.204 140.073 92.861  1.00 40.35  ? 105  GLU L O   1 
ATOM   9526  C CB  . GLU L  1 105 ? 109.334 143.065 92.502  1.00 37.60  ? 105  GLU L CB  1 
ATOM   9527  C CG  . GLU L  1 105 ? 107.865 143.421 92.704  1.00 40.15  ? 105  GLU L CG  1 
ATOM   9528  C CD  . GLU L  1 105 ? 107.405 144.556 91.820  1.00 40.73  ? 105  GLU L CD  1 
ATOM   9529  O OE1 . GLU L  1 105 ? 107.962 144.735 90.715  1.00 33.17  ? 105  GLU L OE1 1 
ATOM   9530  O OE2 . GLU L  1 105 ? 106.471 145.278 92.230  1.00 36.85  ? 105  GLU L OE2 1 
ATOM   9531  N N   . ILE L  1 106 ? 108.046 141.183 94.827  1.00 40.32  ? 106  ILE L N   1 
ATOM   9532  C CA  . ILE L  1 106 ? 106.793 140.519 95.224  1.00 40.93  ? 106  ILE L CA  1 
ATOM   9533  C C   . ILE L  1 106 ? 105.590 141.208 94.574  1.00 41.77  ? 106  ILE L C   1 
ATOM   9534  O O   . ILE L  1 106 ? 105.157 142.279 95.007  1.00 42.83  ? 106  ILE L O   1 
ATOM   9535  C CB  . ILE L  1 106 ? 106.589 140.477 96.768  1.00 39.62  ? 106  ILE L CB  1 
ATOM   9536  C CG1 . ILE L  1 106 ? 107.871 140.065 97.522  1.00 40.57  ? 106  ILE L CG1 1 
ATOM   9537  C CG2 . ILE L  1 106 ? 105.404 139.586 97.143  1.00 40.39  ? 106  ILE L CG2 1 
ATOM   9538  C CD1 . ILE L  1 106 ? 108.642 138.890 96.876  1.00 28.34  ? 106  ILE L CD1 1 
ATOM   9539  N N   . ASP M  1 1   ? 94.112  114.710 93.068  1.00 52.13  ? 1    ASP M N   1 
ATOM   9540  C CA  . ASP M  1 1   ? 94.047  116.043 92.399  1.00 52.00  ? 1    ASP M CA  1 
ATOM   9541  C C   . ASP M  1 1   ? 95.324  116.846 92.672  1.00 52.46  ? 1    ASP M C   1 
ATOM   9542  O O   . ASP M  1 1   ? 95.596  117.252 93.805  1.00 53.57  ? 1    ASP M O   1 
ATOM   9543  C CB  . ASP M  1 1   ? 92.765  116.789 92.806  1.00 51.83  ? 1    ASP M CB  1 
ATOM   9544  C CG  . ASP M  1 1   ? 92.675  118.179 92.201  1.00 51.88  ? 1    ASP M CG  1 
ATOM   9545  O OD1 . ASP M  1 1   ? 92.844  118.324 90.963  1.00 43.78  ? 1    ASP M OD1 1 
ATOM   9546  O OD2 . ASP M  1 1   ? 92.416  119.133 92.974  1.00 56.22  ? 1    ASP M OD2 1 
ATOM   9547  N N   . ILE M  1 2   ? 96.090  117.067 91.607  1.00 51.22  ? 2    ILE M N   1 
ATOM   9548  C CA  . ILE M  1 2   ? 97.511  117.402 91.712  1.00 49.73  ? 2    ILE M CA  1 
ATOM   9549  C C   . ILE M  1 2   ? 97.802  118.896 91.551  1.00 51.21  ? 2    ILE M C   1 
ATOM   9550  O O   . ILE M  1 2   ? 97.463  119.503 90.528  1.00 51.16  ? 2    ILE M O   1 
ATOM   9551  C CB  . ILE M  1 2   ? 98.339  116.541 90.712  1.00 48.21  ? 2    ILE M CB  1 
ATOM   9552  C CG1 . ILE M  1 2   ? 98.110  115.052 90.999  1.00 43.21  ? 2    ILE M CG1 1 
ATOM   9553  C CG2 . ILE M  1 2   ? 99.827  116.875 90.789  1.00 48.19  ? 2    ILE M CG2 1 
ATOM   9554  C CD1 . ILE M  1 2   ? 98.085  114.162 89.778  1.00 32.23  ? 2    ILE M CD1 1 
ATOM   9555  N N   . GLN M  1 3   ? 98.433  119.469 92.578  1.00 51.04  ? 3    GLN M N   1 
ATOM   9556  C CA  . GLN M  1 3   ? 98.793  120.892 92.616  1.00 51.91  ? 3    GLN M CA  1 
ATOM   9557  C C   . GLN M  1 3   ? 99.779  121.210 91.518  1.00 51.51  ? 3    GLN M C   1 
ATOM   9558  O O   . GLN M  1 3   ? 100.624 120.375 91.191  1.00 52.65  ? 3    GLN M O   1 
ATOM   9559  C CB  . GLN M  1 3   ? 99.420  121.267 93.965  1.00 52.44  ? 3    GLN M CB  1 
ATOM   9560  C CG  . GLN M  1 3   ? 98.619  120.816 95.170  1.00 54.96  ? 3    GLN M CG  1 
ATOM   9561  C CD  . GLN M  1 3   ? 97.130  120.883 94.922  1.00 59.01  ? 3    GLN M CD  1 
ATOM   9562  O OE1 . GLN M  1 3   ? 96.448  119.859 94.883  1.00 62.71  ? 3    GLN M OE1 1 
ATOM   9563  N NE2 . GLN M  1 3   ? 96.610  122.097 94.738  1.00 59.64  ? 3    GLN M NE2 1 
ATOM   9564  N N   . MET M  1 4   ? 99.698  122.405 90.947  1.00 49.81  ? 4    MET M N   1 
ATOM   9565  C CA  . MET M  1 4   ? 100.655 122.726 89.903  1.00 50.11  ? 4    MET M CA  1 
ATOM   9566  C C   . MET M  1 4   ? 101.263 124.104 90.108  1.00 49.05  ? 4    MET M C   1 
ATOM   9567  O O   . MET M  1 4   ? 100.601 125.139 89.835  1.00 48.97  ? 4    MET M O   1 
ATOM   9568  C CB  . MET M  1 4   ? 100.033 122.540 88.517  1.00 50.48  ? 4    MET M CB  1 
ATOM   9569  C CG  . MET M  1 4   ? 100.837 121.611 87.601  1.00 50.95  ? 4    MET M CG  1 
ATOM   9570  S SD  . MET M  1 4   ? 101.275 120.032 88.431  1.00 53.94  ? 4    MET M SD  1 
ATOM   9571  C CE  . MET M  1 4   ? 102.385 119.337 87.194  1.00 52.46  ? 4    MET M CE  1 
ATOM   9572  N N   . THR M  1 5   ? 102.509 124.119 90.593  1.00 46.88  ? 5    THR M N   1 
ATOM   9573  C CA  . THR M  1 5   ? 103.108 125.362 91.060  1.00 46.35  ? 5    THR M CA  1 
ATOM   9574  C C   . THR M  1 5   ? 103.954 126.000 89.953  1.00 45.60  ? 5    THR M C   1 
ATOM   9575  O O   . THR M  1 5   ? 105.088 125.552 89.698  1.00 45.88  ? 5    THR M O   1 
ATOM   9576  C CB  . THR M  1 5   ? 103.897 125.137 92.383  1.00 46.67  ? 5    THR M CB  1 
ATOM   9577  O OG1 . THR M  1 5   ? 103.076 124.402 93.308  1.00 47.92  ? 5    THR M OG1 1 
ATOM   9578  C CG2 . THR M  1 5   ? 104.296 126.464 93.018  1.00 43.08  ? 5    THR M CG2 1 
ATOM   9579  N N   . GLN M  1 6   ? 103.392 127.014 89.281  1.00 43.54  ? 6    GLN M N   1 
ATOM   9580  C CA  . GLN M  1 6   ? 104.067 127.640 88.131  1.00 43.06  ? 6    GLN M CA  1 
ATOM   9581  C C   . GLN M  1 6   ? 104.952 128.801 88.565  1.00 41.31  ? 6    GLN M C   1 
ATOM   9582  O O   . GLN M  1 6   ? 104.511 129.703 89.289  1.00 42.08  ? 6    GLN M O   1 
ATOM   9583  C CB  . GLN M  1 6   ? 103.079 128.079 87.022  1.00 42.72  ? 6    GLN M CB  1 
ATOM   9584  C CG  . GLN M  1 6   ? 103.781 128.632 85.746  1.00 42.87  ? 6    GLN M CG  1 
ATOM   9585  C CD  . GLN M  1 6   ? 102.907 128.694 84.485  1.00 41.61  ? 6    GLN M CD  1 
ATOM   9586  O OE1 . GLN M  1 6   ? 101.895 127.996 84.360  1.00 39.40  ? 6    GLN M OE1 1 
ATOM   9587  N NE2 . GLN M  1 6   ? 103.325 129.530 83.538  1.00 29.89  ? 6    GLN M NE2 1 
ATOM   9588  N N   . SER M  1 7   ? 106.207 128.765 88.128  1.00 38.67  ? 7    SER M N   1 
ATOM   9589  C CA  . SER M  1 7   ? 107.131 129.832 88.453  1.00 36.35  ? 7    SER M CA  1 
ATOM   9590  C C   . SER M  1 7   ? 107.991 130.248 87.274  1.00 32.29  ? 7    SER M C   1 
ATOM   9591  O O   . SER M  1 7   ? 108.574 129.411 86.586  1.00 30.83  ? 7    SER M O   1 
ATOM   9592  C CB  . SER M  1 7   ? 107.987 129.497 89.683  1.00 36.64  ? 7    SER M CB  1 
ATOM   9593  O OG  . SER M  1 7   ? 108.327 128.071 89.742  1.00 41.75  ? 7    SER M OG  1 
ATOM   9594  N N   . PRO M  1 8   ? 108.072 131.567 87.059  1.00 30.86  ? 8    PRO M N   1 
ATOM   9595  C CA  . PRO M  1 8   ? 107.380 132.492 87.938  1.00 29.68  ? 8    PRO M CA  1 
ATOM   9596  C C   . PRO M  1 8   ? 106.145 133.113 87.269  1.00 30.73  ? 8    PRO M C   1 
ATOM   9597  O O   . PRO M  1 8   ? 105.444 132.430 86.516  1.00 28.84  ? 8    PRO M O   1 
ATOM   9598  C CB  . PRO M  1 8   ? 108.450 133.545 88.176  1.00 28.97  ? 8    PRO M CB  1 
ATOM   9599  C CG  . PRO M  1 8   ? 109.258 133.556 86.825  1.00 31.53  ? 8    PRO M CG  1 
ATOM   9600  C CD  . PRO M  1 8   ? 108.860 132.303 86.059  1.00 28.94  ? 8    PRO M CD  1 
ATOM   9601  N N   . SER M  1 9   ? 105.890 134.407 87.508  1.00 30.28  ? 9    SER M N   1 
ATOM   9602  C CA  . SER M  1 9   ? 104.568 134.954 87.215  1.00 33.37  ? 9    SER M CA  1 
ATOM   9603  C C   . SER M  1 9   ? 104.504 135.920 86.026  1.00 34.24  ? 9    SER M C   1 
ATOM   9604  O O   . SER M  1 9   ? 104.079 135.560 84.889  1.00 31.23  ? 9    SER M O   1 
ATOM   9605  C CB  . SER M  1 9   ? 104.001 135.648 88.461  1.00 34.78  ? 9    SER M CB  1 
ATOM   9606  O OG  . SER M  1 9   ? 102.727 136.306 88.120  1.00 39.34  ? 9    SER M OG  1 
ATOM   9607  N N   . SER M  1 10  ? 104.817 137.178 86.323  1.00 36.35  ? 10   SER M N   1 
ATOM   9608  C CA  . SER M  1 10  ? 105.072 138.210 85.333  1.00 37.52  ? 10   SER M CA  1 
ATOM   9609  C C   . SER M  1 10  ? 106.534 138.044 84.935  1.00 39.20  ? 10   SER M C   1 
ATOM   9610  O O   . SER M  1 10  ? 107.253 137.258 85.561  1.00 40.20  ? 10   SER M O   1 
ATOM   9611  C CB  . SER M  1 10  ? 104.853 139.601 85.960  1.00 37.76  ? 10   SER M CB  1 
ATOM   9612  O OG  . SER M  1 10  ? 106.023 140.034 86.638  1.00 37.82  ? 10   SER M OG  1 
ATOM   9613  N N   . LEU M  1 11  ? 106.984 138.783 83.915  1.00 39.60  ? 11   LEU M N   1 
ATOM   9614  C CA  . LEU M  1 11  ? 108.361 138.634 83.416  1.00 39.36  ? 11   LEU M CA  1 
ATOM   9615  C C   . LEU M  1 11  ? 108.642 139.554 82.230  1.00 41.88  ? 11   LEU M C   1 
ATOM   9616  O O   . LEU M  1 11  ? 107.934 139.505 81.220  1.00 42.23  ? 11   LEU M O   1 
ATOM   9617  C CB  . LEU M  1 11  ? 108.624 137.170 83.020  1.00 38.37  ? 11   LEU M CB  1 
ATOM   9618  C CG  . LEU M  1 11  ? 110.055 136.665 82.821  1.00 38.63  ? 11   LEU M CG  1 
ATOM   9619  C CD1 . LEU M  1 11  ? 110.203 135.250 83.440  1.00 33.00  ? 11   LEU M CD1 1 
ATOM   9620  C CD2 . LEU M  1 11  ? 110.453 136.692 81.336  1.00 34.62  ? 11   LEU M CD2 1 
ATOM   9621  N N   . SER M  1 12  ? 109.669 140.390 82.352  1.00 42.18  ? 12   SER M N   1 
ATOM   9622  C CA  . SER M  1 12  ? 110.108 141.179 81.204  1.00 44.00  ? 12   SER M CA  1 
ATOM   9623  C C   . SER M  1 12  ? 111.532 140.835 80.769  1.00 44.02  ? 12   SER M C   1 
ATOM   9624  O O   . SER M  1 12  ? 112.480 140.904 81.555  1.00 44.61  ? 12   SER M O   1 
ATOM   9625  C CB  . SER M  1 12  ? 109.906 142.705 81.461  1.00 44.59  ? 12   SER M CB  1 
ATOM   9626  O OG  . SER M  1 12  ? 108.517 143.037 81.376  1.00 43.91  ? 12   SER M OG  1 
ATOM   9627  N N   . ALA M  1 13  ? 111.642 140.442 79.504  1.00 42.40  ? 13   ALA M N   1 
ATOM   9628  C CA  . ALA M  1 13  ? 112.913 140.068 78.903  1.00 40.03  ? 13   ALA M CA  1 
ATOM   9629  C C   . ALA M  1 13  ? 113.257 140.898 77.663  1.00 39.30  ? 13   ALA M C   1 
ATOM   9630  O O   . ALA M  1 13  ? 112.490 141.757 77.213  1.00 37.08  ? 13   ALA M O   1 
ATOM   9631  C CB  . ALA M  1 13  ? 112.918 138.569 78.576  1.00 40.26  ? 13   ALA M CB  1 
ATOM   9632  N N   . SER M  1 14  ? 114.436 140.590 77.133  1.00 38.17  ? 14   SER M N   1 
ATOM   9633  C CA  . SER M  1 14  ? 115.106 141.329 76.076  1.00 37.11  ? 14   SER M CA  1 
ATOM   9634  C C   . SER M  1 14  ? 115.153 140.440 74.847  1.00 37.95  ? 14   SER M C   1 
ATOM   9635  O O   . SER M  1 14  ? 115.063 139.211 74.961  1.00 35.40  ? 14   SER M O   1 
ATOM   9636  C CB  . SER M  1 14  ? 116.536 141.637 76.520  1.00 38.09  ? 14   SER M CB  1 
ATOM   9637  O OG  . SER M  1 14  ? 117.224 140.445 76.877  1.00 36.15  ? 14   SER M OG  1 
ATOM   9638  N N   . VAL M  1 15  ? 115.300 141.041 73.670  1.00 38.03  ? 15   VAL M N   1 
ATOM   9639  C CA  . VAL M  1 15  ? 115.172 140.252 72.453  1.00 37.09  ? 15   VAL M CA  1 
ATOM   9640  C C   . VAL M  1 15  ? 116.336 139.244 72.240  1.00 37.81  ? 15   VAL M C   1 
ATOM   9641  O O   . VAL M  1 15  ? 117.474 139.622 71.781  1.00 38.05  ? 15   VAL M O   1 
ATOM   9642  C CB  . VAL M  1 15  ? 114.896 141.132 71.174  1.00 37.11  ? 15   VAL M CB  1 
ATOM   9643  C CG1 . VAL M  1 15  ? 114.224 140.290 70.066  1.00 36.25  ? 15   VAL M CG1 1 
ATOM   9644  C CG2 . VAL M  1 15  ? 113.991 142.309 71.534  1.00 27.53  ? 15   VAL M CG2 1 
ATOM   9645  N N   . GLY M  1 16  ? 116.055 137.982 72.612  1.00 40.60  ? 16   GLY M N   1 
ATOM   9646  C CA  . GLY M  1 16  ? 117.008 136.894 72.417  1.00 39.08  ? 16   GLY M CA  1 
ATOM   9647  C C   . GLY M  1 16  ? 117.777 136.456 73.654  1.00 39.96  ? 16   GLY M C   1 
ATOM   9648  O O   . GLY M  1 16  ? 118.869 135.878 73.539  1.00 41.36  ? 16   GLY M O   1 
ATOM   9649  N N   . ASP M  1 17  ? 117.228 136.734 74.833  1.00 41.55  ? 17   ASP M N   1 
ATOM   9650  C CA  . ASP M  1 17  ? 117.800 136.215 76.069  1.00 42.55  ? 17   ASP M CA  1 
ATOM   9651  C C   . ASP M  1 17  ? 117.035 134.933 76.390  1.00 43.55  ? 17   ASP M C   1 
ATOM   9652  O O   . ASP M  1 17  ? 115.967 134.695 75.820  1.00 45.26  ? 17   ASP M O   1 
ATOM   9653  C CB  . ASP M  1 17  ? 117.667 137.245 77.196  1.00 43.76  ? 17   ASP M CB  1 
ATOM   9654  C CG  . ASP M  1 17  ? 119.001 137.562 77.873  1.00 43.76  ? 17   ASP M CG  1 
ATOM   9655  O OD1 . ASP M  1 17  ? 120.045 137.008 77.460  1.00 38.26  ? 17   ASP M OD1 1 
ATOM   9656  O OD2 . ASP M  1 17  ? 119.000 138.376 78.822  1.00 41.27  ? 17   ASP M OD2 1 
ATOM   9657  N N   . ARG M  1 18  ? 117.563 134.106 77.285  1.00 43.80  ? 18   ARG M N   1 
ATOM   9658  C CA  . ARG M  1 18  ? 116.895 132.846 77.618  1.00 45.24  ? 18   ARG M CA  1 
ATOM   9659  C C   . ARG M  1 18  ? 115.919 132.966 78.797  1.00 45.09  ? 18   ARG M C   1 
ATOM   9660  O O   . ARG M  1 18  ? 116.368 133.325 79.939  1.00 45.65  ? 18   ARG M O   1 
ATOM   9661  C CB  . ARG M  1 18  ? 117.938 131.756 77.888  1.00 45.34  ? 18   ARG M CB  1 
ATOM   9662  C CG  . ARG M  1 18  ? 117.475 130.668 78.858  1.00 46.29  ? 18   ARG M CG  1 
ATOM   9663  C CD  . ARG M  1 18  ? 118.573 129.666 79.116  1.00 50.38  ? 18   ARG M CD  1 
ATOM   9664  N NE  . ARG M  1 18  ? 118.835 128.845 77.940  1.00 56.75  ? 18   ARG M NE  1 
ATOM   9665  C CZ  . ARG M  1 18  ? 119.690 127.827 77.901  1.00 60.99  ? 18   ARG M CZ  1 
ATOM   9666  N NH1 . ARG M  1 18  ? 120.384 127.485 78.979  1.00 60.74  ? 18   ARG M NH1 1 
ATOM   9667  N NH2 . ARG M  1 18  ? 119.853 127.145 76.775  1.00 57.95  ? 18   ARG M NH2 1 
ATOM   9668  N N   . VAL M  1 19  ? 114.604 132.671 78.535  1.00 44.55  ? 19   VAL M N   1 
ATOM   9669  C CA  . VAL M  1 19  ? 113.669 132.640 79.705  1.00 44.53  ? 19   VAL M CA  1 
ATOM   9670  C C   . VAL M  1 19  ? 113.587 131.232 80.310  1.00 44.00  ? 19   VAL M C   1 
ATOM   9671  O O   . VAL M  1 19  ? 113.258 130.257 79.619  1.00 44.10  ? 19   VAL M O   1 
ATOM   9672  C CB  . VAL M  1 19  ? 112.240 133.170 79.370  1.00 43.04  ? 19   VAL M CB  1 
ATOM   9673  C CG1 . VAL M  1 19  ? 111.331 133.098 80.608  1.00 43.53  ? 19   VAL M CG1 1 
ATOM   9674  C CG2 . VAL M  1 19  ? 112.292 134.605 78.826  1.00 42.13  ? 19   VAL M CG2 1 
ATOM   9675  N N   . THR M  1 20  ? 113.884 131.140 81.604  1.00 45.32  ? 20   THR M N   1 
ATOM   9676  C CA  . THR M  1 20  ? 113.771 129.886 82.342  1.00 46.42  ? 20   THR M CA  1 
ATOM   9677  C C   . THR M  1 20  ? 112.462 129.879 83.138  1.00 46.54  ? 20   THR M C   1 
ATOM   9678  O O   . THR M  1 20  ? 112.179 130.817 83.896  1.00 45.80  ? 20   THR M O   1 
ATOM   9679  C CB  . THR M  1 20  ? 114.991 129.662 83.272  1.00 46.62  ? 20   THR M CB  1 
ATOM   9680  O OG1 . THR M  1 20  ? 116.193 130.052 82.591  1.00 46.34  ? 20   THR M OG1 1 
ATOM   9681  C CG2 . THR M  1 20  ? 115.112 128.197 83.705  1.00 46.51  ? 20   THR M CG2 1 
ATOM   9682  N N   . ILE M  1 21  ? 111.663 128.828 82.937  1.00 47.06  ? 21   ILE M N   1 
ATOM   9683  C CA  . ILE M  1 21  ? 110.345 128.684 83.575  1.00 47.12  ? 21   ILE M CA  1 
ATOM   9684  C C   . ILE M  1 21  ? 110.171 127.282 84.157  1.00 46.47  ? 21   ILE M C   1 
ATOM   9685  O O   . ILE M  1 21  ? 110.483 126.283 83.502  1.00 45.31  ? 21   ILE M O   1 
ATOM   9686  C CB  . ILE M  1 21  ? 109.163 128.945 82.588  1.00 46.83  ? 21   ILE M CB  1 
ATOM   9687  C CG1 . ILE M  1 21  ? 109.543 129.982 81.516  1.00 48.97  ? 21   ILE M CG1 1 
ATOM   9688  C CG2 . ILE M  1 21  ? 107.888 129.321 83.363  1.00 47.41  ? 21   ILE M CG2 1 
ATOM   9689  C CD1 . ILE M  1 21  ? 108.274 130.725 80.849  1.00 53.93  ? 21   ILE M CD1 1 
ATOM   9690  N N   . THR M  1 22  ? 109.664 127.222 85.389  1.00 45.66  ? 22   THR M N   1 
ATOM   9691  C CA  . THR M  1 22  ? 109.420 125.951 86.079  1.00 45.28  ? 22   THR M CA  1 
ATOM   9692  C C   . THR M  1 22  ? 107.992 125.790 86.616  1.00 46.53  ? 22   THR M C   1 
ATOM   9693  O O   . THR M  1 22  ? 107.251 126.765 86.798  1.00 45.96  ? 22   THR M O   1 
ATOM   9694  C CB  . THR M  1 22  ? 110.450 125.686 87.235  1.00 44.49  ? 22   THR M CB  1 
ATOM   9695  O OG1 . THR M  1 22  ? 110.497 126.832 88.118  1.00 41.37  ? 22   THR M OG1 1 
ATOM   9696  C CG2 . THR M  1 22  ? 111.873 125.455 86.680  1.00 41.47  ? 22   THR M CG2 1 
ATOM   9697  N N   . CYS M  1 23  ? 107.641 124.537 86.875  1.00 47.63  ? 23   CYS M N   1 
ATOM   9698  C CA  . CYS M  1 23  ? 106.305 124.115 87.257  1.00 49.69  ? 23   CYS M CA  1 
ATOM   9699  C C   . CYS M  1 23  ? 106.601 122.962 88.221  1.00 50.18  ? 23   CYS M C   1 
ATOM   9700  O O   . CYS M  1 23  ? 107.613 122.280 88.050  1.00 51.55  ? 23   CYS M O   1 
ATOM   9701  C CB  . CYS M  1 23  ? 105.582 123.640 85.976  1.00 49.75  ? 23   CYS M CB  1 
ATOM   9702  S SG  . CYS M  1 23  ? 103.745 123.456 85.941  1.00 47.67  ? 23   CYS M SG  1 
ATOM   9703  N N   . ARG M  1 24  ? 105.773 122.740 89.240  1.00 51.62  ? 24   ARG M N   1 
ATOM   9704  C CA  . ARG M  1 24  ? 105.998 121.579 90.131  1.00 52.50  ? 24   ARG M CA  1 
ATOM   9705  C C   . ARG M  1 24  ? 104.694 120.898 90.558  1.00 51.79  ? 24   ARG M C   1 
ATOM   9706  O O   . ARG M  1 24  ? 103.662 121.556 90.707  1.00 51.29  ? 24   ARG M O   1 
ATOM   9707  C CB  . ARG M  1 24  ? 106.845 121.969 91.363  1.00 53.11  ? 24   ARG M CB  1 
ATOM   9708  C CG  . ARG M  1 24  ? 107.602 120.815 92.065  1.00 52.70  ? 24   ARG M CG  1 
ATOM   9709  C CD  . ARG M  1 24  ? 109.100 120.835 91.724  1.00 53.80  ? 24   ARG M CD  1 
ATOM   9710  N NE  . ARG M  1 24  ? 110.005 120.272 92.741  1.00 52.02  ? 24   ARG M NE  1 
ATOM   9711  C CZ  . ARG M  1 24  ? 109.855 120.401 94.062  1.00 54.05  ? 24   ARG M CZ  1 
ATOM   9712  N NH1 . ARG M  1 24  ? 108.825 121.082 94.570  1.00 54.46  ? 24   ARG M NH1 1 
ATOM   9713  N NH2 . ARG M  1 24  ? 110.746 119.850 94.890  1.00 53.76  ? 24   ARG M NH2 1 
ATOM   9714  N N   . ALA M  1 25  ? 104.756 119.581 90.760  1.00 50.84  ? 25   ALA M N   1 
ATOM   9715  C CA  . ALA M  1 25  ? 103.578 118.785 91.105  1.00 49.29  ? 25   ALA M CA  1 
ATOM   9716  C C   . ALA M  1 25  ? 103.552 118.320 92.560  1.00 48.66  ? 25   ALA M C   1 
ATOM   9717  O O   . ALA M  1 25  ? 104.537 117.774 93.069  1.00 48.20  ? 25   ALA M O   1 
ATOM   9718  C CB  . ALA M  1 25  ? 103.453 117.591 90.168  1.00 48.90  ? 25   ALA M CB  1 
ATOM   9719  N N   . SER M  1 26  ? 102.406 118.558 93.213  1.00 47.22  ? 26   SER M N   1 
ATOM   9720  C CA  . SER M  1 26  ? 102.095 117.997 94.533  1.00 46.40  ? 26   SER M CA  1 
ATOM   9721  C C   . SER M  1 26  ? 102.419 116.509 94.690  1.00 47.29  ? 26   SER M C   1 
ATOM   9722  O O   . SER M  1 26  ? 102.654 116.029 95.823  1.00 47.80  ? 26   SER M O   1 
ATOM   9723  C CB  . SER M  1 26  ? 100.617 118.197 94.854  1.00 47.40  ? 26   SER M CB  1 
ATOM   9724  O OG  . SER M  1 26  ? 99.802  117.458 93.960  1.00 41.25  ? 26   SER M OG  1 
ATOM   9725  N N   . GLN M  1 27  ? 102.420 115.770 93.582  1.00 45.65  ? 27   GLN M N   1 
ATOM   9726  C CA  . GLN M  1 27  ? 102.977 114.427 93.640  1.00 46.11  ? 27   GLN M CA  1 
ATOM   9727  C C   . GLN M  1 27  ? 103.908 114.096 92.474  1.00 46.05  ? 27   GLN M C   1 
ATOM   9728  O O   . GLN M  1 27  ? 104.247 114.962 91.655  1.00 47.00  ? 27   GLN M O   1 
ATOM   9729  C CB  . GLN M  1 27  ? 101.897 113.347 93.917  1.00 47.32  ? 27   GLN M CB  1 
ATOM   9730  C CG  . GLN M  1 27  ? 100.894 113.045 92.787  1.00 46.34  ? 27   GLN M CG  1 
ATOM   9731  C CD  . GLN M  1 27  ? 99.568  112.457 93.319  1.00 46.90  ? 27   GLN M CD  1 
ATOM   9732  O OE1 . GLN M  1 27  ? 98.515  113.084 93.182  1.00 47.98  ? 27   GLN M OE1 1 
ATOM   9733  N NE2 . GLN M  1 27  ? 99.624  111.266 93.931  1.00 50.26  ? 27   GLN M NE2 1 
ATOM   9734  N N   . SER M  1 28  ? 104.355 112.846 92.452  1.00 45.67  ? 28   SER M N   1 
ATOM   9735  C CA  . SER M  1 28  ? 105.215 112.322 91.404  1.00 46.22  ? 28   SER M CA  1 
ATOM   9736  C C   . SER M  1 28  ? 104.370 112.168 90.132  1.00 45.91  ? 28   SER M C   1 
ATOM   9737  O O   . SER M  1 28  ? 103.442 111.357 90.098  1.00 45.53  ? 28   SER M O   1 
ATOM   9738  C CB  . SER M  1 28  ? 105.820 110.987 91.886  1.00 47.65  ? 28   SER M CB  1 
ATOM   9739  O OG  . SER M  1 28  ? 106.029 110.030 90.816  1.00 53.85  ? 28   SER M OG  1 
ATOM   9740  N N   . ILE M  1 29  ? 104.678 112.956 89.100  1.00 46.49  ? 29   ILE M N   1 
ATOM   9741  C CA  . ILE M  1 29  ? 103.826 113.031 87.894  1.00 46.74  ? 29   ILE M CA  1 
ATOM   9742  C C   . ILE M  1 29  ? 104.489 112.451 86.630  1.00 46.47  ? 29   ILE M C   1 
ATOM   9743  O O   . ILE M  1 29  ? 104.788 113.188 85.686  1.00 47.09  ? 29   ILE M O   1 
ATOM   9744  C CB  . ILE M  1 29  ? 103.339 114.508 87.628  1.00 46.28  ? 29   ILE M CB  1 
ATOM   9745  C CG1 . ILE M  1 29  ? 102.170 114.557 86.628  1.00 45.90  ? 29   ILE M CG1 1 
ATOM   9746  C CG2 . ILE M  1 29  ? 104.490 115.470 87.161  1.00 49.02  ? 29   ILE M CG2 1 
ATOM   9747  C CD1 . ILE M  1 29  ? 100.795 114.641 87.288  1.00 47.53  ? 29   ILE M CD1 1 
ATOM   9748  N N   . SER M  1 30  ? 104.692 111.137 86.591  1.00 44.95  ? 30   SER M N   1 
ATOM   9749  C CA  . SER M  1 30  ? 105.539 110.533 85.552  1.00 44.93  ? 30   SER M CA  1 
ATOM   9750  C C   . SER M  1 30  ? 106.126 111.520 84.520  1.00 46.47  ? 30   SER M C   1 
ATOM   9751  O O   . SER M  1 30  ? 107.260 111.973 84.691  1.00 47.73  ? 30   SER M O   1 
ATOM   9752  C CB  . SER M  1 30  ? 104.843 109.356 84.863  1.00 43.90  ? 30   SER M CB  1 
ATOM   9753  O OG  . SER M  1 30  ? 105.792 108.610 84.089  1.00 36.50  ? 30   SER M OG  1 
ATOM   9754  N N   . SER M  1 31  ? 105.377 111.854 83.469  1.00 46.96  ? 31   SER M N   1 
ATOM   9755  C CA  . SER M  1 31  ? 105.917 112.714 82.403  1.00 48.85  ? 31   SER M CA  1 
ATOM   9756  C C   . SER M  1 31  ? 104.880 113.669 81.845  1.00 48.76  ? 31   SER M C   1 
ATOM   9757  O O   . SER M  1 31  ? 105.176 114.454 80.932  1.00 49.43  ? 31   SER M O   1 
ATOM   9758  C CB  . SER M  1 31  ? 106.490 111.844 81.242  1.00 48.99  ? 31   SER M CB  1 
ATOM   9759  O OG  . SER M  1 31  ? 106.830 112.636 80.125  1.00 50.01  ? 31   SER M OG  1 
ATOM   9760  N N   . TYR M  1 32  ? 103.677 113.601 82.392  1.00 48.54  ? 32   TYR M N   1 
ATOM   9761  C CA  . TYR M  1 32  ? 102.539 114.139 81.685  1.00 48.90  ? 32   TYR M CA  1 
ATOM   9762  C C   . TYR M  1 32  ? 102.520 115.653 81.886  1.00 46.87  ? 32   TYR M C   1 
ATOM   9763  O O   . TYR M  1 32  ? 101.839 116.175 82.777  1.00 45.63  ? 32   TYR M O   1 
ATOM   9764  C CB  . TYR M  1 32  ? 101.278 113.371 82.112  1.00 50.70  ? 32   TYR M CB  1 
ATOM   9765  C CG  . TYR M  1 32  ? 101.424 111.854 81.897  1.00 51.27  ? 32   TYR M CG  1 
ATOM   9766  C CD1 . TYR M  1 32  ? 102.478 111.140 82.484  1.00 51.37  ? 32   TYR M CD1 1 
ATOM   9767  C CD2 . TYR M  1 32  ? 100.527 111.142 81.098  1.00 52.11  ? 32   TYR M CD2 1 
ATOM   9768  C CE1 . TYR M  1 32  ? 102.638 109.766 82.282  1.00 50.97  ? 32   TYR M CE1 1 
ATOM   9769  C CE2 . TYR M  1 32  ? 100.677 109.756 80.896  1.00 55.02  ? 32   TYR M CE2 1 
ATOM   9770  C CZ  . TYR M  1 32  ? 101.735 109.079 81.493  1.00 53.73  ? 32   TYR M CZ  1 
ATOM   9771  O OH  . TYR M  1 32  ? 101.888 107.722 81.303  1.00 53.61  ? 32   TYR M OH  1 
ATOM   9772  N N   . LEU M  1 33  ? 103.339 116.336 81.070  1.00 45.93  ? 33   LEU M N   1 
ATOM   9773  C CA  . LEU M  1 33  ? 103.572 117.762 81.270  1.00 45.32  ? 33   LEU M CA  1 
ATOM   9774  C C   . LEU M  1 33  ? 103.433 118.620 80.028  1.00 45.46  ? 33   LEU M C   1 
ATOM   9775  O O   . LEU M  1 33  ? 104.129 118.427 79.003  1.00 46.57  ? 33   LEU M O   1 
ATOM   9776  C CB  . LEU M  1 33  ? 104.894 118.058 81.968  1.00 43.95  ? 33   LEU M CB  1 
ATOM   9777  C CG  . LEU M  1 33  ? 104.667 119.467 82.546  1.00 41.11  ? 33   LEU M CG  1 
ATOM   9778  C CD1 . LEU M  1 33  ? 104.109 119.400 83.966  1.00 40.90  ? 33   LEU M CD1 1 
ATOM   9779  C CD2 . LEU M  1 33  ? 105.912 120.339 82.507  1.00 36.95  ? 33   LEU M CD2 1 
ATOM   9780  N N   . ASN M  1 34  ? 102.541 119.594 80.153  1.00 43.37  ? 34   ASN M N   1 
ATOM   9781  C CA  . ASN M  1 34  ? 102.124 120.299 78.992  1.00 43.32  ? 34   ASN M CA  1 
ATOM   9782  C C   . ASN M  1 34  ? 102.334 121.807 79.198  1.00 41.35  ? 34   ASN M C   1 
ATOM   9783  O O   . ASN M  1 34  ? 102.060 122.333 80.288  1.00 41.40  ? 34   ASN M O   1 
ATOM   9784  C CB  . ASN M  1 34  ? 100.677 119.853 78.644  1.00 44.03  ? 34   ASN M CB  1 
ATOM   9785  C CG  . ASN M  1 34  ? 100.441 118.336 78.947  1.00 45.67  ? 34   ASN M CG  1 
ATOM   9786  O OD1 . ASN M  1 34  ? 100.922 117.452 78.229  1.00 49.96  ? 34   ASN M OD1 1 
ATOM   9787  N ND2 . ASN M  1 34  ? 99.694  118.061 80.013  1.00 52.18  ? 34   ASN M ND2 1 
ATOM   9788  N N   . TRP M  1 35  ? 102.916 122.463 78.172  1.00 37.94  ? 35   TRP M N   1 
ATOM   9789  C CA  . TRP M  1 35  ? 103.102 123.917 78.194  1.00 34.99  ? 35   TRP M CA  1 
ATOM   9790  C C   . TRP M  1 35  ? 102.328 124.523 77.049  1.00 35.54  ? 35   TRP M C   1 
ATOM   9791  O O   . TRP M  1 35  ? 102.315 124.003 75.927  1.00 33.80  ? 35   TRP M O   1 
ATOM   9792  C CB  . TRP M  1 35  ? 104.566 124.326 78.053  1.00 33.52  ? 35   TRP M CB  1 
ATOM   9793  C CG  . TRP M  1 35  ? 105.487 123.800 79.092  1.00 29.98  ? 35   TRP M CG  1 
ATOM   9794  C CD1 . TRP M  1 35  ? 106.224 122.661 79.008  1.00 24.92  ? 35   TRP M CD1 1 
ATOM   9795  C CD2 . TRP M  1 35  ? 105.807 124.395 80.359  1.00 32.56  ? 35   TRP M CD2 1 
ATOM   9796  N NE1 . TRP M  1 35  ? 106.982 122.498 80.138  1.00 26.32  ? 35   TRP M NE1 1 
ATOM   9797  C CE2 . TRP M  1 35  ? 106.744 123.546 80.988  1.00 32.52  ? 35   TRP M CE2 1 
ATOM   9798  C CE3 . TRP M  1 35  ? 105.401 125.562 81.020  1.00 27.57  ? 35   TRP M CE3 1 
ATOM   9799  C CZ2 . TRP M  1 35  ? 107.275 123.817 82.254  1.00 28.36  ? 35   TRP M CZ2 1 
ATOM   9800  C CZ3 . TRP M  1 35  ? 105.933 125.833 82.283  1.00 30.88  ? 35   TRP M CZ3 1 
ATOM   9801  C CH2 . TRP M  1 35  ? 106.858 124.961 82.885  1.00 31.04  ? 35   TRP M CH2 1 
ATOM   9802  N N   . TYR M  1 36  ? 101.708 125.646 77.344  1.00 35.10  ? 36   TYR M N   1 
ATOM   9803  C CA  . TYR M  1 36  ? 100.641 126.110 76.523  1.00 33.53  ? 36   TYR M CA  1 
ATOM   9804  C C   . TYR M  1 36  ? 100.860 127.569 76.222  1.00 35.98  ? 36   TYR M C   1 
ATOM   9805  O O   . TYR M  1 36  ? 100.551 128.440 77.045  1.00 37.76  ? 36   TYR M O   1 
ATOM   9806  C CB  . TYR M  1 36  ? 99.310  125.876 77.253  1.00 32.05  ? 36   TYR M CB  1 
ATOM   9807  C CG  . TYR M  1 36  ? 98.722  124.494 77.050  1.00 27.60  ? 36   TYR M CG  1 
ATOM   9808  C CD1 . TYR M  1 36  ? 98.439  123.660 78.132  1.00 25.13  ? 36   TYR M CD1 1 
ATOM   9809  C CD2 . TYR M  1 36  ? 98.428  124.028 75.770  1.00 31.00  ? 36   TYR M CD2 1 
ATOM   9810  C CE1 . TYR M  1 36  ? 97.887  122.394 77.938  1.00 31.97  ? 36   TYR M CE1 1 
ATOM   9811  C CE2 . TYR M  1 36  ? 97.884  122.771 75.568  1.00 30.85  ? 36   TYR M CE2 1 
ATOM   9812  C CZ  . TYR M  1 36  ? 97.615  121.960 76.651  1.00 30.09  ? 36   TYR M CZ  1 
ATOM   9813  O OH  . TYR M  1 36  ? 97.069  120.711 76.446  1.00 27.60  ? 36   TYR M OH  1 
ATOM   9814  N N   . GLN M  1 37  ? 101.421 127.849 75.058  1.00 37.16  ? 37   GLN M N   1 
ATOM   9815  C CA  . GLN M  1 37  ? 101.578 129.229 74.698  1.00 38.75  ? 37   GLN M CA  1 
ATOM   9816  C C   . GLN M  1 37  ? 100.187 129.744 74.398  1.00 41.16  ? 37   GLN M C   1 
ATOM   9817  O O   . GLN M  1 37  ? 99.503  129.224 73.510  1.00 42.85  ? 37   GLN M O   1 
ATOM   9818  C CB  . GLN M  1 37  ? 102.467 129.344 73.480  1.00 38.50  ? 37   GLN M CB  1 
ATOM   9819  C CG  . GLN M  1 37  ? 102.767 130.755 73.092  1.00 38.10  ? 37   GLN M CG  1 
ATOM   9820  C CD  . GLN M  1 37  ? 103.651 130.810 71.888  1.00 39.39  ? 37   GLN M CD  1 
ATOM   9821  O OE1 . GLN M  1 37  ? 103.197 131.181 70.775  1.00 39.42  ? 37   GLN M OE1 1 
ATOM   9822  N NE2 . GLN M  1 37  ? 104.921 130.416 72.080  1.00 38.44  ? 37   GLN M NE2 1 
ATOM   9823  N N   . GLN M  1 38  ? 99.743  130.727 75.171  1.00 43.40  ? 38   GLN M N   1 
ATOM   9824  C CA  . GLN M  1 38  ? 98.559  131.451 74.772  1.00 44.08  ? 38   GLN M CA  1 
ATOM   9825  C C   . GLN M  1 38  ? 98.960  132.857 74.380  1.00 43.18  ? 38   GLN M C   1 
ATOM   9826  O O   . GLN M  1 38  ? 99.239  133.689 75.249  1.00 43.36  ? 38   GLN M O   1 
ATOM   9827  C CB  . GLN M  1 38  ? 97.502  131.505 75.874  1.00 45.75  ? 38   GLN M CB  1 
ATOM   9828  C CG  . GLN M  1 38  ? 96.279  132.287 75.413  1.00 46.36  ? 38   GLN M CG  1 
ATOM   9829  C CD  . GLN M  1 38  ? 95.383  132.717 76.542  1.00 45.36  ? 38   GLN M CD  1 
ATOM   9830  O OE1 . GLN M  1 38  ? 95.318  133.900 76.880  1.00 52.19  ? 38   GLN M OE1 1 
ATOM   9831  N NE2 . GLN M  1 38  ? 94.683  131.761 77.143  1.00 45.23  ? 38   GLN M NE2 1 
ATOM   9832  N N   . LYS M  1 39  ? 99.028  133.119 73.068  1.00 43.65  ? 39   LYS M N   1 
ATOM   9833  C CA  . LYS M  1 39  ? 99.071  134.512 72.607  1.00 42.98  ? 39   LYS M CA  1 
ATOM   9834  C C   . LYS M  1 39  ? 97.853  135.165 73.212  1.00 44.94  ? 39   LYS M C   1 
ATOM   9835  O O   . LYS M  1 39  ? 96.797  134.497 73.350  1.00 47.37  ? 39   LYS M O   1 
ATOM   9836  C CB  . LYS M  1 39  ? 99.006  134.621 71.082  1.00 42.51  ? 39   LYS M CB  1 
ATOM   9837  C CG  . LYS M  1 39  ? 100.352 134.907 70.401  1.00 40.00  ? 39   LYS M CG  1 
ATOM   9838  C CD  . LYS M  1 39  ? 100.132 135.827 69.187  1.00 38.78  ? 39   LYS M CD  1 
ATOM   9839  C CE  . LYS M  1 39  ? 101.166 135.596 68.086  1.00 34.91  ? 39   LYS M CE  1 
ATOM   9840  N NZ  . LYS M  1 39  ? 102.621 135.671 68.623  1.00 13.46  ? 39   LYS M NZ  1 
ATOM   9841  N N   . PRO M  1 40  ? 97.947  136.452 73.564  1.00 45.25  ? 40   PRO M N   1 
ATOM   9842  C CA  . PRO M  1 40  ? 96.794  136.766 74.372  1.00 44.82  ? 40   PRO M CA  1 
ATOM   9843  C C   . PRO M  1 40  ? 95.692  137.302 73.486  1.00 45.96  ? 40   PRO M C   1 
ATOM   9844  O O   . PRO M  1 40  ? 95.886  137.483 72.279  1.00 48.69  ? 40   PRO M O   1 
ATOM   9845  C CB  . PRO M  1 40  ? 97.314  137.831 75.351  1.00 45.00  ? 40   PRO M CB  1 
ATOM   9846  C CG  . PRO M  1 40  ? 98.509  138.443 74.679  1.00 46.40  ? 40   PRO M CG  1 
ATOM   9847  C CD  . PRO M  1 40  ? 98.827  137.620 73.369  1.00 46.01  ? 40   PRO M CD  1 
ATOM   9848  N N   . GLY M  1 41  ? 94.533  137.542 74.082  1.00 45.21  ? 41   GLY M N   1 
ATOM   9849  C CA  . GLY M  1 41  ? 93.339  137.744 73.292  1.00 43.58  ? 41   GLY M CA  1 
ATOM   9850  C C   . GLY M  1 41  ? 92.868  136.393 72.739  1.00 43.64  ? 41   GLY M C   1 
ATOM   9851  O O   . GLY M  1 41  ? 91.661  136.206 72.476  1.00 42.24  ? 41   GLY M O   1 
ATOM   9852  N N   . LYS M  1 42  ? 93.790  135.437 72.577  1.00 44.05  ? 42   LYS M N   1 
ATOM   9853  C CA  . LYS M  1 42  ? 93.480  134.181 71.867  1.00 42.76  ? 42   LYS M CA  1 
ATOM   9854  C C   . LYS M  1 42  ? 93.140  132.927 72.709  1.00 42.29  ? 42   LYS M C   1 
ATOM   9855  O O   . LYS M  1 42  ? 92.057  132.890 73.365  1.00 41.60  ? 42   LYS M O   1 
ATOM   9856  C CB  . LYS M  1 42  ? 94.517  133.888 70.761  1.00 43.56  ? 42   LYS M CB  1 
ATOM   9857  C CG  . LYS M  1 42  ? 94.163  134.551 69.405  1.00 44.93  ? 42   LYS M CG  1 
ATOM   9858  C CD  . LYS M  1 42  ? 95.212  134.150 68.286  1.00 42.84  ? 42   LYS M CD  1 
ATOM   9859  C CE  . LYS M  1 42  ? 94.770  134.780 66.948  1.00 44.46  ? 42   LYS M CE  1 
ATOM   9860  N NZ  . LYS M  1 42  ? 95.645  134.348 65.794  1.00 44.57  ? 42   LYS M NZ  1 
ATOM   9861  N N   . ALA M  1 43  ? 94.050  131.915 72.680  1.00 40.78  ? 43   ALA M N   1 
ATOM   9862  C CA  . ALA M  1 43  ? 93.681  130.567 73.186  1.00 39.67  ? 43   ALA M CA  1 
ATOM   9863  C C   . ALA M  1 43  ? 94.861  129.587 73.184  1.00 38.99  ? 43   ALA M C   1 
ATOM   9864  O O   . ALA M  1 43  ? 95.529  129.419 72.150  1.00 39.46  ? 43   ALA M O   1 
ATOM   9865  C CB  . ALA M  1 43  ? 92.537  129.990 72.350  1.00 39.72  ? 43   ALA M CB  1 
ATOM   9866  N N   . PRO M  1 44  ? 95.110  128.925 74.332  1.00 36.97  ? 44   PRO M N   1 
ATOM   9867  C CA  . PRO M  1 44  ? 96.285  128.096 74.524  1.00 35.54  ? 44   PRO M CA  1 
ATOM   9868  C C   . PRO M  1 44  ? 96.522  127.101 73.403  1.00 34.92  ? 44   PRO M C   1 
ATOM   9869  O O   . PRO M  1 44  ? 95.642  126.310 73.054  1.00 34.11  ? 44   PRO M O   1 
ATOM   9870  C CB  . PRO M  1 44  ? 95.984  127.366 75.859  1.00 35.08  ? 44   PRO M CB  1 
ATOM   9871  C CG  . PRO M  1 44  ? 95.189  128.338 76.607  1.00 34.86  ? 44   PRO M CG  1 
ATOM   9872  C CD  . PRO M  1 44  ? 94.273  128.935 75.545  1.00 38.60  ? 44   PRO M CD  1 
ATOM   9873  N N   . LYS M  1 45  ? 97.713  127.196 72.832  1.00 34.34  ? 45   LYS M N   1 
ATOM   9874  C CA  . LYS M  1 45  ? 98.161  126.303 71.793  1.00 34.82  ? 45   LYS M CA  1 
ATOM   9875  C C   . LYS M  1 45  ? 99.225  125.423 72.428  1.00 36.28  ? 45   LYS M C   1 
ATOM   9876  O O   . LYS M  1 45  ? 99.656  125.672 73.559  1.00 34.33  ? 45   LYS M O   1 
ATOM   9877  C CB  . LYS M  1 45  ? 98.750  127.112 70.631  1.00 34.09  ? 45   LYS M CB  1 
ATOM   9878  C CG  . LYS M  1 45  ? 97.758  128.046 69.934  1.00 32.85  ? 45   LYS M CG  1 
ATOM   9879  C CD  . LYS M  1 45  ? 97.318  127.491 68.577  1.00 33.04  ? 45   LYS M CD  1 
ATOM   9880  C CE  . LYS M  1 45  ? 96.458  128.497 67.813  1.00 36.63  ? 45   LYS M CE  1 
ATOM   9881  N NZ  . LYS M  1 45  ? 97.200  129.807 67.506  1.00 36.37  ? 45   LYS M NZ  1 
ATOM   9882  N N   . LEU M  1 46  ? 99.650  124.400 71.696  1.00 37.14  ? 46   LEU M N   1 
ATOM   9883  C CA  . LEU M  1 46  ? 100.680 123.489 72.164  1.00 38.82  ? 46   LEU M CA  1 
ATOM   9884  C C   . LEU M  1 46  ? 102.095 123.973 71.932  1.00 40.62  ? 46   LEU M C   1 
ATOM   9885  O O   . LEU M  1 46  ? 102.400 124.602 70.910  1.00 40.77  ? 46   LEU M O   1 
ATOM   9886  C CB  . LEU M  1 46  ? 100.528 122.131 71.478  1.00 37.31  ? 46   LEU M CB  1 
ATOM   9887  C CG  . LEU M  1 46  ? 99.802  121.058 72.281  1.00 37.49  ? 46   LEU M CG  1 
ATOM   9888  C CD1 . LEU M  1 46  ? 100.394 120.943 73.682  1.00 28.17  ? 46   LEU M CD1 1 
ATOM   9889  C CD2 . LEU M  1 46  ? 98.285  121.323 72.348  1.00 31.99  ? 46   LEU M CD2 1 
ATOM   9890  N N   . LEU M  1 47  ? 102.957 123.657 72.889  1.00 42.71  ? 47   LEU M N   1 
ATOM   9891  C CA  . LEU M  1 47  ? 104.391 123.725 72.695  1.00 44.62  ? 47   LEU M CA  1 
ATOM   9892  C C   . LEU M  1 47  ? 104.903 122.286 72.839  1.00 45.60  ? 47   LEU M C   1 
ATOM   9893  O O   . LEU M  1 47  ? 105.641 121.775 71.987  1.00 43.84  ? 47   LEU M O   1 
ATOM   9894  C CB  . LEU M  1 47  ? 105.024 124.650 73.745  1.00 45.00  ? 47   LEU M CB  1 
ATOM   9895  C CG  . LEU M  1 47  ? 104.558 126.114 73.826  1.00 49.13  ? 47   LEU M CG  1 
ATOM   9896  C CD1 . LEU M  1 47  ? 104.490 126.604 75.282  1.00 49.86  ? 47   LEU M CD1 1 
ATOM   9897  C CD2 . LEU M  1 47  ? 105.452 127.029 72.977  1.00 48.68  ? 47   LEU M CD2 1 
ATOM   9898  N N   . ILE M  1 48  ? 104.452 121.647 73.921  1.00 48.39  ? 48   ILE M N   1 
ATOM   9899  C CA  . ILE M  1 48  ? 104.855 120.322 74.406  1.00 49.74  ? 48   ILE M CA  1 
ATOM   9900  C C   . ILE M  1 48  ? 103.650 119.940 75.238  1.00 50.89  ? 48   ILE M C   1 
ATOM   9901  O O   . ILE M  1 48  ? 103.039 120.848 75.818  1.00 49.86  ? 48   ILE M O   1 
ATOM   9902  C CB  . ILE M  1 48  ? 106.013 120.434 75.425  1.00 49.87  ? 48   ILE M CB  1 
ATOM   9903  C CG1 . ILE M  1 48  ? 106.424 121.906 75.645  1.00 48.85  ? 48   ILE M CG1 1 
ATOM   9904  C CG2 . ILE M  1 48  ? 107.173 119.530 75.038  1.00 50.37  ? 48   ILE M CG2 1 
ATOM   9905  C CD1 . ILE M  1 48  ? 107.854 122.117 76.145  1.00 49.37  ? 48   ILE M CD1 1 
ATOM   9906  N N   . TYR M  1 49  ? 103.247 118.670 75.374  1.00 53.33  ? 49   TYR M N   1 
ATOM   9907  C CA  . TYR M  1 49  ? 103.857 117.372 74.946  1.00 56.50  ? 49   TYR M CA  1 
ATOM   9908  C C   . TYR M  1 49  ? 105.089 116.788 75.582  1.00 56.12  ? 49   TYR M C   1 
ATOM   9909  O O   . TYR M  1 49  ? 106.106 116.501 74.907  1.00 54.44  ? 49   TYR M O   1 
ATOM   9910  C CB  . TYR M  1 49  ? 103.788 117.073 73.447  1.00 58.58  ? 49   TYR M CB  1 
ATOM   9911  C CG  . TYR M  1 49  ? 102.426 117.321 72.942  1.00 61.87  ? 49   TYR M CG  1 
ATOM   9912  C CD1 . TYR M  1 49  ? 102.208 117.588 71.607  1.00 65.50  ? 49   TYR M CD1 1 
ATOM   9913  C CD2 . TYR M  1 49  ? 101.344 117.348 73.819  1.00 66.11  ? 49   TYR M CD2 1 
ATOM   9914  C CE1 . TYR M  1 49  ? 100.954 117.863 71.148  1.00 68.30  ? 49   TYR M CE1 1 
ATOM   9915  C CE2 . TYR M  1 49  ? 100.094 117.616 73.379  1.00 68.87  ? 49   TYR M CE2 1 
ATOM   9916  C CZ  . TYR M  1 49  ? 99.904  117.871 72.046  1.00 67.39  ? 49   TYR M CZ  1 
ATOM   9917  O OH  . TYR M  1 49  ? 98.639  118.151 71.638  1.00 67.11  ? 49   TYR M OH  1 
ATOM   9918  N N   . ALA M  1 50  ? 104.931 116.573 76.894  1.00 57.44  ? 50   ALA M N   1 
ATOM   9919  C CA  . ALA M  1 50  ? 105.522 115.369 77.520  1.00 59.85  ? 50   ALA M CA  1 
ATOM   9920  C C   . ALA M  1 50  ? 106.931 115.592 78.035  1.00 61.52  ? 50   ALA M C   1 
ATOM   9921  O O   . ALA M  1 50  ? 107.772 114.683 78.027  1.00 62.65  ? 50   ALA M O   1 
ATOM   9922  C CB  . ALA M  1 50  ? 105.461 114.154 76.567  1.00 59.45  ? 50   ALA M CB  1 
ATOM   9923  N N   . ALA M  1 51  ? 107.158 116.815 78.511  1.00 62.65  ? 51   ALA M N   1 
ATOM   9924  C CA  . ALA M  1 51  ? 108.480 117.304 78.890  1.00 62.81  ? 51   ALA M CA  1 
ATOM   9925  C C   . ALA M  1 51  ? 109.502 117.293 77.738  1.00 62.64  ? 51   ALA M C   1 
ATOM   9926  O O   . ALA M  1 51  ? 110.684 117.557 77.969  1.00 62.19  ? 51   ALA M O   1 
ATOM   9927  C CB  . ALA M  1 51  ? 109.015 116.541 80.116  1.00 63.65  ? 51   ALA M CB  1 
ATOM   9928  N N   . SER M  1 52  ? 109.047 116.995 76.509  1.00 63.72  ? 52   SER M N   1 
ATOM   9929  C CA  . SER M  1 52  ? 109.914 117.032 75.299  1.00 64.23  ? 52   SER M CA  1 
ATOM   9930  C C   . SER M  1 52  ? 109.294 117.276 73.891  1.00 64.44  ? 52   SER M C   1 
ATOM   9931  O O   . SER M  1 52  ? 109.911 117.975 73.080  1.00 65.52  ? 52   SER M O   1 
ATOM   9932  C CB  . SER M  1 52  ? 110.881 115.825 75.238  1.00 64.42  ? 52   SER M CB  1 
ATOM   9933  O OG  . SER M  1 52  ? 111.636 115.728 76.468  1.00 67.32  ? 52   SER M OG  1 
ATOM   9934  N N   . SER M  1 53  ? 108.121 116.711 73.585  1.00 64.33  ? 53   SER M N   1 
ATOM   9935  C CA  . SER M  1 53  ? 107.579 116.782 72.203  1.00 64.06  ? 53   SER M CA  1 
ATOM   9936  C C   . SER M  1 53  ? 107.316 118.203 71.691  1.00 63.67  ? 53   SER M C   1 
ATOM   9937  O O   . SER M  1 53  ? 106.294 118.825 71.997  1.00 63.89  ? 53   SER M O   1 
ATOM   9938  C CB  . SER M  1 53  ? 106.349 115.879 72.008  1.00 64.04  ? 53   SER M CB  1 
ATOM   9939  O OG  . SER M  1 53  ? 105.721 116.110 70.744  1.00 62.66  ? 53   SER M OG  1 
ATOM   9940  N N   . LEU M  1 54  ? 108.265 118.691 70.900  1.00 63.50  ? 54   LEU M N   1 
ATOM   9941  C CA  . LEU M  1 54  ? 108.201 120.019 70.318  1.00 63.05  ? 54   LEU M CA  1 
ATOM   9942  C C   . LEU M  1 54  ? 107.410 119.952 69.022  1.00 62.76  ? 54   LEU M C   1 
ATOM   9943  O O   . LEU M  1 54  ? 107.860 119.356 68.037  1.00 61.29  ? 54   LEU M O   1 
ATOM   9944  C CB  . LEU M  1 54  ? 109.615 120.535 70.056  1.00 62.86  ? 54   LEU M CB  1 
ATOM   9945  C CG  . LEU M  1 54  ? 109.902 122.031 70.158  1.00 62.54  ? 54   LEU M CG  1 
ATOM   9946  C CD1 . LEU M  1 54  ? 111.403 122.211 70.308  1.00 60.28  ? 54   LEU M CD1 1 
ATOM   9947  C CD2 . LEU M  1 54  ? 109.400 122.780 68.941  1.00 61.98  ? 54   LEU M CD2 1 
ATOM   9948  N N   . GLN M  1 55  ? 106.227 120.559 69.031  1.00 62.56  ? 55   GLN M N   1 
ATOM   9949  C CA  . GLN M  1 55  ? 105.367 120.523 67.857  1.00 62.37  ? 55   GLN M CA  1 
ATOM   9950  C C   . GLN M  1 55  ? 105.904 121.366 66.739  1.00 62.60  ? 55   GLN M C   1 
ATOM   9951  O O   . GLN M  1 55  ? 106.620 122.344 66.961  1.00 62.69  ? 55   GLN M O   1 
ATOM   9952  C CB  . GLN M  1 55  ? 103.926 120.917 68.184  1.00 62.46  ? 55   GLN M CB  1 
ATOM   9953  C CG  . GLN M  1 55  ? 103.133 119.742 68.698  1.00 59.95  ? 55   GLN M CG  1 
ATOM   9954  C CD  . GLN M  1 55  ? 103.938 118.964 69.705  1.00 60.05  ? 55   GLN M CD  1 
ATOM   9955  O OE1 . GLN M  1 55  ? 104.704 118.039 69.342  1.00 56.11  ? 55   GLN M OE1 1 
ATOM   9956  N NE2 . GLN M  1 55  ? 103.817 119.366 70.975  1.00 60.49  ? 55   GLN M NE2 1 
ATOM   9957  N N   . SER M  1 56  ? 105.585 120.957 65.521  1.00 62.68  ? 56   SER M N   1 
ATOM   9958  C CA  . SER M  1 56  ? 105.806 121.823 64.392  1.00 62.56  ? 56   SER M CA  1 
ATOM   9959  C C   . SER M  1 56  ? 104.777 122.955 64.478  1.00 63.53  ? 56   SER M C   1 
ATOM   9960  O O   . SER M  1 56  ? 103.597 122.722 64.807  1.00 62.48  ? 56   SER M O   1 
ATOM   9961  C CB  . SER M  1 56  ? 105.737 121.039 63.074  1.00 62.45  ? 56   SER M CB  1 
ATOM   9962  O OG  . SER M  1 56  ? 106.853 120.148 62.963  1.00 55.90  ? 56   SER M OG  1 
ATOM   9963  N N   . GLY M  1 57  ? 105.244 124.175 64.207  1.00 64.93  ? 57   GLY M N   1 
ATOM   9964  C CA  . GLY M  1 57  ? 104.516 125.399 64.551  1.00 65.90  ? 57   GLY M CA  1 
ATOM   9965  C C   . GLY M  1 57  ? 105.385 126.231 65.481  1.00 67.17  ? 57   GLY M C   1 
ATOM   9966  O O   . GLY M  1 57  ? 105.904 127.281 65.090  1.00 67.74  ? 57   GLY M O   1 
ATOM   9967  N N   . VAL M  1 58  ? 105.533 125.748 66.715  1.00 66.43  ? 58   VAL M N   1 
ATOM   9968  C CA  . VAL M  1 58  ? 106.516 126.260 67.678  1.00 66.26  ? 58   VAL M CA  1 
ATOM   9969  C C   . VAL M  1 58  ? 107.954 126.042 67.148  1.00 65.46  ? 58   VAL M C   1 
ATOM   9970  O O   . VAL M  1 58  ? 108.329 124.911 66.830  1.00 65.68  ? 58   VAL M O   1 
ATOM   9971  C CB  . VAL M  1 58  ? 106.281 125.629 69.095  1.00 66.62  ? 58   VAL M CB  1 
ATOM   9972  C CG1 . VAL M  1 58  ? 105.733 124.206 68.995  1.00 67.80  ? 58   VAL M CG1 1 
ATOM   9973  C CG2 . VAL M  1 58  ? 107.534 125.658 69.939  1.00 66.48  ? 58   VAL M CG2 1 
ATOM   9974  N N   . PRO M  1 59  ? 108.747 127.132 67.022  1.00 64.15  ? 59   PRO M N   1 
ATOM   9975  C CA  . PRO M  1 59  ? 110.007 127.117 66.262  1.00 63.09  ? 59   PRO M CA  1 
ATOM   9976  C C   . PRO M  1 59  ? 111.276 126.627 66.975  1.00 62.24  ? 59   PRO M C   1 
ATOM   9977  O O   . PRO M  1 59  ? 112.276 127.357 67.005  1.00 63.05  ? 59   PRO M O   1 
ATOM   9978  C CB  . PRO M  1 59  ? 110.178 128.590 65.835  1.00 63.03  ? 59   PRO M CB  1 
ATOM   9979  C CG  . PRO M  1 59  ? 109.002 129.355 66.455  1.00 63.55  ? 59   PRO M CG  1 
ATOM   9980  C CD  . PRO M  1 59  ? 108.474 128.479 67.549  1.00 64.46  ? 59   PRO M CD  1 
ATOM   9981  N N   . SER M  1 60  ? 111.238 125.408 67.520  1.00 60.06  ? 60   SER M N   1 
ATOM   9982  C CA  . SER M  1 60  ? 112.443 124.693 67.997  1.00 57.55  ? 60   SER M CA  1 
ATOM   9983  C C   . SER M  1 60  ? 113.232 125.395 69.096  1.00 56.56  ? 60   SER M C   1 
ATOM   9984  O O   . SER M  1 60  ? 114.004 124.761 69.827  1.00 55.97  ? 60   SER M O   1 
ATOM   9985  C CB  . SER M  1 60  ? 113.381 124.369 66.826  1.00 57.13  ? 60   SER M CB  1 
ATOM   9986  O OG  . SER M  1 60  ? 114.073 125.533 66.376  1.00 57.03  ? 60   SER M OG  1 
ATOM   9987  N N   . ARG M  1 61  ? 113.044 126.707 69.187  1.00 52.94  ? 61   ARG M N   1 
ATOM   9988  C CA  . ARG M  1 61  ? 113.727 127.510 70.179  1.00 51.00  ? 61   ARG M CA  1 
ATOM   9989  C C   . ARG M  1 61  ? 113.161 127.194 71.558  1.00 48.56  ? 61   ARG M C   1 
ATOM   9990  O O   . ARG M  1 61  ? 113.838 127.367 72.571  1.00 47.19  ? 61   ARG M O   1 
ATOM   9991  C CB  . ARG M  1 61  ? 113.597 128.998 69.854  1.00 52.23  ? 61   ARG M CB  1 
ATOM   9992  C CG  . ARG M  1 61  ? 112.186 129.540 69.891  1.00 54.62  ? 61   ARG M CG  1 
ATOM   9993  C CD  . ARG M  1 61  ? 112.255 131.010 70.208  1.00 61.77  ? 61   ARG M CD  1 
ATOM   9994  N NE  . ARG M  1 61  ? 111.071 131.733 69.762  1.00 64.95  ? 61   ARG M NE  1 
ATOM   9995  C CZ  . ARG M  1 61  ? 110.876 132.154 68.516  1.00 67.42  ? 61   ARG M CZ  1 
ATOM   9996  N NH1 . ARG M  1 61  ? 111.784 131.924 67.574  1.00 71.77  ? 61   ARG M NH1 1 
ATOM   9997  N NH2 . ARG M  1 61  ? 109.765 132.810 68.206  1.00 71.25  ? 61   ARG M NH2 1 
ATOM   9998  N N   . PHE M  1 62  ? 111.922 126.704 71.574  1.00 46.33  ? 62   PHE M N   1 
ATOM   9999  C CA  . PHE M  1 62  ? 111.220 126.314 72.794  1.00 44.00  ? 62   PHE M CA  1 
ATOM   10000 C C   . PHE M  1 62  ? 111.588 124.913 73.215  1.00 43.64  ? 62   PHE M C   1 
ATOM   10001 O O   . PHE M  1 62  ? 111.877 124.069 72.364  1.00 44.45  ? 62   PHE M O   1 
ATOM   10002 C CB  . PHE M  1 62  ? 109.718 126.357 72.554  1.00 42.58  ? 62   PHE M CB  1 
ATOM   10003 C CG  . PHE M  1 62  ? 109.194 127.733 72.395  1.00 37.11  ? 62   PHE M CG  1 
ATOM   10004 C CD1 . PHE M  1 62  ? 109.045 128.298 71.136  1.00 37.76  ? 62   PHE M CD1 1 
ATOM   10005 C CD2 . PHE M  1 62  ? 108.881 128.490 73.514  1.00 31.25  ? 62   PHE M CD2 1 
ATOM   10006 C CE1 . PHE M  1 62  ? 108.573 129.591 70.992  1.00 38.37  ? 62   PHE M CE1 1 
ATOM   10007 C CE2 . PHE M  1 62  ? 108.408 129.784 73.383  1.00 34.31  ? 62   PHE M CE2 1 
ATOM   10008 C CZ  . PHE M  1 62  ? 108.257 130.334 72.119  1.00 37.82  ? 62   PHE M CZ  1 
ATOM   10009 N N   . SER M  1 63  ? 111.572 124.646 74.516  1.00 45.38  ? 63   SER M N   1 
ATOM   10010 C CA  . SER M  1 63  ? 111.858 123.288 74.961  1.00 48.08  ? 63   SER M CA  1 
ATOM   10011 C C   . SER M  1 63  ? 111.413 122.885 76.356  1.00 49.25  ? 63   SER M C   1 
ATOM   10012 O O   . SER M  1 63  ? 110.984 123.699 77.179  1.00 50.43  ? 63   SER M O   1 
ATOM   10013 C CB  . SER M  1 63  ? 113.340 122.924 74.748  1.00 48.36  ? 63   SER M CB  1 
ATOM   10014 O OG  . SER M  1 63  ? 114.207 123.982 75.121  1.00 51.22  ? 63   SER M OG  1 
ATOM   10015 N N   . GLY M  1 64  ? 111.523 121.579 76.568  1.00 51.93  ? 64   GLY M N   1 
ATOM   10016 C CA  . GLY M  1 64  ? 111.184 120.941 77.814  1.00 53.85  ? 64   GLY M CA  1 
ATOM   10017 C C   . GLY M  1 64  ? 112.324 120.003 78.135  1.00 54.99  ? 64   GLY M C   1 
ATOM   10018 O O   . GLY M  1 64  ? 113.127 119.642 77.259  1.00 55.56  ? 64   GLY M O   1 
ATOM   10019 N N   . SER M  1 65  ? 112.374 119.612 79.404  1.00 56.62  ? 65   SER M N   1 
ATOM   10020 C CA  . SER M  1 65  ? 113.411 118.751 79.965  1.00 57.14  ? 65   SER M CA  1 
ATOM   10021 C C   . SER M  1 65  ? 113.083 118.549 81.438  1.00 57.48  ? 65   SER M C   1 
ATOM   10022 O O   . SER M  1 65  ? 112.455 119.403 82.064  1.00 58.13  ? 65   SER M O   1 
ATOM   10023 C CB  . SER M  1 65  ? 114.799 119.378 79.815  1.00 56.82  ? 65   SER M CB  1 
ATOM   10024 O OG  . SER M  1 65  ? 115.804 118.509 80.312  1.00 60.67  ? 65   SER M OG  1 
ATOM   10025 N N   . GLY M  1 66  ? 113.497 117.416 81.990  1.00 58.22  ? 66   GLY M N   1 
ATOM   10026 C CA  . GLY M  1 66  ? 113.115 117.071 83.352  1.00 57.75  ? 66   GLY M CA  1 
ATOM   10027 C C   . GLY M  1 66  ? 111.796 116.312 83.395  1.00 57.72  ? 66   GLY M C   1 
ATOM   10028 O O   . GLY M  1 66  ? 111.139 116.120 82.368  1.00 58.42  ? 66   GLY M O   1 
ATOM   10029 N N   . SER M  1 67  ? 111.417 115.903 84.608  1.00 56.44  ? 67   SER M N   1 
ATOM   10030 C CA  . SER M  1 67  ? 110.374 114.900 84.841  1.00 55.87  ? 67   SER M CA  1 
ATOM   10031 C C   . SER M  1 67  ? 110.167 114.762 86.348  1.00 56.91  ? 67   SER M C   1 
ATOM   10032 O O   . SER M  1 67  ? 110.870 115.402 87.140  1.00 56.67  ? 67   SER M O   1 
ATOM   10033 C CB  . SER M  1 67  ? 110.792 113.528 84.287  1.00 54.95  ? 67   SER M CB  1 
ATOM   10034 O OG  . SER M  1 67  ? 111.389 113.609 83.000  1.00 52.00  ? 67   SER M OG  1 
ATOM   10035 N N   . GLY M  1 68  ? 109.211 113.919 86.738  1.00 57.50  ? 68   GLY M N   1 
ATOM   10036 C CA  . GLY M  1 68  ? 109.046 113.521 88.138  1.00 58.36  ? 68   GLY M CA  1 
ATOM   10037 C C   . GLY M  1 68  ? 108.233 114.490 88.971  1.00 59.47  ? 68   GLY M C   1 
ATOM   10038 O O   . GLY M  1 68  ? 107.072 114.226 89.293  1.00 59.48  ? 68   GLY M O   1 
ATOM   10039 N N   . THR M  1 69  ? 108.854 115.616 89.315  1.00 60.42  ? 69   THR M N   1 
ATOM   10040 C CA  . THR M  1 69  ? 108.256 116.616 90.197  1.00 60.46  ? 69   THR M CA  1 
ATOM   10041 C C   . THR M  1 69  ? 108.359 118.027 89.600  1.00 60.32  ? 69   THR M C   1 
ATOM   10042 O O   . THR M  1 69  ? 107.406 118.803 89.668  1.00 60.15  ? 69   THR M O   1 
ATOM   10043 C CB  . THR M  1 69  ? 108.953 116.624 91.590  1.00 60.54  ? 69   THR M CB  1 
ATOM   10044 O OG1 . THR M  1 69  ? 109.481 115.325 91.885  1.00 60.34  ? 69   THR M OG1 1 
ATOM   10045 C CG2 . THR M  1 69  ? 107.984 117.044 92.691  1.00 61.97  ? 69   THR M CG2 1 
ATOM   10046 N N   . ASP M  1 70  ? 109.503 118.314 88.972  1.00 60.25  ? 70   ASP M N   1 
ATOM   10047 C CA  . ASP M  1 70  ? 110.020 119.686 88.805  1.00 59.27  ? 70   ASP M CA  1 
ATOM   10048 C C   . ASP M  1 70  ? 110.267 120.085 87.354  1.00 57.87  ? 70   ASP M C   1 
ATOM   10049 O O   . ASP M  1 70  ? 110.789 119.272 86.583  1.00 56.94  ? 70   ASP M O   1 
ATOM   10050 C CB  . ASP M  1 70  ? 111.339 119.802 89.573  1.00 59.46  ? 70   ASP M CB  1 
ATOM   10051 C CG  . ASP M  1 70  ? 111.779 121.243 89.769  1.00 60.03  ? 70   ASP M CG  1 
ATOM   10052 O OD1 . ASP M  1 70  ? 110.904 122.158 89.813  1.00 59.67  ? 70   ASP M OD1 1 
ATOM   10053 O OD2 . ASP M  1 70  ? 113.007 121.470 89.881  1.00 61.94  ? 70   ASP M OD2 1 
ATOM   10054 N N   . PHE M  1 71  ? 109.937 121.323 86.966  1.00 55.54  ? 71   PHE M N   1 
ATOM   10055 C CA  . PHE M  1 71  ? 109.825 121.565 85.519  1.00 54.47  ? 71   PHE M CA  1 
ATOM   10056 C C   . PHE M  1 71  ? 110.535 122.634 84.718  1.00 53.18  ? 71   PHE M C   1 
ATOM   10057 O O   . PHE M  1 71  ? 111.009 123.627 85.249  1.00 52.74  ? 71   PHE M O   1 
ATOM   10058 C CB  . PHE M  1 71  ? 108.433 121.220 85.012  1.00 56.00  ? 71   PHE M CB  1 
ATOM   10059 C CG  . PHE M  1 71  ? 108.226 119.753 84.956  1.00 58.94  ? 71   PHE M CG  1 
ATOM   10060 C CD1 . PHE M  1 71  ? 107.623 119.077 86.013  1.00 58.19  ? 71   PHE M CD1 1 
ATOM   10061 C CD2 . PHE M  1 71  ? 108.750 119.022 83.900  1.00 58.67  ? 71   PHE M CD2 1 
ATOM   10062 C CE1 . PHE M  1 71  ? 107.488 117.699 85.984  1.00 59.80  ? 71   PHE M CE1 1 
ATOM   10063 C CE2 . PHE M  1 71  ? 108.610 117.658 83.852  1.00 60.13  ? 71   PHE M CE2 1 
ATOM   10064 C CZ  . PHE M  1 71  ? 107.979 116.991 84.896  1.00 57.61  ? 71   PHE M CZ  1 
ATOM   10065 N N   . THR M  1 72  ? 110.646 122.392 83.419  1.00 51.29  ? 72   THR M N   1 
ATOM   10066 C CA  . THR M  1 72  ? 111.629 123.117 82.649  1.00 49.15  ? 72   THR M CA  1 
ATOM   10067 C C   . THR M  1 72  ? 111.112 123.593 81.306  1.00 47.08  ? 72   THR M C   1 
ATOM   10068 O O   . THR M  1 72  ? 111.195 122.887 80.294  1.00 48.20  ? 72   THR M O   1 
ATOM   10069 C CB  . THR M  1 72  ? 112.926 122.287 82.510  1.00 48.99  ? 72   THR M CB  1 
ATOM   10070 O OG1 . THR M  1 72  ? 113.467 122.009 83.853  1.00 53.69  ? 72   THR M OG1 1 
ATOM   10071 C CG2 . THR M  1 72  ? 113.974 123.040 81.702  1.00 49.49  ? 72   THR M CG2 1 
ATOM   10072 N N   . LEU M  1 73  ? 110.554 124.796 81.303  1.00 44.73  ? 73   LEU M N   1 
ATOM   10073 C CA  . LEU M  1 73  ? 110.277 125.419 80.038  1.00 41.30  ? 73   LEU M CA  1 
ATOM   10074 C C   . LEU M  1 73  ? 111.544 126.128 79.599  1.00 40.48  ? 73   LEU M C   1 
ATOM   10075 O O   . LEU M  1 73  ? 111.913 127.168 80.153  1.00 40.76  ? 73   LEU M O   1 
ATOM   10076 C CB  . LEU M  1 73  ? 109.092 126.378 80.117  1.00 40.04  ? 73   LEU M CB  1 
ATOM   10077 C CG  . LEU M  1 73  ? 108.683 126.883 78.729  1.00 37.08  ? 73   LEU M CG  1 
ATOM   10078 C CD1 . LEU M  1 73  ? 108.185 125.731 77.821  1.00 25.62  ? 73   LEU M CD1 1 
ATOM   10079 C CD2 . LEU M  1 73  ? 107.614 127.959 78.851  1.00 35.51  ? 73   LEU M CD2 1 
ATOM   10080 N N   . THR M  1 74  ? 112.215 125.562 78.608  1.00 38.92  ? 74   THR M N   1 
ATOM   10081 C CA  . THR M  1 74  ? 113.451 126.157 78.136  1.00 39.16  ? 74   THR M CA  1 
ATOM   10082 C C   . THR M  1 74  ? 113.267 126.826 76.769  1.00 40.26  ? 74   THR M C   1 
ATOM   10083 O O   . THR M  1 74  ? 113.336 126.172 75.726  1.00 40.84  ? 74   THR M O   1 
ATOM   10084 C CB  . THR M  1 74  ? 114.593 125.121 78.124  1.00 38.76  ? 74   THR M CB  1 
ATOM   10085 O OG1 . THR M  1 74  ? 114.679 124.491 79.410  1.00 39.38  ? 74   THR M OG1 1 
ATOM   10086 C CG2 . THR M  1 74  ? 115.927 125.788 77.814  1.00 38.39  ? 74   THR M CG2 1 
ATOM   10087 N N   . ILE M  1 75  ? 113.021 128.133 76.785  1.00 39.31  ? 75   ILE M N   1 
ATOM   10088 C CA  . ILE M  1 75  ? 112.968 128.896 75.546  1.00 39.46  ? 75   ILE M CA  1 
ATOM   10089 C C   . ILE M  1 75  ? 114.382 129.401 75.276  1.00 42.31  ? 75   ILE M C   1 
ATOM   10090 O O   . ILE M  1 75  ? 114.876 130.267 76.002  1.00 43.42  ? 75   ILE M O   1 
ATOM   10091 C CB  . ILE M  1 75  ? 111.982 130.084 75.652  1.00 39.48  ? 75   ILE M CB  1 
ATOM   10092 C CG1 . ILE M  1 75  ? 110.633 129.631 76.232  1.00 37.08  ? 75   ILE M CG1 1 
ATOM   10093 C CG2 . ILE M  1 75  ? 111.823 130.776 74.271  1.00 32.40  ? 75   ILE M CG2 1 
ATOM   10094 C CD1 . ILE M  1 75  ? 109.744 130.766 76.739  1.00 26.67  ? 75   ILE M CD1 1 
ATOM   10095 N N   . SER M  1 76  ? 115.037 128.848 74.252  1.00 43.82  ? 76   SER M N   1 
ATOM   10096 C CA  . SER M  1 76  ? 116.440 129.173 73.966  1.00 45.01  ? 76   SER M CA  1 
ATOM   10097 C C   . SER M  1 76  ? 116.653 130.685 73.792  1.00 43.86  ? 76   SER M C   1 
ATOM   10098 O O   . SER M  1 76  ? 117.305 131.329 74.636  1.00 43.65  ? 76   SER M O   1 
ATOM   10099 C CB  . SER M  1 76  ? 116.982 128.367 72.769  1.00 45.29  ? 76   SER M CB  1 
ATOM   10100 O OG  . SER M  1 76  ? 116.787 129.012 71.447  1.00 47.12  ? 76   SER M OG  1 
ATOM   10101 N N   . SER M  1 77  ? 116.083 131.245 72.719  1.00 44.96  ? 77   SER M N   1 
ATOM   10102 C CA  . SER M  1 77  ? 116.170 132.682 72.421  1.00 44.78  ? 77   SER M CA  1 
ATOM   10103 C C   . SER M  1 77  ? 114.758 133.279 72.334  1.00 44.45  ? 77   SER M C   1 
ATOM   10104 O O   . SER M  1 77  ? 113.787 132.511 72.210  1.00 44.88  ? 77   SER M O   1 
ATOM   10105 C CB  . SER M  1 77  ? 116.913 132.876 71.099  1.00 43.62  ? 77   SER M CB  1 
ATOM   10106 O OG  . SER M  1 77  ? 117.044 134.248 70.773  1.00 45.44  ? 77   SER M OG  1 
ATOM   10107 N N   . LEU M  1 78  ? 114.629 134.619 72.371  1.00 46.54  ? 78   LEU M N   1 
ATOM   10108 C CA  . LEU M  1 78  ? 113.298 135.284 72.532  1.00 47.02  ? 78   LEU M CA  1 
ATOM   10109 C C   . LEU M  1 78  ? 112.967 136.478 71.590  1.00 49.24  ? 78   LEU M C   1 
ATOM   10110 O O   . LEU M  1 78  ? 113.856 137.288 71.291  1.00 51.48  ? 78   LEU M O   1 
ATOM   10111 C CB  . LEU M  1 78  ? 113.125 135.736 73.992  1.00 44.51  ? 78   LEU M CB  1 
ATOM   10112 C CG  . LEU M  1 78  ? 111.669 135.865 74.476  1.00 41.84  ? 78   LEU M CG  1 
ATOM   10113 C CD1 . LEU M  1 78  ? 111.119 134.494 74.893  1.00 39.61  ? 78   LEU M CD1 1 
ATOM   10114 C CD2 . LEU M  1 78  ? 111.610 136.895 75.646  1.00 27.11  ? 78   LEU M CD2 1 
ATOM   10115 N N   . GLN M  1 79  ? 111.706 136.600 71.147  1.00 50.02  ? 79   GLN M N   1 
ATOM   10116 C CA  . GLN M  1 79  ? 111.291 137.676 70.202  1.00 50.63  ? 79   GLN M CA  1 
ATOM   10117 C C   . GLN M  1 79  ? 109.842 138.193 70.344  1.00 51.30  ? 79   GLN M C   1 
ATOM   10118 O O   . GLN M  1 79  ? 108.984 137.481 70.890  1.00 53.33  ? 79   GLN M O   1 
ATOM   10119 C CB  . GLN M  1 79  ? 111.531 137.258 68.752  1.00 50.97  ? 79   GLN M CB  1 
ATOM   10120 C CG  . GLN M  1 79  ? 111.150 135.841 68.445  1.00 54.93  ? 79   GLN M CG  1 
ATOM   10121 C CD  . GLN M  1 79  ? 112.357 134.939 68.454  1.00 55.75  ? 79   GLN M CD  1 
ATOM   10122 O OE1 . GLN M  1 79  ? 112.711 134.354 69.480  1.00 56.03  ? 79   GLN M OE1 1 
ATOM   10123 N NE2 . GLN M  1 79  ? 113.016 134.829 67.307  1.00 56.08  ? 79   GLN M NE2 1 
ATOM   10124 N N   . PRO M  1 80  ? 109.553 139.402 69.790  1.00 51.23  ? 80   PRO M N   1 
ATOM   10125 C CA  . PRO M  1 80  ? 108.407 140.251 70.150  1.00 50.34  ? 80   PRO M CA  1 
ATOM   10126 C C   . PRO M  1 80  ? 107.115 139.484 70.384  1.00 49.22  ? 80   PRO M C   1 
ATOM   10127 O O   . PRO M  1 80  ? 106.597 139.465 71.502  1.00 49.70  ? 80   PRO M O   1 
ATOM   10128 C CB  . PRO M  1 80  ? 108.255 141.185 68.930  1.00 50.67  ? 80   PRO M CB  1 
ATOM   10129 C CG  . PRO M  1 80  ? 109.247 140.698 67.903  1.00 52.16  ? 80   PRO M CG  1 
ATOM   10130 C CD  . PRO M  1 80  ? 110.315 140.019 68.690  1.00 51.19  ? 80   PRO M CD  1 
ATOM   10131 N N   . GLU M  1 81  ? 106.636 138.847 69.317  1.00 47.82  ? 81   GLU M N   1 
ATOM   10132 C CA  . GLU M  1 81  ? 105.385 138.098 69.283  1.00 46.15  ? 81   GLU M CA  1 
ATOM   10133 C C   . GLU M  1 81  ? 105.354 136.880 70.209  1.00 46.05  ? 81   GLU M C   1 
ATOM   10134 O O   . GLU M  1 81  ? 104.272 136.411 70.568  1.00 44.51  ? 81   GLU M O   1 
ATOM   10135 C CB  . GLU M  1 81  ? 105.143 137.623 67.858  1.00 46.91  ? 81   GLU M CB  1 
ATOM   10136 C CG  . GLU M  1 81  ? 106.006 136.422 67.505  1.00 43.22  ? 81   GLU M CG  1 
ATOM   10137 C CD  . GLU M  1 81  ? 106.876 136.664 66.302  1.00 43.43  ? 81   GLU M CD  1 
ATOM   10138 O OE1 . GLU M  1 81  ? 108.087 136.367 66.376  1.00 46.94  ? 81   GLU M OE1 1 
ATOM   10139 O OE2 . GLU M  1 81  ? 106.353 137.156 65.278  1.00 42.47  ? 81   GLU M OE2 1 
ATOM   10140 N N   . ASP M  1 82  ? 106.526 136.344 70.564  1.00 45.47  ? 82   ASP M N   1 
ATOM   10141 C CA  . ASP M  1 82  ? 106.598 135.353 71.633  1.00 45.64  ? 82   ASP M CA  1 
ATOM   10142 C C   . ASP M  1 82  ? 105.992 135.972 72.858  1.00 46.41  ? 82   ASP M C   1 
ATOM   10143 O O   . ASP M  1 82  ? 105.778 135.287 73.871  1.00 44.71  ? 82   ASP M O   1 
ATOM   10144 C CB  . ASP M  1 82  ? 108.029 134.930 71.937  1.00 43.79  ? 82   ASP M CB  1 
ATOM   10145 C CG  . ASP M  1 82  ? 108.524 133.849 71.005  1.00 48.64  ? 82   ASP M CG  1 
ATOM   10146 O OD1 . ASP M  1 82  ? 107.749 133.376 70.146  1.00 52.25  ? 82   ASP M OD1 1 
ATOM   10147 O OD2 . ASP M  1 82  ? 109.703 133.466 71.139  1.00 47.75  ? 82   ASP M OD2 1 
ATOM   10148 N N   . PHE M  1 83  ? 105.713 137.272 72.772  1.00 47.18  ? 83   PHE M N   1 
ATOM   10149 C CA  . PHE M  1 83  ? 104.816 137.849 73.723  1.00 47.36  ? 83   PHE M CA  1 
ATOM   10150 C C   . PHE M  1 83  ? 103.727 136.809 73.920  1.00 46.04  ? 83   PHE M C   1 
ATOM   10151 O O   . PHE M  1 83  ? 102.893 136.608 73.014  1.00 45.56  ? 83   PHE M O   1 
ATOM   10152 C CB  . PHE M  1 83  ? 104.117 139.096 73.183  1.00 47.87  ? 83   PHE M CB  1 
ATOM   10153 C CG  . PHE M  1 83  ? 103.115 139.618 74.141  1.00 49.51  ? 83   PHE M CG  1 
ATOM   10154 C CD1 . PHE M  1 83  ? 103.361 140.785 74.840  1.00 50.96  ? 83   PHE M CD1 1 
ATOM   10155 C CD2 . PHE M  1 83  ? 101.975 138.883 74.455  1.00 51.66  ? 83   PHE M CD2 1 
ATOM   10156 C CE1 . PHE M  1 83  ? 102.455 141.248 75.776  1.00 52.22  ? 83   PHE M CE1 1 
ATOM   10157 C CE2 . PHE M  1 83  ? 101.078 139.336 75.397  1.00 51.81  ? 83   PHE M CE2 1 
ATOM   10158 C CZ  . PHE M  1 83  ? 101.311 140.522 76.055  1.00 52.45  ? 83   PHE M CZ  1 
ATOM   10159 N N   . ALA M  1 84  ? 103.730 136.132 75.070  1.00 45.57  ? 84   ALA M N   1 
ATOM   10160 C CA  . ALA M  1 84  ? 102.625 135.231 75.432  1.00 44.37  ? 84   ALA M CA  1 
ATOM   10161 C C   . ALA M  1 84  ? 102.602 134.798 76.911  1.00 44.08  ? 84   ALA M C   1 
ATOM   10162 O O   . ALA M  1 84  ? 103.425 135.253 77.717  1.00 43.37  ? 84   ALA M O   1 
ATOM   10163 C CB  . ALA M  1 84  ? 102.571 133.996 74.494  1.00 44.19  ? 84   ALA M CB  1 
ATOM   10164 N N   . THR M  1 85  ? 101.627 133.940 77.246  1.00 42.33  ? 85   THR M N   1 
ATOM   10165 C CA  . THR M  1 85  ? 101.484 133.323 78.577  1.00 40.23  ? 85   THR M CA  1 
ATOM   10166 C C   . THR M  1 85  ? 101.683 131.804 78.529  1.00 42.86  ? 85   THR M C   1 
ATOM   10167 O O   . THR M  1 85  ? 100.821 131.052 78.012  1.00 43.41  ? 85   THR M O   1 
ATOM   10168 C CB  . THR M  1 85  ? 100.100 133.596 79.196  1.00 38.61  ? 85   THR M CB  1 
ATOM   10169 O OG1 . THR M  1 85  ? 99.915  135.016 79.341  1.00 41.82  ? 85   THR M OG1 1 
ATOM   10170 C CG2 . THR M  1 85  ? 100.000 132.947 80.577  1.00 31.12  ? 85   THR M CG2 1 
ATOM   10171 N N   . TYR M  1 86  ? 102.796 131.345 79.081  1.00 43.57  ? 86   TYR M N   1 
ATOM   10172 C CA  . TYR M  1 86  ? 103.142 129.949 78.929  1.00 44.91  ? 86   TYR M CA  1 
ATOM   10173 C C   . TYR M  1 86  ? 102.691 129.193 80.149  1.00 44.14  ? 86   TYR M C   1 
ATOM   10174 O O   . TYR M  1 86  ? 103.474 128.940 81.081  1.00 46.30  ? 86   TYR M O   1 
ATOM   10175 C CB  . TYR M  1 86  ? 104.627 129.815 78.605  1.00 44.41  ? 86   TYR M CB  1 
ATOM   10176 C CG  . TYR M  1 86  ? 104.958 130.801 77.522  1.00 43.72  ? 86   TYR M CG  1 
ATOM   10177 C CD1 . TYR M  1 86  ? 104.544 132.122 77.649  1.00 50.15  ? 86   TYR M CD1 1 
ATOM   10178 C CD2 . TYR M  1 86  ? 105.636 130.432 76.369  1.00 45.69  ? 86   TYR M CD2 1 
ATOM   10179 C CE1 . TYR M  1 86  ? 104.792 133.041 76.698  1.00 46.17  ? 86   TYR M CE1 1 
ATOM   10180 C CE2 . TYR M  1 86  ? 105.898 131.375 75.387  1.00 49.08  ? 86   TYR M CE2 1 
ATOM   10181 C CZ  . TYR M  1 86  ? 105.466 132.681 75.569  1.00 45.01  ? 86   TYR M CZ  1 
ATOM   10182 O OH  . TYR M  1 86  ? 105.715 133.634 74.619  1.00 43.95  ? 86   TYR M OH  1 
ATOM   10183 N N   . TYR M  1 87  ? 101.394 128.870 80.147  1.00 41.94  ? 87   TYR M N   1 
ATOM   10184 C CA  . TYR M  1 87  ? 100.866 127.984 81.168  1.00 39.92  ? 87   TYR M CA  1 
ATOM   10185 C C   . TYR M  1 87  ? 101.497 126.621 80.971  1.00 41.98  ? 87   TYR M C   1 
ATOM   10186 O O   . TYR M  1 87  ? 102.047 126.306 79.907  1.00 42.47  ? 87   TYR M O   1 
ATOM   10187 C CB  . TYR M  1 87  ? 99.354  127.793 81.071  1.00 36.31  ? 87   TYR M CB  1 
ATOM   10188 C CG  . TYR M  1 87  ? 98.511  129.010 81.289  1.00 27.60  ? 87   TYR M CG  1 
ATOM   10189 C CD1 . TYR M  1 87  ? 98.175  129.830 80.224  1.00 26.44  ? 87   TYR M CD1 1 
ATOM   10190 C CD2 . TYR M  1 87  ? 97.981  129.303 82.546  1.00 26.85  ? 87   TYR M CD2 1 
ATOM   10191 C CE1 . TYR M  1 87  ? 97.368  130.935 80.399  1.00 26.44  ? 87   TYR M CE1 1 
ATOM   10192 C CE2 . TYR M  1 87  ? 97.182  130.414 82.736  1.00 25.14  ? 87   TYR M CE2 1 
ATOM   10193 C CZ  . TYR M  1 87  ? 96.878  131.223 81.656  1.00 28.65  ? 87   TYR M CZ  1 
ATOM   10194 O OH  . TYR M  1 87  ? 96.081  132.329 81.829  1.00 30.31  ? 87   TYR M OH  1 
ATOM   10195 N N   . CYS M  1 88  ? 101.365 125.804 82.020  1.00 43.08  ? 88   CYS M N   1 
ATOM   10196 C CA  . CYS M  1 88  ? 101.949 124.467 82.073  1.00 45.38  ? 88   CYS M CA  1 
ATOM   10197 C C   . CYS M  1 88  ? 100.895 123.530 82.617  1.00 45.74  ? 88   CYS M C   1 
ATOM   10198 O O   . CYS M  1 88  ? 100.129 123.897 83.508  1.00 46.04  ? 88   CYS M O   1 
ATOM   10199 C CB  . CYS M  1 88  ? 103.204 124.398 82.977  1.00 45.47  ? 88   CYS M CB  1 
ATOM   10200 S SG  . CYS M  1 88  ? 103.027 124.970 84.751  1.00 49.21  ? 88   CYS M SG  1 
ATOM   10201 N N   . GLN M  1 89  ? 100.868 122.306 82.098  1.00 44.87  ? 89   GLN M N   1 
ATOM   10202 C CA  . GLN M  1 89  ? 99.814  121.369 82.449  1.00 45.66  ? 89   GLN M CA  1 
ATOM   10203 C C   . GLN M  1 89  ? 100.268 119.934 82.683  1.00 46.45  ? 89   GLN M C   1 
ATOM   10204 O O   . GLN M  1 89  ? 101.120 119.406 81.978  1.00 46.76  ? 89   GLN M O   1 
ATOM   10205 C CB  . GLN M  1 89  ? 98.713  121.382 81.389  1.00 45.28  ? 89   GLN M CB  1 
ATOM   10206 C CG  . GLN M  1 89  ? 97.369  120.921 81.922  1.00 44.66  ? 89   GLN M CG  1 
ATOM   10207 C CD  . GLN M  1 89  ? 96.586  120.096 80.922  1.00 39.14  ? 89   GLN M CD  1 
ATOM   10208 O OE1 . GLN M  1 89  ? 96.999  118.996 80.555  1.00 40.40  ? 89   GLN M OE1 1 
ATOM   10209 N NE2 . GLN M  1 89  ? 95.445  120.608 80.486  1.00 38.12  ? 89   GLN M NE2 1 
ATOM   10210 N N   . GLN M  1 90  ? 99.673  119.323 83.702  1.00 47.01  ? 90   GLN M N   1 
ATOM   10211 C CA  . GLN M  1 90  ? 99.726  117.884 83.874  1.00 48.79  ? 90   GLN M CA  1 
ATOM   10212 C C   . GLN M  1 90  ? 98.480  117.265 83.277  1.00 49.65  ? 90   GLN M C   1 
ATOM   10213 O O   . GLN M  1 90  ? 97.412  117.892 83.184  1.00 52.28  ? 90   GLN M O   1 
ATOM   10214 C CB  . GLN M  1 90  ? 99.819  117.491 85.352  1.00 48.64  ? 90   GLN M CB  1 
ATOM   10215 C CG  . GLN M  1 90  ? 98.533  117.715 86.158  1.00 48.50  ? 90   GLN M CG  1 
ATOM   10216 C CD  . GLN M  1 90  ? 97.640  116.477 86.286  1.00 47.88  ? 90   GLN M CD  1 
ATOM   10217 O OE1 . GLN M  1 90  ? 97.391  115.754 85.325  1.00 48.69  ? 90   GLN M OE1 1 
ATOM   10218 N NE2 . GLN M  1 90  ? 97.137  116.252 87.493  1.00 47.93  ? 90   GLN M NE2 1 
ATOM   10219 N N   . SER M  1 91  ? 98.623  116.007 82.902  1.00 51.28  ? 91   SER M N   1 
ATOM   10220 C CA  . SER M  1 91  ? 97.533  115.207 82.427  1.00 50.67  ? 91   SER M CA  1 
ATOM   10221 C C   . SER M  1 91  ? 97.936  113.793 82.792  1.00 49.24  ? 91   SER M C   1 
ATOM   10222 O O   . SER M  1 91  ? 97.836  112.860 81.958  1.00 48.95  ? 91   SER M O   1 
ATOM   10223 C CB  . SER M  1 91  ? 97.395  115.352 80.909  1.00 51.70  ? 91   SER M CB  1 
ATOM   10224 O OG  . SER M  1 91  ? 96.934  114.084 80.308  1.00 54.42  ? 91   SER M OG  1 
ATOM   10225 N N   . TYR M  1 92  ? 98.425  113.609 84.013  1.00 47.19  ? 92   TYR M N   1 
ATOM   10226 C CA  . TYR M  1 92  ? 98.743  112.254 84.405  1.00 46.20  ? 92   TYR M CA  1 
ATOM   10227 C C   . TYR M  1 92  ? 97.532  111.649 85.101  1.00 44.57  ? 92   TYR M C   1 
ATOM   10228 O O   . TYR M  1 92  ? 97.315  110.432 85.050  1.00 42.58  ? 92   TYR M O   1 
ATOM   10229 C CB  . TYR M  1 92  ? 100.062 112.205 85.190  1.00 46.47  ? 92   TYR M CB  1 
ATOM   10230 C CG  . TYR M  1 92  ? 100.210 111.118 86.214  1.00 45.96  ? 92   TYR M CG  1 
ATOM   10231 C CD1 . TYR M  1 92  ? 101.163 110.112 86.063  1.00 46.26  ? 92   TYR M CD1 1 
ATOM   10232 C CD2 . TYR M  1 92  ? 99.433  111.126 87.369  1.00 48.74  ? 92   TYR M CD2 1 
ATOM   10233 C CE1 . TYR M  1 92  ? 101.312 109.122 87.029  1.00 46.78  ? 92   TYR M CE1 1 
ATOM   10234 C CE2 . TYR M  1 92  ? 99.565  110.144 88.327  1.00 49.12  ? 92   TYR M CE2 1 
ATOM   10235 C CZ  . TYR M  1 92  ? 100.506 109.149 88.161  1.00 46.25  ? 92   TYR M CZ  1 
ATOM   10236 O OH  . TYR M  1 92  ? 100.630 108.179 89.139  1.00 49.40  ? 92   TYR M OH  1 
ATOM   10237 N N   . SER M  1 93  ? 96.725  112.514 85.714  1.00 42.84  ? 93   SER M N   1 
ATOM   10238 C CA  . SER M  1 93  ? 95.393  112.118 86.149  1.00 40.89  ? 93   SER M CA  1 
ATOM   10239 C C   . SER M  1 93  ? 94.355  113.236 86.068  1.00 38.17  ? 93   SER M C   1 
ATOM   10240 O O   . SER M  1 93  ? 94.698  114.454 86.039  1.00 35.06  ? 93   SER M O   1 
ATOM   10241 C CB  . SER M  1 93  ? 95.419  111.437 87.533  1.00 40.95  ? 93   SER M CB  1 
ATOM   10242 O OG  . SER M  1 93  ? 95.476  112.424 88.634  1.00 41.90  ? 93   SER M OG  1 
ATOM   10243 N N   . THR M  1 94  ? 93.094  112.800 86.003  1.00 36.92  ? 94   THR M N   1 
ATOM   10244 C CA  . THR M  1 94  ? 92.004  113.719 85.758  1.00 35.52  ? 94   THR M CA  1 
ATOM   10245 C C   . THR M  1 94  ? 91.566  114.285 87.096  1.00 35.85  ? 94   THR M C   1 
ATOM   10246 O O   . THR M  1 94  ? 91.464  113.547 88.087  1.00 33.02  ? 94   THR M O   1 
ATOM   10247 C CB  . THR M  1 94  ? 90.821  113.003 85.109  1.00 34.99  ? 94   THR M CB  1 
ATOM   10248 O OG1 . THR M  1 94  ? 90.331  111.999 86.011  1.00 35.03  ? 94   THR M OG1 1 
ATOM   10249 C CG2 . THR M  1 94  ? 91.233  112.343 83.794  1.00 30.85  ? 94   THR M CG2 1 
ATOM   10250 N N   . PRO M  1 95  ? 91.287  115.599 87.128  1.00 35.57  ? 95   PRO M N   1 
ATOM   10251 C CA  . PRO M  1 95  ? 91.310  116.500 85.970  1.00 36.46  ? 95   PRO M CA  1 
ATOM   10252 C C   . PRO M  1 95  ? 92.677  117.083 85.584  1.00 36.85  ? 95   PRO M C   1 
ATOM   10253 O O   . PRO M  1 95  ? 93.413  117.565 86.469  1.00 37.71  ? 95   PRO M O   1 
ATOM   10254 C CB  . PRO M  1 95  ? 90.381  117.629 86.410  1.00 35.99  ? 95   PRO M CB  1 
ATOM   10255 C CG  . PRO M  1 95  ? 90.557  117.708 87.880  1.00 35.12  ? 95   PRO M CG  1 
ATOM   10256 C CD  . PRO M  1 95  ? 90.874  116.307 88.357  1.00 35.90  ? 95   PRO M CD  1 
ATOM   10257 N N   . ASN M  1 96  ? 93.002  117.038 84.283  1.00 36.63  ? 96   ASN M N   1 
ATOM   10258 C CA  . ASN M  1 96  ? 94.134  117.800 83.728  1.00 36.30  ? 96   ASN M CA  1 
ATOM   10259 C C   . ASN M  1 96  ? 94.338  119.095 84.509  1.00 38.55  ? 96   ASN M C   1 
ATOM   10260 O O   . ASN M  1 96  ? 93.418  119.923 84.593  1.00 38.29  ? 96   ASN M O   1 
ATOM   10261 C CB  . ASN M  1 96  ? 93.874  118.148 82.253  1.00 33.99  ? 96   ASN M CB  1 
ATOM   10262 C CG  . ASN M  1 96  ? 94.355  117.073 81.282  1.00 32.09  ? 96   ASN M CG  1 
ATOM   10263 O OD1 . ASN M  1 96  ? 94.254  115.873 81.551  1.00 23.20  ? 96   ASN M OD1 1 
ATOM   10264 N ND2 . ASN M  1 96  ? 94.851  117.506 80.128  1.00 33.57  ? 96   ASN M ND2 1 
ATOM   10265 N N   . THR M  1 97  ? 95.522  119.281 85.079  1.00 39.86  ? 97   THR M N   1 
ATOM   10266 C CA  . THR M  1 97  ? 95.690  120.395 85.994  1.00 41.38  ? 97   THR M CA  1 
ATOM   10267 C C   . THR M  1 97  ? 96.786  121.343 85.534  1.00 42.70  ? 97   THR M C   1 
ATOM   10268 O O   . THR M  1 97  ? 97.919  120.934 85.253  1.00 43.34  ? 97   THR M O   1 
ATOM   10269 C CB  . THR M  1 97  ? 95.890  119.908 87.435  1.00 40.59  ? 97   THR M CB  1 
ATOM   10270 O OG1 . THR M  1 97  ? 95.643  118.487 87.507  1.00 43.72  ? 97   THR M OG1 1 
ATOM   10271 C CG2 . THR M  1 97  ? 94.933  120.615 88.390  1.00 38.21  ? 97   THR M CG2 1 
ATOM   10272 N N   . PHE M  1 98  ? 96.409  122.616 85.461  1.00 43.90  ? 98   PHE M N   1 
ATOM   10273 C CA  . PHE M  1 98  ? 97.193  123.657 84.816  1.00 46.84  ? 98   PHE M CA  1 
ATOM   10274 C C   . PHE M  1 98  ? 98.101  124.370 85.812  1.00 47.58  ? 98   PHE M C   1 
ATOM   10275 O O   . PHE M  1 98  ? 98.117  124.019 86.998  1.00 48.40  ? 98   PHE M O   1 
ATOM   10276 C CB  . PHE M  1 98  ? 96.238  124.663 84.174  1.00 48.42  ? 98   PHE M CB  1 
ATOM   10277 C CG  . PHE M  1 98  ? 95.880  124.355 82.744  1.00 50.62  ? 98   PHE M CG  1 
ATOM   10278 C CD1 . PHE M  1 98  ? 95.128  123.225 82.407  1.00 53.11  ? 98   PHE M CD1 1 
ATOM   10279 C CD2 . PHE M  1 98  ? 96.272  125.239 81.730  1.00 54.51  ? 98   PHE M CD2 1 
ATOM   10280 C CE1 . PHE M  1 98  ? 94.790  122.978 81.079  1.00 52.47  ? 98   PHE M CE1 1 
ATOM   10281 C CE2 . PHE M  1 98  ? 95.940  124.990 80.404  1.00 55.30  ? 98   PHE M CE2 1 
ATOM   10282 C CZ  . PHE M  1 98  ? 95.202  123.859 80.079  1.00 51.93  ? 98   PHE M CZ  1 
ATOM   10283 N N   . GLY M  1 99  ? 98.847  125.373 85.341  1.00 47.81  ? 99   GLY M N   1 
ATOM   10284 C CA  . GLY M  1 99  ? 99.739  126.120 86.225  1.00 48.74  ? 99   GLY M CA  1 
ATOM   10285 C C   . GLY M  1 99  ? 99.055  127.366 86.749  1.00 47.57  ? 99   GLY M C   1 
ATOM   10286 O O   . GLY M  1 99  ? 97.885  127.324 87.140  1.00 49.05  ? 99   GLY M O   1 
ATOM   10287 N N   . GLN M  1 100 ? 99.798  128.472 86.779  1.00 46.19  ? 100  GLN M N   1 
ATOM   10288 C CA  . GLN M  1 100 ? 99.171  129.793 86.895  1.00 46.23  ? 100  GLN M CA  1 
ATOM   10289 C C   . GLN M  1 100 ? 99.517  130.787 85.740  1.00 45.09  ? 100  GLN M C   1 
ATOM   10290 O O   . GLN M  1 100 ? 98.817  131.786 85.563  1.00 44.08  ? 100  GLN M O   1 
ATOM   10291 C CB  . GLN M  1 100 ? 99.252  130.406 88.332  1.00 45.45  ? 100  GLN M CB  1 
ATOM   10292 C CG  . GLN M  1 100 ? 100.586 130.247 89.142  1.00 46.60  ? 100  GLN M CG  1 
ATOM   10293 C CD  . GLN M  1 100 ? 100.500 129.148 90.253  1.00 47.99  ? 100  GLN M CD  1 
ATOM   10294 O OE1 . GLN M  1 100 ? 100.949 129.344 91.392  1.00 40.64  ? 100  GLN M OE1 1 
ATOM   10295 N NE2 . GLN M  1 100 ? 99.940  127.982 89.916  1.00 49.40  ? 100  GLN M NE2 1 
ATOM   10296 N N   . GLY M  1 101 ? 100.567 130.498 84.958  1.00 44.67  ? 101  GLY M N   1 
ATOM   10297 C CA  . GLY M  1 101 ? 100.822 131.169 83.653  1.00 44.81  ? 101  GLY M CA  1 
ATOM   10298 C C   . GLY M  1 101 ? 101.805 132.342 83.573  1.00 44.95  ? 101  GLY M C   1 
ATOM   10299 O O   . GLY M  1 101 ? 101.502 133.443 84.061  1.00 43.97  ? 101  GLY M O   1 
ATOM   10300 N N   . THR M  1 102 ? 102.963 132.139 82.941  1.00 44.82  ? 102  THR M N   1 
ATOM   10301 C CA  . THR M  1 102 ? 103.992 133.187 82.897  1.00 43.62  ? 102  THR M CA  1 
ATOM   10302 C C   . THR M  1 102 ? 103.784 134.193 81.749  1.00 43.61  ? 102  THR M C   1 
ATOM   10303 O O   . THR M  1 102 ? 104.102 133.914 80.580  1.00 45.53  ? 102  THR M O   1 
ATOM   10304 C CB  . THR M  1 102 ? 105.447 132.613 82.963  1.00 43.22  ? 102  THR M CB  1 
ATOM   10305 O OG1 . THR M  1 102 ? 105.514 131.602 83.978  1.00 44.69  ? 102  THR M OG1 1 
ATOM   10306 C CG2 . THR M  1 102 ? 106.454 133.708 83.303  1.00 43.88  ? 102  THR M CG2 1 
ATOM   10307 N N   . LYS M  1 103 ? 103.219 135.350 82.116  1.00 44.02  ? 103  LYS M N   1 
ATOM   10308 C CA  . LYS M  1 103 ? 103.021 136.488 81.210  1.00 42.36  ? 103  LYS M CA  1 
ATOM   10309 C C   . LYS M  1 103 ? 104.380 137.064 80.851  1.00 42.23  ? 103  LYS M C   1 
ATOM   10310 O O   . LYS M  1 103 ? 105.048 137.672 81.692  1.00 42.92  ? 103  LYS M O   1 
ATOM   10311 C CB  . LYS M  1 103 ? 102.155 137.574 81.876  1.00 41.63  ? 103  LYS M CB  1 
ATOM   10312 C CG  . LYS M  1 103 ? 100.635 137.416 81.617  1.00 44.11  ? 103  LYS M CG  1 
ATOM   10313 C CD  . LYS M  1 103 ? 99.845  138.556 82.318  1.00 42.65  ? 103  LYS M CD  1 
ATOM   10314 C CE  . LYS M  1 103 ? 98.410  138.106 82.592  1.00 43.32  ? 103  LYS M CE  1 
ATOM   10315 N NZ  . LYS M  1 103 ? 97.398  139.380 82.805  1.00 44.28  ? 103  LYS M NZ  1 
ATOM   10316 N N   . VAL M  1 104 ? 104.793 136.857 79.607  1.00 42.19  ? 104  VAL M N   1 
ATOM   10317 C CA  . VAL M  1 104 ? 106.146 137.208 79.205  1.00 39.48  ? 104  VAL M CA  1 
ATOM   10318 C C   . VAL M  1 104 ? 106.141 138.373 78.212  1.00 38.90  ? 104  VAL M C   1 
ATOM   10319 O O   . VAL M  1 104 ? 105.948 138.169 77.001  1.00 38.09  ? 104  VAL M O   1 
ATOM   10320 C CB  . VAL M  1 104 ? 106.916 135.956 78.666  1.00 39.64  ? 104  VAL M CB  1 
ATOM   10321 C CG1 . VAL M  1 104 ? 108.216 136.353 77.950  1.00 36.25  ? 104  VAL M CG1 1 
ATOM   10322 C CG2 . VAL M  1 104 ? 107.215 134.983 79.803  1.00 36.16  ? 104  VAL M CG2 1 
ATOM   10323 N N   . GLU M  1 105 ? 106.339 139.599 78.739  1.00 40.49  ? 105  GLU M N   1 
ATOM   10324 C CA  . GLU M  1 105 ? 106.514 140.762 77.855  1.00 42.13  ? 105  GLU M CA  1 
ATOM   10325 C C   . GLU M  1 105 ? 107.891 140.655 77.193  1.00 42.19  ? 105  GLU M C   1 
ATOM   10326 O O   . GLU M  1 105 ? 108.707 139.810 77.581  1.00 41.28  ? 105  GLU M O   1 
ATOM   10327 C CB  . GLU M  1 105 ? 106.406 142.089 78.631  1.00 41.81  ? 105  GLU M CB  1 
ATOM   10328 C CG  . GLU M  1 105 ? 105.181 142.242 79.548  1.00 46.42  ? 105  GLU M CG  1 
ATOM   10329 C CD  . GLU M  1 105 ? 103.858 142.094 78.808  1.00 49.59  ? 105  GLU M CD  1 
ATOM   10330 O OE1 . GLU M  1 105 ? 103.232 141.016 78.935  1.00 58.67  ? 105  GLU M OE1 1 
ATOM   10331 O OE2 . GLU M  1 105 ? 103.446 143.047 78.100  1.00 51.21  ? 105  GLU M OE2 1 
ATOM   10332 N N   . ILE M  1 106 ? 108.141 141.496 76.189  1.00 41.33  ? 106  ILE M N   1 
ATOM   10333 C CA  . ILE M  1 106 ? 109.447 141.570 75.525  1.00 41.17  ? 106  ILE M CA  1 
ATOM   10334 C C   . ILE M  1 106 ? 109.856 143.032 75.340  1.00 41.72  ? 106  ILE M C   1 
ATOM   10335 O O   . ILE M  1 106 ? 109.531 143.889 76.162  1.00 43.44  ? 106  ILE M O   1 
ATOM   10336 C CB  . ILE M  1 106 ? 109.456 140.825 74.156  1.00 41.61  ? 106  ILE M CB  1 
ATOM   10337 C CG1 . ILE M  1 106 ? 109.689 139.323 74.350  1.00 36.43  ? 106  ILE M CG1 1 
ATOM   10338 C CG2 . ILE M  1 106 ? 110.534 141.393 73.221  1.00 41.54  ? 106  ILE M CG2 1 
ATOM   10339 C CD1 . ILE M  1 106 ? 108.373 138.467 74.515  1.00 32.29  ? 106  ILE M CD1 1 
ATOM   10340 N N   . ASP N  1 1   ? 93.391  104.849 64.583  1.00 59.94  ? 1    ASP N N   1 
ATOM   10341 C CA  . ASP N  1 1   ? 93.606  103.555 63.869  1.00 59.93  ? 1    ASP N CA  1 
ATOM   10342 C C   . ASP N  1 1   ? 95.101  103.190 63.857  1.00 60.76  ? 1    ASP N C   1 
ATOM   10343 O O   . ASP N  1 1   ? 95.611  102.653 62.870  1.00 60.94  ? 1    ASP N O   1 
ATOM   10344 C CB  . ASP N  1 1   ? 93.040  103.641 62.442  1.00 58.43  ? 1    ASP N CB  1 
ATOM   10345 C CG  . ASP N  1 1   ? 92.172  102.446 62.081  1.00 56.25  ? 1    ASP N CG  1 
ATOM   10346 O OD1 . ASP N  1 1   ? 92.703  101.318 62.010  1.00 53.32  ? 1    ASP N OD1 1 
ATOM   10347 O OD2 . ASP N  1 1   ? 90.956  102.641 61.856  1.00 58.55  ? 1    ASP N OD2 1 
ATOM   10348 N N   . ILE N  1 2   ? 95.792  103.481 64.964  1.00 61.19  ? 2    ILE N N   1 
ATOM   10349 C CA  . ILE N  1 2   ? 97.245  103.258 65.093  1.00 61.17  ? 2    ILE N CA  1 
ATOM   10350 C C   . ILE N  1 2   ? 97.585  101.819 65.541  1.00 61.51  ? 2    ILE N C   1 
ATOM   10351 O O   . ILE N  1 2   ? 97.332  101.424 66.698  1.00 62.85  ? 2    ILE N O   1 
ATOM   10352 C CB  . ILE N  1 2   ? 97.916  104.343 66.008  1.00 60.33  ? 2    ILE N CB  1 
ATOM   10353 C CG1 . ILE N  1 2   ? 97.956  105.711 65.298  1.00 60.71  ? 2    ILE N CG1 1 
ATOM   10354 C CG2 . ILE N  1 2   ? 99.315  103.919 66.487  1.00 61.98  ? 2    ILE N CG2 1 
ATOM   10355 C CD1 . ILE N  1 2   ? 98.747  105.756 63.980  1.00 56.48  ? 2    ILE N CD1 1 
ATOM   10356 N N   . GLN N  1 3   ? 98.167  101.057 64.606  1.00 61.20  ? 3    GLN N N   1 
ATOM   10357 C CA  . GLN N  1 3   ? 98.332  99.596  64.707  1.00 61.07  ? 3    GLN N CA  1 
ATOM   10358 C C   . GLN N  1 3   ? 99.834  99.200  64.972  1.00 61.53  ? 3    GLN N C   1 
ATOM   10359 O O   . GLN N  1 3   ? 100.694 99.479  64.133  1.00 61.84  ? 3    GLN N O   1 
ATOM   10360 C CB  . GLN N  1 3   ? 97.694  98.937  63.432  1.00 61.02  ? 3    GLN N CB  1 
ATOM   10361 C CG  . GLN N  1 3   ? 96.163  99.357  63.155  1.00 60.30  ? 3    GLN N CG  1 
ATOM   10362 C CD  . GLN N  1 3   ? 95.544  99.007  61.744  1.00 60.36  ? 3    GLN N CD  1 
ATOM   10363 O OE1 . GLN N  1 3   ? 96.255  98.732  60.768  1.00 52.61  ? 3    GLN N OE1 1 
ATOM   10364 N NE2 . GLN N  1 3   ? 94.205  99.035  61.670  1.00 59.78  ? 3    GLN N NE2 1 
ATOM   10365 N N   . MET N  1 4   ? 100.141 98.564  66.120  1.00 60.68  ? 4    MET N N   1 
ATOM   10366 C CA  . MET N  1 4   ? 101.547 98.269  66.577  1.00 59.74  ? 4    MET N CA  1 
ATOM   10367 C C   . MET N  1 4   ? 102.143 96.919  66.105  1.00 59.31  ? 4    MET N C   1 
ATOM   10368 O O   . MET N  1 4   ? 101.428 96.110  65.487  1.00 60.01  ? 4    MET N O   1 
ATOM   10369 C CB  . MET N  1 4   ? 101.647 98.298  68.116  1.00 59.50  ? 4    MET N CB  1 
ATOM   10370 C CG  . MET N  1 4   ? 100.708 99.262  68.839  1.00 59.29  ? 4    MET N CG  1 
ATOM   10371 S SD  . MET N  1 4   ? 101.247 100.993 68.733  1.00 59.67  ? 4    MET N SD  1 
ATOM   10372 C CE  . MET N  1 4   ? 102.869 100.873 69.745  1.00 53.40  ? 4    MET N CE  1 
ATOM   10373 N N   . THR N  1 5   ? 103.435 96.677  66.410  1.00 58.99  ? 5    THR N N   1 
ATOM   10374 C CA  . THR N  1 5   ? 104.098 95.364  66.177  1.00 58.23  ? 5    THR N CA  1 
ATOM   10375 C C   . THR N  1 5   ? 105.087 94.972  67.284  1.00 57.61  ? 5    THR N C   1 
ATOM   10376 O O   . THR N  1 5   ? 106.199 95.521  67.342  1.00 57.88  ? 5    THR N O   1 
ATOM   10377 C CB  . THR N  1 5   ? 104.918 95.334  64.854  1.00 57.50  ? 5    THR N CB  1 
ATOM   10378 O OG1 . THR N  1 5   ? 104.127 95.840  63.766  1.00 58.41  ? 5    THR N OG1 1 
ATOM   10379 C CG2 . THR N  1 5   ? 105.373 93.905  64.517  1.00 59.22  ? 5    THR N CG2 1 
ATOM   10380 N N   . GLN N  1 6   ? 104.709 94.031  68.152  1.00 56.90  ? 6    GLN N N   1 
ATOM   10381 C CA  . GLN N  1 6   ? 105.649 93.539  69.171  1.00 56.10  ? 6    GLN N CA  1 
ATOM   10382 C C   . GLN N  1 6   ? 106.463 92.347  68.668  1.00 56.37  ? 6    GLN N C   1 
ATOM   10383 O O   . GLN N  1 6   ? 105.922 91.449  68.016  1.00 55.71  ? 6    GLN N O   1 
ATOM   10384 C CB  . GLN N  1 6   ? 104.938 93.167  70.480  1.00 55.67  ? 6    GLN N CB  1 
ATOM   10385 C CG  . GLN N  1 6   ? 105.908 92.852  71.629  1.00 53.66  ? 6    GLN N CG  1 
ATOM   10386 C CD  . GLN N  1 6   ? 105.233 92.352  72.892  1.00 55.66  ? 6    GLN N CD  1 
ATOM   10387 O OE1 . GLN N  1 6   ? 104.014 92.446  73.053  1.00 49.97  ? 6    GLN N OE1 1 
ATOM   10388 N NE2 . GLN N  1 6   ? 106.035 91.822  73.804  1.00 52.88  ? 6    GLN N NE2 1 
ATOM   10389 N N   . SER N  1 7   ? 107.759 92.347  68.982  1.00 56.12  ? 7    SER N N   1 
ATOM   10390 C CA  . SER N  1 7   ? 108.641 91.212  68.684  1.00 55.88  ? 7    SER N CA  1 
ATOM   10391 C C   . SER N  1 7   ? 109.760 91.062  69.724  1.00 56.88  ? 7    SER N C   1 
ATOM   10392 O O   . SER N  1 7   ? 110.255 92.068  70.240  1.00 57.78  ? 7    SER N O   1 
ATOM   10393 C CB  . SER N  1 7   ? 109.237 91.339  67.282  1.00 55.93  ? 7    SER N CB  1 
ATOM   10394 O OG  . SER N  1 7   ? 109.861 92.605  67.101  1.00 51.21  ? 7    SER N OG  1 
ATOM   10395 N N   . PRO N  1 8   ? 110.177 89.812  70.031  1.00 56.01  ? 8    PRO N N   1 
ATOM   10396 C CA  . PRO N  1 8   ? 109.761 88.485  69.535  1.00 57.19  ? 8    PRO N CA  1 
ATOM   10397 C C   . PRO N  1 8   ? 108.265 88.148  69.636  1.00 57.42  ? 8    PRO N C   1 
ATOM   10398 O O   . PRO N  1 8   ? 107.497 88.844  70.317  1.00 58.44  ? 8    PRO N O   1 
ATOM   10399 C CB  . PRO N  1 8   ? 110.560 87.524  70.422  1.00 57.31  ? 8    PRO N CB  1 
ATOM   10400 C CG  . PRO N  1 8   ? 111.758 88.288  70.791  1.00 55.47  ? 8    PRO N CG  1 
ATOM   10401 C CD  . PRO N  1 8   ? 111.277 89.686  71.006  1.00 54.83  ? 8    PRO N CD  1 
ATOM   10402 N N   . SER N  1 9   ? 107.882 87.072  68.940  1.00 56.82  ? 9    SER N N   1 
ATOM   10403 C CA  . SER N  1 9   ? 106.527 86.497  68.971  1.00 56.43  ? 9    SER N CA  1 
ATOM   10404 C C   . SER N  1 9   ? 106.369 85.581  70.186  1.00 55.55  ? 9    SER N C   1 
ATOM   10405 O O   . SER N  1 9   ? 105.376 85.659  70.918  1.00 55.57  ? 9    SER N O   1 
ATOM   10406 C CB  . SER N  1 9   ? 106.261 85.673  67.694  1.00 56.87  ? 9    SER N CB  1 
ATOM   10407 O OG  . SER N  1 9   ? 106.602 86.392  66.504  1.00 57.15  ? 9    SER N OG  1 
ATOM   10408 N N   . SER N  1 10  ? 107.354 84.693  70.352  1.00 54.37  ? 10   SER N N   1 
ATOM   10409 C CA  . SER N  1 10  ? 107.528 83.820  71.526  1.00 52.97  ? 10   SER N CA  1 
ATOM   10410 C C   . SER N  1 10  ? 109.012 83.789  71.965  1.00 52.77  ? 10   SER N C   1 
ATOM   10411 O O   . SER N  1 10  ? 109.787 84.659  71.556  1.00 52.54  ? 10   SER N O   1 
ATOM   10412 C CB  . SER N  1 10  ? 106.962 82.409  71.273  1.00 52.16  ? 10   SER N CB  1 
ATOM   10413 O OG  . SER N  1 10  ? 106.983 82.057  69.886  1.00 45.90  ? 10   SER N OG  1 
ATOM   10414 N N   . LEU N  1 11  ? 109.407 82.801  72.790  1.00 52.49  ? 11   LEU N N   1 
ATOM   10415 C CA  . LEU N  1 11  ? 110.733 82.811  73.457  1.00 52.69  ? 11   LEU N CA  1 
ATOM   10416 C C   . LEU N  1 11  ? 111.135 81.543  74.255  1.00 52.41  ? 11   LEU N C   1 
ATOM   10417 O O   . LEU N  1 11  ? 110.306 80.665  74.511  1.00 51.67  ? 11   LEU N O   1 
ATOM   10418 C CB  . LEU N  1 11  ? 110.798 84.016  74.406  1.00 52.27  ? 11   LEU N CB  1 
ATOM   10419 C CG  . LEU N  1 11  ? 112.086 84.840  74.559  1.00 54.05  ? 11   LEU N CG  1 
ATOM   10420 C CD1 . LEU N  1 11  ? 111.699 86.327  74.462  1.00 57.37  ? 11   LEU N CD1 1 
ATOM   10421 C CD2 . LEU N  1 11  ? 112.847 84.563  75.852  1.00 55.24  ? 11   LEU N CD2 1 
ATOM   10422 N N   . SER N  1 12  ? 112.427 81.481  74.617  1.00 52.79  ? 12   SER N N   1 
ATOM   10423 C CA  . SER N  1 12  ? 112.972 80.648  75.729  1.00 52.59  ? 12   SER N CA  1 
ATOM   10424 C C   . SER N  1 12  ? 114.283 81.240  76.283  1.00 52.38  ? 12   SER N C   1 
ATOM   10425 O O   . SER N  1 12  ? 115.159 81.638  75.507  1.00 51.41  ? 12   SER N O   1 
ATOM   10426 C CB  . SER N  1 12  ? 113.186 79.179  75.314  1.00 52.43  ? 12   SER N CB  1 
ATOM   10427 O OG  . SER N  1 12  ? 111.941 78.482  75.095  1.00 51.89  ? 12   SER N OG  1 
ATOM   10428 N N   . ALA N  1 13  ? 114.417 81.296  77.611  1.00 52.40  ? 13   ALA N N   1 
ATOM   10429 C CA  . ALA N  1 13  ? 115.642 81.846  78.216  1.00 52.51  ? 13   ALA N CA  1 
ATOM   10430 C C   . ALA N  1 13  ? 116.122 81.114  79.470  1.00 53.15  ? 13   ALA N C   1 
ATOM   10431 O O   . ALA N  1 13  ? 115.375 80.357  80.104  1.00 52.41  ? 13   ALA N O   1 
ATOM   10432 C CB  . ALA N  1 13  ? 115.475 83.361  78.497  1.00 52.38  ? 13   ALA N CB  1 
ATOM   10433 N N   . SER N  1 14  ? 117.393 81.356  79.790  1.00 53.61  ? 14   SER N N   1 
ATOM   10434 C CA  . SER N  1 14  ? 118.059 80.858  80.986  1.00 53.79  ? 14   SER N CA  1 
ATOM   10435 C C   . SER N  1 14  ? 117.835 81.854  82.116  1.00 53.67  ? 14   SER N C   1 
ATOM   10436 O O   . SER N  1 14  ? 117.131 82.854  81.943  1.00 54.04  ? 14   SER N O   1 
ATOM   10437 C CB  . SER N  1 14  ? 119.574 80.736  80.726  1.00 54.19  ? 14   SER N CB  1 
ATOM   10438 O OG  . SER N  1 14  ? 120.234 81.996  81.001  1.00 53.70  ? 14   SER N OG  1 
ATOM   10439 N N   . VAL N  1 15  ? 118.456 81.587  83.264  1.00 53.46  ? 15   VAL N N   1 
ATOM   10440 C CA  . VAL N  1 15  ? 118.376 82.465  84.441  1.00 54.77  ? 15   VAL N CA  1 
ATOM   10441 C C   . VAL N  1 15  ? 119.347 83.655  84.406  1.00 54.98  ? 15   VAL N C   1 
ATOM   10442 O O   . VAL N  1 15  ? 120.508 83.500  83.993  1.00 53.33  ? 15   VAL N O   1 
ATOM   10443 C CB  . VAL N  1 15  ? 118.620 81.680  85.753  1.00 54.32  ? 15   VAL N CB  1 
ATOM   10444 C CG1 . VAL N  1 15  ? 117.286 81.318  86.426  1.00 54.87  ? 15   VAL N CG1 1 
ATOM   10445 C CG2 . VAL N  1 15  ? 119.495 80.432  85.504  1.00 55.29  ? 15   VAL N CG2 1 
ATOM   10446 N N   . GLY N  1 16  ? 118.871 84.828  84.852  1.00 56.28  ? 16   GLY N N   1 
ATOM   10447 C CA  . GLY N  1 16  ? 119.706 86.047  84.974  1.00 56.34  ? 16   GLY N CA  1 
ATOM   10448 C C   . GLY N  1 16  ? 120.306 86.484  83.647  1.00 57.24  ? 16   GLY N C   1 
ATOM   10449 O O   . GLY N  1 16  ? 121.537 86.521  83.478  1.00 57.01  ? 16   GLY N O   1 
ATOM   10450 N N   . ASP N  1 17  ? 119.413 86.855  82.726  1.00 57.12  ? 17   ASP N N   1 
ATOM   10451 C CA  . ASP N  1 17  ? 119.628 86.692  81.291  1.00 57.20  ? 17   ASP N CA  1 
ATOM   10452 C C   . ASP N  1 17  ? 118.847 87.744  80.474  1.00 57.45  ? 17   ASP N C   1 
ATOM   10453 O O   . ASP N  1 17  ? 117.778 87.446  79.930  1.00 57.51  ? 17   ASP N O   1 
ATOM   10454 C CB  . ASP N  1 17  ? 119.149 85.270  80.929  1.00 56.77  ? 17   ASP N CB  1 
ATOM   10455 C CG  . ASP N  1 17  ? 119.810 84.702  79.680  1.00 58.47  ? 17   ASP N CG  1 
ATOM   10456 O OD1 . ASP N  1 17  ? 121.069 84.786  79.547  1.00 56.42  ? 17   ASP N OD1 1 
ATOM   10457 O OD2 . ASP N  1 17  ? 119.066 84.136  78.845  1.00 58.83  ? 17   ASP N OD2 1 
ATOM   10458 N N   . ARG N  1 18  ? 119.378 88.974  80.428  1.00 57.17  ? 18   ARG N N   1 
ATOM   10459 C CA  . ARG N  1 18  ? 118.912 90.078  79.558  1.00 56.61  ? 18   ARG N CA  1 
ATOM   10460 C C   . ARG N  1 18  ? 118.031 89.634  78.388  1.00 57.90  ? 18   ARG N C   1 
ATOM   10461 O O   . ARG N  1 18  ? 118.554 89.328  77.314  1.00 58.59  ? 18   ARG N O   1 
ATOM   10462 C CB  . ARG N  1 18  ? 120.151 90.811  78.992  1.00 56.95  ? 18   ARG N CB  1 
ATOM   10463 C CG  . ARG N  1 18  ? 119.958 92.246  78.463  1.00 55.26  ? 18   ARG N CG  1 
ATOM   10464 C CD  . ARG N  1 18  ? 120.779 92.491  77.178  1.00 54.08  ? 18   ARG N CD  1 
ATOM   10465 N NE  . ARG N  1 18  ? 121.727 93.608  77.277  1.00 45.49  ? 18   ARG N NE  1 
ATOM   10466 C CZ  . ARG N  1 18  ? 122.976 93.491  77.736  1.00 47.30  ? 18   ARG N CZ  1 
ATOM   10467 N NH1 . ARG N  1 18  ? 123.432 92.312  78.154  1.00 44.27  ? 18   ARG N NH1 1 
ATOM   10468 N NH2 . ARG N  1 18  ? 123.772 94.555  77.783  1.00 47.31  ? 18   ARG N NH2 1 
ATOM   10469 N N   . VAL N  1 19  ? 116.716 89.574  78.575  1.00 59.06  ? 19   VAL N N   1 
ATOM   10470 C CA  . VAL N  1 19  ? 115.842 89.396  77.414  1.00 59.87  ? 19   VAL N CA  1 
ATOM   10471 C C   . VAL N  1 19  ? 115.743 90.763  76.745  1.00 60.84  ? 19   VAL N C   1 
ATOM   10472 O O   . VAL N  1 19  ? 115.785 91.792  77.444  1.00 61.65  ? 19   VAL N O   1 
ATOM   10473 C CB  . VAL N  1 19  ? 114.455 88.835  77.794  1.00 59.24  ? 19   VAL N CB  1 
ATOM   10474 C CG1 . VAL N  1 19  ? 113.598 88.614  76.554  1.00 60.09  ? 19   VAL N CG1 1 
ATOM   10475 C CG2 . VAL N  1 19  ? 114.603 87.517  78.559  1.00 57.14  ? 19   VAL N CG2 1 
ATOM   10476 N N   . THR N  1 20  ? 115.640 90.785  75.415  1.00 61.34  ? 20   THR N N   1 
ATOM   10477 C CA  . THR N  1 20  ? 115.598 92.050  74.692  1.00 61.58  ? 20   THR N CA  1 
ATOM   10478 C C   . THR N  1 20  ? 114.410 92.061  73.738  1.00 63.08  ? 20   THR N C   1 
ATOM   10479 O O   . THR N  1 20  ? 114.541 91.789  72.540  1.00 63.23  ? 20   THR N O   1 
ATOM   10480 C CB  . THR N  1 20  ? 116.944 92.331  73.966  1.00 62.06  ? 20   THR N CB  1 
ATOM   10481 O OG1 . THR N  1 20  ? 117.981 92.500  74.957  1.00 59.59  ? 20   THR N OG1 1 
ATOM   10482 C CG2 . THR N  1 20  ? 116.864 93.621  73.103  1.00 60.57  ? 20   THR N CG2 1 
ATOM   10483 N N   . ILE N  1 21  ? 113.235 92.338  74.303  1.00 63.07  ? 21   ILE N N   1 
ATOM   10484 C CA  . ILE N  1 21  ? 112.028 92.576  73.520  1.00 63.66  ? 21   ILE N CA  1 
ATOM   10485 C C   . ILE N  1 21  ? 112.131 93.950  72.837  1.00 64.44  ? 21   ILE N C   1 
ATOM   10486 O O   . ILE N  1 21  ? 112.933 94.794  73.244  1.00 63.17  ? 21   ILE N O   1 
ATOM   10487 C CB  . ILE N  1 21  ? 110.768 92.491  74.427  1.00 63.65  ? 21   ILE N CB  1 
ATOM   10488 C CG1 . ILE N  1 21  ? 110.477 91.020  74.785  1.00 64.62  ? 21   ILE N CG1 1 
ATOM   10489 C CG2 . ILE N  1 21  ? 109.534 93.103  73.732  1.00 61.75  ? 21   ILE N CG2 1 
ATOM   10490 C CD1 . ILE N  1 21  ? 109.706 90.859  76.092  1.00 64.99  ? 21   ILE N CD1 1 
ATOM   10491 N N   . THR N  1 22  ? 111.323 94.156  71.792  1.00 65.40  ? 22   THR N N   1 
ATOM   10492 C CA  . THR N  1 22  ? 111.277 95.415  71.027  1.00 64.91  ? 22   THR N CA  1 
ATOM   10493 C C   . THR N  1 22  ? 109.897 95.660  70.374  1.00 64.82  ? 22   THR N C   1 
ATOM   10494 O O   . THR N  1 22  ? 109.181 94.707  70.058  1.00 64.26  ? 22   THR N O   1 
ATOM   10495 C CB  . THR N  1 22  ? 112.385 95.475  69.943  1.00 65.42  ? 22   THR N CB  1 
ATOM   10496 O OG1 . THR N  1 22  ? 112.617 94.160  69.417  1.00 66.02  ? 22   THR N OG1 1 
ATOM   10497 C CG2 . THR N  1 22  ? 113.691 96.026  70.511  1.00 66.39  ? 22   THR N CG2 1 
ATOM   10498 N N   . CYS N  1 23  ? 109.539 96.937  70.165  1.00 64.84  ? 23   CYS N N   1 
ATOM   10499 C CA  . CYS N  1 23  ? 108.166 97.332  69.752  1.00 64.06  ? 23   CYS N CA  1 
ATOM   10500 C C   . CYS N  1 23  ? 108.062 98.550  68.802  1.00 64.00  ? 23   CYS N C   1 
ATOM   10501 O O   . CYS N  1 23  ? 108.155 99.724  69.265  1.00 64.43  ? 23   CYS N O   1 
ATOM   10502 C CB  . CYS N  1 23  ? 107.301 97.630  70.998  1.00 64.16  ? 23   CYS N CB  1 
ATOM   10503 S SG  . CYS N  1 23  ? 106.170 96.295  71.544  1.00 64.70  ? 23   CYS N SG  1 
ATOM   10504 N N   . ARG N  1 24  ? 107.848 98.285  67.499  1.00 63.08  ? 24   ARG N N   1 
ATOM   10505 C CA  . ARG N  1 24  ? 107.578 99.364  66.527  1.00 61.36  ? 24   ARG N CA  1 
ATOM   10506 C C   . ARG N  1 24  ? 106.075 99.684  66.394  1.00 59.52  ? 24   ARG N C   1 
ATOM   10507 O O   . ARG N  1 24  ? 105.230 98.895  66.829  1.00 58.07  ? 24   ARG N O   1 
ATOM   10508 C CB  . ARG N  1 24  ? 108.183 99.025  65.157  1.00 62.03  ? 24   ARG N CB  1 
ATOM   10509 C CG  . ARG N  1 24  ? 109.517 99.703  64.832  1.00 60.87  ? 24   ARG N CG  1 
ATOM   10510 C CD  . ARG N  1 24  ? 110.142 99.060  63.602  1.00 60.14  ? 24   ARG N CD  1 
ATOM   10511 N NE  . ARG N  1 24  ? 110.659 100.024 62.624  1.00 59.61  ? 24   ARG N NE  1 
ATOM   10512 C CZ  . ARG N  1 24  ? 110.795 99.767  61.322  1.00 55.37  ? 24   ARG N CZ  1 
ATOM   10513 N NH1 . ARG N  1 24  ? 110.450 98.582  60.829  1.00 50.82  ? 24   ARG N NH1 1 
ATOM   10514 N NH2 . ARG N  1 24  ? 111.271 100.700 60.507  1.00 53.66  ? 24   ARG N NH2 1 
ATOM   10515 N N   . ALA N  1 25  ? 105.755 100.832 65.785  1.00 59.09  ? 25   ALA N N   1 
ATOM   10516 C CA  . ALA N  1 25  ? 104.367 101.313 65.663  1.00 58.42  ? 25   ALA N CA  1 
ATOM   10517 C C   . ALA N  1 25  ? 103.999 101.841 64.267  1.00 58.14  ? 25   ALA N C   1 
ATOM   10518 O O   . ALA N  1 25  ? 104.852 101.924 63.378  1.00 58.39  ? 25   ALA N O   1 
ATOM   10519 C CB  . ALA N  1 25  ? 104.093 102.386 66.714  1.00 57.88  ? 25   ALA N CB  1 
ATOM   10520 N N   . SER N  1 26  ? 102.722 102.197 64.098  1.00 58.58  ? 26   SER N N   1 
ATOM   10521 C CA  . SER N  1 26  ? 102.216 102.814 62.865  1.00 58.05  ? 26   SER N CA  1 
ATOM   10522 C C   . SER N  1 26  ? 102.303 104.344 62.886  1.00 57.72  ? 26   SER N C   1 
ATOM   10523 O O   . SER N  1 26  ? 101.693 105.017 62.041  1.00 57.62  ? 26   SER N O   1 
ATOM   10524 C CB  . SER N  1 26  ? 100.767 102.383 62.615  1.00 58.94  ? 26   SER N CB  1 
ATOM   10525 O OG  . SER N  1 26  ? 99.984  102.622 63.765  1.00 59.42  ? 26   SER N OG  1 
ATOM   10526 N N   . GLN N  1 27  ? 103.049 104.889 63.846  1.00 57.28  ? 27   GLN N N   1 
ATOM   10527 C CA  . GLN N  1 27  ? 103.322 106.327 63.899  1.00 56.36  ? 27   GLN N CA  1 
ATOM   10528 C C   . GLN N  1 27  ? 104.116 106.734 65.132  1.00 55.12  ? 27   GLN N C   1 
ATOM   10529 O O   . GLN N  1 27  ? 104.239 105.979 66.102  1.00 54.61  ? 27   GLN N O   1 
ATOM   10530 C CB  . GLN N  1 27  ? 102.021 107.156 63.806  1.00 57.03  ? 27   GLN N CB  1 
ATOM   10531 C CG  . GLN N  1 27  ? 102.151 108.671 64.060  1.00 58.82  ? 27   GLN N CG  1 
ATOM   10532 C CD  . GLN N  1 27  ? 102.652 109.463 62.857  1.00 61.95  ? 27   GLN N CD  1 
ATOM   10533 O OE1 . GLN N  1 27  ? 101.877 110.164 62.205  1.00 64.04  ? 27   GLN N OE1 1 
ATOM   10534 N NE2 . GLN N  1 27  ? 103.946 109.361 62.563  1.00 58.50  ? 27   GLN N NE2 1 
ATOM   10535 N N   . SER N  1 28  ? 104.667 107.942 65.041  1.00 53.60  ? 28   SER N N   1 
ATOM   10536 C CA  . SER N  1 28  ? 105.258 108.678 66.145  1.00 52.74  ? 28   SER N CA  1 
ATOM   10537 C C   . SER N  1 28  ? 104.324 108.676 67.353  1.00 50.60  ? 28   SER N C   1 
ATOM   10538 O O   . SER N  1 28  ? 103.416 109.507 67.453  1.00 49.31  ? 28   SER N O   1 
ATOM   10539 C CB  . SER N  1 28  ? 105.553 110.116 65.698  1.00 52.93  ? 28   SER N CB  1 
ATOM   10540 O OG  . SER N  1 28  ? 106.676 110.659 66.442  1.00 55.16  ? 28   SER N OG  1 
ATOM   10541 N N   . ILE N  1 29  ? 104.543 107.728 68.260  1.00 49.57  ? 29   ILE N N   1 
ATOM   10542 C CA  . ILE N  1 29  ? 103.767 107.650 69.502  1.00 48.36  ? 29   ILE N CA  1 
ATOM   10543 C C   . ILE N  1 29  ? 104.321 108.659 70.540  1.00 46.23  ? 29   ILE N C   1 
ATOM   10544 O O   . ILE N  1 29  ? 104.302 108.431 71.761  1.00 45.57  ? 29   ILE N O   1 
ATOM   10545 C CB  . ILE N  1 29  ? 103.624 106.165 70.004  1.00 49.65  ? 29   ILE N CB  1 
ATOM   10546 C CG1 . ILE N  1 29  ? 103.635 106.079 71.531  1.00 48.87  ? 29   ILE N CG1 1 
ATOM   10547 C CG2 . ILE N  1 29  ? 104.674 105.250 69.359  1.00 45.37  ? 29   ILE N CG2 1 
ATOM   10548 C CD1 . ILE N  1 29  ? 104.512 105.008 72.057  1.00 51.32  ? 29   ILE N CD1 1 
ATOM   10549 N N   . SER N  1 30  ? 104.754 109.811 70.011  1.00 45.14  ? 30   SER N N   1 
ATOM   10550 C CA  . SER N  1 30  ? 105.493 110.864 70.735  1.00 43.89  ? 30   SER N CA  1 
ATOM   10551 C C   . SER N  1 30  ? 106.523 110.262 71.670  1.00 43.16  ? 30   SER N C   1 
ATOM   10552 O O   . SER N  1 30  ? 107.618 109.902 71.263  1.00 43.48  ? 30   SER N O   1 
ATOM   10553 C CB  . SER N  1 30  ? 104.546 111.797 71.511  1.00 43.91  ? 30   SER N CB  1 
ATOM   10554 O OG  . SER N  1 30  ? 105.280 112.705 72.328  1.00 40.01  ? 30   SER N OG  1 
ATOM   10555 N N   . SER N  1 31  ? 106.128 110.171 72.931  1.00 42.48  ? 31   SER N N   1 
ATOM   10556 C CA  . SER N  1 31  ? 106.803 109.374 73.924  1.00 43.01  ? 31   SER N CA  1 
ATOM   10557 C C   . SER N  1 31  ? 105.746 108.488 74.601  1.00 42.65  ? 31   SER N C   1 
ATOM   10558 O O   . SER N  1 31  ? 106.054 107.374 75.057  1.00 40.40  ? 31   SER N O   1 
ATOM   10559 C CB  . SER N  1 31  ? 107.498 110.286 74.935  1.00 41.98  ? 31   SER N CB  1 
ATOM   10560 O OG  . SER N  1 31  ? 107.981 109.529 76.090  1.00 40.33  ? 31   SER N OG  1 
ATOM   10561 N N   . TYR N  1 32  ? 104.501 108.988 74.624  1.00 43.05  ? 32   TYR N N   1 
ATOM   10562 C CA  . TYR N  1 32  ? 103.334 108.376 75.304  1.00 42.78  ? 32   TYR N CA  1 
ATOM   10563 C C   . TYR N  1 32  ? 103.111 106.863 75.105  1.00 42.83  ? 32   TYR N C   1 
ATOM   10564 O O   . TYR N  1 32  ? 102.148 106.460 74.439  1.00 42.41  ? 32   TYR N O   1 
ATOM   10565 C CB  . TYR N  1 32  ? 102.037 109.091 74.879  1.00 40.53  ? 32   TYR N CB  1 
ATOM   10566 C CG  . TYR N  1 32  ? 101.794 110.484 75.427  1.00 39.17  ? 32   TYR N CG  1 
ATOM   10567 C CD1 . TYR N  1 32  ? 101.178 111.453 74.633  1.00 37.00  ? 32   TYR N CD1 1 
ATOM   10568 C CD2 . TYR N  1 32  ? 102.152 110.834 76.732  1.00 38.80  ? 32   TYR N CD2 1 
ATOM   10569 C CE1 . TYR N  1 32  ? 100.930 112.731 75.115  1.00 34.98  ? 32   TYR N CE1 1 
ATOM   10570 C CE2 . TYR N  1 32  ? 101.912 112.121 77.225  1.00 36.97  ? 32   TYR N CE2 1 
ATOM   10571 C CZ  . TYR N  1 32  ? 101.301 113.064 76.406  1.00 37.46  ? 32   TYR N CZ  1 
ATOM   10572 O OH  . TYR N  1 32  ? 101.055 114.337 76.867  1.00 40.40  ? 32   TYR N OH  1 
ATOM   10573 N N   . LEU N  1 33  ? 103.991 106.034 75.688  1.00 43.88  ? 33   LEU N N   1 
ATOM   10574 C CA  . LEU N  1 33  ? 103.864 104.562 75.639  1.00 45.15  ? 33   LEU N CA  1 
ATOM   10575 C C   . LEU N  1 33  ? 103.953 103.952 77.044  1.00 46.51  ? 33   LEU N C   1 
ATOM   10576 O O   . LEU N  1 33  ? 103.996 104.679 78.049  1.00 46.29  ? 33   LEU N O   1 
ATOM   10577 C CB  . LEU N  1 33  ? 104.952 103.942 74.741  1.00 43.44  ? 33   LEU N CB  1 
ATOM   10578 C CG  . LEU N  1 33  ? 105.088 102.408 74.606  1.00 44.37  ? 33   LEU N CG  1 
ATOM   10579 C CD1 . LEU N  1 33  ? 104.199 101.821 73.509  1.00 47.20  ? 33   LEU N CD1 1 
ATOM   10580 C CD2 . LEU N  1 33  ? 106.532 101.995 74.390  1.00 44.53  ? 33   LEU N CD2 1 
ATOM   10581 N N   . ASN N  1 34  ? 103.980 102.609 77.087  1.00 47.50  ? 34   ASN N N   1 
ATOM   10582 C CA  . ASN N  1 34  ? 104.149 101.811 78.312  1.00 48.77  ? 34   ASN N CA  1 
ATOM   10583 C C   . ASN N  1 34  ? 104.295 100.303 78.032  1.00 50.56  ? 34   ASN N C   1 
ATOM   10584 O O   . ASN N  1 34  ? 104.286 99.877  76.874  1.00 50.41  ? 34   ASN N O   1 
ATOM   10585 C CB  . ASN N  1 34  ? 103.005 102.068 79.295  1.00 48.17  ? 34   ASN N CB  1 
ATOM   10586 C CG  . ASN N  1 34  ? 101.664 102.165 78.610  1.00 51.39  ? 34   ASN N CG  1 
ATOM   10587 O OD1 . ASN N  1 34  ? 101.275 103.229 78.128  1.00 53.34  ? 34   ASN N OD1 1 
ATOM   10588 N ND2 . ASN N  1 34  ? 100.943 101.053 78.557  1.00 49.02  ? 34   ASN N ND2 1 
ATOM   10589 N N   . TRP N  1 35  ? 104.426 99.506  79.094  1.00 51.57  ? 35   TRP N N   1 
ATOM   10590 C CA  . TRP N  1 35  ? 104.683 98.070  78.974  1.00 52.08  ? 35   TRP N CA  1 
ATOM   10591 C C   . TRP N  1 35  ? 103.913 97.278  80.044  1.00 50.85  ? 35   TRP N C   1 
ATOM   10592 O O   . TRP N  1 35  ? 104.068 97.550  81.235  1.00 51.89  ? 35   TRP N O   1 
ATOM   10593 C CB  . TRP N  1 35  ? 106.189 97.807  79.111  1.00 53.72  ? 35   TRP N CB  1 
ATOM   10594 C CG  . TRP N  1 35  ? 107.030 98.152  77.890  1.00 54.35  ? 35   TRP N CG  1 
ATOM   10595 C CD1 . TRP N  1 35  ? 107.754 99.296  77.675  1.00 56.14  ? 35   TRP N CD1 1 
ATOM   10596 C CD2 . TRP N  1 35  ? 107.252 97.320  76.744  1.00 56.00  ? 35   TRP N CD2 1 
ATOM   10597 N NE1 . TRP N  1 35  ? 108.403 99.228  76.460  1.00 54.54  ? 35   TRP N NE1 1 
ATOM   10598 C CE2 . TRP N  1 35  ? 108.110 98.027  75.868  1.00 55.88  ? 35   TRP N CE2 1 
ATOM   10599 C CE3 . TRP N  1 35  ? 106.802 96.046  76.369  1.00 57.21  ? 35   TRP N CE3 1 
ATOM   10600 C CZ2 . TRP N  1 35  ? 108.527 97.501  74.639  1.00 55.91  ? 35   TRP N CZ2 1 
ATOM   10601 C CZ3 . TRP N  1 35  ? 107.217 95.524  75.148  1.00 55.00  ? 35   TRP N CZ3 1 
ATOM   10602 C CH2 . TRP N  1 35  ? 108.072 96.252  74.299  1.00 57.08  ? 35   TRP N CH2 1 
ATOM   10603 N N   . TYR N  1 36  ? 103.065 96.332  79.637  1.00 50.10  ? 36   TYR N N   1 
ATOM   10604 C CA  . TYR N  1 36  ? 102.356 95.497  80.619  1.00 47.97  ? 36   TYR N CA  1 
ATOM   10605 C C   . TYR N  1 36  ? 102.947 94.069  80.682  1.00 46.19  ? 36   TYR N C   1 
ATOM   10606 O O   . TYR N  1 36  ? 103.890 93.751  79.950  1.00 42.35  ? 36   TYR N O   1 
ATOM   10607 C CB  . TYR N  1 36  ? 100.835 95.434  80.348  1.00 48.14  ? 36   TYR N CB  1 
ATOM   10608 C CG  . TYR N  1 36  ? 99.995  96.709  80.488  1.00 49.46  ? 36   TYR N CG  1 
ATOM   10609 C CD1 . TYR N  1 36  ? 99.768  97.535  79.384  1.00 51.30  ? 36   TYR N CD1 1 
ATOM   10610 C CD2 . TYR N  1 36  ? 99.339  97.024  81.682  1.00 51.13  ? 36   TYR N CD2 1 
ATOM   10611 C CE1 . TYR N  1 36  ? 98.959  98.672  79.475  1.00 50.19  ? 36   TYR N CE1 1 
ATOM   10612 C CE2 . TYR N  1 36  ? 98.526  98.160  81.784  1.00 51.27  ? 36   TYR N CE2 1 
ATOM   10613 C CZ  . TYR N  1 36  ? 98.342  98.978  80.675  1.00 51.26  ? 36   TYR N CZ  1 
ATOM   10614 O OH  . TYR N  1 36  ? 97.551  100.101 80.771  1.00 49.95  ? 36   TYR N OH  1 
ATOM   10615 N N   . GLN N  1 37  ? 102.378 93.225  81.554  1.00 46.72  ? 37   GLN N N   1 
ATOM   10616 C CA  . GLN N  1 37  ? 102.850 91.853  81.835  1.00 46.67  ? 37   GLN N CA  1 
ATOM   10617 C C   . GLN N  1 37  ? 101.818 91.114  82.681  1.00 48.81  ? 37   GLN N C   1 
ATOM   10618 O O   . GLN N  1 37  ? 101.196 91.730  83.557  1.00 48.88  ? 37   GLN N O   1 
ATOM   10619 C CB  . GLN N  1 37  ? 104.154 91.876  82.650  1.00 46.65  ? 37   GLN N CB  1 
ATOM   10620 C CG  . GLN N  1 37  ? 104.495 90.525  83.332  1.00 46.57  ? 37   GLN N CG  1 
ATOM   10621 C CD  . GLN N  1 37  ? 104.946 90.641  84.792  1.00 42.17  ? 37   GLN N CD  1 
ATOM   10622 O OE1 . GLN N  1 37  ? 104.409 89.967  85.675  1.00 27.79  ? 37   GLN N OE1 1 
ATOM   10623 N NE2 . GLN N  1 37  ? 105.942 91.482  85.041  1.00 41.50  ? 37   GLN N NE2 1 
ATOM   10624 N N   . GLN N  1 38  ? 101.647 89.805  82.454  1.00 49.59  ? 38   GLN N N   1 
ATOM   10625 C CA  . GLN N  1 38  ? 100.907 88.946  83.405  1.00 50.41  ? 38   GLN N CA  1 
ATOM   10626 C C   . GLN N  1 38  ? 101.062 87.431  83.232  1.00 51.04  ? 38   GLN N C   1 
ATOM   10627 O O   . GLN N  1 38  ? 101.294 86.930  82.127  1.00 50.15  ? 38   GLN N O   1 
ATOM   10628 C CB  . GLN N  1 38  ? 99.416  89.311  83.457  1.00 50.04  ? 38   GLN N CB  1 
ATOM   10629 C CG  . GLN N  1 38  ? 98.485  88.460  82.592  1.00 49.71  ? 38   GLN N CG  1 
ATOM   10630 C CD  . GLN N  1 38  ? 98.527  88.823  81.121  1.00 50.86  ? 38   GLN N CD  1 
ATOM   10631 O OE1 . GLN N  1 38  ? 99.592  89.069  80.552  1.00 55.24  ? 38   GLN N OE1 1 
ATOM   10632 N NE2 . GLN N  1 38  ? 97.359  88.848  80.490  1.00 43.76  ? 38   GLN N NE2 1 
ATOM   10633 N N   . LYS N  1 39  ? 100.899 86.720  84.346  1.00 51.44  ? 39   LYS N N   1 
ATOM   10634 C CA  . LYS N  1 39  ? 100.973 85.264  84.385  1.00 53.26  ? 39   LYS N CA  1 
ATOM   10635 C C   . LYS N  1 39  ? 99.565  84.673  84.216  1.00 54.45  ? 39   LYS N C   1 
ATOM   10636 O O   . LYS N  1 39  ? 98.667  84.979  85.020  1.00 56.12  ? 39   LYS N O   1 
ATOM   10637 C CB  . LYS N  1 39  ? 101.637 84.823  85.696  1.00 52.71  ? 39   LYS N CB  1 
ATOM   10638 C CG  . LYS N  1 39  ? 103.015 85.477  85.896  1.00 50.97  ? 39   LYS N CG  1 
ATOM   10639 C CD  . LYS N  1 39  ? 103.426 85.611  87.362  1.00 44.89  ? 39   LYS N CD  1 
ATOM   10640 C CE  . LYS N  1 39  ? 104.023 84.305  87.885  1.00 42.39  ? 39   LYS N CE  1 
ATOM   10641 N NZ  . LYS N  1 39  ? 104.472 84.413  89.352  1.00 36.74  ? 39   LYS N NZ  1 
ATOM   10642 N N   . PRO N  1 40  ? 99.351  83.858  83.154  1.00 54.66  ? 40   PRO N N   1 
ATOM   10643 C CA  . PRO N  1 40  ? 98.025  83.305  82.834  1.00 55.25  ? 40   PRO N CA  1 
ATOM   10644 C C   . PRO N  1 40  ? 97.295  82.617  83.987  1.00 55.72  ? 40   PRO N C   1 
ATOM   10645 O O   . PRO N  1 40  ? 97.865  81.807  84.727  1.00 54.18  ? 40   PRO N O   1 
ATOM   10646 C CB  . PRO N  1 40  ? 98.316  82.332  81.649  1.00 54.82  ? 40   PRO N CB  1 
ATOM   10647 C CG  . PRO N  1 40  ? 99.508  82.942  81.000  1.00 55.70  ? 40   PRO N CG  1 
ATOM   10648 C CD  . PRO N  1 40  ? 100.354 83.443  82.145  1.00 54.81  ? 40   PRO N CD  1 
ATOM   10649 N N   . GLY N  1 41  ? 96.012  82.946  84.071  1.00 56.91  ? 41   GLY N N   1 
ATOM   10650 C CA  . GLY N  1 41  ? 95.332  83.047  85.344  1.00 56.25  ? 41   GLY N CA  1 
ATOM   10651 C C   . GLY N  1 41  ? 94.949  84.525  85.468  1.00 56.64  ? 41   GLY N C   1 
ATOM   10652 O O   . GLY N  1 41  ? 93.752  84.894  85.309  1.00 56.07  ? 41   GLY N O   1 
ATOM   10653 N N   . LYS N  1 42  ? 95.960  85.384  85.685  1.00 56.47  ? 42   LYS N N   1 
ATOM   10654 C CA  . LYS N  1 42  ? 95.722  86.770  86.160  1.00 56.51  ? 42   LYS N CA  1 
ATOM   10655 C C   . LYS N  1 42  ? 95.346  87.870  85.123  1.00 57.26  ? 42   LYS N C   1 
ATOM   10656 O O   . LYS N  1 42  ? 94.332  87.729  84.421  1.00 58.28  ? 42   LYS N O   1 
ATOM   10657 C CB  . LYS N  1 42  ? 96.867  87.230  87.084  1.00 56.52  ? 42   LYS N CB  1 
ATOM   10658 C CG  . LYS N  1 42  ? 96.398  87.919  88.379  1.00 56.94  ? 42   LYS N CG  1 
ATOM   10659 C CD  . LYS N  1 42  ? 96.248  86.902  89.536  1.00 58.90  ? 42   LYS N CD  1 
ATOM   10660 C CE  . LYS N  1 42  ? 95.912  87.602  90.911  1.00 63.86  ? 42   LYS N CE  1 
ATOM   10661 N NZ  . LYS N  1 42  ? 96.049  86.649  92.083  1.00 67.57  ? 42   LYS N NZ  1 
ATOM   10662 N N   . ALA N  1 43  ? 96.146  88.958  85.043  1.00 56.86  ? 43   ALA N N   1 
ATOM   10663 C CA  . ALA N  1 43  ? 95.642  90.224  84.400  1.00 55.66  ? 43   ALA N CA  1 
ATOM   10664 C C   . ALA N  1 43  ? 96.701  91.275  83.979  1.00 54.86  ? 43   ALA N C   1 
ATOM   10665 O O   . ALA N  1 43  ? 97.723  91.415  84.656  1.00 54.78  ? 43   ALA N O   1 
ATOM   10666 C CB  . ALA N  1 43  ? 94.590  90.903  85.333  1.00 55.64  ? 43   ALA N CB  1 
ATOM   10667 N N   . PRO N  1 44  ? 96.445  92.023  82.870  1.00 54.36  ? 44   PRO N N   1 
ATOM   10668 C CA  . PRO N  1 44  ? 97.280  93.169  82.502  1.00 52.57  ? 44   PRO N CA  1 
ATOM   10669 C C   . PRO N  1 44  ? 97.735  93.965  83.721  1.00 51.49  ? 44   PRO N C   1 
ATOM   10670 O O   . PRO N  1 44  ? 96.921  94.629  84.400  1.00 50.75  ? 44   PRO N O   1 
ATOM   10671 C CB  . PRO N  1 44  ? 96.357  94.001  81.610  1.00 51.57  ? 44   PRO N CB  1 
ATOM   10672 C CG  . PRO N  1 44  ? 95.519  92.978  80.922  1.00 52.06  ? 44   PRO N CG  1 
ATOM   10673 C CD  . PRO N  1 44  ? 95.377  91.803  81.875  1.00 55.49  ? 44   PRO N CD  1 
ATOM   10674 N N   . LYS N  1 45  ? 99.039  93.830  83.993  1.00 50.36  ? 45   LYS N N   1 
ATOM   10675 C CA  . LYS N  1 45  ? 99.735  94.490  85.104  1.00 49.13  ? 45   LYS N CA  1 
ATOM   10676 C C   . LYS N  1 45  ? 100.787 95.379  84.466  1.00 48.26  ? 45   LYS N C   1 
ATOM   10677 O O   . LYS N  1 45  ? 101.598 94.924  83.642  1.00 49.56  ? 45   LYS N O   1 
ATOM   10678 C CB  . LYS N  1 45  ? 100.466 93.463  85.976  1.00 48.60  ? 45   LYS N CB  1 
ATOM   10679 C CG  . LYS N  1 45  ? 99.800  93.089  87.293  1.00 47.54  ? 45   LYS N CG  1 
ATOM   10680 C CD  . LYS N  1 45  ? 100.727 92.108  88.051  1.00 48.65  ? 45   LYS N CD  1 
ATOM   10681 C CE  . LYS N  1 45  ? 100.269 91.908  89.489  1.00 47.35  ? 45   LYS N CE  1 
ATOM   10682 N NZ  . LYS N  1 45  ? 99.107  90.972  89.584  1.00 46.32  ? 45   LYS N NZ  1 
ATOM   10683 N N   . LEU N  1 46  ? 100.788 96.632  84.895  1.00 45.94  ? 46   LEU N N   1 
ATOM   10684 C CA  . LEU N  1 46  ? 101.494 97.714  84.240  1.00 42.44  ? 46   LEU N CA  1 
ATOM   10685 C C   . LEU N  1 46  ? 102.946 97.878  84.693  1.00 43.13  ? 46   LEU N C   1 
ATOM   10686 O O   . LEU N  1 46  ? 103.219 98.514  85.725  1.00 42.03  ? 46   LEU N O   1 
ATOM   10687 C CB  . LEU N  1 46  ? 100.703 98.974  84.534  1.00 40.71  ? 46   LEU N CB  1 
ATOM   10688 C CG  . LEU N  1 46  ? 100.992 100.344 83.928  1.00 40.14  ? 46   LEU N CG  1 
ATOM   10689 C CD1 . LEU N  1 46  ? 100.433 100.521 82.534  1.00 35.76  ? 46   LEU N CD1 1 
ATOM   10690 C CD2 . LEU N  1 46  ? 100.274 101.236 84.868  1.00 45.60  ? 46   LEU N CD2 1 
ATOM   10691 N N   . LEU N  1 47  ? 103.870 97.313  83.915  1.00 43.69  ? 47   LEU N N   1 
ATOM   10692 C CA  . LEU N  1 47  ? 105.306 97.388  84.217  1.00 43.60  ? 47   LEU N CA  1 
ATOM   10693 C C   . LEU N  1 47  ? 105.860 98.805  84.062  1.00 44.25  ? 47   LEU N C   1 
ATOM   10694 O O   . LEU N  1 47  ? 105.809 99.583  85.013  1.00 45.40  ? 47   LEU N O   1 
ATOM   10695 C CB  . LEU N  1 47  ? 106.104 96.388  83.372  1.00 43.13  ? 47   LEU N CB  1 
ATOM   10696 C CG  . LEU N  1 47  ? 106.086 94.921  83.797  1.00 42.20  ? 47   LEU N CG  1 
ATOM   10697 C CD1 . LEU N  1 47  ? 107.438 94.317  83.476  1.00 34.23  ? 47   LEU N CD1 1 
ATOM   10698 C CD2 . LEU N  1 47  ? 105.787 94.748  85.283  1.00 33.65  ? 47   LEU N CD2 1 
ATOM   10699 N N   . ILE N  1 48  ? 106.389 99.138  82.876  1.00 46.34  ? 48   ILE N N   1 
ATOM   10700 C CA  . ILE N  1 48  ? 106.787 100.535 82.622  1.00 46.82  ? 48   ILE N CA  1 
ATOM   10701 C C   . ILE N  1 48  ? 105.576 101.398 82.174  1.00 46.65  ? 48   ILE N C   1 
ATOM   10702 O O   . ILE N  1 48  ? 104.561 100.862 81.675  1.00 44.71  ? 48   ILE N O   1 
ATOM   10703 C CB  . ILE N  1 48  ? 107.960 100.641 81.598  1.00 46.30  ? 48   ILE N CB  1 
ATOM   10704 C CG1 . ILE N  1 48  ? 108.883 99.417  81.695  1.00 46.39  ? 48   ILE N CG1 1 
ATOM   10705 C CG2 . ILE N  1 48  ? 108.753 101.924 81.841  1.00 47.46  ? 48   ILE N CG2 1 
ATOM   10706 C CD1 . ILE N  1 48  ? 109.884 99.263  80.562  1.00 45.64  ? 48   ILE N CD1 1 
ATOM   10707 N N   . TYR N  1 49  ? 105.685 102.716 82.417  1.00 47.54  ? 49   TYR N N   1 
ATOM   10708 C CA  . TYR N  1 49  ? 104.806 103.818 81.921  1.00 49.54  ? 49   TYR N CA  1 
ATOM   10709 C C   . TYR N  1 49  ? 105.717 104.819 81.125  1.00 49.28  ? 49   TYR N C   1 
ATOM   10710 O O   . TYR N  1 49  ? 106.944 104.681 81.164  1.00 48.96  ? 49   TYR N O   1 
ATOM   10711 C CB  . TYR N  1 49  ? 104.192 104.598 83.112  1.00 51.57  ? 49   TYR N CB  1 
ATOM   10712 C CG  . TYR N  1 49  ? 102.728 104.393 83.597  1.00 55.43  ? 49   TYR N CG  1 
ATOM   10713 C CD1 . TYR N  1 49  ? 102.443 104.411 84.966  1.00 54.24  ? 49   TYR N CD1 1 
ATOM   10714 C CD2 . TYR N  1 49  ? 101.638 104.293 82.719  1.00 58.08  ? 49   TYR N CD2 1 
ATOM   10715 C CE1 . TYR N  1 49  ? 101.132 104.279 85.466  1.00 55.90  ? 49   TYR N CE1 1 
ATOM   10716 C CE2 . TYR N  1 49  ? 100.304 104.158 83.214  1.00 55.91  ? 49   TYR N CE2 1 
ATOM   10717 C CZ  . TYR N  1 49  ? 100.066 104.154 84.590  1.00 55.59  ? 49   TYR N CZ  1 
ATOM   10718 O OH  . TYR N  1 49  ? 98.777  104.017 85.083  1.00 54.81  ? 49   TYR N OH  1 
ATOM   10719 N N   . ALA N  1 50  ? 105.135 105.809 80.426  1.00 48.81  ? 50   ALA N N   1 
ATOM   10720 C CA  . ALA N  1 50  ? 105.865 106.972 79.808  1.00 48.51  ? 50   ALA N CA  1 
ATOM   10721 C C   . ALA N  1 50  ? 107.110 106.708 78.921  1.00 48.05  ? 50   ALA N C   1 
ATOM   10722 O O   . ALA N  1 50  ? 107.813 107.650 78.519  1.00 45.79  ? 50   ALA N O   1 
ATOM   10723 C CB  . ALA N  1 50  ? 106.189 108.026 80.875  1.00 47.90  ? 50   ALA N CB  1 
ATOM   10724 N N   . ALA N  1 51  ? 107.335 105.424 78.623  1.00 47.98  ? 51   ALA N N   1 
ATOM   10725 C CA  . ALA N  1 51  ? 108.506 104.901 77.894  1.00 48.06  ? 51   ALA N CA  1 
ATOM   10726 C C   . ALA N  1 51  ? 109.531 104.341 78.881  1.00 47.88  ? 51   ALA N C   1 
ATOM   10727 O O   . ALA N  1 51  ? 109.529 103.130 79.145  1.00 48.06  ? 51   ALA N O   1 
ATOM   10728 C CB  . ALA N  1 51  ? 109.137 105.938 76.924  1.00 47.22  ? 51   ALA N CB  1 
ATOM   10729 N N   . SER N  1 52  ? 110.390 105.192 79.437  1.00 49.16  ? 52   SER N N   1 
ATOM   10730 C CA  . SER N  1 52  ? 111.412 104.713 80.373  1.00 48.07  ? 52   SER N CA  1 
ATOM   10731 C C   . SER N  1 52  ? 111.060 104.937 81.845  1.00 48.22  ? 52   SER N C   1 
ATOM   10732 O O   . SER N  1 52  ? 111.824 104.552 82.736  1.00 48.39  ? 52   SER N O   1 
ATOM   10733 C CB  . SER N  1 52  ? 112.786 105.308 80.044  1.00 47.37  ? 52   SER N CB  1 
ATOM   10734 O OG  . SER N  1 52  ? 112.685 106.716 79.832  1.00 45.97  ? 52   SER N OG  1 
ATOM   10735 N N   . SER N  1 53  ? 109.901 105.541 82.093  1.00 47.44  ? 53   SER N N   1 
ATOM   10736 C CA  . SER N  1 53  ? 109.481 105.864 83.456  1.00 47.33  ? 53   SER N CA  1 
ATOM   10737 C C   . SER N  1 53  ? 108.875 104.664 84.195  1.00 48.23  ? 53   SER N C   1 
ATOM   10738 O O   . SER N  1 53  ? 107.686 104.335 84.035  1.00 47.74  ? 53   SER N O   1 
ATOM   10739 C CB  . SER N  1 53  ? 108.530 107.064 83.454  1.00 46.66  ? 53   SER N CB  1 
ATOM   10740 O OG  . SER N  1 53  ? 108.527 107.724 84.722  1.00 43.49  ? 53   SER N OG  1 
ATOM   10741 N N   . LEU N  1 54  ? 109.734 104.026 84.998  1.00 48.15  ? 54   LEU N N   1 
ATOM   10742 C CA  . LEU N  1 54  ? 109.421 102.860 85.832  1.00 47.60  ? 54   LEU N CA  1 
ATOM   10743 C C   . LEU N  1 54  ? 108.231 103.040 86.750  1.00 47.69  ? 54   LEU N C   1 
ATOM   10744 O O   . LEU N  1 54  ? 107.608 104.107 86.828  1.00 47.31  ? 54   LEU N O   1 
ATOM   10745 C CB  . LEU N  1 54  ? 110.610 102.501 86.742  1.00 49.17  ? 54   LEU N CB  1 
ATOM   10746 C CG  . LEU N  1 54  ? 111.535 101.277 86.613  1.00 46.21  ? 54   LEU N CG  1 
ATOM   10747 C CD1 . LEU N  1 54  ? 112.382 101.167 87.929  1.00 44.07  ? 54   LEU N CD1 1 
ATOM   10748 C CD2 . LEU N  1 54  ? 110.742 99.993  86.378  1.00 47.12  ? 54   LEU N CD2 1 
ATOM   10749 N N   . GLN N  1 55  ? 107.970 101.971 87.494  1.00 46.73  ? 55   GLN N N   1 
ATOM   10750 C CA  . GLN N  1 55  ? 106.842 101.907 88.392  1.00 47.28  ? 55   GLN N CA  1 
ATOM   10751 C C   . GLN N  1 55  ? 107.190 101.419 89.795  1.00 49.49  ? 55   GLN N C   1 
ATOM   10752 O O   . GLN N  1 55  ? 108.164 100.689 90.019  1.00 49.14  ? 55   GLN N O   1 
ATOM   10753 C CB  . GLN N  1 55  ? 105.724 101.067 87.773  1.00 45.40  ? 55   GLN N CB  1 
ATOM   10754 C CG  . GLN N  1 55  ? 104.831 101.853 86.833  1.00 43.92  ? 55   GLN N CG  1 
ATOM   10755 C CD  . GLN N  1 55  ? 103.979 102.856 87.582  1.00 37.58  ? 55   GLN N CD  1 
ATOM   10756 O OE1 . GLN N  1 55  ? 103.747 103.974 87.111  1.00 27.72  ? 55   GLN N OE1 1 
ATOM   10757 N NE2 . GLN N  1 55  ? 103.520 102.455 88.776  1.00 35.88  ? 55   GLN N NE2 1 
ATOM   10758 N N   . SER N  1 56  ? 106.346 101.837 90.728  1.00 50.59  ? 56   SER N N   1 
ATOM   10759 C CA  . SER N  1 56  ? 106.608 101.740 92.154  1.00 50.59  ? 56   SER N CA  1 
ATOM   10760 C C   . SER N  1 56  ? 106.133 100.393 92.685  1.00 51.38  ? 56   SER N C   1 
ATOM   10761 O O   . SER N  1 56  ? 105.248 100.320 93.542  1.00 52.20  ? 56   SER N O   1 
ATOM   10762 C CB  . SER N  1 56  ? 105.887 102.887 92.870  1.00 50.53  ? 56   SER N CB  1 
ATOM   10763 O OG  . SER N  1 56  ? 105.903 104.081 92.062  1.00 49.74  ? 56   SER N OG  1 
ATOM   10764 N N   . GLY N  1 57  ? 106.732 99.326  92.162  1.00 51.67  ? 57   GLY N N   1 
ATOM   10765 C CA  . GLY N  1 57  ? 106.381 97.947  92.534  1.00 52.65  ? 57   GLY N CA  1 
ATOM   10766 C C   . GLY N  1 57  ? 107.194 96.958  91.708  1.00 53.07  ? 57   GLY N C   1 
ATOM   10767 O O   . GLY N  1 57  ? 107.712 95.957  92.222  1.00 53.24  ? 57   GLY N O   1 
ATOM   10768 N N   . VAL N  1 58  ? 107.268 97.235  90.409  1.00 53.90  ? 58   VAL N N   1 
ATOM   10769 C CA  . VAL N  1 58  ? 108.274 96.662  89.521  1.00 55.50  ? 58   VAL N CA  1 
ATOM   10770 C C   . VAL N  1 58  ? 109.667 97.127  90.029  1.00 56.45  ? 58   VAL N C   1 
ATOM   10771 O O   . VAL N  1 58  ? 109.807 98.285  90.480  1.00 56.83  ? 58   VAL N O   1 
ATOM   10772 C CB  . VAL N  1 58  ? 107.972 97.093  88.042  1.00 55.77  ? 58   VAL N CB  1 
ATOM   10773 C CG1 . VAL N  1 58  ? 107.753 98.572  87.930  1.00 52.76  ? 58   VAL N CG1 1 
ATOM   10774 C CG2 . VAL N  1 58  ? 109.027 96.639  87.069  1.00 55.19  ? 58   VAL N CG2 1 
ATOM   10775 N N   . PRO N  1 59  ? 110.683 96.225  90.019  1.00 57.33  ? 59   PRO N N   1 
ATOM   10776 C CA  . PRO N  1 59  ? 112.057 96.526  90.465  1.00 57.84  ? 59   PRO N CA  1 
ATOM   10777 C C   . PRO N  1 59  ? 113.039 96.883  89.327  1.00 58.79  ? 59   PRO N C   1 
ATOM   10778 O O   . PRO N  1 59  ? 112.807 96.511  88.169  1.00 59.46  ? 59   PRO N O   1 
ATOM   10779 C CB  . PRO N  1 59  ? 112.483 95.213  91.118  1.00 57.55  ? 59   PRO N CB  1 
ATOM   10780 C CG  . PRO N  1 59  ? 111.770 94.147  90.282  1.00 58.29  ? 59   PRO N CG  1 
ATOM   10781 C CD  . PRO N  1 59  ? 110.553 94.802  89.644  1.00 57.99  ? 59   PRO N CD  1 
ATOM   10782 N N   . SER N  1 60  ? 114.143 97.553  89.670  1.00 59.49  ? 60   SER N N   1 
ATOM   10783 C CA  . SER N  1 60  ? 114.979 98.302  88.698  1.00 59.98  ? 60   SER N CA  1 
ATOM   10784 C C   . SER N  1 60  ? 115.597 97.543  87.496  1.00 60.79  ? 60   SER N C   1 
ATOM   10785 O O   . SER N  1 60  ? 116.284 98.151  86.660  1.00 60.67  ? 60   SER N O   1 
ATOM   10786 C CB  . SER N  1 60  ? 116.052 99.131  89.435  1.00 59.86  ? 60   SER N CB  1 
ATOM   10787 O OG  . SER N  1 60  ? 117.316 98.355  89.611  1.00 56.76  ? 60   SER N OG  1 
ATOM   10788 N N   . ARG N  1 61  ? 115.326 96.238  87.409  1.00 61.20  ? 61   ARG N N   1 
ATOM   10789 C CA  . ARG N  1 61  ? 115.850 95.380  86.338  1.00 61.26  ? 61   ARG N CA  1 
ATOM   10790 C C   . ARG N  1 61  ? 115.178 95.567  84.954  1.00 60.09  ? 61   ARG N C   1 
ATOM   10791 O O   . ARG N  1 61  ? 115.691 95.080  83.943  1.00 60.01  ? 61   ARG N O   1 
ATOM   10792 C CB  . ARG N  1 61  ? 115.788 93.923  86.839  1.00 61.50  ? 61   ARG N CB  1 
ATOM   10793 C CG  . ARG N  1 61  ? 115.885 92.817  85.786  1.00 62.83  ? 61   ARG N CG  1 
ATOM   10794 C CD  . ARG N  1 61  ? 115.927 91.471  86.489  1.00 63.59  ? 61   ARG N CD  1 
ATOM   10795 N NE  . ARG N  1 61  ? 114.655 90.743  86.458  1.00 68.45  ? 61   ARG N NE  1 
ATOM   10796 C CZ  . ARG N  1 61  ? 113.657 90.903  87.326  1.00 71.15  ? 61   ARG N CZ  1 
ATOM   10797 N NH1 . ARG N  1 61  ? 113.751 91.781  88.322  1.00 74.77  ? 61   ARG N NH1 1 
ATOM   10798 N NH2 . ARG N  1 61  ? 112.549 90.183  87.190  1.00 73.96  ? 61   ARG N NH2 1 
ATOM   10799 N N   . PHE N  1 62  ? 114.048 96.273  84.900  1.00 58.93  ? 62   PHE N N   1 
ATOM   10800 C CA  . PHE N  1 62  ? 113.394 96.541  83.606  1.00 58.72  ? 62   PHE N CA  1 
ATOM   10801 C C   . PHE N  1 62  ? 113.519 97.989  83.168  1.00 58.92  ? 62   PHE N C   1 
ATOM   10802 O O   . PHE N  1 62  ? 113.735 98.894  83.986  1.00 57.70  ? 62   PHE N O   1 
ATOM   10803 C CB  . PHE N  1 62  ? 111.918 96.159  83.576  1.00 57.68  ? 62   PHE N CB  1 
ATOM   10804 C CG  . PHE N  1 62  ? 111.569 94.986  84.410  1.00 54.34  ? 62   PHE N CG  1 
ATOM   10805 C CD1 . PHE N  1 62  ? 111.452 95.112  85.785  1.00 48.75  ? 62   PHE N CD1 1 
ATOM   10806 C CD2 . PHE N  1 62  ? 111.306 93.759  83.824  1.00 49.59  ? 62   PHE N CD2 1 
ATOM   10807 C CE1 . PHE N  1 62  ? 111.112 94.029  86.568  1.00 48.96  ? 62   PHE N CE1 1 
ATOM   10808 C CE2 . PHE N  1 62  ? 110.958 92.669  84.604  1.00 50.88  ? 62   PHE N CE2 1 
ATOM   10809 C CZ  . PHE N  1 62  ? 110.862 92.806  85.980  1.00 50.18  ? 62   PHE N CZ  1 
ATOM   10810 N N   . SER N  1 63  ? 113.341 98.203  81.863  1.00 59.95  ? 63   SER N N   1 
ATOM   10811 C CA  . SER N  1 63  ? 113.964 99.346  81.221  1.00 60.46  ? 63   SER N CA  1 
ATOM   10812 C C   . SER N  1 63  ? 113.549 99.526  79.759  1.00 61.19  ? 63   SER N C   1 
ATOM   10813 O O   . SER N  1 63  ? 114.032 98.803  78.871  1.00 61.03  ? 63   SER N O   1 
ATOM   10814 C CB  . SER N  1 63  ? 115.498 99.155  81.259  1.00 61.49  ? 63   SER N CB  1 
ATOM   10815 O OG  . SER N  1 63  ? 115.895 97.944  81.934  1.00 59.83  ? 63   SER N OG  1 
ATOM   10816 N N   . GLY N  1 64  ? 112.672 100.498 79.509  1.00 62.14  ? 64   GLY N N   1 
ATOM   10817 C CA  . GLY N  1 64  ? 112.258 100.852 78.150  1.00 63.06  ? 64   GLY N CA  1 
ATOM   10818 C C   . GLY N  1 64  ? 113.026 102.046 77.615  1.00 64.88  ? 64   GLY N C   1 
ATOM   10819 O O   . GLY N  1 64  ? 113.977 102.506 78.253  1.00 65.78  ? 64   GLY N O   1 
ATOM   10820 N N   . SER N  1 65  ? 112.609 102.554 76.453  1.00 65.71  ? 65   SER N N   1 
ATOM   10821 C CA  . SER N  1 65  ? 113.225 103.732 75.815  1.00 66.13  ? 65   SER N CA  1 
ATOM   10822 C C   . SER N  1 65  ? 112.582 104.039 74.465  1.00 66.05  ? 65   SER N C   1 
ATOM   10823 O O   . SER N  1 65  ? 112.523 103.159 73.602  1.00 67.01  ? 65   SER N O   1 
ATOM   10824 C CB  . SER N  1 65  ? 114.730 103.511 75.595  1.00 66.30  ? 65   SER N CB  1 
ATOM   10825 O OG  . SER N  1 65  ? 115.503 104.256 76.568  1.00 67.71  ? 65   SER N OG  1 
ATOM   10826 N N   . GLY N  1 66  ? 112.102 105.266 74.263  1.00 65.00  ? 66   GLY N N   1 
ATOM   10827 C CA  . GLY N  1 66  ? 111.649 105.635 72.921  1.00 65.35  ? 66   GLY N CA  1 
ATOM   10828 C C   . GLY N  1 66  ? 110.667 106.767 72.674  1.00 64.55  ? 66   GLY N C   1 
ATOM   10829 O O   . GLY N  1 66  ? 109.729 106.993 73.443  1.00 65.53  ? 66   GLY N O   1 
ATOM   10830 N N   . SER N  1 67  ? 110.920 107.480 71.581  1.00 64.31  ? 67   SER N N   1 
ATOM   10831 C CA  . SER N  1 67  ? 109.982 108.409 70.977  1.00 63.59  ? 67   SER N CA  1 
ATOM   10832 C C   . SER N  1 67  ? 109.729 107.791 69.604  1.00 62.40  ? 67   SER N C   1 
ATOM   10833 O O   . SER N  1 67  ? 110.312 106.750 69.292  1.00 62.67  ? 67   SER N O   1 
ATOM   10834 C CB  . SER N  1 67  ? 110.630 109.793 70.845  1.00 63.91  ? 67   SER N CB  1 
ATOM   10835 O OG  . SER N  1 67  ? 109.726 110.845 71.210  1.00 62.78  ? 67   SER N OG  1 
ATOM   10836 N N   . GLY N  1 68  ? 108.875 108.396 68.783  1.00 61.97  ? 68   GLY N N   1 
ATOM   10837 C CA  . GLY N  1 68  ? 108.707 107.942 67.395  1.00 60.77  ? 68   GLY N CA  1 
ATOM   10838 C C   . GLY N  1 68  ? 108.174 106.528 67.185  1.00 60.18  ? 68   GLY N C   1 
ATOM   10839 O O   . GLY N  1 68  ? 107.037 106.231 67.550  1.00 59.49  ? 68   GLY N O   1 
ATOM   10840 N N   . THR N  1 69  ? 109.011 105.657 66.609  1.00 60.27  ? 69   THR N N   1 
ATOM   10841 C CA  . THR N  1 69  ? 108.590 104.338 66.094  1.00 58.94  ? 69   THR N CA  1 
ATOM   10842 C C   . THR N  1 69  ? 109.253 103.125 66.760  1.00 58.10  ? 69   THR N C   1 
ATOM   10843 O O   . THR N  1 69  ? 108.711 102.012 66.719  1.00 58.56  ? 69   THR N O   1 
ATOM   10844 C CB  . THR N  1 69  ? 108.896 104.239 64.570  1.00 58.43  ? 69   THR N CB  1 
ATOM   10845 O OG1 . THR N  1 69  ? 108.470 105.446 63.923  1.00 59.44  ? 69   THR N OG1 1 
ATOM   10846 C CG2 . THR N  1 69  ? 108.178 103.049 63.922  1.00 59.18  ? 69   THR N CG2 1 
ATOM   10847 N N   . ASP N  1 70  ? 110.404 103.345 67.391  1.00 57.10  ? 70   ASP N N   1 
ATOM   10848 C CA  . ASP N  1 70  ? 111.344 102.257 67.658  1.00 56.50  ? 70   ASP N CA  1 
ATOM   10849 C C   . ASP N  1 70  ? 111.678 102.106 69.155  1.00 56.68  ? 70   ASP N C   1 
ATOM   10850 O O   . ASP N  1 70  ? 112.469 102.881 69.702  1.00 55.55  ? 70   ASP N O   1 
ATOM   10851 C CB  . ASP N  1 70  ? 112.612 102.515 66.830  1.00 55.67  ? 70   ASP N CB  1 
ATOM   10852 C CG  . ASP N  1 70  ? 113.158 101.255 66.188  1.00 52.23  ? 70   ASP N CG  1 
ATOM   10853 O OD1 . ASP N  1 70  ? 112.991 100.160 66.767  1.00 49.98  ? 70   ASP N OD1 1 
ATOM   10854 O OD2 . ASP N  1 70  ? 113.770 101.358 65.102  1.00 48.62  ? 70   ASP N OD2 1 
ATOM   10855 N N   . PHE N  1 71  ? 111.084 101.093 69.798  1.00 56.64  ? 71   PHE N N   1 
ATOM   10856 C CA  . PHE N  1 71  ? 111.008 101.008 71.273  1.00 57.73  ? 71   PHE N CA  1 
ATOM   10857 C C   . PHE N  1 71  ? 111.621 99.753  71.919  1.00 58.20  ? 71   PHE N C   1 
ATOM   10858 O O   . PHE N  1 71  ? 111.724 98.689  71.275  1.00 56.84  ? 71   PHE N O   1 
ATOM   10859 C CB  . PHE N  1 71  ? 109.552 101.159 71.729  1.00 57.18  ? 71   PHE N CB  1 
ATOM   10860 C CG  . PHE N  1 71  ? 108.971 102.527 71.482  1.00 57.10  ? 71   PHE N CG  1 
ATOM   10861 C CD1 . PHE N  1 71  ? 108.598 102.928 70.202  1.00 55.19  ? 71   PHE N CD1 1 
ATOM   10862 C CD2 . PHE N  1 71  ? 108.781 103.410 72.537  1.00 57.83  ? 71   PHE N CD2 1 
ATOM   10863 C CE1 . PHE N  1 71  ? 108.063 104.191 69.976  1.00 55.42  ? 71   PHE N CE1 1 
ATOM   10864 C CE2 . PHE N  1 71  ? 108.231 104.668 72.324  1.00 57.72  ? 71   PHE N CE2 1 
ATOM   10865 C CZ  . PHE N  1 71  ? 107.882 105.064 71.040  1.00 57.08  ? 71   PHE N CZ  1 
ATOM   10866 N N   . THR N  1 72  ? 111.984 99.873  73.200  1.00 59.52  ? 72   THR N N   1 
ATOM   10867 C CA  . THR N  1 72  ? 112.806 98.859  73.864  1.00 59.28  ? 72   THR N CA  1 
ATOM   10868 C C   . THR N  1 72  ? 112.295 98.375  75.237  1.00 59.19  ? 72   THR N C   1 
ATOM   10869 O O   . THR N  1 72  ? 112.251 99.140  76.197  1.00 59.18  ? 72   THR N O   1 
ATOM   10870 C CB  . THR N  1 72  ? 114.291 99.350  73.950  1.00 59.73  ? 72   THR N CB  1 
ATOM   10871 O OG1 . THR N  1 72  ? 114.865 99.344  72.622  1.00 59.40  ? 72   THR N OG1 1 
ATOM   10872 C CG2 . THR N  1 72  ? 115.141 98.451  74.909  1.00 58.44  ? 72   THR N CG2 1 
ATOM   10873 N N   . LEU N  1 73  ? 111.881 97.109  75.305  1.00 59.81  ? 73   LEU N N   1 
ATOM   10874 C CA  . LEU N  1 73  ? 111.860 96.392  76.579  1.00 59.77  ? 73   LEU N CA  1 
ATOM   10875 C C   . LEU N  1 73  ? 112.991 95.382  76.575  1.00 60.64  ? 73   LEU N C   1 
ATOM   10876 O O   . LEU N  1 73  ? 113.139 94.572  75.661  1.00 60.61  ? 73   LEU N O   1 
ATOM   10877 C CB  . LEU N  1 73  ? 110.526 95.690  76.883  1.00 59.64  ? 73   LEU N CB  1 
ATOM   10878 C CG  . LEU N  1 73  ? 110.497 94.703  78.073  1.00 59.28  ? 73   LEU N CG  1 
ATOM   10879 C CD1 . LEU N  1 73  ? 110.791 95.381  79.436  1.00 58.72  ? 73   LEU N CD1 1 
ATOM   10880 C CD2 . LEU N  1 73  ? 109.156 93.982  78.122  1.00 58.99  ? 73   LEU N CD2 1 
ATOM   10881 N N   . THR N  1 74  ? 113.799 95.478  77.621  1.00 61.50  ? 74   THR N N   1 
ATOM   10882 C CA  . THR N  1 74  ? 114.824 94.518  77.943  1.00 61.13  ? 74   THR N CA  1 
ATOM   10883 C C   . THR N  1 74  ? 114.728 94.296  79.446  1.00 61.00  ? 74   THR N C   1 
ATOM   10884 O O   . THR N  1 74  ? 115.064 95.186  80.236  1.00 60.08  ? 74   THR N O   1 
ATOM   10885 C CB  . THR N  1 74  ? 116.224 95.065  77.588  1.00 61.54  ? 74   THR N CB  1 
ATOM   10886 O OG1 . THR N  1 74  ? 116.408 95.029  76.167  1.00 64.08  ? 74   THR N OG1 1 
ATOM   10887 C CG2 . THR N  1 74  ? 117.327 94.255  78.255  1.00 58.89  ? 74   THR N CG2 1 
ATOM   10888 N N   . ILE N  1 75  ? 114.221 93.128  79.835  1.00 60.84  ? 75   ILE N N   1 
ATOM   10889 C CA  . ILE N  1 75  ? 114.288 92.658  81.211  1.00 59.98  ? 75   ILE N CA  1 
ATOM   10890 C C   . ILE N  1 75  ? 115.773 92.413  81.478  1.00 60.34  ? 75   ILE N C   1 
ATOM   10891 O O   . ILE N  1 75  ? 116.290 91.364  81.093  1.00 60.37  ? 75   ILE N O   1 
ATOM   10892 C CB  . ILE N  1 75  ? 113.504 91.323  81.359  1.00 60.99  ? 75   ILE N CB  1 
ATOM   10893 C CG1 . ILE N  1 75  ? 112.186 91.369  80.531  1.00 60.25  ? 75   ILE N CG1 1 
ATOM   10894 C CG2 . ILE N  1 75  ? 113.301 90.966  82.841  1.00 60.94  ? 75   ILE N CG2 1 
ATOM   10895 C CD1 . ILE N  1 75  ? 111.355 90.071  80.632  1.00 58.27  ? 75   ILE N CD1 1 
ATOM   10896 N N   . SER N  1 76  ? 116.468 93.361  82.112  1.00 60.32  ? 76   SER N N   1 
ATOM   10897 C CA  . SER N  1 76  ? 117.950 93.325  82.165  1.00 60.30  ? 76   SER N CA  1 
ATOM   10898 C C   . SER N  1 76  ? 118.603 92.016  82.630  1.00 59.40  ? 76   SER N C   1 
ATOM   10899 O O   . SER N  1 76  ? 119.708 91.698  82.189  1.00 60.74  ? 76   SER N O   1 
ATOM   10900 C CB  . SER N  1 76  ? 118.530 94.501  82.976  1.00 61.44  ? 76   SER N CB  1 
ATOM   10901 O OG  . SER N  1 76  ? 119.958 94.509  82.919  1.00 62.68  ? 76   SER N OG  1 
ATOM   10902 N N   . SER N  1 77  ? 117.949 91.264  83.511  1.00 57.86  ? 77   SER N N   1 
ATOM   10903 C CA  . SER N  1 77  ? 118.628 90.138  84.149  1.00 56.23  ? 77   SER N CA  1 
ATOM   10904 C C   . SER N  1 77  ? 117.624 89.078  84.563  1.00 56.76  ? 77   SER N C   1 
ATOM   10905 O O   . SER N  1 77  ? 117.329 88.938  85.754  1.00 55.70  ? 77   SER N O   1 
ATOM   10906 C CB  . SER N  1 77  ? 119.418 90.643  85.365  1.00 55.24  ? 77   SER N CB  1 
ATOM   10907 O OG  .