data_2C0Q
# 
_entry.id   2C0Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2C0Q         
PDBE  EBI-25567    
WWPDB D_1290025567 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1C2B unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE'                          
PDB 1C2O unspecified 'ELECTROPHORUS ELECTRICUS ACETYLCHOLINESTERASE'                          
PDB 1J06 unspecified 'CRYSTAL STRUCTURE OF MOUSE ACETYLCHOLINESTERASE IN THE APOFORM'         
PDB 1J07 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-DECIDIUM COMPLEX'   
PDB 1KU6 unspecified 'FASCICULIN 2-MOUSE ACETYLCHOLINESTERASE COMPLEX'                        
PDB 1MAA unspecified 'MOUSE ACETYLCHOLINESTERASE CATALYTIC DOMAIN, GLYCOSYLATEDPROTEIN'       
PDB 1MAH unspecified 'FASCICULIN2 - MOUSE ACETYLCHOLINESTERASE COMPLEX'                       
PDB 1N5M unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-GALLAMINE COMPLEX'  
PDB 1N5R unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-PROPIDIUM COMPLEX'  
PDB 1Q83 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6SYN COMPLEX'  
PDB 1Q84 unspecified 'CRYSTAL STRUCTURE OF THE MOUSE ACETYLCHOLINESTERASE-TZ2PA6ANTI COMPLEX' 
PDB 2C0P unspecified 'AGED FORM OF MOUSE ACETYLCHOLINESTERASE INHIBITED BY TABUN'             
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2C0Q 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-07 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ekstrom, F.'     1 
'Akfur, C.'       2 
'Tunemalm, A.-K.' 3 
'Lundberg, S.'    4 
# 
_citation.id                        primary 
_citation.title                     
;Structural Changes of Phenylalanine 338 and Histidine 447 Revealed by the Crystal Structures of Tabun-Inhibited Murine Acetylcholinesterase.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            45 
_citation.page_first                74 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16388582 
_citation.pdbx_database_id_DOI      10.1021/BI051286T 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ekstrom, F.'     1 ? 
primary 'Akfur, C.'       2 ? 
primary 'Tunemalm, A.-K.' 3 ? 
primary 'Lundberg, S.'    4 ? 
# 
_cell.entry_id           2C0Q 
_cell.length_a           79.620 
_cell.length_b           112.940 
_cell.length_c           226.160 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2C0Q 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE                  60233.984 2   3.1.1.7 ? 'CATALYTIC DOMAIN, RESIDUES 32-574' 
'TABUN REACTION PRODUCT COVALENTLY ATTACHED TO SER203' 
2 non-polymer syn 'R-ETHYL N,N-DIMETHYLPHOSPHONAMIDATE' 137.117   2   ?       ? ?                                   ? 
3 non-polymer syn 'HEXAETHYLENE GLYCOL'                 282.331   1   ?       ? ?                                   ? 
4 water       nat water                                 18.015    231 ?       ? ?                                   ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATATEAP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
1 544 ALA n 
1 545 THR n 
1 546 GLU n 
1 547 ALA n 
1 548 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               MOUSE 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'MUS MUSCULUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PCDNA3.1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ACES_MOUSE 1 ? ? P21836 ? 
2 PDB 2C0Q       1 ? ? 2C0Q   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2C0Q A 1   ? 543 ? P21836 32  ? 574 ? 1   543 
2 2 2C0Q A 544 ? 548 ? 2C0Q   544 ? 548 ? 544 548 
3 1 2C0Q B 1   ? 543 ? P21836 32  ? 574 ? 1   543 
4 2 2C0Q B 544 ? 548 ? 2C0Q   544 ? 548 ? 544 548 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                               ?                            'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                              ?                            'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                            ?                            'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                       ?                            'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                              ?                            'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                             ?                            'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                       ?                            'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                               ?                            'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                             ?                            'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                 ?                            'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                            ?                            'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                               ?                            'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                ?                            'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                            ?                            'C5 H11 N O2 S'  149.211 
NTJ non-polymer         . 'R-ETHYL N,N-DIMETHYLPHOSPHONAMIDATE' ?                            'C4 H12 N O2 P'  137.117 
P6G non-polymer         . 'HEXAETHYLENE GLYCOL'                 'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     282.331 
PHE 'L-peptide linking' y PHENYLALANINE                         ?                            'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                               ?                            'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                ?                            'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                             ?                            'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                            ?                            'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                              ?                            'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                ?                            'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2C0Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '27-31% (V/V) PEG750MME, 0.1M HEPES PH 7.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-03-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.06276 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I711' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I711 
_diffrn_source.pdbx_wavelength             1.06276 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2C0Q 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             29.200 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   71021 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.09000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.4000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.200 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.59000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.300 
_reflns_shell.pdbx_redundancy        6.20 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2C0Q 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     69540 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.17 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.000 
_refine.ls_number_reflns_R_free                  1422 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.915 
_refine.B_iso_mean                               47.10 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 1J06' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.245 
_refine.pdbx_overall_ESU_R_Free                  0.218 
_refine.overall_SU_ML                            0.158 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             7.272 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8336 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             231 
_refine_hist.number_atoms_total               8602 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        29.17 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.013  0.022  ? 8622  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.464  1.959  ? 11773 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.612  5.000  ? 1064  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.984 22.861 ? 395   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.311 15.000 ? 1255  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       20.474 15.000 ? 72    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.104  0.200  ? 1266  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 6794  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.217  0.200  ? 4229  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.313  0.200  ? 5950  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.137  0.200  ? 385   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.185  0.200  ? 42    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.156  0.200  ? 10    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.803  1.500  ? 5430  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.378  2.000  ? 8588  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.844  3.000  ? 3651  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.961  4.500  ? 3185  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.56 
_refine_ls_shell.number_reflns_R_work             5061 
_refine_ls_shell.R_factor_R_work                  0.3110 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3560 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2C0Q 
_struct.title                     'non-aged form of mouse acetylcholinesterase inhibited by tabun' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2C0Q 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, SERINE ESTERASE, ACETYLCHOLINESTERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? LEU A 214 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 SER A 240 ? VAL A 255 ? SER A 240 VAL A 255 1 ? 16 
HELX_P HELX_P12 12 ASN A 265 ? THR A 275 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? VAL A 288 ? TRP A 286 VAL A 288 5 ? 3  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 343 ? GLY A 335 VAL A 343 1 ? 9  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASP A 460 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 24 ASP A 460 ? ASN A 464 ? ASP A 460 ASN A 464 5 ? 5  
HELX_P HELX_P25 25 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P26 26 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P27 27 ARG A 534 ? LEU A 539 ? ARG A 534 LEU A 539 1 ? 6  
HELX_P HELX_P28 28 ASP B 5   ? GLN B 7   ? ASP B 5   GLN B 7   5 ? 3  
HELX_P HELX_P29 29 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P30 30 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P31 31 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P32 32 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P33 33 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P34 34 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P35 35 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P36 36 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P37 37 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P38 38 SER B 240 ? VAL B 255 ? SER B 240 VAL B 255 1 ? 16 
HELX_P HELX_P39 39 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P40 40 PRO B 277 ? HIS B 284 ? PRO B 277 HIS B 284 1 ? 8  
HELX_P HELX_P41 41 GLU B 285 ? VAL B 288 ? GLU B 285 VAL B 288 5 ? 4  
HELX_P HELX_P42 42 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P43 43 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P44 44 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P45 45 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P46 46 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P47 47 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P48 48 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P49 49 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P50 50 GLY B 456 ? ASP B 460 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P51 51 ASP B 460 ? ASN B 464 ? ASP B 460 ASN B 464 5 ? 5  
HELX_P HELX_P52 52 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P53 53 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P54 54 ARG B 534 ? SER B 541 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96   1_555 ? ? ? ? ? ? ? 2.088 ? ? 
disulf2 disulf ?    ? A CYS 257 SG ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272  1_555 ? ? ? ? ? ? ? 2.140 ? ? 
disulf3 disulf ?    ? A CYS 409 SG ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529  1_555 ? ? ? ? ? ? ? 2.071 ? ? 
disulf4 disulf ?    ? B CYS 69  SG ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96   1_555 ? ? ? ? ? ? ? 2.049 ? ? 
disulf5 disulf ?    ? B CYS 257 SG ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272  1_555 ? ? ? ? ? ? ? 2.111 ? ? 
disulf6 disulf ?    ? B CYS 409 SG ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529  1_555 ? ? ? ? ? ? ? 2.062 ? ? 
covale1 covale one  ? A SER 203 OG ? ? ? 1_555 C NTJ .   P1 ? ? A SER 203 A NTJ 1543 1_555 ? ? ? ? ? ? ? 1.612 ? ? 
covale2 covale none ? B SER 203 OG ? ? ? 1_555 D NTJ .   N1 ? ? B SER 203 B NTJ 1544 1_555 ? ? ? ? ? ? ? 2.040 ? ? 
covale3 covale one  ? B SER 203 OG ? ? ? 1_555 D NTJ .   P1 ? ? B SER 203 B NTJ 1544 1_555 ? ? ? ? ? ? ? 1.591 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 -1.05 
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 7.14  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
BA ? 3  ? 
BB ? 11 ? 
BC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
BA 1  2  ? anti-parallel 
BA 2  3  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? anti-parallel 
BB 3  4  ? anti-parallel 
BB 4  5  ? parallel      
BB 5  6  ? parallel      
BB 6  7  ? parallel      
BB 7  8  ? parallel      
BB 8  9  ? parallel      
BB 9  10 ? parallel      
BB 10 11 ? anti-parallel 
BC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
AA 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
AA 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
AB 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
AB 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
AB 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
AB 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
AB 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
AB 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
AB 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
AB 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
AB 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
AB 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
AB 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
AC 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
AC 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
BA 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
BA 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
BA 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
BB 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
BB 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
BB 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
BB 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
BB 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
BB 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
BB 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
BB 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
BB 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
BB 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
BB 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
BC 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
BC 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N VAL A 12  ? N VAL A 12  O GLY A 15  ? O GLY A 15  
AA 2  3  N ARG A 18  ? N ARG A 18  O LEU A 60  ? O LEU A 60  
AB 1  2  N ALA A 24  ? N ALA A 24  O GLY A 27  ? O GLY A 27  
AB 2  3  N ILE A 35  ? N ILE A 35  O LEU A 99  ? O LEU A 99  
AB 3  4  N TRP A 102 ? N TRP A 102 O LEU A 146 ? O LEU A 146 
AB 4  5  N VAL A 145 ? N VAL A 145 O PRO A 113 ? O PRO A 113 
AB 5  6  O THR A 112 ? O THR A 112 N ASP A 193 ? N ASP A 193 
AB 6  7  N LEU A 199 ? N LEU A 199 O ARG A 224 ? O ARG A 224 
AB 7  8  N ALA A 225 ? N ALA A 225 O GLN A 325 ? O GLN A 325 
AB 8  9  N VAL A 326 ? N VAL A 326 O ARG A 424 ? O ARG A 424 
AB 9  10 N ILE A 429 ? N ILE A 429 O VAL A 511 ? O VAL A 511 
AB 10 11 N SER A 512 ? N SER A 512 O GLU A 519 ? O GLU A 519 
AC 1  2  O VAL A 68  ? O VAL A 68  N SER A 93  ? N SER A 93  
BA 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
BA 2  3  N ARG B 18  ? N ARG B 18  O LEU B 60  ? O LEU B 60  
BB 1  2  N ALA B 24  ? N ALA B 24  O GLY B 27  ? O GLY B 27  
BB 2  3  N ILE B 35  ? N ILE B 35  O LEU B 99  ? O LEU B 99  
BB 3  4  N TRP B 102 ? N TRP B 102 O LEU B 146 ? O LEU B 146 
BB 4  5  N VAL B 145 ? N VAL B 145 O PRO B 113 ? O PRO B 113 
BB 5  6  O THR B 112 ? O THR B 112 N ASP B 193 ? N ASP B 193 
BB 6  7  N LEU B 199 ? N LEU B 199 O ARG B 224 ? O ARG B 224 
BB 7  8  N ALA B 225 ? N ALA B 225 O GLN B 325 ? O GLN B 325 
BB 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
BB 9  10 N ILE B 429 ? N ILE B 429 O VAL B 511 ? O VAL B 511 
BB 10 11 N SER B 512 ? N SER B 512 O GLU B 519 ? O GLU B 519 
BC 1  2  O VAL B 68  ? O VAL B 68  N SER B 93  ? N SER B 93  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE NTJ A1543' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE NTJ B1544' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE P6G B1545' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9  GLY A 121 ? GLY A 121  . ? 1_555 ? 
2  AC1 9  GLY A 122 ? GLY A 122  . ? 1_555 ? 
3  AC1 9  SER A 203 ? SER A 203  . ? 1_555 ? 
4  AC1 9  ALA A 204 ? ALA A 204  . ? 1_555 ? 
5  AC1 9  TRP A 236 ? TRP A 236  . ? 1_555 ? 
6  AC1 9  PHE A 295 ? PHE A 295  . ? 1_555 ? 
7  AC1 9  PHE A 297 ? PHE A 297  . ? 1_555 ? 
8  AC1 9  PHE A 338 ? PHE A 338  . ? 1_555 ? 
9  AC1 9  HOH F .   ? HOH A 2134 . ? 1_555 ? 
10 AC2 7  GLY B 121 ? GLY B 121  . ? 1_555 ? 
11 AC2 7  GLY B 122 ? GLY B 122  . ? 1_555 ? 
12 AC2 7  SER B 203 ? SER B 203  . ? 1_555 ? 
13 AC2 7  ALA B 204 ? ALA B 204  . ? 1_555 ? 
14 AC2 7  PHE B 295 ? PHE B 295  . ? 1_555 ? 
15 AC2 7  PHE B 297 ? PHE B 297  . ? 1_555 ? 
16 AC2 7  PHE B 338 ? PHE B 338  . ? 1_555 ? 
17 AC3 10 LEU A 380 ? LEU A 380  . ? 1_555 ? 
18 AC3 10 HIS A 381 ? HIS A 381  . ? 1_555 ? 
19 AC3 10 GLN A 527 ? GLN A 527  . ? 1_555 ? 
20 AC3 10 PHE A 535 ? PHE A 535  . ? 1_555 ? 
21 AC3 10 ALA B 377 ? ALA B 377  . ? 1_555 ? 
22 AC3 10 LEU B 380 ? LEU B 380  . ? 1_555 ? 
23 AC3 10 HIS B 381 ? HIS B 381  . ? 1_555 ? 
24 AC3 10 PHE B 531 ? PHE B 531  . ? 1_555 ? 
25 AC3 10 PHE B 535 ? PHE B 535  . ? 1_555 ? 
26 AC3 10 HOH G .   ? HOH B 2097 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2C0Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2C0Q 
_atom_sites.fract_transf_matrix[1][1]   0.012560 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008854 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004422 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? 32.571  15.012  55.652  1.00 68.44 ? 1    GLU A N   1 
ATOM   2    C CA  . GLU A 1 1   ? 31.084  15.094  55.558  1.00 68.47 ? 1    GLU A CA  1 
ATOM   3    C C   . GLU A 1 1   ? 30.428  15.272  56.934  1.00 68.46 ? 1    GLU A C   1 
ATOM   4    O O   . GLU A 1 1   ? 31.122  15.418  57.940  1.00 68.69 ? 1    GLU A O   1 
ATOM   5    C CB  . GLU A 1 1   ? 30.531  13.854  54.832  1.00 68.58 ? 1    GLU A CB  1 
ATOM   6    C CG  . GLU A 1 1   ? 30.434  12.575  55.661  1.00 67.77 ? 1    GLU A CG  1 
ATOM   7    C CD  . GLU A 1 1   ? 30.183  11.339  54.810  1.00 68.04 ? 1    GLU A CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? 29.092  10.717  54.932  1.00 67.55 ? 1    GLU A OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? 31.086  10.994  54.020  1.00 66.71 ? 1    GLU A OE2 1 
ATOM   10   N N   . GLY A 1 2   ? 29.094  15.261  56.972  1.00 68.23 ? 2    GLY A N   1 
ATOM   11   C CA  . GLY A 1 2   ? 28.371  15.315  58.237  1.00 67.36 ? 2    GLY A CA  1 
ATOM   12   C C   . GLY A 1 2   ? 27.231  16.285  58.154  1.00 67.03 ? 2    GLY A C   1 
ATOM   13   O O   . GLY A 1 2   ? 26.104  15.965  58.541  1.00 66.64 ? 2    GLY A O   1 
ATOM   14   N N   . ARG A 1 3   ? 27.529  17.466  57.617  1.00 67.15 ? 3    ARG A N   1 
ATOM   15   C CA  . ARG A 1 3   ? 26.550  18.559  57.527  1.00 67.04 ? 3    ARG A CA  1 
ATOM   16   C C   . ARG A 1 3   ? 25.952  18.796  56.131  1.00 66.40 ? 3    ARG A C   1 
ATOM   17   O O   . ARG A 1 3   ? 25.331  19.830  55.907  1.00 66.65 ? 3    ARG A O   1 
ATOM   18   C CB  . ARG A 1 3   ? 27.123  19.872  58.095  1.00 67.27 ? 3    ARG A CB  1 
ATOM   19   C CG  . ARG A 1 3   ? 26.399  20.367  59.356  1.00 68.32 ? 3    ARG A CG  1 
ATOM   20   C CD  . ARG A 1 3   ? 27.216  20.157  60.674  1.00 70.29 ? 3    ARG A CD  1 
ATOM   21   N NE  . ARG A 1 3   ? 26.438  20.314  61.930  1.00 69.96 ? 3    ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 3   ? 25.132  20.027  62.103  1.00 70.65 ? 3    ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 3   ? 24.372  19.537  61.115  1.00 69.46 ? 3    ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 3   ? 24.574  20.215  63.296  1.00 69.22 ? 3    ARG A NH2 1 
ATOM   25   N N   . GLU A 1 4   ? 26.101  17.841  55.216  1.00 65.37 ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 4   ? 25.680  18.052  53.830  1.00 64.88 ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 4   ? 24.721  16.990  53.300  1.00 63.40 ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 4   ? 24.465  15.986  53.946  1.00 63.23 ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 4   ? 26.898  18.207  52.910  1.00 64.64 ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 4   ? 27.711  16.942  52.719  1.00 66.16 ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 4   ? 29.100  17.212  52.144  1.00 67.22 ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 4   ? 30.090  16.667  52.693  1.00 70.24 ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 4   ? 29.205  17.962  51.146  1.00 70.57 ? 4    GLU A OE2 1 
ATOM   34   N N   . ASP A 1 5   ? 24.199  17.228  52.107  1.00 62.12 ? 5    ASP A N   1 
ATOM   35   C CA  . ASP A 1 5   ? 23.136  16.412  51.550  1.00 60.72 ? 5    ASP A CA  1 
ATOM   36   C C   . ASP A 1 5   ? 23.591  14.959  51.387  1.00 60.24 ? 5    ASP A C   1 
ATOM   37   O O   . ASP A 1 5   ? 24.498  14.681  50.612  1.00 60.54 ? 5    ASP A O   1 
ATOM   38   C CB  . ASP A 1 5   ? 22.710  17.015  50.214  1.00 60.16 ? 5    ASP A CB  1 
ATOM   39   C CG  . ASP A 1 5   ? 21.425  16.426  49.680  1.00 59.41 ? 5    ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 5   ? 21.062  15.282  50.018  1.00 58.15 ? 5    ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 5   ? 20.775  17.126  48.882  1.00 58.65 ? 5    ASP A OD2 1 
ATOM   42   N N   . PRO A 1 6   ? 22.983  14.027  52.145  1.00 59.61 ? 6    PRO A N   1 
ATOM   43   C CA  . PRO A 1 6   ? 23.226  12.577  51.983  1.00 58.47 ? 6    PRO A CA  1 
ATOM   44   C C   . PRO A 1 6   ? 23.023  11.975  50.581  1.00 57.46 ? 6    PRO A C   1 
ATOM   45   O O   . PRO A 1 6   ? 23.651  10.965  50.282  1.00 57.46 ? 6    PRO A O   1 
ATOM   46   C CB  . PRO A 1 6   ? 22.235  11.932  52.964  1.00 58.59 ? 6    PRO A CB  1 
ATOM   47   C CG  . PRO A 1 6   ? 21.295  13.015  53.380  1.00 59.16 ? 6    PRO A CG  1 
ATOM   48   C CD  . PRO A 1 6   ? 22.052  14.300  53.257  1.00 59.61 ? 6    PRO A CD  1 
ATOM   49   N N   . GLN A 1 7   ? 22.169  12.544  49.731  1.00 56.33 ? 7    GLN A N   1 
ATOM   50   C CA  . GLN A 1 7   ? 21.995  11.967  48.384  1.00 55.64 ? 7    GLN A CA  1 
ATOM   51   C C   . GLN A 1 7   ? 23.120  12.252  47.398  1.00 54.02 ? 7    GLN A C   1 
ATOM   52   O O   . GLN A 1 7   ? 23.139  11.698  46.301  1.00 54.67 ? 7    GLN A O   1 
ATOM   53   C CB  . GLN A 1 7   ? 20.653  12.341  47.752  1.00 56.46 ? 7    GLN A CB  1 
ATOM   54   C CG  . GLN A 1 7   ? 19.489  11.410  48.150  1.00 60.19 ? 7    GLN A CG  1 
ATOM   55   C CD  . GLN A 1 7   ? 19.488  10.057  47.431  1.00 63.59 ? 7    GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 7   ? 19.758  9.984   46.227  1.00 64.65 ? 7    GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 7   ? 19.139  8.985   48.164  1.00 64.32 ? 7    GLN A NE2 1 
ATOM   58   N N   . LEU A 1 8   ? 24.059  13.099  47.795  1.00 52.10 ? 8    LEU A N   1 
ATOM   59   C CA  . LEU A 1 8   ? 25.043  13.654  46.879  1.00 50.05 ? 8    LEU A CA  1 
ATOM   60   C C   . LEU A 1 8   ? 26.448  13.105  47.086  1.00 49.61 ? 8    LEU A C   1 
ATOM   61   O O   . LEU A 1 8   ? 27.376  13.505  46.394  1.00 49.41 ? 8    LEU A O   1 
ATOM   62   C CB  . LEU A 1 8   ? 25.046  15.186  46.975  1.00 49.28 ? 8    LEU A CB  1 
ATOM   63   C CG  . LEU A 1 8   ? 23.750  15.902  46.557  1.00 47.99 ? 8    LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 8   ? 23.908  17.409  46.613  1.00 44.60 ? 8    LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 8   ? 23.227  15.451  45.180  1.00 45.28 ? 8    LEU A CD2 1 
ATOM   66   N N   . LEU A 1 9   ? 26.609  12.196  48.043  1.00 48.72 ? 9    LEU A N   1 
ATOM   67   C CA  . LEU A 1 9   ? 27.903  11.566  48.247  1.00 47.76 ? 9    LEU A CA  1 
ATOM   68   C C   . LEU A 1 9   ? 27.855  10.145  47.712  1.00 46.84 ? 9    LEU A C   1 
ATOM   69   O O   . LEU A 1 9   ? 27.028  9.332   48.138  1.00 46.32 ? 9    LEU A O   1 
ATOM   70   C CB  . LEU A 1 9   ? 28.327  11.595  49.721  1.00 47.88 ? 9    LEU A CB  1 
ATOM   71   C CG  . LEU A 1 9   ? 28.223  12.962  50.425  1.00 48.91 ? 9    LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 9   ? 28.374  12.868  51.964  1.00 48.83 ? 9    LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 9   ? 29.195  13.949  49.863  1.00 49.44 ? 9    LEU A CD2 1 
ATOM   74   N N   . VAL A 1 10  ? 28.742  9.876   46.754  1.00 45.60 ? 10   VAL A N   1 
ATOM   75   C CA  . VAL A 1 10  ? 28.868  8.567   46.125  1.00 44.08 ? 10   VAL A CA  1 
ATOM   76   C C   . VAL A 1 10  ? 30.355  8.169   46.097  1.00 43.40 ? 10   VAL A C   1 
ATOM   77   O O   . VAL A 1 10  ? 31.247  9.036   46.028  1.00 42.76 ? 10   VAL A O   1 
ATOM   78   C CB  . VAL A 1 10  ? 28.288  8.604   44.701  1.00 43.74 ? 10   VAL A CB  1 
ATOM   79   C CG1 . VAL A 1 10  ? 28.485  7.297   43.994  1.00 44.74 ? 10   VAL A CG1 1 
ATOM   80   C CG2 . VAL A 1 10  ? 26.819  8.914   44.754  1.00 43.85 ? 10   VAL A CG2 1 
ATOM   81   N N   . ARG A 1 11  ? 30.610  6.863   46.186  1.00 42.31 ? 11   ARG A N   1 
ATOM   82   C CA  . ARG A 1 11  ? 31.949  6.325   46.010  1.00 41.07 ? 11   ARG A CA  1 
ATOM   83   C C   . ARG A 1 11  ? 31.978  5.589   44.694  1.00 40.97 ? 11   ARG A C   1 
ATOM   84   O O   . ARG A 1 11  ? 31.069  4.813   44.404  1.00 40.92 ? 11   ARG A O   1 
ATOM   85   C CB  . ARG A 1 11  ? 32.347  5.358   47.139  1.00 41.24 ? 11   ARG A CB  1 
ATOM   86   C CG  . ARG A 1 11  ? 33.744  4.728   46.910  1.00 40.62 ? 11   ARG A CG  1 
ATOM   87   C CD  . ARG A 1 11  ? 34.279  3.898   48.064  1.00 39.29 ? 11   ARG A CD  1 
ATOM   88   N NE  . ARG A 1 11  ? 34.632  4.726   49.202  1.00 37.59 ? 11   ARG A NE  1 
ATOM   89   C CZ  . ARG A 1 11  ? 35.788  5.347   49.326  1.00 40.27 ? 11   ARG A CZ  1 
ATOM   90   N NH1 . ARG A 1 11  ? 36.007  6.105   50.398  1.00 40.22 ? 11   ARG A NH1 1 
ATOM   91   N NH2 . ARG A 1 11  ? 36.715  5.224   48.366  1.00 40.59 ? 11   ARG A NH2 1 
ATOM   92   N N   . VAL A 1 12  ? 33.006  5.866   43.899  1.00 40.47 ? 12   VAL A N   1 
ATOM   93   C CA  . VAL A 1 12  ? 33.325  5.068   42.718  1.00 40.40 ? 12   VAL A CA  1 
ATOM   94   C C   . VAL A 1 12  ? 34.713  4.448   42.919  1.00 41.08 ? 12   VAL A C   1 
ATOM   95   O O   . VAL A 1 12  ? 35.407  4.767   43.900  1.00 40.54 ? 12   VAL A O   1 
ATOM   96   C CB  . VAL A 1 12  ? 33.251  5.878   41.393  1.00 40.13 ? 12   VAL A CB  1 
ATOM   97   C CG1 . VAL A 1 12  ? 31.809  6.261   41.084  1.00 40.19 ? 12   VAL A CG1 1 
ATOM   98   C CG2 . VAL A 1 12  ? 34.159  7.112   41.438  1.00 38.60 ? 12   VAL A CG2 1 
ATOM   99   N N   . ARG A 1 13  ? 35.101  3.576   41.986  1.00 41.61 ? 13   ARG A N   1 
ATOM   100  C CA  . ARG A 1 13  ? 36.333  2.793   42.056  1.00 42.24 ? 13   ARG A CA  1 
ATOM   101  C C   . ARG A 1 13  ? 37.572  3.626   42.352  1.00 42.59 ? 13   ARG A C   1 
ATOM   102  O O   . ARG A 1 13  ? 38.491  3.127   42.952  1.00 43.06 ? 13   ARG A O   1 
ATOM   103  C CB  . ARG A 1 13  ? 36.491  1.982   40.776  1.00 42.71 ? 13   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 13  ? 37.832  1.256   40.541  1.00 45.25 ? 13   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 13  ? 38.179  0.153   41.545  1.00 45.94 ? 13   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 13  ? 39.262  0.668   42.377  1.00 49.19 ? 13   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 13  ? 40.472  0.133   42.504  1.00 48.55 ? 13   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 13  ? 40.798  -1.011  41.909  1.00 47.02 ? 13   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 13  ? 41.347  0.740   43.284  1.00 49.57 ? 13   ARG A NH2 1 
ATOM   110  N N   . GLY A 1 14  ? 37.567  4.906   41.990  1.00 42.83 ? 14   GLY A N   1 
ATOM   111  C CA  . GLY A 1 14  ? 38.716  5.769   42.193  1.00 42.42 ? 14   GLY A CA  1 
ATOM   112  C C   . GLY A 1 14  ? 38.623  6.679   43.400  1.00 43.00 ? 14   GLY A C   1 
ATOM   113  O O   . GLY A 1 14  ? 39.611  7.316   43.773  1.00 43.22 ? 14   GLY A O   1 
ATOM   114  N N   . GLY A 1 15  ? 37.446  6.774   44.018  1.00 43.15 ? 15   GLY A N   1 
ATOM   115  C CA  . GLY A 1 15  ? 37.309  7.614   45.209  1.00 42.83 ? 15   GLY A CA  1 
ATOM   116  C C   . GLY A 1 15  ? 35.923  8.150   45.491  1.00 43.30 ? 15   GLY A C   1 
ATOM   117  O O   . GLY A 1 15  ? 34.916  7.650   44.962  1.00 43.10 ? 15   GLY A O   1 
ATOM   118  N N   . GLN A 1 16  ? 35.883  9.178   46.338  1.00 43.56 ? 16   GLN A N   1 
ATOM   119  C CA  . GLN A 1 16  ? 34.638  9.793   46.789  1.00 43.96 ? 16   GLN A CA  1 
ATOM   120  C C   . GLN A 1 16  ? 34.259  10.975  45.917  1.00 43.62 ? 16   GLN A C   1 
ATOM   121  O O   . GLN A 1 16  ? 35.143  11.763  45.537  1.00 44.00 ? 16   GLN A O   1 
ATOM   122  C CB  . GLN A 1 16  ? 34.763  10.275  48.238  1.00 44.48 ? 16   GLN A CB  1 
ATOM   123  C CG  . GLN A 1 16  ? 35.126  9.212   49.256  1.00 47.71 ? 16   GLN A CG  1 
ATOM   124  C CD  . GLN A 1 16  ? 34.143  9.182   50.415  1.00 53.04 ? 16   GLN A CD  1 
ATOM   125  O OE1 . GLN A 1 16  ? 34.400  9.761   51.477  1.00 53.62 ? 16   GLN A OE1 1 
ATOM   126  N NE2 . GLN A 1 16  ? 32.985  8.526   50.206  1.00 54.59 ? 16   GLN A NE2 1 
ATOM   127  N N   . LEU A 1 17  ? 32.957  11.125  45.619  1.00 42.85 ? 17   LEU A N   1 
ATOM   128  C CA  . LEU A 1 17  ? 32.470  12.285  44.852  1.00 42.17 ? 17   LEU A CA  1 
ATOM   129  C C   . LEU A 1 17  ? 31.337  12.996  45.559  1.00 42.18 ? 17   LEU A C   1 
ATOM   130  O O   . LEU A 1 17  ? 30.506  12.371  46.203  1.00 42.91 ? 17   LEU A O   1 
ATOM   131  C CB  . LEU A 1 17  ? 31.973  11.868  43.472  1.00 42.18 ? 17   LEU A CB  1 
ATOM   132  C CG  . LEU A 1 17  ? 32.803  10.943  42.605  1.00 41.90 ? 17   LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 17  ? 31.906  10.217  41.642  1.00 39.11 ? 17   LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 17  ? 33.861  11.767  41.887  1.00 43.58 ? 17   LEU A CD2 1 
ATOM   135  N N   . ARG A 1 18  ? 31.296  14.312  45.421  1.00 42.18 ? 18   ARG A N   1 
ATOM   136  C CA  . ARG A 1 18  ? 30.178  15.108  45.891  1.00 41.71 ? 18   ARG A CA  1 
ATOM   137  C C   . ARG A 1 18  ? 29.521  15.646  44.629  1.00 41.08 ? 18   ARG A C   1 
ATOM   138  O O   . ARG A 1 18  ? 30.164  16.326  43.828  1.00 41.05 ? 18   ARG A O   1 
ATOM   139  C CB  . ARG A 1 18  ? 30.681  16.260  46.759  1.00 41.49 ? 18   ARG A CB  1 
ATOM   140  C CG  . ARG A 1 18  ? 29.675  16.831  47.779  1.00 42.53 ? 18   ARG A CG  1 
ATOM   141  C CD  . ARG A 1 18  ? 30.057  18.262  48.216  1.00 43.30 ? 18   ARG A CD  1 
ATOM   142  N NE  . ARG A 1 18  ? 31.503  18.516  48.121  1.00 46.49 ? 18   ARG A NE  1 
ATOM   143  C CZ  . ARG A 1 18  ? 32.406  18.219  49.063  1.00 47.07 ? 18   ARG A CZ  1 
ATOM   144  N NH1 . ARG A 1 18  ? 32.057  17.653  50.218  1.00 45.07 ? 18   ARG A NH1 1 
ATOM   145  N NH2 . ARG A 1 18  ? 33.686  18.481  48.831  1.00 49.52 ? 18   ARG A NH2 1 
ATOM   146  N N   . GLY A 1 19  ? 28.256  15.311  44.435  1.00 40.45 ? 19   GLY A N   1 
ATOM   147  C CA  . GLY A 1 19  ? 27.495  15.809  43.314  1.00 40.12 ? 19   GLY A CA  1 
ATOM   148  C C   . GLY A 1 19  ? 26.757  17.063  43.703  1.00 40.41 ? 19   GLY A C   1 
ATOM   149  O O   . GLY A 1 19  ? 26.985  17.616  44.780  1.00 40.73 ? 19   GLY A O   1 
ATOM   150  N N   . ILE A 1 20  ? 25.880  17.516  42.819  1.00 40.56 ? 20   ILE A N   1 
ATOM   151  C CA  . ILE A 1 20  ? 25.074  18.699  43.067  1.00 41.32 ? 20   ILE A CA  1 
ATOM   152  C C   . ILE A 1 20  ? 23.593  18.378  42.806  1.00 42.11 ? 20   ILE A C   1 
ATOM   153  O O   . ILE A 1 20  ? 23.268  17.563  41.925  1.00 42.03 ? 20   ILE A O   1 
ATOM   154  C CB  . ILE A 1 20  ? 25.574  19.897  42.224  1.00 41.36 ? 20   ILE A CB  1 
ATOM   155  C CG1 . ILE A 1 20  ? 24.866  21.197  42.629  1.00 42.46 ? 20   ILE A CG1 1 
ATOM   156  C CG2 . ILE A 1 20  ? 25.447  19.603  40.713  1.00 40.56 ? 20   ILE A CG2 1 
ATOM   157  C CD1 . ILE A 1 20  ? 25.722  22.448  42.496  1.00 44.27 ? 20   ILE A CD1 1 
ATOM   158  N N   . ARG A 1 21  ? 22.713  18.985  43.607  1.00 43.09 ? 21   ARG A N   1 
ATOM   159  C CA  . ARG A 1 21  ? 21.268  18.876  43.431  1.00 44.13 ? 21   ARG A CA  1 
ATOM   160  C C   . ARG A 1 21  ? 20.871  19.993  42.474  1.00 44.75 ? 21   ARG A C   1 
ATOM   161  O O   . ARG A 1 21  ? 21.234  21.163  42.672  1.00 45.04 ? 21   ARG A O   1 
ATOM   162  C CB  . ARG A 1 21  ? 20.594  19.014  44.788  1.00 44.22 ? 21   ARG A CB  1 
ATOM   163  C CG  . ARG A 1 21  ? 19.088  18.819  44.831  1.00 46.87 ? 21   ARG A CG  1 
ATOM   164  C CD  . ARG A 1 21  ? 18.482  19.517  46.070  1.00 49.55 ? 21   ARG A CD  1 
ATOM   165  N NE  . ARG A 1 21  ? 17.123  19.946  45.748  1.00 55.00 ? 21   ARG A NE  1 
ATOM   166  C CZ  . ARG A 1 21  ? 16.031  19.710  46.479  1.00 56.94 ? 21   ARG A CZ  1 
ATOM   167  N NH1 . ARG A 1 21  ? 16.110  19.073  47.648  1.00 59.59 ? 21   ARG A NH1 1 
ATOM   168  N NH2 . ARG A 1 21  ? 14.851  20.146  46.051  1.00 55.47 ? 21   ARG A NH2 1 
ATOM   169  N N   . LEU A 1 22  ? 20.174  19.638  41.406  1.00 45.35 ? 22   LEU A N   1 
ATOM   170  C CA  . LEU A 1 22  ? 19.856  20.612  40.368  1.00 46.24 ? 22   LEU A CA  1 
ATOM   171  C C   . LEU A 1 22  ? 18.349  20.725  40.173  1.00 47.51 ? 22   LEU A C   1 
ATOM   172  O O   . LEU A 1 22  ? 17.618  19.738  40.372  1.00 47.63 ? 22   LEU A O   1 
ATOM   173  C CB  . LEU A 1 22  ? 20.558  20.252  39.040  1.00 45.68 ? 22   LEU A CB  1 
ATOM   174  C CG  . LEU A 1 22  ? 22.090  20.366  38.859  1.00 44.24 ? 22   LEU A CG  1 
ATOM   175  C CD1 . LEU A 1 22  ? 22.461  20.027  37.448  1.00 43.60 ? 22   LEU A CD1 1 
ATOM   176  C CD2 . LEU A 1 22  ? 22.672  21.733  39.195  1.00 41.40 ? 22   LEU A CD2 1 
ATOM   177  N N   . LYS A 1 23  ? 17.881  21.917  39.785  1.00 48.92 ? 23   LYS A N   1 
ATOM   178  C CA  . LYS A 1 23  ? 16.438  22.109  39.493  1.00 50.70 ? 23   LYS A CA  1 
ATOM   179  C C   . LYS A 1 23  ? 16.114  21.701  38.068  1.00 49.48 ? 23   LYS A C   1 
ATOM   180  O O   . LYS A 1 23  ? 16.756  22.148  37.129  1.00 49.92 ? 23   LYS A O   1 
ATOM   181  C CB  . LYS A 1 23  ? 15.985  23.565  39.674  1.00 50.43 ? 23   LYS A CB  1 
ATOM   182  C CG  . LYS A 1 23  ? 15.942  24.091  41.102  1.00 53.19 ? 23   LYS A CG  1 
ATOM   183  C CD  . LYS A 1 23  ? 15.290  25.519  41.150  1.00 54.54 ? 23   LYS A CD  1 
ATOM   184  C CE  . LYS A 1 23  ? 13.691  25.496  41.216  1.00 60.06 ? 23   LYS A CE  1 
ATOM   185  N NZ  . LYS A 1 23  ? 12.957  24.993  39.976  1.00 58.16 ? 23   LYS A NZ  1 
ATOM   186  N N   . ALA A 1 24  ? 15.134  20.830  37.924  1.00 49.02 ? 24   ALA A N   1 
ATOM   187  C CA  . ALA A 1 24  ? 14.471  20.630  36.654  1.00 48.68 ? 24   ALA A CA  1 
ATOM   188  C C   . ALA A 1 24  ? 13.052  21.196  36.779  1.00 48.79 ? 24   ALA A C   1 
ATOM   189  O O   . ALA A 1 24  ? 12.578  21.453  37.893  1.00 48.37 ? 24   ALA A O   1 
ATOM   190  C CB  . ALA A 1 24  ? 14.436  19.164  36.293  1.00 48.36 ? 24   ALA A CB  1 
ATOM   191  N N   . PRO A 1 25  ? 12.387  21.433  35.639  1.00 48.82 ? 25   PRO A N   1 
ATOM   192  C CA  . PRO A 1 25  ? 10.990  21.848  35.625  1.00 48.94 ? 25   PRO A CA  1 
ATOM   193  C C   . PRO A 1 25  ? 10.113  21.128  36.658  1.00 48.97 ? 25   PRO A C   1 
ATOM   194  O O   . PRO A 1 25  ? 9.449   21.788  37.449  1.00 49.30 ? 25   PRO A O   1 
ATOM   195  C CB  . PRO A 1 25  ? 10.554  21.492  34.208  1.00 48.72 ? 25   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 25  ? 11.789  21.764  33.405  1.00 49.14 ? 25   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 25  ? 12.948  21.364  34.274  1.00 48.88 ? 25   PRO A CD  1 
ATOM   198  N N   . GLY A 1 26  ? 10.130  19.801  36.671  1.00 48.84 ? 26   GLY A N   1 
ATOM   199  C CA  . GLY A 1 26  ? 9.228   19.051  37.522  1.00 48.68 ? 26   GLY A CA  1 
ATOM   200  C C   . GLY A 1 26  ? 9.808   18.543  38.833  1.00 49.05 ? 26   GLY A C   1 
ATOM   201  O O   . GLY A 1 26  ? 9.191   17.672  39.476  1.00 49.77 ? 26   GLY A O   1 
ATOM   202  N N   . GLY A 1 27  ? 10.978  19.053  39.236  1.00 48.02 ? 27   GLY A N   1 
ATOM   203  C CA  . GLY A 1 27  ? 11.615  18.633  40.478  1.00 46.81 ? 27   GLY A CA  1 
ATOM   204  C C   . GLY A 1 27  ? 13.130  18.513  40.365  1.00 47.28 ? 27   GLY A C   1 
ATOM   205  O O   . GLY A 1 27  ? 13.702  18.752  39.291  1.00 47.23 ? 27   GLY A O   1 
ATOM   206  N N   . PRO A 1 28  ? 13.803  18.128  41.474  1.00 46.84 ? 28   PRO A N   1 
ATOM   207  C CA  . PRO A 1 28  ? 15.272  18.063  41.534  1.00 45.99 ? 28   PRO A CA  1 
ATOM   208  C C   . PRO A 1 28  ? 15.893  16.832  40.843  1.00 45.18 ? 28   PRO A C   1 
ATOM   209  O O   . PRO A 1 28  ? 15.239  15.793  40.732  1.00 44.09 ? 28   PRO A O   1 
ATOM   210  C CB  . PRO A 1 28  ? 15.531  17.983  43.033  1.00 46.44 ? 28   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 28  ? 14.321  17.216  43.567  1.00 46.19 ? 28   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 28  ? 13.177  17.740  42.760  1.00 46.75 ? 28   PRO A CD  1 
ATOM   213  N N   . VAL A 1 29  ? 17.144  16.972  40.386  1.00 44.40 ? 29   VAL A N   1 
ATOM   214  C CA  . VAL A 1 29  ? 17.962  15.834  39.898  1.00 43.71 ? 29   VAL A CA  1 
ATOM   215  C C   . VAL A 1 29  ? 19.339  15.816  40.565  1.00 43.10 ? 29   VAL A C   1 
ATOM   216  O O   . VAL A 1 29  ? 19.819  16.842  41.088  1.00 42.71 ? 29   VAL A O   1 
ATOM   217  C CB  . VAL A 1 29  ? 18.202  15.845  38.367  1.00 43.41 ? 29   VAL A CB  1 
ATOM   218  C CG1 . VAL A 1 29  ? 16.913  15.759  37.611  1.00 43.52 ? 29   VAL A CG1 1 
ATOM   219  C CG2 . VAL A 1 29  ? 18.987  17.087  37.951  1.00 44.28 ? 29   VAL A CG2 1 
ATOM   220  N N   . SER A 1 30  ? 19.976  14.652  40.540  1.00 42.03 ? 30   SER A N   1 
ATOM   221  C CA  . SER A 1 30  ? 21.358  14.559  41.000  1.00 41.53 ? 30   SER A CA  1 
ATOM   222  C C   . SER A 1 30  ? 22.306  14.676  39.815  1.00 40.61 ? 30   SER A C   1 
ATOM   223  O O   . SER A 1 30  ? 22.148  13.945  38.827  1.00 40.45 ? 30   SER A O   1 
ATOM   224  C CB  . SER A 1 30  ? 21.595  13.230  41.710  1.00 41.53 ? 30   SER A CB  1 
ATOM   225  O OG  . SER A 1 30  ? 21.649  13.394  43.115  1.00 43.15 ? 30   SER A OG  1 
ATOM   226  N N   . ALA A 1 31  ? 23.281  15.575  39.902  1.00 39.04 ? 31   ALA A N   1 
ATOM   227  C CA  . ALA A 1 31  ? 24.321  15.617  38.882  1.00 38.33 ? 31   ALA A CA  1 
ATOM   228  C C   . ALA A 1 31  ? 25.725  15.465  39.463  1.00 38.14 ? 31   ALA A C   1 
ATOM   229  O O   . ALA A 1 31  ? 26.084  16.137  40.436  1.00 39.18 ? 31   ALA A O   1 
ATOM   230  C CB  . ALA A 1 31  ? 24.221  16.868  38.082  1.00 38.31 ? 31   ALA A CB  1 
ATOM   231  N N   . PHE A 1 32  ? 26.512  14.574  38.871  1.00 37.00 ? 32   PHE A N   1 
ATOM   232  C CA  . PHE A 1 32  ? 27.923  14.426  39.202  1.00 35.81 ? 32   PHE A CA  1 
ATOM   233  C C   . PHE A 1 32  ? 28.673  14.810  37.956  1.00 36.06 ? 32   PHE A C   1 
ATOM   234  O O   . PHE A 1 32  ? 28.636  14.097  36.947  1.00 36.17 ? 32   PHE A O   1 
ATOM   235  C CB  . PHE A 1 32  ? 28.217  12.994  39.636  1.00 35.16 ? 32   PHE A CB  1 
ATOM   236  C CG  . PHE A 1 32  ? 27.416  12.574  40.818  1.00 34.29 ? 32   PHE A CG  1 
ATOM   237  C CD1 . PHE A 1 32  ? 26.084  12.168  40.666  1.00 32.93 ? 32   PHE A CD1 1 
ATOM   238  C CD2 . PHE A 1 32  ? 27.957  12.645  42.097  1.00 32.70 ? 32   PHE A CD2 1 
ATOM   239  C CE1 . PHE A 1 32  ? 25.321  11.804  41.792  1.00 31.84 ? 32   PHE A CE1 1 
ATOM   240  C CE2 . PHE A 1 32  ? 27.183  12.296  43.236  1.00 31.76 ? 32   PHE A CE2 1 
ATOM   241  C CZ  . PHE A 1 32  ? 25.884  11.879  43.077  1.00 31.01 ? 32   PHE A CZ  1 
ATOM   242  N N   . LEU A 1 33  ? 29.301  15.982  38.004  1.00 36.18 ? 33   LEU A N   1 
ATOM   243  C CA  . LEU A 1 33  ? 29.863  16.597  36.814  1.00 35.37 ? 33   LEU A CA  1 
ATOM   244  C C   . LEU A 1 33  ? 31.376  16.666  36.917  1.00 35.99 ? 33   LEU A C   1 
ATOM   245  O O   . LEU A 1 33  ? 31.928  17.019  37.974  1.00 35.92 ? 33   LEU A O   1 
ATOM   246  C CB  . LEU A 1 33  ? 29.282  17.994  36.625  1.00 35.15 ? 33   LEU A CB  1 
ATOM   247  C CG  . LEU A 1 33  ? 27.753  18.145  36.520  1.00 34.93 ? 33   LEU A CG  1 
ATOM   248  C CD1 . LEU A 1 33  ? 27.418  19.604  36.314  1.00 34.84 ? 33   LEU A CD1 1 
ATOM   249  C CD2 . LEU A 1 33  ? 27.136  17.304  35.385  1.00 32.77 ? 33   LEU A CD2 1 
ATOM   250  N N   . GLY A 1 34  ? 32.046  16.325  35.821  1.00 35.78 ? 34   GLY A N   1 
ATOM   251  C CA  . GLY A 1 34  ? 33.490  16.410  35.781  1.00 36.02 ? 34   GLY A CA  1 
ATOM   252  C C   . GLY A 1 34  ? 34.197  15.356  36.599  1.00 35.88 ? 34   GLY A C   1 
ATOM   253  O O   . GLY A 1 34  ? 35.156  15.667  37.287  1.00 36.53 ? 34   GLY A O   1 
ATOM   254  N N   . ILE A 1 35  ? 33.712  14.117  36.539  1.00 35.42 ? 35   ILE A N   1 
ATOM   255  C CA  . ILE A 1 35  ? 34.381  12.990  37.154  1.00 34.91 ? 35   ILE A CA  1 
ATOM   256  C C   . ILE A 1 35  ? 35.509  12.560  36.219  1.00 35.66 ? 35   ILE A C   1 
ATOM   257  O O   . ILE A 1 35  ? 35.246  12.218  35.060  1.00 35.84 ? 35   ILE A O   1 
ATOM   258  C CB  . ILE A 1 35  ? 33.416  11.822  37.266  1.00 34.82 ? 35   ILE A CB  1 
ATOM   259  C CG1 . ILE A 1 35  ? 32.180  12.227  38.088  1.00 34.10 ? 35   ILE A CG1 1 
ATOM   260  C CG2 . ILE A 1 35  ? 34.145  10.572  37.779  1.00 34.55 ? 35   ILE A CG2 1 
ATOM   261  C CD1 . ILE A 1 35  ? 30.922  11.358  37.822  1.00 32.38 ? 35   ILE A CD1 1 
ATOM   262  N N   . PRO A 1 36  ? 36.772  12.584  36.688  1.00 35.71 ? 36   PRO A N   1 
ATOM   263  C CA  . PRO A 1 36  ? 37.848  12.181  35.766  1.00 35.71 ? 36   PRO A CA  1 
ATOM   264  C C   . PRO A 1 36  ? 37.809  10.681  35.545  1.00 36.19 ? 36   PRO A C   1 
ATOM   265  O O   . PRO A 1 36  ? 37.626  9.946   36.511  1.00 36.88 ? 36   PRO A O   1 
ATOM   266  C CB  . PRO A 1 36  ? 39.113  12.558  36.531  1.00 35.66 ? 36   PRO A CB  1 
ATOM   267  C CG  . PRO A 1 36  ? 38.714  12.506  37.983  1.00 34.67 ? 36   PRO A CG  1 
ATOM   268  C CD  . PRO A 1 36  ? 37.288  12.953  38.019  1.00 35.59 ? 36   PRO A CD  1 
ATOM   269  N N   . PHE A 1 37  ? 37.945  10.228  34.301  1.00 36.38 ? 37   PHE A N   1 
ATOM   270  C CA  . PHE A 1 37  ? 37.972  8.797   34.021  1.00 36.74 ? 37   PHE A CA  1 
ATOM   271  C C   . PHE A 1 37  ? 39.318  8.345   33.452  1.00 37.64 ? 37   PHE A C   1 
ATOM   272  O O   . PHE A 1 37  ? 39.534  7.144   33.240  1.00 38.53 ? 37   PHE A O   1 
ATOM   273  C CB  . PHE A 1 37  ? 36.806  8.351   33.106  1.00 36.23 ? 37   PHE A CB  1 
ATOM   274  C CG  . PHE A 1 37  ? 36.820  8.969   31.729  1.00 35.71 ? 37   PHE A CG  1 
ATOM   275  C CD1 . PHE A 1 37  ? 37.427  8.322   30.670  1.00 36.25 ? 37   PHE A CD1 1 
ATOM   276  C CD2 . PHE A 1 37  ? 36.189  10.184  31.482  1.00 34.94 ? 37   PHE A CD2 1 
ATOM   277  C CE1 . PHE A 1 37  ? 37.451  8.898   29.380  1.00 36.14 ? 37   PHE A CE1 1 
ATOM   278  C CE2 . PHE A 1 37  ? 36.203  10.748  30.204  1.00 34.69 ? 37   PHE A CE2 1 
ATOM   279  C CZ  . PHE A 1 37  ? 36.841  10.107  29.156  1.00 34.80 ? 37   PHE A CZ  1 
ATOM   280  N N   . ALA A 1 38  ? 40.222  9.294   33.213  1.00 38.00 ? 38   ALA A N   1 
ATOM   281  C CA  . ALA A 1 38  ? 41.528  8.977   32.643  1.00 38.19 ? 38   ALA A CA  1 
ATOM   282  C C   . ALA A 1 38  ? 42.602  9.839   33.247  1.00 38.67 ? 38   ALA A C   1 
ATOM   283  O O   . ALA A 1 38  ? 42.327  10.895  33.800  1.00 39.24 ? 38   ALA A O   1 
ATOM   284  C CB  . ALA A 1 38  ? 41.513  9.204   31.167  1.00 38.48 ? 38   ALA A CB  1 
ATOM   285  N N   . GLU A 1 39  ? 43.840  9.407   33.113  1.00 38.96 ? 39   GLU A N   1 
ATOM   286  C CA  . GLU A 1 39  ? 44.941  10.278  33.474  1.00 39.48 ? 39   GLU A CA  1 
ATOM   287  C C   . GLU A 1 39  ? 44.976  11.402  32.440  1.00 39.02 ? 39   GLU A C   1 
ATOM   288  O O   . GLU A 1 39  ? 44.703  11.171  31.275  1.00 38.85 ? 39   GLU A O   1 
ATOM   289  C CB  . GLU A 1 39  ? 46.270  9.493   33.560  1.00 39.74 ? 39   GLU A CB  1 
ATOM   290  C CG  . GLU A 1 39  ? 46.405  8.636   34.839  1.00 40.26 ? 39   GLU A CG  1 
ATOM   291  C CD  . GLU A 1 39  ? 46.468  9.467   36.118  1.00 44.35 ? 39   GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 39  ? 47.340  10.356  36.217  1.00 48.43 ? 39   GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 39  ? 45.654  9.245   37.042  1.00 45.47 ? 39   GLU A OE2 1 
ATOM   294  N N   . PRO A 1 40  ? 45.266  12.628  32.871  1.00 38.89 ? 40   PRO A N   1 
ATOM   295  C CA  . PRO A 1 40  ? 45.224  13.694  31.883  1.00 39.11 ? 40   PRO A CA  1 
ATOM   296  C C   . PRO A 1 40  ? 46.142  13.393  30.708  1.00 39.64 ? 40   PRO A C   1 
ATOM   297  O O   . PRO A 1 40  ? 47.341  13.225  30.918  1.00 40.88 ? 40   PRO A O   1 
ATOM   298  C CB  . PRO A 1 40  ? 45.690  14.919  32.672  1.00 38.68 ? 40   PRO A CB  1 
ATOM   299  C CG  . PRO A 1 40  ? 45.280  14.602  34.106  1.00 38.68 ? 40   PRO A CG  1 
ATOM   300  C CD  . PRO A 1 40  ? 45.590  13.127  34.221  1.00 38.85 ? 40   PRO A CD  1 
ATOM   301  N N   . PRO A 1 41  ? 45.589  13.302  29.476  1.00 39.60 ? 41   PRO A N   1 
ATOM   302  C CA  . PRO A 1 41  ? 46.427  12.929  28.335  1.00 39.18 ? 41   PRO A CA  1 
ATOM   303  C C   . PRO A 1 41  ? 47.372  14.046  27.896  1.00 39.16 ? 41   PRO A C   1 
ATOM   304  O O   . PRO A 1 41  ? 47.381  14.421  26.724  1.00 38.80 ? 41   PRO A O   1 
ATOM   305  C CB  . PRO A 1 41  ? 45.406  12.602  27.242  1.00 38.62 ? 41   PRO A CB  1 
ATOM   306  C CG  . PRO A 1 41  ? 44.241  13.466  27.569  1.00 38.99 ? 41   PRO A CG  1 
ATOM   307  C CD  . PRO A 1 41  ? 44.183  13.511  29.076  1.00 39.37 ? 41   PRO A CD  1 
ATOM   308  N N   . VAL A 1 42  ? 48.182  14.546  28.816  1.00 39.33 ? 42   VAL A N   1 
ATOM   309  C CA  . VAL A 1 42  ? 49.076  15.656  28.491  1.00 40.71 ? 42   VAL A CA  1 
ATOM   310  C C   . VAL A 1 42  ? 50.556  15.225  28.358  1.00 41.93 ? 42   VAL A C   1 
ATOM   311  O O   . VAL A 1 42  ? 50.899  14.046  28.581  1.00 42.21 ? 42   VAL A O   1 
ATOM   312  C CB  . VAL A 1 42  ? 48.928  16.829  29.508  1.00 40.67 ? 42   VAL A CB  1 
ATOM   313  C CG1 . VAL A 1 42  ? 47.444  17.209  29.670  1.00 39.75 ? 42   VAL A CG1 1 
ATOM   314  C CG2 . VAL A 1 42  ? 49.542  16.455  30.872  1.00 40.22 ? 42   VAL A CG2 1 
ATOM   315  N N   . GLY A 1 43  ? 51.406  16.190  27.978  1.00 42.11 ? 43   GLY A N   1 
ATOM   316  C CA  . GLY A 1 43  ? 52.845  16.023  27.947  1.00 41.94 ? 43   GLY A CA  1 
ATOM   317  C C   . GLY A 1 43  ? 53.193  14.853  27.074  1.00 42.21 ? 43   GLY A C   1 
ATOM   318  O O   . GLY A 1 43  ? 52.851  14.843  25.905  1.00 42.78 ? 43   GLY A O   1 
ATOM   319  N N   . SER A 1 44  ? 53.843  13.844  27.639  1.00 42.78 ? 44   SER A N   1 
ATOM   320  C CA  . SER A 1 44  ? 54.244  12.676  26.838  1.00 43.39 ? 44   SER A CA  1 
ATOM   321  C C   . SER A 1 44  ? 53.076  11.774  26.477  1.00 42.95 ? 44   SER A C   1 
ATOM   322  O O   . SER A 1 44  ? 53.241  10.834  25.709  1.00 42.98 ? 44   SER A O   1 
ATOM   323  C CB  . SER A 1 44  ? 55.344  11.871  27.537  1.00 43.31 ? 44   SER A CB  1 
ATOM   324  O OG  . SER A 1 44  ? 54.885  11.477  28.809  1.00 44.83 ? 44   SER A OG  1 
ATOM   325  N N   . ARG A 1 45  ? 51.894  12.057  27.014  1.00 43.28 ? 45   ARG A N   1 
ATOM   326  C CA  . ARG A 1 45  ? 50.733  11.191  26.748  1.00 43.04 ? 45   ARG A CA  1 
ATOM   327  C C   . ARG A 1 45  ? 49.881  11.658  25.560  1.00 42.14 ? 45   ARG A C   1 
ATOM   328  O O   . ARG A 1 45  ? 48.929  10.971  25.172  1.00 42.18 ? 45   ARG A O   1 
ATOM   329  C CB  . ARG A 1 45  ? 49.859  11.041  27.991  1.00 43.78 ? 45   ARG A CB  1 
ATOM   330  C CG  . ARG A 1 45  ? 50.503  10.354  29.199  1.00 45.92 ? 45   ARG A CG  1 
ATOM   331  C CD  . ARG A 1 45  ? 49.517  10.528  30.364  1.00 51.19 ? 45   ARG A CD  1 
ATOM   332  N NE  . ARG A 1 45  ? 50.029  10.149  31.684  1.00 55.41 ? 45   ARG A NE  1 
ATOM   333  C CZ  . ARG A 1 45  ? 49.971  8.913   32.176  1.00 57.37 ? 45   ARG A CZ  1 
ATOM   334  N NH1 . ARG A 1 45  ? 49.438  7.931   31.445  1.00 57.64 ? 45   ARG A NH1 1 
ATOM   335  N NH2 . ARG A 1 45  ? 50.457  8.654   33.382  1.00 57.15 ? 45   ARG A NH2 1 
ATOM   336  N N   . ARG A 1 46  ? 50.236  12.807  24.982  1.00 40.57 ? 46   ARG A N   1 
ATOM   337  C CA  . ARG A 1 46  ? 49.530  13.356  23.824  1.00 39.32 ? 46   ARG A CA  1 
ATOM   338  C C   . ARG A 1 46  ? 49.636  12.378  22.631  1.00 39.68 ? 46   ARG A C   1 
ATOM   339  O O   . ARG A 1 46  ? 50.724  11.855  22.369  1.00 39.47 ? 46   ARG A O   1 
ATOM   340  C CB  . ARG A 1 46  ? 50.078  14.756  23.485  1.00 38.28 ? 46   ARG A CB  1 
ATOM   341  C CG  . ARG A 1 46  ? 49.525  15.337  22.204  1.00 36.46 ? 46   ARG A CG  1 
ATOM   342  C CD  . ARG A 1 46  ? 50.288  16.505  21.688  1.00 34.07 ? 46   ARG A CD  1 
ATOM   343  N NE  . ARG A 1 46  ? 50.063  17.716  22.474  1.00 33.44 ? 46   ARG A NE  1 
ATOM   344  C CZ  . ARG A 1 46  ? 50.627  18.886  22.204  1.00 30.73 ? 46   ARG A CZ  1 
ATOM   345  N NH1 . ARG A 1 46  ? 51.424  19.000  21.161  1.00 30.81 ? 46   ARG A NH1 1 
ATOM   346  N NH2 . ARG A 1 46  ? 50.391  19.936  22.965  1.00 29.53 ? 46   ARG A NH2 1 
ATOM   347  N N   . PHE A 1 47  ? 48.506  12.113  21.946  1.00 39.49 ? 47   PHE A N   1 
ATOM   348  C CA  . PHE A 1 47  ? 48.406  11.126  20.857  1.00 39.52 ? 47   PHE A CA  1 
ATOM   349  C C   . PHE A 1 47  ? 48.338  9.670   21.322  1.00 40.70 ? 47   PHE A C   1 
ATOM   350  O O   . PHE A 1 47  ? 48.168  8.732   20.502  1.00 40.47 ? 47   PHE A O   1 
ATOM   351  C CB  . PHE A 1 47  ? 49.541  11.259  19.837  1.00 39.46 ? 47   PHE A CB  1 
ATOM   352  C CG  . PHE A 1 47  ? 49.838  12.685  19.403  1.00 39.75 ? 47   PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 47  ? 48.844  13.500  18.869  1.00 39.59 ? 47   PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 47  ? 51.125  13.186  19.486  1.00 38.92 ? 47   PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 47  ? 49.125  14.792  18.461  1.00 38.83 ? 47   PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 47  ? 51.409  14.483  19.090  1.00 39.45 ? 47   PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 47  ? 50.401  15.291  18.569  1.00 38.04 ? 47   PHE A CZ  1 
ATOM   358  N N   . MET A 1 48  ? 48.446  9.457   22.627  1.00 41.82 ? 48   MET A N   1 
ATOM   359  C CA  . MET A 1 48  ? 48.440  8.089   23.159  1.00 44.02 ? 48   MET A CA  1 
ATOM   360  C C   . MET A 1 48  ? 47.116  7.640   23.782  1.00 42.45 ? 48   MET A C   1 
ATOM   361  O O   . MET A 1 48  ? 46.329  8.480   24.234  1.00 42.41 ? 48   MET A O   1 
ATOM   362  C CB  . MET A 1 48  ? 49.578  7.943   24.141  1.00 43.24 ? 48   MET A CB  1 
ATOM   363  C CG  . MET A 1 48  ? 50.886  7.998   23.382  1.00 46.83 ? 48   MET A CG  1 
ATOM   364  S SD  . MET A 1 48  ? 52.041  6.861   24.084  1.00 51.66 ? 48   MET A SD  1 
ATOM   365  C CE  . MET A 1 48  ? 51.434  5.259   23.505  1.00 49.07 ? 48   MET A CE  1 
ATOM   366  N N   . PRO A 1 49  ? 46.865  6.318   23.798  1.00 41.83 ? 49   PRO A N   1 
ATOM   367  C CA  . PRO A 1 49  ? 45.686  5.742   24.430  1.00 41.22 ? 49   PRO A CA  1 
ATOM   368  C C   . PRO A 1 49  ? 45.476  6.303   25.816  1.00 40.84 ? 49   PRO A C   1 
ATOM   369  O O   . PRO A 1 49  ? 46.433  6.739   26.453  1.00 40.34 ? 49   PRO A O   1 
ATOM   370  C CB  . PRO A 1 49  ? 46.043  4.264   24.516  1.00 41.13 ? 49   PRO A CB  1 
ATOM   371  C CG  . PRO A 1 49  ? 46.781  4.045   23.264  1.00 41.23 ? 49   PRO A CG  1 
ATOM   372  C CD  . PRO A 1 49  ? 47.691  5.259   23.193  1.00 41.83 ? 49   PRO A CD  1 
ATOM   373  N N   . PRO A 1 50  ? 44.218  6.365   26.260  1.00 40.73 ? 50   PRO A N   1 
ATOM   374  C CA  . PRO A 1 50  ? 44.010  6.850   27.597  1.00 41.06 ? 50   PRO A CA  1 
ATOM   375  C C   . PRO A 1 50  ? 44.454  5.799   28.594  1.00 42.04 ? 50   PRO A C   1 
ATOM   376  O O   . PRO A 1 50  ? 44.329  4.598   28.340  1.00 41.60 ? 50   PRO A O   1 
ATOM   377  C CB  . PRO A 1 50  ? 42.490  7.052   27.663  1.00 40.76 ? 50   PRO A CB  1 
ATOM   378  C CG  . PRO A 1 50  ? 41.933  6.148   26.652  1.00 40.07 ? 50   PRO A CG  1 
ATOM   379  C CD  . PRO A 1 50  ? 42.956  6.051   25.573  1.00 40.65 ? 50   PRO A CD  1 
ATOM   380  N N   . GLU A 1 51  ? 44.975  6.264   29.713  1.00 43.51 ? 51   GLU A N   1 
ATOM   381  C CA  . GLU A 1 51  ? 45.247  5.414   30.843  1.00 45.96 ? 51   GLU A CA  1 
ATOM   382  C C   . GLU A 1 51  ? 44.172  5.667   31.877  1.00 45.91 ? 51   GLU A C   1 
ATOM   383  O O   . GLU A 1 51  ? 43.784  6.829   32.098  1.00 46.32 ? 51   GLU A O   1 
ATOM   384  C CB  . GLU A 1 51  ? 46.614  5.736   31.424  1.00 46.57 ? 51   GLU A CB  1 
ATOM   385  C CG  . GLU A 1 51  ? 47.743  5.336   30.475  1.00 53.17 ? 51   GLU A CG  1 
ATOM   386  C CD  . GLU A 1 51  ? 49.039  5.017   31.224  1.00 61.67 ? 51   GLU A CD  1 
ATOM   387  O OE1 . GLU A 1 51  ? 49.225  5.564   32.360  1.00 63.89 ? 51   GLU A OE1 1 
ATOM   388  O OE2 . GLU A 1 51  ? 49.850  4.213   30.677  1.00 63.64 ? 51   GLU A OE2 1 
ATOM   389  N N   . PRO A 1 52  ? 43.665  4.589   32.513  1.00 45.92 ? 52   PRO A N   1 
ATOM   390  C CA  . PRO A 1 52  ? 42.659  4.764   33.588  1.00 45.35 ? 52   PRO A CA  1 
ATOM   391  C C   . PRO A 1 52  ? 43.123  5.733   34.669  1.00 44.95 ? 52   PRO A C   1 
ATOM   392  O O   . PRO A 1 52  ? 44.317  5.776   35.007  1.00 45.05 ? 52   PRO A O   1 
ATOM   393  C CB  . PRO A 1 52  ? 42.477  3.344   34.133  1.00 45.04 ? 52   PRO A CB  1 
ATOM   394  C CG  . PRO A 1 52  ? 42.776  2.460   32.923  1.00 45.46 ? 52   PRO A CG  1 
ATOM   395  C CD  . PRO A 1 52  ? 43.939  3.162   32.238  1.00 45.76 ? 52   PRO A CD  1 
ATOM   396  N N   . LYS A 1 53  ? 42.184  6.514   35.181  1.00 44.64 ? 53   LYS A N   1 
ATOM   397  C CA  . LYS A 1 53  ? 42.448  7.495   36.227  1.00 44.78 ? 53   LYS A CA  1 
ATOM   398  C C   . LYS A 1 53  ? 42.872  6.816   37.530  1.00 45.84 ? 53   LYS A C   1 
ATOM   399  O O   . LYS A 1 53  ? 42.103  6.057   38.120  1.00 46.38 ? 53   LYS A O   1 
ATOM   400  C CB  . LYS A 1 53  ? 41.190  8.349   36.463  1.00 44.40 ? 53   LYS A CB  1 
ATOM   401  C CG  . LYS A 1 53  ? 41.258  9.317   37.626  1.00 42.22 ? 53   LYS A CG  1 
ATOM   402  C CD  . LYS A 1 53  ? 42.321  10.364  37.415  1.00 41.58 ? 53   LYS A CD  1 
ATOM   403  C CE  . LYS A 1 53  ? 42.394  11.329  38.597  1.00 41.27 ? 53   LYS A CE  1 
ATOM   404  N NZ  . LYS A 1 53  ? 43.449  12.356  38.386  1.00 41.85 ? 53   LYS A NZ  1 
ATOM   405  N N   . ARG A 1 54  ? 44.098  7.089   37.958  1.00 46.45 ? 54   ARG A N   1 
ATOM   406  C CA  . ARG A 1 54  ? 44.601  6.683   39.265  1.00 47.47 ? 54   ARG A CA  1 
ATOM   407  C C   . ARG A 1 54  ? 43.719  7.222   40.406  1.00 46.75 ? 54   ARG A C   1 
ATOM   408  O O   . ARG A 1 54  ? 43.342  8.389   40.374  1.00 47.48 ? 54   ARG A O   1 
ATOM   409  C CB  . ARG A 1 54  ? 46.032  7.196   39.433  1.00 47.34 ? 54   ARG A CB  1 
ATOM   410  C CG  . ARG A 1 54  ? 47.105  6.112   39.277  1.00 52.69 ? 54   ARG A CG  1 
ATOM   411  C CD  . ARG A 1 54  ? 47.615  5.901   37.831  1.00 59.05 ? 54   ARG A CD  1 
ATOM   412  N NE  . ARG A 1 54  ? 48.729  6.775   37.392  1.00 64.19 ? 54   ARG A NE  1 
ATOM   413  C CZ  . ARG A 1 54  ? 49.199  7.871   38.016  1.00 65.99 ? 54   ARG A CZ  1 
ATOM   414  N NH1 . ARG A 1 54  ? 48.694  8.313   39.170  1.00 65.22 ? 54   ARG A NH1 1 
ATOM   415  N NH2 . ARG A 1 54  ? 50.204  8.546   37.465  1.00 67.17 ? 54   ARG A NH2 1 
ATOM   416  N N   . PRO A 1 55  ? 43.378  6.376   41.402  1.00 46.17 ? 55   PRO A N   1 
ATOM   417  C CA  . PRO A 1 55  ? 42.556  6.817   42.546  1.00 45.57 ? 55   PRO A CA  1 
ATOM   418  C C   . PRO A 1 55  ? 43.061  8.082   43.226  1.00 45.48 ? 55   PRO A C   1 
ATOM   419  O O   . PRO A 1 55  ? 44.251  8.385   43.205  1.00 45.36 ? 55   PRO A O   1 
ATOM   420  C CB  . PRO A 1 55  ? 42.637  5.636   43.512  1.00 45.27 ? 55   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 55  ? 42.819  4.433   42.609  1.00 45.65 ? 55   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 55  ? 43.696  4.933   41.479  1.00 45.88 ? 55   PRO A CD  1 
ATOM   423  N N   . TRP A 1 56  ? 42.146  8.825   43.821  1.00 45.23 ? 56   TRP A N   1 
ATOM   424  C CA  . TRP A 1 56  ? 42.477  10.095  44.425  1.00 45.23 ? 56   TRP A CA  1 
ATOM   425  C C   . TRP A 1 56  ? 42.111  10.026  45.885  1.00 45.96 ? 56   TRP A C   1 
ATOM   426  O O   . TRP A 1 56  ? 41.361  9.125   46.306  1.00 45.93 ? 56   TRP A O   1 
ATOM   427  C CB  . TRP A 1 56  ? 41.700  11.229  43.738  1.00 44.57 ? 56   TRP A CB  1 
ATOM   428  C CG  . TRP A 1 56  ? 40.213  11.044  43.778  1.00 43.89 ? 56   TRP A CG  1 
ATOM   429  C CD1 . TRP A 1 56  ? 39.368  11.404  44.793  1.00 44.73 ? 56   TRP A CD1 1 
ATOM   430  C CD2 . TRP A 1 56  ? 39.387  10.452  42.766  1.00 43.71 ? 56   TRP A CD2 1 
ATOM   431  N NE1 . TRP A 1 56  ? 38.064  11.071  44.479  1.00 43.97 ? 56   TRP A NE1 1 
ATOM   432  C CE2 . TRP A 1 56  ? 38.045  10.494  43.239  1.00 42.83 ? 56   TRP A CE2 1 
ATOM   433  C CE3 . TRP A 1 56  ? 39.643  9.905   41.505  1.00 42.58 ? 56   TRP A CE3 1 
ATOM   434  C CZ2 . TRP A 1 56  ? 36.968  10.006  42.496  1.00 42.22 ? 56   TRP A CZ2 1 
ATOM   435  C CZ3 . TRP A 1 56  ? 38.569  9.401   40.775  1.00 43.97 ? 56   TRP A CZ3 1 
ATOM   436  C CH2 . TRP A 1 56  ? 37.241  9.464   41.278  1.00 42.89 ? 56   TRP A CH2 1 
ATOM   437  N N   . SER A 1 57  ? 42.607  10.975  46.671  1.00 46.46 ? 57   SER A N   1 
ATOM   438  C CA  . SER A 1 57  ? 42.173  11.011  48.066  1.00 47.57 ? 57   SER A CA  1 
ATOM   439  C C   . SER A 1 57  ? 41.161  12.138  48.344  1.00 47.09 ? 57   SER A C   1 
ATOM   440  O O   . SER A 1 57  ? 41.093  13.139  47.611  1.00 46.84 ? 57   SER A O   1 
ATOM   441  C CB  . SER A 1 57  ? 43.383  11.099  48.996  1.00 47.88 ? 57   SER A CB  1 
ATOM   442  O OG  . SER A 1 57  ? 44.028  12.333  48.759  1.00 49.90 ? 57   SER A OG  1 
ATOM   443  N N   . GLY A 1 58  ? 40.392  11.969  49.416  1.00 46.87 ? 58   GLY A N   1 
ATOM   444  C CA  . GLY A 1 58  ? 39.380  12.941  49.809  1.00 46.62 ? 58   GLY A CA  1 
ATOM   445  C C   . GLY A 1 58  ? 38.128  12.855  48.941  1.00 46.61 ? 58   GLY A C   1 
ATOM   446  O O   . GLY A 1 58  ? 37.934  11.909  48.156  1.00 46.21 ? 58   GLY A O   1 
ATOM   447  N N   . VAL A 1 59  ? 37.263  13.846  49.084  1.00 46.43 ? 59   VAL A N   1 
ATOM   448  C CA  . VAL A 1 59  ? 36.028  13.854  48.318  1.00 46.24 ? 59   VAL A CA  1 
ATOM   449  C C   . VAL A 1 59  ? 36.268  14.760  47.131  1.00 46.17 ? 59   VAL A C   1 
ATOM   450  O O   . VAL A 1 59  ? 36.509  15.949  47.309  1.00 45.78 ? 59   VAL A O   1 
ATOM   451  C CB  . VAL A 1 59  ? 34.810  14.343  49.161  1.00 46.39 ? 59   VAL A CB  1 
ATOM   452  C CG1 . VAL A 1 59  ? 33.521  14.141  48.391  1.00 45.28 ? 59   VAL A CG1 1 
ATOM   453  C CG2 . VAL A 1 59  ? 34.751  13.606  50.511  1.00 44.84 ? 59   VAL A CG2 1 
ATOM   454  N N   . LEU A 1 60  ? 36.222  14.185  45.928  1.00 46.13 ? 60   LEU A N   1 
ATOM   455  C CA  . LEU A 1 60  ? 36.381  14.965  44.712  1.00 46.24 ? 60   LEU A CA  1 
ATOM   456  C C   . LEU A 1 60  ? 35.110  15.737  44.474  1.00 46.41 ? 60   LEU A C   1 
ATOM   457  O O   . LEU A 1 60  ? 33.995  15.194  44.524  1.00 46.59 ? 60   LEU A O   1 
ATOM   458  C CB  . LEU A 1 60  ? 36.741  14.087  43.498  1.00 46.47 ? 60   LEU A CB  1 
ATOM   459  C CG  . LEU A 1 60  ? 37.131  14.770  42.174  1.00 46.08 ? 60   LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 60  ? 38.084  13.936  41.390  1.00 46.01 ? 60   LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 60  ? 35.929  15.068  41.312  1.00 46.88 ? 60   LEU A CD2 1 
ATOM   462  N N   . ASP A 1 61  ? 35.283  17.024  44.230  1.00 46.68 ? 61   ASP A N   1 
ATOM   463  C CA  . ASP A 1 61  ? 34.160  17.883  43.943  1.00 46.81 ? 61   ASP A CA  1 
ATOM   464  C C   . ASP A 1 61  ? 33.687  17.716  42.495  1.00 45.48 ? 61   ASP A C   1 
ATOM   465  O O   . ASP A 1 61  ? 34.383  18.087  41.570  1.00 45.35 ? 61   ASP A O   1 
ATOM   466  C CB  . ASP A 1 61  ? 34.541  19.331  44.208  1.00 47.72 ? 61   ASP A CB  1 
ATOM   467  C CG  . ASP A 1 61  ? 33.418  20.277  43.873  1.00 50.99 ? 61   ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 61  ? 33.366  20.738  42.702  1.00 53.53 ? 61   ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 61  ? 32.562  20.499  44.767  1.00 54.49 ? 61   ASP A OD2 1 
ATOM   470  N N   . ALA A 1 62  ? 32.495  17.166  42.325  1.00 44.47 ? 62   ALA A N   1 
ATOM   471  C CA  . ALA A 1 62  ? 31.909  16.923  41.010  1.00 43.68 ? 62   ALA A CA  1 
ATOM   472  C C   . ALA A 1 62  ? 30.621  17.754  40.787  1.00 43.10 ? 62   ALA A C   1 
ATOM   473  O O   . ALA A 1 62  ? 29.550  17.209  40.459  1.00 42.10 ? 62   ALA A O   1 
ATOM   474  C CB  . ALA A 1 62  ? 31.619  15.437  40.854  1.00 43.87 ? 62   ALA A CB  1 
ATOM   475  N N   . THR A 1 63  ? 30.746  19.072  40.950  1.00 42.26 ? 63   THR A N   1 
ATOM   476  C CA  . THR A 1 63  ? 29.603  19.975  40.914  1.00 42.03 ? 63   THR A CA  1 
ATOM   477  C C   . THR A 1 63  ? 29.604  20.923  39.697  1.00 42.41 ? 63   THR A C   1 
ATOM   478  O O   . THR A 1 63  ? 28.662  21.709  39.501  1.00 43.49 ? 63   THR A O   1 
ATOM   479  C CB  . THR A 1 63  ? 29.491  20.792  42.233  1.00 42.35 ? 63   THR A CB  1 
ATOM   480  O OG1 . THR A 1 63  ? 30.688  21.553  42.438  1.00 41.53 ? 63   THR A OG1 1 
ATOM   481  C CG2 . THR A 1 63  ? 29.242  19.864  43.469  1.00 41.42 ? 63   THR A CG2 1 
ATOM   482  N N   . THR A 1 64  ? 30.635  20.842  38.862  1.00 41.56 ? 64   THR A N   1 
ATOM   483  C CA  . THR A 1 64  ? 30.693  21.653  37.658  1.00 41.47 ? 64   THR A CA  1 
ATOM   484  C C   . THR A 1 64  ? 31.319  20.903  36.488  1.00 40.81 ? 64   THR A C   1 
ATOM   485  O O   . THR A 1 64  ? 32.082  19.968  36.669  1.00 40.99 ? 64   THR A O   1 
ATOM   486  C CB  . THR A 1 64  ? 31.504  22.957  37.873  1.00 41.87 ? 64   THR A CB  1 
ATOM   487  O OG1 . THR A 1 64  ? 32.742  22.635  38.504  1.00 43.27 ? 64   THR A OG1 1 
ATOM   488  C CG2 . THR A 1 64  ? 30.763  23.958  38.773  1.00 43.38 ? 64   THR A CG2 1 
ATOM   489  N N   . PHE A 1 65  ? 30.990  21.329  35.275  1.00 40.09 ? 65   PHE A N   1 
ATOM   490  C CA  . PHE A 1 65  ? 31.619  20.779  34.093  1.00 38.94 ? 65   PHE A CA  1 
ATOM   491  C C   . PHE A 1 65  ? 33.105  21.078  34.134  1.00 38.79 ? 65   PHE A C   1 
ATOM   492  O O   . PHE A 1 65  ? 33.535  22.090  34.689  1.00 38.66 ? 65   PHE A O   1 
ATOM   493  C CB  . PHE A 1 65  ? 30.980  21.324  32.816  1.00 38.15 ? 65   PHE A CB  1 
ATOM   494  C CG  . PHE A 1 65  ? 29.562  20.846  32.597  1.00 37.32 ? 65   PHE A CG  1 
ATOM   495  C CD1 . PHE A 1 65  ? 29.296  19.499  32.356  1.00 35.67 ? 65   PHE A CD1 1 
ATOM   496  C CD2 . PHE A 1 65  ? 28.503  21.746  32.627  1.00 36.79 ? 65   PHE A CD2 1 
ATOM   497  C CE1 . PHE A 1 65  ? 28.000  19.048  32.168  1.00 37.87 ? 65   PHE A CE1 1 
ATOM   498  C CE2 . PHE A 1 65  ? 27.184  21.315  32.425  1.00 38.70 ? 65   PHE A CE2 1 
ATOM   499  C CZ  . PHE A 1 65  ? 26.927  19.965  32.199  1.00 37.89 ? 65   PHE A CZ  1 
ATOM   500  N N   . GLN A 1 66  ? 33.874  20.165  33.562  1.00 38.19 ? 66   GLN A N   1 
ATOM   501  C CA  . GLN A 1 66  ? 35.297  20.299  33.489  1.00 37.87 ? 66   GLN A CA  1 
ATOM   502  C C   . GLN A 1 66  ? 35.723  20.865  32.157  1.00 37.37 ? 66   GLN A C   1 
ATOM   503  O O   . GLN A 1 66  ? 34.889  21.308  31.374  1.00 37.16 ? 66   GLN A O   1 
ATOM   504  C CB  . GLN A 1 66  ? 35.963  18.953  33.734  1.00 38.53 ? 66   GLN A CB  1 
ATOM   505  C CG  . GLN A 1 66  ? 36.317  18.767  35.179  1.00 39.68 ? 66   GLN A CG  1 
ATOM   506  C CD  . GLN A 1 66  ? 37.573  19.538  35.562  1.00 42.00 ? 66   GLN A CD  1 
ATOM   507  O OE1 . GLN A 1 66  ? 38.127  20.303  34.753  1.00 42.79 ? 66   GLN A OE1 1 
ATOM   508  N NE2 . GLN A 1 66  ? 38.042  19.321  36.791  1.00 40.66 ? 66   GLN A NE2 1 
ATOM   509  N N   . ASN A 1 67  ? 37.038  20.889  31.934  1.00 36.12 ? 67   ASN A N   1 
ATOM   510  C CA  . ASN A 1 67  ? 37.594  21.419  30.722  1.00 34.55 ? 67   ASN A CA  1 
ATOM   511  C C   . ASN A 1 67  ? 36.996  20.745  29.506  1.00 33.79 ? 67   ASN A C   1 
ATOM   512  O O   . ASN A 1 67  ? 36.575  19.575  29.546  1.00 33.78 ? 67   ASN A O   1 
ATOM   513  C CB  . ASN A 1 67  ? 39.127  21.293  30.731  1.00 34.72 ? 67   ASN A CB  1 
ATOM   514  C CG  . ASN A 1 67  ? 39.784  22.095  31.884  1.00 36.82 ? 67   ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 67  ? 39.354  23.193  32.255  1.00 38.40 ? 67   ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 67  ? 40.826  21.540  32.437  1.00 38.97 ? 67   ASN A ND2 1 
ATOM   517  N N   . VAL A 1 68  ? 36.940  21.516  28.433  1.00 32.47 ? 68   VAL A N   1 
ATOM   518  C CA  . VAL A 1 68  ? 36.643  21.020  27.117  1.00 32.23 ? 68   VAL A CA  1 
ATOM   519  C C   . VAL A 1 68  ? 37.980  20.678  26.423  1.00 33.27 ? 68   VAL A C   1 
ATOM   520  O O   . VAL A 1 68  ? 38.981  21.396  26.576  1.00 32.99 ? 68   VAL A O   1 
ATOM   521  C CB  . VAL A 1 68  ? 35.872  22.095  26.334  1.00 31.61 ? 68   VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 68  ? 35.757  21.738  24.875  1.00 30.61 ? 68   VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 68  ? 34.515  22.320  26.957  1.00 30.28 ? 68   VAL A CG2 1 
ATOM   524  N N   . CYS A 1 69  ? 37.983  19.588  25.662  1.00 34.02 ? 69   CYS A N   1 
ATOM   525  C CA  . CYS A 1 69  ? 39.154  19.164  24.933  1.00 35.38 ? 69   CYS A CA  1 
ATOM   526  C C   . CYS A 1 69  ? 39.577  20.215  23.937  1.00 36.58 ? 69   CYS A C   1 
ATOM   527  O O   . CYS A 1 69  ? 38.734  20.899  23.353  1.00 36.74 ? 69   CYS A O   1 
ATOM   528  C CB  . CYS A 1 69  ? 38.881  17.839  24.237  1.00 35.12 ? 69   CYS A CB  1 
ATOM   529  S SG  . CYS A 1 69  ? 38.704  16.500  25.444  1.00 36.30 ? 69   CYS A SG  1 
ATOM   530  N N   . TYR A 1 70  ? 40.893  20.327  23.738  1.00 38.01 ? 70   TYR A N   1 
ATOM   531  C CA  . TYR A 1 70  ? 41.456  21.390  22.924  1.00 38.67 ? 70   TYR A CA  1 
ATOM   532  C C   . TYR A 1 70  ? 40.965  21.257  21.504  1.00 39.46 ? 70   TYR A C   1 
ATOM   533  O O   . TYR A 1 70  ? 41.042  20.183  20.912  1.00 39.40 ? 70   TYR A O   1 
ATOM   534  C CB  . TYR A 1 70  ? 42.995  21.430  23.014  1.00 38.92 ? 70   TYR A CB  1 
ATOM   535  C CG  . TYR A 1 70  ? 43.482  22.845  23.002  1.00 38.43 ? 70   TYR A CG  1 
ATOM   536  C CD1 . TYR A 1 70  ? 43.821  23.504  24.182  1.00 38.53 ? 70   TYR A CD1 1 
ATOM   537  C CD2 . TYR A 1 70  ? 43.538  23.552  21.811  1.00 39.15 ? 70   TYR A CD2 1 
ATOM   538  C CE1 . TYR A 1 70  ? 44.227  24.833  24.167  1.00 38.49 ? 70   TYR A CE1 1 
ATOM   539  C CE2 . TYR A 1 70  ? 43.939  24.861  21.782  1.00 39.14 ? 70   TYR A CE2 1 
ATOM   540  C CZ  . TYR A 1 70  ? 44.273  25.504  22.956  1.00 40.00 ? 70   TYR A CZ  1 
ATOM   541  O OH  . TYR A 1 70  ? 44.655  26.842  22.879  1.00 42.18 ? 70   TYR A OH  1 
ATOM   542  N N   . GLN A 1 71  ? 40.425  22.343  20.965  1.00 40.86 ? 71   GLN A N   1 
ATOM   543  C CA  . GLN A 1 71  ? 39.797  22.287  19.640  1.00 42.40 ? 71   GLN A CA  1 
ATOM   544  C C   . GLN A 1 71  ? 39.693  23.639  18.960  1.00 44.20 ? 71   GLN A C   1 
ATOM   545  O O   . GLN A 1 71  ? 39.820  24.677  19.594  1.00 43.59 ? 71   GLN A O   1 
ATOM   546  C CB  . GLN A 1 71  ? 38.398  21.662  19.744  1.00 41.33 ? 71   GLN A CB  1 
ATOM   547  C CG  . GLN A 1 71  ? 37.434  22.510  20.555  1.00 39.97 ? 71   GLN A CG  1 
ATOM   548  C CD  . GLN A 1 71  ? 36.219  21.747  21.023  1.00 38.51 ? 71   GLN A CD  1 
ATOM   549  O OE1 . GLN A 1 71  ? 35.096  22.037  20.597  1.00 39.10 ? 71   GLN A OE1 1 
ATOM   550  N NE2 . GLN A 1 71  ? 36.425  20.776  21.910  1.00 34.52 ? 71   GLN A NE2 1 
ATOM   551  N N   . TYR A 1 72  ? 39.448  23.596  17.660  1.00 47.83 ? 72   TYR A N   1 
ATOM   552  C CA  . TYR A 1 72  ? 39.058  24.764  16.878  1.00 52.09 ? 72   TYR A CA  1 
ATOM   553  C C   . TYR A 1 72  ? 37.755  25.426  17.378  1.00 53.08 ? 72   TYR A C   1 
ATOM   554  O O   . TYR A 1 72  ? 36.774  24.738  17.631  1.00 53.25 ? 72   TYR A O   1 
ATOM   555  C CB  . TYR A 1 72  ? 38.908  24.332  15.429  1.00 54.24 ? 72   TYR A CB  1 
ATOM   556  C CG  . TYR A 1 72  ? 38.503  25.440  14.504  1.00 58.53 ? 72   TYR A CG  1 
ATOM   557  C CD1 . TYR A 1 72  ? 37.192  25.506  14.000  1.00 60.95 ? 72   TYR A CD1 1 
ATOM   558  C CD2 . TYR A 1 72  ? 39.430  26.425  14.117  1.00 61.44 ? 72   TYR A CD2 1 
ATOM   559  C CE1 . TYR A 1 72  ? 36.807  26.530  13.134  1.00 62.56 ? 72   TYR A CE1 1 
ATOM   560  C CE2 . TYR A 1 72  ? 39.061  27.461  13.255  1.00 63.00 ? 72   TYR A CE2 1 
ATOM   561  C CZ  . TYR A 1 72  ? 37.744  27.510  12.766  1.00 62.40 ? 72   TYR A CZ  1 
ATOM   562  O OH  . TYR A 1 72  ? 37.366  28.535  11.916  1.00 61.78 ? 72   TYR A OH  1 
ATOM   563  N N   . VAL A 1 73  ? 37.773  26.745  17.567  1.00 54.29 ? 73   VAL A N   1 
ATOM   564  C CA  . VAL A 1 73  ? 36.577  27.504  17.952  1.00 55.74 ? 73   VAL A CA  1 
ATOM   565  C C   . VAL A 1 73  ? 36.082  28.280  16.727  1.00 57.21 ? 73   VAL A C   1 
ATOM   566  O O   . VAL A 1 73  ? 36.803  29.111  16.168  1.00 57.12 ? 73   VAL A O   1 
ATOM   567  C CB  . VAL A 1 73  ? 36.845  28.517  19.101  1.00 55.61 ? 73   VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 73  ? 35.584  29.322  19.434  1.00 54.87 ? 73   VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 73  ? 37.365  27.816  20.336  1.00 55.48 ? 73   VAL A CG2 1 
ATOM   570  N N   . ASP A 1 74  ? 34.852  28.002  16.307  1.00 58.90 ? 74   ASP A N   1 
ATOM   571  C CA  . ASP A 1 74  ? 34.291  28.670  15.141  1.00 60.15 ? 74   ASP A CA  1 
ATOM   572  C C   . ASP A 1 74  ? 33.967  30.141  15.439  1.00 60.54 ? 74   ASP A C   1 
ATOM   573  O O   . ASP A 1 74  ? 33.438  30.459  16.498  1.00 60.37 ? 74   ASP A O   1 
ATOM   574  C CB  . ASP A 1 74  ? 33.052  27.927  14.649  1.00 60.48 ? 74   ASP A CB  1 
ATOM   575  C CG  . ASP A 1 74  ? 32.382  28.639  13.511  1.00 62.83 ? 74   ASP A CG  1 
ATOM   576  O OD1 . ASP A 1 74  ? 33.044  28.843  12.462  1.00 66.78 ? 74   ASP A OD1 1 
ATOM   577  O OD2 . ASP A 1 74  ? 31.211  29.031  13.673  1.00 64.64 ? 74   ASP A OD2 1 
ATOM   578  N N   . THR A 1 75  ? 34.300  31.028  14.501  1.00 61.38 ? 75   THR A N   1 
ATOM   579  C CA  . THR A 1 75  ? 33.999  32.471  14.637  1.00 62.09 ? 75   THR A CA  1 
ATOM   580  C C   . THR A 1 75  ? 33.349  33.085  13.368  1.00 62.38 ? 75   THR A C   1 
ATOM   581  O O   . THR A 1 75  ? 33.197  34.322  13.252  1.00 62.36 ? 75   THR A O   1 
ATOM   582  C CB  . THR A 1 75  ? 35.267  33.294  15.046  1.00 62.23 ? 75   THR A CB  1 
ATOM   583  O OG1 . THR A 1 75  ? 36.400  32.782  14.335  1.00 62.06 ? 75   THR A OG1 1 
ATOM   584  C CG2 . THR A 1 75  ? 35.515  33.234  16.574  1.00 61.22 ? 75   THR A CG2 1 
ATOM   585  N N   . LEU A 1 76  ? 32.947  32.218  12.437  1.00 62.40 ? 76   LEU A N   1 
ATOM   586  C CA  . LEU A 1 76  ? 32.276  32.651  11.213  1.00 62.78 ? 76   LEU A CA  1 
ATOM   587  C C   . LEU A 1 76  ? 31.218  33.756  11.444  1.00 62.66 ? 76   LEU A C   1 
ATOM   588  O O   . LEU A 1 76  ? 31.135  34.707  10.668  1.00 63.14 ? 76   LEU A O   1 
ATOM   589  C CB  . LEU A 1 76  ? 31.671  31.453  10.465  1.00 62.48 ? 76   LEU A CB  1 
ATOM   590  C CG  . LEU A 1 76  ? 31.395  31.674  8.962   1.00 64.07 ? 76   LEU A CG  1 
ATOM   591  C CD1 . LEU A 1 76  ? 32.642  32.173  8.165   1.00 64.61 ? 76   LEU A CD1 1 
ATOM   592  C CD2 . LEU A 1 76  ? 30.767  30.441  8.275   1.00 63.49 ? 76   LEU A CD2 1 
ATOM   593  N N   . TYR A 1 77  ? 30.436  33.636  12.518  1.00 61.96 ? 77   TYR A N   1 
ATOM   594  C CA  . TYR A 1 77  ? 29.333  34.535  12.784  1.00 60.98 ? 77   TYR A CA  1 
ATOM   595  C C   . TYR A 1 77  ? 29.272  34.892  14.273  1.00 61.44 ? 77   TYR A C   1 
ATOM   596  O O   . TYR A 1 77  ? 28.529  34.262  15.043  1.00 61.31 ? 77   TYR A O   1 
ATOM   597  C CB  . TYR A 1 77  ? 28.025  33.872  12.388  1.00 60.19 ? 77   TYR A CB  1 
ATOM   598  C CG  . TYR A 1 77  ? 27.865  33.452  10.944  1.00 59.27 ? 77   TYR A CG  1 
ATOM   599  C CD1 . TYR A 1 77  ? 27.578  34.385  9.954   1.00 58.34 ? 77   TYR A CD1 1 
ATOM   600  C CD2 . TYR A 1 77  ? 27.926  32.110  10.578  1.00 59.20 ? 77   TYR A CD2 1 
ATOM   601  C CE1 . TYR A 1 77  ? 27.388  34.003  8.632   1.00 57.32 ? 77   TYR A CE1 1 
ATOM   602  C CE2 . TYR A 1 77  ? 27.734  31.713  9.252   1.00 58.93 ? 77   TYR A CE2 1 
ATOM   603  C CZ  . TYR A 1 77  ? 27.466  32.671  8.285   1.00 58.57 ? 77   TYR A CZ  1 
ATOM   604  O OH  . TYR A 1 77  ? 27.276  32.295  6.968   1.00 58.91 ? 77   TYR A OH  1 
ATOM   605  N N   . PRO A 1 78  ? 30.043  35.915  14.690  1.00 61.70 ? 78   PRO A N   1 
ATOM   606  C CA  . PRO A 1 78  ? 30.104  36.371  16.091  1.00 61.23 ? 78   PRO A CA  1 
ATOM   607  C C   . PRO A 1 78  ? 28.739  36.784  16.595  1.00 60.74 ? 78   PRO A C   1 
ATOM   608  O O   . PRO A 1 78  ? 27.963  37.383  15.845  1.00 61.32 ? 78   PRO A O   1 
ATOM   609  C CB  . PRO A 1 78  ? 30.990  37.613  16.019  1.00 61.35 ? 78   PRO A CB  1 
ATOM   610  C CG  . PRO A 1 78  ? 31.834  37.390  14.810  1.00 62.38 ? 78   PRO A CG  1 
ATOM   611  C CD  . PRO A 1 78  ? 30.927  36.707  13.817  1.00 61.96 ? 78   PRO A CD  1 
ATOM   612  N N   . GLY A 1 79  ? 28.447  36.467  17.853  1.00 59.73 ? 79   GLY A N   1 
ATOM   613  C CA  . GLY A 1 79  ? 27.179  36.840  18.468  1.00 58.00 ? 79   GLY A CA  1 
ATOM   614  C C   . GLY A 1 79  ? 26.021  35.973  18.022  1.00 56.93 ? 79   GLY A C   1 
ATOM   615  O O   . GLY A 1 79  ? 24.993  35.934  18.683  1.00 56.93 ? 79   GLY A O   1 
ATOM   616  N N   . PHE A 1 80  ? 26.188  35.268  16.905  1.00 55.74 ? 80   PHE A N   1 
ATOM   617  C CA  . PHE A 1 80  ? 25.120  34.461  16.329  1.00 54.37 ? 80   PHE A CA  1 
ATOM   618  C C   . PHE A 1 80  ? 24.884  33.141  17.058  1.00 53.94 ? 80   PHE A C   1 
ATOM   619  O O   . PHE A 1 80  ? 25.739  32.258  17.054  1.00 53.71 ? 80   PHE A O   1 
ATOM   620  C CB  . PHE A 1 80  ? 25.413  34.206  14.852  1.00 54.10 ? 80   PHE A CB  1 
ATOM   621  C CG  . PHE A 1 80  ? 24.368  33.397  14.154  1.00 52.31 ? 80   PHE A CG  1 
ATOM   622  C CD1 . PHE A 1 80  ? 23.043  33.813  14.139  1.00 51.30 ? 80   PHE A CD1 1 
ATOM   623  C CD2 . PHE A 1 80  ? 24.717  32.228  13.491  1.00 51.58 ? 80   PHE A CD2 1 
ATOM   624  C CE1 . PHE A 1 80  ? 22.068  33.071  13.467  1.00 51.60 ? 80   PHE A CE1 1 
ATOM   625  C CE2 . PHE A 1 80  ? 23.758  31.471  12.819  1.00 51.24 ? 80   PHE A CE2 1 
ATOM   626  C CZ  . PHE A 1 80  ? 22.427  31.896  12.806  1.00 52.07 ? 80   PHE A CZ  1 
ATOM   627  N N   . GLU A 1 81  ? 23.698  33.008  17.646  1.00 53.75 ? 81   GLU A N   1 
ATOM   628  C CA  . GLU A 1 81  ? 23.315  31.823  18.419  1.00 53.71 ? 81   GLU A CA  1 
ATOM   629  C C   . GLU A 1 81  ? 23.501  30.511  17.645  1.00 52.53 ? 81   GLU A C   1 
ATOM   630  O O   . GLU A 1 81  ? 24.091  29.560  18.155  1.00 52.69 ? 81   GLU A O   1 
ATOM   631  C CB  . GLU A 1 81  ? 21.868  31.959  18.916  1.00 54.41 ? 81   GLU A CB  1 
ATOM   632  C CG  . GLU A 1 81  ? 21.319  30.722  19.649  1.00 57.52 ? 81   GLU A CG  1 
ATOM   633  C CD  . GLU A 1 81  ? 21.517  30.798  21.169  1.00 62.18 ? 81   GLU A CD  1 
ATOM   634  O OE1 . GLU A 1 81  ? 21.273  31.902  21.733  1.00 63.10 ? 81   GLU A OE1 1 
ATOM   635  O OE2 . GLU A 1 81  ? 21.895  29.760  21.797  1.00 62.06 ? 81   GLU A OE2 1 
ATOM   636  N N   . GLY A 1 82  ? 23.013  30.468  16.413  1.00 51.25 ? 82   GLY A N   1 
ATOM   637  C CA  . GLY A 1 82  ? 23.067  29.253  15.617  1.00 50.03 ? 82   GLY A CA  1 
ATOM   638  C C   . GLY A 1 82  ? 24.423  28.557  15.562  1.00 49.62 ? 82   GLY A C   1 
ATOM   639  O O   . GLY A 1 82  ? 24.471  27.329  15.440  1.00 49.33 ? 82   GLY A O   1 
ATOM   640  N N   . THR A 1 83  ? 25.517  29.331  15.615  1.00 48.73 ? 83   THR A N   1 
ATOM   641  C CA  . THR A 1 83  ? 26.860  28.765  15.644  1.00 47.96 ? 83   THR A CA  1 
ATOM   642  C C   . THR A 1 83  ? 27.407  28.722  17.062  1.00 48.20 ? 83   THR A C   1 
ATOM   643  O O   . THR A 1 83  ? 28.038  27.745  17.433  1.00 47.94 ? 83   THR A O   1 
ATOM   644  C CB  . THR A 1 83  ? 27.882  29.518  14.740  1.00 47.90 ? 83   THR A CB  1 
ATOM   645  O OG1 . THR A 1 83  ? 27.881  30.914  15.052  1.00 47.60 ? 83   THR A OG1 1 
ATOM   646  C CG2 . THR A 1 83  ? 27.585  29.317  13.273  1.00 46.78 ? 83   THR A CG2 1 
ATOM   647  N N   . GLU A 1 84  ? 27.171  29.784  17.840  1.00 48.64 ? 84   GLU A N   1 
ATOM   648  C CA  . GLU A 1 84  ? 27.673  29.886  19.207  1.00 49.18 ? 84   GLU A CA  1 
ATOM   649  C C   . GLU A 1 84  ? 27.216  28.721  20.084  1.00 48.60 ? 84   GLU A C   1 
ATOM   650  O O   . GLU A 1 84  ? 27.977  28.236  20.920  1.00 49.01 ? 84   GLU A O   1 
ATOM   651  C CB  . GLU A 1 84  ? 27.245  31.194  19.880  1.00 50.06 ? 84   GLU A CB  1 
ATOM   652  C CG  . GLU A 1 84  ? 27.742  32.529  19.255  1.00 54.60 ? 84   GLU A CG  1 
ATOM   653  C CD  . GLU A 1 84  ? 29.267  32.705  19.251  1.00 60.45 ? 84   GLU A CD  1 
ATOM   654  O OE1 . GLU A 1 84  ? 29.993  31.751  19.669  1.00 63.10 ? 84   GLU A OE1 1 
ATOM   655  O OE2 . GLU A 1 84  ? 29.728  33.802  18.822  1.00 59.61 ? 84   GLU A OE2 1 
ATOM   656  N N   . MET A 1 85  ? 25.981  28.257  19.903  1.00 47.51 ? 85   MET A N   1 
ATOM   657  C CA  . MET A 1 85  ? 25.493  27.136  20.707  1.00 45.96 ? 85   MET A CA  1 
ATOM   658  C C   . MET A 1 85  ? 26.397  25.894  20.684  1.00 44.13 ? 85   MET A C   1 
ATOM   659  O O   . MET A 1 85  ? 26.329  25.098  21.588  1.00 43.99 ? 85   MET A O   1 
ATOM   660  C CB  . MET A 1 85  ? 24.070  26.766  20.310  1.00 46.01 ? 85   MET A CB  1 
ATOM   661  C CG  . MET A 1 85  ? 23.969  25.965  19.014  1.00 47.02 ? 85   MET A CG  1 
ATOM   662  S SD  . MET A 1 85  ? 22.249  25.627  18.581  1.00 47.36 ? 85   MET A SD  1 
ATOM   663  C CE  . MET A 1 85  ? 21.736  24.564  19.902  1.00 46.92 ? 85   MET A CE  1 
ATOM   664  N N   . TRP A 1 86  ? 27.228  25.725  19.659  1.00 42.80 ? 86   TRP A N   1 
ATOM   665  C CA  . TRP A 1 86  ? 28.084  24.542  19.544  1.00 41.49 ? 86   TRP A CA  1 
ATOM   666  C C   . TRP A 1 86  ? 29.502  24.776  20.071  1.00 41.62 ? 86   TRP A C   1 
ATOM   667  O O   . TRP A 1 86  ? 30.332  23.849  20.120  1.00 41.14 ? 86   TRP A O   1 
ATOM   668  C CB  . TRP A 1 86  ? 28.137  24.032  18.095  1.00 40.74 ? 86   TRP A CB  1 
ATOM   669  C CG  . TRP A 1 86  ? 26.788  23.767  17.513  1.00 40.10 ? 86   TRP A CG  1 
ATOM   670  C CD1 . TRP A 1 86  ? 26.197  24.458  16.526  1.00 38.95 ? 86   TRP A CD1 1 
ATOM   671  C CD2 . TRP A 1 86  ? 25.857  22.742  17.904  1.00 39.21 ? 86   TRP A CD2 1 
ATOM   672  N NE1 . TRP A 1 86  ? 24.961  23.938  16.256  1.00 38.93 ? 86   TRP A NE1 1 
ATOM   673  C CE2 . TRP A 1 86  ? 24.721  22.889  17.094  1.00 39.24 ? 86   TRP A CE2 1 
ATOM   674  C CE3 . TRP A 1 86  ? 25.882  21.708  18.850  1.00 38.36 ? 86   TRP A CE3 1 
ATOM   675  C CZ2 . TRP A 1 86  ? 23.600  22.040  17.194  1.00 40.39 ? 86   TRP A CZ2 1 
ATOM   676  C CZ3 . TRP A 1 86  ? 24.768  20.868  18.955  1.00 39.83 ? 86   TRP A CZ3 1 
ATOM   677  C CH2 . TRP A 1 86  ? 23.646  21.035  18.125  1.00 39.17 ? 86   TRP A CH2 1 
ATOM   678  N N   . ASN A 1 87  ? 29.775  26.011  20.474  1.00 41.44 ? 87   ASN A N   1 
ATOM   679  C CA  . ASN A 1 87  ? 31.130  26.419  20.831  1.00 41.55 ? 87   ASN A CA  1 
ATOM   680  C C   . ASN A 1 87  ? 31.459  26.014  22.249  1.00 40.84 ? 87   ASN A C   1 
ATOM   681  O O   . ASN A 1 87  ? 30.567  25.968  23.085  1.00 41.30 ? 87   ASN A O   1 
ATOM   682  C CB  . ASN A 1 87  ? 31.286  27.937  20.662  1.00 41.85 ? 87   ASN A CB  1 
ATOM   683  C CG  . ASN A 1 87  ? 31.825  28.316  19.284  1.00 44.06 ? 87   ASN A CG  1 
ATOM   684  O OD1 . ASN A 1 87  ? 32.122  27.439  18.445  1.00 46.78 ? 87   ASN A OD1 1 
ATOM   685  N ND2 . ASN A 1 87  ? 31.985  29.619  19.051  1.00 43.70 ? 87   ASN A ND2 1 
ATOM   686  N N   . PRO A 1 88  ? 32.736  25.725  22.527  1.00 39.92 ? 88   PRO A N   1 
ATOM   687  C CA  . PRO A 1 88  ? 33.154  25.326  23.875  1.00 39.40 ? 88   PRO A CA  1 
ATOM   688  C C   . PRO A 1 88  ? 32.632  26.274  24.950  1.00 39.27 ? 88   PRO A C   1 
ATOM   689  O O   . PRO A 1 88  ? 32.675  27.473  24.760  1.00 39.74 ? 88   PRO A O   1 
ATOM   690  C CB  . PRO A 1 88  ? 34.675  25.383  23.798  1.00 39.30 ? 88   PRO A CB  1 
ATOM   691  C CG  . PRO A 1 88  ? 34.991  25.144  22.358  1.00 39.57 ? 88   PRO A CG  1 
ATOM   692  C CD  . PRO A 1 88  ? 33.850  25.722  21.561  1.00 39.50 ? 88   PRO A CD  1 
ATOM   693  N N   . ASN A 1 89  ? 32.122  25.755  26.059  1.00 38.49 ? 89   ASN A N   1 
ATOM   694  C CA  . ASN A 1 89  ? 31.552  26.619  27.071  1.00 38.13 ? 89   ASN A CA  1 
ATOM   695  C C   . ASN A 1 89  ? 32.281  26.477  28.405  1.00 38.58 ? 89   ASN A C   1 
ATOM   696  O O   . ASN A 1 89  ? 31.773  26.860  29.469  1.00 38.05 ? 89   ASN A O   1 
ATOM   697  C CB  . ASN A 1 89  ? 30.078  26.327  27.234  1.00 37.69 ? 89   ASN A CB  1 
ATOM   698  C CG  . ASN A 1 89  ? 29.810  24.946  27.805  1.00 38.11 ? 89   ASN A CG  1 
ATOM   699  O OD1 . ASN A 1 89  ? 30.644  24.036  27.717  1.00 38.41 ? 89   ASN A OD1 1 
ATOM   700  N ND2 . ASN A 1 89  ? 28.624  24.774  28.383  1.00 36.52 ? 89   ASN A ND2 1 
ATOM   701  N N   . ARG A 1 90  ? 33.472  25.887  28.327  1.00 38.74 ? 90   ARG A N   1 
ATOM   702  C CA  . ARG A 1 90  ? 34.401  25.779  29.452  1.00 38.98 ? 90   ARG A CA  1 
ATOM   703  C C   . ARG A 1 90  ? 35.799  25.926  28.877  1.00 38.63 ? 90   ARG A C   1 
ATOM   704  O O   . ARG A 1 90  ? 35.975  25.916  27.665  1.00 38.58 ? 90   ARG A O   1 
ATOM   705  C CB  . ARG A 1 90  ? 34.240  24.448  30.210  1.00 39.30 ? 90   ARG A CB  1 
ATOM   706  C CG  . ARG A 1 90  ? 33.002  24.364  31.118  1.00 39.86 ? 90   ARG A CG  1 
ATOM   707  C CD  . ARG A 1 90  ? 33.097  25.327  32.316  1.00 42.74 ? 90   ARG A CD  1 
ATOM   708  N NE  . ARG A 1 90  ? 31.973  25.161  33.218  1.00 47.88 ? 90   ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 90  ? 30.711  25.491  32.908  1.00 51.42 ? 90   ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 90  ? 30.425  26.022  31.726  1.00 51.11 ? 90   ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 90  ? 29.720  25.293  33.778  1.00 52.32 ? 90   ARG A NH2 1 
ATOM   712  N N   . GLU A 1 91  ? 36.785  26.088  29.743  1.00 38.50 ? 91   GLU A N   1 
ATOM   713  C CA  . GLU A 1 91  ? 38.151  26.309  29.314  1.00 38.32 ? 91   GLU A CA  1 
ATOM   714  C C   . GLU A 1 91  ? 38.693  25.225  28.371  1.00 37.90 ? 91   GLU A C   1 
ATOM   715  O O   . GLU A 1 91  ? 38.536  24.033  28.634  1.00 37.77 ? 91   GLU A O   1 
ATOM   716  C CB  . GLU A 1 91  ? 39.013  26.349  30.552  1.00 38.43 ? 91   GLU A CB  1 
ATOM   717  C CG  . GLU A 1 91  ? 40.469  26.571  30.240  1.00 41.69 ? 91   GLU A CG  1 
ATOM   718  C CD  . GLU A 1 91  ? 41.335  26.465  31.471  1.00 44.35 ? 91   GLU A CD  1 
ATOM   719  O OE1 . GLU A 1 91  ? 40.731  26.379  32.567  1.00 44.05 ? 91   GLU A OE1 1 
ATOM   720  O OE2 . GLU A 1 91  ? 42.594  26.445  31.325  1.00 44.17 ? 91   GLU A OE2 1 
ATOM   721  N N   . LEU A 1 92  ? 39.337  25.630  27.285  1.00 37.42 ? 92   LEU A N   1 
ATOM   722  C CA  . LEU A 1 92  ? 40.042  24.670  26.441  1.00 37.70 ? 92   LEU A CA  1 
ATOM   723  C C   . LEU A 1 92  ? 41.345  24.188  27.078  1.00 37.56 ? 92   LEU A C   1 
ATOM   724  O O   . LEU A 1 92  ? 42.207  24.993  27.415  1.00 38.59 ? 92   LEU A O   1 
ATOM   725  C CB  . LEU A 1 92  ? 40.318  25.240  25.053  1.00 37.84 ? 92   LEU A CB  1 
ATOM   726  C CG  . LEU A 1 92  ? 39.110  25.661  24.215  1.00 38.03 ? 92   LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 92  ? 39.617  26.257  22.922  1.00 38.38 ? 92   LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 92  ? 38.223  24.458  23.920  1.00 38.23 ? 92   LEU A CD2 1 
ATOM   729  N N   . SER A 1 93  ? 41.463  22.880  27.266  1.00 36.62 ? 93   SER A N   1 
ATOM   730  C CA  . SER A 1 93  ? 42.655  22.276  27.814  1.00 35.88 ? 93   SER A CA  1 
ATOM   731  C C   . SER A 1 93  ? 42.804  20.841  27.309  1.00 36.27 ? 93   SER A C   1 
ATOM   732  O O   . SER A 1 93  ? 41.815  20.179  26.922  1.00 36.32 ? 93   SER A O   1 
ATOM   733  C CB  . SER A 1 93  ? 42.612  22.316  29.343  1.00 36.09 ? 93   SER A CB  1 
ATOM   734  O OG  . SER A 1 93  ? 43.455  21.340  29.919  1.00 34.37 ? 93   SER A OG  1 
ATOM   735  N N   . GLU A 1 94  ? 44.044  20.359  27.292  1.00 35.88 ? 94   GLU A N   1 
ATOM   736  C CA  . GLU A 1 94  ? 44.304  18.982  26.871  1.00 34.81 ? 94   GLU A CA  1 
ATOM   737  C C   . GLU A 1 94  ? 43.932  18.052  27.988  1.00 33.78 ? 94   GLU A C   1 
ATOM   738  O O   . GLU A 1 94  ? 43.728  16.865  27.778  1.00 32.97 ? 94   GLU A O   1 
ATOM   739  C CB  . GLU A 1 94  ? 45.770  18.811  26.511  1.00 35.50 ? 94   GLU A CB  1 
ATOM   740  C CG  . GLU A 1 94  ? 46.054  19.072  25.055  1.00 36.99 ? 94   GLU A CG  1 
ATOM   741  C CD  . GLU A 1 94  ? 47.524  18.965  24.748  1.00 41.45 ? 94   GLU A CD  1 
ATOM   742  O OE1 . GLU A 1 94  ? 47.937  17.899  24.251  1.00 40.67 ? 94   GLU A OE1 1 
ATOM   743  O OE2 . GLU A 1 94  ? 48.262  19.958  25.016  1.00 43.21 ? 94   GLU A OE2 1 
ATOM   744  N N   . ASP A 1 95  ? 43.857  18.614  29.189  1.00 33.33 ? 95   ASP A N   1 
ATOM   745  C CA  . ASP A 1 95  ? 43.444  17.878  30.377  1.00 33.75 ? 95   ASP A CA  1 
ATOM   746  C C   . ASP A 1 95  ? 41.910  17.995  30.397  1.00 33.95 ? 95   ASP A C   1 
ATOM   747  O O   . ASP A 1 95  ? 41.342  18.904  31.006  1.00 33.25 ? 95   ASP A O   1 
ATOM   748  C CB  . ASP A 1 95  ? 44.109  18.501  31.606  1.00 32.73 ? 95   ASP A CB  1 
ATOM   749  C CG  . ASP A 1 95  ? 43.573  17.971  32.916  1.00 34.36 ? 95   ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 95  ? 42.702  17.066  32.960  1.00 36.14 ? 95   ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 95  ? 44.044  18.471  33.951  1.00 36.91 ? 95   ASP A OD2 1 
ATOM   752  N N   . CYS A 1 96  ? 41.260  17.086  29.684  1.00 34.37 ? 96   CYS A N   1 
ATOM   753  C CA  . CYS A 1 96  ? 39.831  17.192  29.439  1.00 35.24 ? 96   CYS A CA  1 
ATOM   754  C C   . CYS A 1 96  ? 39.075  15.858  29.546  1.00 35.18 ? 96   CYS A C   1 
ATOM   755  O O   . CYS A 1 96  ? 37.890  15.787  29.221  1.00 35.29 ? 96   CYS A O   1 
ATOM   756  C CB  . CYS A 1 96  ? 39.631  17.772  28.052  1.00 35.16 ? 96   CYS A CB  1 
ATOM   757  S SG  . CYS A 1 96  ? 40.308  16.772  26.752  1.00 36.69 ? 96   CYS A SG  1 
ATOM   758  N N   . LEU A 1 97  ? 39.761  14.803  29.978  1.00 34.88 ? 97   LEU A N   1 
ATOM   759  C CA  . LEU A 1 97  ? 39.137  13.499  30.014  1.00 34.86 ? 97   LEU A CA  1 
ATOM   760  C C   . LEU A 1 97  ? 38.309  13.369  31.294  1.00 34.68 ? 97   LEU A C   1 
ATOM   761  O O   . LEU A 1 97  ? 38.722  12.750  32.271  1.00 35.20 ? 97   LEU A O   1 
ATOM   762  C CB  . LEU A 1 97  ? 40.163  12.364  29.787  1.00 34.33 ? 97   LEU A CB  1 
ATOM   763  C CG  . LEU A 1 97  ? 40.706  12.300  28.337  1.00 35.53 ? 97   LEU A CG  1 
ATOM   764  C CD1 . LEU A 1 97  ? 41.546  11.034  28.044  1.00 34.52 ? 97   LEU A CD1 1 
ATOM   765  C CD2 . LEU A 1 97  ? 39.604  12.444  27.272  1.00 34.42 ? 97   LEU A CD2 1 
ATOM   766  N N   . TYR A 1 98  ? 37.146  14.015  31.278  1.00 34.59 ? 98   TYR A N   1 
ATOM   767  C CA  . TYR A 1 98  ? 36.185  13.952  32.373  1.00 34.10 ? 98   TYR A CA  1 
ATOM   768  C C   . TYR A 1 98  ? 34.838  13.509  31.844  1.00 33.19 ? 98   TYR A C   1 
ATOM   769  O O   . TYR A 1 98  ? 34.587  13.601  30.650  1.00 33.43 ? 98   TYR A O   1 
ATOM   770  C CB  . TYR A 1 98  ? 36.081  15.311  33.053  1.00 34.49 ? 98   TYR A CB  1 
ATOM   771  C CG  . TYR A 1 98  ? 37.417  15.768  33.585  1.00 35.30 ? 98   TYR A CG  1 
ATOM   772  C CD1 . TYR A 1 98  ? 37.762  15.627  34.949  1.00 34.38 ? 98   TYR A CD1 1 
ATOM   773  C CD2 . TYR A 1 98  ? 38.354  16.334  32.727  1.00 36.28 ? 98   TYR A CD2 1 
ATOM   774  C CE1 . TYR A 1 98  ? 39.020  16.065  35.424  1.00 33.28 ? 98   TYR A CE1 1 
ATOM   775  C CE2 . TYR A 1 98  ? 39.609  16.748  33.191  1.00 36.42 ? 98   TYR A CE2 1 
ATOM   776  C CZ  . TYR A 1 98  ? 39.929  16.613  34.523  1.00 35.37 ? 98   TYR A CZ  1 
ATOM   777  O OH  . TYR A 1 98  ? 41.172  17.041  34.892  1.00 36.40 ? 98   TYR A OH  1 
ATOM   778  N N   . LEU A 1 99  ? 33.983  12.999  32.716  1.00 32.70 ? 99   LEU A N   1 
ATOM   779  C CA  . LEU A 1 99  ? 32.627  12.623  32.315  1.00 31.47 ? 99   LEU A CA  1 
ATOM   780  C C   . LEU A 1 99  ? 31.578  13.131  33.306  1.00 31.40 ? 99   LEU A C   1 
ATOM   781  O O   . LEU A 1 99  ? 31.935  13.628  34.388  1.00 30.35 ? 99   LEU A O   1 
ATOM   782  C CB  . LEU A 1 99  ? 32.516  11.105  32.100  1.00 31.79 ? 99   LEU A CB  1 
ATOM   783  C CG  . LEU A 1 99  ? 32.832  10.086  33.206  1.00 31.59 ? 99   LEU A CG  1 
ATOM   784  C CD1 . LEU A 1 99  ? 31.814  10.145  34.343  1.00 30.55 ? 99   LEU A CD1 1 
ATOM   785  C CD2 . LEU A 1 99  ? 32.876  8.658   32.626  1.00 29.56 ? 99   LEU A CD2 1 
ATOM   786  N N   . ASN A 1 100 ? 30.296  13.000  32.931  1.00 31.05 ? 100  ASN A N   1 
ATOM   787  C CA  . ASN A 1 100 ? 29.174  13.543  33.715  1.00 30.93 ? 100  ASN A CA  1 
ATOM   788  C C   . ASN A 1 100 ? 28.053  12.529  33.905  1.00 32.07 ? 100  ASN A C   1 
ATOM   789  O O   . ASN A 1 100 ? 27.739  11.760  32.981  1.00 32.67 ? 100  ASN A O   1 
ATOM   790  C CB  . ASN A 1 100 ? 28.604  14.784  33.034  1.00 30.40 ? 100  ASN A CB  1 
ATOM   791  C CG  . ASN A 1 100 ? 29.683  15.693  32.491  1.00 29.14 ? 100  ASN A CG  1 
ATOM   792  O OD1 . ASN A 1 100 ? 30.407  16.337  33.259  1.00 27.98 ? 100  ASN A OD1 1 
ATOM   793  N ND2 . ASN A 1 100 ? 29.815  15.740  31.163  1.00 25.10 ? 100  ASN A ND2 1 
ATOM   794  N N   . VAL A 1 101 ? 27.451  12.515  35.096  1.00 32.86 ? 101  VAL A N   1 
ATOM   795  C CA  . VAL A 1 101 ? 26.328  11.624  35.375  1.00 33.62 ? 101  VAL A CA  1 
ATOM   796  C C   . VAL A 1 101 ? 25.111  12.410  35.899  1.00 34.70 ? 101  VAL A C   1 
ATOM   797  O O   . VAL A 1 101 ? 25.238  13.237  36.815  1.00 34.01 ? 101  VAL A O   1 
ATOM   798  C CB  . VAL A 1 101 ? 26.724  10.533  36.404  1.00 33.92 ? 101  VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 101 ? 25.541  9.610   36.701  1.00 32.34 ? 101  VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 101 ? 27.924  9.744   35.921  1.00 33.52 ? 101  VAL A CG2 1 
ATOM   801  N N   . TRP A 1 102 ? 23.942  12.161  35.303  1.00 35.84 ? 102  TRP A N   1 
ATOM   802  C CA  . TRP A 1 102 ? 22.669  12.659  35.845  1.00 36.56 ? 102  TRP A CA  1 
ATOM   803  C C   . TRP A 1 102 ? 21.823  11.454  36.218  1.00 37.61 ? 102  TRP A C   1 
ATOM   804  O O   . TRP A 1 102 ? 21.698  10.501  35.425  1.00 38.14 ? 102  TRP A O   1 
ATOM   805  C CB  . TRP A 1 102 ? 21.881  13.472  34.827  1.00 36.57 ? 102  TRP A CB  1 
ATOM   806  C CG  . TRP A 1 102 ? 22.370  14.847  34.567  1.00 36.57 ? 102  TRP A CG  1 
ATOM   807  C CD1 . TRP A 1 102 ? 22.025  15.986  35.237  1.00 36.95 ? 102  TRP A CD1 1 
ATOM   808  C CD2 . TRP A 1 102 ? 23.287  15.245  33.545  1.00 36.26 ? 102  TRP A CD2 1 
ATOM   809  N NE1 . TRP A 1 102 ? 22.681  17.075  34.703  1.00 37.44 ? 102  TRP A NE1 1 
ATOM   810  C CE2 . TRP A 1 102 ? 23.458  16.646  33.659  1.00 37.03 ? 102  TRP A CE2 1 
ATOM   811  C CE3 . TRP A 1 102 ? 23.977  14.554  32.541  1.00 35.93 ? 102  TRP A CE3 1 
ATOM   812  C CZ2 . TRP A 1 102 ? 24.282  17.370  32.805  1.00 36.85 ? 102  TRP A CZ2 1 
ATOM   813  C CZ3 . TRP A 1 102 ? 24.789  15.272  31.686  1.00 37.20 ? 102  TRP A CZ3 1 
ATOM   814  C CH2 . TRP A 1 102 ? 24.942  16.669  31.827  1.00 37.37 ? 102  TRP A CH2 1 
ATOM   815  N N   . THR A 1 103 ? 21.243  11.503  37.415  1.00 38.19 ? 103  THR A N   1 
ATOM   816  C CA  . THR A 1 103 ? 20.306  10.498  37.895  1.00 39.21 ? 103  THR A CA  1 
ATOM   817  C C   . THR A 1 103 ? 19.231  11.251  38.622  1.00 39.87 ? 103  THR A C   1 
ATOM   818  O O   . THR A 1 103 ? 19.454  12.399  39.015  1.00 40.38 ? 103  THR A O   1 
ATOM   819  C CB  . THR A 1 103 ? 20.947  9.537   38.927  1.00 38.77 ? 103  THR A CB  1 
ATOM   820  O OG1 . THR A 1 103 ? 21.532  10.297  39.978  1.00 39.24 ? 103  THR A OG1 1 
ATOM   821  C CG2 . THR A 1 103 ? 22.016  8.736   38.310  1.00 40.75 ? 103  THR A CG2 1 
ATOM   822  N N   . PRO A 1 104 ? 18.063  10.617  38.815  1.00 41.02 ? 104  PRO A N   1 
ATOM   823  C CA  . PRO A 1 104 ? 16.994  11.139  39.668  1.00 42.03 ? 104  PRO A CA  1 
ATOM   824  C C   . PRO A 1 104 ? 17.436  11.539  41.067  1.00 42.99 ? 104  PRO A C   1 
ATOM   825  O O   . PRO A 1 104 ? 18.560  11.242  41.485  1.00 44.03 ? 104  PRO A O   1 
ATOM   826  C CB  . PRO A 1 104 ? 16.012  9.971   39.757  1.00 41.69 ? 104  PRO A CB  1 
ATOM   827  C CG  . PRO A 1 104 ? 16.190  9.259   38.487  1.00 42.22 ? 104  PRO A CG  1 
ATOM   828  C CD  . PRO A 1 104 ? 17.666  9.353   38.169  1.00 40.93 ? 104  PRO A CD  1 
ATOM   829  N N   . TYR A 1 105 ? 16.547  12.235  41.764  1.00 43.92 ? 105  TYR A N   1 
ATOM   830  C CA  . TYR A 1 105 ? 16.748  12.637  43.133  1.00 45.13 ? 105  TYR A CA  1 
ATOM   831  C C   . TYR A 1 105 ? 15.452  12.318  43.838  1.00 46.92 ? 105  TYR A C   1 
ATOM   832  O O   . TYR A 1 105 ? 14.396  12.857  43.475  1.00 48.06 ? 105  TYR A O   1 
ATOM   833  C CB  . TYR A 1 105 ? 16.989  14.119  43.192  1.00 44.21 ? 105  TYR A CB  1 
ATOM   834  C CG  . TYR A 1 105 ? 17.441  14.652  44.524  1.00 43.35 ? 105  TYR A CG  1 
ATOM   835  C CD1 . TYR A 1 105 ? 18.788  14.920  44.758  1.00 41.57 ? 105  TYR A CD1 1 
ATOM   836  C CD2 . TYR A 1 105 ? 16.520  14.936  45.542  1.00 42.17 ? 105  TYR A CD2 1 
ATOM   837  C CE1 . TYR A 1 105 ? 19.208  15.457  45.981  1.00 41.60 ? 105  TYR A CE1 1 
ATOM   838  C CE2 . TYR A 1 105 ? 16.933  15.475  46.769  1.00 39.29 ? 105  TYR A CE2 1 
ATOM   839  C CZ  . TYR A 1 105 ? 18.273  15.728  46.971  1.00 41.36 ? 105  TYR A CZ  1 
ATOM   840  O OH  . TYR A 1 105 ? 18.704  16.249  48.161  1.00 42.04 ? 105  TYR A OH  1 
ATOM   841  N N   . PRO A 1 106 ? 15.497  11.401  44.808  1.00 47.78 ? 106  PRO A N   1 
ATOM   842  C CA  . PRO A 1 106 ? 16.678  10.657  45.242  1.00 48.19 ? 106  PRO A CA  1 
ATOM   843  C C   . PRO A 1 106 ? 17.075  9.607   44.192  1.00 48.74 ? 106  PRO A C   1 
ATOM   844  O O   . PRO A 1 106 ? 16.239  9.236   43.358  1.00 48.48 ? 106  PRO A O   1 
ATOM   845  C CB  . PRO A 1 106 ? 16.198  9.957   46.536  1.00 48.04 ? 106  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 106 ? 14.823  10.460  46.813  1.00 47.97 ? 106  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 106 ? 14.280  10.995  45.531  1.00 47.77 ? 106  PRO A CD  1 
ATOM   848  N N   . ARG A 1 107 ? 18.317  9.122   44.230  1.00 49.44 ? 107  ARG A N   1 
ATOM   849  C CA  . ARG A 1 107 ? 18.744  8.039   43.314  1.00 50.66 ? 107  ARG A CA  1 
ATOM   850  C C   . ARG A 1 107 ? 17.747  6.885   43.408  1.00 50.96 ? 107  ARG A C   1 
ATOM   851  O O   . ARG A 1 107 ? 17.208  6.625   44.474  1.00 51.41 ? 107  ARG A O   1 
ATOM   852  C CB  . ARG A 1 107 ? 20.185  7.561   43.603  1.00 50.16 ? 107  ARG A CB  1 
ATOM   853  C CG  . ARG A 1 107 ? 21.265  8.680   43.489  1.00 50.76 ? 107  ARG A CG  1 
ATOM   854  C CD  . ARG A 1 107 ? 22.693  8.157   43.581  1.00 51.84 ? 107  ARG A CD  1 
ATOM   855  N NE  . ARG A 1 107 ? 22.936  7.313   44.765  1.00 54.42 ? 107  ARG A NE  1 
ATOM   856  C CZ  . ARG A 1 107 ? 23.486  7.744   45.904  1.00 55.78 ? 107  ARG A CZ  1 
ATOM   857  N NH1 . ARG A 1 107 ? 23.855  9.013   46.040  1.00 55.78 ? 107  ARG A NH1 1 
ATOM   858  N NH2 . ARG A 1 107 ? 23.657  6.909   46.923  1.00 56.55 ? 107  ARG A NH2 1 
ATOM   859  N N   . PRO A 1 108 ? 17.456  6.215   42.290  1.00 51.80 ? 108  PRO A N   1 
ATOM   860  C CA  . PRO A 1 108 ? 16.490  5.103   42.370  1.00 52.79 ? 108  PRO A CA  1 
ATOM   861  C C   . PRO A 1 108 ? 17.004  3.886   43.151  1.00 53.93 ? 108  PRO A C   1 
ATOM   862  O O   . PRO A 1 108 ? 18.197  3.559   43.083  1.00 54.58 ? 108  PRO A O   1 
ATOM   863  C CB  . PRO A 1 108 ? 16.267  4.729   40.907  1.00 52.94 ? 108  PRO A CB  1 
ATOM   864  C CG  . PRO A 1 108 ? 17.514  5.246   40.179  1.00 51.74 ? 108  PRO A CG  1 
ATOM   865  C CD  . PRO A 1 108 ? 17.957  6.451   40.921  1.00 51.61 ? 108  PRO A CD  1 
ATOM   866  N N   . ALA A 1 109 ? 16.109  3.221   43.872  1.00 55.19 ? 109  ALA A N   1 
ATOM   867  C CA  . ALA A 1 109 ? 16.460  2.007   44.647  1.00 56.40 ? 109  ALA A CA  1 
ATOM   868  C C   . ALA A 1 109 ? 16.746  0.806   43.735  1.00 56.74 ? 109  ALA A C   1 
ATOM   869  O O   . ALA A 1 109 ? 17.737  0.110   43.925  1.00 56.96 ? 109  ALA A O   1 
ATOM   870  C CB  . ALA A 1 109 ? 15.344  1.656   45.661  1.00 56.70 ? 109  ALA A CB  1 
ATOM   871  N N   . SER A 1 110 ? 15.876  0.569   42.752  1.00 56.81 ? 110  SER A N   1 
ATOM   872  C CA  . SER A 1 110 ? 16.114  -0.475  41.755  1.00 56.85 ? 110  SER A CA  1 
ATOM   873  C C   . SER A 1 110 ? 16.982  0.051   40.586  1.00 56.72 ? 110  SER A C   1 
ATOM   874  O O   . SER A 1 110 ? 16.845  1.217   40.184  1.00 57.04 ? 110  SER A O   1 
ATOM   875  C CB  . SER A 1 110 ? 14.785  -1.003  41.227  1.00 56.94 ? 110  SER A CB  1 
ATOM   876  O OG  . SER A 1 110 ? 14.076  0.037   40.587  1.00 56.77 ? 110  SER A OG  1 
ATOM   877  N N   . PRO A 1 111 ? 17.879  -0.802  40.044  1.00 55.93 ? 111  PRO A N   1 
ATOM   878  C CA  . PRO A 1 111 ? 18.726  -0.428  38.901  1.00 54.97 ? 111  PRO A CA  1 
ATOM   879  C C   . PRO A 1 111 ? 17.922  0.085   37.698  1.00 54.05 ? 111  PRO A C   1 
ATOM   880  O O   . PRO A 1 111 ? 16.885  -0.479  37.347  1.00 54.39 ? 111  PRO A O   1 
ATOM   881  C CB  . PRO A 1 111 ? 19.461  -1.732  38.554  1.00 55.25 ? 111  PRO A CB  1 
ATOM   882  C CG  . PRO A 1 111 ? 18.710  -2.826  39.270  1.00 55.86 ? 111  PRO A CG  1 
ATOM   883  C CD  . PRO A 1 111 ? 18.148  -2.181  40.493  1.00 55.97 ? 111  PRO A CD  1 
ATOM   884  N N   . THR A 1 112 ? 18.415  1.162   37.091  1.00 52.70 ? 112  THR A N   1 
ATOM   885  C CA  . THR A 1 112 ? 17.736  1.885   36.025  1.00 50.73 ? 112  THR A CA  1 
ATOM   886  C C   . THR A 1 112 ? 18.584  1.864   34.765  1.00 49.44 ? 112  THR A C   1 
ATOM   887  O O   . THR A 1 112 ? 19.805  1.996   34.838  1.00 48.86 ? 112  THR A O   1 
ATOM   888  C CB  . THR A 1 112 ? 17.596  3.360   36.387  1.00 50.75 ? 112  THR A CB  1 
ATOM   889  O OG1 . THR A 1 112 ? 17.513  3.489   37.807  1.00 51.16 ? 112  THR A OG1 1 
ATOM   890  C CG2 . THR A 1 112 ? 16.358  3.949   35.747  1.00 51.19 ? 112  THR A CG2 1 
ATOM   891  N N   . PRO A 1 113 ? 17.932  1.717   33.605  1.00 48.11 ? 113  PRO A N   1 
ATOM   892  C CA  . PRO A 1 113 ? 18.583  1.813   32.301  1.00 46.93 ? 113  PRO A CA  1 
ATOM   893  C C   . PRO A 1 113 ? 19.443  3.080   32.149  1.00 44.91 ? 113  PRO A C   1 
ATOM   894  O O   . PRO A 1 113 ? 19.024  4.167   32.529  1.00 44.14 ? 113  PRO A O   1 
ATOM   895  C CB  . PRO A 1 113 ? 17.393  1.852   31.329  1.00 47.19 ? 113  PRO A CB  1 
ATOM   896  C CG  . PRO A 1 113 ? 16.365  1.036   32.011  1.00 48.18 ? 113  PRO A CG  1 
ATOM   897  C CD  . PRO A 1 113 ? 16.493  1.425   33.467  1.00 48.14 ? 113  PRO A CD  1 
ATOM   898  N N   . VAL A 1 114 ? 20.639  2.896   31.601  1.00 43.02 ? 114  VAL A N   1 
ATOM   899  C CA  . VAL A 1 114 ? 21.615  3.951   31.424  1.00 41.33 ? 114  VAL A CA  1 
ATOM   900  C C   . VAL A 1 114 ? 21.697  4.348   29.951  1.00 40.83 ? 114  VAL A C   1 
ATOM   901  O O   . VAL A 1 114 ? 21.777  3.484   29.064  1.00 40.71 ? 114  VAL A O   1 
ATOM   902  C CB  . VAL A 1 114 ? 23.011  3.496   31.901  1.00 41.04 ? 114  VAL A CB  1 
ATOM   903  C CG1 . VAL A 1 114 ? 24.063  4.584   31.659  1.00 39.17 ? 114  VAL A CG1 1 
ATOM   904  C CG2 . VAL A 1 114 ? 22.964  3.084   33.376  1.00 40.73 ? 114  VAL A CG2 1 
ATOM   905  N N   . LEU A 1 115 ? 21.678  5.654   29.709  1.00 39.51 ? 115  LEU A N   1 
ATOM   906  C CA  . LEU A 1 115 ? 21.825  6.215   28.381  1.00 38.53 ? 115  LEU A CA  1 
ATOM   907  C C   . LEU A 1 115 ? 23.140  6.966   28.351  1.00 37.59 ? 115  LEU A C   1 
ATOM   908  O O   . LEU A 1 115 ? 23.349  7.864   29.171  1.00 37.90 ? 115  LEU A O   1 
ATOM   909  C CB  . LEU A 1 115 ? 20.664  7.179   28.112  1.00 38.82 ? 115  LEU A CB  1 
ATOM   910  C CG  . LEU A 1 115 ? 19.367  6.598   27.532  1.00 40.83 ? 115  LEU A CG  1 
ATOM   911  C CD1 . LEU A 1 115 ? 18.260  7.611   27.554  1.00 40.26 ? 115  LEU A CD1 1 
ATOM   912  C CD2 . LEU A 1 115 ? 19.635  6.225   26.086  1.00 45.27 ? 115  LEU A CD2 1 
ATOM   913  N N   . ILE A 1 116 ? 24.030  6.596   27.437  1.00 36.33 ? 116  ILE A N   1 
ATOM   914  C CA  . ILE A 1 116 ? 25.333  7.263   27.323  1.00 35.30 ? 116  ILE A CA  1 
ATOM   915  C C   . ILE A 1 116 ? 25.415  8.087   26.035  1.00 35.11 ? 116  ILE A C   1 
ATOM   916  O O   . ILE A 1 116 ? 25.290  7.538   24.922  1.00 34.86 ? 116  ILE A O   1 
ATOM   917  C CB  . ILE A 1 116 ? 26.513  6.279   27.366  1.00 35.49 ? 116  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 116 ? 26.452  5.427   28.631  1.00 36.91 ? 116  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 116 ? 27.868  7.019   27.277  1.00 32.91 ? 116  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 116 ? 27.557  4.384   28.716  1.00 37.97 ? 116  ILE A CD1 1 
ATOM   921  N N   . TRP A 1 117 ? 25.642  9.396   26.192  1.00 33.68 ? 117  TRP A N   1 
ATOM   922  C CA  . TRP A 1 117 ? 25.648  10.324  25.063  1.00 32.76 ? 117  TRP A CA  1 
ATOM   923  C C   . TRP A 1 117 ? 27.043  10.493  24.521  1.00 31.80 ? 117  TRP A C   1 
ATOM   924  O O   . TRP A 1 117 ? 27.982  10.698  25.288  1.00 32.52 ? 117  TRP A O   1 
ATOM   925  C CB  . TRP A 1 117 ? 25.116  11.699  25.489  1.00 32.71 ? 117  TRP A CB  1 
ATOM   926  C CG  . TRP A 1 117 ? 25.198  12.766  24.388  1.00 33.19 ? 117  TRP A CG  1 
ATOM   927  C CD1 . TRP A 1 117 ? 26.010  13.858  24.358  1.00 32.03 ? 117  TRP A CD1 1 
ATOM   928  C CD2 . TRP A 1 117 ? 24.430  12.807  23.174  1.00 32.65 ? 117  TRP A CD2 1 
ATOM   929  N NE1 . TRP A 1 117 ? 25.802  14.571  23.209  1.00 30.95 ? 117  TRP A NE1 1 
ATOM   930  C CE2 . TRP A 1 117 ? 24.832  13.953  22.467  1.00 31.17 ? 117  TRP A CE2 1 
ATOM   931  C CE3 . TRP A 1 117 ? 23.420  11.995  22.634  1.00 31.94 ? 117  TRP A CE3 1 
ATOM   932  C CZ2 . TRP A 1 117 ? 24.256  14.324  21.241  1.00 31.74 ? 117  TRP A CZ2 1 
ATOM   933  C CZ3 . TRP A 1 117 ? 22.853  12.355  21.414  1.00 32.46 ? 117  TRP A CZ3 1 
ATOM   934  C CH2 . TRP A 1 117 ? 23.279  13.515  20.731  1.00 32.47 ? 117  TRP A CH2 1 
ATOM   935  N N   . ILE A 1 118 ? 27.183  10.408  23.208  1.00 31.02 ? 118  ILE A N   1 
ATOM   936  C CA  . ILE A 1 118 ? 28.452  10.731  22.558  1.00 30.01 ? 118  ILE A CA  1 
ATOM   937  C C   . ILE A 1 118 ? 28.274  11.906  21.583  1.00 29.85 ? 118  ILE A C   1 
ATOM   938  O O   . ILE A 1 118 ? 27.675  11.753  20.525  1.00 29.11 ? 118  ILE A O   1 
ATOM   939  C CB  . ILE A 1 118 ? 29.070  9.523   21.849  1.00 30.07 ? 118  ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 118 ? 29.212  8.339   22.811  1.00 29.86 ? 118  ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 118 ? 30.444  9.912   21.276  1.00 28.68 ? 118  ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 118 ? 29.871  7.080   22.154  1.00 28.26 ? 118  ILE A CD1 1 
ATOM   943  N N   . TYR A 1 119 ? 28.773  13.077  21.960  1.00 29.14 ? 119  TYR A N   1 
ATOM   944  C CA  . TYR A 1 119 ? 28.549  14.289  21.172  1.00 28.75 ? 119  TYR A CA  1 
ATOM   945  C C   . TYR A 1 119 ? 29.212  14.272  19.790  1.00 29.52 ? 119  TYR A C   1 
ATOM   946  O O   . TYR A 1 119 ? 30.207  13.549  19.576  1.00 28.73 ? 119  TYR A O   1 
ATOM   947  C CB  . TYR A 1 119 ? 29.059  15.508  21.933  1.00 28.96 ? 119  TYR A CB  1 
ATOM   948  C CG  . TYR A 1 119 ? 30.559  15.509  22.294  1.00 28.64 ? 119  TYR A CG  1 
ATOM   949  C CD1 . TYR A 1 119 ? 31.562  15.705  21.318  1.00 29.46 ? 119  TYR A CD1 1 
ATOM   950  C CD2 . TYR A 1 119 ? 30.952  15.422  23.618  1.00 24.80 ? 119  TYR A CD2 1 
ATOM   951  C CE1 . TYR A 1 119 ? 32.950  15.755  21.684  1.00 28.81 ? 119  TYR A CE1 1 
ATOM   952  C CE2 . TYR A 1 119 ? 32.281  15.464  23.985  1.00 28.45 ? 119  TYR A CE2 1 
ATOM   953  C CZ  . TYR A 1 119 ? 33.285  15.628  23.031  1.00 29.35 ? 119  TYR A CZ  1 
ATOM   954  O OH  . TYR A 1 119 ? 34.601  15.643  23.485  1.00 29.55 ? 119  TYR A OH  1 
ATOM   955  N N   . GLY A 1 120 ? 28.662  15.084  18.869  1.00 29.02 ? 120  GLY A N   1 
ATOM   956  C CA  . GLY A 1 120 ? 29.237  15.274  17.544  1.00 28.55 ? 120  GLY A CA  1 
ATOM   957  C C   . GLY A 1 120 ? 30.128  16.508  17.470  1.00 29.20 ? 120  GLY A C   1 
ATOM   958  O O   . GLY A 1 120 ? 30.478  17.121  18.500  1.00 28.69 ? 120  GLY A O   1 
ATOM   959  N N   . GLY A 1 121 ? 30.488  16.899  16.251  1.00 29.71 ? 121  GLY A N   1 
ATOM   960  C CA  . GLY A 1 121 ? 31.446  17.999  16.059  1.00 30.79 ? 121  GLY A CA  1 
ATOM   961  C C   . GLY A 1 121 ? 32.533  17.643  15.052  1.00 31.54 ? 121  GLY A C   1 
ATOM   962  O O   . GLY A 1 121 ? 33.644  18.210  15.094  1.00 31.73 ? 121  GLY A O   1 
ATOM   963  N N   . GLY A 1 122 ? 32.208  16.675  14.187  1.00 31.09 ? 122  GLY A N   1 
ATOM   964  C CA  . GLY A 1 122 ? 33.021  16.274  13.067  1.00 31.01 ? 122  GLY A CA  1 
ATOM   965  C C   . GLY A 1 122 ? 34.352  15.659  13.451  1.00 31.79 ? 122  GLY A C   1 
ATOM   966  O O   . GLY A 1 122 ? 35.225  15.530  12.590  1.00 31.71 ? 122  GLY A O   1 
ATOM   967  N N   . PHE A 1 123 ? 34.502  15.266  14.723  1.00 31.57 ? 123  PHE A N   1 
ATOM   968  C CA  . PHE A 1 123 ? 35.777  14.736  15.249  1.00 31.47 ? 123  PHE A CA  1 
ATOM   969  C C   . PHE A 1 123 ? 36.849  15.824  15.444  1.00 32.29 ? 123  PHE A C   1 
ATOM   970  O O   . PHE A 1 123 ? 38.002  15.489  15.736  1.00 32.27 ? 123  PHE A O   1 
ATOM   971  C CB  . PHE A 1 123 ? 36.346  13.603  14.381  1.00 30.87 ? 123  PHE A CB  1 
ATOM   972  C CG  . PHE A 1 123 ? 35.491  12.345  14.355  1.00 28.98 ? 123  PHE A CG  1 
ATOM   973  C CD1 . PHE A 1 123 ? 35.228  11.636  15.520  1.00 27.49 ? 123  PHE A CD1 1 
ATOM   974  C CD2 . PHE A 1 123 ? 34.975  11.875  13.162  1.00 26.41 ? 123  PHE A CD2 1 
ATOM   975  C CE1 . PHE A 1 123 ? 34.434  10.473  15.500  1.00 28.41 ? 123  PHE A CE1 1 
ATOM   976  C CE2 . PHE A 1 123 ? 34.190  10.727  13.124  1.00 26.59 ? 123  PHE A CE2 1 
ATOM   977  C CZ  . PHE A 1 123 ? 33.919  10.020  14.298  1.00 27.19 ? 123  PHE A CZ  1 
ATOM   978  N N   . TYR A 1 124 ? 36.462  17.108  15.297  1.00 32.21 ? 124  TYR A N   1 
ATOM   979  C CA  . TYR A 1 124 ? 37.357  18.255  15.553  1.00 32.16 ? 124  TYR A CA  1 
ATOM   980  C C   . TYR A 1 124 ? 36.813  19.195  16.619  1.00 31.96 ? 124  TYR A C   1 
ATOM   981  O O   . TYR A 1 124 ? 37.487  20.150  16.994  1.00 32.61 ? 124  TYR A O   1 
ATOM   982  C CB  . TYR A 1 124 ? 37.676  19.069  14.275  1.00 32.26 ? 124  TYR A CB  1 
ATOM   983  C CG  . TYR A 1 124 ? 36.458  19.771  13.715  1.00 32.52 ? 124  TYR A CG  1 
ATOM   984  C CD1 . TYR A 1 124 ? 36.040  21.014  14.202  1.00 33.01 ? 124  TYR A CD1 1 
ATOM   985  C CD2 . TYR A 1 124 ? 35.683  19.154  12.744  1.00 34.20 ? 124  TYR A CD2 1 
ATOM   986  C CE1 . TYR A 1 124 ? 34.887  21.636  13.708  1.00 32.37 ? 124  TYR A CE1 1 
ATOM   987  C CE2 . TYR A 1 124 ? 34.551  19.758  12.243  1.00 34.85 ? 124  TYR A CE2 1 
ATOM   988  C CZ  . TYR A 1 124 ? 34.160  20.989  12.734  1.00 33.47 ? 124  TYR A CZ  1 
ATOM   989  O OH  . TYR A 1 124 ? 33.024  21.525  12.215  1.00 34.15 ? 124  TYR A OH  1 
ATOM   990  N N   . SER A 1 125 ? 35.597  18.958  17.089  1.00 31.63 ? 125  SER A N   1 
ATOM   991  C CA  . SER A 1 125 ? 35.015  19.788  18.142  1.00 31.48 ? 125  SER A CA  1 
ATOM   992  C C   . SER A 1 125 ? 33.971  19.024  18.945  1.00 31.75 ? 125  SER A C   1 
ATOM   993  O O   . SER A 1 125 ? 33.636  17.866  18.632  1.00 30.96 ? 125  SER A O   1 
ATOM   994  C CB  . SER A 1 125 ? 34.371  21.062  17.562  1.00 31.55 ? 125  SER A CB  1 
ATOM   995  O OG  . SER A 1 125 ? 33.433  20.739  16.538  1.00 32.46 ? 125  SER A OG  1 
ATOM   996  N N   . GLY A 1 126 ? 33.440  19.703  19.961  1.00 31.72 ? 126  GLY A N   1 
ATOM   997  C CA  . GLY A 1 126 ? 32.380  19.156  20.764  1.00 32.20 ? 126  GLY A CA  1 
ATOM   998  C C   . GLY A 1 126 ? 32.736  19.099  22.219  1.00 32.87 ? 126  GLY A C   1 
ATOM   999  O O   . GLY A 1 126 ? 33.908  19.276  22.611  1.00 31.98 ? 126  GLY A O   1 
ATOM   1000 N N   . ALA A 1 127 ? 31.711  18.865  23.036  1.00 32.86 ? 127  ALA A N   1 
ATOM   1001 C CA  . ALA A 1 127 ? 31.865  18.964  24.490  1.00 33.25 ? 127  ALA A CA  1 
ATOM   1002 C C   . ALA A 1 127 ? 30.628  18.414  25.173  1.00 33.21 ? 127  ALA A C   1 
ATOM   1003 O O   . ALA A 1 127 ? 29.522  18.614  24.696  1.00 34.17 ? 127  ALA A O   1 
ATOM   1004 C CB  . ALA A 1 127 ? 32.151  20.414  24.912  1.00 32.28 ? 127  ALA A CB  1 
ATOM   1005 N N   . ALA A 1 128 ? 30.801  17.692  26.271  1.00 33.14 ? 128  ALA A N   1 
ATOM   1006 C CA  . ALA A 1 128 ? 29.645  17.042  26.890  1.00 32.75 ? 128  ALA A CA  1 
ATOM   1007 C C   . ALA A 1 128 ? 28.829  18.063  27.676  1.00 32.81 ? 128  ALA A C   1 
ATOM   1008 O O   . ALA A 1 128 ? 27.741  17.757  28.164  1.00 33.25 ? 128  ALA A O   1 
ATOM   1009 C CB  . ALA A 1 128 ? 30.078  15.905  27.789  1.00 31.94 ? 128  ALA A CB  1 
ATOM   1010 N N   . SER A 1 129 ? 29.361  19.273  27.770  1.00 31.80 ? 129  SER A N   1 
ATOM   1011 C CA  . SER A 1 129 ? 28.866  20.269  28.667  1.00 31.96 ? 129  SER A CA  1 
ATOM   1012 C C   . SER A 1 129 ? 28.036  21.370  27.969  1.00 32.57 ? 129  SER A C   1 
ATOM   1013 O O   . SER A 1 129 ? 27.679  22.373  28.608  1.00 32.33 ? 129  SER A O   1 
ATOM   1014 C CB  . SER A 1 129 ? 30.068  20.902  29.366  1.00 31.59 ? 129  SER A CB  1 
ATOM   1015 O OG  . SER A 1 129 ? 30.933  21.477  28.400  1.00 30.04 ? 129  SER A OG  1 
ATOM   1016 N N   . LEU A 1 130 ? 27.751  21.215  26.679  1.00 32.75 ? 130  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 130 ? 26.853  22.167  26.001  1.00 34.14 ? 130  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 130 ? 25.406  22.072  26.536  1.00 34.62 ? 130  LEU A C   1 
ATOM   1019 O O   . LEU A 1 130 ? 24.943  20.998  26.921  1.00 35.18 ? 130  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 130 ? 26.880  21.971  24.481  1.00 34.16 ? 130  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 130 ? 28.239  21.807  23.781  1.00 34.33 ? 130  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 130 ? 28.004  21.576  22.313  1.00 35.11 ? 130  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 130 ? 29.139  23.011  23.996  1.00 32.47 ? 130  LEU A CD2 1 
ATOM   1024 N N   . ASP A 1 131 ? 24.709  23.201  26.590  1.00 35.75 ? 131  ASP A N   1 
ATOM   1025 C CA  . ASP A 1 131 ? 23.321  23.262  27.115  1.00 35.92 ? 131  ASP A CA  1 
ATOM   1026 C C   . ASP A 1 131 ? 22.404  22.233  26.497  1.00 35.54 ? 131  ASP A C   1 
ATOM   1027 O O   . ASP A 1 131 ? 21.610  21.620  27.224  1.00 35.50 ? 131  ASP A O   1 
ATOM   1028 C CB  . ASP A 1 131 ? 22.697  24.618  26.880  1.00 35.72 ? 131  ASP A CB  1 
ATOM   1029 C CG  . ASP A 1 131 ? 23.302  25.693  27.736  1.00 39.47 ? 131  ASP A CG  1 
ATOM   1030 O OD1 . ASP A 1 131 ? 23.939  25.401  28.788  1.00 40.63 ? 131  ASP A OD1 1 
ATOM   1031 O OD2 . ASP A 1 131 ? 23.135  26.865  27.335  1.00 44.42 ? 131  ASP A OD2 1 
ATOM   1032 N N   . VAL A 1 132 ? 22.522  22.028  25.185  1.00 34.89 ? 132  VAL A N   1 
ATOM   1033 C CA  . VAL A 1 132 ? 21.652  21.069  24.507  1.00 35.35 ? 132  VAL A CA  1 
ATOM   1034 C C   . VAL A 1 132 ? 21.939  19.622  24.839  1.00 35.75 ? 132  VAL A C   1 
ATOM   1035 O O   . VAL A 1 132 ? 21.286  18.742  24.298  1.00 36.35 ? 132  VAL A O   1 
ATOM   1036 C CB  . VAL A 1 132 ? 21.681  21.178  22.962  1.00 35.50 ? 132  VAL A CB  1 
ATOM   1037 C CG1 . VAL A 1 132 ? 21.125  22.526  22.513  1.00 35.38 ? 132  VAL A CG1 1 
ATOM   1038 C CG2 . VAL A 1 132 ? 23.080  20.911  22.430  1.00 34.32 ? 132  VAL A CG2 1 
ATOM   1039 N N   . TYR A 1 133 ? 22.917  19.352  25.692  1.00 35.76 ? 133  TYR A N   1 
ATOM   1040 C CA  . TYR A 1 133 ? 23.145  17.970  26.099  1.00 36.15 ? 133  TYR A CA  1 
ATOM   1041 C C   . TYR A 1 133 ? 22.812  17.823  27.582  1.00 36.68 ? 133  TYR A C   1 
ATOM   1042 O O   . TYR A 1 133 ? 23.225  16.854  28.224  1.00 37.27 ? 133  TYR A O   1 
ATOM   1043 C CB  . TYR A 1 133 ? 24.600  17.521  25.827  1.00 35.27 ? 133  TYR A CB  1 
ATOM   1044 C CG  . TYR A 1 133 ? 25.127  17.725  24.420  1.00 34.11 ? 133  TYR A CG  1 
ATOM   1045 C CD1 . TYR A 1 133 ? 24.309  17.566  23.319  1.00 33.58 ? 133  TYR A CD1 1 
ATOM   1046 C CD2 . TYR A 1 133 ? 26.471  18.023  24.197  1.00 35.02 ? 133  TYR A CD2 1 
ATOM   1047 C CE1 . TYR A 1 133 ? 24.797  17.725  22.034  1.00 34.71 ? 133  TYR A CE1 1 
ATOM   1048 C CE2 . TYR A 1 133 ? 26.978  18.195  22.896  1.00 34.45 ? 133  TYR A CE2 1 
ATOM   1049 C CZ  . TYR A 1 133 ? 26.125  18.049  21.826  1.00 34.55 ? 133  TYR A CZ  1 
ATOM   1050 O OH  . TYR A 1 133 ? 26.571  18.213  20.534  1.00 32.23 ? 133  TYR A OH  1 
ATOM   1051 N N   . ASP A 1 134 ? 22.080  18.789  28.126  1.00 36.82 ? 134  ASP A N   1 
ATOM   1052 C CA  . ASP A 1 134 ? 21.759  18.784  29.547  1.00 37.38 ? 134  ASP A CA  1 
ATOM   1053 C C   . ASP A 1 134 ? 20.919  17.561  29.911  1.00 37.42 ? 134  ASP A C   1 
ATOM   1054 O O   . ASP A 1 134 ? 19.782  17.400  29.455  1.00 37.64 ? 134  ASP A O   1 
ATOM   1055 C CB  . ASP A 1 134 ? 21.061  20.078  29.925  1.00 37.73 ? 134  ASP A CB  1 
ATOM   1056 C CG  . ASP A 1 134 ? 20.878  20.231  31.406  1.00 39.18 ? 134  ASP A CG  1 
ATOM   1057 O OD1 . ASP A 1 134 ? 20.835  19.229  32.133  1.00 42.24 ? 134  ASP A OD1 1 
ATOM   1058 O OD2 . ASP A 1 134 ? 20.738  21.371  31.864  1.00 42.15 ? 134  ASP A OD2 1 
ATOM   1059 N N   . GLY A 1 135 ? 21.493  16.691  30.727  1.00 37.05 ? 135  GLY A N   1 
ATOM   1060 C CA  . GLY A 1 135 ? 20.841  15.441  31.062  1.00 37.65 ? 135  GLY A CA  1 
ATOM   1061 C C   . GLY A 1 135 ? 19.709  15.521  32.069  1.00 38.11 ? 135  GLY A C   1 
ATOM   1062 O O   . GLY A 1 135 ? 18.953  14.566  32.212  1.00 38.30 ? 135  GLY A O   1 
ATOM   1063 N N   . ARG A 1 136 ? 19.566  16.657  32.750  1.00 38.37 ? 136  ARG A N   1 
ATOM   1064 C CA  . ARG A 1 136 ? 18.568  16.787  33.827  1.00 38.73 ? 136  ARG A CA  1 
ATOM   1065 C C   . ARG A 1 136 ? 17.127  16.435  33.450  1.00 38.85 ? 136  ARG A C   1 
ATOM   1066 O O   . ARG A 1 136 ? 16.427  15.892  34.296  1.00 39.27 ? 136  ARG A O   1 
ATOM   1067 C CB  . ARG A 1 136 ? 18.602  18.162  34.492  1.00 38.53 ? 136  ARG A CB  1 
ATOM   1068 C CG  . ARG A 1 136 ? 17.833  19.244  33.767  1.00 39.46 ? 136  ARG A CG  1 
ATOM   1069 C CD  . ARG A 1 136 ? 18.005  20.584  34.465  1.00 41.68 ? 136  ARG A CD  1 
ATOM   1070 N NE  . ARG A 1 136 ? 19.379  21.083  34.360  1.00 43.56 ? 136  ARG A NE  1 
ATOM   1071 C CZ  . ARG A 1 136 ? 19.890  22.049  35.135  1.00 44.37 ? 136  ARG A CZ  1 
ATOM   1072 N NH1 . ARG A 1 136 ? 21.141  22.440  34.972  1.00 40.61 ? 136  ARG A NH1 1 
ATOM   1073 N NH2 . ARG A 1 136 ? 19.157  22.620  36.094  1.00 44.88 ? 136  ARG A NH2 1 
ATOM   1074 N N   . PHE A 1 137 ? 16.690  16.728  32.217  1.00 38.42 ? 137  PHE A N   1 
ATOM   1075 C CA  . PHE A 1 137 ? 15.297  16.497  31.834  1.00 38.01 ? 137  PHE A CA  1 
ATOM   1076 C C   . PHE A 1 137 ? 15.006  15.020  31.650  1.00 39.22 ? 137  PHE A C   1 
ATOM   1077 O O   . PHE A 1 137 ? 13.979  14.531  32.131  1.00 40.65 ? 137  PHE A O   1 
ATOM   1078 C CB  . PHE A 1 137 ? 14.897  17.265  30.587  1.00 37.23 ? 137  PHE A CB  1 
ATOM   1079 C CG  . PHE A 1 137 ? 15.237  18.696  30.634  1.00 35.64 ? 137  PHE A CG  1 
ATOM   1080 C CD1 . PHE A 1 137 ? 14.464  19.583  31.364  1.00 37.19 ? 137  PHE A CD1 1 
ATOM   1081 C CD2 . PHE A 1 137 ? 16.334  19.180  29.936  1.00 35.94 ? 137  PHE A CD2 1 
ATOM   1082 C CE1 . PHE A 1 137 ? 14.796  20.953  31.417  1.00 36.93 ? 137  PHE A CE1 1 
ATOM   1083 C CE2 . PHE A 1 137 ? 16.678  20.548  29.981  1.00 34.76 ? 137  PHE A CE2 1 
ATOM   1084 C CZ  . PHE A 1 137 ? 15.918  21.426  30.715  1.00 35.10 ? 137  PHE A CZ  1 
ATOM   1085 N N   . LEU A 1 138 ? 15.893  14.300  30.971  1.00 39.65 ? 138  LEU A N   1 
ATOM   1086 C CA  . LEU A 1 138 ? 15.730  12.864  30.807  1.00 40.11 ? 138  LEU A CA  1 
ATOM   1087 C C   . LEU A 1 138 ? 15.863  12.160  32.154  1.00 40.74 ? 138  LEU A C   1 
ATOM   1088 O O   . LEU A 1 138 ? 15.258  11.102  32.371  1.00 41.25 ? 138  LEU A O   1 
ATOM   1089 C CB  . LEU A 1 138 ? 16.749  12.301  29.819  1.00 39.85 ? 138  LEU A CB  1 
ATOM   1090 C CG  . LEU A 1 138 ? 16.461  12.450  28.329  1.00 40.34 ? 138  LEU A CG  1 
ATOM   1091 C CD1 . LEU A 1 138 ? 17.721  12.304  27.498  1.00 39.04 ? 138  LEU A CD1 1 
ATOM   1092 C CD2 . LEU A 1 138 ? 15.384  11.471  27.861  1.00 40.31 ? 138  LEU A CD2 1 
ATOM   1093 N N   . ALA A 1 139 ? 16.646  12.750  33.055  1.00 40.87 ? 139  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 139 ? 16.809  12.203  34.389  1.00 41.30 ? 139  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 139 ? 15.542  12.449  35.222  1.00 42.29 ? 139  ALA A C   1 
ATOM   1096 O O   . ALA A 1 139 ? 15.009  11.528  35.855  1.00 42.43 ? 139  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 139 ? 18.032  12.815  35.063  1.00 40.72 ? 139  ALA A CB  1 
ATOM   1098 N N   . GLN A 1 140 ? 15.053  13.692  35.228  1.00 42.92 ? 140  GLN A N   1 
ATOM   1099 C CA  . GLN A 1 140 ? 13.907  14.027  36.052  1.00 43.43 ? 140  GLN A CA  1 
ATOM   1100 C C   . GLN A 1 140 ? 12.624  13.396  35.467  1.00 43.61 ? 140  GLN A C   1 
ATOM   1101 O O   . GLN A 1 140 ? 11.909  12.700  36.180  1.00 43.08 ? 140  GLN A O   1 
ATOM   1102 C CB  . GLN A 1 140 ? 13.777  15.542  36.236  1.00 43.13 ? 140  GLN A CB  1 
ATOM   1103 C CG  . GLN A 1 140 ? 12.927  15.974  37.431  1.00 44.92 ? 140  GLN A CG  1 
ATOM   1104 C CD  . GLN A 1 140 ? 11.453  15.570  37.301  1.00 47.36 ? 140  GLN A CD  1 
ATOM   1105 O OE1 . GLN A 1 140 ? 10.837  15.742  36.246  1.00 48.63 ? 140  GLN A OE1 1 
ATOM   1106 N NE2 . GLN A 1 140 ? 10.891  15.020  38.374  1.00 46.16 ? 140  GLN A NE2 1 
ATOM   1107 N N   . VAL A 1 141 ? 12.367  13.602  34.171  1.00 43.44 ? 141  VAL A N   1 
ATOM   1108 C CA  . VAL A 1 141 ? 11.083  13.209  33.580  1.00 43.11 ? 141  VAL A CA  1 
ATOM   1109 C C   . VAL A 1 141 ? 10.951  11.710  33.325  1.00 43.40 ? 141  VAL A C   1 
ATOM   1110 O O   . VAL A 1 141 ? 9.904   11.150  33.597  1.00 43.84 ? 141  VAL A O   1 
ATOM   1111 C CB  . VAL A 1 141 ? 10.744  14.011  32.303  1.00 43.02 ? 141  VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 141 ? 9.508   13.447  31.631  1.00 42.56 ? 141  VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 141 ? 10.535  15.485  32.636  1.00 42.60 ? 141  VAL A CG2 1 
ATOM   1114 N N   . GLU A 1 142 ? 12.005  11.063  32.830  1.00 43.28 ? 142  GLU A N   1 
ATOM   1115 C CA  . GLU A 1 142 ? 11.950  9.641   32.486  1.00 42.86 ? 142  GLU A CA  1 
ATOM   1116 C C   . GLU A 1 142 ? 12.673  8.724   33.473  1.00 42.73 ? 142  GLU A C   1 
ATOM   1117 O O   . GLU A 1 142 ? 12.703  7.504   33.286  1.00 42.17 ? 142  GLU A O   1 
ATOM   1118 C CB  . GLU A 1 142 ? 12.542  9.418   31.105  1.00 43.30 ? 142  GLU A CB  1 
ATOM   1119 C CG  . GLU A 1 142 ? 11.768  10.064  29.991  1.00 45.25 ? 142  GLU A CG  1 
ATOM   1120 C CD  . GLU A 1 142 ? 10.385  9.471   29.799  1.00 49.85 ? 142  GLU A CD  1 
ATOM   1121 O OE1 . GLU A 1 142 ? 10.134  8.303   30.216  1.00 50.15 ? 142  GLU A OE1 1 
ATOM   1122 O OE2 . GLU A 1 142 ? 9.547   10.190  29.207  1.00 52.63 ? 142  GLU A OE2 1 
ATOM   1123 N N   . GLY A 1 143 ? 13.278  9.309   34.506  1.00 42.26 ? 143  GLY A N   1 
ATOM   1124 C CA  . GLY A 1 143 ? 14.003  8.535   35.505  1.00 41.56 ? 143  GLY A CA  1 
ATOM   1125 C C   . GLY A 1 143 ? 15.237  7.839   34.978  1.00 41.44 ? 143  GLY A C   1 
ATOM   1126 O O   . GLY A 1 143 ? 15.708  6.886   35.589  1.00 41.79 ? 143  GLY A O   1 
ATOM   1127 N N   . ALA A 1 144 ? 15.768  8.317   33.851  1.00 41.14 ? 144  ALA A N   1 
ATOM   1128 C CA  . ALA A 1 144 ? 16.977  7.748   33.240  1.00 40.55 ? 144  ALA A CA  1 
ATOM   1129 C C   . ALA A 1 144 ? 18.237  8.087   34.036  1.00 39.66 ? 144  ALA A C   1 
ATOM   1130 O O   . ALA A 1 144 ? 18.285  9.106   34.728  1.00 39.64 ? 144  ALA A O   1 
ATOM   1131 C CB  . ALA A 1 144 ? 17.125  8.264   31.840  1.00 40.53 ? 144  ALA A CB  1 
ATOM   1132 N N   . VAL A 1 145 ? 19.248  7.233   33.943  1.00 38.59 ? 145  VAL A N   1 
ATOM   1133 C CA  . VAL A 1 145 ? 20.609  7.632   34.314  1.00 37.86 ? 145  VAL A CA  1 
ATOM   1134 C C   . VAL A 1 145 ? 21.294  8.021   33.005  1.00 37.28 ? 145  VAL A C   1 
ATOM   1135 O O   . VAL A 1 145 ? 21.405  7.204   32.076  1.00 37.88 ? 145  VAL A O   1 
ATOM   1136 C CB  . VAL A 1 145 ? 21.384  6.508   35.059  1.00 37.96 ? 145  VAL A CB  1 
ATOM   1137 C CG1 . VAL A 1 145 ? 22.837  6.911   35.309  1.00 38.42 ? 145  VAL A CG1 1 
ATOM   1138 C CG2 . VAL A 1 145 ? 20.713  6.207   36.398  1.00 37.47 ? 145  VAL A CG2 1 
ATOM   1139 N N   . LEU A 1 146 ? 21.717  9.272   32.902  1.00 35.50 ? 146  LEU A N   1 
ATOM   1140 C CA  . LEU A 1 146 ? 22.359  9.708   31.684  1.00 34.29 ? 146  LEU A CA  1 
ATOM   1141 C C   . LEU A 1 146 ? 23.821  9.974   31.974  1.00 33.14 ? 146  LEU A C   1 
ATOM   1142 O O   . LEU A 1 146 ? 24.150  10.572  32.997  1.00 32.96 ? 146  LEU A O   1 
ATOM   1143 C CB  . LEU A 1 146 ? 21.646  10.935  31.090  1.00 34.46 ? 146  LEU A CB  1 
ATOM   1144 C CG  . LEU A 1 146 ? 22.124  11.268  29.675  1.00 36.09 ? 146  LEU A CG  1 
ATOM   1145 C CD1 . LEU A 1 146 ? 21.004  11.362  28.701  1.00 37.64 ? 146  LEU A CD1 1 
ATOM   1146 C CD2 . LEU A 1 146 ? 22.948  12.568  29.677  1.00 41.03 ? 146  LEU A CD2 1 
ATOM   1147 N N   . VAL A 1 147 ? 24.692  9.504   31.084  1.00 32.36 ? 147  VAL A N   1 
ATOM   1148 C CA  . VAL A 1 147 ? 26.130  9.694   31.212  1.00 31.52 ? 147  VAL A CA  1 
ATOM   1149 C C   . VAL A 1 147 ? 26.650  10.260  29.917  1.00 31.60 ? 147  VAL A C   1 
ATOM   1150 O O   . VAL A 1 147 ? 26.288  9.770   28.833  1.00 31.36 ? 147  VAL A O   1 
ATOM   1151 C CB  . VAL A 1 147 ? 26.862  8.363   31.446  1.00 32.02 ? 147  VAL A CB  1 
ATOM   1152 C CG1 . VAL A 1 147 ? 28.395  8.572   31.536  1.00 30.82 ? 147  VAL A CG1 1 
ATOM   1153 C CG2 . VAL A 1 147 ? 26.333  7.650   32.674  1.00 31.26 ? 147  VAL A CG2 1 
ATOM   1154 N N   . SER A 1 148 ? 27.506  11.277  30.025  1.00 30.76 ? 148  SER A N   1 
ATOM   1155 C CA  . SER A 1 148 ? 28.186  11.849  28.866  1.00 30.41 ? 148  SER A CA  1 
ATOM   1156 C C   . SER A 1 148 ? 29.671  12.078  29.175  1.00 30.26 ? 148  SER A C   1 
ATOM   1157 O O   . SER A 1 148 ? 30.037  12.435  30.302  1.00 30.05 ? 148  SER A O   1 
ATOM   1158 C CB  . SER A 1 148 ? 27.505  13.139  28.417  1.00 30.19 ? 148  SER A CB  1 
ATOM   1159 O OG  . SER A 1 148 ? 27.584  14.133  29.437  1.00 31.11 ? 148  SER A OG  1 
ATOM   1160 N N   . MET A 1 149 ? 30.522  11.835  28.181  1.00 30.30 ? 149  MET A N   1 
ATOM   1161 C CA  . MET A 1 149 ? 31.977  11.966  28.348  1.00 30.03 ? 149  MET A CA  1 
ATOM   1162 C C   . MET A 1 149 ? 32.581  12.934  27.370  1.00 29.87 ? 149  MET A C   1 
ATOM   1163 O O   . MET A 1 149 ? 32.044  13.135  26.260  1.00 30.45 ? 149  MET A O   1 
ATOM   1164 C CB  . MET A 1 149 ? 32.684  10.614  28.156  1.00 30.11 ? 149  MET A CB  1 
ATOM   1165 C CG  . MET A 1 149 ? 33.042  10.255  26.724  1.00 30.02 ? 149  MET A CG  1 
ATOM   1166 S SD  . MET A 1 149 ? 31.624  9.766   25.724  1.00 32.84 ? 149  MET A SD  1 
ATOM   1167 C CE  . MET A 1 149 ? 31.229  8.149   26.378  1.00 29.20 ? 149  MET A CE  1 
ATOM   1168 N N   . ASN A 1 150 ? 33.708  13.506  27.770  1.00 29.51 ? 150  ASN A N   1 
ATOM   1169 C CA  . ASN A 1 150 ? 34.576  14.235  26.851  1.00 29.91 ? 150  ASN A CA  1 
ATOM   1170 C C   . ASN A 1 150 ? 35.483  13.221  26.227  1.00 30.02 ? 150  ASN A C   1 
ATOM   1171 O O   . ASN A 1 150 ? 35.890  12.278  26.889  1.00 30.67 ? 150  ASN A O   1 
ATOM   1172 C CB  . ASN A 1 150 ? 35.422  15.288  27.579  1.00 28.95 ? 150  ASN A CB  1 
ATOM   1173 C CG  . ASN A 1 150 ? 34.623  16.521  27.979  1.00 30.99 ? 150  ASN A CG  1 
ATOM   1174 O OD1 . ASN A 1 150 ? 33.396  16.649  27.715  1.00 28.42 ? 150  ASN A OD1 1 
ATOM   1175 N ND2 . ASN A 1 150 ? 35.320  17.461  28.616  1.00 31.23 ? 150  ASN A ND2 1 
ATOM   1176 N N   . TYR A 1 151 ? 35.802  13.401  24.955  1.00 30.44 ? 151  TYR A N   1 
ATOM   1177 C CA  . TYR A 1 151 ? 36.810  12.581  24.325  1.00 30.53 ? 151  TYR A CA  1 
ATOM   1178 C C   . TYR A 1 151 ? 37.596  13.495  23.430  1.00 31.80 ? 151  TYR A C   1 
ATOM   1179 O O   . TYR A 1 151 ? 37.073  14.519  22.988  1.00 33.36 ? 151  TYR A O   1 
ATOM   1180 C CB  . TYR A 1 151 ? 36.183  11.445  23.517  1.00 29.71 ? 151  TYR A CB  1 
ATOM   1181 C CG  . TYR A 1 151 ? 35.305  11.893  22.376  1.00 28.37 ? 151  TYR A CG  1 
ATOM   1182 C CD1 . TYR A 1 151 ? 33.940  12.131  22.566  1.00 27.51 ? 151  TYR A CD1 1 
ATOM   1183 C CD2 . TYR A 1 151 ? 35.826  12.048  21.099  1.00 27.27 ? 151  TYR A CD2 1 
ATOM   1184 C CE1 . TYR A 1 151 ? 33.122  12.533  21.499  1.00 25.89 ? 151  TYR A CE1 1 
ATOM   1185 C CE2 . TYR A 1 151 ? 35.030  12.461  20.028  1.00 25.84 ? 151  TYR A CE2 1 
ATOM   1186 C CZ  . TYR A 1 151 ? 33.669  12.709  20.234  1.00 26.92 ? 151  TYR A CZ  1 
ATOM   1187 O OH  . TYR A 1 151 ? 32.874  13.129  19.168  1.00 25.14 ? 151  TYR A OH  1 
ATOM   1188 N N   . ARG A 1 152 ? 38.848  13.136  23.164  1.00 32.03 ? 152  ARG A N   1 
ATOM   1189 C CA  . ARG A 1 152 ? 39.741  13.992  22.423  1.00 31.82 ? 152  ARG A CA  1 
ATOM   1190 C C   . ARG A 1 152 ? 39.322  14.084  20.983  1.00 32.10 ? 152  ARG A C   1 
ATOM   1191 O O   . ARG A 1 152 ? 38.939  13.094  20.356  1.00 32.13 ? 152  ARG A O   1 
ATOM   1192 C CB  . ARG A 1 152 ? 41.179  13.498  22.527  1.00 31.74 ? 152  ARG A CB  1 
ATOM   1193 C CG  . ARG A 1 152 ? 41.799  13.844  23.862  1.00 32.71 ? 152  ARG A CG  1 
ATOM   1194 C CD  . ARG A 1 152 ? 43.093  13.118  24.067  1.00 33.45 ? 152  ARG A CD  1 
ATOM   1195 N NE  . ARG A 1 152 ? 42.926  11.684  24.287  1.00 32.70 ? 152  ARG A NE  1 
ATOM   1196 C CZ  . ARG A 1 152 ? 43.942  10.814  24.312  1.00 35.96 ? 152  ARG A CZ  1 
ATOM   1197 N NH1 . ARG A 1 152 ? 45.207  11.239  24.107  1.00 34.32 ? 152  ARG A NH1 1 
ATOM   1198 N NH2 . ARG A 1 152 ? 43.698  9.516   24.537  1.00 33.63 ? 152  ARG A NH2 1 
ATOM   1199 N N   . VAL A 1 153 ? 39.405  15.296  20.464  1.00 32.21 ? 153  VAL A N   1 
ATOM   1200 C CA  . VAL A 1 153 ? 39.043  15.576  19.103  1.00 32.72 ? 153  VAL A CA  1 
ATOM   1201 C C   . VAL A 1 153 ? 40.266  16.128  18.352  1.00 34.11 ? 153  VAL A C   1 
ATOM   1202 O O   . VAL A 1 153 ? 41.353  16.353  18.947  1.00 33.69 ? 153  VAL A O   1 
ATOM   1203 C CB  . VAL A 1 153 ? 37.883  16.566  19.091  1.00 33.15 ? 153  VAL A CB  1 
ATOM   1204 C CG1 . VAL A 1 153 ? 36.630  15.893  19.677  1.00 32.46 ? 153  VAL A CG1 1 
ATOM   1205 C CG2 . VAL A 1 153 ? 38.239  17.822  19.887  1.00 31.24 ? 153  VAL A CG2 1 
ATOM   1206 N N   . GLY A 1 154 ? 40.090  16.336  17.051  1.00 34.35 ? 154  GLY A N   1 
ATOM   1207 C CA  . GLY A 1 154 ? 41.145  16.897  16.216  1.00 34.80 ? 154  GLY A CA  1 
ATOM   1208 C C   . GLY A 1 154 ? 42.375  16.025  16.212  1.00 34.90 ? 154  GLY A C   1 
ATOM   1209 O O   . GLY A 1 154 ? 42.270  14.804  16.330  1.00 35.41 ? 154  GLY A O   1 
ATOM   1210 N N   . THR A 1 155 ? 43.537  16.655  16.074  1.00 34.70 ? 155  THR A N   1 
ATOM   1211 C CA  . THR A 1 155 ? 44.814  15.948  16.159  1.00 34.14 ? 155  THR A CA  1 
ATOM   1212 C C   . THR A 1 155 ? 44.944  15.193  17.461  1.00 33.91 ? 155  THR A C   1 
ATOM   1213 O O   . THR A 1 155 ? 45.391  14.040  17.453  1.00 35.20 ? 155  THR A O   1 
ATOM   1214 C CB  . THR A 1 155 ? 46.043  16.877  15.998  1.00 34.05 ? 155  THR A CB  1 
ATOM   1215 O OG1 . THR A 1 155 ? 45.938  18.003  16.877  1.00 32.65 ? 155  THR A OG1 1 
ATOM   1216 C CG2 . THR A 1 155 ? 46.133  17.385  14.566  1.00 34.62 ? 155  THR A CG2 1 
ATOM   1217 N N   . PHE A 1 156 ? 44.539  15.803  18.568  1.00 32.84 ? 156  PHE A N   1 
ATOM   1218 C CA  . PHE A 1 156 ? 44.792  15.215  19.894  1.00 32.78 ? 156  PHE A CA  1 
ATOM   1219 C C   . PHE A 1 156 ? 44.123  13.872  20.009  1.00 33.42 ? 156  PHE A C   1 
ATOM   1220 O O   . PHE A 1 156 ? 44.638  12.963  20.646  1.00 34.13 ? 156  PHE A O   1 
ATOM   1221 C CB  . PHE A 1 156 ? 44.347  16.172  21.001  1.00 32.32 ? 156  PHE A CB  1 
ATOM   1222 C CG  . PHE A 1 156 ? 44.851  17.568  20.799  1.00 32.43 ? 156  PHE A CG  1 
ATOM   1223 C CD1 . PHE A 1 156 ? 46.157  17.916  21.181  1.00 34.70 ? 156  PHE A CD1 1 
ATOM   1224 C CD2 . PHE A 1 156 ? 44.084  18.501  20.135  1.00 32.53 ? 156  PHE A CD2 1 
ATOM   1225 C CE1 . PHE A 1 156 ? 46.663  19.178  20.953  1.00 33.39 ? 156  PHE A CE1 1 
ATOM   1226 C CE2 . PHE A 1 156 ? 44.572  19.789  19.894  1.00 34.92 ? 156  PHE A CE2 1 
ATOM   1227 C CZ  . PHE A 1 156 ? 45.875  20.128  20.304  1.00 34.50 ? 156  PHE A CZ  1 
ATOM   1228 N N   . GLY A 1 157 ? 42.982  13.719  19.352  1.00 33.34 ? 157  GLY A N   1 
ATOM   1229 C CA  . GLY A 1 157 ? 42.283  12.481  19.456  1.00 33.34 ? 157  GLY A CA  1 
ATOM   1230 C C   . GLY A 1 157 ? 42.499  11.592  18.263  1.00 33.35 ? 157  GLY A C   1 
ATOM   1231 O O   . GLY A 1 157 ? 42.223  10.376  18.345  1.00 33.52 ? 157  GLY A O   1 
ATOM   1232 N N   . PHE A 1 158 ? 42.944  12.176  17.142  1.00 32.53 ? 158  PHE A N   1 
ATOM   1233 C CA  . PHE A 1 158 ? 42.941  11.405  15.899  1.00 32.63 ? 158  PHE A CA  1 
ATOM   1234 C C   . PHE A 1 158 ? 44.196  11.384  15.033  1.00 33.21 ? 158  PHE A C   1 
ATOM   1235 O O   . PHE A 1 158 ? 44.321  10.525  14.176  1.00 33.20 ? 158  PHE A O   1 
ATOM   1236 C CB  . PHE A 1 158 ? 41.637  11.585  15.101  1.00 31.64 ? 158  PHE A CB  1 
ATOM   1237 C CG  . PHE A 1 158 ? 40.427  11.124  15.858  1.00 31.09 ? 158  PHE A CG  1 
ATOM   1238 C CD1 . PHE A 1 158 ? 40.084  9.777   15.893  1.00 31.14 ? 158  PHE A CD1 1 
ATOM   1239 C CD2 . PHE A 1 158 ? 39.667  12.019  16.590  1.00 29.24 ? 158  PHE A CD2 1 
ATOM   1240 C CE1 . PHE A 1 158 ? 39.007  9.335   16.629  1.00 29.32 ? 158  PHE A CE1 1 
ATOM   1241 C CE2 . PHE A 1 158 ? 38.567  11.596  17.335  1.00 29.66 ? 158  PHE A CE2 1 
ATOM   1242 C CZ  . PHE A 1 158 ? 38.230  10.268  17.367  1.00 30.34 ? 158  PHE A CZ  1 
ATOM   1243 N N   . LEU A 1 159 ? 45.149  12.273  15.286  1.00 33.80 ? 159  LEU A N   1 
ATOM   1244 C CA  . LEU A 1 159 ? 46.394  12.212  14.516  1.00 34.84 ? 159  LEU A CA  1 
ATOM   1245 C C   . LEU A 1 159 ? 47.017  10.818  14.638  1.00 35.01 ? 159  LEU A C   1 
ATOM   1246 O O   . LEU A 1 159 ? 47.216  10.316  15.733  1.00 35.39 ? 159  LEU A O   1 
ATOM   1247 C CB  . LEU A 1 159 ? 47.383  13.309  14.948  1.00 34.44 ? 159  LEU A CB  1 
ATOM   1248 C CG  . LEU A 1 159 ? 48.687  13.354  14.140  1.00 34.20 ? 159  LEU A CG  1 
ATOM   1249 C CD1 . LEU A 1 159 ? 49.198  14.805  13.917  1.00 32.13 ? 159  LEU A CD1 1 
ATOM   1250 C CD2 . LEU A 1 159 ? 49.749  12.500  14.859  1.00 33.69 ? 159  LEU A CD2 1 
ATOM   1251 N N   . ALA A 1 160 ? 47.336  10.188  13.523  1.00 36.28 ? 160  ALA A N   1 
ATOM   1252 C CA  . ALA A 1 160 ? 47.872  8.829   13.604  1.00 37.76 ? 160  ALA A CA  1 
ATOM   1253 C C   . ALA A 1 160 ? 49.054  8.628   12.702  1.00 38.55 ? 160  ALA A C   1 
ATOM   1254 O O   . ALA A 1 160 ? 49.028  9.011   11.535  1.00 38.46 ? 160  ALA A O   1 
ATOM   1255 C CB  . ALA A 1 160 ? 46.791  7.810   13.251  1.00 37.19 ? 160  ALA A CB  1 
ATOM   1256 N N   . LEU A 1 161 ? 50.089  7.992   13.235  1.00 40.32 ? 161  LEU A N   1 
ATOM   1257 C CA  . LEU A 1 161 ? 51.070  7.322   12.361  1.00 41.01 ? 161  LEU A CA  1 
ATOM   1258 C C   . LEU A 1 161 ? 50.826  5.820   12.466  1.00 41.80 ? 161  LEU A C   1 
ATOM   1259 O O   . LEU A 1 161 ? 51.370  5.166   13.346  1.00 41.90 ? 161  LEU A O   1 
ATOM   1260 C CB  . LEU A 1 161 ? 52.486  7.744   12.717  1.00 40.36 ? 161  LEU A CB  1 
ATOM   1261 C CG  . LEU A 1 161 ? 52.536  9.245   12.414  1.00 41.72 ? 161  LEU A CG  1 
ATOM   1262 C CD1 . LEU A 1 161 ? 53.604  9.934   13.184  1.00 44.28 ? 161  LEU A CD1 1 
ATOM   1263 C CD2 . LEU A 1 161 ? 52.694  9.535   10.934  1.00 41.17 ? 161  LEU A CD2 1 
ATOM   1264 N N   . PRO A 1 162 ? 49.937  5.283   11.611  1.00 42.75 ? 162  PRO A N   1 
ATOM   1265 C CA  . PRO A 1 162 ? 49.474  3.899   11.785  1.00 44.41 ? 162  PRO A CA  1 
ATOM   1266 C C   . PRO A 1 162 ? 50.657  2.927   11.859  1.00 46.33 ? 162  PRO A C   1 
ATOM   1267 O O   . PRO A 1 162 ? 51.581  3.019   11.050  1.00 47.29 ? 162  PRO A O   1 
ATOM   1268 C CB  . PRO A 1 162 ? 48.633  3.656   10.531  1.00 43.89 ? 162  PRO A CB  1 
ATOM   1269 C CG  . PRO A 1 162 ? 48.152  5.025   10.164  1.00 42.97 ? 162  PRO A CG  1 
ATOM   1270 C CD  . PRO A 1 162 ? 49.303  5.925   10.457  1.00 42.37 ? 162  PRO A CD  1 
ATOM   1271 N N   . GLY A 1 163 ? 50.663  2.044   12.851  1.00 47.82 ? 163  GLY A N   1 
ATOM   1272 C CA  . GLY A 1 163 ? 51.784  1.137   13.026  1.00 49.10 ? 163  GLY A CA  1 
ATOM   1273 C C   . GLY A 1 163 ? 52.733  1.593   14.111  1.00 50.13 ? 163  GLY A C   1 
ATOM   1274 O O   . GLY A 1 163 ? 53.391  0.775   14.711  1.00 51.08 ? 163  GLY A O   1 
ATOM   1275 N N   . SER A 1 164 ? 52.813  2.888   14.385  1.00 50.88 ? 164  SER A N   1 
ATOM   1276 C CA  . SER A 1 164 ? 53.709  3.371   15.433  1.00 51.16 ? 164  SER A CA  1 
ATOM   1277 C C   . SER A 1 164 ? 53.169  3.038   16.830  1.00 51.97 ? 164  SER A C   1 
ATOM   1278 O O   . SER A 1 164 ? 51.992  2.696   16.994  1.00 52.58 ? 164  SER A O   1 
ATOM   1279 C CB  . SER A 1 164 ? 53.951  4.878   15.290  1.00 51.37 ? 164  SER A CB  1 
ATOM   1280 O OG  . SER A 1 164 ? 52.855  5.660   15.752  1.00 51.06 ? 164  SER A OG  1 
ATOM   1281 N N   . ARG A 1 165 ? 54.031  3.141   17.831  1.00 52.22 ? 165  ARG A N   1 
ATOM   1282 C CA  . ARG A 1 165 ? 53.655  2.868   19.214  1.00 53.46 ? 165  ARG A CA  1 
ATOM   1283 C C   . ARG A 1 165 ? 53.095  4.138   19.852  1.00 51.82 ? 165  ARG A C   1 
ATOM   1284 O O   . ARG A 1 165 ? 52.206  4.069   20.724  1.00 51.61 ? 165  ARG A O   1 
ATOM   1285 C CB  . ARG A 1 165 ? 54.905  2.451   20.007  1.00 53.70 ? 165  ARG A CB  1 
ATOM   1286 C CG  . ARG A 1 165 ? 55.026  0.963   20.363  1.00 57.05 ? 165  ARG A CG  1 
ATOM   1287 C CD  . ARG A 1 165 ? 55.835  0.777   21.687  1.00 57.92 ? 165  ARG A CD  1 
ATOM   1288 N NE  . ARG A 1 165 ? 55.441  1.770   22.709  1.00 66.23 ? 165  ARG A NE  1 
ATOM   1289 C CZ  . ARG A 1 165 ? 56.173  2.827   23.095  1.00 68.29 ? 165  ARG A CZ  1 
ATOM   1290 N NH1 . ARG A 1 165 ? 57.382  3.049   22.564  1.00 68.50 ? 165  ARG A NH1 1 
ATOM   1291 N NH2 . ARG A 1 165 ? 55.691  3.666   24.020  1.00 67.98 ? 165  ARG A NH2 1 
ATOM   1292 N N   . GLU A 1 166 ? 53.631  5.282   19.396  1.00 50.27 ? 166  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 166 ? 53.454  6.585   20.029  1.00 48.70 ? 166  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 166 ? 52.287  7.438   19.490  1.00 46.84 ? 166  GLU A C   1 
ATOM   1295 O O   . GLU A 1 166 ? 51.895  8.432   20.128  1.00 46.68 ? 166  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 166 ? 54.761  7.384   19.972  1.00 49.43 ? 166  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 166 ? 56.015  6.630   20.468  1.00 52.45 ? 166  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 166 ? 56.852  6.009   19.317  1.00 56.70 ? 166  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 166 ? 56.288  5.608   18.245  1.00 58.30 ? 166  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 166 ? 58.088  5.928   19.506  1.00 56.66 ? 166  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 167 ? 51.743  7.060   18.333  1.00 44.20 ? 167  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 167 ? 50.506  7.652   17.815  1.00 41.81 ? 167  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 167 ? 49.721  6.641   16.980  1.00 40.39 ? 167  ALA A C   1 
ATOM   1304 O O   . ALA A 1 167 ? 49.678  6.743   15.750  1.00 40.33 ? 167  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 167 ? 50.791  8.933   17.008  1.00 40.79 ? 167  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 168 ? 49.083  5.669   17.641  1.00 39.60 ? 168  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 168 ? 48.395  4.633   16.855  1.00 39.90 ? 168  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 168 ? 47.102  5.107   16.178  1.00 40.22 ? 168  PRO A C   1 
ATOM   1309 O O   . PRO A 1 168 ? 46.588  4.412   15.302  1.00 40.62 ? 168  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 168 ? 48.106  3.523   17.883  1.00 39.52 ? 168  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 168 ? 48.210  4.196   19.230  1.00 38.66 ? 168  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 168 ? 48.966  5.462   19.100  1.00 39.34 ? 168  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 169 ? 46.596  6.289   16.547  1.00 40.45 ? 169  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 169 ? 45.297  6.755   16.048  1.00 39.75 ? 169  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 169 ? 44.121  6.133   16.794  1.00 39.73 ? 169  GLY A C   1 
ATOM   1316 O O   . GLY A 1 169 ? 44.293  5.233   17.661  1.00 39.78 ? 169  GLY A O   1 
ATOM   1317 N N   . ASN A 1 170 ? 42.927  6.622   16.465  1.00 38.88 ? 170  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 170 ? 41.689  6.248   17.151  1.00 38.28 ? 170  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 170 ? 41.664  6.472   18.664  1.00 37.42 ? 170  ASN A C   1 
ATOM   1320 O O   . ASN A 1 170 ? 40.778  5.944   19.353  1.00 38.34 ? 170  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 170 ? 41.290  4.801   16.818  1.00 37.78 ? 170  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 170 ? 41.038  4.604   15.342  1.00 39.30 ? 170  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 170 ? 40.519  5.490   14.652  1.00 41.32 ? 170  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 170 ? 41.420  3.450   14.839  1.00 39.11 ? 170  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 171 ? 42.587  7.260   19.203  1.00 36.09 ? 171  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 171 ? 42.627  7.357   20.661  1.00 34.57 ? 171  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 171 ? 41.420  8.065   21.238  1.00 33.58 ? 171  VAL A C   1 
ATOM   1328 O O   . VAL A 1 171 ? 41.081  7.841   22.399  1.00 33.46 ? 171  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 171 ? 43.948  7.911   21.232  1.00 34.68 ? 171  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 171 ? 45.109  7.136   20.679  1.00 35.07 ? 171  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 171 ? 44.106  9.424   20.990  1.00 34.66 ? 171  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 172 ? 40.785  8.928   20.440  1.00 32.61 ? 172  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 172 ? 39.515  9.559   20.836  1.00 31.33 ? 172  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 172 ? 38.436  8.503   21.002  1.00 30.67 ? 172  GLY A C   1 
ATOM   1335 O O   . GLY A 1 172 ? 37.599  8.575   21.888  1.00 30.24 ? 172  GLY A O   1 
ATOM   1336 N N   . LEU A 1 173 ? 38.460  7.506   20.134  1.00 31.01 ? 173  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 173 ? 37.533  6.395   20.240  1.00 31.50 ? 173  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 173 ? 37.798  5.613   21.518  1.00 32.56 ? 173  LEU A C   1 
ATOM   1339 O O   . LEU A 1 173 ? 36.861  5.162   22.200  1.00 32.59 ? 173  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 173 ? 37.617  5.516   19.012  1.00 30.81 ? 173  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 173 ? 36.971  6.099   17.759  1.00 29.62 ? 173  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 173 ? 37.110  5.131   16.636  1.00 27.61 ? 173  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 173 ? 35.518  6.443   18.000  1.00 28.13 ? 173  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 174 ? 39.082  5.519   21.865  1.00 33.60 ? 174  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 174 ? 39.513  4.863   23.073  1.00 33.60 ? 174  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 174 ? 39.093  5.601   24.322  1.00 33.95 ? 174  LEU A C   1 
ATOM   1347 O O   . LEU A 1 174 ? 38.722  4.953   25.286  1.00 35.80 ? 174  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 174 ? 41.034  4.612   23.050  1.00 33.52 ? 174  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 174 ? 41.544  3.552   22.041  1.00 33.92 ? 174  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 174 ? 43.047  3.544   21.964  1.00 32.59 ? 174  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 174 ? 41.045  2.165   22.391  1.00 31.40 ? 174  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 175 ? 39.167  6.932   24.344  1.00 33.90 ? 175  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 175 ? 38.631  7.712   25.472  1.00 33.56 ? 175  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 175 ? 37.140  7.374   25.694  1.00 33.38 ? 175  ASP A C   1 
ATOM   1355 O O   . ASP A 1 175 ? 36.688  7.182   26.834  1.00 33.43 ? 175  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 175 ? 38.720  9.210   25.218  1.00 34.05 ? 175  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 175 ? 40.132  9.702   24.909  1.00 35.73 ? 175  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 175 ? 41.139  9.077   25.331  1.00 35.98 ? 175  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 175 ? 40.217  10.768  24.248  1.00 35.98 ? 175  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 176 ? 36.389  7.294   24.605  1.00 32.57 ? 176  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 176 ? 34.987  6.931   24.662  1.00 33.62 ? 176  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 176 ? 34.839  5.551   25.300  1.00 34.27 ? 176  GLN A C   1 
ATOM   1363 O O   . GLN A 1 176 ? 34.034  5.371   26.224  1.00 33.76 ? 176  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 176 ? 34.341  6.978   23.265  1.00 33.02 ? 176  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 176 ? 34.382  8.349   22.577  1.00 32.52 ? 176  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 176 ? 33.799  8.328   21.188  1.00 35.28 ? 176  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 176 ? 33.232  7.317   20.761  1.00 37.96 ? 176  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 176 ? 33.943  9.435   20.455  1.00 33.82 ? 176  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 177 ? 35.642  4.600   24.817  1.00 35.33 ? 177  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 177 ? 35.658  3.225   25.338  1.00 36.17 ? 177  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 177 ? 36.042  3.156   26.809  1.00 36.05 ? 177  ARG A C   1 
ATOM   1372 O O   . ARG A 1 177 ? 35.463  2.379   27.569  1.00 36.98 ? 177  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 177 ? 36.591  2.316   24.526  1.00 36.71 ? 177  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 177 ? 36.622  0.856   25.054  1.00 38.67 ? 177  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 177 ? 37.516  -0.027  24.253  1.00 38.26 ? 177  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 177 ? 36.822  -0.460  23.039  1.00 40.47 ? 177  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 177 ? 37.448  -0.895  21.934  1.00 40.55 ? 177  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 177 ? 38.789  -0.943  21.892  1.00 38.18 ? 177  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 177 ? 36.732  -1.261  20.864  1.00 37.33 ? 177  ARG A NH2 1 
ATOM   1380 N N   . LEU A 1 178 ? 37.004  3.967   27.220  1.00 35.26 ? 178  LEU A N   1 
ATOM   1381 C CA  . LEU A 1 178 ? 37.395  3.981   28.608  1.00 34.88 ? 178  LEU A CA  1 
ATOM   1382 C C   . LEU A 1 178 ? 36.216  4.462   29.502  1.00 34.89 ? 178  LEU A C   1 
ATOM   1383 O O   . LEU A 1 178 ? 35.956  3.894   30.561  1.00 35.47 ? 178  LEU A O   1 
ATOM   1384 C CB  . LEU A 1 178 ? 38.662  4.834   28.790  1.00 34.44 ? 178  LEU A CB  1 
ATOM   1385 C CG  . LEU A 1 178 ? 39.147  4.878   30.234  1.00 35.51 ? 178  LEU A CG  1 
ATOM   1386 C CD1 . LEU A 1 178 ? 39.450  3.432   30.723  1.00 37.84 ? 178  LEU A CD1 1 
ATOM   1387 C CD2 . LEU A 1 178 ? 40.343  5.783   30.373  1.00 35.61 ? 178  LEU A CD2 1 
ATOM   1388 N N   . ALA A 1 179 ? 35.516  5.517   29.077  1.00 34.91 ? 179  ALA A N   1 
ATOM   1389 C CA  . ALA A 1 179 ? 34.298  5.973   29.759  1.00 34.06 ? 179  ALA A CA  1 
ATOM   1390 C C   . ALA A 1 179 ? 33.197  4.886   29.762  1.00 34.11 ? 179  ALA A C   1 
ATOM   1391 O O   . ALA A 1 179 ? 32.455  4.757   30.737  1.00 33.88 ? 179  ALA A O   1 
ATOM   1392 C CB  . ALA A 1 179 ? 33.799  7.278   29.153  1.00 33.27 ? 179  ALA A CB  1 
ATOM   1393 N N   . LEU A 1 180 ? 33.108  4.077   28.705  1.00 34.64 ? 180  LEU A N   1 
ATOM   1394 C CA  . LEU A 1 180 ? 32.152  2.976   28.721  1.00 35.65 ? 180  LEU A CA  1 
ATOM   1395 C C   . LEU A 1 180 ? 32.547  1.929   29.780  1.00 36.92 ? 180  LEU A C   1 
ATOM   1396 O O   . LEU A 1 180 ? 31.677  1.435   30.523  1.00 37.89 ? 180  LEU A O   1 
ATOM   1397 C CB  . LEU A 1 180 ? 31.947  2.346   27.349  1.00 35.15 ? 180  LEU A CB  1 
ATOM   1398 C CG  . LEU A 1 180 ? 31.526  3.215   26.148  1.00 35.71 ? 180  LEU A CG  1 
ATOM   1399 C CD1 . LEU A 1 180 ? 30.889  2.357   25.081  1.00 33.08 ? 180  LEU A CD1 1 
ATOM   1400 C CD2 . LEU A 1 180 ? 30.609  4.378   26.489  1.00 34.42 ? 180  LEU A CD2 1 
ATOM   1401 N N   . GLN A 1 181 ? 33.848  1.633   29.880  1.00 36.73 ? 181  GLN A N   1 
ATOM   1402 C CA  . GLN A 1 181 ? 34.355  0.742   30.911  1.00 36.83 ? 181  GLN A CA  1 
ATOM   1403 C C   . GLN A 1 181 ? 34.093  1.294   32.311  1.00 36.45 ? 181  GLN A C   1 
ATOM   1404 O O   . GLN A 1 181 ? 33.582  0.575   33.182  1.00 36.74 ? 181  GLN A O   1 
ATOM   1405 C CB  . GLN A 1 181 ? 35.839  0.429   30.685  1.00 36.70 ? 181  GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 181 ? 36.033  -0.469  29.446  1.00 38.35 ? 181  GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 181 ? 37.490  -0.629  28.975  1.00 38.44 ? 181  GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 181 ? 38.386  0.091   29.390  1.00 40.42 ? 181  GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 181 ? 37.707  -1.582  28.084  1.00 40.69 ? 181  GLN A NE2 1 
ATOM   1410 N N   . TRP A 1 182 ? 34.421  2.569   32.524  1.00 35.57 ? 182  TRP A N   1 
ATOM   1411 C CA  . TRP A 1 182 ? 34.041  3.262   33.753  1.00 34.98 ? 182  TRP A CA  1 
ATOM   1412 C C   . TRP A 1 182 ? 32.541  3.078   34.094  1.00 35.24 ? 182  TRP A C   1 
ATOM   1413 O O   . TRP A 1 182 ? 32.186  2.984   35.265  1.00 35.07 ? 182  TRP A O   1 
ATOM   1414 C CB  . TRP A 1 182 ? 34.352  4.759   33.643  1.00 34.68 ? 182  TRP A CB  1 
ATOM   1415 C CG  . TRP A 1 182 ? 34.201  5.511   34.948  1.00 33.20 ? 182  TRP A CG  1 
ATOM   1416 C CD1 . TRP A 1 182 ? 35.187  5.808   35.823  1.00 32.24 ? 182  TRP A CD1 1 
ATOM   1417 C CD2 . TRP A 1 182 ? 32.990  6.057   35.498  1.00 33.00 ? 182  TRP A CD2 1 
ATOM   1418 N NE1 . TRP A 1 182 ? 34.679  6.513   36.887  1.00 34.03 ? 182  TRP A NE1 1 
ATOM   1419 C CE2 . TRP A 1 182 ? 33.330  6.671   36.720  1.00 32.26 ? 182  TRP A CE2 1 
ATOM   1420 C CE3 . TRP A 1 182 ? 31.651  6.097   35.065  1.00 31.51 ? 182  TRP A CE3 1 
ATOM   1421 C CZ2 . TRP A 1 182 ? 32.385  7.306   37.536  1.00 32.85 ? 182  TRP A CZ2 1 
ATOM   1422 C CZ3 . TRP A 1 182 ? 30.710  6.733   35.867  1.00 31.92 ? 182  TRP A CZ3 1 
ATOM   1423 C CH2 . TRP A 1 182 ? 31.079  7.315   37.102  1.00 33.19 ? 182  TRP A CH2 1 
ATOM   1424 N N   . VAL A 1 183 ? 31.669  3.034   33.089  1.00 35.05 ? 183  VAL A N   1 
ATOM   1425 C CA  . VAL A 1 183 ? 30.247  2.935   33.384  1.00 35.58 ? 183  VAL A CA  1 
ATOM   1426 C C   . VAL A 1 183 ? 29.950  1.523   33.866  1.00 36.24 ? 183  VAL A C   1 
ATOM   1427 O O   . VAL A 1 183 ? 29.250  1.360   34.856  1.00 36.76 ? 183  VAL A O   1 
ATOM   1428 C CB  . VAL A 1 183 ? 29.316  3.358   32.196  1.00 35.56 ? 183  VAL A CB  1 
ATOM   1429 C CG1 . VAL A 1 183 ? 27.892  2.797   32.383  1.00 34.44 ? 183  VAL A CG1 1 
ATOM   1430 C CG2 . VAL A 1 183 ? 29.288  4.882   32.026  1.00 33.60 ? 183  VAL A CG2 1 
ATOM   1431 N N   . GLN A 1 184 ? 30.506  0.522   33.188  1.00 36.64 ? 184  GLN A N   1 
ATOM   1432 C CA  . GLN A 1 184 ? 30.353  -0.871  33.595  1.00 37.55 ? 184  GLN A CA  1 
ATOM   1433 C C   . GLN A 1 184 ? 30.695  -1.070  35.060  1.00 38.31 ? 184  GLN A C   1 
ATOM   1434 O O   . GLN A 1 184 ? 29.909  -1.650  35.799  1.00 38.33 ? 184  GLN A O   1 
ATOM   1435 C CB  . GLN A 1 184 ? 31.183  -1.811  32.713  1.00 37.14 ? 184  GLN A CB  1 
ATOM   1436 C CG  . GLN A 1 184 ? 30.591  -1.979  31.357  1.00 38.60 ? 184  GLN A CG  1 
ATOM   1437 C CD  . GLN A 1 184 ? 29.181  -2.577  31.409  1.00 41.42 ? 184  GLN A CD  1 
ATOM   1438 O OE1 . GLN A 1 184 ? 29.015  -3.772  31.619  1.00 44.64 ? 184  GLN A OE1 1 
ATOM   1439 N NE2 . GLN A 1 184 ? 28.174  -1.748  31.223  1.00 40.05 ? 184  GLN A NE2 1 
ATOM   1440 N N   . GLU A 1 185 ? 31.847  -0.561  35.492  1.00 39.30 ? 185  GLU A N   1 
ATOM   1441 C CA  . GLU A 1 185 ? 32.283  -0.801  36.852  1.00 39.85 ? 185  GLU A CA  1 
ATOM   1442 C C   . GLU A 1 185 ? 31.586  0.068   37.900  1.00 39.80 ? 185  GLU A C   1 
ATOM   1443 O O   . GLU A 1 185 ? 31.437  -0.357  39.060  1.00 40.48 ? 185  GLU A O   1 
ATOM   1444 C CB  . GLU A 1 185 ? 33.796  -0.614  36.994  1.00 40.26 ? 185  GLU A CB  1 
ATOM   1445 C CG  . GLU A 1 185 ? 34.212  -0.712  38.461  1.00 42.16 ? 185  GLU A CG  1 
ATOM   1446 C CD  . GLU A 1 185 ? 35.674  -0.979  38.675  1.00 47.60 ? 185  GLU A CD  1 
ATOM   1447 O OE1 . GLU A 1 185 ? 36.022  -1.475  39.782  1.00 48.79 ? 185  GLU A OE1 1 
ATOM   1448 O OE2 . GLU A 1 185 ? 36.475  -0.680  37.749  1.00 51.12 ? 185  GLU A OE2 1 
ATOM   1449 N N   . ASN A 1 186 ? 31.199  1.290   37.533  1.00 39.19 ? 186  ASN A N   1 
ATOM   1450 C CA  . ASN A 1 186 ? 30.774  2.250   38.556  1.00 38.13 ? 186  ASN A CA  1 
ATOM   1451 C C   . ASN A 1 186 ? 29.341  2.714   38.512  1.00 38.01 ? 186  ASN A C   1 
ATOM   1452 O O   . ASN A 1 186 ? 28.872  3.280   39.488  1.00 38.25 ? 186  ASN A O   1 
ATOM   1453 C CB  . ASN A 1 186 ? 31.643  3.483   38.535  1.00 38.05 ? 186  ASN A CB  1 
ATOM   1454 C CG  . ASN A 1 186 ? 33.106  3.170   38.660  1.00 38.23 ? 186  ASN A CG  1 
ATOM   1455 O OD1 . ASN A 1 186 ? 33.615  2.990   39.755  1.00 39.56 ? 186  ASN A OD1 1 
ATOM   1456 N ND2 . ASN A 1 186 ? 33.800  3.148   37.536  1.00 38.15 ? 186  ASN A ND2 1 
ATOM   1457 N N   . ILE A 1 187 ? 28.643  2.534   37.396  1.00 37.89 ? 187  ILE A N   1 
ATOM   1458 C CA  . ILE A 1 187 ? 27.313  3.140   37.293  1.00 37.65 ? 187  ILE A CA  1 
ATOM   1459 C C   . ILE A 1 187 ? 26.336  2.670   38.379  1.00 37.87 ? 187  ILE A C   1 
ATOM   1460 O O   . ILE A 1 187 ? 25.468  3.442   38.793  1.00 38.24 ? 187  ILE A O   1 
ATOM   1461 C CB  . ILE A 1 187 ? 26.669  3.082   35.869  1.00 37.63 ? 187  ILE A CB  1 
ATOM   1462 C CG1 . ILE A 1 187 ? 25.726  4.289   35.669  1.00 37.91 ? 187  ILE A CG1 1 
ATOM   1463 C CG2 . ILE A 1 187 ? 25.953  1.755   35.591  1.00 35.99 ? 187  ILE A CG2 1 
ATOM   1464 C CD1 . ILE A 1 187 ? 26.429  5.629   35.656  1.00 32.70 ? 187  ILE A CD1 1 
ATOM   1465 N N   . ALA A 1 188 ? 26.502  1.433   38.855  1.00 37.75 ? 188  ALA A N   1 
ATOM   1466 C CA  . ALA A 1 188 ? 25.636  0.879   39.893  1.00 37.62 ? 188  ALA A CA  1 
ATOM   1467 C C   . ALA A 1 188 ? 25.664  1.732   41.150  1.00 37.77 ? 188  ALA A C   1 
ATOM   1468 O O   . ALA A 1 188 ? 24.638  1.914   41.796  1.00 37.91 ? 188  ALA A O   1 
ATOM   1469 C CB  . ALA A 1 188 ? 26.023  -0.530  40.206  1.00 37.47 ? 188  ALA A CB  1 
ATOM   1470 N N   . ALA A 1 189 ? 26.826  2.284   41.488  1.00 37.99 ? 189  ALA A N   1 
ATOM   1471 C CA  . ALA A 1 189 ? 26.897  3.228   42.594  1.00 37.99 ? 189  ALA A CA  1 
ATOM   1472 C C   . ALA A 1 189 ? 25.804  4.288   42.470  1.00 38.60 ? 189  ALA A C   1 
ATOM   1473 O O   . ALA A 1 189 ? 25.352  4.832   43.470  1.00 39.64 ? 189  ALA A O   1 
ATOM   1474 C CB  . ALA A 1 189 ? 28.239  3.877   42.668  1.00 37.10 ? 189  ALA A CB  1 
ATOM   1475 N N   . PHE A 1 190 ? 25.377  4.592   41.253  1.00 38.68 ? 190  PHE A N   1 
ATOM   1476 C CA  . PHE A 1 190 ? 24.431  5.693   41.056  1.00 39.34 ? 190  PHE A CA  1 
ATOM   1477 C C   . PHE A 1 190 ? 23.013  5.179   40.902  1.00 39.99 ? 190  PHE A C   1 
ATOM   1478 O O   . PHE A 1 190 ? 22.103  5.968   40.646  1.00 40.81 ? 190  PHE A O   1 
ATOM   1479 C CB  . PHE A 1 190 ? 24.809  6.515   39.818  1.00 38.76 ? 190  PHE A CB  1 
ATOM   1480 C CG  . PHE A 1 190 ? 26.133  7.179   39.932  1.00 37.73 ? 190  PHE A CG  1 
ATOM   1481 C CD1 . PHE A 1 190 ? 27.291  6.505   39.590  1.00 37.74 ? 190  PHE A CD1 1 
ATOM   1482 C CD2 . PHE A 1 190 ? 26.230  8.468   40.402  1.00 36.76 ? 190  PHE A CD2 1 
ATOM   1483 C CE1 . PHE A 1 190 ? 28.534  7.120   39.710  1.00 37.15 ? 190  PHE A CE1 1 
ATOM   1484 C CE2 . PHE A 1 190 ? 27.475  9.087   40.531  1.00 37.48 ? 190  PHE A CE2 1 
ATOM   1485 C CZ  . PHE A 1 190 ? 28.622  8.416   40.179  1.00 36.93 ? 190  PHE A CZ  1 
ATOM   1486 N N   . GLY A 1 191 ? 22.839  3.862   41.035  1.00 39.55 ? 191  GLY A N   1 
ATOM   1487 C CA  . GLY A 1 191 ? 21.580  3.223   40.730  1.00 40.01 ? 191  GLY A CA  1 
ATOM   1488 C C   . GLY A 1 191 ? 21.404  2.939   39.254  1.00 41.00 ? 191  GLY A C   1 
ATOM   1489 O O   . GLY A 1 191 ? 20.315  2.559   38.811  1.00 40.69 ? 191  GLY A O   1 
ATOM   1490 N N   . GLY A 1 192 ? 22.474  3.107   38.476  1.00 41.24 ? 192  GLY A N   1 
ATOM   1491 C CA  . GLY A 1 192 ? 22.434  2.671   37.083  1.00 41.51 ? 192  GLY A CA  1 
ATOM   1492 C C   . GLY A 1 192 ? 22.512  1.160   36.937  1.00 41.48 ? 192  GLY A C   1 
ATOM   1493 O O   . GLY A 1 192 ? 23.118  0.492   37.770  1.00 41.64 ? 192  GLY A O   1 
ATOM   1494 N N   . ASP A 1 193 ? 21.909  0.633   35.871  1.00 41.39 ? 193  ASP A N   1 
ATOM   1495 C CA  . ASP A 1 193 ? 21.971  -0.776  35.548  1.00 41.56 ? 193  ASP A CA  1 
ATOM   1496 C C   . ASP A 1 193 ? 22.980  -1.037  34.425  1.00 42.16 ? 193  ASP A C   1 
ATOM   1497 O O   . ASP A 1 193 ? 22.670  -0.809  33.248  1.00 41.29 ? 193  ASP A O   1 
ATOM   1498 C CB  . ASP A 1 193 ? 20.590  -1.286  35.133  1.00 41.65 ? 193  ASP A CB  1 
ATOM   1499 C CG  . ASP A 1 193 ? 20.571  -2.797  34.856  1.00 42.96 ? 193  ASP A CG  1 
ATOM   1500 O OD1 . ASP A 1 193 ? 21.641  -3.448  34.943  1.00 44.08 ? 193  ASP A OD1 1 
ATOM   1501 O OD2 . ASP A 1 193 ? 19.479  -3.336  34.542  1.00 43.57 ? 193  ASP A OD2 1 
ATOM   1502 N N   . PRO A 1 194 ? 24.177  -1.565  34.778  1.00 42.50 ? 194  PRO A N   1 
ATOM   1503 C CA  . PRO A 1 194 ? 25.230  -1.812  33.773  1.00 43.03 ? 194  PRO A CA  1 
ATOM   1504 C C   . PRO A 1 194 ? 24.844  -2.809  32.670  1.00 43.97 ? 194  PRO A C   1 
ATOM   1505 O O   . PRO A 1 194 ? 25.532  -2.887  31.645  1.00 43.65 ? 194  PRO A O   1 
ATOM   1506 C CB  . PRO A 1 194 ? 26.412  -2.341  34.604  1.00 43.00 ? 194  PRO A CB  1 
ATOM   1507 C CG  . PRO A 1 194 ? 25.802  -2.843  35.868  1.00 42.51 ? 194  PRO A CG  1 
ATOM   1508 C CD  . PRO A 1 194 ? 24.596  -1.964  36.130  1.00 41.90 ? 194  PRO A CD  1 
ATOM   1509 N N   . MET A 1 195 ? 23.746  -3.540  32.875  1.00 45.10 ? 195  MET A N   1 
ATOM   1510 C CA  . MET A 1 195 ? 23.314  -4.604  31.969  1.00 46.52 ? 195  MET A CA  1 
ATOM   1511 C C   . MET A 1 195 ? 22.292  -4.050  31.013  1.00 45.23 ? 195  MET A C   1 
ATOM   1512 O O   . MET A 1 195 ? 21.718  -4.771  30.189  1.00 45.80 ? 195  MET A O   1 
ATOM   1513 C CB  . MET A 1 195 ? 22.704  -5.777  32.753  1.00 46.82 ? 195  MET A CB  1 
ATOM   1514 C CG  . MET A 1 195 ? 23.569  -6.269  33.917  1.00 49.12 ? 195  MET A CG  1 
ATOM   1515 S SD  . MET A 1 195 ? 23.399  -8.043  34.273  1.00 51.42 ? 195  MET A SD  1 
ATOM   1516 C CE  . MET A 1 195 ? 24.546  -8.732  33.057  1.00 53.30 ? 195  MET A CE  1 
ATOM   1517 N N   . SER A 1 196 ? 22.053  -2.753  31.136  1.00 44.28 ? 196  SER A N   1 
ATOM   1518 C CA  . SER A 1 196 ? 21.148  -2.049  30.250  1.00 42.78 ? 196  SER A CA  1 
ATOM   1519 C C   . SER A 1 196 ? 21.722  -0.649  29.954  1.00 41.57 ? 196  SER A C   1 
ATOM   1520 O O   . SER A 1 196 ? 21.303  0.380   30.528  1.00 40.86 ? 196  SER A O   1 
ATOM   1521 C CB  . SER A 1 196 ? 19.770  -1.984  30.863  1.00 42.82 ? 196  SER A CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 18.934  -1.181  30.062  1.00 45.74 ? 196  SER A OG  1 
ATOM   1523 N N   . VAL A 1 197 ? 22.702  -0.657  29.052  1.00 39.62 ? 197  VAL A N   1 
ATOM   1524 C CA  . VAL A 1 197 ? 23.445  0.519   28.621  1.00 37.91 ? 197  VAL A CA  1 
ATOM   1525 C C   . VAL A 1 197 ? 23.171  0.769   27.120  1.00 36.90 ? 197  VAL A C   1 
ATOM   1526 O O   . VAL A 1 197 ? 23.438  -0.072  26.256  1.00 36.54 ? 197  VAL A O   1 
ATOM   1527 C CB  . VAL A 1 197 ? 24.978  0.316   28.900  1.00 38.07 ? 197  VAL A CB  1 
ATOM   1528 C CG1 . VAL A 1 197 ? 25.824  1.363   28.188  1.00 37.52 ? 197  VAL A CG1 1 
ATOM   1529 C CG2 . VAL A 1 197 ? 25.273  0.293   30.402  1.00 36.58 ? 197  VAL A CG2 1 
ATOM   1530 N N   . THR A 1 198 ? 22.618  1.931   26.821  1.00 36.58 ? 198  THR A N   1 
ATOM   1531 C CA  . THR A 1 198 ? 22.313  2.321   25.438  1.00 36.48 ? 198  THR A CA  1 
ATOM   1532 C C   . THR A 1 198 ? 23.187  3.501   25.031  1.00 36.16 ? 198  THR A C   1 
ATOM   1533 O O   . THR A 1 198 ? 23.166  4.534   25.719  1.00 36.59 ? 198  THR A O   1 
ATOM   1534 C CB  . THR A 1 198 ? 20.841  2.749   25.312  1.00 36.03 ? 198  THR A CB  1 
ATOM   1535 O OG1 . THR A 1 198 ? 20.010  1.632   25.639  1.00 36.75 ? 198  THR A OG1 1 
ATOM   1536 C CG2 . THR A 1 198 ? 20.540  3.157   23.901  1.00 35.84 ? 198  THR A CG2 1 
ATOM   1537 N N   . LEU A 1 199 ? 23.968  3.338   23.962  1.00 35.25 ? 199  LEU A N   1 
ATOM   1538 C CA  . LEU A 1 199 ? 24.719  4.455   23.382  1.00 35.28 ? 199  LEU A CA  1 
ATOM   1539 C C   . LEU A 1 199 ? 23.820  5.269   22.431  1.00 34.72 ? 199  LEU A C   1 
ATOM   1540 O O   . LEU A 1 199 ? 23.190  4.698   21.541  1.00 35.42 ? 199  LEU A O   1 
ATOM   1541 C CB  . LEU A 1 199 ? 25.948  3.965   22.599  1.00 35.37 ? 199  LEU A CB  1 
ATOM   1542 C CG  . LEU A 1 199 ? 26.952  2.975   23.216  1.00 36.21 ? 199  LEU A CG  1 
ATOM   1543 C CD1 . LEU A 1 199 ? 28.141  2.750   22.290  1.00 33.65 ? 199  LEU A CD1 1 
ATOM   1544 C CD2 . LEU A 1 199 ? 27.417  3.456   24.583  1.00 36.90 ? 199  LEU A CD2 1 
ATOM   1545 N N   . PHE A 1 200 ? 23.735  6.581   22.635  1.00 33.51 ? 200  PHE A N   1 
ATOM   1546 C CA  . PHE A 1 200 ? 23.206  7.479   21.595  1.00 32.49 ? 200  PHE A CA  1 
ATOM   1547 C C   . PHE A 1 200 ? 24.153  8.613   21.295  1.00 32.44 ? 200  PHE A C   1 
ATOM   1548 O O   . PHE A 1 200 ? 24.814  9.127   22.187  1.00 32.57 ? 200  PHE A O   1 
ATOM   1549 C CB  . PHE A 1 200 ? 21.756  7.966   21.850  1.00 31.62 ? 200  PHE A CB  1 
ATOM   1550 C CG  . PHE A 1 200 ? 21.564  8.955   23.005  1.00 29.12 ? 200  PHE A CG  1 
ATOM   1551 C CD1 . PHE A 1 200 ? 22.190  8.797   24.223  1.00 26.66 ? 200  PHE A CD1 1 
ATOM   1552 C CD2 . PHE A 1 200 ? 20.630  10.002  22.874  1.00 29.42 ? 200  PHE A CD2 1 
ATOM   1553 C CE1 . PHE A 1 200 ? 21.948  9.681   25.283  1.00 27.33 ? 200  PHE A CE1 1 
ATOM   1554 C CE2 . PHE A 1 200 ? 20.380  10.905  23.920  1.00 27.59 ? 200  PHE A CE2 1 
ATOM   1555 C CZ  . PHE A 1 200 ? 21.045  10.749  25.139  1.00 28.77 ? 200  PHE A CZ  1 
ATOM   1556 N N   . GLY A 1 201 ? 24.227  8.984   20.027  1.00 32.41 ? 201  GLY A N   1 
ATOM   1557 C CA  . GLY A 1 201 ? 25.075  10.074  19.609  1.00 32.49 ? 201  GLY A CA  1 
ATOM   1558 C C   . GLY A 1 201 ? 24.595  10.663  18.308  1.00 32.42 ? 201  GLY A C   1 
ATOM   1559 O O   . GLY A 1 201 ? 23.818  10.051  17.582  1.00 31.80 ? 201  GLY A O   1 
ATOM   1560 N N   . GLU A 1 202 ? 25.054  11.871  18.017  1.00 32.57 ? 202  GLU A N   1 
ATOM   1561 C CA  . GLU A 1 202 ? 24.620  12.548  16.804  1.00 32.79 ? 202  GLU A CA  1 
ATOM   1562 C C   . GLU A 1 202 ? 25.835  12.975  15.962  1.00 32.95 ? 202  GLU A C   1 
ATOM   1563 O O   . GLU A 1 202 ? 26.856  13.357  16.498  1.00 32.52 ? 202  GLU A O   1 
ATOM   1564 C CB  . GLU A 1 202 ? 23.676  13.698  17.185  1.00 32.18 ? 202  GLU A CB  1 
ATOM   1565 C CG  . GLU A 1 202 ? 23.112  14.456  16.024  1.00 33.61 ? 202  GLU A CG  1 
ATOM   1566 C CD  . GLU A 1 202 ? 24.091  15.504  15.524  1.00 35.59 ? 202  GLU A CD  1 
ATOM   1567 O OE1 . GLU A 1 202 ? 25.008  15.916  16.306  1.00 35.53 ? 202  GLU A OE1 1 
ATOM   1568 O OE2 . GLU A 1 202 ? 23.949  15.900  14.356  1.00 31.79 ? 202  GLU A OE2 1 
ATOM   1569 N N   . SER A 1 203 ? 25.710  12.875  14.642  1.00 34.44 ? 203  SER A N   1 
ATOM   1570 C CA  . SER A 1 203 ? 26.789  13.170  13.672  1.00 35.70 ? 203  SER A CA  1 
ATOM   1571 C C   . SER A 1 203 ? 28.139  12.386  13.878  1.00 35.64 ? 203  SER A C   1 
ATOM   1572 O O   . SER A 1 203 ? 28.178  11.184  13.620  1.00 35.59 ? 203  SER A O   1 
ATOM   1573 C CB  . SER A 1 203 ? 26.969  14.678  13.487  1.00 35.99 ? 203  SER A CB  1 
ATOM   1574 O OG  . SER A 1 203 ? 27.817  14.917  12.369  1.00 40.35 ? 203  SER A OG  1 
ATOM   1575 N N   . ALA A 1 204 ? 29.231  13.027  14.301  1.00 34.98 ? 204  ALA A N   1 
ATOM   1576 C CA  . ALA A 1 204 ? 30.437  12.224  14.610  1.00 35.56 ? 204  ALA A CA  1 
ATOM   1577 C C   . ALA A 1 204 ? 30.184  11.362  15.851  1.00 35.34 ? 204  ALA A C   1 
ATOM   1578 O O   . ALA A 1 204 ? 30.852  10.355  16.052  1.00 35.36 ? 204  ALA A O   1 
ATOM   1579 C CB  . ALA A 1 204 ? 31.683  13.073  14.794  1.00 34.83 ? 204  ALA A CB  1 
ATOM   1580 N N   . GLY A 1 205 ? 29.219  11.767  16.676  1.00 35.30 ? 205  GLY A N   1 
ATOM   1581 C CA  . GLY A 1 205 ? 28.803  10.970  17.824  1.00 35.03 ? 205  GLY A CA  1 
ATOM   1582 C C   . GLY A 1 205 ? 28.133  9.711   17.321  1.00 35.24 ? 205  GLY A C   1 
ATOM   1583 O O   . GLY A 1 205 ? 28.378  8.611   17.810  1.00 35.37 ? 205  GLY A O   1 
ATOM   1584 N N   . ALA A 1 206 ? 27.315  9.855   16.295  1.00 35.40 ? 206  ALA A N   1 
ATOM   1585 C CA  . ALA A 1 206 ? 26.640  8.684   15.742  1.00 35.18 ? 206  ALA A CA  1 
ATOM   1586 C C   . ALA A 1 206 ? 27.643  7.776   15.060  1.00 34.93 ? 206  ALA A C   1 
ATOM   1587 O O   . ALA A 1 206 ? 27.575  6.560   15.220  1.00 36.09 ? 206  ALA A O   1 
ATOM   1588 C CB  . ALA A 1 206 ? 25.523  9.083   14.786  1.00 34.65 ? 206  ALA A CB  1 
ATOM   1589 N N   . ALA A 1 207 ? 28.562  8.349   14.296  1.00 34.15 ? 207  ALA A N   1 
ATOM   1590 C CA  . ALA A 1 207 ? 29.584  7.558   13.666  1.00 33.98 ? 207  ALA A CA  1 
ATOM   1591 C C   . ALA A 1 207 ? 30.392  6.882   14.764  1.00 34.23 ? 207  ALA A C   1 
ATOM   1592 O O   . ALA A 1 207 ? 30.653  5.688   14.675  1.00 34.70 ? 207  ALA A O   1 
ATOM   1593 C CB  . ALA A 1 207 ? 30.455  8.404   12.808  1.00 34.57 ? 207  ALA A CB  1 
ATOM   1594 N N   . SER A 1 208 ? 30.736  7.616   15.824  1.00 33.79 ? 208  SER A N   1 
ATOM   1595 C CA  . SER A 1 208 ? 31.328  6.983   17.000  1.00 34.06 ? 208  SER A CA  1 
ATOM   1596 C C   . SER A 1 208 ? 30.530  5.756   17.499  1.00 34.71 ? 208  SER A C   1 
ATOM   1597 O O   . SER A 1 208 ? 31.100  4.663   17.601  1.00 35.61 ? 208  SER A O   1 
ATOM   1598 C CB  . SER A 1 208 ? 31.608  7.985   18.120  1.00 33.39 ? 208  SER A CB  1 
ATOM   1599 O OG  . SER A 1 208 ? 32.719  8.799   17.782  1.00 34.25 ? 208  SER A OG  1 
ATOM   1600 N N   . VAL A 1 209 ? 29.233  5.911   17.778  1.00 34.41 ? 209  VAL A N   1 
ATOM   1601 C CA  . VAL A 1 209 ? 28.412  4.784   18.253  1.00 34.35 ? 209  VAL A CA  1 
ATOM   1602 C C   . VAL A 1 209 ? 28.594  3.535   17.364  1.00 35.27 ? 209  VAL A C   1 
ATOM   1603 O O   . VAL A 1 209 ? 28.835  2.444   17.873  1.00 34.97 ? 209  VAL A O   1 
ATOM   1604 C CB  . VAL A 1 209 ? 26.910  5.178   18.391  1.00 34.19 ? 209  VAL A CB  1 
ATOM   1605 C CG1 . VAL A 1 209 ? 26.009  3.951   18.595  1.00 32.13 ? 209  VAL A CG1 1 
ATOM   1606 C CG2 . VAL A 1 209 ? 26.729  6.171   19.536  1.00 32.85 ? 209  VAL A CG2 1 
ATOM   1607 N N   . GLY A 1 210 ? 28.527  3.733   16.047  1.00 36.07 ? 210  GLY A N   1 
ATOM   1608 C CA  . GLY A 1 210 ? 28.687  2.684   15.055  1.00 37.59 ? 210  GLY A CA  1 
ATOM   1609 C C   . GLY A 1 210 ? 30.081  2.081   15.052  1.00 39.29 ? 210  GLY A C   1 
ATOM   1610 O O   . GLY A 1 210 ? 30.228  0.881   14.793  1.00 39.95 ? 210  GLY A O   1 
ATOM   1611 N N   . MET A 1 211 ? 31.108  2.882   15.347  1.00 39.72 ? 211  MET A N   1 
ATOM   1612 C CA  . MET A 1 211 ? 32.442  2.320   15.518  1.00 40.64 ? 211  MET A CA  1 
ATOM   1613 C C   . MET A 1 211 ? 32.422  1.306   16.668  1.00 40.46 ? 211  MET A C   1 
ATOM   1614 O O   . MET A 1 211 ? 33.067  0.259   16.578  1.00 41.39 ? 211  MET A O   1 
ATOM   1615 C CB  . MET A 1 211 ? 33.476  3.393   15.877  1.00 41.84 ? 211  MET A CB  1 
ATOM   1616 C CG  . MET A 1 211 ? 33.466  4.654   15.054  1.00 43.63 ? 211  MET A CG  1 
ATOM   1617 S SD  . MET A 1 211 ? 34.327  4.370   13.535  1.00 45.69 ? 211  MET A SD  1 
ATOM   1618 C CE  . MET A 1 211 ? 34.017  5.902   12.685  1.00 43.44 ? 211  MET A CE  1 
ATOM   1619 N N   . HIS A 1 212 ? 31.735  1.632   17.768  1.00 39.00 ? 212  HIS A N   1 
ATOM   1620 C CA  . HIS A 1 212 ? 31.718  0.732   18.904  1.00 38.54 ? 212  HIS A CA  1 
ATOM   1621 C C   . HIS A 1 212 ? 30.925  -0.511  18.548  1.00 39.22 ? 212  HIS A C   1 
ATOM   1622 O O   . HIS A 1 212 ? 31.278  -1.594  18.970  1.00 40.28 ? 212  HIS A O   1 
ATOM   1623 C CB  . HIS A 1 212 ? 31.189  1.387   20.174  1.00 37.51 ? 212  HIS A CB  1 
ATOM   1624 C CG  . HIS A 1 212 ? 32.052  2.492   20.683  1.00 35.45 ? 212  HIS A CG  1 
ATOM   1625 N ND1 . HIS A 1 212 ? 33.315  2.274   21.190  1.00 32.98 ? 212  HIS A ND1 1 
ATOM   1626 C CD2 . HIS A 1 212 ? 31.842  3.829   20.761  1.00 33.51 ? 212  HIS A CD2 1 
ATOM   1627 C CE1 . HIS A 1 212 ? 33.847  3.428   21.560  1.00 31.80 ? 212  HIS A CE1 1 
ATOM   1628 N NE2 . HIS A 1 212 ? 32.975  4.388   21.308  1.00 32.55 ? 212  HIS A NE2 1 
ATOM   1629 N N   . ILE A 1 213 ? 29.880  -0.369  17.743  1.00 39.30 ? 213  ILE A N   1 
ATOM   1630 C CA  . ILE A 1 213 ? 29.172  -1.536  17.268  1.00 39.23 ? 213  ILE A CA  1 
ATOM   1631 C C   . ILE A 1 213 ? 30.117  -2.470  16.517  1.00 39.63 ? 213  ILE A C   1 
ATOM   1632 O O   . ILE A 1 213 ? 30.018  -3.673  16.635  1.00 39.87 ? 213  ILE A O   1 
ATOM   1633 C CB  . ILE A 1 213 ? 27.942  -1.152  16.413  1.00 39.13 ? 213  ILE A CB  1 
ATOM   1634 C CG1 . ILE A 1 213 ? 26.825  -0.644  17.330  1.00 38.35 ? 213  ILE A CG1 1 
ATOM   1635 C CG2 . ILE A 1 213 ? 27.420  -2.358  15.601  1.00 37.91 ? 213  ILE A CG2 1 
ATOM   1636 C CD1 . ILE A 1 213 ? 25.741  0.063   16.611  1.00 36.63 ? 213  ILE A CD1 1 
ATOM   1637 N N   . LEU A 1 214 ? 31.050  -1.910  15.760  1.00 40.28 ? 214  LEU A N   1 
ATOM   1638 C CA  . LEU A 1 214 ? 31.871  -2.699  14.838  1.00 40.11 ? 214  LEU A CA  1 
ATOM   1639 C C   . LEU A 1 214 ? 33.180  -3.162  15.446  1.00 39.69 ? 214  LEU A C   1 
ATOM   1640 O O   . LEU A 1 214 ? 33.975  -3.783  14.767  1.00 39.56 ? 214  LEU A O   1 
ATOM   1641 C CB  . LEU A 1 214 ? 32.187  -1.869  13.595  1.00 40.15 ? 214  LEU A CB  1 
ATOM   1642 C CG  . LEU A 1 214 ? 31.000  -1.476  12.728  1.00 41.92 ? 214  LEU A CG  1 
ATOM   1643 C CD1 . LEU A 1 214 ? 31.417  -0.428  11.717  1.00 40.64 ? 214  LEU A CD1 1 
ATOM   1644 C CD2 . LEU A 1 214 ? 30.386  -2.702  12.041  1.00 42.59 ? 214  LEU A CD2 1 
ATOM   1645 N N   . SER A 1 215 ? 33.413  -2.845  16.711  1.00 40.02 ? 215  SER A N   1 
ATOM   1646 C CA  . SER A 1 215 ? 34.702  -3.088  17.329  1.00 40.78 ? 215  SER A CA  1 
ATOM   1647 C C   . SER A 1 215 ? 34.502  -3.943  18.560  1.00 41.93 ? 215  SER A C   1 
ATOM   1648 O O   . SER A 1 215 ? 34.029  -3.470  19.574  1.00 42.54 ? 215  SER A O   1 
ATOM   1649 C CB  . SER A 1 215 ? 35.339  -1.761  17.708  1.00 40.77 ? 215  SER A CB  1 
ATOM   1650 O OG  . SER A 1 215 ? 36.632  -1.914  18.240  1.00 39.36 ? 215  SER A OG  1 
ATOM   1651 N N   . LEU A 1 216 ? 34.874  -5.214  18.441  1.00 43.62 ? 216  LEU A N   1 
ATOM   1652 C CA  . LEU A 1 216 ? 34.666  -6.263  19.429  1.00 44.40 ? 216  LEU A CA  1 
ATOM   1653 C C   . LEU A 1 216 ? 34.869  -5.861  20.897  1.00 43.80 ? 216  LEU A C   1 
ATOM   1654 O O   . LEU A 1 216 ? 33.993  -6.083  21.713  1.00 43.90 ? 216  LEU A O   1 
ATOM   1655 C CB  . LEU A 1 216 ? 35.603  -7.437  19.076  1.00 46.10 ? 216  LEU A CB  1 
ATOM   1656 C CG  . LEU A 1 216 ? 35.072  -8.888  19.009  1.00 49.49 ? 216  LEU A CG  1 
ATOM   1657 C CD1 . LEU A 1 216 ? 34.582  -9.436  20.392  1.00 50.65 ? 216  LEU A CD1 1 
ATOM   1658 C CD2 . LEU A 1 216 ? 33.989  -9.040  17.889  1.00 51.76 ? 216  LEU A CD2 1 
ATOM   1659 N N   . PRO A 1 217 ? 36.042  -5.298  21.259  1.00 43.51 ? 217  PRO A N   1 
ATOM   1660 C CA  . PRO A 1 217 ? 36.151  -4.991  22.698  1.00 43.08 ? 217  PRO A CA  1 
ATOM   1661 C C   . PRO A 1 217 ? 35.109  -3.999  23.267  1.00 43.42 ? 217  PRO A C   1 
ATOM   1662 O O   . PRO A 1 217 ? 34.960  -3.909  24.496  1.00 43.67 ? 217  PRO A O   1 
ATOM   1663 C CB  . PRO A 1 217 ? 37.571  -4.437  22.835  1.00 43.05 ? 217  PRO A CB  1 
ATOM   1664 C CG  . PRO A 1 217 ? 38.305  -4.929  21.610  1.00 42.39 ? 217  PRO A CG  1 
ATOM   1665 C CD  . PRO A 1 217 ? 37.276  -4.958  20.522  1.00 42.42 ? 217  PRO A CD  1 
ATOM   1666 N N   . SER A 1 218 ? 34.408  -3.263  22.402  1.00 43.02 ? 218  SER A N   1 
ATOM   1667 C CA  . SER A 1 218 ? 33.433  -2.255  22.845  1.00 43.12 ? 218  SER A CA  1 
ATOM   1668 C C   . SER A 1 218 ? 32.077  -2.893  23.000  1.00 43.52 ? 218  SER A C   1 
ATOM   1669 O O   . SER A 1 218 ? 31.184  -2.348  23.679  1.00 42.84 ? 218  SER A O   1 
ATOM   1670 C CB  . SER A 1 218 ? 33.297  -1.126  21.825  1.00 42.97 ? 218  SER A CB  1 
ATOM   1671 O OG  . SER A 1 218 ? 34.376  -0.219  21.899  1.00 43.77 ? 218  SER A OG  1 
ATOM   1672 N N   . ARG A 1 219 ? 31.941  -4.047  22.344  1.00 43.82 ? 219  ARG A N   1 
ATOM   1673 C CA  . ARG A 1 219 ? 30.669  -4.750  22.174  1.00 44.33 ? 219  ARG A CA  1 
ATOM   1674 C C   . ARG A 1 219 ? 29.974  -5.173  23.454  1.00 43.87 ? 219  ARG A C   1 
ATOM   1675 O O   . ARG A 1 219 ? 28.757  -5.020  23.572  1.00 44.79 ? 219  ARG A O   1 
ATOM   1676 C CB  . ARG A 1 219 ? 30.835  -5.950  21.253  1.00 44.27 ? 219  ARG A CB  1 
ATOM   1677 C CG  . ARG A 1 219 ? 30.826  -5.563  19.800  1.00 47.04 ? 219  ARG A CG  1 
ATOM   1678 C CD  . ARG A 1 219 ? 29.666  -4.610  19.505  1.00 50.24 ? 219  ARG A CD  1 
ATOM   1679 N NE  . ARG A 1 219 ? 28.583  -4.753  20.474  1.00 53.01 ? 219  ARG A NE  1 
ATOM   1680 C CZ  . ARG A 1 219 ? 27.432  -5.375  20.243  1.00 54.64 ? 219  ARG A CZ  1 
ATOM   1681 N NH1 . ARG A 1 219 ? 27.201  -5.923  19.038  1.00 51.89 ? 219  ARG A NH1 1 
ATOM   1682 N NH2 . ARG A 1 219 ? 26.517  -5.434  21.230  1.00 53.77 ? 219  ARG A NH2 1 
ATOM   1683 N N   . SER A 1 220 ? 30.762  -5.698  24.385  1.00 43.15 ? 220  SER A N   1 
ATOM   1684 C CA  . SER A 1 220 ? 30.326  -6.073  25.719  1.00 42.64 ? 220  SER A CA  1 
ATOM   1685 C C   . SER A 1 220 ? 30.003  -4.908  26.655  1.00 41.40 ? 220  SER A C   1 
ATOM   1686 O O   . SER A 1 220 ? 29.690  -5.142  27.827  1.00 42.05 ? 220  SER A O   1 
ATOM   1687 C CB  . SER A 1 220 ? 31.433  -6.895  26.392  1.00 43.11 ? 220  SER A CB  1 
ATOM   1688 O OG  . SER A 1 220 ? 32.692  -6.221  26.317  1.00 45.83 ? 220  SER A OG  1 
ATOM   1689 N N   . LEU A 1 221 ? 30.092  -3.670  26.181  1.00 39.77 ? 221  LEU A N   1 
ATOM   1690 C CA  . LEU A 1 221 ? 29.991  -2.528  27.087  1.00 37.95 ? 221  LEU A CA  1 
ATOM   1691 C C   . LEU A 1 221 ? 28.651  -1.827  26.963  1.00 37.64 ? 221  LEU A C   1 
ATOM   1692 O O   . LEU A 1 221 ? 28.385  -0.844  27.674  1.00 37.45 ? 221  LEU A O   1 
ATOM   1693 C CB  . LEU A 1 221 ? 31.151  -1.563  26.882  1.00 36.97 ? 221  LEU A CB  1 
ATOM   1694 C CG  . LEU A 1 221 ? 32.558  -2.177  27.000  1.00 37.20 ? 221  LEU A CG  1 
ATOM   1695 C CD1 . LEU A 1 221 ? 33.664  -1.174  26.577  1.00 34.41 ? 221  LEU A CD1 1 
ATOM   1696 C CD2 . LEU A 1 221 ? 32.837  -2.708  28.416  1.00 34.12 ? 221  LEU A CD2 1 
ATOM   1697 N N   . PHE A 1 222 ? 27.806  -2.332  26.065  1.00 36.88 ? 222  PHE A N   1 
ATOM   1698 C CA  . PHE A 1 222 ? 26.490  -1.729  25.837  1.00 36.85 ? 222  PHE A CA  1 
ATOM   1699 C C   . PHE A 1 222 ? 25.613  -2.770  25.152  1.00 37.09 ? 222  PHE A C   1 
ATOM   1700 O O   . PHE A 1 222 ? 26.123  -3.759  24.667  1.00 36.26 ? 222  PHE A O   1 
ATOM   1701 C CB  . PHE A 1 222 ? 26.592  -0.431  25.000  1.00 35.75 ? 222  PHE A CB  1 
ATOM   1702 C CG  . PHE A 1 222 ? 27.005  -0.667  23.577  1.00 34.56 ? 222  PHE A CG  1 
ATOM   1703 C CD1 . PHE A 1 222 ? 28.356  -0.814  23.231  1.00 34.12 ? 222  PHE A CD1 1 
ATOM   1704 C CD2 . PHE A 1 222 ? 26.065  -0.751  22.579  1.00 33.09 ? 222  PHE A CD2 1 
ATOM   1705 C CE1 . PHE A 1 222 ? 28.746  -1.050  21.913  1.00 31.09 ? 222  PHE A CE1 1 
ATOM   1706 C CE2 . PHE A 1 222 ? 26.466  -1.001  21.250  1.00 32.43 ? 222  PHE A CE2 1 
ATOM   1707 C CZ  . PHE A 1 222 ? 27.795  -1.160  20.934  1.00 31.27 ? 222  PHE A CZ  1 
ATOM   1708 N N   . HIS A 1 223 ? 24.308  -2.513  25.075  1.00 38.25 ? 223  HIS A N   1 
ATOM   1709 C CA  . HIS A 1 223 ? 23.363  -3.515  24.580  1.00 39.53 ? 223  HIS A CA  1 
ATOM   1710 C C   . HIS A 1 223 ? 22.524  -3.016  23.419  1.00 39.96 ? 223  HIS A C   1 
ATOM   1711 O O   . HIS A 1 223 ? 22.049  -3.810  22.596  1.00 41.25 ? 223  HIS A O   1 
ATOM   1712 C CB  . HIS A 1 223 ? 22.505  -3.999  25.755  1.00 39.38 ? 223  HIS A CB  1 
ATOM   1713 C CG  . HIS A 1 223 ? 23.314  -4.181  27.009  1.00 40.98 ? 223  HIS A CG  1 
ATOM   1714 N ND1 . HIS A 1 223 ? 24.029  -5.334  27.280  1.00 40.29 ? 223  HIS A ND1 1 
ATOM   1715 C CD2 . HIS A 1 223 ? 23.605  -3.317  28.010  1.00 40.37 ? 223  HIS A CD2 1 
ATOM   1716 C CE1 . HIS A 1 223 ? 24.675  -5.196  28.422  1.00 40.05 ? 223  HIS A CE1 1 
ATOM   1717 N NE2 . HIS A 1 223 ? 24.437  -3.979  28.883  1.00 43.62 ? 223  HIS A NE2 1 
ATOM   1718 N N   . ARG A 1 224 ? 22.357  -1.703  23.343  1.00 40.01 ? 224  ARG A N   1 
ATOM   1719 C CA  . ARG A 1 224 ? 21.483  -1.058  22.353  1.00 39.95 ? 224  ARG A CA  1 
ATOM   1720 C C   . ARG A 1 224 ? 22.154  0.206   21.819  1.00 39.05 ? 224  ARG A C   1 
ATOM   1721 O O   . ARG A 1 224 ? 23.034  0.759   22.467  1.00 39.50 ? 224  ARG A O   1 
ATOM   1722 C CB  . ARG A 1 224 ? 20.159  -0.686  23.025  1.00 40.64 ? 224  ARG A CB  1 
ATOM   1723 C CG  . ARG A 1 224 ? 19.203  -1.827  23.096  1.00 43.79 ? 224  ARG A CG  1 
ATOM   1724 C CD  . ARG A 1 224 ? 17.987  -1.518  23.942  1.00 47.53 ? 224  ARG A CD  1 
ATOM   1725 N NE  . ARG A 1 224 ? 18.266  -1.645  25.371  1.00 50.49 ? 224  ARG A NE  1 
ATOM   1726 C CZ  . ARG A 1 224 ? 18.585  -2.771  26.011  1.00 50.82 ? 224  ARG A CZ  1 
ATOM   1727 N NH1 . ARG A 1 224 ? 18.712  -3.929  25.374  1.00 52.62 ? 224  ARG A NH1 1 
ATOM   1728 N NH2 . ARG A 1 224 ? 18.798  -2.729  27.309  1.00 52.74 ? 224  ARG A NH2 1 
ATOM   1729 N N   . ALA A 1 225 ? 21.746  0.676   20.648  1.00 38.32 ? 225  ALA A N   1 
ATOM   1730 C CA  . ALA A 1 225 ? 22.402  1.844   20.056  1.00 37.35 ? 225  ALA A CA  1 
ATOM   1731 C C   . ALA A 1 225 ? 21.468  2.803   19.295  1.00 37.08 ? 225  ALA A C   1 
ATOM   1732 O O   . ALA A 1 225 ? 20.553  2.378   18.583  1.00 36.96 ? 225  ALA A O   1 
ATOM   1733 C CB  . ALA A 1 225 ? 23.518  1.403   19.170  1.00 36.85 ? 225  ALA A CB  1 
ATOM   1734 N N   . VAL A 1 226 ? 21.727  4.095   19.440  1.00 36.24 ? 226  VAL A N   1 
ATOM   1735 C CA  . VAL A 1 226 ? 21.052  5.100   18.646  1.00 36.33 ? 226  VAL A CA  1 
ATOM   1736 C C   . VAL A 1 226 ? 22.059  5.958   17.862  1.00 36.59 ? 226  VAL A C   1 
ATOM   1737 O O   . VAL A 1 226 ? 22.972  6.556   18.453  1.00 36.73 ? 226  VAL A O   1 
ATOM   1738 C CB  . VAL A 1 226 ? 20.186  6.017   19.512  1.00 36.38 ? 226  VAL A CB  1 
ATOM   1739 C CG1 . VAL A 1 226 ? 19.462  7.034   18.620  1.00 36.74 ? 226  VAL A CG1 1 
ATOM   1740 C CG2 . VAL A 1 226 ? 19.174  5.208   20.334  1.00 35.38 ? 226  VAL A CG2 1 
ATOM   1741 N N   . LEU A 1 227 ? 21.883  6.016   16.543  1.00 35.96 ? 227  LEU A N   1 
ATOM   1742 C CA  . LEU A 1 227 ? 22.713  6.839   15.678  1.00 35.21 ? 227  LEU A CA  1 
ATOM   1743 C C   . LEU A 1 227 ? 21.867  7.881   14.987  1.00 35.65 ? 227  LEU A C   1 
ATOM   1744 O O   . LEU A 1 227 ? 21.075  7.568   14.090  1.00 36.00 ? 227  LEU A O   1 
ATOM   1745 C CB  . LEU A 1 227 ? 23.406  5.984   14.625  1.00 34.81 ? 227  LEU A CB  1 
ATOM   1746 C CG  . LEU A 1 227 ? 24.351  4.883   15.109  1.00 34.41 ? 227  LEU A CG  1 
ATOM   1747 C CD1 . LEU A 1 227 ? 23.564  3.697   15.708  1.00 33.13 ? 227  LEU A CD1 1 
ATOM   1748 C CD2 . LEU A 1 227 ? 25.199  4.420   13.947  1.00 32.04 ? 227  LEU A CD2 1 
ATOM   1749 N N   . GLN A 1 228 ? 22.035  9.124   15.410  1.00 36.10 ? 228  GLN A N   1 
ATOM   1750 C CA  . GLN A 1 228 ? 21.315  10.264  14.838  1.00 36.38 ? 228  GLN A CA  1 
ATOM   1751 C C   . GLN A 1 228 ? 22.217  10.936  13.805  1.00 37.11 ? 228  GLN A C   1 
ATOM   1752 O O   . GLN A 1 228 ? 23.309  11.411  14.138  1.00 37.53 ? 228  GLN A O   1 
ATOM   1753 C CB  . GLN A 1 228 ? 20.934  11.240  15.948  1.00 35.55 ? 228  GLN A CB  1 
ATOM   1754 C CG  . GLN A 1 228 ? 20.286  10.549  17.156  1.00 35.81 ? 228  GLN A CG  1 
ATOM   1755 C CD  . GLN A 1 228 ? 19.971  11.478  18.308  1.00 37.47 ? 228  GLN A CD  1 
ATOM   1756 O OE1 . GLN A 1 228 ? 19.731  11.029  19.433  1.00 40.06 ? 228  GLN A OE1 1 
ATOM   1757 N NE2 . GLN A 1 228 ? 19.974  12.781  18.047  1.00 40.45 ? 228  GLN A NE2 1 
ATOM   1758 N N   . SER A 1 229 ? 21.778  10.938  12.545  1.00 37.22 ? 229  SER A N   1 
ATOM   1759 C CA  . SER A 1 229 ? 22.457  11.647  11.463  1.00 37.02 ? 229  SER A CA  1 
ATOM   1760 C C   . SER A 1 229 ? 23.956  11.360  11.342  1.00 37.50 ? 229  SER A C   1 
ATOM   1761 O O   . SER A 1 229 ? 24.758  12.269  11.115  1.00 38.14 ? 229  SER A O   1 
ATOM   1762 C CB  . SER A 1 229 ? 22.237  13.145  11.600  1.00 36.89 ? 229  SER A CB  1 
ATOM   1763 O OG  . SER A 1 229 ? 20.884  13.428  11.804  1.00 36.42 ? 229  SER A OG  1 
ATOM   1764 N N   . GLY A 1 230 ? 24.339  10.099  11.448  1.00 37.83 ? 230  GLY A N   1 
ATOM   1765 C CA  . GLY A 1 230 ? 25.748  9.740   11.315  1.00 37.39 ? 230  GLY A CA  1 
ATOM   1766 C C   . GLY A 1 230 ? 25.918  8.242   11.274  1.00 37.46 ? 230  GLY A C   1 
ATOM   1767 O O   . GLY A 1 230 ? 25.074  7.494   11.798  1.00 37.54 ? 230  GLY A O   1 
ATOM   1768 N N   . THR A 1 231 ? 26.999  7.805   10.631  1.00 36.88 ? 231  THR A N   1 
ATOM   1769 C CA  . THR A 1 231 ? 27.254  6.394   10.409  1.00 37.18 ? 231  THR A CA  1 
ATOM   1770 C C   . THR A 1 231 ? 28.763  6.091   10.383  1.00 37.35 ? 231  THR A C   1 
ATOM   1771 O O   . THR A 1 231 ? 29.554  6.930   9.972   1.00 37.30 ? 231  THR A O   1 
ATOM   1772 C CB  . THR A 1 231 ? 26.636  5.932   9.053   1.00 37.37 ? 231  THR A CB  1 
ATOM   1773 O OG1 . THR A 1 231 ? 27.184  6.704   7.986   1.00 36.57 ? 231  THR A OG1 1 
ATOM   1774 C CG2 . THR A 1 231 ? 25.142  6.120   9.038   1.00 38.09 ? 231  THR A CG2 1 
ATOM   1775 N N   . PRO A 1 232 ? 29.174  4.877   10.798  1.00 37.30 ? 232  PRO A N   1 
ATOM   1776 C CA  . PRO A 1 232 ? 30.608  4.621   10.708  1.00 36.87 ? 232  PRO A CA  1 
ATOM   1777 C C   . PRO A 1 232 ? 31.079  4.427   9.252   1.00 36.65 ? 232  PRO A C   1 
ATOM   1778 O O   . PRO A 1 232 ? 32.226  4.729   8.932   1.00 35.86 ? 232  PRO A O   1 
ATOM   1779 C CB  . PRO A 1 232 ? 30.785  3.365   11.554  1.00 36.54 ? 232  PRO A CB  1 
ATOM   1780 C CG  . PRO A 1 232 ? 29.519  2.651   11.442  1.00 37.11 ? 232  PRO A CG  1 
ATOM   1781 C CD  . PRO A 1 232 ? 28.443  3.713   11.336  1.00 37.57 ? 232  PRO A CD  1 
ATOM   1782 N N   . ASN A 1 233 ? 30.179  3.945   8.392   1.00 36.55 ? 233  ASN A N   1 
ATOM   1783 C CA  . ASN A 1 233 ? 30.419  3.849   6.962   1.00 36.59 ? 233  ASN A CA  1 
ATOM   1784 C C   . ASN A 1 233 ? 30.145  5.209   6.336   1.00 37.27 ? 233  ASN A C   1 
ATOM   1785 O O   . ASN A 1 233 ? 29.542  6.079   6.976   1.00 37.62 ? 233  ASN A O   1 
ATOM   1786 C CB  . ASN A 1 233 ? 29.482  2.821   6.342   1.00 35.84 ? 233  ASN A CB  1 
ATOM   1787 C CG  . ASN A 1 233 ? 28.036  3.116   6.638   1.00 36.35 ? 233  ASN A CG  1 
ATOM   1788 O OD1 . ASN A 1 233 ? 27.618  3.060   7.792   1.00 38.72 ? 233  ASN A OD1 1 
ATOM   1789 N ND2 . ASN A 1 233 ? 27.262  3.452   5.612   1.00 33.49 ? 233  ASN A ND2 1 
ATOM   1790 N N   . GLY A 1 234 ? 30.558  5.395   5.084   1.00 37.68 ? 234  GLY A N   1 
ATOM   1791 C CA  . GLY A 1 234 ? 30.329  6.667   4.393   1.00 37.95 ? 234  GLY A CA  1 
ATOM   1792 C C   . GLY A 1 234 ? 31.625  7.424   4.138   1.00 38.19 ? 234  GLY A C   1 
ATOM   1793 O O   . GLY A 1 234 ? 32.696  7.017   4.618   1.00 38.47 ? 234  GLY A O   1 
ATOM   1794 N N   . PRO A 1 235 ? 31.539  8.554   3.413   1.00 37.99 ? 235  PRO A N   1 
ATOM   1795 C CA  . PRO A 1 235 ? 32.742  9.203   2.891   1.00 37.13 ? 235  PRO A CA  1 
ATOM   1796 C C   . PRO A 1 235 ? 33.635  9.957   3.876   1.00 36.67 ? 235  PRO A C   1 
ATOM   1797 O O   . PRO A 1 235 ? 34.780  10.306  3.507   1.00 38.03 ? 235  PRO A O   1 
ATOM   1798 C CB  . PRO A 1 235 ? 32.194  10.162  1.836   1.00 37.23 ? 235  PRO A CB  1 
ATOM   1799 C CG  . PRO A 1 235 ? 30.783  10.495  2.304   1.00 38.60 ? 235  PRO A CG  1 
ATOM   1800 C CD  . PRO A 1 235 ? 30.295  9.255   3.026   1.00 38.09 ? 235  PRO A CD  1 
ATOM   1801 N N   . TRP A 1 236 ? 33.175  10.218  5.093   1.00 34.82 ? 236  TRP A N   1 
ATOM   1802 C CA  . TRP A 1 236 ? 33.911  11.160  5.962   1.00 33.44 ? 236  TRP A CA  1 
ATOM   1803 C C   . TRP A 1 236 ? 34.321  10.597  7.314   1.00 33.51 ? 236  TRP A C   1 
ATOM   1804 O O   . TRP A 1 236 ? 35.197  11.173  7.976   1.00 32.47 ? 236  TRP A O   1 
ATOM   1805 C CB  . TRP A 1 236 ? 33.084  12.434  6.212   1.00 32.12 ? 236  TRP A CB  1 
ATOM   1806 C CG  . TRP A 1 236 ? 31.701  12.121  6.739   1.00 31.97 ? 236  TRP A CG  1 
ATOM   1807 C CD1 . TRP A 1 236 ? 30.557  11.913  5.987   1.00 30.48 ? 236  TRP A CD1 1 
ATOM   1808 C CD2 . TRP A 1 236 ? 31.317  11.921  8.110   1.00 30.26 ? 236  TRP A CD2 1 
ATOM   1809 N NE1 . TRP A 1 236 ? 29.495  11.627  6.813   1.00 29.27 ? 236  TRP A NE1 1 
ATOM   1810 C CE2 . TRP A 1 236 ? 29.923  11.621  8.114   1.00 30.05 ? 236  TRP A CE2 1 
ATOM   1811 C CE3 . TRP A 1 236 ? 32.002  11.993  9.338   1.00 30.05 ? 236  TRP A CE3 1 
ATOM   1812 C CZ2 . TRP A 1 236 ? 29.208  11.385  9.293   1.00 29.02 ? 236  TRP A CZ2 1 
ATOM   1813 C CZ3 . TRP A 1 236 ? 31.298  11.762  10.513  1.00 29.19 ? 236  TRP A CZ3 1 
ATOM   1814 C CH2 . TRP A 1 236 ? 29.909  11.452  10.482  1.00 31.12 ? 236  TRP A CH2 1 
ATOM   1815 N N   . ALA A 1 237 ? 33.665  9.516   7.748   1.00 33.23 ? 237  ALA A N   1 
ATOM   1816 C CA  . ALA A 1 237 ? 33.859  9.031   9.121   1.00 33.57 ? 237  ALA A CA  1 
ATOM   1817 C C   . ALA A 1 237 ? 35.173  8.301   9.381   1.00 34.02 ? 237  ALA A C   1 
ATOM   1818 O O   . ALA A 1 237 ? 35.538  8.131   10.544  1.00 35.09 ? 237  ALA A O   1 
ATOM   1819 C CB  . ALA A 1 237 ? 32.686  8.199   9.603   1.00 32.81 ? 237  ALA A CB  1 
ATOM   1820 N N   . THR A 1 238 ? 35.879  7.870   8.334   1.00 33.98 ? 238  THR A N   1 
ATOM   1821 C CA  . THR A 1 238 ? 37.151  7.149   8.506   1.00 34.22 ? 238  THR A CA  1 
ATOM   1822 C C   . THR A 1 238 ? 38.084  7.548   7.401   1.00 34.84 ? 238  THR A C   1 
ATOM   1823 O O   . THR A 1 238 ? 37.633  8.018   6.375   1.00 35.74 ? 238  THR A O   1 
ATOM   1824 C CB  . THR A 1 238 ? 37.000  5.615   8.439   1.00 33.72 ? 238  THR A CB  1 
ATOM   1825 O OG1 . THR A 1 238 ? 36.415  5.240   7.184   1.00 32.43 ? 238  THR A OG1 1 
ATOM   1826 C CG2 . THR A 1 238 ? 36.126  5.109   9.559   1.00 34.05 ? 238  THR A CG2 1 
ATOM   1827 N N   . VAL A 1 239 ? 39.384  7.375   7.613   1.00 35.00 ? 239  VAL A N   1 
ATOM   1828 C CA  . VAL A 1 239 ? 40.369  7.484   6.538   1.00 34.69 ? 239  VAL A CA  1 
ATOM   1829 C C   . VAL A 1 239 ? 41.186  6.197   6.552   1.00 35.46 ? 239  VAL A C   1 
ATOM   1830 O O   . VAL A 1 239 ? 41.246  5.520   7.576   1.00 35.27 ? 239  VAL A O   1 
ATOM   1831 C CB  . VAL A 1 239 ? 41.335  8.700   6.705   1.00 34.60 ? 239  VAL A CB  1 
ATOM   1832 C CG1 . VAL A 1 239 ? 40.634  10.018  6.320   1.00 32.23 ? 239  VAL A CG1 1 
ATOM   1833 C CG2 . VAL A 1 239 ? 41.974  8.735   8.124   1.00 32.32 ? 239  VAL A CG2 1 
ATOM   1834 N N   . SER A 1 240 ? 41.800  5.860   5.418   1.00 35.84 ? 240  SER A N   1 
ATOM   1835 C CA  . SER A 1 240 ? 42.703  4.711   5.350   1.00 36.68 ? 240  SER A CA  1 
ATOM   1836 C C   . SER A 1 240 ? 43.984  4.992   6.140   1.00 36.45 ? 240  SER A C   1 
ATOM   1837 O O   . SER A 1 240 ? 44.292  6.146   6.493   1.00 35.56 ? 240  SER A O   1 
ATOM   1838 C CB  . SER A 1 240 ? 43.068  4.424   3.897   1.00 36.88 ? 240  SER A CB  1 
ATOM   1839 O OG  . SER A 1 240 ? 43.776  5.544   3.405   1.00 38.37 ? 240  SER A OG  1 
ATOM   1840 N N   . ALA A 1 241 ? 44.725  3.927   6.423   1.00 36.54 ? 241  ALA A N   1 
ATOM   1841 C CA  . ALA A 1 241 ? 46.001  4.055   7.112   1.00 36.55 ? 241  ALA A CA  1 
ATOM   1842 C C   . ALA A 1 241 ? 46.937  5.004   6.328   1.00 36.50 ? 241  ALA A C   1 
ATOM   1843 O O   . ALA A 1 241 ? 47.496  5.929   6.901   1.00 36.35 ? 241  ALA A O   1 
ATOM   1844 C CB  . ALA A 1 241 ? 46.628  2.684   7.313   1.00 36.61 ? 241  ALA A CB  1 
ATOM   1845 N N   . GLY A 1 242 ? 47.061  4.791   5.018   1.00 36.93 ? 242  GLY A N   1 
ATOM   1846 C CA  . GLY A 1 242 ? 47.897  5.639   4.146   1.00 37.49 ? 242  GLY A CA  1 
ATOM   1847 C C   . GLY A 1 242 ? 47.572  7.126   4.208   1.00 37.69 ? 242  GLY A C   1 
ATOM   1848 O O   . GLY A 1 242 ? 48.470  7.989   4.368   1.00 37.03 ? 242  GLY A O   1 
ATOM   1849 N N   . GLU A 1 243 ? 46.278  7.416   4.097   1.00 37.20 ? 243  GLU A N   1 
ATOM   1850 C CA  . GLU A 1 243 ? 45.819  8.779   4.059   1.00 37.24 ? 243  GLU A CA  1 
ATOM   1851 C C   . GLU A 1 243 ? 46.055  9.428   5.435   1.00 37.62 ? 243  GLU A C   1 
ATOM   1852 O O   . GLU A 1 243 ? 46.524  10.614  5.513   1.00 37.74 ? 243  GLU A O   1 
ATOM   1853 C CB  . GLU A 1 243 ? 44.374  8.840   3.543   1.00 36.98 ? 243  GLU A CB  1 
ATOM   1854 C CG  . GLU A 1 243 ? 43.705  10.201  3.502   1.00 38.81 ? 243  GLU A CG  1 
ATOM   1855 C CD  . GLU A 1 243 ? 44.401  11.290  2.651   1.00 42.11 ? 243  GLU A CD  1 
ATOM   1856 O OE1 . GLU A 1 243 ? 43.934  12.452  2.766   1.00 41.68 ? 243  GLU A OE1 1 
ATOM   1857 O OE2 . GLU A 1 243 ? 45.381  11.024  1.888   1.00 41.57 ? 243  GLU A OE2 1 
ATOM   1858 N N   . ALA A 1 244 ? 45.807  8.663   6.510   1.00 36.81 ? 244  ALA A N   1 
ATOM   1859 C CA  . ALA A 1 244 ? 46.058  9.186   7.861   1.00 37.04 ? 244  ALA A CA  1 
ATOM   1860 C C   . ALA A 1 244 ? 47.531  9.478   8.061   1.00 37.80 ? 244  ALA A C   1 
ATOM   1861 O O   . ALA A 1 244 ? 47.891  10.502  8.670   1.00 38.35 ? 244  ALA A O   1 
ATOM   1862 C CB  . ALA A 1 244 ? 45.554  8.263   8.936   1.00 36.31 ? 244  ALA A CB  1 
ATOM   1863 N N   . ARG A 1 245 ? 48.386  8.604   7.527   1.00 38.48 ? 245  ARG A N   1 
ATOM   1864 C CA  . ARG A 1 245 ? 49.817  8.822   7.611   1.00 39.34 ? 245  ARG A CA  1 
ATOM   1865 C C   . ARG A 1 245 ? 50.154  10.116  6.886   1.00 39.74 ? 245  ARG A C   1 
ATOM   1866 O O   . ARG A 1 245 ? 50.879  10.945  7.394   1.00 39.64 ? 245  ARG A O   1 
ATOM   1867 C CB  . ARG A 1 245 ? 50.580  7.644   7.015   1.00 40.03 ? 245  ARG A CB  1 
ATOM   1868 C CG  . ARG A 1 245 ? 52.109  7.820   6.945   1.00 39.21 ? 245  ARG A CG  1 
ATOM   1869 C CD  . ARG A 1 245 ? 52.780  6.425   6.862   1.00 39.92 ? 245  ARG A CD  1 
ATOM   1870 N NE  . ARG A 1 245 ? 52.803  5.727   8.157   1.00 40.09 ? 245  ARG A NE  1 
ATOM   1871 C CZ  . ARG A 1 245 ? 53.648  6.018   9.153   1.00 39.76 ? 245  ARG A CZ  1 
ATOM   1872 N NH1 . ARG A 1 245 ? 54.559  6.982   9.014   1.00 38.98 ? 245  ARG A NH1 1 
ATOM   1873 N NH2 . ARG A 1 245 ? 53.588  5.340   10.292  1.00 38.96 ? 245  ARG A NH2 1 
ATOM   1874 N N   . ARG A 1 246 ? 49.571  10.290  5.713   1.00 40.01 ? 246  ARG A N   1 
ATOM   1875 C CA  . ARG A 1 246 ? 49.850  11.421  4.863   1.00 40.57 ? 246  ARG A CA  1 
ATOM   1876 C C   . ARG A 1 246 ? 49.480  12.761  5.536   1.00 40.67 ? 246  ARG A C   1 
ATOM   1877 O O   . ARG A 1 246 ? 50.307  13.697  5.592   1.00 41.54 ? 246  ARG A O   1 
ATOM   1878 C CB  . ARG A 1 246 ? 49.080  11.210  3.573   1.00 41.12 ? 246  ARG A CB  1 
ATOM   1879 C CG  . ARG A 1 246 ? 49.468  12.078  2.434   1.00 43.35 ? 246  ARG A CG  1 
ATOM   1880 C CD  . ARG A 1 246 ? 48.233  12.377  1.591   1.00 44.86 ? 246  ARG A CD  1 
ATOM   1881 N NE  . ARG A 1 246 ? 48.133  13.823  1.437   1.00 48.47 ? 246  ARG A NE  1 
ATOM   1882 C CZ  . ARG A 1 246 ? 47.099  14.570  1.803   1.00 49.21 ? 246  ARG A CZ  1 
ATOM   1883 N NH1 . ARG A 1 246 ? 46.013  14.027  2.319   1.00 47.38 ? 246  ARG A NH1 1 
ATOM   1884 N NH2 . ARG A 1 246 ? 47.152  15.882  1.608   1.00 53.26 ? 246  ARG A NH2 1 
ATOM   1885 N N   . ARG A 1 247 ? 48.264  12.852  6.076   1.00 39.88 ? 247  ARG A N   1 
ATOM   1886 C CA  . ARG A 1 247 ? 47.821  14.079  6.737   1.00 38.63 ? 247  ARG A CA  1 
ATOM   1887 C C   . ARG A 1 247 ? 48.640  14.375  7.983   1.00 38.32 ? 247  ARG A C   1 
ATOM   1888 O O   . ARG A 1 247 ? 48.891  15.554  8.302   1.00 37.99 ? 247  ARG A O   1 
ATOM   1889 C CB  . ARG A 1 247 ? 46.337  14.005  7.093   1.00 38.68 ? 247  ARG A CB  1 
ATOM   1890 C CG  . ARG A 1 247 ? 45.423  13.830  5.892   1.00 38.59 ? 247  ARG A CG  1 
ATOM   1891 C CD  . ARG A 1 247 ? 44.019  13.585  6.341   1.00 38.81 ? 247  ARG A CD  1 
ATOM   1892 N NE  . ARG A 1 247 ? 43.125  13.264  5.234   1.00 40.38 ? 247  ARG A NE  1 
ATOM   1893 C CZ  . ARG A 1 247 ? 41.790  13.264  5.330   1.00 39.82 ? 247  ARG A CZ  1 
ATOM   1894 N NH1 . ARG A 1 247 ? 41.204  13.576  6.483   1.00 38.30 ? 247  ARG A NH1 1 
ATOM   1895 N NH2 . ARG A 1 247 ? 41.036  12.950  4.286   1.00 35.49 ? 247  ARG A NH2 1 
ATOM   1896 N N   . ALA A 1 248 ? 49.042  13.313  8.691   1.00 37.53 ? 248  ALA A N   1 
ATOM   1897 C CA  . ALA A 1 248 ? 49.807  13.446  9.933   1.00 36.98 ? 248  ALA A CA  1 
ATOM   1898 C C   . ALA A 1 248 ? 51.210  13.990  9.655   1.00 36.85 ? 248  ALA A C   1 
ATOM   1899 O O   . ALA A 1 248 ? 51.672  14.940  10.300  1.00 36.29 ? 248  ALA A O   1 
ATOM   1900 C CB  . ALA A 1 248 ? 49.876  12.122  10.664  1.00 36.46 ? 248  ALA A CB  1 
ATOM   1901 N N   . THR A 1 249 ? 51.871  13.413  8.664   1.00 37.17 ? 249  THR A N   1 
ATOM   1902 C CA  . THR A 1 249 ? 53.199  13.889  8.321   1.00 38.40 ? 249  THR A CA  1 
ATOM   1903 C C   . THR A 1 249 ? 53.204  15.303  7.704   1.00 38.59 ? 249  THR A C   1 
ATOM   1904 O O   . THR A 1 249 ? 54.097  16.089  8.020   1.00 38.65 ? 249  THR A O   1 
ATOM   1905 C CB  . THR A 1 249 ? 54.115  12.839  7.586   1.00 38.12 ? 249  THR A CB  1 
ATOM   1906 O OG1 . THR A 1 249 ? 54.658  13.434  6.410   1.00 39.47 ? 249  THR A OG1 1 
ATOM   1907 C CG2 . THR A 1 249 ? 53.380  11.604  7.205   1.00 37.13 ? 249  THR A CG2 1 
ATOM   1908 N N   . LEU A 1 250 ? 52.196  15.628  6.886   1.00 39.19 ? 250  LEU A N   1 
ATOM   1909 C CA  . LEU A 1 250 ? 52.003  17.004  6.411   1.00 39.34 ? 250  LEU A CA  1 
ATOM   1910 C C   . LEU A 1 250 ? 51.780  17.997  7.562   1.00 39.87 ? 250  LEU A C   1 
ATOM   1911 O O   . LEU A 1 250 ? 52.441  19.043  7.639   1.00 40.14 ? 250  LEU A O   1 
ATOM   1912 C CB  . LEU A 1 250 ? 50.863  17.099  5.381   1.00 39.84 ? 250  LEU A CB  1 
ATOM   1913 C CG  . LEU A 1 250 ? 50.529  18.482  4.755   1.00 40.20 ? 250  LEU A CG  1 
ATOM   1914 C CD1 . LEU A 1 250 ? 51.799  19.305  4.376   1.00 41.95 ? 250  LEU A CD1 1 
ATOM   1915 C CD2 . LEU A 1 250 ? 49.620  18.360  3.530   1.00 39.25 ? 250  LEU A CD2 1 
ATOM   1916 N N   . LEU A 1 251 ? 50.877  17.673  8.481   1.00 39.90 ? 251  LEU A N   1 
ATOM   1917 C CA  . LEU A 1 251 ? 50.678  18.550  9.612   1.00 39.73 ? 251  LEU A CA  1 
ATOM   1918 C C   . LEU A 1 251 ? 52.001  18.805  10.344  1.00 40.00 ? 251  LEU A C   1 
ATOM   1919 O O   . LEU A 1 251 ? 52.321  19.947  10.654  1.00 39.54 ? 251  LEU A O   1 
ATOM   1920 C CB  . LEU A 1 251 ? 49.625  18.002  10.559  1.00 39.26 ? 251  LEU A CB  1 
ATOM   1921 C CG  . LEU A 1 251 ? 49.419  18.999  11.693  1.00 38.96 ? 251  LEU A CG  1 
ATOM   1922 C CD1 . LEU A 1 251 ? 47.975  19.378  11.840  1.00 40.61 ? 251  LEU A CD1 1 
ATOM   1923 C CD2 . LEU A 1 251 ? 49.985  18.499  12.984  1.00 37.05 ? 251  LEU A CD2 1 
ATOM   1924 N N   . ALA A 1 252 ? 52.734  17.731  10.633  1.00 40.82 ? 252  ALA A N   1 
ATOM   1925 C CA  . ALA A 1 252 ? 54.106  17.787  11.178  1.00 41.69 ? 252  ALA A CA  1 
ATOM   1926 C C   . ALA A 1 252 ? 55.000  18.750  10.397  1.00 42.18 ? 252  ALA A C   1 
ATOM   1927 O O   . ALA A 1 252 ? 55.570  19.682  10.981  1.00 41.94 ? 252  ALA A O   1 
ATOM   1928 C CB  . ALA A 1 252 ? 54.723  16.399  11.197  1.00 41.73 ? 252  ALA A CB  1 
ATOM   1929 N N   . ARG A 1 253 ? 55.092  18.574  9.081   1.00 42.99 ? 253  ARG A N   1 
ATOM   1930 C CA  . ARG A 1 253 ? 55.833  19.555  8.277   1.00 45.34 ? 253  ARG A CA  1 
ATOM   1931 C C   . ARG A 1 253 ? 55.359  20.982  8.600   1.00 45.27 ? 253  ARG A C   1 
ATOM   1932 O O   . ARG A 1 253 ? 56.154  21.813  9.019   1.00 45.80 ? 253  ARG A O   1 
ATOM   1933 C CB  . ARG A 1 253 ? 55.730  19.276  6.779   1.00 44.70 ? 253  ARG A CB  1 
ATOM   1934 C CG  . ARG A 1 253 ? 56.586  18.136  6.285   1.00 47.35 ? 253  ARG A CG  1 
ATOM   1935 C CD  . ARG A 1 253 ? 56.760  18.167  4.747   1.00 49.41 ? 253  ARG A CD  1 
ATOM   1936 N NE  . ARG A 1 253 ? 57.093  16.816  4.251   1.00 60.39 ? 253  ARG A NE  1 
ATOM   1937 C CZ  . ARG A 1 253 ? 56.199  15.911  3.803   1.00 63.30 ? 253  ARG A CZ  1 
ATOM   1938 N NH1 . ARG A 1 253 ? 56.617  14.711  3.387   1.00 62.93 ? 253  ARG A NH1 1 
ATOM   1939 N NH2 . ARG A 1 253 ? 54.886  16.193  3.762   1.00 63.83 ? 253  ARG A NH2 1 
ATOM   1940 N N   . LEU A 1 254 ? 54.055  21.240  8.463   1.00 45.72 ? 254  LEU A N   1 
ATOM   1941 C CA  . LEU A 1 254 ? 53.498  22.590  8.643   1.00 46.02 ? 254  LEU A CA  1 
ATOM   1942 C C   . LEU A 1 254 ? 53.830  23.243  9.978   1.00 46.85 ? 254  LEU A C   1 
ATOM   1943 O O   . LEU A 1 254 ? 53.656  24.454  10.101  1.00 47.38 ? 254  LEU A O   1 
ATOM   1944 C CB  . LEU A 1 254 ? 51.983  22.646  8.383   1.00 44.79 ? 254  LEU A CB  1 
ATOM   1945 C CG  . LEU A 1 254 ? 51.515  22.292  6.965   1.00 44.98 ? 254  LEU A CG  1 
ATOM   1946 C CD1 . LEU A 1 254 ? 50.014  21.955  6.872   1.00 42.50 ? 254  LEU A CD1 1 
ATOM   1947 C CD2 . LEU A 1 254 ? 51.897  23.369  5.954   1.00 43.42 ? 254  LEU A CD2 1 
ATOM   1948 N N   . VAL A 1 255 ? 54.308  22.469  10.958  1.00 47.53 ? 255  VAL A N   1 
ATOM   1949 C CA  . VAL A 1 255 ? 54.615  23.029  12.289  1.00 48.44 ? 255  VAL A CA  1 
ATOM   1950 C C   . VAL A 1 255 ? 56.091  22.917  12.730  1.00 50.10 ? 255  VAL A C   1 
ATOM   1951 O O   . VAL A 1 255 ? 56.440  23.335  13.844  1.00 51.03 ? 255  VAL A O   1 
ATOM   1952 C CB  . VAL A 1 255 ? 53.680  22.489  13.428  1.00 47.78 ? 255  VAL A CB  1 
ATOM   1953 C CG1 . VAL A 1 255 ? 52.243  22.929  13.217  1.00 46.82 ? 255  VAL A CG1 1 
ATOM   1954 C CG2 . VAL A 1 255 ? 53.775  20.969  13.562  1.00 47.59 ? 255  VAL A CG2 1 
ATOM   1955 N N   . GLY A 1 256 ? 56.953  22.364  11.879  1.00 51.10 ? 256  GLY A N   1 
ATOM   1956 C CA  . GLY A 1 256 ? 58.370  22.209  12.228  1.00 52.07 ? 256  GLY A CA  1 
ATOM   1957 C C   . GLY A 1 256 ? 58.858  20.765  12.235  1.00 52.80 ? 256  GLY A C   1 
ATOM   1958 O O   . GLY A 1 256 ? 60.040  20.497  12.033  1.00 53.52 ? 256  GLY A O   1 
ATOM   1959 N N   . CYS A 1 257 ? 57.948  19.824  12.431  1.00 52.85 ? 257  CYS A N   1 
ATOM   1960 C CA  . CYS A 1 257 ? 58.329  18.444  12.672  1.00 52.71 ? 257  CYS A CA  1 
ATOM   1961 C C   . CYS A 1 257 ? 58.251  17.637  11.414  1.00 52.70 ? 257  CYS A C   1 
ATOM   1962 O O   . CYS A 1 257 ? 58.718  18.099  10.387  1.00 53.53 ? 257  CYS A O   1 
ATOM   1963 C CB  . CYS A 1 257 ? 57.432  17.863  13.740  1.00 52.13 ? 257  CYS A CB  1 
ATOM   1964 S SG  . CYS A 1 257 ? 57.415  18.940  15.147  1.00 54.16 ? 257  CYS A SG  1 
ATOM   1965 N N   . ASN A 1 265 ? 61.614  7.847   10.394  1.00 60.36 ? 265  ASN A N   1 
ATOM   1966 C CA  . ASN A 1 265 ? 61.430  7.415   11.778  1.00 60.69 ? 265  ASN A CA  1 
ATOM   1967 C C   . ASN A 1 265 ? 60.251  8.130   12.492  1.00 60.09 ? 265  ASN A C   1 
ATOM   1968 O O   . ASN A 1 265 ? 60.269  9.363   12.683  1.00 59.96 ? 265  ASN A O   1 
ATOM   1969 C CB  . ASN A 1 265 ? 62.743  7.601   12.558  1.00 61.11 ? 265  ASN A CB  1 
ATOM   1970 C CG  . ASN A 1 265 ? 62.719  6.937   13.948  1.00 62.99 ? 265  ASN A CG  1 
ATOM   1971 O OD1 . ASN A 1 265 ? 62.593  7.625   14.973  1.00 64.73 ? 265  ASN A OD1 1 
ATOM   1972 N ND2 . ASN A 1 265 ? 62.854  5.600   13.984  1.00 64.03 ? 265  ASN A ND2 1 
ATOM   1973 N N   . ASP A 1 266 ? 59.245  7.348   12.895  1.00 59.18 ? 266  ASP A N   1 
ATOM   1974 C CA  . ASP A 1 266 ? 58.014  7.890   13.500  1.00 58.26 ? 266  ASP A CA  1 
ATOM   1975 C C   . ASP A 1 266 ? 58.228  8.485   14.890  1.00 58.22 ? 266  ASP A C   1 
ATOM   1976 O O   . ASP A 1 266 ? 57.625  9.503   15.237  1.00 58.25 ? 266  ASP A O   1 
ATOM   1977 C CB  . ASP A 1 266 ? 56.911  6.828   13.544  1.00 57.77 ? 266  ASP A CB  1 
ATOM   1978 C CG  . ASP A 1 266 ? 56.297  6.564   12.176  1.00 57.45 ? 266  ASP A CG  1 
ATOM   1979 O OD1 . ASP A 1 266 ? 56.497  7.379   11.249  1.00 56.90 ? 266  ASP A OD1 1 
ATOM   1980 O OD2 . ASP A 1 266 ? 55.609  5.536   12.016  1.00 56.45 ? 266  ASP A OD2 1 
ATOM   1981 N N   . THR A 1 267 ? 59.093  7.856   15.682  1.00 58.05 ? 267  THR A N   1 
ATOM   1982 C CA  . THR A 1 267 ? 59.413  8.342   17.030  1.00 57.31 ? 267  THR A CA  1 
ATOM   1983 C C   . THR A 1 267 ? 59.878  9.805   17.050  1.00 57.17 ? 267  THR A C   1 
ATOM   1984 O O   . THR A 1 267 ? 59.353  10.608  17.821  1.00 56.96 ? 267  THR A O   1 
ATOM   1985 C CB  . THR A 1 267 ? 60.425  7.393   17.727  1.00 57.28 ? 267  THR A CB  1 
ATOM   1986 O OG1 . THR A 1 267 ? 59.895  6.066   17.696  1.00 56.35 ? 267  THR A OG1 1 
ATOM   1987 C CG2 . THR A 1 267 ? 60.677  7.790   19.189  1.00 56.45 ? 267  THR A CG2 1 
ATOM   1988 N N   . GLU A 1 268 ? 60.850  10.148  16.205  1.00 57.21 ? 268  GLU A N   1 
ATOM   1989 C CA  . GLU A 1 268 ? 61.384  11.527  16.154  1.00 57.94 ? 268  GLU A CA  1 
ATOM   1990 C C   . GLU A 1 268 ? 60.292  12.563  15.826  1.00 56.17 ? 268  GLU A C   1 
ATOM   1991 O O   . GLU A 1 268 ? 60.245  13.648  16.420  1.00 56.57 ? 268  GLU A O   1 
ATOM   1992 C CB  . GLU A 1 268 ? 62.545  11.645  15.139  1.00 58.03 ? 268  GLU A CB  1 
ATOM   1993 C CG  . GLU A 1 268 ? 63.967  11.460  15.719  1.00 60.69 ? 268  GLU A CG  1 
ATOM   1994 C CD  . GLU A 1 268 ? 65.097  11.708  14.676  1.00 61.63 ? 268  GLU A CD  1 
ATOM   1995 O OE1 . GLU A 1 268 ? 64.913  12.510  13.713  1.00 65.80 ? 268  GLU A OE1 1 
ATOM   1996 O OE2 . GLU A 1 268 ? 66.188  11.099  14.830  1.00 65.66 ? 268  GLU A OE2 1 
ATOM   1997 N N   . LEU A 1 269 ? 59.426  12.209  14.879  1.00 54.11 ? 269  LEU A N   1 
ATOM   1998 C CA  . LEU A 1 269 ? 58.352  13.063  14.424  1.00 52.29 ? 269  LEU A CA  1 
ATOM   1999 C C   . LEU A 1 269 ? 57.310  13.331  15.522  1.00 51.46 ? 269  LEU A C   1 
ATOM   2000 O O   . LEU A 1 269 ? 56.961  14.490  15.795  1.00 51.46 ? 269  LEU A O   1 
ATOM   2001 C CB  . LEU A 1 269 ? 57.706  12.422  13.202  1.00 52.12 ? 269  LEU A CB  1 
ATOM   2002 C CG  . LEU A 1 269 ? 56.725  13.234  12.374  1.00 51.23 ? 269  LEU A CG  1 
ATOM   2003 C CD1 . LEU A 1 269 ? 56.773  12.772  10.954  1.00 50.57 ? 269  LEU A CD1 1 
ATOM   2004 C CD2 . LEU A 1 269 ? 55.322  13.066  12.918  1.00 52.13 ? 269  LEU A CD2 1 
ATOM   2005 N N   . ILE A 1 270 ? 56.823  12.263  16.152  1.00 49.94 ? 270  ILE A N   1 
ATOM   2006 C CA  . ILE A 1 270 ? 55.824  12.383  17.195  1.00 48.59 ? 270  ILE A CA  1 
ATOM   2007 C C   . ILE A 1 270 ? 56.386  13.145  18.377  1.00 48.66 ? 270  ILE A C   1 
ATOM   2008 O O   . ILE A 1 270 ? 55.717  14.036  18.927  1.00 48.75 ? 270  ILE A O   1 
ATOM   2009 C CB  . ILE A 1 270 ? 55.275  11.008  17.627  1.00 48.46 ? 270  ILE A CB  1 
ATOM   2010 C CG1 . ILE A 1 270 ? 54.629  10.337  16.417  1.00 48.40 ? 270  ILE A CG1 1 
ATOM   2011 C CG2 . ILE A 1 270 ? 54.254  11.167  18.759  1.00 45.97 ? 270  ILE A CG2 1 
ATOM   2012 C CD1 . ILE A 1 270 ? 54.536  8.863   16.497  1.00 49.08 ? 270  ILE A CD1 1 
ATOM   2013 N N   . ALA A 1 271 ? 57.621  12.815  18.751  1.00 47.89 ? 271  ALA A N   1 
ATOM   2014 C CA  . ALA A 1 271 ? 58.257  13.448  19.881  1.00 47.74 ? 271  ALA A CA  1 
ATOM   2015 C C   . ALA A 1 271 ? 58.308  14.953  19.656  1.00 47.57 ? 271  ALA A C   1 
ATOM   2016 O O   . ALA A 1 271 ? 58.115  15.741  20.572  1.00 47.84 ? 271  ALA A O   1 
ATOM   2017 C CB  . ALA A 1 271 ? 59.656  12.882  20.073  1.00 47.65 ? 271  ALA A CB  1 
ATOM   2018 N N   . CYS A 1 272 ? 58.574  15.340  18.417  1.00 48.32 ? 272  CYS A N   1 
ATOM   2019 C CA  . CYS A 1 272 ? 58.614  16.744  18.036  1.00 47.69 ? 272  CYS A CA  1 
ATOM   2020 C C   . CYS A 1 272 ? 57.214  17.403  18.079  1.00 46.17 ? 272  CYS A C   1 
ATOM   2021 O O   . CYS A 1 272 ? 57.067  18.512  18.606  1.00 45.69 ? 272  CYS A O   1 
ATOM   2022 C CB  . CYS A 1 272 ? 59.250  16.886  16.658  1.00 47.79 ? 272  CYS A CB  1 
ATOM   2023 S SG  . CYS A 1 272 ? 59.300  18.600  16.102  1.00 51.76 ? 272  CYS A SG  1 
ATOM   2024 N N   . LEU A 1 273 ? 56.214  16.720  17.514  1.00 44.80 ? 273  LEU A N   1 
ATOM   2025 C CA  . LEU A 1 273 ? 54.800  17.111  17.659  1.00 44.01 ? 273  LEU A CA  1 
ATOM   2026 C C   . LEU A 1 273 ? 54.396  17.326  19.128  1.00 43.84 ? 273  LEU A C   1 
ATOM   2027 O O   . LEU A 1 273 ? 53.673  18.279  19.437  1.00 43.71 ? 273  LEU A O   1 
ATOM   2028 C CB  . LEU A 1 273 ? 53.858  16.098  16.984  1.00 43.44 ? 273  LEU A CB  1 
ATOM   2029 C CG  . LEU A 1 273 ? 53.670  16.194  15.464  1.00 42.80 ? 273  LEU A CG  1 
ATOM   2030 C CD1 . LEU A 1 273 ? 52.922  14.999  14.865  1.00 41.31 ? 273  LEU A CD1 1 
ATOM   2031 C CD2 . LEU A 1 273 ? 52.970  17.462  15.083  1.00 43.54 ? 273  LEU A CD2 1 
ATOM   2032 N N   . ARG A 1 274 ? 54.896  16.474  20.028  1.00 43.30 ? 274  ARG A N   1 
ATOM   2033 C CA  . ARG A 1 274 ? 54.586  16.596  21.455  1.00 43.51 ? 274  ARG A CA  1 
ATOM   2034 C C   . ARG A 1 274 ? 55.119  17.867  22.109  1.00 43.48 ? 274  ARG A C   1 
ATOM   2035 O O   . ARG A 1 274 ? 54.557  18.339  23.103  1.00 44.06 ? 274  ARG A O   1 
ATOM   2036 C CB  . ARG A 1 274 ? 55.005  15.346  22.231  1.00 42.54 ? 274  ARG A CB  1 
ATOM   2037 C CG  . ARG A 1 274 ? 54.086  14.130  21.955  1.00 44.15 ? 274  ARG A CG  1 
ATOM   2038 C CD  . ARG A 1 274 ? 54.282  12.996  22.962  1.00 44.97 ? 274  ARG A CD  1 
ATOM   2039 N NE  . ARG A 1 274 ? 55.713  12.747  23.144  1.00 48.91 ? 274  ARG A NE  1 
ATOM   2040 C CZ  . ARG A 1 274 ? 56.375  11.737  22.586  1.00 48.93 ? 274  ARG A CZ  1 
ATOM   2041 N NH1 . ARG A 1 274 ? 55.708  10.858  21.851  1.00 49.41 ? 274  ARG A NH1 1 
ATOM   2042 N NH2 . ARG A 1 274 ? 57.695  11.605  22.771  1.00 47.46 ? 274  ARG A NH2 1 
ATOM   2043 N N   . THR A 1 275 ? 56.178  18.444  21.547  1.00 43.42 ? 275  THR A N   1 
ATOM   2044 C CA  . THR A 1 275 ? 56.747  19.690  22.079  1.00 42.95 ? 275  THR A CA  1 
ATOM   2045 C C   . THR A 1 275 ? 55.987  20.908  21.526  1.00 43.30 ? 275  THR A C   1 
ATOM   2046 O O   . THR A 1 275 ? 56.222  22.038  21.966  1.00 43.17 ? 275  THR A O   1 
ATOM   2047 C CB  . THR A 1 275 ? 58.252  19.866  21.698  1.00 43.12 ? 275  THR A CB  1 
ATOM   2048 O OG1 . THR A 1 275 ? 58.356  20.135  20.293  1.00 42.37 ? 275  THR A OG1 1 
ATOM   2049 C CG2 . THR A 1 275 ? 59.085  18.620  22.027  1.00 42.05 ? 275  THR A CG2 1 
ATOM   2050 N N   . ARG A 1 276 ? 55.102  20.694  20.552  1.00 42.99 ? 276  ARG A N   1 
ATOM   2051 C CA  . ARG A 1 276 ? 54.377  21.816  19.963  1.00 43.41 ? 276  ARG A CA  1 
ATOM   2052 C C   . ARG A 1 276 ? 53.228  22.231  20.852  1.00 43.06 ? 276  ARG A C   1 
ATOM   2053 O O   . ARG A 1 276 ? 52.523  21.385  21.405  1.00 43.37 ? 276  ARG A O   1 
ATOM   2054 C CB  . ARG A 1 276 ? 53.862  21.468  18.570  1.00 43.84 ? 276  ARG A CB  1 
ATOM   2055 C CG  . ARG A 1 276 ? 54.947  21.306  17.518  1.00 46.43 ? 276  ARG A CG  1 
ATOM   2056 C CD  . ARG A 1 276 ? 55.794  22.588  17.373  1.00 52.50 ? 276  ARG A CD  1 
ATOM   2057 N NE  . ARG A 1 276 ? 57.007  22.324  16.593  1.00 58.45 ? 276  ARG A NE  1 
ATOM   2058 C CZ  . ARG A 1 276 ? 58.246  22.258  17.096  1.00 60.92 ? 276  ARG A CZ  1 
ATOM   2059 N NH1 . ARG A 1 276 ? 58.462  22.455  18.401  1.00 60.95 ? 276  ARG A NH1 1 
ATOM   2060 N NH2 . ARG A 1 276 ? 59.281  22.001  16.288  1.00 60.18 ? 276  ARG A NH2 1 
ATOM   2061 N N   . PRO A 1 277 ? 53.027  23.541  21.009  1.00 42.90 ? 277  PRO A N   1 
ATOM   2062 C CA  . PRO A 1 277 ? 51.875  24.012  21.789  1.00 42.55 ? 277  PRO A CA  1 
ATOM   2063 C C   . PRO A 1 277 ? 50.549  23.576  21.132  1.00 42.56 ? 277  PRO A C   1 
ATOM   2064 O O   . PRO A 1 277 ? 50.464  23.476  19.900  1.00 42.29 ? 277  PRO A O   1 
ATOM   2065 C CB  . PRO A 1 277 ? 52.005  25.542  21.724  1.00 42.59 ? 277  PRO A CB  1 
ATOM   2066 C CG  . PRO A 1 277 ? 53.394  25.807  21.316  1.00 42.23 ? 277  PRO A CG  1 
ATOM   2067 C CD  . PRO A 1 277 ? 53.812  24.651  20.452  1.00 42.34 ? 277  PRO A CD  1 
ATOM   2068 N N   . ALA A 1 278 ? 49.522  23.326  21.941  1.00 42.37 ? 278  ALA A N   1 
ATOM   2069 C CA  . ALA A 1 278 ? 48.226  22.838  21.428  1.00 41.59 ? 278  ALA A CA  1 
ATOM   2070 C C   . ALA A 1 278 ? 47.629  23.731  20.325  1.00 41.06 ? 278  ALA A C   1 
ATOM   2071 O O   . ALA A 1 278 ? 47.101  23.231  19.324  1.00 40.75 ? 278  ALA A O   1 
ATOM   2072 C CB  . ALA A 1 278 ? 47.217  22.635  22.597  1.00 41.28 ? 278  ALA A CB  1 
ATOM   2073 N N   . GLN A 1 279 ? 47.743  25.046  20.506  1.00 40.77 ? 279  GLN A N   1 
ATOM   2074 C CA  . GLN A 1 279 ? 47.193  26.009  19.559  1.00 40.45 ? 279  GLN A CA  1 
ATOM   2075 C C   . GLN A 1 279 ? 47.816  25.956  18.170  1.00 41.30 ? 279  GLN A C   1 
ATOM   2076 O O   . GLN A 1 279 ? 47.140  26.236  17.173  1.00 41.74 ? 279  GLN A O   1 
ATOM   2077 C CB  . GLN A 1 279 ? 47.271  27.425  20.127  1.00 39.99 ? 279  GLN A CB  1 
ATOM   2078 C CG  . GLN A 1 279 ? 46.302  28.403  19.468  1.00 38.35 ? 279  GLN A CG  1 
ATOM   2079 C CD  . GLN A 1 279 ? 44.870  27.889  19.487  1.00 37.28 ? 279  GLN A CD  1 
ATOM   2080 O OE1 . GLN A 1 279 ? 44.332  27.554  20.553  1.00 34.46 ? 279  GLN A OE1 1 
ATOM   2081 N NE2 . GLN A 1 279 ? 44.258  27.801  18.311  1.00 34.24 ? 279  GLN A NE2 1 
ATOM   2082 N N   . ASP A 1 280 ? 49.099  25.613  18.100  1.00 42.06 ? 280  ASP A N   1 
ATOM   2083 C CA  . ASP A 1 280 ? 49.783  25.381  16.830  1.00 42.71 ? 280  ASP A CA  1 
ATOM   2084 C C   . ASP A 1 280 ? 49.139  24.269  16.021  1.00 42.03 ? 280  ASP A C   1 
ATOM   2085 O O   . ASP A 1 280 ? 48.926  24.415  14.814  1.00 42.61 ? 280  ASP A O   1 
ATOM   2086 C CB  . ASP A 1 280 ? 51.226  24.978  17.082  1.00 43.67 ? 280  ASP A CB  1 
ATOM   2087 C CG  . ASP A 1 280 ? 52.176  26.158  17.138  1.00 47.71 ? 280  ASP A CG  1 
ATOM   2088 O OD1 . ASP A 1 280 ? 51.908  27.190  17.844  1.00 47.13 ? 280  ASP A OD1 1 
ATOM   2089 O OD2 . ASP A 1 280 ? 53.233  25.999  16.474  1.00 52.33 ? 280  ASP A OD2 1 
ATOM   2090 N N   . LEU A 1 281 ? 48.848  23.146  16.659  1.00 41.62 ? 281  LEU A N   1 
ATOM   2091 C CA  . LEU A 1 281 ? 48.201  22.054  15.930  1.00 41.71 ? 281  LEU A CA  1 
ATOM   2092 C C   . LEU A 1 281 ? 46.797  22.497  15.470  1.00 41.26 ? 281  LEU A C   1 
ATOM   2093 O O   . LEU A 1 281 ? 46.415  22.250  14.329  1.00 41.47 ? 281  LEU A O   1 
ATOM   2094 C CB  . LEU A 1 281 ? 48.167  20.743  16.736  1.00 41.67 ? 281  LEU A CB  1 
ATOM   2095 C CG  . LEU A 1 281 ? 49.465  20.266  17.422  1.00 42.77 ? 281  LEU A CG  1 
ATOM   2096 C CD1 . LEU A 1 281 ? 49.301  18.864  18.050  1.00 40.85 ? 281  LEU A CD1 1 
ATOM   2097 C CD2 . LEU A 1 281 ? 50.713  20.284  16.487  1.00 41.52 ? 281  LEU A CD2 1 
ATOM   2098 N N   . VAL A 1 282 ? 46.051  23.186  16.325  1.00 40.59 ? 282  VAL A N   1 
ATOM   2099 C CA  . VAL A 1 282 ? 44.749  23.668  15.908  1.00 40.97 ? 282  VAL A CA  1 
ATOM   2100 C C   . VAL A 1 282 ? 44.864  24.647  14.705  1.00 41.55 ? 282  VAL A C   1 
ATOM   2101 O O   . VAL A 1 282 ? 44.065  24.571  13.757  1.00 41.25 ? 282  VAL A O   1 
ATOM   2102 C CB  . VAL A 1 282 ? 43.946  24.294  17.074  1.00 41.09 ? 282  VAL A CB  1 
ATOM   2103 C CG1 . VAL A 1 282 ? 42.636  24.835  16.562  1.00 40.00 ? 282  VAL A CG1 1 
ATOM   2104 C CG2 . VAL A 1 282 ? 43.699  23.264  18.161  1.00 40.07 ? 282  VAL A CG2 1 
ATOM   2105 N N   . ASP A 1 283 ? 45.863  25.531  14.730  1.00 41.55 ? 283  ASP A N   1 
ATOM   2106 C CA  . ASP A 1 283 ? 46.062  26.490  13.633  1.00 42.00 ? 283  ASP A CA  1 
ATOM   2107 C C   . ASP A 1 283 ? 46.356  25.851  12.277  1.00 41.83 ? 283  ASP A C   1 
ATOM   2108 O O   . ASP A 1 283 ? 46.113  26.487  11.242  1.00 41.81 ? 283  ASP A O   1 
ATOM   2109 C CB  . ASP A 1 283 ? 47.159  27.518  13.960  1.00 42.00 ? 283  ASP A CB  1 
ATOM   2110 C CG  . ASP A 1 283 ? 46.760  28.472  15.098  1.00 44.02 ? 283  ASP A CG  1 
ATOM   2111 O OD1 . ASP A 1 283 ? 45.592  28.430  15.573  1.00 45.06 ? 283  ASP A OD1 1 
ATOM   2112 O OD2 . ASP A 1 283 ? 47.637  29.258  15.531  1.00 46.56 ? 283  ASP A OD2 1 
ATOM   2113 N N   . HIS A 1 284 ? 46.881  24.624  12.260  1.00 40.80 ? 284  HIS A N   1 
ATOM   2114 C CA  . HIS A 1 284 ? 47.189  24.012  10.969  1.00 40.58 ? 284  HIS A CA  1 
ATOM   2115 C C   . HIS A 1 284 ? 46.311  22.848  10.610  1.00 40.00 ? 284  HIS A C   1 
ATOM   2116 O O   . HIS A 1 284 ? 46.375  22.336  9.483   1.00 39.38 ? 284  HIS A O   1 
ATOM   2117 C CB  . HIS A 1 284 ? 48.669  23.646  10.844  1.00 40.34 ? 284  HIS A CB  1 
ATOM   2118 C CG  . HIS A 1 284 ? 49.551  24.843  10.708  1.00 42.10 ? 284  HIS A CG  1 
ATOM   2119 N ND1 . HIS A 1 284 ? 50.167  25.440  11.793  1.00 43.17 ? 284  HIS A ND1 1 
ATOM   2120 C CD2 . HIS A 1 284 ? 49.880  25.588  9.626   1.00 42.20 ? 284  HIS A CD2 1 
ATOM   2121 C CE1 . HIS A 1 284 ? 50.856  26.487  11.379  1.00 44.07 ? 284  HIS A CE1 1 
ATOM   2122 N NE2 . HIS A 1 284 ? 50.703  26.596  10.069  1.00 44.63 ? 284  HIS A NE2 1 
ATOM   2123 N N   . GLU A 1 285 ? 45.511  22.437  11.579  1.00 40.00 ? 285  GLU A N   1 
ATOM   2124 C CA  . GLU A 1 285 ? 44.568  21.337  11.445  1.00 41.07 ? 285  GLU A CA  1 
ATOM   2125 C C   . GLU A 1 285 ? 43.836  21.302  10.099  1.00 41.13 ? 285  GLU A C   1 
ATOM   2126 O O   . GLU A 1 285 ? 43.742  20.263  9.477   1.00 40.73 ? 285  GLU A O   1 
ATOM   2127 C CB  . GLU A 1 285 ? 43.574  21.431  12.586  1.00 41.21 ? 285  GLU A CB  1 
ATOM   2128 C CG  . GLU A 1 285 ? 42.673  20.264  12.694  1.00 43.17 ? 285  GLU A CG  1 
ATOM   2129 C CD  . GLU A 1 285 ? 41.898  20.228  13.988  1.00 45.19 ? 285  GLU A CD  1 
ATOM   2130 O OE1 . GLU A 1 285 ? 41.694  21.266  14.652  1.00 46.12 ? 285  GLU A OE1 1 
ATOM   2131 O OE2 . GLU A 1 285 ? 41.461  19.120  14.333  1.00 49.73 ? 285  GLU A OE2 1 
ATOM   2132 N N   . TRP A 1 286 ? 43.375  22.454  9.629   1.00 42.60 ? 286  TRP A N   1 
ATOM   2133 C CA  . TRP A 1 286 ? 42.607  22.542  8.378   1.00 44.21 ? 286  TRP A CA  1 
ATOM   2134 C C   . TRP A 1 286 ? 43.403  22.595  7.063   1.00 44.74 ? 286  TRP A C   1 
ATOM   2135 O O   . TRP A 1 286 ? 42.815  22.617  5.992   1.00 45.78 ? 286  TRP A O   1 
ATOM   2136 C CB  . TRP A 1 286 ? 41.596  23.690  8.482   1.00 44.90 ? 286  TRP A CB  1 
ATOM   2137 C CG  . TRP A 1 286 ? 40.553  23.364  9.541   1.00 46.81 ? 286  TRP A CG  1 
ATOM   2138 C CD1 . TRP A 1 286 ? 40.526  23.788  10.845  1.00 47.11 ? 286  TRP A CD1 1 
ATOM   2139 C CD2 . TRP A 1 286 ? 39.435  22.477  9.386   1.00 47.50 ? 286  TRP A CD2 1 
ATOM   2140 N NE1 . TRP A 1 286 ? 39.449  23.240  11.501  1.00 47.62 ? 286  TRP A NE1 1 
ATOM   2141 C CE2 . TRP A 1 286 ? 38.759  22.437  10.629  1.00 47.00 ? 286  TRP A CE2 1 
ATOM   2142 C CE3 . TRP A 1 286 ? 38.931  21.726  8.306   1.00 46.46 ? 286  TRP A CE3 1 
ATOM   2143 C CZ2 . TRP A 1 286 ? 37.600  21.678  10.827  1.00 47.50 ? 286  TRP A CZ2 1 
ATOM   2144 C CZ3 . TRP A 1 286 ? 37.776  20.979  8.495   1.00 47.31 ? 286  TRP A CZ3 1 
ATOM   2145 C CH2 . TRP A 1 286 ? 37.120  20.959  9.752   1.00 47.92 ? 286  TRP A CH2 1 
ATOM   2146 N N   . HIS A 1 287 ? 44.730  22.594  7.122   1.00 44.95 ? 287  HIS A N   1 
ATOM   2147 C CA  . HIS A 1 287 ? 45.504  22.714  5.907   1.00 44.89 ? 287  HIS A CA  1 
ATOM   2148 C C   . HIS A 1 287 ? 45.948  21.388  5.317   1.00 44.96 ? 287  HIS A C   1 
ATOM   2149 O O   . HIS A 1 287 ? 46.814  21.382  4.448   1.00 45.69 ? 287  HIS A O   1 
ATOM   2150 C CB  . HIS A 1 287 ? 46.740  23.576  6.150   1.00 45.24 ? 287  HIS A CB  1 
ATOM   2151 C CG  . HIS A 1 287 ? 46.447  24.913  6.751   1.00 47.24 ? 287  HIS A CG  1 
ATOM   2152 N ND1 . HIS A 1 287 ? 45.388  25.698  6.350   1.00 49.23 ? 287  HIS A ND1 1 
ATOM   2153 C CD2 . HIS A 1 287 ? 47.088  25.613  7.716   1.00 49.87 ? 287  HIS A CD2 1 
ATOM   2154 C CE1 . HIS A 1 287 ? 45.373  26.814  7.057   1.00 50.44 ? 287  HIS A CE1 1 
ATOM   2155 N NE2 . HIS A 1 287 ? 46.395  26.788  7.894   1.00 50.91 ? 287  HIS A NE2 1 
ATOM   2156 N N   . VAL A 1 288 ? 45.390  20.264  5.760   1.00 44.49 ? 288  VAL A N   1 
ATOM   2157 C CA  . VAL A 1 288 ? 45.923  18.961  5.329   1.00 43.92 ? 288  VAL A CA  1 
ATOM   2158 C C   . VAL A 1 288 ? 44.980  18.108  4.461   1.00 44.45 ? 288  VAL A C   1 
ATOM   2159 O O   . VAL A 1 288 ? 45.337  16.983  4.088   1.00 44.72 ? 288  VAL A O   1 
ATOM   2160 C CB  . VAL A 1 288 ? 46.490  18.110  6.519   1.00 43.78 ? 288  VAL A CB  1 
ATOM   2161 C CG1 . VAL A 1 288 ? 47.522  18.892  7.321   1.00 42.38 ? 288  VAL A CG1 1 
ATOM   2162 C CG2 . VAL A 1 288 ? 45.377  17.631  7.429   1.00 43.17 ? 288  VAL A CG2 1 
ATOM   2163 N N   . LEU A 1 289 ? 43.810  18.637  4.104   1.00 44.95 ? 289  LEU A N   1 
ATOM   2164 C CA  . LEU A 1 289 ? 42.835  17.888  3.290   1.00 45.38 ? 289  LEU A CA  1 
ATOM   2165 C C   . LEU A 1 289 ? 43.254  17.891  1.838   1.00 46.17 ? 289  LEU A C   1 
ATOM   2166 O O   . LEU A 1 289 ? 43.682  18.923  1.335   1.00 47.02 ? 289  LEU A O   1 
ATOM   2167 C CB  . LEU A 1 289 ? 41.444  18.510  3.406   1.00 45.30 ? 289  LEU A CB  1 
ATOM   2168 C CG  . LEU A 1 289 ? 40.759  18.448  4.778   1.00 45.94 ? 289  LEU A CG  1 
ATOM   2169 C CD1 . LEU A 1 289 ? 39.661  19.546  4.896   1.00 44.12 ? 289  LEU A CD1 1 
ATOM   2170 C CD2 . LEU A 1 289 ? 40.226  17.005  5.058   1.00 44.96 ? 289  LEU A CD2 1 
ATOM   2171 N N   . PRO A 1 290 ? 43.119  16.749  1.147   1.00 46.70 ? 290  PRO A N   1 
ATOM   2172 C CA  . PRO A 1 290 ? 43.613  16.629  -0.244  1.00 47.24 ? 290  PRO A CA  1 
ATOM   2173 C C   . PRO A 1 290 ? 42.957  17.551  -1.264  1.00 47.98 ? 290  PRO A C   1 
ATOM   2174 O O   . PRO A 1 290 ? 43.571  17.845  -2.294  1.00 48.25 ? 290  PRO A O   1 
ATOM   2175 C CB  . PRO A 1 290 ? 43.322  15.169  -0.614  1.00 46.83 ? 290  PRO A CB  1 
ATOM   2176 C CG  . PRO A 1 290 ? 42.326  14.682  0.390   1.00 47.13 ? 290  PRO A CG  1 
ATOM   2177 C CD  . PRO A 1 290 ? 42.521  15.495  1.640   1.00 46.82 ? 290  PRO A CD  1 
ATOM   2178 N N   . GLN A 1 291 ? 41.708  17.950  -1.009  1.00 48.70 ? 291  GLN A N   1 
ATOM   2179 C CA  . GLN A 1 291 ? 40.973  18.872  -1.880  1.00 49.08 ? 291  GLN A CA  1 
ATOM   2180 C C   . GLN A 1 291 ? 40.174  19.850  -1.047  1.00 48.98 ? 291  GLN A C   1 
ATOM   2181 O O   . GLN A 1 291 ? 39.868  19.587  0.121   1.00 49.18 ? 291  GLN A O   1 
ATOM   2182 C CB  . GLN A 1 291 ? 39.985  18.154  -2.804  1.00 49.03 ? 291  GLN A CB  1 
ATOM   2183 C CG  . GLN A 1 291 ? 40.502  16.943  -3.541  1.00 51.08 ? 291  GLN A CG  1 
ATOM   2184 C CD  . GLN A 1 291 ? 40.334  15.648  -2.736  1.00 54.54 ? 291  GLN A CD  1 
ATOM   2185 O OE1 . GLN A 1 291 ? 41.017  14.648  -2.996  1.00 54.40 ? 291  GLN A OE1 1 
ATOM   2186 N NE2 . GLN A 1 291 ? 39.423  15.666  -1.750  1.00 55.81 ? 291  GLN A NE2 1 
ATOM   2187 N N   . GLU A 1 292 ? 39.838  20.975  -1.670  1.00 48.65 ? 292  GLU A N   1 
ATOM   2188 C CA  . GLU A 1 292 ? 38.840  21.883  -1.161  1.00 49.07 ? 292  GLU A CA  1 
ATOM   2189 C C   . GLU A 1 292 ? 37.536  21.083  -1.006  1.00 47.92 ? 292  GLU A C   1 
ATOM   2190 O O   . GLU A 1 292 ? 37.056  20.456  -1.968  1.00 47.66 ? 292  GLU A O   1 
ATOM   2191 C CB  . GLU A 1 292 ? 38.650  23.024  -2.163  1.00 48.93 ? 292  GLU A CB  1 
ATOM   2192 C CG  . GLU A 1 292 ? 37.787  24.195  -1.667  1.00 50.65 ? 292  GLU A CG  1 
ATOM   2193 C CD  . GLU A 1 292 ? 37.265  25.052  -2.826  1.00 51.97 ? 292  GLU A CD  1 
ATOM   2194 O OE1 . GLU A 1 292 ? 37.300  24.576  -3.983  1.00 55.62 ? 292  GLU A OE1 1 
ATOM   2195 O OE2 . GLU A 1 292 ? 36.803  26.192  -2.596  1.00 55.94 ? 292  GLU A OE2 1 
ATOM   2196 N N   . SER A 1 293 ? 36.971  21.099  0.198   1.00 46.82 ? 293  SER A N   1 
ATOM   2197 C CA  . SER A 1 293 ? 35.752  20.325  0.457   1.00 46.25 ? 293  SER A CA  1 
ATOM   2198 C C   . SER A 1 293 ? 34.843  20.904  1.548   1.00 44.92 ? 293  SER A C   1 
ATOM   2199 O O   . SER A 1 293 ? 35.164  21.902  2.179   1.00 44.49 ? 293  SER A O   1 
ATOM   2200 C CB  . SER A 1 293 ? 36.136  18.893  0.821   1.00 46.21 ? 293  SER A CB  1 
ATOM   2201 O OG  . SER A 1 293 ? 37.179  18.907  1.773   1.00 46.97 ? 293  SER A OG  1 
ATOM   2202 N N   . ILE A 1 294 ? 33.682  20.281  1.717   1.00 43.94 ? 294  ILE A N   1 
ATOM   2203 C CA  . ILE A 1 294 ? 32.833  20.463  2.912   1.00 42.39 ? 294  ILE A CA  1 
ATOM   2204 C C   . ILE A 1 294 ? 32.460  19.052  3.368   1.00 41.60 ? 294  ILE A C   1 
ATOM   2205 O O   . ILE A 1 294 ? 32.530  18.105  2.569   1.00 41.30 ? 294  ILE A O   1 
ATOM   2206 C CB  . ILE A 1 294 ? 31.547  21.329  2.666   1.00 42.09 ? 294  ILE A CB  1 
ATOM   2207 C CG1 . ILE A 1 294 ? 30.741  20.811  1.475   1.00 41.65 ? 294  ILE A CG1 1 
ATOM   2208 C CG2 . ILE A 1 294 ? 31.900  22.823  2.505   1.00 41.02 ? 294  ILE A CG2 1 
ATOM   2209 C CD1 . ILE A 1 294 ? 29.323  21.325  1.471   1.00 41.06 ? 294  ILE A CD1 1 
ATOM   2210 N N   . PHE A 1 295 ? 32.107  18.903  4.642   1.00 40.41 ? 295  PHE A N   1 
ATOM   2211 C CA  . PHE A 1 295 ? 31.818  17.572  5.202   1.00 39.85 ? 295  PHE A CA  1 
ATOM   2212 C C   . PHE A 1 295 ? 33.042  16.624  5.063   1.00 39.37 ? 295  PHE A C   1 
ATOM   2213 O O   . PHE A 1 295 ? 32.902  15.435  4.766   1.00 38.33 ? 295  PHE A O   1 
ATOM   2214 C CB  . PHE A 1 295 ? 30.558  16.969  4.550   1.00 39.26 ? 295  PHE A CB  1 
ATOM   2215 C CG  . PHE A 1 295 ? 29.574  16.407  5.535   1.00 39.31 ? 295  PHE A CG  1 
ATOM   2216 C CD1 . PHE A 1 295 ? 29.958  15.411  6.443   1.00 37.58 ? 295  PHE A CD1 1 
ATOM   2217 C CD2 . PHE A 1 295 ? 28.257  16.872  5.558   1.00 36.13 ? 295  PHE A CD2 1 
ATOM   2218 C CE1 . PHE A 1 295 ? 29.047  14.912  7.366   1.00 36.44 ? 295  PHE A CE1 1 
ATOM   2219 C CE2 . PHE A 1 295 ? 27.355  16.372  6.460   1.00 35.59 ? 295  PHE A CE2 1 
ATOM   2220 C CZ  . PHE A 1 295 ? 27.740  15.389  7.371   1.00 36.51 ? 295  PHE A CZ  1 
ATOM   2221 N N   . ARG A 1 296 ? 34.239  17.198  5.225   1.00 39.43 ? 296  ARG A N   1 
ATOM   2222 C CA  . ARG A 1 296 ? 35.509  16.438  5.299   1.00 39.33 ? 296  ARG A CA  1 
ATOM   2223 C C   . ARG A 1 296 ? 36.348  17.014  6.408   1.00 39.91 ? 296  ARG A C   1 
ATOM   2224 O O   . ARG A 1 296 ? 36.470  18.252  6.550   1.00 40.30 ? 296  ARG A O   1 
ATOM   2225 C CB  . ARG A 1 296 ? 36.318  16.474  4.005   1.00 38.48 ? 296  ARG A CB  1 
ATOM   2226 C CG  . ARG A 1 296 ? 35.670  15.784  2.835   1.00 37.16 ? 296  ARG A CG  1 
ATOM   2227 C CD  . ARG A 1 296 ? 35.447  14.292  3.010   1.00 35.81 ? 296  ARG A CD  1 
ATOM   2228 N NE  . ARG A 1 296 ? 34.836  13.741  1.785   1.00 37.05 ? 296  ARG A NE  1 
ATOM   2229 C CZ  . ARG A 1 296 ? 33.526  13.571  1.577   1.00 34.70 ? 296  ARG A CZ  1 
ATOM   2230 N NH1 . ARG A 1 296 ? 32.628  13.891  2.509   1.00 33.87 ? 296  ARG A NH1 1 
ATOM   2231 N NH2 . ARG A 1 296 ? 33.111  13.082  0.423   1.00 33.95 ? 296  ARG A NH2 1 
ATOM   2232 N N   . PHE A 1 297 ? 36.919  16.119  7.203   1.00 39.68 ? 297  PHE A N   1 
ATOM   2233 C CA  . PHE A 1 297 ? 37.622  16.541  8.394   1.00 39.92 ? 297  PHE A CA  1 
ATOM   2234 C C   . PHE A 1 297 ? 38.988  15.881  8.426   1.00 38.85 ? 297  PHE A C   1 
ATOM   2235 O O   . PHE A 1 297 ? 39.140  14.774  7.973   1.00 38.53 ? 297  PHE A O   1 
ATOM   2236 C CB  . PHE A 1 297 ? 36.741  16.271  9.625   1.00 40.72 ? 297  PHE A CB  1 
ATOM   2237 C CG  . PHE A 1 297 ? 35.263  16.467  9.340   1.00 42.20 ? 297  PHE A CG  1 
ATOM   2238 C CD1 . PHE A 1 297 ? 34.709  17.766  9.288   1.00 42.78 ? 297  PHE A CD1 1 
ATOM   2239 C CD2 . PHE A 1 297 ? 34.438  15.368  9.047   1.00 41.48 ? 297  PHE A CD2 1 
ATOM   2240 C CE1 . PHE A 1 297 ? 33.347  17.977  8.984   1.00 41.46 ? 297  PHE A CE1 1 
ATOM   2241 C CE2 . PHE A 1 297 ? 33.068  15.568  8.745   1.00 43.33 ? 297  PHE A CE2 1 
ATOM   2242 C CZ  . PHE A 1 297 ? 32.521  16.877  8.723   1.00 41.92 ? 297  PHE A CZ  1 
ATOM   2243 N N   . SER A 1 298 ? 39.983  16.594  8.927   1.00 38.37 ? 298  SER A N   1 
ATOM   2244 C CA  . SER A 1 298 ? 41.374  16.187  8.762   1.00 37.98 ? 298  SER A CA  1 
ATOM   2245 C C   . SER A 1 298 ? 41.758  14.954  9.563   1.00 37.44 ? 298  SER A C   1 
ATOM   2246 O O   . SER A 1 298 ? 42.367  14.026  9.020   1.00 37.45 ? 298  SER A O   1 
ATOM   2247 C CB  . SER A 1 298 ? 42.278  17.337  9.142   1.00 38.06 ? 298  SER A CB  1 
ATOM   2248 O OG  . SER A 1 298 ? 42.153  18.367  8.203   1.00 39.27 ? 298  SER A OG  1 
ATOM   2249 N N   . PHE A 1 299 ? 41.395  14.941  10.846  1.00 37.02 ? 299  PHE A N   1 
ATOM   2250 C CA  . PHE A 1 299 ? 41.729  13.819  11.724  1.00 36.27 ? 299  PHE A CA  1 
ATOM   2251 C C   . PHE A 1 299 ? 40.491  13.128  12.250  1.00 36.13 ? 299  PHE A C   1 
ATOM   2252 O O   . PHE A 1 299 ? 39.783  13.646  13.115  1.00 36.44 ? 299  PHE A O   1 
ATOM   2253 C CB  . PHE A 1 299 ? 42.700  14.278  12.801  1.00 35.78 ? 299  PHE A CB  1 
ATOM   2254 C CG  . PHE A 1 299 ? 43.905  14.910  12.217  1.00 36.38 ? 299  PHE A CG  1 
ATOM   2255 C CD1 . PHE A 1 299 ? 44.916  14.121  11.674  1.00 36.45 ? 299  PHE A CD1 1 
ATOM   2256 C CD2 . PHE A 1 299 ? 43.983  16.301  12.082  1.00 36.50 ? 299  PHE A CD2 1 
ATOM   2257 C CE1 . PHE A 1 299 ? 46.036  14.709  11.047  1.00 37.11 ? 299  PHE A CE1 1 
ATOM   2258 C CE2 . PHE A 1 299 ? 45.086  16.891  11.461  1.00 39.11 ? 299  PHE A CE2 1 
ATOM   2259 C CZ  . PHE A 1 299 ? 46.130  16.089  10.953  1.00 36.46 ? 299  PHE A CZ  1 
ATOM   2260 N N   . VAL A 1 300 ? 40.224  11.966  11.668  1.00 35.96 ? 300  VAL A N   1 
ATOM   2261 C CA  . VAL A 1 300 ? 39.041  11.168  11.971  1.00 35.92 ? 300  VAL A CA  1 
ATOM   2262 C C   . VAL A 1 300 ? 39.466  9.721   12.302  1.00 36.57 ? 300  VAL A C   1 
ATOM   2263 O O   . VAL A 1 300 ? 40.628  9.377   12.115  1.00 36.47 ? 300  VAL A O   1 
ATOM   2264 C CB  . VAL A 1 300 ? 38.011  11.227  10.800  1.00 35.50 ? 300  VAL A CB  1 
ATOM   2265 C CG1 . VAL A 1 300 ? 37.550  12.682  10.563  1.00 35.37 ? 300  VAL A CG1 1 
ATOM   2266 C CG2 . VAL A 1 300 ? 38.562  10.607  9.507   1.00 33.78 ? 300  VAL A CG2 1 
ATOM   2267 N N   . PRO A 1 301 ? 38.536  8.870   12.799  1.00 36.97 ? 301  PRO A N   1 
ATOM   2268 C CA  . PRO A 1 301 ? 38.922  7.470   12.972  1.00 37.02 ? 301  PRO A CA  1 
ATOM   2269 C C   . PRO A 1 301 ? 39.663  6.891   11.761  1.00 37.57 ? 301  PRO A C   1 
ATOM   2270 O O   . PRO A 1 301 ? 39.243  7.087   10.607  1.00 37.21 ? 301  PRO A O   1 
ATOM   2271 C CB  . PRO A 1 301 ? 37.579  6.763   13.188  1.00 36.24 ? 301  PRO A CB  1 
ATOM   2272 C CG  . PRO A 1 301 ? 36.772  7.782   13.899  1.00 36.83 ? 301  PRO A CG  1 
ATOM   2273 C CD  . PRO A 1 301 ? 37.154  9.103   13.264  1.00 36.88 ? 301  PRO A CD  1 
ATOM   2274 N N   . VAL A 1 302 ? 40.754  6.178   12.047  1.00 37.87 ? 302  VAL A N   1 
ATOM   2275 C CA  . VAL A 1 302 ? 41.512  5.444   11.021  1.00 38.37 ? 302  VAL A CA  1 
ATOM   2276 C C   . VAL A 1 302 ? 41.202  3.914   10.998  1.00 38.76 ? 302  VAL A C   1 
ATOM   2277 O O   . VAL A 1 302 ? 40.936  3.289   12.032  1.00 38.50 ? 302  VAL A O   1 
ATOM   2278 C CB  . VAL A 1 302 ? 43.047  5.712   11.180  1.00 38.43 ? 302  VAL A CB  1 
ATOM   2279 C CG1 . VAL A 1 302 ? 43.534  5.286   12.558  1.00 36.62 ? 302  VAL A CG1 1 
ATOM   2280 C CG2 . VAL A 1 302 ? 43.831  5.034   10.096  1.00 38.76 ? 302  VAL A CG2 1 
ATOM   2281 N N   . VAL A 1 303 ? 41.223  3.338   9.802   1.00 38.92 ? 303  VAL A N   1 
ATOM   2282 C CA  . VAL A 1 303 ? 41.123  1.906   9.626   1.00 39.21 ? 303  VAL A CA  1 
ATOM   2283 C C   . VAL A 1 303 ? 42.524  1.383   9.908   1.00 40.50 ? 303  VAL A C   1 
ATOM   2284 O O   . VAL A 1 303 ? 43.399  1.364   9.016   1.00 41.02 ? 303  VAL A O   1 
ATOM   2285 C CB  . VAL A 1 303 ? 40.681  1.535   8.204   1.00 38.80 ? 303  VAL A CB  1 
ATOM   2286 C CG1 . VAL A 1 303 ? 40.562  0.044   8.084   1.00 38.05 ? 303  VAL A CG1 1 
ATOM   2287 C CG2 . VAL A 1 303 ? 39.358  2.205   7.861   1.00 37.71 ? 303  VAL A CG2 1 
ATOM   2288 N N   . ASP A 1 304 ? 42.734  1.000   11.164  1.00 41.07 ? 304  ASP A N   1 
ATOM   2289 C CA  . ASP A 1 304 ? 44.050  0.687   11.692  1.00 41.97 ? 304  ASP A CA  1 
ATOM   2290 C C   . ASP A 1 304 ? 44.304  -0.817  11.686  1.00 42.48 ? 304  ASP A C   1 
ATOM   2291 O O   . ASP A 1 304 ? 45.431  -1.258  11.906  1.00 42.69 ? 304  ASP A O   1 
ATOM   2292 C CB  . ASP A 1 304 ? 44.183  1.241   13.124  1.00 41.70 ? 304  ASP A CB  1 
ATOM   2293 C CG  . ASP A 1 304 ? 43.019  0.821   14.037  1.00 41.50 ? 304  ASP A CG  1 
ATOM   2294 O OD1 . ASP A 1 304 ? 41.960  0.368   13.530  1.00 38.57 ? 304  ASP A OD1 1 
ATOM   2295 O OD2 . ASP A 1 304 ? 43.171  0.946   15.275  1.00 40.43 ? 304  ASP A OD2 1 
ATOM   2296 N N   . GLY A 1 305 ? 43.256  -1.598  11.426  1.00 42.98 ? 305  GLY A N   1 
ATOM   2297 C CA  . GLY A 1 305 ? 43.320  -3.063  11.555  1.00 43.29 ? 305  GLY A CA  1 
ATOM   2298 C C   . GLY A 1 305 ? 43.422  -3.481  13.020  1.00 43.81 ? 305  GLY A C   1 
ATOM   2299 O O   . GLY A 1 305 ? 43.822  -4.603  13.309  1.00 44.43 ? 305  GLY A O   1 
ATOM   2300 N N   . ASP A 1 306 ? 43.068  -2.581  13.944  1.00 43.63 ? 306  ASP A N   1 
ATOM   2301 C CA  . ASP A 1 306 ? 43.049  -2.864  15.394  1.00 43.54 ? 306  ASP A CA  1 
ATOM   2302 C C   . ASP A 1 306 ? 41.665  -2.538  15.967  1.00 43.63 ? 306  ASP A C   1 
ATOM   2303 O O   . ASP A 1 306 ? 40.817  -3.439  16.100  1.00 44.02 ? 306  ASP A O   1 
ATOM   2304 C CB  . ASP A 1 306 ? 44.131  -2.059  16.121  1.00 43.63 ? 306  ASP A CB  1 
ATOM   2305 C CG  . ASP A 1 306 ? 44.214  -2.370  17.607  1.00 45.05 ? 306  ASP A CG  1 
ATOM   2306 O OD1 . ASP A 1 306 ? 43.393  -3.120  18.169  1.00 45.99 ? 306  ASP A OD1 1 
ATOM   2307 O OD2 . ASP A 1 306 ? 45.131  -1.836  18.238  1.00 49.13 ? 306  ASP A OD2 1 
ATOM   2308 N N   . PHE A 1 307 ? 41.429  -1.258  16.285  1.00 42.98 ? 307  PHE A N   1 
ATOM   2309 C CA  . PHE A 1 307 ? 40.103  -0.800  16.681  1.00 42.39 ? 307  PHE A CA  1 
ATOM   2310 C C   . PHE A 1 307 ? 39.097  -1.173  15.588  1.00 42.86 ? 307  PHE A C   1 
ATOM   2311 O O   . PHE A 1 307 ? 38.070  -1.771  15.859  1.00 43.31 ? 307  PHE A O   1 
ATOM   2312 C CB  . PHE A 1 307 ? 40.093  0.710   16.944  1.00 41.02 ? 307  PHE A CB  1 
ATOM   2313 C CG  . PHE A 1 307 ? 38.894  1.182   17.746  1.00 40.03 ? 307  PHE A CG  1 
ATOM   2314 C CD1 . PHE A 1 307 ? 37.609  1.179   17.193  1.00 36.68 ? 307  PHE A CD1 1 
ATOM   2315 C CD2 . PHE A 1 307 ? 39.046  1.617   19.056  1.00 37.62 ? 307  PHE A CD2 1 
ATOM   2316 C CE1 . PHE A 1 307 ? 36.521  1.614   17.925  1.00 34.86 ? 307  PHE A CE1 1 
ATOM   2317 C CE2 . PHE A 1 307 ? 37.937  2.053   19.805  1.00 36.57 ? 307  PHE A CE2 1 
ATOM   2318 C CZ  . PHE A 1 307 ? 36.683  2.051   19.233  1.00 34.78 ? 307  PHE A CZ  1 
ATOM   2319 N N   . LEU A 1 308 ? 39.418  -0.810  14.352  1.00 43.53 ? 308  LEU A N   1 
ATOM   2320 C CA  . LEU A 1 308 ? 38.630  -1.151  13.193  1.00 43.68 ? 308  LEU A CA  1 
ATOM   2321 C C   . LEU A 1 308 ? 39.403  -2.209  12.441  1.00 44.62 ? 308  LEU A C   1 
ATOM   2322 O O   . LEU A 1 308 ? 40.462  -1.926  11.879  1.00 44.28 ? 308  LEU A O   1 
ATOM   2323 C CB  . LEU A 1 308 ? 38.421  0.092   12.325  1.00 43.23 ? 308  LEU A CB  1 
ATOM   2324 C CG  . LEU A 1 308 ? 37.385  1.103   12.833  1.00 43.16 ? 308  LEU A CG  1 
ATOM   2325 C CD1 . LEU A 1 308 ? 37.323  2.324   11.939  1.00 41.84 ? 308  LEU A CD1 1 
ATOM   2326 C CD2 . LEU A 1 308 ? 35.997  0.450   12.951  1.00 42.31 ? 308  LEU A CD2 1 
ATOM   2327 N N   . SER A 1 309 ? 38.893  -3.440  12.442  1.00 45.59 ? 309  SER A N   1 
ATOM   2328 C CA  . SER A 1 309 ? 39.675  -4.562  11.912  1.00 46.56 ? 309  SER A CA  1 
ATOM   2329 C C   . SER A 1 309 ? 39.715  -4.524  10.396  1.00 46.85 ? 309  SER A C   1 
ATOM   2330 O O   . SER A 1 309 ? 40.643  -5.034  9.780   1.00 47.34 ? 309  SER A O   1 
ATOM   2331 C CB  . SER A 1 309 ? 39.211  -5.925  12.478  1.00 46.15 ? 309  SER A CB  1 
ATOM   2332 O OG  . SER A 1 309 ? 37.939  -6.298  11.985  1.00 48.05 ? 309  SER A OG  1 
ATOM   2333 N N   . ASP A 1 310 ? 38.723  -3.874  9.807   1.00 47.56 ? 310  ASP A N   1 
ATOM   2334 C CA  . ASP A 1 310 ? 38.658  -3.658  8.352   1.00 48.32 ? 310  ASP A CA  1 
ATOM   2335 C C   . ASP A 1 310 ? 37.889  -2.336  8.125   1.00 48.10 ? 310  ASP A C   1 
ATOM   2336 O O   . ASP A 1 310 ? 37.573  -1.663  9.088   1.00 47.78 ? 310  ASP A O   1 
ATOM   2337 C CB  . ASP A 1 310 ? 37.950  -4.860  7.703   1.00 48.34 ? 310  ASP A CB  1 
ATOM   2338 C CG  . ASP A 1 310 ? 38.273  -5.043  6.219   1.00 49.77 ? 310  ASP A CG  1 
ATOM   2339 O OD1 . ASP A 1 310 ? 38.775  -4.117  5.529   1.00 52.24 ? 310  ASP A OD1 1 
ATOM   2340 O OD2 . ASP A 1 310 ? 37.964  -6.143  5.722   1.00 51.26 ? 310  ASP A OD2 1 
ATOM   2341 N N   . THR A 1 311 ? 37.595  -1.952  6.883   1.00 48.21 ? 311  THR A N   1 
ATOM   2342 C CA  . THR A 1 311 ? 36.806  -0.741  6.650   1.00 48.70 ? 311  THR A CA  1 
ATOM   2343 C C   . THR A 1 311 ? 35.422  -0.958  7.266   1.00 49.43 ? 311  THR A C   1 
ATOM   2344 O O   . THR A 1 311 ? 34.998  -2.105  7.391   1.00 49.99 ? 311  THR A O   1 
ATOM   2345 C CB  . THR A 1 311 ? 36.638  -0.423  5.148   1.00 48.32 ? 311  THR A CB  1 
ATOM   2346 O OG1 . THR A 1 311 ? 35.556  -1.189  4.610   1.00 49.19 ? 311  THR A OG1 1 
ATOM   2347 C CG2 . THR A 1 311 ? 37.900  -0.722  4.367   1.00 47.97 ? 311  THR A CG2 1 
ATOM   2348 N N   . PRO A 1 312 ? 34.730  0.118   7.705   1.00 49.96 ? 312  PRO A N   1 
ATOM   2349 C CA  . PRO A 1 312 ? 33.341  -0.094  8.132   1.00 50.49 ? 312  PRO A CA  1 
ATOM   2350 C C   . PRO A 1 312 ? 32.412  -0.705  7.067   1.00 51.65 ? 312  PRO A C   1 
ATOM   2351 O O   . PRO A 1 312 ? 31.610  -1.561  7.407   1.00 51.64 ? 312  PRO A O   1 
ATOM   2352 C CB  . PRO A 1 312 ? 32.889  1.306   8.561   1.00 49.75 ? 312  PRO A CB  1 
ATOM   2353 C CG  . PRO A 1 312 ? 34.139  1.968   8.971   1.00 49.24 ? 312  PRO A CG  1 
ATOM   2354 C CD  . PRO A 1 312 ? 35.140  1.514   7.936   1.00 49.45 ? 312  PRO A CD  1 
ATOM   2355 N N   . GLU A 1 313 ? 32.525  -0.283  5.809   1.00 54.03 ? 313  GLU A N   1 
ATOM   2356 C CA  . GLU A 1 313 ? 31.790  -0.906  4.691   1.00 55.78 ? 313  GLU A CA  1 
ATOM   2357 C C   . GLU A 1 313 ? 31.918  -2.455  4.768   1.00 56.11 ? 313  GLU A C   1 
ATOM   2358 O O   . GLU A 1 313 ? 30.903  -3.170  4.797   1.00 56.25 ? 313  GLU A O   1 
ATOM   2359 C CB  . GLU A 1 313 ? 32.279  -0.348  3.323   1.00 55.80 ? 313  GLU A CB  1 
ATOM   2360 C CG  . GLU A 1 313 ? 31.462  -0.765  2.036   1.00 56.88 ? 313  GLU A CG  1 
ATOM   2361 C CD  . GLU A 1 313 ? 32.240  -0.596  0.668   1.00 59.12 ? 313  GLU A CD  1 
ATOM   2362 O OE1 . GLU A 1 313 ? 33.363  -1.170  0.511   1.00 61.92 ? 313  GLU A OE1 1 
ATOM   2363 O OE2 . GLU A 1 313 ? 31.702  0.089   -0.260  1.00 62.15 ? 313  GLU A OE2 1 
ATOM   2364 N N   . ALA A 1 314 ? 33.153  -2.963  4.847   1.00 56.13 ? 314  ALA A N   1 
ATOM   2365 C CA  . ALA A 1 314 ? 33.392  -4.401  4.935   1.00 56.26 ? 314  ALA A CA  1 
ATOM   2366 C C   . ALA A 1 314 ? 32.748  -5.019  6.176   1.00 56.78 ? 314  ALA A C   1 
ATOM   2367 O O   . ALA A 1 314 ? 32.107  -6.063  6.085   1.00 56.70 ? 314  ALA A O   1 
ATOM   2368 C CB  . ALA A 1 314 ? 34.893  -4.716  4.888   1.00 56.00 ? 314  ALA A CB  1 
ATOM   2369 N N   . LEU A 1 315 ? 32.904  -4.375  7.333   1.00 57.44 ? 315  LEU A N   1 
ATOM   2370 C CA  . LEU A 1 315 ? 32.383  -4.949  8.586   1.00 57.75 ? 315  LEU A CA  1 
ATOM   2371 C C   . LEU A 1 315 ? 30.866  -4.877  8.697   1.00 58.73 ? 315  LEU A C   1 
ATOM   2372 O O   . LEU A 1 315 ? 30.271  -5.715  9.354   1.00 59.28 ? 315  LEU A O   1 
ATOM   2373 C CB  . LEU A 1 315 ? 33.040  -4.350  9.827   1.00 56.79 ? 315  LEU A CB  1 
ATOM   2374 C CG  . LEU A 1 315 ? 34.562  -4.354  9.862   1.00 55.85 ? 315  LEU A CG  1 
ATOM   2375 C CD1 . LEU A 1 315 ? 35.028  -3.507  11.010  1.00 54.83 ? 315  LEU A CD1 1 
ATOM   2376 C CD2 . LEU A 1 315 ? 35.130  -5.762  9.962   1.00 55.13 ? 315  LEU A CD2 1 
ATOM   2377 N N   . ILE A 1 316 ? 30.223  -3.901  8.073   1.00 59.89 ? 316  ILE A N   1 
ATOM   2378 C CA  . ILE A 1 316 ? 28.768  -3.945  8.091   1.00 61.30 ? 316  ILE A CA  1 
ATOM   2379 C C   . ILE A 1 316 ? 28.269  -5.098  7.212   1.00 63.06 ? 316  ILE A C   1 
ATOM   2380 O O   . ILE A 1 316 ? 27.397  -5.840  7.651   1.00 63.70 ? 316  ILE A O   1 
ATOM   2381 C CB  . ILE A 1 316 ? 28.021  -2.567  7.868   1.00 60.75 ? 316  ILE A CB  1 
ATOM   2382 C CG1 . ILE A 1 316 ? 28.274  -1.958  6.504   1.00 60.25 ? 316  ILE A CG1 1 
ATOM   2383 C CG2 . ILE A 1 316 ? 28.381  -1.564  8.949   1.00 60.68 ? 316  ILE A CG2 1 
ATOM   2384 C CD1 . ILE A 1 316 ? 27.377  -0.785  6.233   1.00 60.75 ? 316  ILE A CD1 1 
ATOM   2385 N N   . ASN A 1 317 ? 28.858  -5.287  6.022   1.00 64.66 ? 317  ASN A N   1 
ATOM   2386 C CA  . ASN A 1 317 ? 28.454  -6.380  5.109   1.00 66.02 ? 317  ASN A CA  1 
ATOM   2387 C C   . ASN A 1 317 ? 28.619  -7.793  5.695   1.00 66.68 ? 317  ASN A C   1 
ATOM   2388 O O   . ASN A 1 317 ? 27.782  -8.660  5.460   1.00 67.15 ? 317  ASN A O   1 
ATOM   2389 C CB  . ASN A 1 317 ? 29.204  -6.332  3.763   1.00 66.24 ? 317  ASN A CB  1 
ATOM   2390 C CG  . ASN A 1 317 ? 29.048  -5.003  3.025   1.00 66.72 ? 317  ASN A CG  1 
ATOM   2391 O OD1 . ASN A 1 317 ? 28.057  -4.280  3.200   1.00 67.15 ? 317  ASN A OD1 1 
ATOM   2392 N ND2 . ASN A 1 317 ? 30.042  -4.677  2.183   1.00 65.46 ? 317  ASN A ND2 1 
ATOM   2393 N N   . THR A 1 318 ? 29.686  -8.024  6.453   1.00 67.11 ? 318  THR A N   1 
ATOM   2394 C CA  . THR A 1 318 ? 30.053  -9.391  6.818   1.00 67.74 ? 318  THR A CA  1 
ATOM   2395 C C   . THR A 1 318 ? 29.897  -9.704  8.309   1.00 68.17 ? 318  THR A C   1 
ATOM   2396 O O   . THR A 1 318 ? 30.328  -10.769 8.776   1.00 68.38 ? 318  THR A O   1 
ATOM   2397 C CB  . THR A 1 318 ? 31.512  -9.716  6.404   1.00 67.94 ? 318  THR A CB  1 
ATOM   2398 O OG1 . THR A 1 318 ? 32.418  -9.184  7.382   1.00 67.93 ? 318  THR A OG1 1 
ATOM   2399 C CG2 . THR A 1 318 ? 31.856  -9.164  4.986   1.00 68.18 ? 318  THR A CG2 1 
ATOM   2400 N N   . GLY A 1 319 ? 29.294  -8.785  9.058   1.00 68.22 ? 319  GLY A N   1 
ATOM   2401 C CA  . GLY A 1 319 ? 29.150  -8.952  10.505  1.00 68.26 ? 319  GLY A CA  1 
ATOM   2402 C C   . GLY A 1 319 ? 27.815  -9.551  10.932  1.00 68.35 ? 319  GLY A C   1 
ATOM   2403 O O   . GLY A 1 319 ? 26.814  -9.476  10.213  1.00 67.95 ? 319  GLY A O   1 
ATOM   2404 N N   . ASP A 1 320 ? 27.816  -10.139 12.123  1.00 68.52 ? 320  ASP A N   1 
ATOM   2405 C CA  . ASP A 1 320 ? 26.640  -10.777 12.696  1.00 68.84 ? 320  ASP A CA  1 
ATOM   2406 C C   . ASP A 1 320 ? 26.030  -9.847  13.754  1.00 68.32 ? 320  ASP A C   1 
ATOM   2407 O O   . ASP A 1 320 ? 26.650  -9.555  14.788  1.00 67.73 ? 320  ASP A O   1 
ATOM   2408 C CB  . ASP A 1 320 ? 27.039  -12.149 13.283  1.00 69.67 ? 320  ASP A CB  1 
ATOM   2409 C CG  . ASP A 1 320 ? 25.872  -12.894 13.929  1.00 71.30 ? 320  ASP A CG  1 
ATOM   2410 O OD1 . ASP A 1 320 ? 24.740  -12.868 13.383  1.00 73.55 ? 320  ASP A OD1 1 
ATOM   2411 O OD2 . ASP A 1 320 ? 26.102  -13.520 14.990  1.00 72.70 ? 320  ASP A OD2 1 
ATOM   2412 N N   . PHE A 1 321 ? 24.820  -9.367  13.463  1.00 68.01 ? 321  PHE A N   1 
ATOM   2413 C CA  . PHE A 1 321 ? 24.149  -8.373  14.306  1.00 67.69 ? 321  PHE A CA  1 
ATOM   2414 C C   . PHE A 1 321 ? 22.879  -8.924  14.933  1.00 67.98 ? 321  PHE A C   1 
ATOM   2415 O O   . PHE A 1 321 ? 21.931  -8.183  15.199  1.00 68.06 ? 321  PHE A O   1 
ATOM   2416 C CB  . PHE A 1 321 ? 23.902  -7.073  13.529  1.00 67.19 ? 321  PHE A CB  1 
ATOM   2417 C CG  . PHE A 1 321 ? 25.157  -6.490  12.947  1.00 66.36 ? 321  PHE A CG  1 
ATOM   2418 C CD1 . PHE A 1 321 ? 26.240  -6.192  13.765  1.00 64.62 ? 321  PHE A CD1 1 
ATOM   2419 C CD2 . PHE A 1 321 ? 25.278  -6.281  11.585  1.00 65.96 ? 321  PHE A CD2 1 
ATOM   2420 C CE1 . PHE A 1 321 ? 27.412  -5.696  13.243  1.00 63.65 ? 321  PHE A CE1 1 
ATOM   2421 C CE2 . PHE A 1 321 ? 26.456  -5.770  11.057  1.00 65.53 ? 321  PHE A CE2 1 
ATOM   2422 C CZ  . PHE A 1 321 ? 27.521  -5.480  11.895  1.00 64.85 ? 321  PHE A CZ  1 
ATOM   2423 N N   . GLN A 1 322 ? 22.904  -10.244 15.145  1.00 68.11 ? 322  GLN A N   1 
ATOM   2424 C CA  . GLN A 1 322 ? 21.962  -11.025 15.948  1.00 67.98 ? 322  GLN A CA  1 
ATOM   2425 C C   . GLN A 1 322 ? 21.381  -10.239 17.127  1.00 67.02 ? 322  GLN A C   1 
ATOM   2426 O O   . GLN A 1 322 ? 20.172  -9.983  17.192  1.00 66.59 ? 322  GLN A O   1 
ATOM   2427 C CB  . GLN A 1 322 ? 22.719  -12.259 16.509  1.00 68.90 ? 322  GLN A CB  1 
ATOM   2428 C CG  . GLN A 1 322 ? 21.933  -13.580 16.585  1.00 70.74 ? 322  GLN A CG  1 
ATOM   2429 C CD  . GLN A 1 322 ? 21.675  -14.151 15.203  1.00 73.43 ? 322  GLN A CD  1 
ATOM   2430 O OE1 . GLN A 1 322 ? 20.864  -13.612 14.435  1.00 75.12 ? 322  GLN A OE1 1 
ATOM   2431 N NE2 . GLN A 1 322 ? 22.381  -15.228 14.866  1.00 73.03 ? 322  GLN A NE2 1 
ATOM   2432 N N   . ASP A 1 323 ? 22.266  -9.862  18.048  1.00 65.92 ? 323  ASP A N   1 
ATOM   2433 C CA  . ASP A 1 323 ? 21.862  -9.358  19.357  1.00 65.69 ? 323  ASP A CA  1 
ATOM   2434 C C   . ASP A 1 323 ? 21.529  -7.869  19.449  1.00 63.93 ? 323  ASP A C   1 
ATOM   2435 O O   . ASP A 1 323 ? 21.385  -7.338  20.552  1.00 64.14 ? 323  ASP A O   1 
ATOM   2436 C CB  . ASP A 1 323 ? 22.930  -9.714  20.409  1.00 66.42 ? 323  ASP A CB  1 
ATOM   2437 C CG  . ASP A 1 323 ? 22.524  -10.930 21.274  1.00 69.95 ? 323  ASP A CG  1 
ATOM   2438 O OD1 . ASP A 1 323 ? 22.071  -11.958 20.694  1.00 72.75 ? 323  ASP A OD1 1 
ATOM   2439 O OD2 . ASP A 1 323 ? 22.652  -10.856 22.531  1.00 72.77 ? 323  ASP A OD2 1 
ATOM   2440 N N   . LEU A 1 324 ? 21.372  -7.208  18.306  1.00 61.80 ? 324  LEU A N   1 
ATOM   2441 C CA  . LEU A 1 324 ? 21.458  -5.751  18.248  1.00 59.24 ? 324  LEU A CA  1 
ATOM   2442 C C   . LEU A 1 324 ? 20.154  -5.052  17.946  1.00 57.41 ? 324  LEU A C   1 
ATOM   2443 O O   . LEU A 1 324 ? 19.564  -5.263  16.889  1.00 57.61 ? 324  LEU A O   1 
ATOM   2444 C CB  . LEU A 1 324 ? 22.487  -5.350  17.199  1.00 59.32 ? 324  LEU A CB  1 
ATOM   2445 C CG  . LEU A 1 324 ? 23.208  -4.025  17.406  1.00 58.61 ? 324  LEU A CG  1 
ATOM   2446 C CD1 . LEU A 1 324 ? 23.874  -3.974  18.774  1.00 58.03 ? 324  LEU A CD1 1 
ATOM   2447 C CD2 . LEU A 1 324 ? 24.216  -3.875  16.299  1.00 56.96 ? 324  LEU A CD2 1 
ATOM   2448 N N   . GLN A 1 325 ? 19.713  -4.217  18.875  1.00 54.90 ? 325  GLN A N   1 
ATOM   2449 C CA  . GLN A 1 325 ? 18.617  -3.311  18.596  1.00 53.22 ? 325  GLN A CA  1 
ATOM   2450 C C   . GLN A 1 325 ? 19.170  -1.900  18.390  1.00 51.45 ? 325  GLN A C   1 
ATOM   2451 O O   . GLN A 1 325 ? 19.994  -1.412  19.167  1.00 51.04 ? 325  GLN A O   1 
ATOM   2452 C CB  . GLN A 1 325 ? 17.546  -3.349  19.684  1.00 53.55 ? 325  GLN A CB  1 
ATOM   2453 C CG  . GLN A 1 325 ? 17.115  -4.751  20.113  1.00 55.45 ? 325  GLN A CG  1 
ATOM   2454 C CD  . GLN A 1 325 ? 17.694  -5.115  21.461  1.00 58.49 ? 325  GLN A CD  1 
ATOM   2455 O OE1 . GLN A 1 325 ? 17.071  -4.862  22.486  1.00 61.39 ? 325  GLN A OE1 1 
ATOM   2456 N NE2 . GLN A 1 325 ? 18.906  -5.665  21.475  1.00 58.86 ? 325  GLN A NE2 1 
ATOM   2457 N N   . VAL A 1 326 ? 18.719  -1.261  17.320  1.00 49.38 ? 326  VAL A N   1 
ATOM   2458 C CA  . VAL A 1 326 ? 19.351  -0.054  16.822  1.00 47.86 ? 326  VAL A CA  1 
ATOM   2459 C C   . VAL A 1 326 ? 18.278  0.903   16.357  1.00 46.81 ? 326  VAL A C   1 
ATOM   2460 O O   . VAL A 1 326 ? 17.378  0.526   15.639  1.00 46.83 ? 326  VAL A O   1 
ATOM   2461 C CB  . VAL A 1 326 ? 20.318  -0.377  15.636  1.00 47.72 ? 326  VAL A CB  1 
ATOM   2462 C CG1 . VAL A 1 326 ? 20.810  0.857   15.002  1.00 46.99 ? 326  VAL A CG1 1 
ATOM   2463 C CG2 . VAL A 1 326 ? 21.493  -1.178  16.105  1.00 47.07 ? 326  VAL A CG2 1 
ATOM   2464 N N   . LEU A 1 327 ? 18.387  2.148   16.780  1.00 45.93 ? 327  LEU A N   1 
ATOM   2465 C CA  . LEU A 1 327 ? 17.543  3.220   16.284  1.00 45.35 ? 327  LEU A CA  1 
ATOM   2466 C C   . LEU A 1 327 ? 18.437  4.114   15.438  1.00 44.24 ? 327  LEU A C   1 
ATOM   2467 O O   . LEU A 1 327 ? 19.526  4.476   15.877  1.00 44.21 ? 327  LEU A O   1 
ATOM   2468 C CB  . LEU A 1 327 ? 16.952  3.985   17.473  1.00 45.27 ? 327  LEU A CB  1 
ATOM   2469 C CG  . LEU A 1 327 ? 16.099  5.230   17.262  1.00 46.22 ? 327  LEU A CG  1 
ATOM   2470 C CD1 . LEU A 1 327 ? 14.850  4.916   16.498  1.00 46.51 ? 327  LEU A CD1 1 
ATOM   2471 C CD2 . LEU A 1 327 ? 15.742  5.809   18.607  1.00 46.44 ? 327  LEU A CD2 1 
ATOM   2472 N N   . VAL A 1 328 ? 18.008  4.436   14.221  1.00 43.33 ? 328  VAL A N   1 
ATOM   2473 C CA  . VAL A 1 328 ? 18.789  5.300   13.316  1.00 42.92 ? 328  VAL A CA  1 
ATOM   2474 C C   . VAL A 1 328 ? 17.927  6.338   12.646  1.00 42.21 ? 328  VAL A C   1 
ATOM   2475 O O   . VAL A 1 328 ? 16.760  6.112   12.429  1.00 42.42 ? 328  VAL A O   1 
ATOM   2476 C CB  . VAL A 1 328 ? 19.507  4.521   12.171  1.00 42.70 ? 328  VAL A CB  1 
ATOM   2477 C CG1 . VAL A 1 328 ? 20.400  3.492   12.726  1.00 42.81 ? 328  VAL A CG1 1 
ATOM   2478 C CG2 . VAL A 1 328 ? 18.500  3.885   11.237  1.00 42.77 ? 328  VAL A CG2 1 
ATOM   2479 N N   . GLY A 1 329 ? 18.508  7.465   12.253  1.00 42.06 ? 329  GLY A N   1 
ATOM   2480 C CA  . GLY A 1 329 ? 17.728  8.418   11.466  1.00 41.03 ? 329  GLY A CA  1 
ATOM   2481 C C   . GLY A 1 329 ? 18.429  9.675   11.032  1.00 40.07 ? 329  GLY A C   1 
ATOM   2482 O O   . GLY A 1 329 ? 19.615  9.848   11.262  1.00 40.32 ? 329  GLY A O   1 
ATOM   2483 N N   . VAL A 1 330 ? 17.661  10.557  10.410  1.00 39.13 ? 330  VAL A N   1 
ATOM   2484 C CA  . VAL A 1 330 ? 18.185  11.729  9.769   1.00 38.04 ? 330  VAL A CA  1 
ATOM   2485 C C   . VAL A 1 330 ? 17.237  12.901  10.002  1.00 38.74 ? 330  VAL A C   1 
ATOM   2486 O O   . VAL A 1 330 ? 16.070  12.717  10.366  1.00 38.37 ? 330  VAL A O   1 
ATOM   2487 C CB  . VAL A 1 330 ? 18.363  11.499  8.261   1.00 38.05 ? 330  VAL A CB  1 
ATOM   2488 C CG1 . VAL A 1 330 ? 19.322  10.349  7.996   1.00 36.17 ? 330  VAL A CG1 1 
ATOM   2489 C CG2 . VAL A 1 330 ? 17.002  11.282  7.563   1.00 36.40 ? 330  VAL A CG2 1 
ATOM   2490 N N   . VAL A 1 331 ? 17.748  14.114  9.819   1.00 38.99 ? 331  VAL A N   1 
ATOM   2491 C CA  . VAL A 1 331 ? 16.897  15.297  9.828   1.00 38.65 ? 331  VAL A CA  1 
ATOM   2492 C C   . VAL A 1 331 ? 16.505  15.631  8.395   1.00 39.01 ? 331  VAL A C   1 
ATOM   2493 O O   . VAL A 1 331 ? 17.117  15.140  7.445   1.00 39.13 ? 331  VAL A O   1 
ATOM   2494 C CB  . VAL A 1 331 ? 17.602  16.467  10.510  1.00 38.84 ? 331  VAL A CB  1 
ATOM   2495 C CG1 . VAL A 1 331 ? 17.996  16.065  11.904  1.00 39.04 ? 331  VAL A CG1 1 
ATOM   2496 C CG2 . VAL A 1 331 ? 18.845  16.910  9.720   1.00 37.13 ? 331  VAL A CG2 1 
ATOM   2497 N N   . LYS A 1 332 ? 15.472  16.450  8.240   1.00 39.35 ? 332  LYS A N   1 
ATOM   2498 C CA  . LYS A 1 332 ? 14.981  16.860  6.925   1.00 39.38 ? 332  LYS A CA  1 
ATOM   2499 C C   . LYS A 1 332 ? 16.089  17.405  6.024   1.00 38.84 ? 332  LYS A C   1 
ATOM   2500 O O   . LYS A 1 332 ? 16.127  17.087  4.849   1.00 38.31 ? 332  LYS A O   1 
ATOM   2501 C CB  . LYS A 1 332 ? 13.867  17.907  7.066   1.00 39.14 ? 332  LYS A CB  1 
ATOM   2502 C CG  . LYS A 1 332 ? 12.799  17.869  5.951   1.00 40.26 ? 332  LYS A CG  1 
ATOM   2503 C CD  . LYS A 1 332 ? 11.708  18.969  6.132   1.00 40.94 ? 332  LYS A CD  1 
ATOM   2504 C CE  . LYS A 1 332 ? 12.095  20.316  5.443   1.00 45.10 ? 332  LYS A CE  1 
ATOM   2505 N NZ  . LYS A 1 332 ? 12.508  21.445  6.378   1.00 46.08 ? 332  LYS A NZ  1 
ATOM   2506 N N   . ASP A 1 333 ? 16.999  18.211  6.568   1.00 38.71 ? 333  ASP A N   1 
ATOM   2507 C CA  . ASP A 1 333 ? 18.010  18.878  5.716   1.00 38.33 ? 333  ASP A CA  1 
ATOM   2508 C C   . ASP A 1 333 ? 19.445  18.658  6.203   1.00 38.04 ? 333  ASP A C   1 
ATOM   2509 O O   . ASP A 1 333 ? 20.051  19.519  6.836   1.00 38.12 ? 333  ASP A O   1 
ATOM   2510 C CB  . ASP A 1 333 ? 17.668  20.368  5.540   1.00 37.94 ? 333  ASP A CB  1 
ATOM   2511 C CG  . ASP A 1 333 ? 16.232  20.578  5.031   1.00 38.37 ? 333  ASP A CG  1 
ATOM   2512 O OD1 . ASP A 1 333 ? 15.326  20.781  5.875   1.00 38.10 ? 333  ASP A OD1 1 
ATOM   2513 O OD2 . ASP A 1 333 ? 16.003  20.505  3.801   1.00 36.49 ? 333  ASP A OD2 1 
ATOM   2514 N N   . GLU A 1 334 ? 19.981  17.482  5.916   1.00 37.84 ? 334  GLU A N   1 
ATOM   2515 C CA  . GLU A 1 334 ? 21.299  17.127  6.394   1.00 37.49 ? 334  GLU A CA  1 
ATOM   2516 C C   . GLU A 1 334 ? 22.398  17.973  5.740   1.00 38.23 ? 334  GLU A C   1 
ATOM   2517 O O   . GLU A 1 334 ? 23.467  18.147  6.315   1.00 38.91 ? 334  GLU A O   1 
ATOM   2518 C CB  . GLU A 1 334 ? 21.572  15.645  6.147   1.00 36.93 ? 334  GLU A CB  1 
ATOM   2519 C CG  . GLU A 1 334 ? 20.734  14.691  6.966   1.00 36.31 ? 334  GLU A CG  1 
ATOM   2520 C CD  . GLU A 1 334 ? 21.133  14.632  8.432   1.00 38.36 ? 334  GLU A CD  1 
ATOM   2521 O OE1 . GLU A 1 334 ? 22.241  15.100  8.783   1.00 40.28 ? 334  GLU A OE1 1 
ATOM   2522 O OE2 . GLU A 1 334 ? 20.335  14.109  9.251   1.00 38.17 ? 334  GLU A OE2 1 
ATOM   2523 N N   . GLY A 1 335 ? 22.148  18.497  4.549   1.00 38.36 ? 335  GLY A N   1 
ATOM   2524 C CA  . GLY A 1 335 ? 23.192  19.154  3.794   1.00 39.03 ? 335  GLY A CA  1 
ATOM   2525 C C   . GLY A 1 335 ? 23.246  20.660  3.899   1.00 39.95 ? 335  GLY A C   1 
ATOM   2526 O O   . GLY A 1 335 ? 24.184  21.266  3.435   1.00 40.55 ? 335  GLY A O   1 
ATOM   2527 N N   . SER A 1 336 ? 22.248  21.297  4.489   1.00 40.89 ? 336  SER A N   1 
ATOM   2528 C CA  . SER A 1 336 ? 22.187  22.750  4.392   1.00 41.42 ? 336  SER A CA  1 
ATOM   2529 C C   . SER A 1 336 ? 23.286  23.451  5.218   1.00 42.50 ? 336  SER A C   1 
ATOM   2530 O O   . SER A 1 336 ? 23.883  24.419  4.755   1.00 42.40 ? 336  SER A O   1 
ATOM   2531 C CB  . SER A 1 336 ? 20.816  23.231  4.801   1.00 41.21 ? 336  SER A CB  1 
ATOM   2532 O OG  . SER A 1 336 ? 20.585  22.855  6.137   1.00 40.20 ? 336  SER A OG  1 
ATOM   2533 N N   . TYR A 1 337 ? 23.557  22.941  6.422   1.00 43.87 ? 337  TYR A N   1 
ATOM   2534 C CA  . TYR A 1 337 ? 24.495  23.557  7.369   1.00 45.15 ? 337  TYR A CA  1 
ATOM   2535 C C   . TYR A 1 337 ? 25.845  23.932  6.757   1.00 45.64 ? 337  TYR A C   1 
ATOM   2536 O O   . TYR A 1 337 ? 26.331  25.049  6.941   1.00 45.59 ? 337  TYR A O   1 
ATOM   2537 C CB  . TYR A 1 337 ? 24.715  22.653  8.598   1.00 46.17 ? 337  TYR A CB  1 
ATOM   2538 C CG  . TYR A 1 337 ? 25.297  23.361  9.803   1.00 47.17 ? 337  TYR A CG  1 
ATOM   2539 C CD1 . TYR A 1 337 ? 24.474  23.808  10.847  1.00 47.48 ? 337  TYR A CD1 1 
ATOM   2540 C CD2 . TYR A 1 337 ? 26.674  23.576  9.905   1.00 48.84 ? 337  TYR A CD2 1 
ATOM   2541 C CE1 . TYR A 1 337 ? 25.010  24.471  11.959  1.00 48.20 ? 337  TYR A CE1 1 
ATOM   2542 C CE2 . TYR A 1 337 ? 27.224  24.228  11.001  1.00 49.22 ? 337  TYR A CE2 1 
ATOM   2543 C CZ  . TYR A 1 337 ? 26.392  24.677  12.027  1.00 49.44 ? 337  TYR A CZ  1 
ATOM   2544 O OH  . TYR A 1 337 ? 26.970  25.330  13.106  1.00 49.08 ? 337  TYR A OH  1 
ATOM   2545 N N   . PHE A 1 338 ? 26.461  23.016  6.035   1.00 46.35 ? 338  PHE A N   1 
ATOM   2546 C CA  . PHE A 1 338 ? 27.839  23.262  5.644   1.00 47.52 ? 338  PHE A CA  1 
ATOM   2547 C C   . PHE A 1 338 ? 27.997  24.046  4.352   1.00 46.85 ? 338  PHE A C   1 
ATOM   2548 O O   . PHE A 1 338 ? 29.102  24.487  4.007   1.00 46.53 ? 338  PHE A O   1 
ATOM   2549 C CB  . PHE A 1 338 ? 28.635  21.957  5.643   1.00 49.33 ? 338  PHE A CB  1 
ATOM   2550 C CG  . PHE A 1 338 ? 29.083  21.530  7.030   1.00 52.18 ? 338  PHE A CG  1 
ATOM   2551 C CD1 . PHE A 1 338 ? 28.756  20.264  7.527   1.00 52.53 ? 338  PHE A CD1 1 
ATOM   2552 C CD2 . PHE A 1 338 ? 29.817  22.423  7.851   1.00 55.00 ? 338  PHE A CD2 1 
ATOM   2553 C CE1 . PHE A 1 338 ? 29.157  19.887  8.786   1.00 53.34 ? 338  PHE A CE1 1 
ATOM   2554 C CE2 . PHE A 1 338 ? 30.226  22.052  9.133   1.00 56.08 ? 338  PHE A CE2 1 
ATOM   2555 C CZ  . PHE A 1 338 ? 29.896  20.781  9.601   1.00 54.98 ? 338  PHE A CZ  1 
ATOM   2556 N N   . LEU A 1 339 ? 26.878  24.246  3.665   1.00 45.84 ? 339  LEU A N   1 
ATOM   2557 C CA  . LEU A 1 339 ? 26.881  24.999  2.443   1.00 45.22 ? 339  LEU A CA  1 
ATOM   2558 C C   . LEU A 1 339 ? 27.402  26.404  2.672   1.00 45.47 ? 339  LEU A C   1 
ATOM   2559 O O   . LEU A 1 339 ? 28.085  26.940  1.807   1.00 44.90 ? 339  LEU A O   1 
ATOM   2560 C CB  . LEU A 1 339 ? 25.490  25.024  1.809   1.00 45.06 ? 339  LEU A CB  1 
ATOM   2561 C CG  . LEU A 1 339 ? 24.940  23.666  1.374   1.00 43.42 ? 339  LEU A CG  1 
ATOM   2562 C CD1 . LEU A 1 339 ? 23.651  23.857  0.608   1.00 40.83 ? 339  LEU A CD1 1 
ATOM   2563 C CD2 . LEU A 1 339 ? 25.977  22.874  0.561   1.00 40.35 ? 339  LEU A CD2 1 
ATOM   2564 N N   . VAL A 1 340 ? 27.108  26.983  3.836   1.00 46.09 ? 340  VAL A N   1 
ATOM   2565 C CA  . VAL A 1 340 ? 27.553  28.352  4.143   1.00 47.22 ? 340  VAL A CA  1 
ATOM   2566 C C   . VAL A 1 340 ? 29.015  28.417  4.568   1.00 48.27 ? 340  VAL A C   1 
ATOM   2567 O O   . VAL A 1 340 ? 29.594  29.494  4.673   1.00 48.48 ? 340  VAL A O   1 
ATOM   2568 C CB  . VAL A 1 340 ? 26.686  29.053  5.216   1.00 47.34 ? 340  VAL A CB  1 
ATOM   2569 C CG1 . VAL A 1 340 ? 25.200  29.035  4.829   1.00 46.79 ? 340  VAL A CG1 1 
ATOM   2570 C CG2 . VAL A 1 340 ? 26.921  28.450  6.620   1.00 47.79 ? 340  VAL A CG2 1 
ATOM   2571 N N   . TYR A 1 341 ? 29.616  27.263  4.819   1.00 49.17 ? 341  TYR A N   1 
ATOM   2572 C CA  . TYR A 1 341 ? 30.996  27.253  5.224   1.00 50.06 ? 341  TYR A CA  1 
ATOM   2573 C C   . TYR A 1 341 ? 31.951  27.220  4.037   1.00 50.49 ? 341  TYR A C   1 
ATOM   2574 O O   . TYR A 1 341 ? 33.127  27.546  4.194   1.00 51.87 ? 341  TYR A O   1 
ATOM   2575 C CB  . TYR A 1 341 ? 31.278  26.123  6.219   1.00 50.69 ? 341  TYR A CB  1 
ATOM   2576 C CG  . TYR A 1 341 ? 30.820  26.476  7.613   1.00 51.65 ? 341  TYR A CG  1 
ATOM   2577 C CD1 . TYR A 1 341 ? 29.485  26.285  8.003   1.00 51.61 ? 341  TYR A CD1 1 
ATOM   2578 C CD2 . TYR A 1 341 ? 31.708  27.031  8.536   1.00 51.76 ? 341  TYR A CD2 1 
ATOM   2579 C CE1 . TYR A 1 341 ? 29.050  26.638  9.286   1.00 52.67 ? 341  TYR A CE1 1 
ATOM   2580 C CE2 . TYR A 1 341 ? 31.288  27.373  9.824   1.00 53.71 ? 341  TYR A CE2 1 
ATOM   2581 C CZ  . TYR A 1 341 ? 29.956  27.178  10.188  1.00 53.39 ? 341  TYR A CZ  1 
ATOM   2582 O OH  . TYR A 1 341 ? 29.544  27.519  11.448  1.00 53.50 ? 341  TYR A OH  1 
ATOM   2583 N N   . GLY A 1 342 ? 31.474  26.859  2.850   1.00 49.77 ? 342  GLY A N   1 
ATOM   2584 C CA  . GLY A 1 342 ? 32.393  26.827  1.724   1.00 48.39 ? 342  GLY A CA  1 
ATOM   2585 C C   . GLY A 1 342 ? 31.880  26.505  0.341   1.00 47.43 ? 342  GLY A C   1 
ATOM   2586 O O   . GLY A 1 342 ? 32.671  26.157  -0.540  1.00 47.97 ? 342  GLY A O   1 
ATOM   2587 N N   . VAL A 1 343 ? 30.579  26.595  0.124   1.00 45.77 ? 343  VAL A N   1 
ATOM   2588 C CA  . VAL A 1 343 ? 30.130  26.631  -1.248  1.00 44.95 ? 343  VAL A CA  1 
ATOM   2589 C C   . VAL A 1 343 ? 29.858  28.093  -1.632  1.00 44.80 ? 343  VAL A C   1 
ATOM   2590 O O   . VAL A 1 343 ? 29.062  28.790  -0.997  1.00 44.44 ? 343  VAL A O   1 
ATOM   2591 C CB  . VAL A 1 343 ? 28.961  25.693  -1.516  1.00 44.70 ? 343  VAL A CB  1 
ATOM   2592 C CG1 . VAL A 1 343 ? 28.588  25.729  -2.990  1.00 44.22 ? 343  VAL A CG1 1 
ATOM   2593 C CG2 . VAL A 1 343 ? 29.353  24.274  -1.122  1.00 44.90 ? 343  VAL A CG2 1 
ATOM   2594 N N   . PRO A 1 344 ? 30.592  28.595  -2.633  1.00 44.82 ? 344  PRO A N   1 
ATOM   2595 C CA  . PRO A 1 344 ? 30.370  30.005  -2.985  1.00 44.32 ? 344  PRO A CA  1 
ATOM   2596 C C   . PRO A 1 344 ? 28.948  30.139  -3.500  1.00 44.07 ? 344  PRO A C   1 
ATOM   2597 O O   . PRO A 1 344 ? 28.454  29.235  -4.183  1.00 44.13 ? 344  PRO A O   1 
ATOM   2598 C CB  . PRO A 1 344 ? 31.401  30.259  -4.091  1.00 43.93 ? 344  PRO A CB  1 
ATOM   2599 C CG  . PRO A 1 344 ? 32.431  29.144  -3.897  1.00 43.95 ? 344  PRO A CG  1 
ATOM   2600 C CD  . PRO A 1 344 ? 31.644  27.968  -3.456  1.00 44.17 ? 344  PRO A CD  1 
ATOM   2601 N N   . GLY A 1 345 ? 28.294  31.234  -3.139  1.00 43.64 ? 345  GLY A N   1 
ATOM   2602 C CA  . GLY A 1 345 ? 26.893  31.435  -3.453  1.00 43.62 ? 345  GLY A CA  1 
ATOM   2603 C C   . GLY A 1 345 ? 26.037  31.378  -2.211  1.00 43.74 ? 345  GLY A C   1 
ATOM   2604 O O   . GLY A 1 345 ? 25.030  32.052  -2.136  1.00 43.95 ? 345  GLY A O   1 
ATOM   2605 N N   . PHE A 1 346 ? 26.447  30.588  -1.222  1.00 44.41 ? 346  PHE A N   1 
ATOM   2606 C CA  . PHE A 1 346 ? 25.598  30.304  -0.056  1.00 45.01 ? 346  PHE A CA  1 
ATOM   2607 C C   . PHE A 1 346 ? 25.889  31.165  1.154   1.00 45.72 ? 346  PHE A C   1 
ATOM   2608 O O   . PHE A 1 346 ? 27.057  31.469  1.441   1.00 45.51 ? 346  PHE A O   1 
ATOM   2609 C CB  . PHE A 1 346 ? 25.683  28.825  0.322   1.00 44.49 ? 346  PHE A CB  1 
ATOM   2610 C CG  . PHE A 1 346 ? 25.046  27.908  -0.693  1.00 43.93 ? 346  PHE A CG  1 
ATOM   2611 C CD1 . PHE A 1 346 ? 25.784  27.389  -1.734  1.00 41.80 ? 346  PHE A CD1 1 
ATOM   2612 C CD2 . PHE A 1 346 ? 23.703  27.573  -0.597  1.00 42.88 ? 346  PHE A CD2 1 
ATOM   2613 C CE1 . PHE A 1 346 ? 25.191  26.555  -2.661  1.00 42.23 ? 346  PHE A CE1 1 
ATOM   2614 C CE2 . PHE A 1 346 ? 23.117  26.757  -1.511  1.00 41.29 ? 346  PHE A CE2 1 
ATOM   2615 C CZ  . PHE A 1 346 ? 23.856  26.243  -2.550  1.00 42.63 ? 346  PHE A CZ  1 
ATOM   2616 N N   . SER A 1 347 ? 24.817  31.549  1.857   1.00 46.33 ? 347  SER A N   1 
ATOM   2617 C CA  . SER A 1 347 ? 24.922  32.422  3.028   1.00 47.62 ? 347  SER A CA  1 
ATOM   2618 C C   . SER A 1 347 ? 23.734  32.340  3.967   1.00 48.18 ? 347  SER A C   1 
ATOM   2619 O O   . SER A 1 347 ? 22.598  32.112  3.524   1.00 48.79 ? 347  SER A O   1 
ATOM   2620 C CB  . SER A 1 347 ? 25.100  33.888  2.610   1.00 47.62 ? 347  SER A CB  1 
ATOM   2621 O OG  . SER A 1 347 ? 24.741  34.745  3.681   1.00 48.28 ? 347  SER A OG  1 
ATOM   2622 N N   . LYS A 1 348 ? 23.984  32.591  5.253   1.00 48.12 ? 348  LYS A N   1 
ATOM   2623 C CA  . LYS A 1 348 ? 22.904  32.581  6.227   1.00 48.35 ? 348  LYS A CA  1 
ATOM   2624 C C   . LYS A 1 348 ? 22.059  33.834  6.076   1.00 48.61 ? 348  LYS A C   1 
ATOM   2625 O O   . LYS A 1 348 ? 20.889  33.843  6.477   1.00 48.31 ? 348  LYS A O   1 
ATOM   2626 C CB  . LYS A 1 348 ? 23.421  32.420  7.676   1.00 48.04 ? 348  LYS A CB  1 
ATOM   2627 C CG  . LYS A 1 348 ? 23.834  33.705  8.387   1.00 48.15 ? 348  LYS A CG  1 
ATOM   2628 C CD  . LYS A 1 348 ? 23.946  33.500  9.895   1.00 48.78 ? 348  LYS A CD  1 
ATOM   2629 C CE  . LYS A 1 348 ? 24.268  34.798  10.658  1.00 48.32 ? 348  LYS A CE  1 
ATOM   2630 N NZ  . LYS A 1 348 ? 23.113  35.721  10.751  1.00 47.57 ? 348  LYS A NZ  1 
ATOM   2631 N N   . ASP A 1 349 ? 22.656  34.882  5.489   1.00 49.01 ? 349  ASP A N   1 
ATOM   2632 C CA  . ASP A 1 349 ? 22.034  36.219  5.453   1.00 49.24 ? 349  ASP A CA  1 
ATOM   2633 C C   . ASP A 1 349 ? 21.163  36.549  4.225   1.00 49.03 ? 349  ASP A C   1 
ATOM   2634 O O   . ASP A 1 349 ? 20.642  37.659  4.124   1.00 49.23 ? 349  ASP A O   1 
ATOM   2635 C CB  . ASP A 1 349 ? 23.081  37.308  5.716   1.00 48.91 ? 349  ASP A CB  1 
ATOM   2636 C CG  . ASP A 1 349 ? 23.737  37.154  7.075   1.00 50.23 ? 349  ASP A CG  1 
ATOM   2637 O OD1 . ASP A 1 349 ? 23.018  36.965  8.085   1.00 49.18 ? 349  ASP A OD1 1 
ATOM   2638 O OD2 . ASP A 1 349 ? 24.989  37.201  7.132   1.00 53.45 ? 349  ASP A OD2 1 
ATOM   2639 N N   . ASN A 1 350 ? 21.020  35.598  3.302   1.00 48.87 ? 350  ASN A N   1 
ATOM   2640 C CA  . ASN A 1 350 ? 20.054  35.706  2.220   1.00 48.93 ? 350  ASN A CA  1 
ATOM   2641 C C   . ASN A 1 350 ? 19.514  34.344  1.793   1.00 48.73 ? 350  ASN A C   1 
ATOM   2642 O O   . ASN A 1 350 ? 19.772  33.331  2.452   1.00 48.83 ? 350  ASN A O   1 
ATOM   2643 C CB  . ASN A 1 350 ? 20.619  36.477  1.024   1.00 48.76 ? 350  ASN A CB  1 
ATOM   2644 C CG  . ASN A 1 350 ? 21.833  35.828  0.438   1.00 50.32 ? 350  ASN A CG  1 
ATOM   2645 O OD1 . ASN A 1 350 ? 21.868  34.609  0.213   1.00 50.90 ? 350  ASN A OD1 1 
ATOM   2646 N ND2 . ASN A 1 350 ? 22.857  36.640  0.176   1.00 51.07 ? 350  ASN A ND2 1 
ATOM   2647 N N   . GLU A 1 351 ? 18.767  34.332  0.690   1.00 48.11 ? 351  GLU A N   1 
ATOM   2648 C CA  . GLU A 1 351 ? 18.063  33.135  0.239   1.00 47.63 ? 351  GLU A CA  1 
ATOM   2649 C C   . GLU A 1 351 ? 18.967  32.128  -0.463  1.00 45.68 ? 351  GLU A C   1 
ATOM   2650 O O   . GLU A 1 351 ? 18.549  31.006  -0.744  1.00 44.91 ? 351  GLU A O   1 
ATOM   2651 C CB  . GLU A 1 351 ? 16.907  33.519  -0.693  1.00 48.70 ? 351  GLU A CB  1 
ATOM   2652 C CG  . GLU A 1 351 ? 15.869  34.446  -0.086  1.00 52.64 ? 351  GLU A CG  1 
ATOM   2653 C CD  . GLU A 1 351 ? 15.177  33.854  1.138   1.00 59.22 ? 351  GLU A CD  1 
ATOM   2654 O OE1 . GLU A 1 351 ? 15.051  32.598  1.269   1.00 61.02 ? 351  GLU A OE1 1 
ATOM   2655 O OE2 . GLU A 1 351 ? 14.736  34.680  1.976   1.00 63.54 ? 351  GLU A OE2 1 
ATOM   2656 N N   . SER A 1 352 ? 20.186  32.562  -0.759  1.00 43.71 ? 352  SER A N   1 
ATOM   2657 C CA  . SER A 1 352 ? 21.171  31.767  -1.457  1.00 42.44 ? 352  SER A CA  1 
ATOM   2658 C C   . SER A 1 352 ? 20.612  31.099  -2.725  1.00 42.09 ? 352  SER A C   1 
ATOM   2659 O O   . SER A 1 352 ? 20.668  29.873  -2.894  1.00 42.07 ? 352  SER A O   1 
ATOM   2660 C CB  . SER A 1 352 ? 21.816  30.734  -0.516  1.00 42.52 ? 352  SER A CB  1 
ATOM   2661 O OG  . SER A 1 352 ? 21.988  31.247  0.792   1.00 40.18 ? 352  SER A OG  1 
ATOM   2662 N N   . LEU A 1 353 ? 20.079  31.903  -3.623  1.00 40.87 ? 353  LEU A N   1 
ATOM   2663 C CA  . LEU A 1 353 ? 19.667  31.372  -4.888  1.00 40.99 ? 353  LEU A CA  1 
ATOM   2664 C C   . LEU A 1 353 ? 20.915  31.306  -5.753  1.00 40.90 ? 353  LEU A C   1 
ATOM   2665 O O   . LEU A 1 353 ? 21.656  32.261  -5.863  1.00 42.09 ? 353  LEU A O   1 
ATOM   2666 C CB  . LEU A 1 353 ? 18.584  32.246  -5.494  1.00 40.80 ? 353  LEU A CB  1 
ATOM   2667 C CG  . LEU A 1 353 ? 17.347  32.464  -4.607  1.00 41.73 ? 353  LEU A CG  1 
ATOM   2668 C CD1 . LEU A 1 353 ? 16.445  33.508  -5.218  1.00 43.50 ? 353  LEU A CD1 1 
ATOM   2669 C CD2 . LEU A 1 353 ? 16.571  31.188  -4.377  1.00 41.58 ? 353  LEU A CD2 1 
ATOM   2670 N N   . ILE A 1 354 ? 21.200  30.162  -6.336  1.00 40.56 ? 354  ILE A N   1 
ATOM   2671 C CA  . ILE A 1 354 ? 22.496  29.999  -7.001  1.00 39.34 ? 354  ILE A CA  1 
ATOM   2672 C C   . ILE A 1 354 ? 22.299  29.718  -8.481  1.00 39.56 ? 354  ILE A C   1 
ATOM   2673 O O   . ILE A 1 354 ? 21.179  29.469  -8.945  1.00 40.16 ? 354  ILE A O   1 
ATOM   2674 C CB  . ILE A 1 354 ? 23.326  28.883  -6.359  1.00 38.62 ? 354  ILE A CB  1 
ATOM   2675 C CG1 . ILE A 1 354 ? 22.482  27.610  -6.261  1.00 37.47 ? 354  ILE A CG1 1 
ATOM   2676 C CG2 . ILE A 1 354 ? 23.819  29.320  -5.000  1.00 37.17 ? 354  ILE A CG2 1 
ATOM   2677 C CD1 . ILE A 1 354 ? 23.259  26.352  -6.306  1.00 39.09 ? 354  ILE A CD1 1 
ATOM   2678 N N   . SER A 1 355 ? 23.384  29.759  -9.225  1.00 39.30 ? 355  SER A N   1 
ATOM   2679 C CA  . SER A 1 355 ? 23.287  29.576  -10.634 1.00 39.89 ? 355  SER A CA  1 
ATOM   2680 C C   . SER A 1 355 ? 23.678  28.152  -10.919 1.00 39.98 ? 355  SER A C   1 
ATOM   2681 O O   . SER A 1 355 ? 24.180  27.434  -10.056 1.00 39.83 ? 355  SER A O   1 
ATOM   2682 C CB  . SER A 1 355 ? 24.245  30.516  -11.348 1.00 40.12 ? 355  SER A CB  1 
ATOM   2683 O OG  . SER A 1 355 ? 25.579  30.303  -10.889 1.00 41.64 ? 355  SER A OG  1 
ATOM   2684 N N   . ARG A 1 356 ? 23.464  27.754  -12.153 1.00 40.25 ? 356  ARG A N   1 
ATOM   2685 C CA  . ARG A 1 356 ? 23.934  26.487  -12.596 1.00 40.82 ? 356  ARG A CA  1 
ATOM   2686 C C   . ARG A 1 356 ? 25.450  26.397  -12.392 1.00 40.87 ? 356  ARG A C   1 
ATOM   2687 O O   . ARG A 1 356 ? 25.955  25.359  -11.950 1.00 41.16 ? 356  ARG A O   1 
ATOM   2688 C CB  . ARG A 1 356 ? 23.556  26.303  -14.055 1.00 40.94 ? 356  ARG A CB  1 
ATOM   2689 C CG  . ARG A 1 356 ? 23.665  24.900  -14.463 1.00 42.23 ? 356  ARG A CG  1 
ATOM   2690 C CD  . ARG A 1 356 ? 22.516  24.399  -15.292 1.00 42.35 ? 356  ARG A CD  1 
ATOM   2691 N NE  . ARG A 1 356 ? 22.808  22.990  -15.514 1.00 43.33 ? 356  ARG A NE  1 
ATOM   2692 C CZ  . ARG A 1 356 ? 22.405  21.997  -14.726 1.00 44.07 ? 356  ARG A CZ  1 
ATOM   2693 N NH1 . ARG A 1 356 ? 21.617  22.239  -13.671 1.00 43.20 ? 356  ARG A NH1 1 
ATOM   2694 N NH2 . ARG A 1 356 ? 22.764  20.747  -15.027 1.00 44.13 ? 356  ARG A NH2 1 
ATOM   2695 N N   . ALA A 1 357 ? 26.160  27.494  -12.673 1.00 40.62 ? 357  ALA A N   1 
ATOM   2696 C CA  . ALA A 1 357 ? 27.616  27.504  -12.555 1.00 40.28 ? 357  ALA A CA  1 
ATOM   2697 C C   . ALA A 1 357 ? 28.014  27.236  -11.105 1.00 39.98 ? 357  ALA A C   1 
ATOM   2698 O O   . ALA A 1 357 ? 28.868  26.375  -10.833 1.00 40.46 ? 357  ALA A O   1 
ATOM   2699 C CB  . ALA A 1 357 ? 28.214  28.824  -13.059 1.00 39.66 ? 357  ALA A CB  1 
ATOM   2700 N N   . GLN A 1 358 ? 27.375  27.950  -10.182 1.00 38.56 ? 358  GLN A N   1 
ATOM   2701 C CA  . GLN A 1 358 ? 27.646  27.776  -8.769  1.00 38.01 ? 358  GLN A CA  1 
ATOM   2702 C C   . GLN A 1 358 ? 27.298  26.385  -8.289  1.00 37.93 ? 358  GLN A C   1 
ATOM   2703 O O   . GLN A 1 358 ? 27.905  25.894  -7.351  1.00 38.10 ? 358  GLN A O   1 
ATOM   2704 C CB  . GLN A 1 358 ? 26.909  28.826  -7.934  1.00 37.52 ? 358  GLN A CB  1 
ATOM   2705 C CG  . GLN A 1 358 ? 27.429  30.216  -8.179  1.00 37.81 ? 358  GLN A CG  1 
ATOM   2706 C CD  . GLN A 1 358 ? 26.662  31.286  -7.463  1.00 39.29 ? 358  GLN A CD  1 
ATOM   2707 O OE1 . GLN A 1 358 ? 25.437  31.390  -7.578  1.00 41.37 ? 358  GLN A OE1 1 
ATOM   2708 N NE2 . GLN A 1 358 ? 27.380  32.120  -6.738  1.00 39.31 ? 358  GLN A NE2 1 
ATOM   2709 N N   . PHE A 1 359 ? 26.318  25.755  -8.930  1.00 37.95 ? 359  PHE A N   1 
ATOM   2710 C CA  . PHE A 1 359 ? 25.909  24.424  -8.562  1.00 37.81 ? 359  PHE A CA  1 
ATOM   2711 C C   . PHE A 1 359 ? 26.931  23.375  -9.033  1.00 38.33 ? 359  PHE A C   1 
ATOM   2712 O O   . PHE A 1 359 ? 27.279  22.475  -8.275  1.00 38.07 ? 359  PHE A O   1 
ATOM   2713 C CB  . PHE A 1 359 ? 24.511  24.140  -9.103  1.00 37.41 ? 359  PHE A CB  1 
ATOM   2714 C CG  . PHE A 1 359 ? 24.087  22.705  -8.985  1.00 36.19 ? 359  PHE A CG  1 
ATOM   2715 C CD1 . PHE A 1 359 ? 23.975  21.916  -10.101 1.00 37.57 ? 359  PHE A CD1 1 
ATOM   2716 C CD2 . PHE A 1 359 ? 23.771  22.154  -7.761  1.00 37.48 ? 359  PHE A CD2 1 
ATOM   2717 C CE1 . PHE A 1 359 ? 23.576  20.572  -9.994  1.00 39.36 ? 359  PHE A CE1 1 
ATOM   2718 C CE2 . PHE A 1 359 ? 23.369  20.822  -7.646  1.00 38.11 ? 359  PHE A CE2 1 
ATOM   2719 C CZ  . PHE A 1 359 ? 23.270  20.036  -8.761  1.00 38.18 ? 359  PHE A CZ  1 
ATOM   2720 N N   . LEU A 1 360 ? 27.406  23.487  -10.271 1.00 38.90 ? 360  LEU A N   1 
ATOM   2721 C CA  . LEU A 1 360 ? 28.413  22.556  -10.767 1.00 40.01 ? 360  LEU A CA  1 
ATOM   2722 C C   . LEU A 1 360 ? 29.687  22.634  -9.912  1.00 39.69 ? 360  LEU A C   1 
ATOM   2723 O O   . LEU A 1 360 ? 30.316  21.605  -9.628  1.00 39.58 ? 360  LEU A O   1 
ATOM   2724 C CB  . LEU A 1 360 ? 28.725  22.771  -12.260 1.00 40.87 ? 360  LEU A CB  1 
ATOM   2725 C CG  . LEU A 1 360 ? 27.607  22.782  -13.352 1.00 44.31 ? 360  LEU A CG  1 
ATOM   2726 C CD1 . LEU A 1 360 ? 28.109  22.309  -14.742 1.00 46.52 ? 360  LEU A CD1 1 
ATOM   2727 C CD2 . LEU A 1 360 ? 26.369  21.984  -12.995 1.00 46.86 ? 360  LEU A CD2 1 
ATOM   2728 N N   . ALA A 1 361 ? 30.041  23.847  -9.479  1.00 39.09 ? 361  ALA A N   1 
ATOM   2729 C CA  . ALA A 1 361 ? 31.223  24.061  -8.655  1.00 38.51 ? 361  ALA A CA  1 
ATOM   2730 C C   . ALA A 1 361 ? 30.971  23.497  -7.268  1.00 38.63 ? 361  ALA A C   1 
ATOM   2731 O O   . ALA A 1 361 ? 31.877  22.891  -6.654  1.00 39.13 ? 361  ALA A O   1 
ATOM   2732 C CB  . ALA A 1 361 ? 31.574  25.536  -8.577  1.00 38.24 ? 361  ALA A CB  1 
ATOM   2733 N N   . GLY A 1 362 ? 29.734  23.675  -6.790  1.00 37.85 ? 362  GLY A N   1 
ATOM   2734 C CA  . GLY A 1 362 ? 29.335  23.211  -5.480  1.00 36.89 ? 362  GLY A CA  1 
ATOM   2735 C C   . GLY A 1 362 ? 29.437  21.702  -5.417  1.00 37.14 ? 362  GLY A C   1 
ATOM   2736 O O   . GLY A 1 362 ? 29.780  21.130  -4.377  1.00 37.18 ? 362  GLY A O   1 
ATOM   2737 N N   . VAL A 1 363 ? 29.147  21.052  -6.536  1.00 37.35 ? 363  VAL A N   1 
ATOM   2738 C CA  . VAL A 1 363 ? 29.179  19.599  -6.593  1.00 37.89 ? 363  VAL A CA  1 
ATOM   2739 C C   . VAL A 1 363 ? 30.606  19.067  -6.490  1.00 38.56 ? 363  VAL A C   1 
ATOM   2740 O O   . VAL A 1 363 ? 30.813  18.078  -5.815  1.00 39.88 ? 363  VAL A O   1 
ATOM   2741 C CB  . VAL A 1 363 ? 28.456  19.044  -7.837  1.00 37.63 ? 363  VAL A CB  1 
ATOM   2742 C CG1 . VAL A 1 363 ? 28.750  17.565  -8.026  1.00 36.84 ? 363  VAL A CG1 1 
ATOM   2743 C CG2 . VAL A 1 363 ? 26.962  19.303  -7.732  1.00 36.71 ? 363  VAL A CG2 1 
ATOM   2744 N N   . ARG A 1 364 ? 31.576  19.724  -7.122  1.00 38.88 ? 364  ARG A N   1 
ATOM   2745 C CA  . ARG A 1 364 ? 32.992  19.370  -6.948  1.00 39.79 ? 364  ARG A CA  1 
ATOM   2746 C C   . ARG A 1 364 ? 33.440  19.514  -5.496  1.00 39.99 ? 364  ARG A C   1 
ATOM   2747 O O   . ARG A 1 364 ? 34.314  18.767  -5.047  1.00 40.65 ? 364  ARG A O   1 
ATOM   2748 C CB  . ARG A 1 364 ? 33.907  20.246  -7.793  1.00 40.10 ? 364  ARG A CB  1 
ATOM   2749 C CG  . ARG A 1 364 ? 33.641  20.220  -9.276  1.00 42.26 ? 364  ARG A CG  1 
ATOM   2750 C CD  . ARG A 1 364 ? 33.204  18.831  -9.731  1.00 47.73 ? 364  ARG A CD  1 
ATOM   2751 N NE  . ARG A 1 364 ? 34.278  17.844  -9.732  1.00 50.24 ? 364  ARG A NE  1 
ATOM   2752 C CZ  . ARG A 1 364 ? 34.977  17.512  -10.815 1.00 50.45 ? 364  ARG A CZ  1 
ATOM   2753 N NH1 . ARG A 1 364 ? 34.726  18.096  -11.989 1.00 50.19 ? 364  ARG A NH1 1 
ATOM   2754 N NH2 . ARG A 1 364 ? 35.921  16.593  -10.722 1.00 50.85 ? 364  ARG A NH2 1 
ATOM   2755 N N   . ILE A 1 365 ? 32.847  20.462  -4.763  1.00 39.27 ? 365  ILE A N   1 
ATOM   2756 C CA  . ILE A 1 365 ? 33.236  20.705  -3.373  1.00 38.32 ? 365  ILE A CA  1 
ATOM   2757 C C   . ILE A 1 365 ? 32.552  19.743  -2.393  1.00 38.56 ? 365  ILE A C   1 
ATOM   2758 O O   . ILE A 1 365 ? 33.181  19.268  -1.432  1.00 38.14 ? 365  ILE A O   1 
ATOM   2759 C CB  . ILE A 1 365 ? 33.048  22.188  -2.999  1.00 38.11 ? 365  ILE A CB  1 
ATOM   2760 C CG1 . ILE A 1 365 ? 34.136  23.022  -3.673  1.00 36.91 ? 365  ILE A CG1 1 
ATOM   2761 C CG2 . ILE A 1 365 ? 33.112  22.422  -1.493  1.00 38.06 ? 365  ILE A CG2 1 
ATOM   2762 C CD1 . ILE A 1 365 ? 33.738  24.484  -3.916  1.00 36.48 ? 365  ILE A CD1 1 
ATOM   2763 N N   . GLY A 1 366 ? 31.280  19.442  -2.654  1.00 39.03 ? 366  GLY A N   1 
ATOM   2764 C CA  . GLY A 1 366 ? 30.491  18.543  -1.808  1.00 38.78 ? 366  GLY A CA  1 
ATOM   2765 C C   . GLY A 1 366 ? 30.796  17.084  -2.105  1.00 39.72 ? 366  GLY A C   1 
ATOM   2766 O O   . GLY A 1 366 ? 30.466  16.194  -1.321  1.00 40.12 ? 366  GLY A O   1 
ATOM   2767 N N   . VAL A 1 367 ? 31.412  16.806  -3.245  1.00 39.81 ? 367  VAL A N   1 
ATOM   2768 C CA  . VAL A 1 367 ? 31.752  15.429  -3.550  1.00 39.92 ? 367  VAL A CA  1 
ATOM   2769 C C   . VAL A 1 367 ? 33.185  15.461  -4.008  1.00 40.89 ? 367  VAL A C   1 
ATOM   2770 O O   . VAL A 1 367 ? 33.466  15.169  -5.175  1.00 40.80 ? 367  VAL A O   1 
ATOM   2771 C CB  . VAL A 1 367 ? 30.826  14.805  -4.636  1.00 39.78 ? 367  VAL A CB  1 
ATOM   2772 C CG1 . VAL A 1 367 ? 30.862  13.287  -4.556  1.00 37.39 ? 367  VAL A CG1 1 
ATOM   2773 C CG2 . VAL A 1 367 ? 29.394  15.311  -4.494  1.00 38.92 ? 367  VAL A CG2 1 
ATOM   2774 N N   . PRO A 1 368 ? 34.102  15.807  -3.081  1.00 41.80 ? 368  PRO A N   1 
ATOM   2775 C CA  . PRO A 1 368 ? 35.476  16.167  -3.427  1.00 42.66 ? 368  PRO A CA  1 
ATOM   2776 C C   . PRO A 1 368 ? 36.257  15.001  -4.021  1.00 44.03 ? 368  PRO A C   1 
ATOM   2777 O O   . PRO A 1 368 ? 37.130  15.217  -4.836  1.00 44.95 ? 368  PRO A O   1 
ATOM   2778 C CB  . PRO A 1 368 ? 36.073  16.626  -2.094  1.00 42.43 ? 368  PRO A CB  1 
ATOM   2779 C CG  . PRO A 1 368 ? 35.217  15.979  -1.047  1.00 41.81 ? 368  PRO A CG  1 
ATOM   2780 C CD  . PRO A 1 368 ? 33.863  15.846  -1.625  1.00 41.42 ? 368  PRO A CD  1 
ATOM   2781 N N   . GLN A 1 369 ? 35.913  13.778  -3.651  1.00 45.86 ? 369  GLN A N   1 
ATOM   2782 C CA  . GLN A 1 369 ? 36.545  12.582  -4.219  1.00 47.84 ? 369  GLN A CA  1 
ATOM   2783 C C   . GLN A 1 369 ? 36.071  12.167  -5.623  1.00 48.54 ? 369  GLN A C   1 
ATOM   2784 O O   . GLN A 1 369 ? 36.510  11.130  -6.126  1.00 49.02 ? 369  GLN A O   1 
ATOM   2785 C CB  . GLN A 1 369 ? 36.382  11.396  -3.258  1.00 47.68 ? 369  GLN A CB  1 
ATOM   2786 C CG  . GLN A 1 369 ? 37.489  11.315  -2.192  1.00 51.77 ? 369  GLN A CG  1 
ATOM   2787 C CD  . GLN A 1 369 ? 37.363  12.363  -1.058  1.00 55.36 ? 369  GLN A CD  1 
ATOM   2788 O OE1 . GLN A 1 369 ? 36.464  12.278  -0.187  1.00 55.52 ? 369  GLN A OE1 1 
ATOM   2789 N NE2 . GLN A 1 369 ? 38.282  13.344  -1.058  1.00 55.03 ? 369  GLN A NE2 1 
ATOM   2790 N N   . ALA A 1 370 ? 35.175  12.935  -6.247  1.00 49.37 ? 370  ALA A N   1 
ATOM   2791 C CA  . ALA A 1 370 ? 34.629  12.549  -7.562  1.00 49.92 ? 370  ALA A CA  1 
ATOM   2792 C C   . ALA A 1 370 ? 35.470  12.999  -8.749  1.00 50.67 ? 370  ALA A C   1 
ATOM   2793 O O   . ALA A 1 370 ? 35.921  14.147  -8.822  1.00 50.58 ? 370  ALA A O   1 
ATOM   2794 C CB  . ALA A 1 370 ? 33.208  13.041  -7.733  1.00 49.62 ? 370  ALA A CB  1 
ATOM   2795 N N   . SER A 1 371 ? 35.650  12.081  -9.689  1.00 51.89 ? 371  SER A N   1 
ATOM   2796 C CA  . SER A 1 371 ? 36.206  12.384  -10.994 1.00 53.22 ? 371  SER A CA  1 
ATOM   2797 C C   . SER A 1 371 ? 35.234  13.262  -11.765 1.00 53.99 ? 371  SER A C   1 
ATOM   2798 O O   . SER A 1 371 ? 34.104  13.494  -11.324 1.00 55.13 ? 371  SER A O   1 
ATOM   2799 C CB  . SER A 1 371 ? 36.442  11.081  -11.762 1.00 53.43 ? 371  SER A CB  1 
ATOM   2800 O OG  . SER A 1 371 ? 35.234  10.330  -11.887 1.00 54.50 ? 371  SER A OG  1 
ATOM   2801 N N   . ASP A 1 372 ? 35.663  13.744  -12.922 1.00 54.60 ? 372  ASP A N   1 
ATOM   2802 C CA  . ASP A 1 372 ? 34.808  14.554  -13.783 1.00 54.95 ? 372  ASP A CA  1 
ATOM   2803 C C   . ASP A 1 372 ? 33.522  13.833  -14.187 1.00 54.78 ? 372  ASP A C   1 
ATOM   2804 O O   . ASP A 1 372 ? 32.446  14.442  -14.258 1.00 54.89 ? 372  ASP A O   1 
ATOM   2805 C CB  . ASP A 1 372 ? 35.587  14.991  -15.018 1.00 55.16 ? 372  ASP A CB  1 
ATOM   2806 C CG  . ASP A 1 372 ? 36.672  16.008  -14.692 1.00 56.32 ? 372  ASP A CG  1 
ATOM   2807 O OD1 . ASP A 1 372 ? 37.019  16.183  -13.505 1.00 56.30 ? 372  ASP A OD1 1 
ATOM   2808 O OD2 . ASP A 1 372 ? 37.177  16.651  -15.635 1.00 59.39 ? 372  ASP A OD2 1 
ATOM   2809 N N   . LEU A 1 373 ? 33.642  12.534  -14.425 1.00 54.23 ? 373  LEU A N   1 
ATOM   2810 C CA  . LEU A 1 373 ? 32.518  11.723  -14.850 1.00 53.79 ? 373  LEU A CA  1 
ATOM   2811 C C   . LEU A 1 373 ? 31.536  11.460  -13.702 1.00 53.68 ? 373  LEU A C   1 
ATOM   2812 O O   . LEU A 1 373 ? 30.319  11.588  -13.864 1.00 53.68 ? 373  LEU A O   1 
ATOM   2813 C CB  . LEU A 1 373 ? 33.037  10.398  -15.400 1.00 53.85 ? 373  LEU A CB  1 
ATOM   2814 C CG  . LEU A 1 373 ? 32.006  9.416   -15.929 1.00 53.98 ? 373  LEU A CG  1 
ATOM   2815 C CD1 . LEU A 1 373 ? 31.046  10.109  -16.902 1.00 53.72 ? 373  LEU A CD1 1 
ATOM   2816 C CD2 . LEU A 1 373 ? 32.733  8.270   -16.595 1.00 54.15 ? 373  LEU A CD2 1 
ATOM   2817 N N   . ALA A 1 374 ? 32.070  11.064  -12.548 1.00 52.84 ? 374  ALA A N   1 
ATOM   2818 C CA  . ALA A 1 374 ? 31.246  10.844  -11.377 1.00 51.37 ? 374  ALA A CA  1 
ATOM   2819 C C   . ALA A 1 374 ? 30.445  12.097  -11.060 1.00 50.45 ? 374  ALA A C   1 
ATOM   2820 O O   . ALA A 1 374 ? 29.262  11.997  -10.744 1.00 50.33 ? 374  ALA A O   1 
ATOM   2821 C CB  . ALA A 1 374 ? 32.106  10.427  -10.190 1.00 51.48 ? 374  ALA A CB  1 
ATOM   2822 N N   . ALA A 1 375 ? 31.090  13.265  -11.151 1.00 49.35 ? 375  ALA A N   1 
ATOM   2823 C CA  . ALA A 1 375 ? 30.445  14.537  -10.846 1.00 48.76 ? 375  ALA A CA  1 
ATOM   2824 C C   . ALA A 1 375 ? 29.357  14.820  -11.864 1.00 49.10 ? 375  ALA A C   1 
ATOM   2825 O O   . ALA A 1 375 ? 28.260  15.262  -11.505 1.00 49.42 ? 375  ALA A O   1 
ATOM   2826 C CB  . ALA A 1 375 ? 31.448  15.659  -10.831 1.00 48.66 ? 375  ALA A CB  1 
ATOM   2827 N N   . GLU A 1 376 ? 29.658  14.549  -13.133 1.00 48.82 ? 376  GLU A N   1 
ATOM   2828 C CA  . GLU A 1 376 ? 28.684  14.666  -14.189 1.00 48.68 ? 376  GLU A CA  1 
ATOM   2829 C C   . GLU A 1 376 ? 27.462  13.862  -13.812 1.00 47.19 ? 376  GLU A C   1 
ATOM   2830 O O   . GLU A 1 376 ? 26.341  14.354  -13.927 1.00 47.11 ? 376  GLU A O   1 
ATOM   2831 C CB  . GLU A 1 376 ? 29.254  14.172  -15.521 1.00 49.98 ? 376  GLU A CB  1 
ATOM   2832 C CG  . GLU A 1 376 ? 29.672  15.270  -16.514 1.00 55.26 ? 376  GLU A CG  1 
ATOM   2833 C CD  . GLU A 1 376 ? 28.458  15.874  -17.224 1.00 63.18 ? 376  GLU A CD  1 
ATOM   2834 O OE1 . GLU A 1 376 ? 27.580  16.490  -16.538 1.00 65.27 ? 376  GLU A OE1 1 
ATOM   2835 O OE2 . GLU A 1 376 ? 28.378  15.722  -18.470 1.00 65.34 ? 376  GLU A OE2 1 
ATOM   2836 N N   . ALA A 1 377 ? 27.680  12.646  -13.323 1.00 45.06 ? 377  ALA A N   1 
ATOM   2837 C CA  . ALA A 1 377 ? 26.574  11.814  -12.894 1.00 44.29 ? 377  ALA A CA  1 
ATOM   2838 C C   . ALA A 1 377 ? 25.740  12.426  -11.745 1.00 43.79 ? 377  ALA A C   1 
ATOM   2839 O O   . ALA A 1 377 ? 24.506  12.408  -11.801 1.00 43.16 ? 377  ALA A O   1 
ATOM   2840 C CB  . ALA A 1 377 ? 27.031  10.397  -12.565 1.00 44.14 ? 377  ALA A CB  1 
ATOM   2841 N N   . VAL A 1 378 ? 26.404  12.988  -10.733 1.00 42.88 ? 378  VAL A N   1 
ATOM   2842 C CA  . VAL A 1 378 ? 25.693  13.645  -9.634  1.00 42.00 ? 378  VAL A CA  1 
ATOM   2843 C C   . VAL A 1 378 ? 24.831  14.782  -10.195 1.00 42.29 ? 378  VAL A C   1 
ATOM   2844 O O   . VAL A 1 378 ? 23.618  14.900  -9.888  1.00 41.71 ? 378  VAL A O   1 
ATOM   2845 C CB  . VAL A 1 378 ? 26.653  14.213  -8.545  1.00 42.13 ? 378  VAL A CB  1 
ATOM   2846 C CG1 . VAL A 1 378 ? 25.858  14.884  -7.448  1.00 41.25 ? 378  VAL A CG1 1 
ATOM   2847 C CG2 . VAL A 1 378 ? 27.567  13.137  -7.966  1.00 39.26 ? 378  VAL A CG2 1 
ATOM   2848 N N   . VAL A 1 379 ? 25.463  15.596  -11.039 1.00 42.03 ? 379  VAL A N   1 
ATOM   2849 C CA  . VAL A 1 379 ? 24.824  16.780  -11.591 1.00 42.13 ? 379  VAL A CA  1 
ATOM   2850 C C   . VAL A 1 379 ? 23.660  16.417  -12.507 1.00 42.57 ? 379  VAL A C   1 
ATOM   2851 O O   . VAL A 1 379 ? 22.647  17.104  -12.555 1.00 42.22 ? 379  VAL A O   1 
ATOM   2852 C CB  . VAL A 1 379 ? 25.842  17.674  -12.326 1.00 41.65 ? 379  VAL A CB  1 
ATOM   2853 C CG1 . VAL A 1 379 ? 25.149  18.601  -13.321 1.00 40.79 ? 379  VAL A CG1 1 
ATOM   2854 C CG2 . VAL A 1 379 ? 26.603  18.484  -11.324 1.00 41.31 ? 379  VAL A CG2 1 
ATOM   2855 N N   . LEU A 1 380 ? 23.822  15.321  -13.227 1.00 43.59 ? 380  LEU A N   1 
ATOM   2856 C CA  . LEU A 1 380 ? 22.781  14.829  -14.096 1.00 44.55 ? 380  LEU A CA  1 
ATOM   2857 C C   . LEU A 1 380 ? 21.604  14.334  -13.261 1.00 44.55 ? 380  LEU A C   1 
ATOM   2858 O O   . LEU A 1 380 ? 20.460  14.716  -13.508 1.00 45.23 ? 380  LEU A O   1 
ATOM   2859 C CB  . LEU A 1 380 ? 23.345  13.737  -14.990 1.00 45.14 ? 380  LEU A CB  1 
ATOM   2860 C CG  . LEU A 1 380 ? 24.006  14.132  -16.335 1.00 47.89 ? 380  LEU A CG  1 
ATOM   2861 C CD1 . LEU A 1 380 ? 22.997  13.871  -17.477 1.00 50.47 ? 380  LEU A CD1 1 
ATOM   2862 C CD2 . LEU A 1 380 ? 24.649  15.568  -16.445 1.00 47.35 ? 380  LEU A CD2 1 
ATOM   2863 N N   . HIS A 1 381 ? 21.897  13.534  -12.244 1.00 43.69 ? 381  HIS A N   1 
ATOM   2864 C CA  . HIS A 1 381 ? 20.876  13.027  -11.345 1.00 43.53 ? 381  HIS A CA  1 
ATOM   2865 C C   . HIS A 1 381 ? 20.017  14.072  -10.608 1.00 42.49 ? 381  HIS A C   1 
ATOM   2866 O O   . HIS A 1 381 ? 18.810  13.917  -10.527 1.00 42.27 ? 381  HIS A O   1 
ATOM   2867 C CB  . HIS A 1 381 ? 21.503  12.087  -10.323 1.00 43.54 ? 381  HIS A CB  1 
ATOM   2868 C CG  . HIS A 1 381 ? 20.505  11.408  -9.454  1.00 45.29 ? 381  HIS A CG  1 
ATOM   2869 N ND1 . HIS A 1 381 ? 19.958  10.184  -9.773  1.00 49.04 ? 381  HIS A ND1 1 
ATOM   2870 C CD2 . HIS A 1 381 ? 19.944  11.776  -8.276  1.00 47.47 ? 381  HIS A CD2 1 
ATOM   2871 C CE1 . HIS A 1 381 ? 19.114  9.819   -8.818  1.00 49.17 ? 381  HIS A CE1 1 
ATOM   2872 N NE2 . HIS A 1 381 ? 19.090  10.766  -7.896  1.00 47.74 ? 381  HIS A NE2 1 
ATOM   2873 N N   . TYR A 1 382 ? 20.656  15.109  -10.066 1.00 41.42 ? 382  TYR A N   1 
ATOM   2874 C CA  . TYR A 1 382 ? 20.012  16.095  -9.206  1.00 39.91 ? 382  TYR A CA  1 
ATOM   2875 C C   . TYR A 1 382 ? 19.510  17.318  -9.956  1.00 40.33 ? 382  TYR A C   1 
ATOM   2876 O O   . TYR A 1 382 ? 18.815  18.149  -9.377  1.00 40.50 ? 382  TYR A O   1 
ATOM   2877 C CB  . TYR A 1 382 ? 20.962  16.540  -8.089  1.00 39.51 ? 382  TYR A CB  1 
ATOM   2878 C CG  . TYR A 1 382 ? 21.099  15.535  -6.971  1.00 37.05 ? 382  TYR A CG  1 
ATOM   2879 C CD1 . TYR A 1 382 ? 22.003  14.479  -7.059  1.00 36.18 ? 382  TYR A CD1 1 
ATOM   2880 C CD2 . TYR A 1 382 ? 20.328  15.649  -5.822  1.00 35.77 ? 382  TYR A CD2 1 
ATOM   2881 C CE1 . TYR A 1 382 ? 22.110  13.537  -6.030  1.00 36.02 ? 382  TYR A CE1 1 
ATOM   2882 C CE2 . TYR A 1 382 ? 20.425  14.731  -4.787  1.00 34.78 ? 382  TYR A CE2 1 
ATOM   2883 C CZ  . TYR A 1 382 ? 21.312  13.682  -4.903  1.00 36.29 ? 382  TYR A CZ  1 
ATOM   2884 O OH  . TYR A 1 382 ? 21.398  12.785  -3.890  1.00 38.16 ? 382  TYR A OH  1 
ATOM   2885 N N   . THR A 1 383 ? 19.849  17.451  -11.237 1.00 40.73 ? 383  THR A N   1 
ATOM   2886 C CA  . THR A 1 383 ? 19.263  18.519  -12.041 1.00 41.18 ? 383  THR A CA  1 
ATOM   2887 C C   . THR A 1 383 ? 17.797  18.193  -12.274 1.00 41.66 ? 383  THR A C   1 
ATOM   2888 O O   . THR A 1 383 ? 17.450  17.036  -12.525 1.00 41.29 ? 383  THR A O   1 
ATOM   2889 C CB  . THR A 1 383 ? 19.973  18.658  -13.383 1.00 41.08 ? 383  THR A CB  1 
ATOM   2890 O OG1 . THR A 1 383 ? 21.341  18.984  -13.151 1.00 41.85 ? 383  THR A OG1 1 
ATOM   2891 C CG2 . THR A 1 383 ? 19.359  19.766  -14.220 1.00 40.89 ? 383  THR A CG2 1 
ATOM   2892 N N   . ASP A 1 384 ? 16.948  19.205  -12.174 1.00 42.44 ? 384  ASP A N   1 
ATOM   2893 C CA  . ASP A 1 384 ? 15.570  19.087  -12.595 1.00 44.55 ? 384  ASP A CA  1 
ATOM   2894 C C   . ASP A 1 384 ? 15.484  19.514  -14.057 1.00 45.17 ? 384  ASP A C   1 
ATOM   2895 O O   . ASP A 1 384 ? 15.441  20.720  -14.334 1.00 45.15 ? 384  ASP A O   1 
ATOM   2896 C CB  . ASP A 1 384 ? 14.680  19.981  -11.738 1.00 44.60 ? 384  ASP A CB  1 
ATOM   2897 C CG  . ASP A 1 384 ? 13.212  20.039  -12.230 1.00 48.82 ? 384  ASP A CG  1 
ATOM   2898 O OD1 . ASP A 1 384 ? 12.878  19.602  -13.364 1.00 49.11 ? 384  ASP A OD1 1 
ATOM   2899 O OD2 . ASP A 1 384 ? 12.376  20.580  -11.465 1.00 53.08 ? 384  ASP A OD2 1 
ATOM   2900 N N   . TRP A 1 385 ? 15.415  18.544  -14.982 1.00 45.52 ? 385  TRP A N   1 
ATOM   2901 C CA  . TRP A 1 385 ? 15.464  18.889  -16.415 1.00 46.49 ? 385  TRP A CA  1 
ATOM   2902 C C   . TRP A 1 385 ? 14.283  19.696  -17.005 1.00 47.15 ? 385  TRP A C   1 
ATOM   2903 O O   . TRP A 1 385 ? 14.390  20.200  -18.110 1.00 47.76 ? 385  TRP A O   1 
ATOM   2904 C CB  . TRP A 1 385 ? 15.916  17.725  -17.291 1.00 45.58 ? 385  TRP A CB  1 
ATOM   2905 C CG  . TRP A 1 385 ? 17.239  17.220  -16.840 1.00 45.36 ? 385  TRP A CG  1 
ATOM   2906 C CD1 . TRP A 1 385 ? 17.466  16.184  -15.990 1.00 44.81 ? 385  TRP A CD1 1 
ATOM   2907 C CD2 . TRP A 1 385 ? 18.519  17.738  -17.188 1.00 43.77 ? 385  TRP A CD2 1 
ATOM   2908 N NE1 . TRP A 1 385 ? 18.805  16.017  -15.789 1.00 44.20 ? 385  TRP A NE1 1 
ATOM   2909 C CE2 . TRP A 1 385 ? 19.479  16.959  -16.514 1.00 44.89 ? 385  TRP A CE2 1 
ATOM   2910 C CE3 . TRP A 1 385 ? 18.950  18.780  -18.011 1.00 45.42 ? 385  TRP A CE3 1 
ATOM   2911 C CZ2 . TRP A 1 385 ? 20.860  17.193  -16.627 1.00 45.49 ? 385  TRP A CZ2 1 
ATOM   2912 C CZ3 . TRP A 1 385 ? 20.322  19.019  -18.131 1.00 44.88 ? 385  TRP A CZ3 1 
ATOM   2913 C CH2 . TRP A 1 385 ? 21.260  18.232  -17.430 1.00 45.41 ? 385  TRP A CH2 1 
ATOM   2914 N N   . LEU A 1 386 ? 13.187  19.849  -16.273 1.00 48.30 ? 386  LEU A N   1 
ATOM   2915 C CA  . LEU A 1 386 ? 12.188  20.868  -16.648 1.00 49.76 ? 386  LEU A CA  1 
ATOM   2916 C C   . LEU A 1 386 ? 12.672  22.299  -16.347 1.00 50.37 ? 386  LEU A C   1 
ATOM   2917 O O   . LEU A 1 386 ? 12.380  23.238  -17.082 1.00 51.14 ? 386  LEU A O   1 
ATOM   2918 C CB  . LEU A 1 386 ? 10.880  20.656  -15.911 1.00 49.78 ? 386  LEU A CB  1 
ATOM   2919 C CG  . LEU A 1 386 ? 9.909   19.600  -16.405 1.00 52.07 ? 386  LEU A CG  1 
ATOM   2920 C CD1 . LEU A 1 386 ? 9.922   18.340  -15.492 1.00 52.81 ? 386  LEU A CD1 1 
ATOM   2921 C CD2 . LEU A 1 386 ? 8.547   20.247  -16.393 1.00 53.79 ? 386  LEU A CD2 1 
ATOM   2922 N N   . HIS A 1 387 ? 13.395  22.468  -15.248 1.00 50.57 ? 387  HIS A N   1 
ATOM   2923 C CA  . HIS A 1 387 ? 13.774  23.790  -14.810 1.00 50.67 ? 387  HIS A CA  1 
ATOM   2924 C C   . HIS A 1 387 ? 15.255  23.829  -14.474 1.00 49.63 ? 387  HIS A C   1 
ATOM   2925 O O   . HIS A 1 387 ? 15.604  24.172  -13.360 1.00 50.02 ? 387  HIS A O   1 
ATOM   2926 C CB  . HIS A 1 387 ? 12.950  24.179  -13.573 1.00 51.42 ? 387  HIS A CB  1 
ATOM   2927 C CG  . HIS A 1 387 ? 11.470  24.215  -13.805 1.00 54.18 ? 387  HIS A CG  1 
ATOM   2928 N ND1 . HIS A 1 387 ? 10.646  23.140  -13.529 1.00 56.44 ? 387  HIS A ND1 1 
ATOM   2929 C CD2 . HIS A 1 387 ? 10.660  25.203  -14.265 1.00 57.42 ? 387  HIS A CD2 1 
ATOM   2930 C CE1 . HIS A 1 387 ? 9.394   23.462  -13.814 1.00 57.78 ? 387  HIS A CE1 1 
ATOM   2931 N NE2 . HIS A 1 387 ? 9.374   24.707  -14.265 1.00 58.63 ? 387  HIS A NE2 1 
ATOM   2932 N N   . PRO A 1 388 ? 16.136  23.508  -15.439 1.00 48.74 ? 388  PRO A N   1 
ATOM   2933 C CA  . PRO A 1 388 ? 17.529  23.199  -15.082 1.00 47.82 ? 388  PRO A CA  1 
ATOM   2934 C C   . PRO A 1 388 ? 18.351  24.383  -14.621 1.00 47.07 ? 388  PRO A C   1 
ATOM   2935 O O   . PRO A 1 388 ? 19.442  24.187  -14.092 1.00 47.61 ? 388  PRO A O   1 
ATOM   2936 C CB  . PRO A 1 388 ? 18.123  22.620  -16.381 1.00 47.76 ? 388  PRO A CB  1 
ATOM   2937 C CG  . PRO A 1 388 ? 17.274  23.118  -17.467 1.00 47.98 ? 388  PRO A CG  1 
ATOM   2938 C CD  . PRO A 1 388 ? 15.903  23.433  -16.895 1.00 48.80 ? 388  PRO A CD  1 
ATOM   2939 N N   . GLU A 1 389 ? 17.828  25.590  -14.811 1.00 46.35 ? 389  GLU A N   1 
ATOM   2940 C CA  . GLU A 1 389 ? 18.545  26.825  -14.507 1.00 45.74 ? 389  GLU A CA  1 
ATOM   2941 C C   . GLU A 1 389 ? 17.916  27.511  -13.317 1.00 44.53 ? 389  GLU A C   1 
ATOM   2942 O O   . GLU A 1 389 ? 18.374  28.583  -12.900 1.00 44.25 ? 389  GLU A O   1 
ATOM   2943 C CB  . GLU A 1 389 ? 18.505  27.786  -15.697 1.00 46.40 ? 389  GLU A CB  1 
ATOM   2944 C CG  . GLU A 1 389 ? 19.257  27.313  -16.965 1.00 50.32 ? 389  GLU A CG  1 
ATOM   2945 C CD  . GLU A 1 389 ? 20.733  27.740  -17.002 1.00 55.17 ? 389  GLU A CD  1 
ATOM   2946 O OE1 . GLU A 1 389 ? 21.274  28.325  -16.024 1.00 56.55 ? 389  GLU A OE1 1 
ATOM   2947 O OE2 . GLU A 1 389 ? 21.366  27.485  -18.037 1.00 58.44 ? 389  GLU A OE2 1 
ATOM   2948 N N   . ASP A 1 390 ? 16.870  26.890  -12.776 1.00 42.84 ? 390  ASP A N   1 
ATOM   2949 C CA  . ASP A 1 390 ? 16.075  27.479  -11.703 1.00 41.84 ? 390  ASP A CA  1 
ATOM   2950 C C   . ASP A 1 390 ? 16.839  27.535  -10.363 1.00 41.23 ? 390  ASP A C   1 
ATOM   2951 O O   . ASP A 1 390 ? 17.182  26.509  -9.785  1.00 40.31 ? 390  ASP A O   1 
ATOM   2952 C CB  . ASP A 1 390 ? 14.712  26.776  -11.577 1.00 41.16 ? 390  ASP A CB  1 
ATOM   2953 C CG  . ASP A 1 390 ? 13.938  27.233  -10.378 1.00 41.61 ? 390  ASP A CG  1 
ATOM   2954 O OD1 . ASP A 1 390 ? 13.021  28.059  -10.504 1.00 45.46 ? 390  ASP A OD1 1 
ATOM   2955 O OD2 . ASP A 1 390 ? 14.253  26.794  -9.275  1.00 42.95 ? 390  ASP A OD2 1 
ATOM   2956 N N   . PRO A 1 391 ? 17.101  28.750  -9.876  1.00 40.93 ? 391  PRO A N   1 
ATOM   2957 C CA  . PRO A 1 391 ? 17.975  28.956  -8.732  1.00 41.17 ? 391  PRO A CA  1 
ATOM   2958 C C   . PRO A 1 391 ? 17.481  28.418  -7.404  1.00 41.38 ? 391  PRO A C   1 
ATOM   2959 O O   . PRO A 1 391 ? 18.306  28.008  -6.587  1.00 41.33 ? 391  PRO A O   1 
ATOM   2960 C CB  . PRO A 1 391 ? 18.141  30.480  -8.678  1.00 41.42 ? 391  PRO A CB  1 
ATOM   2961 C CG  . PRO A 1 391 ? 16.951  31.011  -9.363  1.00 41.41 ? 391  PRO A CG  1 
ATOM   2962 C CD  . PRO A 1 391 ? 16.635  30.020  -10.447 1.00 40.74 ? 391  PRO A CD  1 
ATOM   2963 N N   . THR A 1 392 ? 16.168  28.424  -7.169  1.00 41.31 ? 392  THR A N   1 
ATOM   2964 C CA  . THR A 1 392 ? 15.651  27.809  -5.965  1.00 40.65 ? 392  THR A CA  1 
ATOM   2965 C C   . THR A 1 392 ? 15.881  26.288  -5.996  1.00 40.52 ? 392  THR A C   1 
ATOM   2966 O O   . THR A 1 392 ? 16.244  25.705  -4.979  1.00 40.69 ? 392  THR A O   1 
ATOM   2967 C CB  . THR A 1 392 ? 14.168  28.156  -5.733  1.00 41.17 ? 392  THR A CB  1 
ATOM   2968 O OG1 . THR A 1 392 ? 14.070  29.517  -5.303  1.00 42.93 ? 392  THR A OG1 1 
ATOM   2969 C CG2 . THR A 1 392 ? 13.526  27.253  -4.640  1.00 39.63 ? 392  THR A CG2 1 
ATOM   2970 N N   . HIS A 1 393 ? 15.664  25.640  -7.139  1.00 39.93 ? 393  HIS A N   1 
ATOM   2971 C CA  . HIS A 1 393 ? 15.843  24.200  -7.196  1.00 40.13 ? 393  HIS A CA  1 
ATOM   2972 C C   . HIS A 1 393 ? 17.307  23.860  -7.002  1.00 39.26 ? 393  HIS A C   1 
ATOM   2973 O O   . HIS A 1 393 ? 17.622  22.988  -6.217  1.00 39.70 ? 393  HIS A O   1 
ATOM   2974 C CB  . HIS A 1 393 ? 15.359  23.569  -8.496  1.00 40.43 ? 393  HIS A CB  1 
ATOM   2975 C CG  . HIS A 1 393 ? 15.805  22.138  -8.651  1.00 45.40 ? 393  HIS A CG  1 
ATOM   2976 N ND1 . HIS A 1 393 ? 15.209  21.088  -7.970  1.00 49.24 ? 393  HIS A ND1 1 
ATOM   2977 C CD2 . HIS A 1 393 ? 16.821  21.587  -9.365  1.00 46.25 ? 393  HIS A CD2 1 
ATOM   2978 C CE1 . HIS A 1 393 ? 15.816  19.955  -8.287  1.00 47.73 ? 393  HIS A CE1 1 
ATOM   2979 N NE2 . HIS A 1 393 ? 16.798  20.232  -9.128  1.00 47.19 ? 393  HIS A NE2 1 
ATOM   2980 N N   . LEU A 1 394 ? 18.183  24.574  -7.710  1.00 38.31 ? 394  LEU A N   1 
ATOM   2981 C CA  . LEU A 1 394 ? 19.621  24.399  -7.625  1.00 37.07 ? 394  LEU A CA  1 
ATOM   2982 C C   . LEU A 1 394 ? 20.097  24.528  -6.189  1.00 37.18 ? 394  LEU A C   1 
ATOM   2983 O O   . LEU A 1 394 ? 20.806  23.659  -5.671  1.00 36.90 ? 394  LEU A O   1 
ATOM   2984 C CB  . LEU A 1 394 ? 20.328  25.400  -8.535  1.00 36.63 ? 394  LEU A CB  1 
ATOM   2985 C CG  . LEU A 1 394 ? 20.054  25.170  -10.027 1.00 34.95 ? 394  LEU A CG  1 
ATOM   2986 C CD1 . LEU A 1 394 ? 20.506  26.356  -10.881 1.00 29.94 ? 394  LEU A CD1 1 
ATOM   2987 C CD2 . LEU A 1 394 ? 20.640  23.822  -10.515 1.00 32.01 ? 394  LEU A CD2 1 
ATOM   2988 N N   . ARG A 1 395 ? 19.670  25.593  -5.530  1.00 37.08 ? 395  ARG A N   1 
ATOM   2989 C CA  . ARG A 1 395 ? 20.024  25.777  -4.143  1.00 37.37 ? 395  ARG A CA  1 
ATOM   2990 C C   . ARG A 1 395 ? 19.637  24.551  -3.301  1.00 38.05 ? 395  ARG A C   1 
ATOM   2991 O O   . ARG A 1 395 ? 20.461  24.053  -2.530  1.00 38.98 ? 395  ARG A O   1 
ATOM   2992 C CB  . ARG A 1 395 ? 19.386  27.032  -3.605  1.00 36.97 ? 395  ARG A CB  1 
ATOM   2993 C CG  . ARG A 1 395 ? 19.620  27.223  -2.142  1.00 36.77 ? 395  ARG A CG  1 
ATOM   2994 C CD  . ARG A 1 395 ? 18.346  26.963  -1.426  1.00 38.14 ? 395  ARG A CD  1 
ATOM   2995 N NE  . ARG A 1 395 ? 17.595  28.195  -1.284  1.00 37.96 ? 395  ARG A NE  1 
ATOM   2996 C CZ  . ARG A 1 395 ? 16.269  28.279  -1.203  1.00 37.53 ? 395  ARG A CZ  1 
ATOM   2997 N NH1 . ARG A 1 395 ? 15.490  27.192  -1.280  1.00 31.95 ? 395  ARG A NH1 1 
ATOM   2998 N NH2 . ARG A 1 395 ? 15.733  29.483  -1.043  1.00 37.57 ? 395  ARG A NH2 1 
ATOM   2999 N N   . ASP A 1 396 ? 18.417  24.043  -3.480  1.00 37.32 ? 396  ASP A N   1 
ATOM   3000 C CA  . ASP A 1 396 ? 17.964  22.843  -2.769  1.00 37.00 ? 396  ASP A CA  1 
ATOM   3001 C C   . ASP A 1 396 ? 18.641  21.562  -3.233  1.00 36.51 ? 396  ASP A C   1 
ATOM   3002 O O   . ASP A 1 396 ? 18.839  20.641  -2.451  1.00 36.75 ? 396  ASP A O   1 
ATOM   3003 C CB  . ASP A 1 396 ? 16.440  22.717  -2.852  1.00 36.06 ? 396  ASP A CB  1 
ATOM   3004 C CG  . ASP A 1 396 ? 15.744  23.865  -2.140  1.00 37.61 ? 396  ASP A CG  1 
ATOM   3005 O OD1 . ASP A 1 396 ? 16.397  24.518  -1.277  1.00 37.89 ? 396  ASP A OD1 1 
ATOM   3006 O OD2 . ASP A 1 396 ? 14.563  24.138  -2.439  1.00 38.68 ? 396  ASP A OD2 1 
ATOM   3007 N N   . ALA A 1 397 ? 18.991  21.493  -4.504  1.00 36.30 ? 397  ALA A N   1 
ATOM   3008 C CA  . ALA A 1 397 ? 19.637  20.303  -5.005  1.00 36.66 ? 397  ALA A CA  1 
ATOM   3009 C C   . ALA A 1 397 ? 21.058  20.216  -4.422  1.00 37.11 ? 397  ALA A C   1 
ATOM   3010 O O   . ALA A 1 397 ? 21.544  19.125  -4.087  1.00 37.97 ? 397  ALA A O   1 
ATOM   3011 C CB  . ALA A 1 397 ? 19.643  20.289  -6.525  1.00 36.45 ? 397  ALA A CB  1 
ATOM   3012 N N   . MET A 1 398 ? 21.695  21.371  -4.243  1.00 36.72 ? 398  MET A N   1 
ATOM   3013 C CA  . MET A 1 398 ? 23.021  21.414  -3.646  1.00 36.19 ? 398  MET A CA  1 
ATOM   3014 C C   . MET A 1 398 ? 22.964  20.872  -2.218  1.00 35.90 ? 398  MET A C   1 
ATOM   3015 O O   . MET A 1 398 ? 23.863  20.116  -1.805  1.00 36.15 ? 398  MET A O   1 
ATOM   3016 C CB  . MET A 1 398 ? 23.606  22.838  -3.665  1.00 36.13 ? 398  MET A CB  1 
ATOM   3017 C CG  . MET A 1 398 ? 25.072  22.931  -3.254  1.00 34.65 ? 398  MET A CG  1 
ATOM   3018 S SD  . MET A 1 398 ? 26.077  22.150  -4.499  1.00 36.25 ? 398  MET A SD  1 
ATOM   3019 C CE  . MET A 1 398 ? 26.639  20.689  -3.646  1.00 34.18 ? 398  MET A CE  1 
ATOM   3020 N N   . SER A 1 399 ? 21.934  21.273  -1.476  1.00 34.20 ? 399  SER A N   1 
ATOM   3021 C CA  . SER A 1 399 ? 21.740  20.782  -0.132  1.00 34.01 ? 399  SER A CA  1 
ATOM   3022 C C   . SER A 1 399 ? 21.536  19.264  -0.143  1.00 34.68 ? 399  SER A C   1 
ATOM   3023 O O   . SER A 1 399 ? 22.195  18.534  0.615   1.00 35.29 ? 399  SER A O   1 
ATOM   3024 C CB  . SER A 1 399 ? 20.552  21.466  0.504   1.00 33.62 ? 399  SER A CB  1 
ATOM   3025 O OG  . SER A 1 399 ? 20.391  21.109  1.867   1.00 34.23 ? 399  SER A OG  1 
ATOM   3026 N N   . ALA A 1 400 ? 20.678  18.789  -1.046  1.00 34.56 ? 400  ALA A N   1 
ATOM   3027 C CA  . ALA A 1 400 ? 20.370  17.367  -1.168  1.00 34.38 ? 400  ALA A CA  1 
ATOM   3028 C C   . ALA A 1 400 ? 21.621  16.523  -1.473  1.00 34.14 ? 400  ALA A C   1 
ATOM   3029 O O   . ALA A 1 400 ? 21.830  15.478  -0.855  1.00 33.53 ? 400  ALA A O   1 
ATOM   3030 C CB  . ALA A 1 400 ? 19.276  17.142  -2.215  1.00 34.22 ? 400  ALA A CB  1 
ATOM   3031 N N   . VAL A 1 401 ? 22.440  16.982  -2.421  1.00 34.24 ? 401  VAL A N   1 
ATOM   3032 C CA  . VAL A 1 401 ? 23.699  16.288  -2.784  1.00 34.17 ? 401  VAL A CA  1 
ATOM   3033 C C   . VAL A 1 401 ? 24.565  16.063  -1.552  1.00 33.79 ? 401  VAL A C   1 
ATOM   3034 O O   . VAL A 1 401 ? 24.970  14.943  -1.281  1.00 33.31 ? 401  VAL A O   1 
ATOM   3035 C CB  . VAL A 1 401 ? 24.529  17.094  -3.829  1.00 35.00 ? 401  VAL A CB  1 
ATOM   3036 C CG1 . VAL A 1 401 ? 25.917  16.481  -4.010  1.00 32.00 ? 401  VAL A CG1 1 
ATOM   3037 C CG2 . VAL A 1 401 ? 23.755  17.189  -5.171  1.00 35.16 ? 401  VAL A CG2 1 
ATOM   3038 N N   . VAL A 1 402 ? 24.779  17.120  -0.775  1.00 33.38 ? 402  VAL A N   1 
ATOM   3039 C CA  . VAL A 1 402 ? 25.655  17.046  0.373   1.00 33.84 ? 402  VAL A CA  1 
ATOM   3040 C C   . VAL A 1 402 ? 25.049  16.169  1.468   1.00 34.66 ? 402  VAL A C   1 
ATOM   3041 O O   . VAL A 1 402 ? 25.706  15.254  1.992   1.00 34.82 ? 402  VAL A O   1 
ATOM   3042 C CB  . VAL A 1 402 ? 25.967  18.440  0.874   1.00 34.21 ? 402  VAL A CB  1 
ATOM   3043 C CG1 . VAL A 1 402 ? 26.657  18.395  2.224   1.00 34.12 ? 402  VAL A CG1 1 
ATOM   3044 C CG2 . VAL A 1 402 ? 26.799  19.185  -0.172  1.00 32.20 ? 402  VAL A CG2 1 
ATOM   3045 N N   . GLY A 1 403 ? 23.772  16.416  1.759   1.00 35.31 ? 403  GLY A N   1 
ATOM   3046 C CA  . GLY A 1 403 ? 23.014  15.639  2.724   1.00 34.93 ? 403  GLY A CA  1 
ATOM   3047 C C   . GLY A 1 403 ? 22.933  14.181  2.365   1.00 35.82 ? 403  GLY A C   1 
ATOM   3048 O O   . GLY A 1 403 ? 23.148  13.337  3.229   1.00 36.36 ? 403  GLY A O   1 
ATOM   3049 N N   . ASP A 1 404 ? 22.623  13.869  1.102   1.00 35.90 ? 404  ASP A N   1 
ATOM   3050 C CA  . ASP A 1 404 ? 22.444  12.471  0.679   1.00 35.91 ? 404  ASP A CA  1 
ATOM   3051 C C   . ASP A 1 404 ? 23.743  11.708  0.704   1.00 36.35 ? 404  ASP A C   1 
ATOM   3052 O O   . ASP A 1 404 ? 23.816  10.627  1.252   1.00 37.54 ? 404  ASP A O   1 
ATOM   3053 C CB  . ASP A 1 404 ? 21.850  12.367  -0.731  1.00 35.76 ? 404  ASP A CB  1 
ATOM   3054 C CG  . ASP A 1 404 ? 20.433  12.922  -0.823  1.00 36.65 ? 404  ASP A CG  1 
ATOM   3055 O OD1 . ASP A 1 404 ? 19.735  13.098  0.223   1.00 36.10 ? 404  ASP A OD1 1 
ATOM   3056 O OD2 . ASP A 1 404 ? 20.030  13.210  -1.965  1.00 37.06 ? 404  ASP A OD2 1 
ATOM   3057 N N   . HIS A 1 405 ? 24.766  12.274  0.092   1.00 36.23 ? 405  HIS A N   1 
ATOM   3058 C CA  . HIS A 1 405 ? 26.071  11.655  -0.003  1.00 35.90 ? 405  HIS A CA  1 
ATOM   3059 C C   . HIS A 1 405 ? 26.676  11.336  1.354   1.00 35.93 ? 405  HIS A C   1 
ATOM   3060 O O   . HIS A 1 405 ? 27.265  10.259  1.528   1.00 36.68 ? 405  HIS A O   1 
ATOM   3061 C CB  . HIS A 1 405 ? 26.985  12.604  -0.774  1.00 35.85 ? 405  HIS A CB  1 
ATOM   3062 C CG  . HIS A 1 405 ? 28.408  12.165  -0.864  1.00 36.17 ? 405  HIS A CG  1 
ATOM   3063 N ND1 . HIS A 1 405 ? 28.772  10.883  -1.217  1.00 36.51 ? 405  HIS A ND1 1 
ATOM   3064 C CD2 . HIS A 1 405 ? 29.562  12.858  -0.699  1.00 34.95 ? 405  HIS A CD2 1 
ATOM   3065 C CE1 . HIS A 1 405 ? 30.092  10.806  -1.264  1.00 36.56 ? 405  HIS A CE1 1 
ATOM   3066 N NE2 . HIS A 1 405 ? 30.593  11.989  -0.954  1.00 35.38 ? 405  HIS A NE2 1 
ATOM   3067 N N   . ASN A 1 406 ? 26.529  12.254  2.315   1.00 35.58 ? 406  ASN A N   1 
ATOM   3068 C CA  . ASN A 1 406 ? 27.266  12.154  3.593   1.00 34.93 ? 406  ASN A CA  1 
ATOM   3069 C C   . ASN A 1 406 ? 26.483  11.510  4.703   1.00 34.82 ? 406  ASN A C   1 
ATOM   3070 O O   . ASN A 1 406 ? 27.061  10.922  5.613   1.00 34.26 ? 406  ASN A O   1 
ATOM   3071 C CB  . ASN A 1 406 ? 27.740  13.531  4.062   1.00 34.75 ? 406  ASN A CB  1 
ATOM   3072 C CG  . ASN A 1 406 ? 28.841  14.107  3.175   1.00 34.81 ? 406  ASN A CG  1 
ATOM   3073 O OD1 . ASN A 1 406 ? 29.958  13.614  3.141   1.00 37.67 ? 406  ASN A OD1 1 
ATOM   3074 N ND2 . ASN A 1 406 ? 28.518  15.146  2.460   1.00 34.55 ? 406  ASN A ND2 1 
ATOM   3075 N N   . VAL A 1 407 ? 25.159  11.636  4.638   1.00 35.21 ? 407  VAL A N   1 
ATOM   3076 C CA  . VAL A 1 407 ? 24.306  11.183  5.734   1.00 35.50 ? 407  VAL A CA  1 
ATOM   3077 C C   . VAL A 1 407 ? 23.177  10.287  5.294   1.00 36.41 ? 407  VAL A C   1 
ATOM   3078 O O   . VAL A 1 407 ? 23.185  9.117   5.676   1.00 36.82 ? 407  VAL A O   1 
ATOM   3079 C CB  . VAL A 1 407 ? 23.728  12.339  6.572   1.00 35.08 ? 407  VAL A CB  1 
ATOM   3080 C CG1 . VAL A 1 407 ? 22.913  11.782  7.712   1.00 33.49 ? 407  VAL A CG1 1 
ATOM   3081 C CG2 . VAL A 1 407 ? 24.845  13.231  7.099   1.00 34.56 ? 407  VAL A CG2 1 
ATOM   3082 N N   . VAL A 1 408 ? 22.212  10.809  4.508   1.00 37.19 ? 408  VAL A N   1 
ATOM   3083 C CA  . VAL A 1 408 ? 20.976  10.063  4.234   1.00 37.30 ? 408  VAL A CA  1 
ATOM   3084 C C   . VAL A 1 408 ? 21.261  8.701   3.594   1.00 38.46 ? 408  VAL A C   1 
ATOM   3085 O O   . VAL A 1 408 ? 20.686  7.701   4.026   1.00 39.13 ? 408  VAL A O   1 
ATOM   3086 C CB  . VAL A 1 408 ? 19.921  10.846  3.426   1.00 37.59 ? 408  VAL A CB  1 
ATOM   3087 C CG1 . VAL A 1 408 ? 18.627  10.008  3.279   1.00 37.29 ? 408  VAL A CG1 1 
ATOM   3088 C CG2 . VAL A 1 408 ? 19.573  12.195  4.098   1.00 37.49 ? 408  VAL A CG2 1 
ATOM   3089 N N   . CYS A 1 409 ? 22.166  8.645   2.611   1.00 38.77 ? 409  CYS A N   1 
ATOM   3090 C CA  . CYS A 1 409 ? 22.457  7.392   1.947   1.00 39.70 ? 409  CYS A CA  1 
ATOM   3091 C C   . CYS A 1 409 ? 23.332  6.413   2.748   1.00 40.19 ? 409  CYS A C   1 
ATOM   3092 O O   . CYS A 1 409 ? 23.017  5.217   2.785   1.00 40.69 ? 409  CYS A O   1 
ATOM   3093 C CB  . CYS A 1 409 ? 22.950  7.606   0.527   1.00 39.99 ? 409  CYS A CB  1 
ATOM   3094 S SG  . CYS A 1 409 ? 21.630  8.323   -0.475  1.00 42.47 ? 409  CYS A SG  1 
ATOM   3095 N N   . PRO A 1 410 ? 24.428  6.894   3.378   1.00 39.70 ? 410  PRO A N   1 
ATOM   3096 C CA  . PRO A 1 410 ? 25.081  6.123   4.437   1.00 38.96 ? 410  PRO A CA  1 
ATOM   3097 C C   . PRO A 1 410 ? 24.131  5.524   5.491   1.00 38.32 ? 410  PRO A C   1 
ATOM   3098 O O   . PRO A 1 410 ? 24.287  4.353   5.859   1.00 37.92 ? 410  PRO A O   1 
ATOM   3099 C CB  . PRO A 1 410 ? 25.992  7.164   5.071   1.00 38.27 ? 410  PRO A CB  1 
ATOM   3100 C CG  . PRO A 1 410 ? 26.411  7.935   3.917   1.00 39.27 ? 410  PRO A CG  1 
ATOM   3101 C CD  . PRO A 1 410 ? 25.176  8.130   3.109   1.00 39.43 ? 410  PRO A CD  1 
ATOM   3102 N N   . VAL A 1 411 ? 23.168  6.310   5.973   1.00 38.09 ? 411  VAL A N   1 
ATOM   3103 C CA  . VAL A 1 411 ? 22.209  5.807   6.948   1.00 38.31 ? 411  VAL A CA  1 
ATOM   3104 C C   . VAL A 1 411 ? 21.396  4.684   6.328   1.00 38.72 ? 411  VAL A C   1 
ATOM   3105 O O   . VAL A 1 411 ? 21.247  3.638   6.944   1.00 39.30 ? 411  VAL A O   1 
ATOM   3106 C CB  . VAL A 1 411 ? 21.294  6.893   7.517   1.00 38.21 ? 411  VAL A CB  1 
ATOM   3107 C CG1 . VAL A 1 411 ? 20.117  6.272   8.200   1.00 37.61 ? 411  VAL A CG1 1 
ATOM   3108 C CG2 . VAL A 1 411 ? 22.050  7.762   8.489   1.00 37.68 ? 411  VAL A CG2 1 
ATOM   3109 N N   . ALA A 1 412 ? 20.917  4.861   5.102   1.00 39.43 ? 412  ALA A N   1 
ATOM   3110 C CA  . ALA A 1 412 ? 20.200  3.765   4.414   1.00 40.67 ? 412  ALA A CA  1 
ATOM   3111 C C   . ALA A 1 412 ? 21.093  2.515   4.208   1.00 40.86 ? 412  ALA A C   1 
ATOM   3112 O O   . ALA A 1 412 ? 20.715  1.431   4.600   1.00 41.49 ? 412  ALA A O   1 
ATOM   3113 C CB  . ALA A 1 412 ? 19.575  4.247   3.101   1.00 40.15 ? 412  ALA A CB  1 
ATOM   3114 N N   . GLN A 1 413 ? 22.277  2.673   3.638   1.00 42.07 ? 413  GLN A N   1 
ATOM   3115 C CA  . GLN A 1 413 ? 23.256  1.577   3.538   1.00 42.96 ? 413  GLN A CA  1 
ATOM   3116 C C   . GLN A 1 413 ? 23.377  0.846   4.900   1.00 43.36 ? 413  GLN A C   1 
ATOM   3117 O O   . GLN A 1 413 ? 23.168  -0.371  4.974   1.00 42.95 ? 413  GLN A O   1 
ATOM   3118 C CB  . GLN A 1 413 ? 24.597  2.124   2.996   1.00 43.25 ? 413  GLN A CB  1 
ATOM   3119 C CG  . GLN A 1 413 ? 25.819  1.195   2.943   1.00 44.94 ? 413  GLN A CG  1 
ATOM   3120 C CD  . GLN A 1 413 ? 25.706  0.088   1.889   1.00 54.17 ? 413  GLN A CD  1 
ATOM   3121 O OE1 . GLN A 1 413 ? 24.963  0.211   0.893   1.00 57.75 ? 413  GLN A OE1 1 
ATOM   3122 N NE2 . GLN A 1 413 ? 26.438  -1.016  2.111   1.00 54.90 ? 413  GLN A NE2 1 
ATOM   3123 N N   . LEU A 1 414 ? 23.630  1.595   5.983   1.00 43.50 ? 414  LEU A N   1 
ATOM   3124 C CA  . LEU A 1 414 ? 23.696  1.004   7.327   1.00 42.85 ? 414  LEU A CA  1 
ATOM   3125 C C   . LEU A 1 414 ? 22.407  0.291   7.779   1.00 43.24 ? 414  LEU A C   1 
ATOM   3126 O O   . LEU A 1 414 ? 22.473  -0.868  8.195   1.00 42.86 ? 414  LEU A O   1 
ATOM   3127 C CB  . LEU A 1 414 ? 24.146  2.033   8.374   1.00 42.60 ? 414  LEU A CB  1 
ATOM   3128 C CG  . LEU A 1 414 ? 24.282  1.535   9.823   1.00 41.93 ? 414  LEU A CG  1 
ATOM   3129 C CD1 . LEU A 1 414 ? 25.513  0.669   10.014  1.00 41.53 ? 414  LEU A CD1 1 
ATOM   3130 C CD2 . LEU A 1 414 ? 24.309  2.683   10.801  1.00 42.03 ? 414  LEU A CD2 1 
ATOM   3131 N N   . ALA A 1 415 ? 21.258  0.976   7.717   1.00 43.43 ? 415  ALA A N   1 
ATOM   3132 C CA  . ALA A 1 415 ? 19.962  0.386   8.118   1.00 44.00 ? 415  ALA A CA  1 
ATOM   3133 C C   . ALA A 1 415 ? 19.676  -0.919  7.369   1.00 44.95 ? 415  ALA A C   1 
ATOM   3134 O O   . ALA A 1 415 ? 19.239  -1.908  7.967   1.00 44.48 ? 415  ALA A O   1 
ATOM   3135 C CB  . ALA A 1 415 ? 18.811  1.372   7.912   1.00 43.17 ? 415  ALA A CB  1 
ATOM   3136 N N   . GLY A 1 416 ? 19.916  -0.901  6.056   1.00 46.02 ? 416  GLY A N   1 
ATOM   3137 C CA  . GLY A 1 416 ? 19.804  -2.083  5.214   1.00 47.48 ? 416  GLY A CA  1 
ATOM   3138 C C   . GLY A 1 416 ? 20.682  -3.240  5.667   1.00 48.48 ? 416  GLY A C   1 
ATOM   3139 O O   . GLY A 1 416 ? 20.188  -4.330  5.959   1.00 48.67 ? 416  GLY A O   1 
ATOM   3140 N N   . ARG A 1 417 ? 21.987  -3.011  5.738   1.00 49.42 ? 417  ARG A N   1 
ATOM   3141 C CA  . ARG A 1 417 ? 22.909  -4.095  6.045   1.00 50.44 ? 417  ARG A CA  1 
ATOM   3142 C C   . ARG A 1 417 ? 22.617  -4.690  7.412   1.00 50.70 ? 417  ARG A C   1 
ATOM   3143 O O   . ARG A 1 417 ? 22.531  -5.909  7.548   1.00 50.81 ? 417  ARG A O   1 
ATOM   3144 C CB  . ARG A 1 417 ? 24.369  -3.654  5.904   1.00 50.74 ? 417  ARG A CB  1 
ATOM   3145 C CG  . ARG A 1 417 ? 24.772  -3.268  4.475   1.00 53.14 ? 417  ARG A CG  1 
ATOM   3146 C CD  . ARG A 1 417 ? 24.127  -4.174  3.398   1.00 60.23 ? 417  ARG A CD  1 
ATOM   3147 N NE  . ARG A 1 417 ? 24.883  -5.414  3.158   1.00 64.60 ? 417  ARG A NE  1 
ATOM   3148 C CZ  . ARG A 1 417 ? 25.552  -5.696  2.032   1.00 67.46 ? 417  ARG A CZ  1 
ATOM   3149 N NH1 . ARG A 1 417 ? 25.580  -4.832  1.011   1.00 67.85 ? 417  ARG A NH1 1 
ATOM   3150 N NH2 . ARG A 1 417 ? 26.215  -6.846  1.927   1.00 68.28 ? 417  ARG A NH2 1 
ATOM   3151 N N   . LEU A 1 418 ? 22.426  -3.823  8.407   1.00 51.08 ? 418  LEU A N   1 
ATOM   3152 C CA  . LEU A 1 418 ? 22.040  -4.235  9.759   1.00 50.89 ? 418  LEU A CA  1 
ATOM   3153 C C   . LEU A 1 418 ? 20.752  -5.095  9.802   1.00 51.16 ? 418  LEU A C   1 
ATOM   3154 O O   . LEU A 1 418 ? 20.771  -6.215  10.326  1.00 50.70 ? 418  LEU A O   1 
ATOM   3155 C CB  . LEU A 1 418 ? 21.941  -3.008  10.681  1.00 50.94 ? 418  LEU A CB  1 
ATOM   3156 C CG  . LEU A 1 418 ? 23.081  -2.668  11.664  1.00 50.92 ? 418  LEU A CG  1 
ATOM   3157 C CD1 . LEU A 1 418 ? 24.461  -2.998  11.126  1.00 51.50 ? 418  LEU A CD1 1 
ATOM   3158 C CD2 . LEU A 1 418 ? 23.011  -1.213  12.098  1.00 50.44 ? 418  LEU A CD2 1 
ATOM   3159 N N   . ALA A 1 419 ? 19.653  -4.602  9.238   1.00 51.39 ? 419  ALA A N   1 
ATOM   3160 C CA  . ALA A 1 419 ? 18.421  -5.398  9.185   1.00 52.20 ? 419  ALA A CA  1 
ATOM   3161 C C   . ALA A 1 419 ? 18.641  -6.810  8.553   1.00 53.12 ? 419  ALA A C   1 
ATOM   3162 O O   . ALA A 1 419 ? 18.181  -7.825  9.097   1.00 53.68 ? 419  ALA A O   1 
ATOM   3163 C CB  . ALA A 1 419 ? 17.323  -4.640  8.470   1.00 51.76 ? 419  ALA A CB  1 
ATOM   3164 N N   . ALA A 1 420 ? 19.376  -6.875  7.444   1.00 53.43 ? 420  ALA A N   1 
ATOM   3165 C CA  . ALA A 1 420 ? 19.646  -8.138  6.772   1.00 53.66 ? 420  ALA A CA  1 
ATOM   3166 C C   . ALA A 1 420 ? 20.546  -9.064  7.575   1.00 54.26 ? 420  ALA A C   1 
ATOM   3167 O O   . ALA A 1 420 ? 20.507  -10.271 7.359   1.00 54.53 ? 420  ALA A O   1 
ATOM   3168 C CB  . ALA A 1 420 ? 20.243  -7.893  5.397   1.00 53.47 ? 420  ALA A CB  1 
ATOM   3169 N N   . GLN A 1 421 ? 21.376  -8.510  8.467   1.00 54.48 ? 421  GLN A N   1 
ATOM   3170 C CA  . GLN A 1 421 ? 22.272  -9.323  9.311   1.00 54.64 ? 421  GLN A CA  1 
ATOM   3171 C C   . GLN A 1 421 ? 21.660  -9.643  10.681  1.00 53.97 ? 421  GLN A C   1 
ATOM   3172 O O   . GLN A 1 421 ? 22.380  -9.986  11.619  1.00 53.42 ? 421  GLN A O   1 
ATOM   3173 C CB  . GLN A 1 421 ? 23.639  -8.637  9.515   1.00 55.37 ? 421  GLN A CB  1 
ATOM   3174 C CG  . GLN A 1 421 ? 24.763  -8.997  8.540   1.00 57.45 ? 421  GLN A CG  1 
ATOM   3175 C CD  . GLN A 1 421 ? 24.449  -8.589  7.126   1.00 61.91 ? 421  GLN A CD  1 
ATOM   3176 O OE1 . GLN A 1 421 ? 23.476  -9.069  6.552   1.00 64.15 ? 421  GLN A OE1 1 
ATOM   3177 N NE2 . GLN A 1 421 ? 25.262  -7.692  6.548   1.00 62.14 ? 421  GLN A NE2 1 
ATOM   3178 N N   . GLY A 1 422 ? 20.340  -9.480  10.792  1.00 53.76 ? 422  GLY A N   1 
ATOM   3179 C CA  . GLY A 1 422 ? 19.569  -9.937  11.958  1.00 53.01 ? 422  GLY A CA  1 
ATOM   3180 C C   . GLY A 1 422 ? 19.452  -8.995  13.141  1.00 52.61 ? 422  GLY A C   1 
ATOM   3181 O O   . GLY A 1 422 ? 19.419  -9.439  14.296  1.00 53.32 ? 422  GLY A O   1 
ATOM   3182 N N   . ALA A 1 423 ? 19.389  -7.698  12.871  1.00 51.53 ? 423  ALA A N   1 
ATOM   3183 C CA  . ALA A 1 423 ? 19.320  -6.727  13.939  1.00 50.30 ? 423  ALA A CA  1 
ATOM   3184 C C   . ALA A 1 423 ? 17.940  -6.176  13.887  1.00 49.67 ? 423  ALA A C   1 
ATOM   3185 O O   . ALA A 1 423 ? 17.277  -6.277  12.864  1.00 49.10 ? 423  ALA A O   1 
ATOM   3186 C CB  . ALA A 1 423 ? 20.337  -5.622  13.727  1.00 50.53 ? 423  ALA A CB  1 
ATOM   3187 N N   . ARG A 1 424 ? 17.496  -5.607  14.994  1.00 49.20 ? 424  ARG A N   1 
ATOM   3188 C CA  . ARG A 1 424 ? 16.229  -4.928  14.997  1.00 49.13 ? 424  ARG A CA  1 
ATOM   3189 C C   . ARG A 1 424 ? 16.550  -3.468  14.805  1.00 48.30 ? 424  ARG A C   1 
ATOM   3190 O O   . ARG A 1 424 ? 17.288  -2.881  15.609  1.00 48.32 ? 424  ARG A O   1 
ATOM   3191 C CB  . ARG A 1 424 ? 15.476  -5.151  16.300  1.00 49.47 ? 424  ARG A CB  1 
ATOM   3192 C CG  . ARG A 1 424 ? 13.974  -4.945  16.150  1.00 51.92 ? 424  ARG A CG  1 
ATOM   3193 C CD  . ARG A 1 424 ? 13.215  -5.876  17.099  1.00 58.00 ? 424  ARG A CD  1 
ATOM   3194 N NE  . ARG A 1 424 ? 12.927  -5.267  18.408  1.00 62.04 ? 424  ARG A NE  1 
ATOM   3195 C CZ  . ARG A 1 424 ? 12.962  -5.917  19.582  1.00 64.35 ? 424  ARG A CZ  1 
ATOM   3196 N NH1 . ARG A 1 424 ? 13.309  -7.206  19.640  1.00 65.19 ? 424  ARG A NH1 1 
ATOM   3197 N NH2 . ARG A 1 424 ? 12.663  -5.276  20.713  1.00 62.70 ? 424  ARG A NH2 1 
ATOM   3198 N N   . VAL A 1 425 ? 16.002  -2.885  13.740  1.00 47.10 ? 425  VAL A N   1 
ATOM   3199 C CA  . VAL A 1 425 ? 16.328  -1.517  13.359  1.00 45.66 ? 425  VAL A CA  1 
ATOM   3200 C C   . VAL A 1 425 ? 15.064  -0.717  13.352  1.00 44.96 ? 425  VAL A C   1 
ATOM   3201 O O   . VAL A 1 425 ? 14.102  -1.132  12.730  1.00 45.52 ? 425  VAL A O   1 
ATOM   3202 C CB  . VAL A 1 425 ? 16.953  -1.459  11.935  1.00 45.40 ? 425  VAL A CB  1 
ATOM   3203 C CG1 . VAL A 1 425 ? 17.352  -0.045  11.571  1.00 44.21 ? 425  VAL A CG1 1 
ATOM   3204 C CG2 . VAL A 1 425 ? 18.134  -2.409  11.816  1.00 45.17 ? 425  VAL A CG2 1 
ATOM   3205 N N   . TYR A 1 426 ? 15.060  0.424   14.032  1.00 44.27 ? 426  TYR A N   1 
ATOM   3206 C CA  . TYR A 1 426 ? 13.983  1.413   13.876  1.00 44.05 ? 426  TYR A CA  1 
ATOM   3207 C C   . TYR A 1 426 ? 14.550  2.657   13.200  1.00 43.77 ? 426  TYR A C   1 
ATOM   3208 O O   . TYR A 1 426 ? 15.658  3.075   13.538  1.00 44.20 ? 426  TYR A O   1 
ATOM   3209 C CB  . TYR A 1 426 ? 13.361  1.761   15.235  1.00 43.79 ? 426  TYR A CB  1 
ATOM   3210 C CG  . TYR A 1 426 ? 12.630  0.595   15.847  1.00 44.18 ? 426  TYR A CG  1 
ATOM   3211 C CD1 . TYR A 1 426 ? 13.312  -0.331  16.634  1.00 43.34 ? 426  TYR A CD1 1 
ATOM   3212 C CD2 . TYR A 1 426 ? 11.248  0.404   15.626  1.00 44.15 ? 426  TYR A CD2 1 
ATOM   3213 C CE1 . TYR A 1 426 ? 12.665  -1.423  17.187  1.00 45.37 ? 426  TYR A CE1 1 
ATOM   3214 C CE2 . TYR A 1 426 ? 10.580  -0.679  16.186  1.00 45.07 ? 426  TYR A CE2 1 
ATOM   3215 C CZ  . TYR A 1 426 ? 11.300  -1.602  16.966  1.00 46.40 ? 426  TYR A CZ  1 
ATOM   3216 O OH  . TYR A 1 426 ? 10.680  -2.698  17.528  1.00 45.80 ? 426  TYR A OH  1 
ATOM   3217 N N   . ALA A 1 427 ? 13.807  3.247   12.267  1.00 42.73 ? 427  ALA A N   1 
ATOM   3218 C CA  . ALA A 1 427 ? 14.324  4.358   11.460  1.00 42.25 ? 427  ALA A CA  1 
ATOM   3219 C C   . ALA A 1 427 ? 13.419  5.557   11.520  1.00 42.47 ? 427  ALA A C   1 
ATOM   3220 O O   . ALA A 1 427 ? 12.190  5.414   11.567  1.00 43.92 ? 427  ALA A O   1 
ATOM   3221 C CB  . ALA A 1 427 ? 14.496  3.931   10.014  1.00 42.18 ? 427  ALA A CB  1 
ATOM   3222 N N   . TYR A 1 428 ? 13.992  6.752   11.509  1.00 41.78 ? 428  TYR A N   1 
ATOM   3223 C CA  . TYR A 1 428 ? 13.160  7.961   11.500  1.00 41.27 ? 428  TYR A CA  1 
ATOM   3224 C C   . TYR A 1 428 ? 13.746  9.021   10.567  1.00 41.29 ? 428  TYR A C   1 
ATOM   3225 O O   . TYR A 1 428 ? 14.931  8.961   10.182  1.00 41.58 ? 428  TYR A O   1 
ATOM   3226 C CB  . TYR A 1 428 ? 13.007  8.525   12.916  1.00 40.86 ? 428  TYR A CB  1 
ATOM   3227 C CG  . TYR A 1 428 ? 14.297  9.064   13.467  1.00 40.90 ? 428  TYR A CG  1 
ATOM   3228 C CD1 . TYR A 1 428 ? 14.684  10.377  13.225  1.00 42.45 ? 428  TYR A CD1 1 
ATOM   3229 C CD2 . TYR A 1 428 ? 15.155  8.259   14.195  1.00 41.07 ? 428  TYR A CD2 1 
ATOM   3230 C CE1 . TYR A 1 428 ? 15.892  10.877  13.711  1.00 42.43 ? 428  TYR A CE1 1 
ATOM   3231 C CE2 . TYR A 1 428 ? 16.355  8.752   14.691  1.00 41.63 ? 428  TYR A CE2 1 
ATOM   3232 C CZ  . TYR A 1 428 ? 16.722  10.058  14.443  1.00 41.51 ? 428  TYR A CZ  1 
ATOM   3233 O OH  . TYR A 1 428 ? 17.910  10.556  14.929  1.00 40.59 ? 428  TYR A OH  1 
ATOM   3234 N N   . ILE A 1 429 ? 12.897  9.964   10.184  1.00 40.45 ? 429  ILE A N   1 
ATOM   3235 C CA  . ILE A 1 429 ? 13.334  11.220  9.627   1.00 39.89 ? 429  ILE A CA  1 
ATOM   3236 C C   . ILE A 1 429 ? 12.685  12.262  10.514  1.00 39.86 ? 429  ILE A C   1 
ATOM   3237 O O   . ILE A 1 429 ? 11.474  12.224  10.739  1.00 40.68 ? 429  ILE A O   1 
ATOM   3238 C CB  . ILE A 1 429 ? 12.950  11.370  8.131   1.00 40.24 ? 429  ILE A CB  1 
ATOM   3239 C CG1 . ILE A 1 429 ? 13.407  12.716  7.567   1.00 39.94 ? 429  ILE A CG1 1 
ATOM   3240 C CG2 . ILE A 1 429 ? 11.433  11.184  7.904   1.00 41.93 ? 429  ILE A CG2 1 
ATOM   3241 C CD1 . ILE A 1 429 ? 13.264  12.801  6.046   1.00 39.62 ? 429  ILE A CD1 1 
ATOM   3242 N N   . PHE A 1 430 ? 13.497  13.160  11.059  1.00 39.16 ? 430  PHE A N   1 
ATOM   3243 C CA  . PHE A 1 430 ? 13.037  14.236  11.933  1.00 37.87 ? 430  PHE A CA  1 
ATOM   3244 C C   . PHE A 1 430 ? 12.700  15.465  11.090  1.00 38.58 ? 430  PHE A C   1 
ATOM   3245 O O   . PHE A 1 430 ? 13.548  15.946  10.347  1.00 38.50 ? 430  PHE A O   1 
ATOM   3246 C CB  . PHE A 1 430 ? 14.167  14.567  12.890  1.00 36.51 ? 430  PHE A CB  1 
ATOM   3247 C CG  . PHE A 1 430 ? 13.803  15.537  13.947  1.00 33.10 ? 430  PHE A CG  1 
ATOM   3248 C CD1 . PHE A 1 430 ? 13.956  16.889  13.738  1.00 30.14 ? 430  PHE A CD1 1 
ATOM   3249 C CD2 . PHE A 1 430 ? 13.363  15.091  15.178  1.00 31.93 ? 430  PHE A CD2 1 
ATOM   3250 C CE1 . PHE A 1 430 ? 13.657  17.802  14.723  1.00 29.94 ? 430  PHE A CE1 1 
ATOM   3251 C CE2 . PHE A 1 430 ? 13.050  15.987  16.171  1.00 32.07 ? 430  PHE A CE2 1 
ATOM   3252 C CZ  . PHE A 1 430 ? 13.193  17.360  15.938  1.00 32.76 ? 430  PHE A CZ  1 
ATOM   3253 N N   . GLU A 1 431 ? 11.476  15.980  11.179  1.00 39.64 ? 431  GLU A N   1 
ATOM   3254 C CA  . GLU A 1 431 ? 11.087  17.035  10.235  1.00 40.84 ? 431  GLU A CA  1 
ATOM   3255 C C   . GLU A 1 431 ? 10.674  18.342  10.856  1.00 41.08 ? 431  GLU A C   1 
ATOM   3256 O O   . GLU A 1 431 ? 10.252  19.253  10.154  1.00 41.56 ? 431  GLU A O   1 
ATOM   3257 C CB  . GLU A 1 431 ? 9.969   16.573  9.311   1.00 41.03 ? 431  GLU A CB  1 
ATOM   3258 C CG  . GLU A 1 431 ? 10.259  15.314  8.536   1.00 43.74 ? 431  GLU A CG  1 
ATOM   3259 C CD  . GLU A 1 431 ? 9.107   14.940  7.627   1.00 45.74 ? 431  GLU A CD  1 
ATOM   3260 O OE1 . GLU A 1 431 ? 7.958   14.968  8.113   1.00 49.22 ? 431  GLU A OE1 1 
ATOM   3261 O OE2 . GLU A 1 431 ? 9.341   14.607  6.440   1.00 46.46 ? 431  GLU A OE2 1 
ATOM   3262 N N   . HIS A 1 432 ? 10.761  18.453  12.168  1.00 41.71 ? 432  HIS A N   1 
ATOM   3263 C CA  . HIS A 1 432 ? 10.293  19.677  12.785  1.00 42.25 ? 432  HIS A CA  1 
ATOM   3264 C C   . HIS A 1 432 ? 11.414  20.701  12.998  1.00 42.57 ? 432  HIS A C   1 
ATOM   3265 O O   . HIS A 1 432 ? 12.430  20.424  13.634  1.00 42.26 ? 432  HIS A O   1 
ATOM   3266 C CB  . HIS A 1 432 ? 9.600   19.392  14.104  1.00 42.27 ? 432  HIS A CB  1 
ATOM   3267 C CG  . HIS A 1 432 ? 9.309   20.624  14.886  1.00 42.98 ? 432  HIS A CG  1 
ATOM   3268 N ND1 . HIS A 1 432 ? 8.262   21.465  14.579  1.00 43.26 ? 432  HIS A ND1 1 
ATOM   3269 C CD2 . HIS A 1 432 ? 9.949   21.183  15.937  1.00 44.32 ? 432  HIS A CD2 1 
ATOM   3270 C CE1 . HIS A 1 432 ? 8.255   22.480  15.421  1.00 43.83 ? 432  HIS A CE1 1 
ATOM   3271 N NE2 . HIS A 1 432 ? 9.270   22.334  16.254  1.00 47.12 ? 432  HIS A NE2 1 
ATOM   3272 N N   . ARG A 1 433 ? 11.185  21.891  12.469  1.00 42.84 ? 433  ARG A N   1 
ATOM   3273 C CA  . ARG A 1 433 ? 12.059  23.021  12.643  1.00 43.13 ? 433  ARG A CA  1 
ATOM   3274 C C   . ARG A 1 433 ? 11.666  23.763  13.918  1.00 44.27 ? 433  ARG A C   1 
ATOM   3275 O O   . ARG A 1 433 ? 10.506  24.152  14.090  1.00 44.70 ? 433  ARG A O   1 
ATOM   3276 C CB  . ARG A 1 433 ? 11.908  23.919  11.427  1.00 42.34 ? 433  ARG A CB  1 
ATOM   3277 C CG  . ARG A 1 433 ? 12.762  25.116  11.424  1.00 41.60 ? 433  ARG A CG  1 
ATOM   3278 C CD  . ARG A 1 433 ? 12.746  25.697  10.051  1.00 41.44 ? 433  ARG A CD  1 
ATOM   3279 N NE  . ARG A 1 433 ? 13.772  26.716  9.838   1.00 40.75 ? 433  ARG A NE  1 
ATOM   3280 C CZ  . ARG A 1 433 ? 13.762  27.898  10.436  1.00 42.57 ? 433  ARG A CZ  1 
ATOM   3281 N NH1 . ARG A 1 433 ? 12.812  28.186  11.329  1.00 43.19 ? 433  ARG A NH1 1 
ATOM   3282 N NH2 . ARG A 1 433 ? 14.728  28.769  10.178  1.00 42.65 ? 433  ARG A NH2 1 
ATOM   3283 N N   . ALA A 1 434 ? 12.637  23.946  14.814  1.00 45.40 ? 434  ALA A N   1 
ATOM   3284 C CA  . ALA A 1 434 ? 12.438  24.643  16.073  1.00 46.53 ? 434  ALA A CA  1 
ATOM   3285 C C   . ALA A 1 434 ? 11.861  26.026  15.808  1.00 47.56 ? 434  ALA A C   1 
ATOM   3286 O O   . ALA A 1 434 ? 12.295  26.713  14.896  1.00 48.01 ? 434  ALA A O   1 
ATOM   3287 C CB  . ALA A 1 434 ? 13.774  24.765  16.828  1.00 46.44 ? 434  ALA A CB  1 
ATOM   3288 N N   . SER A 1 435 ? 10.886  26.427  16.613  1.00 48.63 ? 435  SER A N   1 
ATOM   3289 C CA  . SER A 1 435 ? 10.282  27.753  16.506  1.00 49.48 ? 435  SER A CA  1 
ATOM   3290 C C   . SER A 1 435 ? 11.331  28.817  16.823  1.00 49.99 ? 435  SER A C   1 
ATOM   3291 O O   . SER A 1 435 ? 11.240  29.944  16.367  1.00 50.01 ? 435  SER A O   1 
ATOM   3292 C CB  . SER A 1 435 ? 9.054   27.878  17.442  1.00 49.22 ? 435  SER A CB  1 
ATOM   3293 O OG  . SER A 1 435 ? 9.415   28.173  18.790  1.00 47.76 ? 435  SER A OG  1 
ATOM   3294 N N   . THR A 1 436 ? 12.329  28.436  17.605  1.00 51.25 ? 436  THR A N   1 
ATOM   3295 C CA  . THR A 1 436 ? 13.414  29.344  17.994  1.00 52.39 ? 436  THR A CA  1 
ATOM   3296 C C   . THR A 1 436 ? 14.534  29.450  16.966  1.00 52.61 ? 436  THR A C   1 
ATOM   3297 O O   . THR A 1 436 ? 15.226  30.475  16.932  1.00 53.79 ? 436  THR A O   1 
ATOM   3298 C CB  . THR A 1 436 ? 14.084  28.917  19.318  1.00 52.62 ? 436  THR A CB  1 
ATOM   3299 O OG1 . THR A 1 436 ? 14.089  27.479  19.435  1.00 52.54 ? 436  THR A OG1 1 
ATOM   3300 C CG2 . THR A 1 436 ? 13.349  29.546  20.494  1.00 54.27 ? 436  THR A CG2 1 
ATOM   3301 N N   . LEU A 1 437 ? 14.715  28.403  16.147  1.00 51.75 ? 437  LEU A N   1 
ATOM   3302 C CA  . LEU A 1 437 ? 15.850  28.301  15.216  1.00 50.80 ? 437  LEU A CA  1 
ATOM   3303 C C   . LEU A 1 437 ? 16.281  29.642  14.619  1.00 50.29 ? 437  LEU A C   1 
ATOM   3304 O O   . LEU A 1 437 ? 15.457  30.448  14.211  1.00 50.18 ? 437  LEU A O   1 
ATOM   3305 C CB  . LEU A 1 437 ? 15.549  27.285  14.109  1.00 50.59 ? 437  LEU A CB  1 
ATOM   3306 C CG  . LEU A 1 437 ? 16.744  26.782  13.294  1.00 50.26 ? 437  LEU A CG  1 
ATOM   3307 C CD1 . LEU A 1 437 ? 17.636  25.954  14.135  1.00 48.92 ? 437  LEU A CD1 1 
ATOM   3308 C CD2 . LEU A 1 437 ? 16.281  25.967  12.124  1.00 50.54 ? 437  LEU A CD2 1 
ATOM   3309 N N   . THR A 1 438 ? 17.578  29.884  14.574  1.00 49.83 ? 438  THR A N   1 
ATOM   3310 C CA  . THR A 1 438 ? 18.060  31.171  14.081  1.00 49.28 ? 438  THR A CA  1 
ATOM   3311 C C   . THR A 1 438 ? 18.671  31.114  12.693  1.00 48.58 ? 438  THR A C   1 
ATOM   3312 O O   . THR A 1 438 ? 19.002  32.155  12.137  1.00 49.63 ? 438  THR A O   1 
ATOM   3313 C CB  . THR A 1 438 ? 19.062  31.840  15.060  1.00 49.50 ? 438  THR A CB  1 
ATOM   3314 O OG1 . THR A 1 438 ? 20.062  30.893  15.449  1.00 49.57 ? 438  THR A OG1 1 
ATOM   3315 C CG2 . THR A 1 438 ? 18.334  32.325  16.310  1.00 49.94 ? 438  THR A CG2 1 
ATOM   3316 N N   . TRP A 1 439 ? 18.834  29.922  12.124  1.00 46.92 ? 439  TRP A N   1 
ATOM   3317 C CA  . TRP A 1 439 ? 19.291  29.812  10.738  1.00 45.32 ? 439  TRP A CA  1 
ATOM   3318 C C   . TRP A 1 439 ? 18.146  30.247  9.829   1.00 44.71 ? 439  TRP A C   1 
ATOM   3319 O O   . TRP A 1 439 ? 16.997  30.147  10.217  1.00 44.77 ? 439  TRP A O   1 
ATOM   3320 C CB  . TRP A 1 439 ? 19.706  28.376  10.427  1.00 44.28 ? 439  TRP A CB  1 
ATOM   3321 C CG  . TRP A 1 439 ? 20.898  27.998  11.171  1.00 43.31 ? 439  TRP A CG  1 
ATOM   3322 C CD1 . TRP A 1 439 ? 20.954  27.250  12.306  1.00 42.29 ? 439  TRP A CD1 1 
ATOM   3323 C CD2 . TRP A 1 439 ? 22.237  28.383  10.876  1.00 42.77 ? 439  TRP A CD2 1 
ATOM   3324 N NE1 . TRP A 1 439 ? 22.245  27.137  12.738  1.00 41.68 ? 439  TRP A NE1 1 
ATOM   3325 C CE2 . TRP A 1 439 ? 23.059  27.821  11.877  1.00 42.46 ? 439  TRP A CE2 1 
ATOM   3326 C CE3 . TRP A 1 439 ? 22.828  29.139  9.855   1.00 41.30 ? 439  TRP A CE3 1 
ATOM   3327 C CZ2 . TRP A 1 439 ? 24.434  27.990  11.888  1.00 42.53 ? 439  TRP A CZ2 1 
ATOM   3328 C CZ3 . TRP A 1 439 ? 24.185  29.307  9.861   1.00 41.32 ? 439  TRP A CZ3 1 
ATOM   3329 C CH2 . TRP A 1 439 ? 24.981  28.731  10.871  1.00 43.48 ? 439  TRP A CH2 1 
ATOM   3330 N N   . PRO A 1 440 ? 18.446  30.731  8.615   1.00 44.33 ? 440  PRO A N   1 
ATOM   3331 C CA  . PRO A 1 440 ? 17.330  31.165  7.790   1.00 44.16 ? 440  PRO A CA  1 
ATOM   3332 C C   . PRO A 1 440 ? 16.447  29.984  7.426   1.00 44.29 ? 440  PRO A C   1 
ATOM   3333 O O   . PRO A 1 440 ? 16.886  28.836  7.540   1.00 44.11 ? 440  PRO A O   1 
ATOM   3334 C CB  . PRO A 1 440 ? 18.017  31.716  6.544   1.00 44.33 ? 440  PRO A CB  1 
ATOM   3335 C CG  . PRO A 1 440 ? 19.339  31.012  6.506   1.00 43.63 ? 440  PRO A CG  1 
ATOM   3336 C CD  . PRO A 1 440 ? 19.736  30.904  7.923   1.00 43.98 ? 440  PRO A CD  1 
ATOM   3337 N N   . LEU A 1 441 ? 15.211  30.286  7.016   1.00 44.22 ? 441  LEU A N   1 
ATOM   3338 C CA  . LEU A 1 441 ? 14.231  29.309  6.570   1.00 43.81 ? 441  LEU A CA  1 
ATOM   3339 C C   . LEU A 1 441 ? 14.731  28.320  5.549   1.00 43.07 ? 441  LEU A C   1 
ATOM   3340 O O   . LEU A 1 441 ? 14.300  27.171  5.570   1.00 43.27 ? 441  LEU A O   1 
ATOM   3341 C CB  . LEU A 1 441 ? 13.033  30.025  5.967   1.00 44.68 ? 441  LEU A CB  1 
ATOM   3342 C CG  . LEU A 1 441 ? 12.062  30.560  7.017   1.00 48.12 ? 441  LEU A CG  1 
ATOM   3343 C CD1 . LEU A 1 441 ? 11.644  32.038  6.675   1.00 50.67 ? 441  LEU A CD1 1 
ATOM   3344 C CD2 . LEU A 1 441 ? 10.861  29.577  7.188   1.00 49.40 ? 441  LEU A CD2 1 
ATOM   3345 N N   . TRP A 1 442 ? 15.615  28.755  4.645   1.00 42.12 ? 442  TRP A N   1 
ATOM   3346 C CA  . TRP A 1 442 ? 15.963  27.916  3.489   1.00 41.27 ? 442  TRP A CA  1 
ATOM   3347 C C   . TRP A 1 442 ? 16.707  26.660  3.911   1.00 41.08 ? 442  TRP A C   1 
ATOM   3348 O O   . TRP A 1 442 ? 16.661  25.641  3.220   1.00 40.75 ? 442  TRP A O   1 
ATOM   3349 C CB  . TRP A 1 442 ? 16.683  28.673  2.359   1.00 40.01 ? 442  TRP A CB  1 
ATOM   3350 C CG  . TRP A 1 442 ? 18.075  29.134  2.655   1.00 40.07 ? 442  TRP A CG  1 
ATOM   3351 C CD1 . TRP A 1 442 ? 18.455  30.398  3.029   1.00 39.81 ? 442  TRP A CD1 1 
ATOM   3352 C CD2 . TRP A 1 442 ? 19.284  28.369  2.558   1.00 38.56 ? 442  TRP A CD2 1 
ATOM   3353 N NE1 . TRP A 1 442 ? 19.811  30.458  3.189   1.00 38.16 ? 442  TRP A NE1 1 
ATOM   3354 C CE2 . TRP A 1 442 ? 20.352  29.234  2.905   1.00 38.15 ? 442  TRP A CE2 1 
ATOM   3355 C CE3 . TRP A 1 442 ? 19.571  27.040  2.218   1.00 38.24 ? 442  TRP A CE3 1 
ATOM   3356 C CZ2 . TRP A 1 442 ? 21.691  28.809  2.950   1.00 36.89 ? 442  TRP A CZ2 1 
ATOM   3357 C CZ3 . TRP A 1 442 ? 20.914  26.619  2.246   1.00 39.21 ? 442  TRP A CZ3 1 
ATOM   3358 C CH2 . TRP A 1 442 ? 21.952  27.513  2.617   1.00 38.51 ? 442  TRP A CH2 1 
ATOM   3359 N N   . MET A 1 443 ? 17.330  26.736  5.082   1.00 41.15 ? 443  MET A N   1 
ATOM   3360 C CA  . MET A 1 443 ? 18.154  25.659  5.600   1.00 41.16 ? 443  MET A CA  1 
ATOM   3361 C C   . MET A 1 443 ? 17.337  24.559  6.205   1.00 40.49 ? 443  MET A C   1 
ATOM   3362 O O   . MET A 1 443 ? 17.887  23.509  6.509   1.00 41.25 ? 443  MET A O   1 
ATOM   3363 C CB  . MET A 1 443 ? 19.190  26.187  6.585   1.00 40.76 ? 443  MET A CB  1 
ATOM   3364 C CG  . MET A 1 443 ? 20.199  27.064  5.885   1.00 41.45 ? 443  MET A CG  1 
ATOM   3365 S SD  . MET A 1 443 ? 21.498  27.746  6.922   1.00 43.15 ? 443  MET A SD  1 
ATOM   3366 C CE  . MET A 1 443 ? 22.451  26.284  7.322   1.00 43.01 ? 443  MET A CE  1 
ATOM   3367 N N   . GLY A 1 444 ? 16.026  24.778  6.322   1.00 40.08 ? 444  GLY A N   1 
ATOM   3368 C CA  . GLY A 1 444 ? 15.082  23.789  6.868   1.00 39.08 ? 444  GLY A CA  1 
ATOM   3369 C C   . GLY A 1 444 ? 15.452  23.311  8.262   1.00 38.61 ? 444  GLY A C   1 
ATOM   3370 O O   . GLY A 1 444 ? 15.591  24.109  9.185   1.00 38.83 ? 444  GLY A O   1 
ATOM   3371 N N   . VAL A 1 445 ? 15.627  22.005  8.413   1.00 38.00 ? 445  VAL A N   1 
ATOM   3372 C CA  . VAL A 1 445 ? 16.029  21.413  9.690   1.00 37.76 ? 445  VAL A CA  1 
ATOM   3373 C C   . VAL A 1 445 ? 17.448  20.906  9.483   1.00 38.11 ? 445  VAL A C   1 
ATOM   3374 O O   . VAL A 1 445 ? 17.629  19.789  8.961   1.00 38.62 ? 445  VAL A O   1 
ATOM   3375 C CB  . VAL A 1 445 ? 15.136  20.181  10.080  1.00 37.52 ? 445  VAL A CB  1 
ATOM   3376 C CG1 . VAL A 1 445 ? 15.425  19.749  11.495  1.00 35.73 ? 445  VAL A CG1 1 
ATOM   3377 C CG2 . VAL A 1 445 ? 13.651  20.476  9.884   1.00 36.61 ? 445  VAL A CG2 1 
ATOM   3378 N N   . PRO A 1 446 ? 18.457  21.718  9.848   1.00 37.86 ? 446  PRO A N   1 
ATOM   3379 C CA  . PRO A 1 446 ? 19.862  21.325  9.689   1.00 37.69 ? 446  PRO A CA  1 
ATOM   3380 C C   . PRO A 1 446 ? 20.245  20.211  10.693  1.00 37.95 ? 446  PRO A C   1 
ATOM   3381 O O   . PRO A 1 446 ? 19.493  19.961  11.647  1.00 37.61 ? 446  PRO A O   1 
ATOM   3382 C CB  . PRO A 1 446 ? 20.627  22.624  9.987   1.00 37.76 ? 446  PRO A CB  1 
ATOM   3383 C CG  . PRO A 1 446 ? 19.556  23.719  10.005  1.00 38.07 ? 446  PRO A CG  1 
ATOM   3384 C CD  . PRO A 1 446 ? 18.321  23.054  10.450  1.00 37.78 ? 446  PRO A CD  1 
ATOM   3385 N N   . HIS A 1 447 ? 21.376  19.526  10.494  1.00 37.48 ? 447  HIS A N   1 
ATOM   3386 C CA  . HIS A 1 447 ? 21.706  18.461  11.435  1.00 37.73 ? 447  HIS A CA  1 
ATOM   3387 C C   . HIS A 1 447 ? 21.997  19.061  12.801  1.00 36.96 ? 447  HIS A C   1 
ATOM   3388 O O   . HIS A 1 447 ? 22.457  20.193  12.901  1.00 36.76 ? 447  HIS A O   1 
ATOM   3389 C CB  . HIS A 1 447 ? 22.827  17.551  10.936  1.00 38.24 ? 447  HIS A CB  1 
ATOM   3390 C CG  . HIS A 1 447 ? 24.004  18.290  10.393  1.00 41.91 ? 447  HIS A CG  1 
ATOM   3391 N ND1 . HIS A 1 447 ? 24.739  19.177  11.153  1.00 41.99 ? 447  HIS A ND1 1 
ATOM   3392 C CD2 . HIS A 1 447 ? 24.574  18.281  9.158   1.00 44.81 ? 447  HIS A CD2 1 
ATOM   3393 C CE1 . HIS A 1 447 ? 25.704  19.692  10.405  1.00 44.36 ? 447  HIS A CE1 1 
ATOM   3394 N NE2 . HIS A 1 447 ? 25.635  19.159  9.194   1.00 44.60 ? 447  HIS A NE2 1 
ATOM   3395 N N   . GLY A 1 448 ? 21.659  18.333  13.854  1.00 36.55 ? 448  GLY A N   1 
ATOM   3396 C CA  . GLY A 1 448 ? 21.881  18.820  15.204  1.00 36.35 ? 448  GLY A CA  1 
ATOM   3397 C C   . GLY A 1 448 ? 20.676  19.435  15.881  1.00 36.65 ? 448  GLY A C   1 
ATOM   3398 O O   . GLY A 1 448 ? 20.640  19.567  17.121  1.00 36.76 ? 448  GLY A O   1 
ATOM   3399 N N   . TYR A 1 449 ? 19.675  19.809  15.090  1.00 36.86 ? 449  TYR A N   1 
ATOM   3400 C CA  . TYR A 1 449 ? 18.535  20.541  15.642  1.00 37.39 ? 449  TYR A CA  1 
ATOM   3401 C C   . TYR A 1 449 ? 17.348  19.655  16.120  1.00 37.45 ? 449  TYR A C   1 
ATOM   3402 O O   . TYR A 1 449 ? 16.316  20.176  16.532  1.00 37.38 ? 449  TYR A O   1 
ATOM   3403 C CB  . TYR A 1 449 ? 18.145  21.708  14.715  1.00 37.28 ? 449  TYR A CB  1 
ATOM   3404 C CG  . TYR A 1 449 ? 19.221  22.760  14.773  1.00 37.75 ? 449  TYR A CG  1 
ATOM   3405 C CD1 . TYR A 1 449 ? 20.319  22.734  13.903  1.00 37.46 ? 449  TYR A CD1 1 
ATOM   3406 C CD2 . TYR A 1 449 ? 19.196  23.744  15.762  1.00 39.17 ? 449  TYR A CD2 1 
ATOM   3407 C CE1 . TYR A 1 449 ? 21.336  23.694  13.999  1.00 36.26 ? 449  TYR A CE1 1 
ATOM   3408 C CE2 . TYR A 1 449 ? 20.208  24.716  15.854  1.00 37.05 ? 449  TYR A CE2 1 
ATOM   3409 C CZ  . TYR A 1 449 ? 21.253  24.672  14.979  1.00 37.36 ? 449  TYR A CZ  1 
ATOM   3410 O OH  . TYR A 1 449 ? 22.221  25.611  15.112  1.00 40.66 ? 449  TYR A OH  1 
ATOM   3411 N N   . GLU A 1 450 ? 17.523  18.327  16.070  1.00 36.96 ? 450  GLU A N   1 
ATOM   3412 C CA  . GLU A 1 450 ? 16.644  17.406  16.772  1.00 36.42 ? 450  GLU A CA  1 
ATOM   3413 C C   . GLU A 1 450 ? 17.119  17.257  18.206  1.00 36.47 ? 450  GLU A C   1 
ATOM   3414 O O   . GLU A 1 450 ? 16.316  17.005  19.094  1.00 36.51 ? 450  GLU A O   1 
ATOM   3415 C CB  . GLU A 1 450 ? 16.597  16.046  16.088  1.00 35.99 ? 450  GLU A CB  1 
ATOM   3416 C CG  . GLU A 1 450 ? 17.729  15.106  16.428  1.00 37.60 ? 450  GLU A CG  1 
ATOM   3417 C CD  . GLU A 1 450 ? 19.012  15.386  15.646  1.00 38.78 ? 450  GLU A CD  1 
ATOM   3418 O OE1 . GLU A 1 450 ? 19.273  16.563  15.265  1.00 37.97 ? 450  GLU A OE1 1 
ATOM   3419 O OE2 . GLU A 1 450 ? 19.764  14.410  15.434  1.00 37.95 ? 450  GLU A OE2 1 
ATOM   3420 N N   . ILE A 1 451 ? 18.423  17.454  18.435  1.00 36.36 ? 451  ILE A N   1 
ATOM   3421 C CA  . ILE A 1 451 ? 19.051  17.113  19.718  1.00 35.40 ? 451  ILE A CA  1 
ATOM   3422 C C   . ILE A 1 451 ? 18.339  17.720  20.915  1.00 36.14 ? 451  ILE A C   1 
ATOM   3423 O O   . ILE A 1 451 ? 17.997  16.990  21.861  1.00 36.85 ? 451  ILE A O   1 
ATOM   3424 C CB  . ILE A 1 451 ? 20.557  17.487  19.784  1.00 35.20 ? 451  ILE A CB  1 
ATOM   3425 C CG1 . ILE A 1 451 ? 21.352  16.756  18.688  1.00 35.21 ? 451  ILE A CG1 1 
ATOM   3426 C CG2 . ILE A 1 451 ? 21.118  17.128  21.170  1.00 34.74 ? 451  ILE A CG2 1 
ATOM   3427 C CD1 . ILE A 1 451 ? 22.824  17.173  18.579  1.00 33.79 ? 451  ILE A CD1 1 
ATOM   3428 N N   . GLU A 1 452 ? 18.147  19.043  20.902  1.00 35.85 ? 452  GLU A N   1 
ATOM   3429 C CA  . GLU A 1 452 ? 17.465  19.733  21.997  1.00 36.96 ? 452  GLU A CA  1 
ATOM   3430 C C   . GLU A 1 452 ? 16.044  19.177  22.303  1.00 37.16 ? 452  GLU A C   1 
ATOM   3431 O O   . GLU A 1 452 ? 15.575  19.259  23.449  1.00 36.98 ? 452  GLU A O   1 
ATOM   3432 C CB  . GLU A 1 452 ? 17.371  21.217  21.701  1.00 37.18 ? 452  GLU A CB  1 
ATOM   3433 C CG  . GLU A 1 452 ? 16.584  21.475  20.436  1.00 40.39 ? 452  GLU A CG  1 
ATOM   3434 C CD  . GLU A 1 452 ? 16.655  22.907  19.961  1.00 42.23 ? 452  GLU A CD  1 
ATOM   3435 O OE1 . GLU A 1 452 ? 16.083  23.779  20.638  1.00 44.82 ? 452  GLU A OE1 1 
ATOM   3436 O OE2 . GLU A 1 452 ? 17.243  23.152  18.896  1.00 42.06 ? 452  GLU A OE2 1 
ATOM   3437 N N   . PHE A 1 453 ? 15.379  18.600  21.302  1.00 36.88 ? 453  PHE A N   1 
ATOM   3438 C CA  . PHE A 1 453 ? 14.095  17.944  21.539  1.00 37.24 ? 453  PHE A CA  1 
ATOM   3439 C C   . PHE A 1 453 ? 14.233  16.609  22.255  1.00 37.10 ? 453  PHE A C   1 
ATOM   3440 O O   . PHE A 1 453 ? 13.558  16.391  23.267  1.00 36.91 ? 453  PHE A O   1 
ATOM   3441 C CB  . PHE A 1 453 ? 13.263  17.825  20.252  1.00 37.64 ? 453  PHE A CB  1 
ATOM   3442 C CG  . PHE A 1 453 ? 12.784  19.153  19.745  1.00 38.40 ? 453  PHE A CG  1 
ATOM   3443 C CD1 . PHE A 1 453 ? 11.610  19.707  20.231  1.00 38.98 ? 453  PHE A CD1 1 
ATOM   3444 C CD2 . PHE A 1 453 ? 13.552  19.881  18.841  1.00 40.07 ? 453  PHE A CD2 1 
ATOM   3445 C CE1 . PHE A 1 453 ? 11.193  20.949  19.805  1.00 40.84 ? 453  PHE A CE1 1 
ATOM   3446 C CE2 . PHE A 1 453 ? 13.143  21.130  18.392  1.00 40.15 ? 453  PHE A CE2 1 
ATOM   3447 C CZ  . PHE A 1 453 ? 11.950  21.664  18.876  1.00 41.27 ? 453  PHE A CZ  1 
ATOM   3448 N N   . ILE A 1 454 ? 15.092  15.733  21.742  1.00 36.71 ? 454  ILE A N   1 
ATOM   3449 C CA  . ILE A 1 454 ? 15.388  14.441  22.362  1.00 36.96 ? 454  ILE A CA  1 
ATOM   3450 C C   . ILE A 1 454 ? 15.752  14.618  23.849  1.00 37.36 ? 454  ILE A C   1 
ATOM   3451 O O   . ILE A 1 454 ? 15.305  13.833  24.704  1.00 37.05 ? 454  ILE A O   1 
ATOM   3452 C CB  . ILE A 1 454 ? 16.599  13.766  21.661  1.00 37.43 ? 454  ILE A CB  1 
ATOM   3453 C CG1 . ILE A 1 454 ? 16.440  13.764  20.130  1.00 37.83 ? 454  ILE A CG1 1 
ATOM   3454 C CG2 . ILE A 1 454 ? 16.901  12.397  22.251  1.00 37.45 ? 454  ILE A CG2 1 
ATOM   3455 C CD1 . ILE A 1 454 ? 15.555  12.753  19.652  1.00 39.09 ? 454  ILE A CD1 1 
ATOM   3456 N N   . PHE A 1 455 ? 16.563  15.641  24.155  1.00 37.00 ? 455  PHE A N   1 
ATOM   3457 C CA  . PHE A 1 455 ? 17.022  15.878  25.523  1.00 37.24 ? 455  PHE A CA  1 
ATOM   3458 C C   . PHE A 1 455 ? 15.965  16.610  26.329  1.00 38.21 ? 455  PHE A C   1 
ATOM   3459 O O   . PHE A 1 455 ? 16.123  16.812  27.543  1.00 38.82 ? 455  PHE A O   1 
ATOM   3460 C CB  . PHE A 1 455 ? 18.322  16.681  25.546  1.00 36.73 ? 455  PHE A CB  1 
ATOM   3461 C CG  . PHE A 1 455 ? 19.551  15.846  25.456  1.00 35.63 ? 455  PHE A CG  1 
ATOM   3462 C CD1 . PHE A 1 455 ? 20.002  15.395  24.234  1.00 33.81 ? 455  PHE A CD1 1 
ATOM   3463 C CD2 . PHE A 1 455 ? 20.267  15.517  26.610  1.00 36.16 ? 455  PHE A CD2 1 
ATOM   3464 C CE1 . PHE A 1 455 ? 21.156  14.597  24.156  1.00 36.80 ? 455  PHE A CE1 1 
ATOM   3465 C CE2 . PHE A 1 455 ? 21.423  14.743  26.547  1.00 34.13 ? 455  PHE A CE2 1 
ATOM   3466 C CZ  . PHE A 1 455 ? 21.869  14.274  25.306  1.00 34.97 ? 455  PHE A CZ  1 
ATOM   3467 N N   . GLY A 1 456 ? 14.901  17.023  25.645  1.00 38.62 ? 456  GLY A N   1 
ATOM   3468 C CA  . GLY A 1 456 ? 13.739  17.606  26.287  1.00 39.11 ? 456  GLY A CA  1 
ATOM   3469 C C   . GLY A 1 456 ? 13.899  19.017  26.801  1.00 39.59 ? 456  GLY A C   1 
ATOM   3470 O O   . GLY A 1 456 ? 13.280  19.370  27.796  1.00 39.83 ? 456  GLY A O   1 
ATOM   3471 N N   . LEU A 1 457 ? 14.718  19.830  26.139  1.00 40.61 ? 457  LEU A N   1 
ATOM   3472 C CA  . LEU A 1 457 ? 14.890  21.240  26.540  1.00 41.58 ? 457  LEU A CA  1 
ATOM   3473 C C   . LEU A 1 457 ? 13.607  22.069  26.508  1.00 42.86 ? 457  LEU A C   1 
ATOM   3474 O O   . LEU A 1 457 ? 13.442  22.946  27.344  1.00 43.34 ? 457  LEU A O   1 
ATOM   3475 C CB  . LEU A 1 457 ? 15.979  21.953  25.730  1.00 41.37 ? 457  LEU A CB  1 
ATOM   3476 C CG  . LEU A 1 457 ? 17.364  21.997  26.368  1.00 40.64 ? 457  LEU A CG  1 
ATOM   3477 C CD1 . LEU A 1 457 ? 18.074  20.649  26.290  1.00 39.70 ? 457  LEU A CD1 1 
ATOM   3478 C CD2 . LEU A 1 457 ? 18.193  23.040  25.682  1.00 40.94 ? 457  LEU A CD2 1 
ATOM   3479 N N   . PRO A 1 458 ? 12.694  21.808  25.556  1.00 44.01 ? 458  PRO A N   1 
ATOM   3480 C CA  . PRO A 1 458 ? 11.449  22.552  25.590  1.00 45.40 ? 458  PRO A CA  1 
ATOM   3481 C C   . PRO A 1 458 ? 10.643  22.425  26.879  1.00 47.02 ? 458  PRO A C   1 
ATOM   3482 O O   . PRO A 1 458 ? 9.682   23.157  27.055  1.00 47.91 ? 458  PRO A O   1 
ATOM   3483 C CB  . PRO A 1 458 ? 10.670  21.956  24.416  1.00 45.29 ? 458  PRO A CB  1 
ATOM   3484 C CG  . PRO A 1 458 ? 11.707  21.545  23.482  1.00 44.18 ? 458  PRO A CG  1 
ATOM   3485 C CD  . PRO A 1 458 ? 12.719  20.914  24.390  1.00 44.29 ? 458  PRO A CD  1 
ATOM   3486 N N   . LEU A 1 459 ? 11.017  21.523  27.776  1.00 48.53 ? 459  LEU A N   1 
ATOM   3487 C CA  . LEU A 1 459 ? 10.274  21.389  29.028  1.00 50.03 ? 459  LEU A CA  1 
ATOM   3488 C C   . LEU A 1 459 ? 10.582  22.519  30.001  1.00 50.99 ? 459  LEU A C   1 
ATOM   3489 O O   . LEU A 1 459 ? 9.899   22.675  31.009  1.00 51.21 ? 459  LEU A O   1 
ATOM   3490 C CB  . LEU A 1 459 ? 10.540  20.038  29.687  1.00 49.54 ? 459  LEU A CB  1 
ATOM   3491 C CG  . LEU A 1 459 ? 9.626   18.891  29.274  1.00 50.35 ? 459  LEU A CG  1 
ATOM   3492 C CD1 . LEU A 1 459 ? 9.613   18.712  27.775  1.00 52.55 ? 459  LEU A CD1 1 
ATOM   3493 C CD2 . LEU A 1 459 ? 10.129  17.631  29.900  1.00 51.57 ? 459  LEU A CD2 1 
ATOM   3494 N N   . ASP A 1 460 ? 11.607  23.302  29.699  1.00 52.36 ? 460  ASP A N   1 
ATOM   3495 C CA  . ASP A 1 460 ? 12.003  24.392  30.571  1.00 54.34 ? 460  ASP A CA  1 
ATOM   3496 C C   . ASP A 1 460 ? 11.157  25.594  30.148  1.00 55.65 ? 460  ASP A C   1 
ATOM   3497 O O   . ASP A 1 460 ? 11.349  26.127  29.047  1.00 55.46 ? 460  ASP A O   1 
ATOM   3498 C CB  . ASP A 1 460 ? 13.508  24.660  30.430  1.00 54.24 ? 460  ASP A CB  1 
ATOM   3499 C CG  . ASP A 1 460 ? 13.991  25.835  31.267  1.00 55.25 ? 460  ASP A CG  1 
ATOM   3500 O OD1 . ASP A 1 460 ? 13.167  26.633  31.755  1.00 56.42 ? 460  ASP A OD1 1 
ATOM   3501 O OD2 . ASP A 1 460 ? 15.221  25.976  31.428  1.00 56.09 ? 460  ASP A OD2 1 
ATOM   3502 N N   . PRO A 1 461 ? 10.221  26.033  31.024  1.00 57.13 ? 461  PRO A N   1 
ATOM   3503 C CA  . PRO A 1 461 ? 9.243   27.043  30.571  1.00 58.22 ? 461  PRO A CA  1 
ATOM   3504 C C   . PRO A 1 461 ? 9.914   28.399  30.321  1.00 58.93 ? 461  PRO A C   1 
ATOM   3505 O O   . PRO A 1 461 ? 9.374   29.225  29.594  1.00 59.67 ? 461  PRO A O   1 
ATOM   3506 C CB  . PRO A 1 461 ? 8.210   27.099  31.707  1.00 58.21 ? 461  PRO A CB  1 
ATOM   3507 C CG  . PRO A 1 461 ? 8.975   26.643  32.947  1.00 58.49 ? 461  PRO A CG  1 
ATOM   3508 C CD  . PRO A 1 461 ? 10.060  25.684  32.455  1.00 57.40 ? 461  PRO A CD  1 
ATOM   3509 N N   . SER A 1 462 ? 11.114  28.591  30.853  1.00 59.38 ? 462  SER A N   1 
ATOM   3510 C CA  . SER A 1 462 ? 11.907  29.771  30.528  1.00 59.95 ? 462  SER A CA  1 
ATOM   3511 C C   . SER A 1 462 ? 12.587  29.771  29.139  1.00 60.22 ? 462  SER A C   1 
ATOM   3512 O O   . SER A 1 462 ? 13.377  30.670  28.859  1.00 60.34 ? 462  SER A O   1 
ATOM   3513 C CB  . SER A 1 462 ? 12.970  29.978  31.606  1.00 60.20 ? 462  SER A CB  1 
ATOM   3514 O OG  . SER A 1 462 ? 14.077  29.132  31.374  1.00 60.13 ? 462  SER A OG  1 
ATOM   3515 N N   . LEU A 1 463 ? 12.295  28.796  28.267  1.00 60.68 ? 463  LEU A N   1 
ATOM   3516 C CA  . LEU A 1 463 ? 13.023  28.700  26.978  1.00 60.30 ? 463  LEU A CA  1 
ATOM   3517 C C   . LEU A 1 463 ? 12.313  29.102  25.659  1.00 60.06 ? 463  LEU A C   1 
ATOM   3518 O O   . LEU A 1 463 ? 12.918  29.034  24.582  1.00 60.31 ? 463  LEU A O   1 
ATOM   3519 C CB  . LEU A 1 463 ? 13.772  27.367  26.846  1.00 60.38 ? 463  LEU A CB  1 
ATOM   3520 C CG  . LEU A 1 463 ? 15.134  27.332  27.549  1.00 60.86 ? 463  LEU A CG  1 
ATOM   3521 C CD1 . LEU A 1 463 ? 15.706  25.908  27.602  1.00 61.54 ? 463  LEU A CD1 1 
ATOM   3522 C CD2 . LEU A 1 463 ? 16.145  28.293  26.906  1.00 60.79 ? 463  LEU A CD2 1 
ATOM   3523 N N   . ASN A 1 464 ? 11.056  29.527  25.728  1.00 59.67 ? 464  ASN A N   1 
ATOM   3524 C CA  . ASN A 1 464 ? 10.371  30.138  24.546  1.00 59.39 ? 464  ASN A CA  1 
ATOM   3525 C C   . ASN A 1 464 ? 9.821   29.159  23.499  1.00 58.09 ? 464  ASN A C   1 
ATOM   3526 O O   . ASN A 1 464 ? 9.284   29.610  22.479  1.00 58.45 ? 464  ASN A O   1 
ATOM   3527 C CB  . ASN A 1 464 ? 11.241  31.205  23.806  1.00 59.66 ? 464  ASN A CB  1 
ATOM   3528 C CG  . ASN A 1 464 ? 11.300  32.563  24.529  1.00 61.21 ? 464  ASN A CG  1 
ATOM   3529 O OD1 . ASN A 1 464 ? 10.840  32.712  25.665  1.00 62.44 ? 464  ASN A OD1 1 
ATOM   3530 N ND2 . ASN A 1 464 ? 11.886  33.559  23.858  1.00 62.47 ? 464  ASN A ND2 1 
ATOM   3531 N N   . TYR A 1 465 ? 9.954   27.851  23.721  1.00 55.94 ? 465  TYR A N   1 
ATOM   3532 C CA  . TYR A 1 465 ? 9.332   26.887  22.809  1.00 54.42 ? 465  TYR A CA  1 
ATOM   3533 C C   . TYR A 1 465 ? 7.809   26.980  22.881  1.00 53.64 ? 465  TYR A C   1 
ATOM   3534 O O   . TYR A 1 465 ? 7.269   27.364  23.901  1.00 53.54 ? 465  TYR A O   1 
ATOM   3535 C CB  . TYR A 1 465 ? 9.777   25.457  23.114  1.00 53.72 ? 465  TYR A CB  1 
ATOM   3536 C CG  . TYR A 1 465 ? 11.252  25.225  22.936  1.00 52.53 ? 465  TYR A CG  1 
ATOM   3537 C CD1 . TYR A 1 465 ? 11.777  24.803  21.715  1.00 50.80 ? 465  TYR A CD1 1 
ATOM   3538 C CD2 . TYR A 1 465 ? 12.121  25.433  23.995  1.00 50.95 ? 465  TYR A CD2 1 
ATOM   3539 C CE1 . TYR A 1 465 ? 13.124  24.596  21.569  1.00 50.73 ? 465  TYR A CE1 1 
ATOM   3540 C CE2 . TYR A 1 465 ? 13.452  25.235  23.863  1.00 50.86 ? 465  TYR A CE2 1 
ATOM   3541 C CZ  . TYR A 1 465 ? 13.966  24.817  22.654  1.00 51.76 ? 465  TYR A CZ  1 
ATOM   3542 O OH  . TYR A 1 465 ? 15.335  24.620  22.576  1.00 51.04 ? 465  TYR A OH  1 
ATOM   3543 N N   . THR A 1 466 ? 7.128   26.636  21.795  1.00 53.12 ? 466  THR A N   1 
ATOM   3544 C CA  . THR A 1 466 ? 5.655   26.562  21.799  1.00 52.47 ? 466  THR A CA  1 
ATOM   3545 C C   . THR A 1 466 ? 5.149   25.345  22.594  1.00 52.83 ? 466  THR A C   1 
ATOM   3546 O O   . THR A 1 466 ? 5.886   24.377  22.838  1.00 52.80 ? 466  THR A O   1 
ATOM   3547 C CB  . THR A 1 466 ? 5.076   26.473  20.381  1.00 51.93 ? 466  THR A CB  1 
ATOM   3548 O OG1 . THR A 1 466 ? 5.303   25.154  19.864  1.00 52.33 ? 466  THR A OG1 1 
ATOM   3549 C CG2 . THR A 1 466 ? 5.689   27.521  19.464  1.00 49.81 ? 466  THR A CG2 1 
ATOM   3550 N N   . THR A 1 467 ? 3.883   25.404  22.985  1.00 52.68 ? 467  THR A N   1 
ATOM   3551 C CA  . THR A 1 467 ? 3.237   24.332  23.719  1.00 52.56 ? 467  THR A CA  1 
ATOM   3552 C C   . THR A 1 467 ? 3.264   22.995  22.966  1.00 52.52 ? 467  THR A C   1 
ATOM   3553 O O   . THR A 1 467 ? 3.510   21.954  23.575  1.00 52.63 ? 467  THR A O   1 
ATOM   3554 C CB  . THR A 1 467 ? 1.797   24.758  24.130  1.00 53.05 ? 467  THR A CB  1 
ATOM   3555 O OG1 . THR A 1 467 ? 1.887   25.822  25.093  1.00 53.59 ? 467  THR A OG1 1 
ATOM   3556 C CG2 . THR A 1 467 ? 0.993   23.598  24.747  1.00 53.13 ? 467  THR A CG2 1 
ATOM   3557 N N   . GLU A 1 468 ? 3.049   23.002  21.654  1.00 52.28 ? 468  GLU A N   1 
ATOM   3558 C CA  . GLU A 1 468 ? 3.139   21.742  20.905  1.00 52.56 ? 468  GLU A CA  1 
ATOM   3559 C C   . GLU A 1 468 ? 4.582   21.191  20.882  1.00 51.55 ? 468  GLU A C   1 
ATOM   3560 O O   . GLU A 1 468 ? 4.782   19.973  20.863  1.00 51.26 ? 468  GLU A O   1 
ATOM   3561 C CB  . GLU A 1 468 ? 2.559   21.846  19.482  1.00 53.06 ? 468  GLU A CB  1 
ATOM   3562 C CG  . GLU A 1 468 ? 1.321   22.726  19.353  1.00 56.79 ? 468  GLU A CG  1 
ATOM   3563 C CD  . GLU A 1 468 ? 1.669   24.159  18.897  1.00 61.82 ? 468  GLU A CD  1 
ATOM   3564 O OE1 . GLU A 1 468 ? 1.588   25.107  19.745  1.00 61.38 ? 468  GLU A OE1 1 
ATOM   3565 O OE2 . GLU A 1 468 ? 2.030   24.317  17.684  1.00 62.74 ? 468  GLU A OE2 1 
ATOM   3566 N N   . GLU A 1 469 ? 5.563   22.092  20.896  1.00 50.61 ? 469  GLU A N   1 
ATOM   3567 C CA  . GLU A 1 469 ? 6.974   21.709  21.038  1.00 49.81 ? 469  GLU A CA  1 
ATOM   3568 C C   . GLU A 1 469 ? 7.288   21.084  22.398  1.00 50.08 ? 469  GLU A C   1 
ATOM   3569 O O   . GLU A 1 469 ? 8.094   20.152  22.471  1.00 49.91 ? 469  GLU A O   1 
ATOM   3570 C CB  . GLU A 1 469 ? 7.913   22.885  20.747  1.00 49.75 ? 469  GLU A CB  1 
ATOM   3571 C CG  . GLU A 1 469 ? 8.160   23.116  19.265  1.00 47.99 ? 469  GLU A CG  1 
ATOM   3572 C CD  . GLU A 1 469 ? 8.892   24.422  18.969  1.00 47.81 ? 469  GLU A CD  1 
ATOM   3573 O OE1 . GLU A 1 469 ? 8.837   25.366  19.799  1.00 45.43 ? 469  GLU A OE1 1 
ATOM   3574 O OE2 . GLU A 1 469 ? 9.520   24.505  17.892  1.00 44.64 ? 469  GLU A OE2 1 
ATOM   3575 N N   . ARG A 1 470 ? 6.649   21.571  23.463  1.00 49.86 ? 470  ARG A N   1 
ATOM   3576 C CA  . ARG A 1 470 ? 6.796   20.937  24.771  1.00 51.02 ? 470  ARG A CA  1 
ATOM   3577 C C   . ARG A 1 470 ? 6.227   19.506  24.745  1.00 49.40 ? 470  ARG A C   1 
ATOM   3578 O O   . ARG A 1 470 ? 6.861   18.578  25.232  1.00 49.98 ? 470  ARG A O   1 
ATOM   3579 C CB  . ARG A 1 470 ? 6.195   21.798  25.900  1.00 51.09 ? 470  ARG A CB  1 
ATOM   3580 C CG  . ARG A 1 470 ? 6.494   21.253  27.330  1.00 54.84 ? 470  ARG A CG  1 
ATOM   3581 C CD  . ARG A 1 470 ? 5.632   21.860  28.532  1.00 55.25 ? 470  ARG A CD  1 
ATOM   3582 N NE  . ARG A 1 470 ? 4.176   21.671  28.386  1.00 64.12 ? 470  ARG A NE  1 
ATOM   3583 C CZ  . ARG A 1 470 ? 3.559   20.490  28.231  1.00 66.67 ? 470  ARG A CZ  1 
ATOM   3584 N NH1 . ARG A 1 470 ? 4.255   19.356  28.183  1.00 67.97 ? 470  ARG A NH1 1 
ATOM   3585 N NH2 . ARG A 1 470 ? 2.236   20.437  28.102  1.00 68.61 ? 470  ARG A NH2 1 
ATOM   3586 N N   . ILE A 1 471 ? 5.076   19.312  24.114  1.00 48.27 ? 471  ILE A N   1 
ATOM   3587 C CA  . ILE A 1 471 ? 4.459   17.981  24.022  1.00 47.10 ? 471  ILE A CA  1 
ATOM   3588 C C   . ILE A 1 471 ? 5.261   17.048  23.132  1.00 46.49 ? 471  ILE A C   1 
ATOM   3589 O O   . ILE A 1 471 ? 5.391   15.845  23.402  1.00 46.59 ? 471  ILE A O   1 
ATOM   3590 C CB  . ILE A 1 471 ? 2.963   18.061  23.511  1.00 47.39 ? 471  ILE A CB  1 
ATOM   3591 C CG1 . ILE A 1 471 ? 2.043   18.577  24.637  1.00 46.91 ? 471  ILE A CG1 1 
ATOM   3592 C CG2 . ILE A 1 471 ? 2.466   16.676  22.942  1.00 45.15 ? 471  ILE A CG2 1 
ATOM   3593 C CD1 . ILE A 1 471 ? 0.964   19.544  24.163  1.00 48.37 ? 471  ILE A CD1 1 
ATOM   3594 N N   . PHE A 1 472 ? 5.757   17.613  22.038  1.00 45.77 ? 472  PHE A N   1 
ATOM   3595 C CA  . PHE A 1 472 ? 6.564   16.894  21.047  1.00 44.27 ? 472  PHE A CA  1 
ATOM   3596 C C   . PHE A 1 472 ? 7.853   16.353  21.683  1.00 43.99 ? 472  PHE A C   1 
ATOM   3597 O O   . PHE A 1 472 ? 8.211   15.191  21.459  1.00 43.29 ? 472  PHE A O   1 
ATOM   3598 C CB  . PHE A 1 472 ? 6.853   17.838  19.891  1.00 43.25 ? 472  PHE A CB  1 
ATOM   3599 C CG  . PHE A 1 472 ? 7.735   17.276  18.829  1.00 42.35 ? 472  PHE A CG  1 
ATOM   3600 C CD1 . PHE A 1 472 ? 7.552   15.970  18.358  1.00 40.06 ? 472  PHE A CD1 1 
ATOM   3601 C CD2 . PHE A 1 472 ? 8.747   18.087  18.266  1.00 39.77 ? 472  PHE A CD2 1 
ATOM   3602 C CE1 . PHE A 1 472 ? 8.368   15.456  17.354  1.00 40.22 ? 472  PHE A CE1 1 
ATOM   3603 C CE2 . PHE A 1 472 ? 9.565   17.602  17.263  1.00 40.61 ? 472  PHE A CE2 1 
ATOM   3604 C CZ  . PHE A 1 472 ? 9.383   16.279  16.791  1.00 40.99 ? 472  PHE A CZ  1 
ATOM   3605 N N   . ALA A 1 473 ? 8.498   17.187  22.509  1.00 43.66 ? 473  ALA A N   1 
ATOM   3606 C CA  . ALA A 1 473 ? 9.728   16.810  23.205  1.00 44.03 ? 473  ALA A CA  1 
ATOM   3607 C C   . ALA A 1 473 ? 9.497   15.599  24.100  1.00 44.72 ? 473  ALA A C   1 
ATOM   3608 O O   . ALA A 1 473 ? 10.295  14.658  24.096  1.00 44.12 ? 473  ALA A O   1 
ATOM   3609 C CB  . ALA A 1 473 ? 10.281  17.986  24.006  1.00 43.70 ? 473  ALA A CB  1 
ATOM   3610 N N   . GLN A 1 474 ? 8.388   15.632  24.853  1.00 45.50 ? 474  GLN A N   1 
ATOM   3611 C CA  . GLN A 1 474 ? 7.948   14.499  25.691  1.00 45.97 ? 474  GLN A CA  1 
ATOM   3612 C C   . GLN A 1 474 ? 7.727   13.246  24.872  1.00 45.44 ? 474  GLN A C   1 
ATOM   3613 O O   . GLN A 1 474 ? 8.117   12.158  25.286  1.00 46.08 ? 474  GLN A O   1 
ATOM   3614 C CB  . GLN A 1 474 ? 6.672   14.843  26.459  1.00 45.84 ? 474  GLN A CB  1 
ATOM   3615 C CG  . GLN A 1 474 ? 6.849   16.022  27.428  1.00 47.16 ? 474  GLN A CG  1 
ATOM   3616 C CD  . GLN A 1 474 ? 5.575   16.356  28.201  1.00 48.31 ? 474  GLN A CD  1 
ATOM   3617 O OE1 . GLN A 1 474 ? 4.581   16.822  27.636  1.00 51.78 ? 474  GLN A OE1 1 
ATOM   3618 N NE2 . GLN A 1 474 ? 5.612   16.138  29.501  1.00 50.76 ? 474  GLN A NE2 1 
ATOM   3619 N N   . ARG A 1 475 ? 7.129   13.383  23.697  1.00 45.06 ? 475  ARG A N   1 
ATOM   3620 C CA  . ARG A 1 475 ? 6.969   12.219  22.837  1.00 45.02 ? 475  ARG A CA  1 
ATOM   3621 C C   . ARG A 1 475 ? 8.331   11.592  22.510  1.00 44.90 ? 475  ARG A C   1 
ATOM   3622 O O   . ARG A 1 475 ? 8.497   10.370  22.622  1.00 45.22 ? 475  ARG A O   1 
ATOM   3623 C CB  . ARG A 1 475 ? 6.247   12.592  21.543  1.00 45.19 ? 475  ARG A CB  1 
ATOM   3624 C CG  . ARG A 1 475 ? 4.736   12.457  21.586  1.00 45.93 ? 475  ARG A CG  1 
ATOM   3625 C CD  . ARG A 1 475 ? 4.111   12.898  20.240  1.00 44.74 ? 475  ARG A CD  1 
ATOM   3626 N NE  . ARG A 1 475 ? 4.570   12.036  19.157  1.00 43.83 ? 475  ARG A NE  1 
ATOM   3627 C CZ  . ARG A 1 475 ? 4.754   12.437  17.899  1.00 41.66 ? 475  ARG A CZ  1 
ATOM   3628 N NH1 . ARG A 1 475 ? 4.520   13.698  17.531  1.00 38.15 ? 475  ARG A NH1 1 
ATOM   3629 N NH2 . ARG A 1 475 ? 5.193   11.560  17.008  1.00 40.99 ? 475  ARG A NH2 1 
ATOM   3630 N N   . LEU A 1 476 ? 9.290   12.432  22.103  1.00 44.33 ? 476  LEU A N   1 
ATOM   3631 C CA  . LEU A 1 476 ? 10.607  11.960  21.672  1.00 43.92 ? 476  LEU A CA  1 
ATOM   3632 C C   . LEU A 1 476 ? 11.396  11.366  22.824  1.00 43.75 ? 476  LEU A C   1 
ATOM   3633 O O   . LEU A 1 476 ? 12.058  10.348  22.642  1.00 43.70 ? 476  LEU A O   1 
ATOM   3634 C CB  . LEU A 1 476 ? 11.409  13.069  20.968  1.00 43.99 ? 476  LEU A CB  1 
ATOM   3635 C CG  . LEU A 1 476 ? 10.751  13.682  19.723  1.00 42.80 ? 476  LEU A CG  1 
ATOM   3636 C CD1 . LEU A 1 476 ? 11.521  14.851  19.257  1.00 42.22 ? 476  LEU A CD1 1 
ATOM   3637 C CD2 . LEU A 1 476 ? 10.613  12.680  18.611  1.00 42.22 ? 476  LEU A CD2 1 
ATOM   3638 N N   . MET A 1 477 ? 11.298  11.976  24.008  1.00 43.69 ? 477  MET A N   1 
ATOM   3639 C CA  . MET A 1 477 ? 11.982  11.457  25.186  1.00 44.00 ? 477  MET A CA  1 
ATOM   3640 C C   . MET A 1 477 ? 11.416  10.074  25.513  1.00 44.35 ? 477  MET A C   1 
ATOM   3641 O O   . MET A 1 477 ? 12.149  9.181   25.992  1.00 44.39 ? 477  MET A O   1 
ATOM   3642 C CB  . MET A 1 477 ? 11.813  12.374  26.395  1.00 43.88 ? 477  MET A CB  1 
ATOM   3643 C CG  . MET A 1 477 ? 12.337  13.804  26.241  1.00 43.95 ? 477  MET A CG  1 
ATOM   3644 S SD  . MET A 1 477 ? 11.902  14.862  27.663  1.00 44.30 ? 477  MET A SD  1 
ATOM   3645 C CE  . MET A 1 477 ? 12.958  14.230  28.949  1.00 43.10 ? 477  MET A CE  1 
ATOM   3646 N N   . LYS A 1 478 ? 10.121  9.901   25.244  1.00 43.84 ? 478  LYS A N   1 
ATOM   3647 C CA  . LYS A 1 478 ? 9.472   8.621   25.464  1.00 44.10 ? 478  LYS A CA  1 
ATOM   3648 C C   . LYS A 1 478 ? 9.944   7.563   24.472  1.00 43.54 ? 478  LYS A C   1 
ATOM   3649 O O   . LYS A 1 478 ? 10.219  6.430   24.869  1.00 43.22 ? 478  LYS A O   1 
ATOM   3650 C CB  . LYS A 1 478 ? 7.954   8.747   25.447  1.00 44.51 ? 478  LYS A CB  1 
ATOM   3651 C CG  . LYS A 1 478 ? 7.396   9.279   26.737  1.00 47.45 ? 478  LYS A CG  1 
ATOM   3652 C CD  . LYS A 1 478 ? 6.369   8.318   27.345  1.00 52.48 ? 478  LYS A CD  1 
ATOM   3653 C CE  . LYS A 1 478 ? 5.823   8.880   28.659  1.00 54.94 ? 478  LYS A CE  1 
ATOM   3654 N NZ  . LYS A 1 478 ? 6.744   8.593   29.801  1.00 56.69 ? 478  LYS A NZ  1 
ATOM   3655 N N   . TYR A 1 479 ? 10.058  7.928   23.197  1.00 42.90 ? 479  TYR A N   1 
ATOM   3656 C CA  . TYR A 1 479 ? 10.583  6.996   22.207  1.00 42.64 ? 479  TYR A CA  1 
ATOM   3657 C C   . TYR A 1 479 ? 11.995  6.525   22.587  1.00 41.91 ? 479  TYR A C   1 
ATOM   3658 O O   . TYR A 1 479 ? 12.273  5.321   22.661  1.00 41.65 ? 479  TYR A O   1 
ATOM   3659 C CB  . TYR A 1 479 ? 10.591  7.633   20.818  1.00 43.12 ? 479  TYR A CB  1 
ATOM   3660 C CG  . TYR A 1 479 ? 9.229   7.907   20.203  1.00 43.43 ? 479  TYR A CG  1 
ATOM   3661 C CD1 . TYR A 1 479 ? 8.200   6.956   20.229  1.00 43.05 ? 479  TYR A CD1 1 
ATOM   3662 C CD2 . TYR A 1 479 ? 8.994   9.100   19.537  1.00 45.05 ? 479  TYR A CD2 1 
ATOM   3663 C CE1 . TYR A 1 479 ? 6.956   7.210   19.627  1.00 43.01 ? 479  TYR A CE1 1 
ATOM   3664 C CE2 . TYR A 1 479 ? 7.759   9.378   18.942  1.00 45.09 ? 479  TYR A CE2 1 
ATOM   3665 C CZ  . TYR A 1 479 ? 6.740   8.433   18.976  1.00 44.75 ? 479  TYR A CZ  1 
ATOM   3666 O OH  . TYR A 1 479 ? 5.528   8.748   18.362  1.00 43.26 ? 479  TYR A OH  1 
ATOM   3667 N N   . TRP A 1 480 ? 12.864  7.490   22.870  1.00 41.15 ? 480  TRP A N   1 
ATOM   3668 C CA  . TRP A 1 480 ? 14.257  7.216   23.188  1.00 40.80 ? 480  TRP A CA  1 
ATOM   3669 C C   . TRP A 1 480 ? 14.427  6.324   24.423  1.00 41.65 ? 480  TRP A C   1 
ATOM   3670 O O   . TRP A 1 480 ? 15.093  5.269   24.352  1.00 41.73 ? 480  TRP A O   1 
ATOM   3671 C CB  . TRP A 1 480 ? 15.041  8.524   23.307  1.00 39.31 ? 480  TRP A CB  1 
ATOM   3672 C CG  . TRP A 1 480 ? 15.807  8.871   22.049  1.00 38.59 ? 480  TRP A CG  1 
ATOM   3673 C CD1 . TRP A 1 480 ? 17.159  9.003   21.941  1.00 37.72 ? 480  TRP A CD1 1 
ATOM   3674 C CD2 . TRP A 1 480 ? 15.283  9.111   20.723  1.00 37.97 ? 480  TRP A CD2 1 
ATOM   3675 N NE1 . TRP A 1 480 ? 17.514  9.300   20.649  1.00 36.82 ? 480  TRP A NE1 1 
ATOM   3676 C CE2 . TRP A 1 480 ? 16.393  9.378   19.879  1.00 34.84 ? 480  TRP A CE2 1 
ATOM   3677 C CE3 . TRP A 1 480 ? 13.987  9.123   20.165  1.00 36.52 ? 480  TRP A CE3 1 
ATOM   3678 C CZ2 . TRP A 1 480 ? 16.257  9.653   18.525  1.00 35.80 ? 480  TRP A CZ2 1 
ATOM   3679 C CZ3 . TRP A 1 480 ? 13.844  9.395   18.803  1.00 35.53 ? 480  TRP A CZ3 1 
ATOM   3680 C CH2 . TRP A 1 480 ? 14.972  9.661   17.998  1.00 37.83 ? 480  TRP A CH2 1 
ATOM   3681 N N   . THR A 1 481 ? 13.824  6.724   25.544  1.00 42.04 ? 481  THR A N   1 
ATOM   3682 C CA  . THR A 1 481 ? 13.930  5.940   26.782  1.00 42.29 ? 481  THR A CA  1 
ATOM   3683 C C   . THR A 1 481 ? 13.151  4.634   26.719  1.00 42.19 ? 481  THR A C   1 
ATOM   3684 O O   . THR A 1 481 ? 13.535  3.669   27.357  1.00 42.42 ? 481  THR A O   1 
ATOM   3685 C CB  . THR A 1 481 ? 13.481  6.734   27.997  1.00 42.63 ? 481  THR A CB  1 
ATOM   3686 O OG1 . THR A 1 481 ? 12.176  7.276   27.744  1.00 43.50 ? 481  THR A OG1 1 
ATOM   3687 C CG2 . THR A 1 481 ? 14.445  7.883   28.267  1.00 42.87 ? 481  THR A CG2 1 
ATOM   3688 N N   . ASN A 1 482 ? 12.067  4.580   25.953  1.00 42.22 ? 482  ASN A N   1 
ATOM   3689 C CA  . ASN A 1 482 ? 11.442  3.279   25.712  1.00 42.89 ? 482  ASN A CA  1 
ATOM   3690 C C   . ASN A 1 482 ? 12.402  2.386   24.960  1.00 43.02 ? 482  ASN A C   1 
ATOM   3691 O O   . ASN A 1 482 ? 12.579  1.214   25.330  1.00 43.55 ? 482  ASN A O   1 
ATOM   3692 C CB  . ASN A 1 482 ? 10.084  3.369   24.993  1.00 42.88 ? 482  ASN A CB  1 
ATOM   3693 C CG  . ASN A 1 482 ? 8.968   3.856   25.914  1.00 44.90 ? 482  ASN A CG  1 
ATOM   3694 O OD1 . ASN A 1 482 ? 9.152   3.980   27.133  1.00 47.07 ? 482  ASN A OD1 1 
ATOM   3695 N ND2 . ASN A 1 482 ? 7.816   4.152   25.336  1.00 45.83 ? 482  ASN A ND2 1 
ATOM   3696 N N   . PHE A 1 483 ? 13.043  2.935   23.924  1.00 42.94 ? 483  PHE A N   1 
ATOM   3697 C CA  . PHE A 1 483 ? 14.022  2.160   23.178  1.00 42.91 ? 483  PHE A CA  1 
ATOM   3698 C C   . PHE A 1 483 ? 15.165  1.673   24.066  1.00 43.82 ? 483  PHE A C   1 
ATOM   3699 O O   . PHE A 1 483 ? 15.542  0.507   24.001  1.00 44.07 ? 483  PHE A O   1 
ATOM   3700 C CB  . PHE A 1 483 ? 14.561  2.913   21.973  1.00 42.39 ? 483  PHE A CB  1 
ATOM   3701 C CG  . PHE A 1 483 ? 15.574  2.143   21.221  1.00 40.17 ? 483  PHE A CG  1 
ATOM   3702 C CD1 . PHE A 1 483 ? 15.178  1.135   20.345  1.00 39.63 ? 483  PHE A CD1 1 
ATOM   3703 C CD2 . PHE A 1 483 ? 16.931  2.378   21.420  1.00 38.11 ? 483  PHE A CD2 1 
ATOM   3704 C CE1 . PHE A 1 483 ? 16.130  0.370   19.644  1.00 37.86 ? 483  PHE A CE1 1 
ATOM   3705 C CE2 . PHE A 1 483 ? 17.895  1.627   20.732  1.00 37.57 ? 483  PHE A CE2 1 
ATOM   3706 C CZ  . PHE A 1 483 ? 17.486  0.623   19.834  1.00 38.27 ? 483  PHE A CZ  1 
ATOM   3707 N N   . ALA A 1 484 ? 15.711  2.554   24.900  1.00 45.24 ? 484  ALA A N   1 
ATOM   3708 C CA  . ALA A 1 484 ? 16.772  2.160   25.841  1.00 46.35 ? 484  ALA A CA  1 
ATOM   3709 C C   . ALA A 1 484 ? 16.285  1.080   26.804  1.00 47.37 ? 484  ALA A C   1 
ATOM   3710 O O   . ALA A 1 484 ? 17.026  0.137   27.103  1.00 47.28 ? 484  ALA A O   1 
ATOM   3711 C CB  . ALA A 1 484 ? 17.267  3.351   26.619  1.00 46.13 ? 484  ALA A CB  1 
ATOM   3712 N N   . ARG A 1 485 ? 15.048  1.229   27.298  1.00 48.36 ? 485  ARG A N   1 
ATOM   3713 C CA  . ARG A 1 485 ? 14.478  0.259   28.237  1.00 49.58 ? 485  ARG A CA  1 
ATOM   3714 C C   . ARG A 1 485 ? 14.311  -1.125  27.606  1.00 49.14 ? 485  ARG A C   1 
ATOM   3715 O O   . ARG A 1 485 ? 14.743  -2.109  28.192  1.00 49.16 ? 485  ARG A O   1 
ATOM   3716 C CB  . ARG A 1 485 ? 13.156  0.757   28.861  1.00 49.53 ? 485  ARG A CB  1 
ATOM   3717 C CG  . ARG A 1 485 ? 13.349  1.656   30.100  1.00 51.51 ? 485  ARG A CG  1 
ATOM   3718 C CD  . ARG A 1 485 ? 12.022  2.044   30.803  1.00 51.30 ? 485  ARG A CD  1 
ATOM   3719 N NE  . ARG A 1 485 ? 11.252  3.015   30.016  1.00 54.97 ? 485  ARG A NE  1 
ATOM   3720 C CZ  . ARG A 1 485 ? 11.255  4.340   30.198  1.00 56.33 ? 485  ARG A CZ  1 
ATOM   3721 N NH1 . ARG A 1 485 ? 11.978  4.900   31.172  1.00 56.16 ? 485  ARG A NH1 1 
ATOM   3722 N NH2 . ARG A 1 485 ? 10.523  5.114   29.394  1.00 56.28 ? 485  ARG A NH2 1 
ATOM   3723 N N   . THR A 1 486 ? 13.742  -1.181  26.397  1.00 49.28 ? 486  THR A N   1 
ATOM   3724 C CA  . THR A 1 486 ? 13.222  -2.436  25.839  1.00 49.31 ? 486  THR A CA  1 
ATOM   3725 C C   . THR A 1 486 ? 13.763  -2.873  24.464  1.00 49.79 ? 486  THR A C   1 
ATOM   3726 O O   . THR A 1 486 ? 13.573  -4.018  24.052  1.00 49.96 ? 486  THR A O   1 
ATOM   3727 C CB  . THR A 1 486 ? 11.685  -2.385  25.716  1.00 49.16 ? 486  THR A CB  1 
ATOM   3728 O OG1 . THR A 1 486 ? 11.339  -1.570  24.600  1.00 49.58 ? 486  THR A OG1 1 
ATOM   3729 C CG2 . THR A 1 486 ? 11.017  -1.819  26.980  1.00 48.01 ? 486  THR A CG2 1 
ATOM   3730 N N   . GLY A 1 487 ? 14.429  -1.975  23.750  1.00 50.36 ? 487  GLY A N   1 
ATOM   3731 C CA  . GLY A 1 487 ? 14.822  -2.240  22.365  1.00 50.28 ? 487  GLY A CA  1 
ATOM   3732 C C   . GLY A 1 487 ? 13.680  -1.929  21.409  1.00 50.63 ? 487  GLY A C   1 
ATOM   3733 O O   . GLY A 1 487 ? 13.712  -2.339  20.246  1.00 50.50 ? 487  GLY A O   1 
ATOM   3734 N N   . ASP A 1 488 ? 12.688  -1.178  21.900  1.00 51.12 ? 488  ASP A N   1 
ATOM   3735 C CA  . ASP A 1 488 ? 11.456  -0.896  21.173  1.00 51.92 ? 488  ASP A CA  1 
ATOM   3736 C C   . ASP A 1 488 ? 10.973  0.486   21.576  1.00 52.30 ? 488  ASP A C   1 
ATOM   3737 O O   . ASP A 1 488 ? 10.684  0.710   22.755  1.00 52.52 ? 488  ASP A O   1 
ATOM   3738 C CB  . ASP A 1 488 ? 10.406  -1.944  21.545  1.00 51.94 ? 488  ASP A CB  1 
ATOM   3739 C CG  . ASP A 1 488 ? 9.137   -1.848  20.720  1.00 53.98 ? 488  ASP A CG  1 
ATOM   3740 O OD1 . ASP A 1 488 ? 8.785   -0.767  20.194  1.00 55.96 ? 488  ASP A OD1 1 
ATOM   3741 O OD2 . ASP A 1 488 ? 8.456   -2.884  20.614  1.00 56.87 ? 488  ASP A OD2 1 
ATOM   3742 N N   . PRO A 1 489 ? 10.874  1.423   20.603  1.00 52.96 ? 489  PRO A N   1 
ATOM   3743 C CA  . PRO A 1 489 ? 10.510  2.803   20.944  1.00 53.71 ? 489  PRO A CA  1 
ATOM   3744 C C   . PRO A 1 489 ? 9.030   2.934   21.282  1.00 54.98 ? 489  PRO A C   1 
ATOM   3745 O O   . PRO A 1 489 ? 8.597   3.969   21.786  1.00 54.80 ? 489  PRO A O   1 
ATOM   3746 C CB  . PRO A 1 489 ? 10.848  3.585   19.672  1.00 53.33 ? 489  PRO A CB  1 
ATOM   3747 C CG  . PRO A 1 489 ? 10.777  2.601   18.579  1.00 52.04 ? 489  PRO A CG  1 
ATOM   3748 C CD  . PRO A 1 489 ? 11.106  1.257   19.154  1.00 52.66 ? 489  PRO A CD  1 
ATOM   3749 N N   . ASN A 1 490 ? 8.271   1.873   21.031  1.00 56.70 ? 490  ASN A N   1 
ATOM   3750 C CA  . ASN A 1 490 ? 6.834   1.907   21.242  1.00 58.65 ? 490  ASN A CA  1 
ATOM   3751 C C   . ASN A 1 490 ? 6.440   1.784   22.706  1.00 61.52 ? 490  ASN A C   1 
ATOM   3752 O O   . ASN A 1 490 ? 7.113   1.129   23.502  1.00 61.57 ? 490  ASN A O   1 
ATOM   3753 C CB  . ASN A 1 490 ? 6.149   0.842   20.394  1.00 57.32 ? 490  ASN A CB  1 
ATOM   3754 C CG  . ASN A 1 490 ? 6.191   1.162   18.924  1.00 53.52 ? 490  ASN A CG  1 
ATOM   3755 O OD1 . ASN A 1 490 ? 5.589   2.140   18.465  1.00 48.44 ? 490  ASN A OD1 1 
ATOM   3756 N ND2 . ASN A 1 490 ? 6.901   0.342   18.173  1.00 48.58 ? 490  ASN A ND2 1 
ATOM   3757 N N   . ASP A 1 491 ? 5.358   2.458   23.056  1.00 65.65 ? 491  ASP A N   1 
ATOM   3758 C CA  . ASP A 1 491 ? 4.814   2.377   24.396  1.00 70.05 ? 491  ASP A CA  1 
ATOM   3759 C C   . ASP A 1 491 ? 3.971   1.106   24.549  1.00 72.65 ? 491  ASP A C   1 
ATOM   3760 O O   . ASP A 1 491 ? 2.894   0.989   23.928  1.00 72.64 ? 491  ASP A O   1 
ATOM   3761 C CB  . ASP A 1 491 ? 3.980   3.617   24.708  1.00 70.73 ? 491  ASP A CB  1 
ATOM   3762 C CG  . ASP A 1 491 ? 3.889   3.887   26.199  1.00 73.27 ? 491  ASP A CG  1 
ATOM   3763 O OD1 . ASP A 1 491 ? 4.339   4.990   26.619  1.00 75.31 ? 491  ASP A OD1 1 
ATOM   3764 O OD2 . ASP A 1 491 ? 3.394   2.988   26.939  1.00 75.22 ? 491  ASP A OD2 1 
ATOM   3765 N N   . PRO A 1 492 ? 4.447   0.166   25.399  1.00 75.30 ? 492  PRO A N   1 
ATOM   3766 C CA  . PRO A 1 492 ? 3.952   -1.232  25.447  1.00 77.27 ? 492  PRO A CA  1 
ATOM   3767 C C   . PRO A 1 492 ? 2.436   -1.366  25.706  1.00 78.91 ? 492  PRO A C   1 
ATOM   3768 O O   . PRO A 1 492 ? 1.798   -2.266  25.137  1.00 79.00 ? 492  PRO A O   1 
ATOM   3769 C CB  . PRO A 1 492 ? 4.778   -1.874  26.578  1.00 77.28 ? 492  PRO A CB  1 
ATOM   3770 C CG  . PRO A 1 492 ? 5.261   -0.684  27.423  1.00 77.10 ? 492  PRO A CG  1 
ATOM   3771 C CD  . PRO A 1 492 ? 5.488   0.419   26.418  1.00 75.66 ? 492  PRO A CD  1 
ATOM   3772 N N   . ARG A 1 493 ? 1.869   -0.482  26.534  1.00 80.78 ? 493  ARG A N   1 
ATOM   3773 C CA  . ARG A 1 493 ? 0.409   -0.446  26.713  1.00 82.77 ? 493  ARG A CA  1 
ATOM   3774 C C   . ARG A 1 493 ? -0.219  0.317   25.547  1.00 83.44 ? 493  ARG A C   1 
ATOM   3775 O O   . ARG A 1 493 ? -0.845  -0.289  24.666  1.00 83.70 ? 493  ARG A O   1 
ATOM   3776 C CB  . ARG A 1 493 ? -0.029  0.179   28.059  1.00 83.18 ? 493  ARG A CB  1 
ATOM   3777 C CG  . ARG A 1 493 ? 0.754   -0.247  29.314  1.00 85.30 ? 493  ARG A CG  1 
ATOM   3778 C CD  . ARG A 1 493 ? 1.808   0.805   29.692  1.00 87.91 ? 493  ARG A CD  1 
ATOM   3779 N NE  . ARG A 1 493 ? 2.513   0.460   30.931  1.00 89.70 ? 493  ARG A NE  1 
ATOM   3780 C CZ  . ARG A 1 493 ? 3.358   1.269   31.573  1.00 90.53 ? 493  ARG A CZ  1 
ATOM   3781 N NH1 . ARG A 1 493 ? 3.613   2.487   31.105  1.00 90.62 ? 493  ARG A NH1 1 
ATOM   3782 N NH2 . ARG A 1 493 ? 3.946   0.862   32.695  1.00 90.41 ? 493  ARG A NH2 1 
ATOM   3783 N N   . ASP A 1 494 ? -0.008  1.638   25.545  1.00 84.18 ? 494  ASP A N   1 
ATOM   3784 C CA  . ASP A 1 494 ? -0.588  2.591   24.581  1.00 84.69 ? 494  ASP A CA  1 
ATOM   3785 C C   . ASP A 1 494 ? -0.667  2.131   23.111  1.00 84.72 ? 494  ASP A C   1 
ATOM   3786 O O   . ASP A 1 494 ? 0.082   2.614   22.248  1.00 85.03 ? 494  ASP A O   1 
ATOM   3787 C CB  . ASP A 1 494 ? 0.172   3.915   24.667  1.00 84.79 ? 494  ASP A CB  1 
ATOM   3788 C CG  . ASP A 1 494 ? -0.614  5.060   24.100  1.00 85.99 ? 494  ASP A CG  1 
ATOM   3789 O OD1 . ASP A 1 494 ? -0.803  5.118   22.861  1.00 87.33 ? 494  ASP A OD1 1 
ATOM   3790 O OD2 . ASP A 1 494 ? -1.059  5.901   24.906  1.00 87.63 ? 494  ASP A OD2 1 
ATOM   3791 N N   . SER A 1 495 ? -1.593  1.214   22.835  1.00 84.67 ? 495  SER A N   1 
ATOM   3792 C CA  . SER A 1 495 ? -1.796  0.675   21.481  1.00 84.38 ? 495  SER A CA  1 
ATOM   3793 C C   . SER A 1 495 ? -2.674  1.590   20.615  1.00 83.81 ? 495  SER A C   1 
ATOM   3794 O O   . SER A 1 495 ? -2.788  1.367   19.400  1.00 83.66 ? 495  SER A O   1 
ATOM   3795 C CB  . SER A 1 495 ? -2.356  -0.760  21.531  1.00 84.67 ? 495  SER A CB  1 
ATOM   3796 O OG  . SER A 1 495 ? -3.545  -0.833  22.307  1.00 84.60 ? 495  SER A OG  1 
ATOM   3797 N N   . LYS A 1 496 ? -3.279  2.606   21.256  1.00 83.14 ? 496  LYS A N   1 
ATOM   3798 C CA  . LYS A 1 496 ? -4.003  3.722   20.589  1.00 82.11 ? 496  LYS A CA  1 
ATOM   3799 C C   . LYS A 1 496 ? -3.139  4.446   19.521  1.00 81.20 ? 496  LYS A C   1 
ATOM   3800 O O   . LYS A 1 496 ? -3.452  4.382   18.316  1.00 81.11 ? 496  LYS A O   1 
ATOM   3801 C CB  . LYS A 1 496 ? -4.526  4.734   21.631  1.00 82.05 ? 496  LYS A CB  1 
ATOM   3802 N N   . SER A 1 497 ? -2.060  5.110   19.977  1.00 79.52 ? 497  SER A N   1 
ATOM   3803 C CA  . SER A 1 497 ? -1.048  5.748   19.109  1.00 77.53 ? 497  SER A CA  1 
ATOM   3804 C C   . SER A 1 497 ? -0.556  4.795   18.012  1.00 75.83 ? 497  SER A C   1 
ATOM   3805 O O   . SER A 1 497 ? -0.432  3.573   18.255  1.00 75.93 ? 497  SER A O   1 
ATOM   3806 C CB  . SER A 1 497 ? 0.161   6.211   19.932  1.00 77.64 ? 497  SER A CB  1 
ATOM   3807 O OG  . SER A 1 497 ? -0.219  7.063   20.998  1.00 77.80 ? 497  SER A OG  1 
ATOM   3808 N N   . PRO A 1 498 ? -0.251  5.345   16.812  1.00 73.75 ? 498  PRO A N   1 
ATOM   3809 C CA  . PRO A 1 498 ? 0.172   4.470   15.702  1.00 71.60 ? 498  PRO A CA  1 
ATOM   3810 C C   . PRO A 1 498 ? 1.540   3.877   16.024  1.00 69.27 ? 498  PRO A C   1 
ATOM   3811 O O   . PRO A 1 498 ? 2.370   4.558   16.634  1.00 68.74 ? 498  PRO A O   1 
ATOM   3812 C CB  . PRO A 1 498 ? 0.250   5.413   14.492  1.00 71.65 ? 498  PRO A CB  1 
ATOM   3813 C CG  . PRO A 1 498 ? -0.326  6.741   14.949  1.00 72.84 ? 498  PRO A CG  1 
ATOM   3814 C CD  . PRO A 1 498 ? -0.238  6.776   16.441  1.00 73.58 ? 498  PRO A CD  1 
ATOM   3815 N N   . GLN A 1 499 ? 1.748   2.614   15.652  1.00 66.27 ? 499  GLN A N   1 
ATOM   3816 C CA  . GLN A 1 499 ? 2.992   1.917   15.955  1.00 63.36 ? 499  GLN A CA  1 
ATOM   3817 C C   . GLN A 1 499 ? 4.126   2.274   14.981  1.00 61.32 ? 499  GLN A C   1 
ATOM   3818 O O   . GLN A 1 499 ? 3.911   2.448   13.781  1.00 61.36 ? 499  GLN A O   1 
ATOM   3819 C CB  . GLN A 1 499 ? 2.772   0.398   15.990  1.00 63.39 ? 499  GLN A CB  1 
ATOM   3820 C CG  . GLN A 1 499 ? 1.750   -0.054  17.029  1.00 63.88 ? 499  GLN A CG  1 
ATOM   3821 C CD  . GLN A 1 499 ? 2.119   0.342   18.468  1.00 63.73 ? 499  GLN A CD  1 
ATOM   3822 O OE1 . GLN A 1 499 ? 3.039   -0.236  19.066  1.00 62.30 ? 499  GLN A OE1 1 
ATOM   3823 N NE2 . GLN A 1 499 ? 1.383   1.321   19.032  1.00 62.16 ? 499  GLN A NE2 1 
ATOM   3824 N N   . TRP A 1 500 ? 5.329   2.396   15.527  1.00 58.14 ? 500  TRP A N   1 
ATOM   3825 C CA  . TRP A 1 500 ? 6.541   2.548   14.759  1.00 55.16 ? 500  TRP A CA  1 
ATOM   3826 C C   . TRP A 1 500 ? 6.986   1.116   14.463  1.00 54.04 ? 500  TRP A C   1 
ATOM   3827 O O   . TRP A 1 500 ? 7.351   0.395   15.381  1.00 53.99 ? 500  TRP A O   1 
ATOM   3828 C CB  . TRP A 1 500 ? 7.558   3.287   15.640  1.00 54.07 ? 500  TRP A CB  1 
ATOM   3829 C CG  . TRP A 1 500 ? 8.886   3.660   15.051  1.00 52.53 ? 500  TRP A CG  1 
ATOM   3830 C CD1 . TRP A 1 500 ? 9.508   3.107   13.963  1.00 51.95 ? 500  TRP A CD1 1 
ATOM   3831 C CD2 . TRP A 1 500 ? 9.790   4.637   15.572  1.00 51.82 ? 500  TRP A CD2 1 
ATOM   3832 N NE1 . TRP A 1 500 ? 10.733  3.706   13.759  1.00 52.32 ? 500  TRP A NE1 1 
ATOM   3833 C CE2 . TRP A 1 500 ? 10.930  4.645   14.737  1.00 51.56 ? 500  TRP A CE2 1 
ATOM   3834 C CE3 . TRP A 1 500 ? 9.744   5.519   16.662  1.00 50.97 ? 500  TRP A CE3 1 
ATOM   3835 C CZ2 . TRP A 1 500 ? 12.002  5.499   14.954  1.00 51.19 ? 500  TRP A CZ2 1 
ATOM   3836 C CZ3 . TRP A 1 500 ? 10.815  6.363   16.879  1.00 51.20 ? 500  TRP A CZ3 1 
ATOM   3837 C CH2 . TRP A 1 500 ? 11.928  6.349   16.029  1.00 51.14 ? 500  TRP A CH2 1 
ATOM   3838 N N   . PRO A 1 501 ? 6.915   0.678   13.190  1.00 52.97 ? 501  PRO A N   1 
ATOM   3839 C CA  . PRO A 1 501 ? 7.354   -0.671  12.884  1.00 52.17 ? 501  PRO A CA  1 
ATOM   3840 C C   . PRO A 1 501 ? 8.848   -0.735  12.688  1.00 51.42 ? 501  PRO A C   1 
ATOM   3841 O O   . PRO A 1 501 ? 9.442   0.270   12.344  1.00 51.48 ? 501  PRO A O   1 
ATOM   3842 C CB  . PRO A 1 501 ? 6.673   -0.955  11.541  1.00 52.26 ? 501  PRO A CB  1 
ATOM   3843 C CG  . PRO A 1 501 ? 6.525   0.355   10.897  1.00 52.08 ? 501  PRO A CG  1 
ATOM   3844 C CD  . PRO A 1 501 ? 6.411   1.377   11.990  1.00 52.95 ? 501  PRO A CD  1 
ATOM   3845 N N   . PRO A 1 502 ? 9.460   -1.908  12.895  1.00 50.96 ? 502  PRO A N   1 
ATOM   3846 C CA  . PRO A 1 502 ? 10.862  -2.050  12.479  1.00 50.90 ? 502  PRO A CA  1 
ATOM   3847 C C   . PRO A 1 502 ? 11.146  -1.742  10.998  1.00 50.94 ? 502  PRO A C   1 
ATOM   3848 O O   . PRO A 1 502 ? 10.309  -1.975  10.126  1.00 51.01 ? 502  PRO A O   1 
ATOM   3849 C CB  . PRO A 1 502 ? 11.195  -3.520  12.807  1.00 50.68 ? 502  PRO A CB  1 
ATOM   3850 C CG  . PRO A 1 502 ? 10.241  -3.891  13.882  1.00 50.53 ? 502  PRO A CG  1 
ATOM   3851 C CD  . PRO A 1 502 ? 8.963   -3.120  13.571  1.00 50.80 ? 502  PRO A CD  1 
ATOM   3852 N N   . TYR A 1 503 ? 12.328  -1.193  10.735  1.00 50.82 ? 503  TYR A N   1 
ATOM   3853 C CA  . TYR A 1 503 ? 12.819  -1.082  9.392   1.00 50.32 ? 503  TYR A CA  1 
ATOM   3854 C C   . TYR A 1 503 ? 13.297  -2.460  8.928   1.00 51.19 ? 503  TYR A C   1 
ATOM   3855 O O   . TYR A 1 503 ? 14.074  -3.129  9.624   1.00 51.61 ? 503  TYR A O   1 
ATOM   3856 C CB  . TYR A 1 503 ? 13.958  -0.073  9.335   1.00 49.54 ? 503  TYR A CB  1 
ATOM   3857 C CG  . TYR A 1 503 ? 14.550  0.090   7.954   1.00 48.11 ? 503  TYR A CG  1 
ATOM   3858 C CD1 . TYR A 1 503 ? 15.625  -0.702  7.533   1.00 45.56 ? 503  TYR A CD1 1 
ATOM   3859 C CD2 . TYR A 1 503 ? 14.032  1.029   7.061   1.00 47.11 ? 503  TYR A CD2 1 
ATOM   3860 C CE1 . TYR A 1 503 ? 16.166  -0.556  6.265   1.00 46.35 ? 503  TYR A CE1 1 
ATOM   3861 C CE2 . TYR A 1 503 ? 14.579  1.181   5.786   1.00 47.28 ? 503  TYR A CE2 1 
ATOM   3862 C CZ  . TYR A 1 503 ? 15.643  0.384   5.399   1.00 46.85 ? 503  TYR A CZ  1 
ATOM   3863 O OH  . TYR A 1 503 ? 16.171  0.523   4.143   1.00 47.27 ? 503  TYR A OH  1 
ATOM   3864 N N   . THR A 1 504 ? 12.831  -2.870  7.747   1.00 51.68 ? 504  THR A N   1 
ATOM   3865 C CA  . THR A 1 504 ? 13.152  -4.171  7.150   1.00 51.98 ? 504  THR A CA  1 
ATOM   3866 C C   . THR A 1 504 ? 13.558  -3.989  5.692   1.00 52.52 ? 504  THR A C   1 
ATOM   3867 O O   . THR A 1 504 ? 13.111  -3.046  5.050   1.00 52.32 ? 504  THR A O   1 
ATOM   3868 C CB  . THR A 1 504 ? 11.920  -5.126  7.207   1.00 52.13 ? 504  THR A CB  1 
ATOM   3869 O OG1 . THR A 1 504 ? 10.789  -4.524  6.539   1.00 51.49 ? 504  THR A OG1 1 
ATOM   3870 C CG2 . THR A 1 504 ? 11.558  -5.456  8.667   1.00 51.03 ? 504  THR A CG2 1 
ATOM   3871 N N   . THR A 1 505 ? 14.386  -4.888  5.160   1.00 53.25 ? 505  THR A N   1 
ATOM   3872 C CA  . THR A 1 505 ? 14.801  -4.776  3.753   1.00 54.24 ? 505  THR A CA  1 
ATOM   3873 C C   . THR A 1 505 ? 13.629  -4.953  2.801   1.00 54.27 ? 505  THR A C   1 
ATOM   3874 O O   . THR A 1 505 ? 13.553  -4.254  1.780   1.00 54.35 ? 505  THR A O   1 
ATOM   3875 C CB  . THR A 1 505 ? 15.867  -5.779  3.362   1.00 54.41 ? 505  THR A CB  1 
ATOM   3876 O OG1 . THR A 1 505 ? 15.383  -7.087  3.671   1.00 56.36 ? 505  THR A OG1 1 
ATOM   3877 C CG2 . THR A 1 505 ? 17.185  -5.498  4.107   1.00 54.53 ? 505  THR A CG2 1 
ATOM   3878 N N   . ALA A 1 506 ? 12.720  -5.875  3.143   1.00 54.26 ? 506  ALA A N   1 
ATOM   3879 C CA  . ALA A 1 506 ? 11.466  -6.059  2.383   1.00 53.96 ? 506  ALA A CA  1 
ATOM   3880 C C   . ALA A 1 506 ? 10.614  -4.786  2.327   1.00 53.28 ? 506  ALA A C   1 
ATOM   3881 O O   . ALA A 1 506 ? 10.250  -4.368  1.254   1.00 53.63 ? 506  ALA A O   1 
ATOM   3882 C CB  . ALA A 1 506 ? 10.624  -7.247  2.927   1.00 53.90 ? 506  ALA A CB  1 
ATOM   3883 N N   . ALA A 1 507 ? 10.317  -4.167  3.466   1.00 52.39 ? 507  ALA A N   1 
ATOM   3884 C CA  . ALA A 1 507 ? 9.378   -3.036  3.473   1.00 51.82 ? 507  ALA A CA  1 
ATOM   3885 C C   . ALA A 1 507 ? 9.993   -1.639  3.693   1.00 51.05 ? 507  ALA A C   1 
ATOM   3886 O O   . ALA A 1 507 ? 9.346   -0.624  3.423   1.00 50.68 ? 507  ALA A O   1 
ATOM   3887 C CB  . ALA A 1 507 ? 8.223   -3.286  4.461   1.00 51.53 ? 507  ALA A CB  1 
ATOM   3888 N N   . GLN A 1 508 ? 11.220  -1.587  4.198   1.00 50.47 ? 508  GLN A N   1 
ATOM   3889 C CA  . GLN A 1 508 ? 11.933  -0.315  4.385   1.00 49.75 ? 508  GLN A CA  1 
ATOM   3890 C C   . GLN A 1 508 ? 11.055  0.772   5.006   1.00 48.85 ? 508  GLN A C   1 
ATOM   3891 O O   . GLN A 1 508 ? 10.928  1.867   4.464   1.00 48.43 ? 508  GLN A O   1 
ATOM   3892 C CB  . GLN A 1 508 ? 12.503  0.180   3.051   1.00 49.73 ? 508  GLN A CB  1 
ATOM   3893 C CG  . GLN A 1 508 ? 13.194  -0.878  2.244   1.00 51.14 ? 508  GLN A CG  1 
ATOM   3894 C CD  . GLN A 1 508 ? 13.551  -0.397  0.861   1.00 53.55 ? 508  GLN A CD  1 
ATOM   3895 O OE1 . GLN A 1 508 ? 14.130  0.681   0.703   1.00 55.33 ? 508  GLN A OE1 1 
ATOM   3896 N NE2 . GLN A 1 508 ? 13.222  -1.198  -0.157  1.00 52.62 ? 508  GLN A NE2 1 
ATOM   3897 N N   . GLN A 1 509 ? 10.436  0.461   6.135   1.00 48.36 ? 509  GLN A N   1 
ATOM   3898 C CA  . GLN A 1 509 ? 9.584   1.427   6.811   1.00 47.90 ? 509  GLN A CA  1 
ATOM   3899 C C   . GLN A 1 509 ? 10.344  2.245   7.844   1.00 47.17 ? 509  GLN A C   1 
ATOM   3900 O O   . GLN A 1 509 ? 11.268  1.748   8.516   1.00 46.60 ? 509  GLN A O   1 
ATOM   3901 C CB  . GLN A 1 509 ? 8.398   0.736   7.485   1.00 48.39 ? 509  GLN A CB  1 
ATOM   3902 C CG  . GLN A 1 509 ? 7.273   0.285   6.540   1.00 48.72 ? 509  GLN A CG  1 
ATOM   3903 C CD  . GLN A 1 509 ? 6.300   -0.677  7.230   1.00 47.84 ? 509  GLN A CD  1 
ATOM   3904 O OE1 . GLN A 1 509 ? 6.632   -1.847  7.463   1.00 46.99 ? 509  GLN A OE1 1 
ATOM   3905 N NE2 . GLN A 1 509 ? 5.113   -0.178  7.583   1.00 46.21 ? 509  GLN A NE2 1 
ATOM   3906 N N   . TYR A 1 510 ? 9.923   3.500   7.959   1.00 46.13 ? 510  TYR A N   1 
ATOM   3907 C CA  . TYR A 1 510 ? 10.494  4.453   8.880   1.00 45.90 ? 510  TYR A CA  1 
ATOM   3908 C C   . TYR A 1 510 ? 9.405   5.443   9.239   1.00 46.10 ? 510  TYR A C   1 
ATOM   3909 O O   . TYR A 1 510 ? 8.387   5.503   8.551   1.00 46.53 ? 510  TYR A O   1 
ATOM   3910 C CB  . TYR A 1 510 ? 11.703  5.153   8.244   1.00 45.88 ? 510  TYR A CB  1 
ATOM   3911 C CG  . TYR A 1 510 ? 11.420  6.076   7.078   1.00 45.14 ? 510  TYR A CG  1 
ATOM   3912 C CD1 . TYR A 1 510 ? 11.333  5.589   5.766   1.00 45.76 ? 510  TYR A CD1 1 
ATOM   3913 C CD2 . TYR A 1 510 ? 11.295  7.436   7.275   1.00 44.93 ? 510  TYR A CD2 1 
ATOM   3914 C CE1 . TYR A 1 510 ? 11.091  6.443   4.694   1.00 44.39 ? 510  TYR A CE1 1 
ATOM   3915 C CE2 . TYR A 1 510 ? 11.046  8.289   6.218   1.00 46.19 ? 510  TYR A CE2 1 
ATOM   3916 C CZ  . TYR A 1 510 ? 10.955  7.790   4.929   1.00 45.71 ? 510  TYR A CZ  1 
ATOM   3917 O OH  . TYR A 1 510 ? 10.716  8.674   3.894   1.00 46.03 ? 510  TYR A OH  1 
ATOM   3918 N N   . VAL A 1 511 ? 9.580   6.214   10.306  1.00 45.92 ? 511  VAL A N   1 
ATOM   3919 C CA  . VAL A 1 511 ? 8.531   7.163   10.662  1.00 46.14 ? 511  VAL A CA  1 
ATOM   3920 C C   . VAL A 1 511 ? 8.943   8.623   10.540  1.00 46.27 ? 511  VAL A C   1 
ATOM   3921 O O   . VAL A 1 511 ? 10.125  8.949   10.572  1.00 46.64 ? 511  VAL A O   1 
ATOM   3922 C CB  . VAL A 1 511 ? 7.953   6.899   12.061  1.00 46.25 ? 511  VAL A CB  1 
ATOM   3923 C CG1 . VAL A 1 511 ? 7.241   5.568   12.100  1.00 45.82 ? 511  VAL A CG1 1 
ATOM   3924 C CG2 . VAL A 1 511 ? 9.040   6.971   13.117  1.00 46.74 ? 511  VAL A CG2 1 
ATOM   3925 N N   . SER A 1 512 ? 7.956   9.496   10.382  1.00 46.63 ? 512  SER A N   1 
ATOM   3926 C CA  . SER A 1 512 ? 8.184   10.925  10.428  1.00 47.00 ? 512  SER A CA  1 
ATOM   3927 C C   . SER A 1 512 ? 8.059   11.405  11.872  1.00 46.93 ? 512  SER A C   1 
ATOM   3928 O O   . SER A 1 512 ? 7.117   11.040  12.580  1.00 47.03 ? 512  SER A O   1 
ATOM   3929 C CB  . SER A 1 512 ? 7.217   11.672  9.502   1.00 47.23 ? 512  SER A CB  1 
ATOM   3930 O OG  . SER A 1 512 ? 5.844   11.491  9.871   1.00 49.77 ? 512  SER A OG  1 
ATOM   3931 N N   . LEU A 1 513 ? 9.043   12.182  12.321  1.00 46.61 ? 513  LEU A N   1 
ATOM   3932 C CA  . LEU A 1 513 ? 8.966   12.816  13.612  1.00 46.39 ? 513  LEU A CA  1 
ATOM   3933 C C   . LEU A 1 513 ? 8.699   14.295  13.368  1.00 47.25 ? 513  LEU A C   1 
ATOM   3934 O O   . LEU A 1 513 ? 9.550   15.030  12.849  1.00 47.59 ? 513  LEU A O   1 
ATOM   3935 C CB  . LEU A 1 513 ? 10.225  12.562  14.458  1.00 45.86 ? 513  LEU A CB  1 
ATOM   3936 C CG  . LEU A 1 513 ? 10.628  11.104  14.767  1.00 44.02 ? 513  LEU A CG  1 
ATOM   3937 C CD1 . LEU A 1 513 ? 11.933  11.044  15.518  1.00 42.61 ? 513  LEU A CD1 1 
ATOM   3938 C CD2 . LEU A 1 513 ? 9.622   10.424  15.588  1.00 43.32 ? 513  LEU A CD2 1 
ATOM   3939 N N   . ASN A 1 514 ? 7.477   14.700  13.690  1.00 47.77 ? 514  ASN A N   1 
ATOM   3940 C CA  . ASN A 1 514 ? 7.069   16.096  13.653  1.00 48.80 ? 514  ASN A CA  1 
ATOM   3941 C C   . ASN A 1 514 ? 5.904   16.303  14.621  1.00 49.45 ? 514  ASN A C   1 
ATOM   3942 O O   . ASN A 1 514 ? 5.651   15.448  15.480  1.00 49.30 ? 514  ASN A O   1 
ATOM   3943 C CB  . ASN A 1 514 ? 6.714   16.539  12.226  1.00 48.88 ? 514  ASN A CB  1 
ATOM   3944 C CG  . ASN A 1 514 ? 5.830   15.533  11.503  1.00 48.10 ? 514  ASN A CG  1 
ATOM   3945 O OD1 . ASN A 1 514 ? 4.810   15.098  12.043  1.00 47.18 ? 514  ASN A OD1 1 
ATOM   3946 N ND2 . ASN A 1 514 ? 6.218   15.158  10.274  1.00 44.82 ? 514  ASN A ND2 1 
ATOM   3947 N N   . LEU A 1 515 ? 5.213   17.435  14.503  1.00 50.48 ? 515  LEU A N   1 
ATOM   3948 C CA  . LEU A 1 515 ? 4.175   17.790  15.473  1.00 51.26 ? 515  LEU A CA  1 
ATOM   3949 C C   . LEU A 1 515 ? 2.925   16.957  15.277  1.00 52.36 ? 515  LEU A C   1 
ATOM   3950 O O   . LEU A 1 515 ? 2.198   16.718  16.220  1.00 53.15 ? 515  LEU A O   1 
ATOM   3951 C CB  . LEU A 1 515 ? 3.855   19.277  15.415  1.00 50.82 ? 515  LEU A CB  1 
ATOM   3952 C CG  . LEU A 1 515 ? 5.018   20.226  15.725  1.00 50.36 ? 515  LEU A CG  1 
ATOM   3953 C CD1 . LEU A 1 515 ? 4.611   21.667  15.516  1.00 49.09 ? 515  LEU A CD1 1 
ATOM   3954 C CD2 . LEU A 1 515 ? 5.559   20.023  17.144  1.00 48.57 ? 515  LEU A CD2 1 
ATOM   3955 N N   . LYS A 1 516 ? 2.694   16.504  14.048  1.00 53.57 ? 516  LYS A N   1 
ATOM   3956 C CA  . LYS A 1 516 ? 1.643   15.537  13.739  1.00 54.84 ? 516  LYS A CA  1 
ATOM   3957 C C   . LYS A 1 516 ? 2.017   14.167  14.316  1.00 54.52 ? 516  LYS A C   1 
ATOM   3958 O O   . LYS A 1 516 ? 3.192   13.891  14.530  1.00 54.04 ? 516  LYS A O   1 
ATOM   3959 C CB  . LYS A 1 516 ? 1.436   15.435  12.221  1.00 54.41 ? 516  LYS A CB  1 
ATOM   3960 C CG  . LYS A 1 516 ? 0.808   16.685  11.562  1.00 57.05 ? 516  LYS A CG  1 
ATOM   3961 C CD  . LYS A 1 516 ? 0.943   16.652  9.999   1.00 57.63 ? 516  LYS A CD  1 
ATOM   3962 C CE  . LYS A 1 516 ? 0.076   15.529  9.316   1.00 61.43 ? 516  LYS A CE  1 
ATOM   3963 N NZ  . LYS A 1 516 ? 0.333   15.378  7.834   1.00 60.17 ? 516  LYS A NZ  1 
ATOM   3964 N N   . PRO A 1 517 ? 1.008   13.319  14.609  1.00 54.77 ? 517  PRO A N   1 
ATOM   3965 C CA  . PRO A 1 517 ? 1.245   11.950  15.067  1.00 54.20 ? 517  PRO A CA  1 
ATOM   3966 C C   . PRO A 1 517 ? 2.086   11.174  14.078  1.00 54.30 ? 517  PRO A C   1 
ATOM   3967 O O   . PRO A 1 517 ? 2.099   11.514  12.890  1.00 54.05 ? 517  PRO A O   1 
ATOM   3968 C CB  . PRO A 1 517 ? -0.165  11.348  15.108  1.00 54.19 ? 517  PRO A CB  1 
ATOM   3969 C CG  . PRO A 1 517 ? -1.068  12.502  15.314  1.00 54.05 ? 517  PRO A CG  1 
ATOM   3970 C CD  . PRO A 1 517 ? -0.437  13.645  14.568  1.00 54.65 ? 517  PRO A CD  1 
ATOM   3971 N N   . LEU A 1 518 ? 2.757   10.130  14.570  1.00 54.55 ? 518  LEU A N   1 
ATOM   3972 C CA  . LEU A 1 518 ? 3.606   9.263   13.755  1.00 54.70 ? 518  LEU A CA  1 
ATOM   3973 C C   . LEU A 1 518 ? 2.948   8.823   12.463  1.00 55.28 ? 518  LEU A C   1 
ATOM   3974 O O   . LEU A 1 518 ? 1.896   8.201   12.491  1.00 55.48 ? 518  LEU A O   1 
ATOM   3975 C CB  . LEU A 1 518 ? 3.981   7.993   14.517  1.00 54.58 ? 518  LEU A CB  1 
ATOM   3976 C CG  . LEU A 1 518 ? 5.169   7.914   15.465  1.00 53.71 ? 518  LEU A CG  1 
ATOM   3977 C CD1 . LEU A 1 518 ? 5.721   6.497   15.414  1.00 52.49 ? 518  LEU A CD1 1 
ATOM   3978 C CD2 . LEU A 1 518 ? 6.222   8.897   15.078  1.00 53.76 ? 518  LEU A CD2 1 
ATOM   3979 N N   . GLU A 1 519 ? 3.588   9.130   11.338  1.00 55.65 ? 519  GLU A N   1 
ATOM   3980 C CA  . GLU A 1 519 ? 3.168   8.650   10.023  1.00 55.95 ? 519  GLU A CA  1 
ATOM   3981 C C   . GLU A 1 519 ? 4.247   7.716   9.489   1.00 54.82 ? 519  GLU A C   1 
ATOM   3982 O O   . GLU A 1 519 ? 5.439   7.938   9.733   1.00 54.73 ? 519  GLU A O   1 
ATOM   3983 C CB  . GLU A 1 519 ? 2.925   9.842   9.090   1.00 55.89 ? 519  GLU A CB  1 
ATOM   3984 C CG  . GLU A 1 519 ? 2.794   9.521   7.586   1.00 58.57 ? 519  GLU A CG  1 
ATOM   3985 C CD  . GLU A 1 519 ? 2.596   10.788  6.755   1.00 58.97 ? 519  GLU A CD  1 
ATOM   3986 O OE1 . GLU A 1 519 ? 1.771   11.635  7.196   1.00 62.77 ? 519  GLU A OE1 1 
ATOM   3987 O OE2 . GLU A 1 519 ? 3.271   10.946  5.693   1.00 61.28 ? 519  GLU A OE2 1 
ATOM   3988 N N   . VAL A 1 520 ? 3.826   6.657   8.795   1.00 53.87 ? 520  VAL A N   1 
ATOM   3989 C CA  . VAL A 1 520 ? 4.741   5.621   8.315   1.00 52.49 ? 520  VAL A CA  1 
ATOM   3990 C C   . VAL A 1 520 ? 4.984   5.761   6.818   1.00 52.50 ? 520  VAL A C   1 
ATOM   3991 O O   . VAL A 1 520 ? 4.038   5.844   6.030   1.00 52.16 ? 520  VAL A O   1 
ATOM   3992 C CB  . VAL A 1 520 ? 4.238   4.201   8.647   1.00 52.33 ? 520  VAL A CB  1 
ATOM   3993 C CG1 . VAL A 1 520 ? 5.208   3.144   8.133   1.00 51.55 ? 520  VAL A CG1 1 
ATOM   3994 C CG2 . VAL A 1 520 ? 4.042   4.043   10.146  1.00 51.42 ? 520  VAL A CG2 1 
ATOM   3995 N N   . ARG A 1 521 ? 6.263   5.798   6.439   1.00 52.15 ? 521  ARG A N   1 
ATOM   3996 C CA  . ARG A 1 521 ? 6.660   5.957   5.045   1.00 51.64 ? 521  ARG A CA  1 
ATOM   3997 C C   . ARG A 1 521 ? 7.570   4.816   4.637   1.00 51.78 ? 521  ARG A C   1 
ATOM   3998 O O   . ARG A 1 521 ? 8.111   4.105   5.485   1.00 51.77 ? 521  ARG A O   1 
ATOM   3999 C CB  . ARG A 1 521 ? 7.353   7.300   4.811   1.00 51.27 ? 521  ARG A CB  1 
ATOM   4000 C CG  . ARG A 1 521 ? 6.850   8.425   5.675   1.00 50.78 ? 521  ARG A CG  1 
ATOM   4001 C CD  . ARG A 1 521 ? 6.826   9.709   4.907   1.00 50.68 ? 521  ARG A CD  1 
ATOM   4002 N NE  . ARG A 1 521 ? 6.528   10.877  5.729   1.00 48.68 ? 521  ARG A NE  1 
ATOM   4003 C CZ  . ARG A 1 521 ? 7.308   11.952  5.786   1.00 48.36 ? 521  ARG A CZ  1 
ATOM   4004 N NH1 . ARG A 1 521 ? 8.423   12.009  5.073   1.00 48.01 ? 521  ARG A NH1 1 
ATOM   4005 N NH2 . ARG A 1 521 ? 6.968   12.980  6.544   1.00 49.17 ? 521  ARG A NH2 1 
ATOM   4006 N N   . ARG A 1 522 ? 7.719   4.621   3.337   1.00 51.98 ? 522  ARG A N   1 
ATOM   4007 C CA  . ARG A 1 522 ? 8.509   3.501   2.849   1.00 53.13 ? 522  ARG A CA  1 
ATOM   4008 C C   . ARG A 1 522 ? 9.624   3.985   1.914   1.00 52.59 ? 522  ARG A C   1 
ATOM   4009 O O   . ARG A 1 522 ? 9.445   4.932   1.127   1.00 52.04 ? 522  ARG A O   1 
ATOM   4010 C CB  . ARG A 1 522 ? 7.634   2.406   2.188   1.00 52.98 ? 522  ARG A CB  1 
ATOM   4011 C CG  . ARG A 1 522 ? 6.223   2.121   2.853   1.00 55.37 ? 522  ARG A CG  1 
ATOM   4012 C CD  . ARG A 1 522 ? 5.721   0.670   2.657   1.00 55.81 ? 522  ARG A CD  1 
ATOM   4013 N NE  . ARG A 1 522 ? 5.818   0.251   1.255   1.00 63.36 ? 522  ARG A NE  1 
ATOM   4014 C CZ  . ARG A 1 522 ? 6.805   -0.493  0.735   1.00 67.15 ? 522  ARG A CZ  1 
ATOM   4015 N NH1 . ARG A 1 522 ? 7.792   -0.940  1.500   1.00 69.58 ? 522  ARG A NH1 1 
ATOM   4016 N NH2 . ARG A 1 522 ? 6.818   -0.800  -0.562  1.00 68.25 ? 522  ARG A NH2 1 
ATOM   4017 N N   . GLY A 1 523 ? 10.782  3.334   2.032   1.00 52.45 ? 523  GLY A N   1 
ATOM   4018 C CA  . GLY A 1 523 ? 11.962  3.675   1.252   1.00 52.51 ? 523  GLY A CA  1 
ATOM   4019 C C   . GLY A 1 523 ? 12.596  4.982   1.676   1.00 52.63 ? 523  GLY A C   1 
ATOM   4020 O O   . GLY A 1 523 ? 11.952  6.047   1.686   1.00 52.65 ? 523  GLY A O   1 
ATOM   4021 N N   . LEU A 1 524 ? 13.870  4.906   2.032   1.00 52.65 ? 524  LEU A N   1 
ATOM   4022 C CA  . LEU A 1 524 ? 14.586  6.098   2.446   1.00 52.53 ? 524  LEU A CA  1 
ATOM   4023 C C   . LEU A 1 524 ? 15.375  6.602   1.270   1.00 51.90 ? 524  LEU A C   1 
ATOM   4024 O O   . LEU A 1 524 ? 16.455  6.079   0.985   1.00 52.07 ? 524  LEU A O   1 
ATOM   4025 C CB  . LEU A 1 524 ? 15.515  5.763   3.597   1.00 52.98 ? 524  LEU A CB  1 
ATOM   4026 C CG  . LEU A 1 524 ? 15.707  6.879   4.619   1.00 55.14 ? 524  LEU A CG  1 
ATOM   4027 C CD1 . LEU A 1 524 ? 14.816  8.147   4.350   1.00 56.26 ? 524  LEU A CD1 1 
ATOM   4028 C CD2 . LEU A 1 524 ? 15.472  6.273   6.020   1.00 56.53 ? 524  LEU A CD2 1 
ATOM   4029 N N   . ARG A 1 525 ? 14.838  7.608   0.585   1.00 51.13 ? 525  ARG A N   1 
ATOM   4030 C CA  . ARG A 1 525 ? 15.416  8.067   -0.677  1.00 50.96 ? 525  ARG A CA  1 
ATOM   4031 C C   . ARG A 1 525 ? 15.911  6.859   -1.455  1.00 50.32 ? 525  ARG A C   1 
ATOM   4032 O O   . ARG A 1 525 ? 17.084  6.801   -1.819  1.00 50.37 ? 525  ARG A O   1 
ATOM   4033 C CB  . ARG A 1 525 ? 16.618  8.973   -0.429  1.00 50.94 ? 525  ARG A CB  1 
ATOM   4034 C CG  . ARG A 1 525 ? 16.337  10.224  0.338   1.00 51.97 ? 525  ARG A CG  1 
ATOM   4035 C CD  . ARG A 1 525 ? 16.061  11.362  -0.580  1.00 53.66 ? 525  ARG A CD  1 
ATOM   4036 N NE  . ARG A 1 525 ? 16.697  12.586  -0.107  1.00 55.56 ? 525  ARG A NE  1 
ATOM   4037 C CZ  . ARG A 1 525 ? 16.311  13.302  0.951   1.00 55.25 ? 525  ARG A CZ  1 
ATOM   4038 N NH1 . ARG A 1 525 ? 15.279  12.920  1.703   1.00 55.49 ? 525  ARG A NH1 1 
ATOM   4039 N NH2 . ARG A 1 525 ? 16.973  14.411  1.259   1.00 53.48 ? 525  ARG A NH2 1 
ATOM   4040 N N   . ALA A 1 526 ? 15.035  5.886   -1.689  1.00 49.80 ? 526  ALA A N   1 
ATOM   4041 C CA  . ALA A 1 526 ? 15.476  4.597   -2.236  1.00 48.77 ? 526  ALA A CA  1 
ATOM   4042 C C   . ALA A 1 526 ? 16.127  4.749   -3.613  1.00 48.11 ? 526  ALA A C   1 
ATOM   4043 O O   . ALA A 1 526 ? 17.238  4.246   -3.806  1.00 47.88 ? 526  ALA A O   1 
ATOM   4044 C CB  . ALA A 1 526 ? 14.338  3.566   -2.244  1.00 48.66 ? 526  ALA A CB  1 
ATOM   4045 N N   . GLN A 1 527 ? 15.483  5.483   -4.532  1.00 47.19 ? 527  GLN A N   1 
ATOM   4046 C CA  . GLN A 1 527 ? 16.025  5.644   -5.897  1.00 46.76 ? 527  GLN A CA  1 
ATOM   4047 C C   . GLN A 1 527 ? 17.363  6.337   -5.832  1.00 46.19 ? 527  GLN A C   1 
ATOM   4048 O O   . GLN A 1 527 ? 18.360  5.834   -6.347  1.00 45.98 ? 527  GLN A O   1 
ATOM   4049 C CB  . GLN A 1 527 ? 15.090  6.430   -6.845  1.00 46.71 ? 527  GLN A CB  1 
ATOM   4050 C CG  . GLN A 1 527 ? 13.959  5.637   -7.532  1.00 47.20 ? 527  GLN A CG  1 
ATOM   4051 C CD  . GLN A 1 527 ? 14.350  4.242   -8.032  1.00 48.06 ? 527  GLN A CD  1 
ATOM   4052 O OE1 . GLN A 1 527 ? 14.033  3.245   -7.393  1.00 51.11 ? 527  GLN A OE1 1 
ATOM   4053 N NE2 . GLN A 1 527 ? 15.030  4.169   -9.169  1.00 48.10 ? 527  GLN A NE2 1 
ATOM   4054 N N   . THR A 1 528 ? 17.377  7.494   -5.174  1.00 45.63 ? 528  THR A N   1 
ATOM   4055 C CA  . THR A 1 528 ? 18.588  8.288   -5.054  1.00 44.46 ? 528  THR A CA  1 
ATOM   4056 C C   . THR A 1 528 ? 19.694  7.516   -4.362  1.00 43.99 ? 528  THR A C   1 
ATOM   4057 O O   . THR A 1 528 ? 20.831  7.608   -4.768  1.00 43.95 ? 528  THR A O   1 
ATOM   4058 C CB  . THR A 1 528 ? 18.307  9.610   -4.337  1.00 44.78 ? 528  THR A CB  1 
ATOM   4059 O OG1 . THR A 1 528 ? 17.474  10.408  -5.187  1.00 43.74 ? 528  THR A OG1 1 
ATOM   4060 C CG2 . THR A 1 528 ? 19.613  10.380  -4.003  1.00 43.21 ? 528  THR A CG2 1 
ATOM   4061 N N   . CYS A 1 529 ? 19.371  6.737   -3.341  1.00 43.33 ? 529  CYS A N   1 
ATOM   4062 C CA  . CYS A 1 529 ? 20.428  6.038   -2.649  1.00 43.30 ? 529  CYS A CA  1 
ATOM   4063 C C   . CYS A 1 529 ? 20.992  4.867   -3.449  1.00 43.22 ? 529  CYS A C   1 
ATOM   4064 O O   . CYS A 1 529 ? 22.140  4.482   -3.245  1.00 43.11 ? 529  CYS A O   1 
ATOM   4065 C CB  . CYS A 1 529 ? 20.050  5.666   -1.218  1.00 43.04 ? 529  CYS A CB  1 
ATOM   4066 S SG  . CYS A 1 529 ? 19.979  7.130   -0.100  1.00 45.34 ? 529  CYS A SG  1 
ATOM   4067 N N   . ALA A 1 530 ? 20.220  4.331   -4.392  1.00 42.96 ? 530  ALA A N   1 
ATOM   4068 C CA  . ALA A 1 530 ? 20.800  3.353   -5.315  1.00 42.80 ? 530  ALA A CA  1 
ATOM   4069 C C   . ALA A 1 530 ? 21.928  3.996   -6.110  1.00 42.54 ? 530  ALA A C   1 
ATOM   4070 O O   . ALA A 1 530 ? 22.939  3.355   -6.408  1.00 42.29 ? 530  ALA A O   1 
ATOM   4071 C CB  . ALA A 1 530 ? 19.757  2.769   -6.243  1.00 42.24 ? 530  ALA A CB  1 
ATOM   4072 N N   . PHE A 1 531 ? 21.751  5.269   -6.447  1.00 42.56 ? 531  PHE A N   1 
ATOM   4073 C CA  . PHE A 1 531 ? 22.802  6.006   -7.113  1.00 42.61 ? 531  PHE A CA  1 
ATOM   4074 C C   . PHE A 1 531 ? 24.076  6.055   -6.265  1.00 42.25 ? 531  PHE A C   1 
ATOM   4075 O O   . PHE A 1 531 ? 25.117  5.551   -6.682  1.00 42.03 ? 531  PHE A O   1 
ATOM   4076 C CB  . PHE A 1 531 ? 22.337  7.412   -7.483  1.00 43.33 ? 531  PHE A CB  1 
ATOM   4077 C CG  . PHE A 1 531 ? 23.420  8.243   -8.099  1.00 44.68 ? 531  PHE A CG  1 
ATOM   4078 C CD1 . PHE A 1 531 ? 23.845  7.986   -9.398  1.00 44.08 ? 531  PHE A CD1 1 
ATOM   4079 C CD2 . PHE A 1 531 ? 24.042  9.250   -7.363  1.00 45.67 ? 531  PHE A CD2 1 
ATOM   4080 C CE1 . PHE A 1 531 ? 24.852  8.734   -9.966  1.00 47.48 ? 531  PHE A CE1 1 
ATOM   4081 C CE2 . PHE A 1 531 ? 25.060  10.001  -7.917  1.00 47.02 ? 531  PHE A CE2 1 
ATOM   4082 C CZ  . PHE A 1 531 ? 25.471  9.744   -9.223  1.00 46.82 ? 531  PHE A CZ  1 
ATOM   4083 N N   . TRP A 1 532 ? 23.977  6.626   -5.067  1.00 41.63 ? 532  TRP A N   1 
ATOM   4084 C CA  . TRP A 1 532 ? 25.137  6.781   -4.192  1.00 41.45 ? 532  TRP A CA  1 
ATOM   4085 C C   . TRP A 1 532 ? 25.761  5.473   -3.741  1.00 42.30 ? 532  TRP A C   1 
ATOM   4086 O O   . TRP A 1 532 ? 26.980  5.349   -3.738  1.00 42.49 ? 532  TRP A O   1 
ATOM   4087 C CB  . TRP A 1 532 ? 24.783  7.616   -2.968  1.00 40.07 ? 532  TRP A CB  1 
ATOM   4088 C CG  . TRP A 1 532 ? 24.469  8.989   -3.301  1.00 37.64 ? 532  TRP A CG  1 
ATOM   4089 C CD1 . TRP A 1 532 ? 23.246  9.555   -3.322  1.00 36.39 ? 532  TRP A CD1 1 
ATOM   4090 C CD2 . TRP A 1 532 ? 25.390  10.000  -3.702  1.00 37.72 ? 532  TRP A CD2 1 
ATOM   4091 N NE1 . TRP A 1 532 ? 23.330  10.875  -3.704  1.00 36.31 ? 532  TRP A NE1 1 
ATOM   4092 C CE2 . TRP A 1 532 ? 24.641  11.176  -3.940  1.00 37.86 ? 532  TRP A CE2 1 
ATOM   4093 C CE3 . TRP A 1 532 ? 26.779  10.036  -3.878  1.00 36.42 ? 532  TRP A CE3 1 
ATOM   4094 C CZ2 . TRP A 1 532 ? 25.237  12.374  -4.336  1.00 36.71 ? 532  TRP A CZ2 1 
ATOM   4095 C CZ3 . TRP A 1 532 ? 27.364  11.223  -4.283  1.00 35.55 ? 532  TRP A CZ3 1 
ATOM   4096 C CH2 . TRP A 1 532 ? 26.596  12.372  -4.500  1.00 36.04 ? 532  TRP A CH2 1 
ATOM   4097 N N   . ASN A 1 533 ? 24.927  4.506   -3.373  1.00 43.32 ? 533  ASN A N   1 
ATOM   4098 C CA  . ASN A 1 533 ? 25.395  3.279   -2.728  1.00 44.49 ? 533  ASN A CA  1 
ATOM   4099 C C   . ASN A 1 533 ? 25.773  2.144   -3.669  1.00 45.25 ? 533  ASN A C   1 
ATOM   4100 O O   . ASN A 1 533 ? 26.660  1.365   -3.352  1.00 45.31 ? 533  ASN A O   1 
ATOM   4101 C CB  . ASN A 1 533 ? 24.350  2.758   -1.739  1.00 44.50 ? 533  ASN A CB  1 
ATOM   4102 C CG  . ASN A 1 533 ? 24.104  3.709   -0.608  1.00 45.20 ? 533  ASN A CG  1 
ATOM   4103 O OD1 . ASN A 1 533 ? 24.834  4.671   -0.436  1.00 48.18 ? 533  ASN A OD1 1 
ATOM   4104 N ND2 . ASN A 1 533 ? 23.063  3.454   0.176   1.00 46.70 ? 533  ASN A ND2 1 
ATOM   4105 N N   . ARG A 1 534 ? 25.088  2.023   -4.800  1.00 46.23 ? 534  ARG A N   1 
ATOM   4106 C CA  . ARG A 1 534 ? 25.363  0.917   -5.718  1.00 47.82 ? 534  ARG A CA  1 
ATOM   4107 C C   . ARG A 1 534 ? 26.100  1.366   -6.958  1.00 49.21 ? 534  ARG A C   1 
ATOM   4108 O O   . ARG A 1 534 ? 27.138  0.777   -7.300  1.00 50.50 ? 534  ARG A O   1 
ATOM   4109 C CB  . ARG A 1 534 ? 24.102  0.172   -6.121  1.00 47.45 ? 534  ARG A CB  1 
ATOM   4110 C CG  . ARG A 1 534 ? 23.307  -0.374  -4.967  1.00 48.17 ? 534  ARG A CG  1 
ATOM   4111 C CD  . ARG A 1 534 ? 21.926  -0.766  -5.435  1.00 49.65 ? 534  ARG A CD  1 
ATOM   4112 N NE  . ARG A 1 534 ? 21.075  -1.175  -4.326  1.00 50.66 ? 534  ARG A NE  1 
ATOM   4113 C CZ  . ARG A 1 534 ? 20.943  -2.428  -3.894  1.00 50.50 ? 534  ARG A CZ  1 
ATOM   4114 N NH1 . ARG A 1 534 ? 21.608  -3.423  -4.478  1.00 48.69 ? 534  ARG A NH1 1 
ATOM   4115 N NH2 . ARG A 1 534 ? 20.135  -2.678  -2.871  1.00 50.03 ? 534  ARG A NH2 1 
ATOM   4116 N N   . PHE A 1 535 ? 25.598  2.407   -7.624  1.00 49.98 ? 535  PHE A N   1 
ATOM   4117 C CA  . PHE A 1 535 ? 26.222  2.853   -8.855  1.00 50.77 ? 535  PHE A CA  1 
ATOM   4118 C C   . PHE A 1 535 ? 27.520  3.614   -8.683  1.00 51.96 ? 535  PHE A C   1 
ATOM   4119 O O   . PHE A 1 535 ? 28.501  3.292   -9.314  1.00 51.72 ? 535  PHE A O   1 
ATOM   4120 C CB  . PHE A 1 535 ? 25.264  3.643   -9.726  1.00 50.23 ? 535  PHE A CB  1 
ATOM   4121 C CG  . PHE A 1 535 ? 25.860  4.046   -11.029 1.00 49.55 ? 535  PHE A CG  1 
ATOM   4122 C CD1 . PHE A 1 535 ? 26.161  3.083   -11.994 1.00 49.99 ? 535  PHE A CD1 1 
ATOM   4123 C CD2 . PHE A 1 535 ? 26.154  5.379   -11.287 1.00 48.71 ? 535  PHE A CD2 1 
ATOM   4124 C CE1 . PHE A 1 535 ? 26.741  3.435   -13.199 1.00 48.39 ? 535  PHE A CE1 1 
ATOM   4125 C CE2 . PHE A 1 535 ? 26.718  5.748   -12.486 1.00 49.36 ? 535  PHE A CE2 1 
ATOM   4126 C CZ  . PHE A 1 535 ? 27.015  4.769   -13.451 1.00 50.45 ? 535  PHE A CZ  1 
ATOM   4127 N N   . LEU A 1 536 ? 27.521  4.633   -7.844  1.00 54.69 ? 536  LEU A N   1 
ATOM   4128 C CA  . LEU A 1 536 ? 28.649  5.570   -7.783  1.00 56.90 ? 536  LEU A CA  1 
ATOM   4129 C C   . LEU A 1 536 ? 30.008  4.916   -7.440  1.00 59.00 ? 536  LEU A C   1 
ATOM   4130 O O   . LEU A 1 536 ? 31.024  5.320   -8.014  1.00 59.03 ? 536  LEU A O   1 
ATOM   4131 C CB  . LEU A 1 536 ? 28.322  6.757   -6.865  1.00 56.57 ? 536  LEU A CB  1 
ATOM   4132 C CG  . LEU A 1 536 ? 29.052  8.111   -6.902  1.00 56.33 ? 536  LEU A CG  1 
ATOM   4133 C CD1 . LEU A 1 536 ? 30.220  8.192   -5.883  1.00 58.41 ? 536  LEU A CD1 1 
ATOM   4134 C CD2 . LEU A 1 536 ? 29.509  8.512   -8.299  1.00 58.97 ? 536  LEU A CD2 1 
ATOM   4135 N N   . PRO A 1 537 ? 30.039  3.917   -6.516  1.00 61.15 ? 537  PRO A N   1 
ATOM   4136 C CA  . PRO A 1 537 ? 31.266  3.122   -6.349  1.00 62.88 ? 537  PRO A CA  1 
ATOM   4137 C C   . PRO A 1 537 ? 31.831  2.567   -7.661  1.00 64.97 ? 537  PRO A C   1 
ATOM   4138 O O   . PRO A 1 537 ? 33.025  2.766   -7.922  1.00 65.31 ? 537  PRO A O   1 
ATOM   4139 C CB  . PRO A 1 537 ? 30.825  1.975   -5.439  1.00 62.81 ? 537  PRO A CB  1 
ATOM   4140 C CG  . PRO A 1 537 ? 29.727  2.553   -4.637  1.00 61.85 ? 537  PRO A CG  1 
ATOM   4141 C CD  . PRO A 1 537 ? 28.995  3.490   -5.560  1.00 61.31 ? 537  PRO A CD  1 
ATOM   4142 N N   . LYS A 1 538 ? 30.998  1.905   -8.479  1.00 67.10 ? 538  LYS A N   1 
ATOM   4143 C CA  . LYS A 1 538 ? 31.455  1.312   -9.766  1.00 69.47 ? 538  LYS A CA  1 
ATOM   4144 C C   . LYS A 1 538 ? 32.039  2.324   -10.748 1.00 70.88 ? 538  LYS A C   1 
ATOM   4145 O O   . LYS A 1 538 ? 33.053  2.066   -11.387 1.00 71.28 ? 538  LYS A O   1 
ATOM   4146 C CB  . LYS A 1 538 ? 30.362  0.478   -10.443 1.00 69.21 ? 538  LYS A CB  1 
ATOM   4147 C CG  . LYS A 1 538 ? 29.664  -0.465  -9.483  1.00 70.59 ? 538  LYS A CG  1 
ATOM   4148 C CD  . LYS A 1 538 ? 29.588  -1.889  -9.985  1.00 71.83 ? 538  LYS A CD  1 
ATOM   4149 C CE  . LYS A 1 538 ? 29.174  -2.817  -8.836  1.00 73.55 ? 538  LYS A CE  1 
ATOM   4150 N NZ  . LYS A 1 538 ? 29.219  -4.270  -9.195  1.00 73.44 ? 538  LYS A NZ  1 
ATOM   4151 N N   . LEU A 1 539 ? 31.403  3.480   -10.846 1.00 73.03 ? 539  LEU A N   1 
ATOM   4152 C CA  . LEU A 1 539 ? 31.920  4.597   -11.614 1.00 75.24 ? 539  LEU A CA  1 
ATOM   4153 C C   . LEU A 1 539 ? 33.249  5.115   -11.059 1.00 77.18 ? 539  LEU A C   1 
ATOM   4154 O O   . LEU A 1 539 ? 33.892  5.980   -11.661 1.00 77.80 ? 539  LEU A O   1 
ATOM   4155 C CB  . LEU A 1 539 ? 30.895  5.719   -11.596 1.00 75.25 ? 539  LEU A CB  1 
ATOM   4156 C CG  . LEU A 1 539 ? 30.998  6.810   -12.645 1.00 75.42 ? 539  LEU A CG  1 
ATOM   4157 C CD1 . LEU A 1 539 ? 31.068  6.143   -13.998 1.00 76.68 ? 539  LEU A CD1 1 
ATOM   4158 C CD2 . LEU A 1 539 ? 29.811  7.747   -12.549 1.00 75.17 ? 539  LEU A CD2 1 
ATOM   4159 N N   . LEU A 1 540 ? 33.653  4.605   -9.898  1.00 79.35 ? 540  LEU A N   1 
ATOM   4160 C CA  . LEU A 1 540 ? 35.015  4.829   -9.385  1.00 81.31 ? 540  LEU A CA  1 
ATOM   4161 C C   . LEU A 1 540 ? 35.881  3.539   -9.499  1.00 82.42 ? 540  LEU A C   1 
ATOM   4162 O O   . LEU A 1 540 ? 36.744  3.272   -8.664  1.00 82.66 ? 540  LEU A O   1 
ATOM   4163 C CB  . LEU A 1 540 ? 34.975  5.419   -7.955  1.00 81.42 ? 540  LEU A CB  1 
ATOM   4164 C CG  . LEU A 1 540 ? 34.800  6.946   -7.724  1.00 82.00 ? 540  LEU A CG  1 
ATOM   4165 C CD1 . LEU A 1 540 ? 34.529  7.775   -8.995  1.00 81.06 ? 540  LEU A CD1 1 
ATOM   4166 C CD2 . LEU A 1 540 ? 33.768  7.285   -6.612  1.00 81.14 ? 540  LEU A CD2 1 
ATOM   4167 N N   . SER A 1 541 ? 35.593  2.738   -10.532 1.00 83.83 ? 541  SER A N   1 
ATOM   4168 C CA  . SER A 1 541 ? 36.468  1.663   -11.048 1.00 84.85 ? 541  SER A CA  1 
ATOM   4169 C C   . SER A 1 541 ? 36.624  1.900   -12.564 1.00 85.39 ? 541  SER A C   1 
ATOM   4170 O O   . SER A 1 541 ? 36.603  0.950   -13.372 1.00 85.59 ? 541  SER A O   1 
ATOM   4171 C CB  . SER A 1 541 ? 35.882  0.252   -10.793 1.00 85.03 ? 541  SER A CB  1 
ATOM   4172 O OG  . SER A 1 541 ? 35.616  -0.001  -9.421  1.00 85.05 ? 541  SER A OG  1 
ATOM   4173 N N   . ALA A 1 542 ? 36.743  3.185   -12.920 1.00 85.76 ? 542  ALA A N   1 
ATOM   4174 C CA  . ALA A 1 542 ? 36.852  3.682   -14.298 1.00 85.86 ? 542  ALA A CA  1 
ATOM   4175 C C   . ALA A 1 542 ? 37.220  5.166   -14.247 1.00 85.97 ? 542  ALA A C   1 
ATOM   4176 O O   . ALA A 1 542 ? 37.898  5.616   -13.318 1.00 85.95 ? 542  ALA A O   1 
ATOM   4177 C CB  . ALA A 1 542 ? 35.538  3.490   -15.068 1.00 85.64 ? 542  ALA A CB  1 
ATOM   4178 N N   . GLU B 1 4   ? -17.667 4.342   -67.878 1.00 78.63 ? 4    GLU B N   1 
ATOM   4179 C CA  . GLU B 1 4   ? -16.477 5.127   -68.341 1.00 78.03 ? 4    GLU B CA  1 
ATOM   4180 C C   . GLU B 1 4   ? -16.437 6.531   -67.688 1.00 77.16 ? 4    GLU B C   1 
ATOM   4181 O O   . GLU B 1 4   ? -16.545 7.572   -68.351 1.00 77.24 ? 4    GLU B O   1 
ATOM   4182 C CB  . GLU B 1 4   ? -16.416 5.169   -69.884 1.00 78.46 ? 4    GLU B CB  1 
ATOM   4183 C CG  . GLU B 1 4   ? -15.043 5.589   -70.479 1.00 79.91 ? 4    GLU B CG  1 
ATOM   4184 C CD  . GLU B 1 4   ? -13.813 4.961   -69.771 1.00 83.80 ? 4    GLU B CD  1 
ATOM   4185 O OE1 . GLU B 1 4   ? -13.869 3.777   -69.321 1.00 84.72 ? 4    GLU B OE1 1 
ATOM   4186 O OE2 . GLU B 1 4   ? -12.776 5.664   -69.677 1.00 84.37 ? 4    GLU B OE2 1 
ATOM   4187 N N   . ASP B 1 5   ? -16.268 6.527   -66.370 1.00 75.76 ? 5    ASP B N   1 
ATOM   4188 C CA  . ASP B 1 5   ? -16.301 7.734   -65.546 1.00 74.34 ? 5    ASP B CA  1 
ATOM   4189 C C   . ASP B 1 5   ? -15.078 8.619   -65.796 1.00 73.61 ? 5    ASP B C   1 
ATOM   4190 O O   . ASP B 1 5   ? -13.955 8.163   -65.619 1.00 73.88 ? 5    ASP B O   1 
ATOM   4191 C CB  . ASP B 1 5   ? -16.347 7.300   -64.083 1.00 73.93 ? 5    ASP B CB  1 
ATOM   4192 C CG  . ASP B 1 5   ? -16.767 8.401   -63.147 1.00 72.08 ? 5    ASP B CG  1 
ATOM   4193 O OD1 . ASP B 1 5   ? -17.287 8.034   -62.079 1.00 68.53 ? 5    ASP B OD1 1 
ATOM   4194 O OD2 . ASP B 1 5   ? -16.571 9.601   -63.452 1.00 70.99 ? 5    ASP B OD2 1 
ATOM   4195 N N   . PRO B 1 6   ? -15.287 9.886   -66.212 1.00 72.83 ? 6    PRO B N   1 
ATOM   4196 C CA  . PRO B 1 6   ? -14.154 10.801  -66.471 1.00 71.87 ? 6    PRO B CA  1 
ATOM   4197 C C   . PRO B 1 6   ? -13.467 11.273  -65.199 1.00 70.76 ? 6    PRO B C   1 
ATOM   4198 O O   . PRO B 1 6   ? -12.399 11.871  -65.267 1.00 70.70 ? 6    PRO B O   1 
ATOM   4199 C CB  . PRO B 1 6   ? -14.800 12.002  -67.183 1.00 72.02 ? 6    PRO B CB  1 
ATOM   4200 C CG  . PRO B 1 6   ? -16.224 11.584  -67.490 1.00 72.85 ? 6    PRO B CG  1 
ATOM   4201 C CD  . PRO B 1 6   ? -16.584 10.534  -66.476 1.00 72.97 ? 6    PRO B CD  1 
ATOM   4202 N N   . GLN B 1 7   ? -14.088 11.014  -64.052 1.00 69.39 ? 7    GLN B N   1 
ATOM   4203 C CA  . GLN B 1 7   ? -13.483 11.330  -62.762 1.00 68.10 ? 7    GLN B CA  1 
ATOM   4204 C C   . GLN B 1 7   ? -12.332 10.403  -62.457 1.00 67.13 ? 7    GLN B C   1 
ATOM   4205 O O   . GLN B 1 7   ? -11.435 10.756  -61.686 1.00 67.12 ? 7    GLN B O   1 
ATOM   4206 C CB  . GLN B 1 7   ? -14.517 11.226  -61.637 1.00 68.19 ? 7    GLN B CB  1 
ATOM   4207 C CG  . GLN B 1 7   ? -15.483 12.410  -61.586 1.00 68.14 ? 7    GLN B CG  1 
ATOM   4208 C CD  . GLN B 1 7   ? -14.768 13.702  -61.256 1.00 66.97 ? 7    GLN B CD  1 
ATOM   4209 O OE1 . GLN B 1 7   ? -14.301 13.870  -60.149 1.00 68.68 ? 7    GLN B OE1 1 
ATOM   4210 N NE2 . GLN B 1 7   ? -14.659 14.604  -62.221 1.00 66.05 ? 7    GLN B NE2 1 
ATOM   4211 N N   . LEU B 1 8   ? -12.373 9.218   -63.068 1.00 65.64 ? 8    LEU B N   1 
ATOM   4212 C CA  . LEU B 1 8   ? -11.401 8.160   -62.822 1.00 63.95 ? 8    LEU B CA  1 
ATOM   4213 C C   . LEU B 1 8   ? -10.348 8.091   -63.923 1.00 63.08 ? 8    LEU B C   1 
ATOM   4214 O O   . LEU B 1 8   ? -9.639  7.107   -64.059 1.00 63.00 ? 8    LEU B O   1 
ATOM   4215 C CB  . LEU B 1 8   ? -12.112 6.820   -62.701 1.00 63.46 ? 8    LEU B CB  1 
ATOM   4216 C CG  . LEU B 1 8   ? -13.253 6.763   -61.704 1.00 63.18 ? 8    LEU B CG  1 
ATOM   4217 C CD1 . LEU B 1 8   ? -13.904 5.391   -61.747 1.00 62.99 ? 8    LEU B CD1 1 
ATOM   4218 C CD2 . LEU B 1 8   ? -12.751 7.085   -60.304 1.00 63.46 ? 8    LEU B CD2 1 
ATOM   4219 N N   . LEU B 1 9   ? -10.230 9.157   -64.692 1.00 61.89 ? 9    LEU B N   1 
ATOM   4220 C CA  . LEU B 1 9   ? -9.361  9.143   -65.830 1.00 60.99 ? 9    LEU B CA  1 
ATOM   4221 C C   . LEU B 1 9   ? -8.464  10.366  -65.726 1.00 60.03 ? 9    LEU B C   1 
ATOM   4222 O O   . LEU B 1 9   ? -8.959  11.488  -65.729 1.00 59.85 ? 9    LEU B O   1 
ATOM   4223 C CB  . LEU B 1 9   ? -10.223 9.193   -67.090 1.00 61.36 ? 9    LEU B CB  1 
ATOM   4224 C CG  . LEU B 1 9   ? -9.903  8.304   -68.284 1.00 63.00 ? 9    LEU B CG  1 
ATOM   4225 C CD1 . LEU B 1 9   ? -11.013 8.506   -69.312 1.00 64.47 ? 9    LEU B CD1 1 
ATOM   4226 C CD2 . LEU B 1 9   ? -8.522  8.630   -68.899 1.00 64.20 ? 9    LEU B CD2 1 
ATOM   4227 N N   . VAL B 1 10  ? -7.152  10.151  -65.607 1.00 58.74 ? 10   VAL B N   1 
ATOM   4228 C CA  . VAL B 1 10  ? -6.203  11.244  -65.355 1.00 57.33 ? 10   VAL B CA  1 
ATOM   4229 C C   . VAL B 1 10  ? -5.000  11.107  -66.271 1.00 56.82 ? 10   VAL B C   1 
ATOM   4230 O O   . VAL B 1 10  ? -4.528  9.998   -66.485 1.00 56.78 ? 10   VAL B O   1 
ATOM   4231 C CB  . VAL B 1 10  ? -5.670  11.207  -63.884 1.00 57.40 ? 10   VAL B CB  1 
ATOM   4232 C CG1 . VAL B 1 10  ? -4.750  12.388  -63.600 1.00 56.43 ? 10   VAL B CG1 1 
ATOM   4233 C CG2 . VAL B 1 10  ? -6.796  11.179  -62.883 1.00 56.76 ? 10   VAL B CG2 1 
ATOM   4234 N N   . ARG B 1 11  ? -4.492  12.221  -66.791 1.00 56.02 ? 11   ARG B N   1 
ATOM   4235 C CA  . ARG B 1 11  ? -3.251  12.204  -67.540 1.00 55.78 ? 11   ARG B CA  1 
ATOM   4236 C C   . ARG B 1 11  ? -2.146  12.755  -66.668 1.00 54.96 ? 11   ARG B C   1 
ATOM   4237 O O   . ARG B 1 11  ? -2.047  13.954  -66.425 1.00 55.33 ? 11   ARG B O   1 
ATOM   4238 C CB  . ARG B 1 11  ? -3.342  12.980  -68.864 1.00 55.22 ? 11   ARG B CB  1 
ATOM   4239 C CG  . ARG B 1 11  ? -1.967  13.251  -69.540 1.00 57.30 ? 11   ARG B CG  1 
ATOM   4240 C CD  . ARG B 1 11  ? -2.041  13.783  -70.994 1.00 58.84 ? 11   ARG B CD  1 
ATOM   4241 N NE  . ARG B 1 11  ? -2.031  12.693  -71.984 1.00 66.38 ? 11   ARG B NE  1 
ATOM   4242 C CZ  . ARG B 1 11  ? -3.127  12.099  -72.481 1.00 68.74 ? 11   ARG B CZ  1 
ATOM   4243 N NH1 . ARG B 1 11  ? -4.350  12.481  -72.097 1.00 69.88 ? 11   ARG B NH1 1 
ATOM   4244 N NH2 . ARG B 1 11  ? -3.004  11.114  -73.367 1.00 68.78 ? 11   ARG B NH2 1 
ATOM   4245 N N   . VAL B 1 12  ? -1.307  11.862  -66.188 1.00 54.12 ? 12   VAL B N   1 
ATOM   4246 C CA  . VAL B 1 12  ? -0.061  12.275  -65.591 1.00 52.91 ? 12   VAL B CA  1 
ATOM   4247 C C   . VAL B 1 12  ? 0.984   12.366  -66.697 1.00 52.78 ? 12   VAL B C   1 
ATOM   4248 O O   . VAL B 1 12  ? 0.722   11.979  -67.826 1.00 52.71 ? 12   VAL B O   1 
ATOM   4249 C CB  . VAL B 1 12  ? 0.361   11.316  -64.478 1.00 52.69 ? 12   VAL B CB  1 
ATOM   4250 C CG1 . VAL B 1 12  ? -0.750  11.238  -63.440 1.00 52.01 ? 12   VAL B CG1 1 
ATOM   4251 C CG2 . VAL B 1 12  ? 0.684   9.934   -65.036 1.00 51.65 ? 12   VAL B CG2 1 
ATOM   4252 N N   . ARG B 1 13  ? 2.154   12.886  -66.359 1.00 52.68 ? 13   ARG B N   1 
ATOM   4253 C CA  . ARG B 1 13  ? 3.269   13.080  -67.282 1.00 53.15 ? 13   ARG B CA  1 
ATOM   4254 C C   . ARG B 1 13  ? 3.676   11.848  -68.118 1.00 52.57 ? 13   ARG B C   1 
ATOM   4255 O O   . ARG B 1 13  ? 4.132   11.997  -69.243 1.00 52.19 ? 13   ARG B O   1 
ATOM   4256 C CB  . ARG B 1 13  ? 4.465   13.556  -66.470 1.00 53.53 ? 13   ARG B CB  1 
ATOM   4257 C CG  . ARG B 1 13  ? 5.560   14.174  -67.273 1.00 58.20 ? 13   ARG B CG  1 
ATOM   4258 C CD  . ARG B 1 13  ? 6.324   15.208  -66.425 1.00 64.42 ? 13   ARG B CD  1 
ATOM   4259 N NE  . ARG B 1 13  ? 5.491   16.318  -65.963 1.00 66.04 ? 13   ARG B NE  1 
ATOM   4260 C CZ  . ARG B 1 13  ? 5.963   17.417  -65.363 1.00 69.04 ? 13   ARG B CZ  1 
ATOM   4261 N NH1 . ARG B 1 13  ? 7.279   17.563  -65.142 1.00 67.81 ? 13   ARG B NH1 1 
ATOM   4262 N NH2 . ARG B 1 13  ? 5.111   18.378  -64.973 1.00 68.98 ? 13   ARG B NH2 1 
ATOM   4263 N N   . GLY B 1 14  ? 3.526   10.647  -67.562 1.00 52.21 ? 14   GLY B N   1 
ATOM   4264 C CA  . GLY B 1 14  ? 3.917   9.421   -68.250 1.00 52.06 ? 14   GLY B CA  1 
ATOM   4265 C C   . GLY B 1 14  ? 2.824   8.839   -69.136 1.00 52.08 ? 14   GLY B C   1 
ATOM   4266 O O   . GLY B 1 14  ? 3.070   7.891   -69.879 1.00 51.99 ? 14   GLY B O   1 
ATOM   4267 N N   . GLY B 1 15  ? 1.620   9.411   -69.056 1.00 51.72 ? 15   GLY B N   1 
ATOM   4268 C CA  . GLY B 1 15  ? 0.461   8.924   -69.805 1.00 51.47 ? 15   GLY B CA  1 
ATOM   4269 C C   . GLY B 1 15  ? -0.807  8.915   -68.976 1.00 51.44 ? 15   GLY B C   1 
ATOM   4270 O O   . GLY B 1 15  ? -0.872  9.571   -67.938 1.00 51.39 ? 15   GLY B O   1 
ATOM   4271 N N   . GLN B 1 16  ? -1.803  8.148   -69.419 1.00 51.42 ? 16   GLN B N   1 
ATOM   4272 C CA  . GLN B 1 16  ? -3.123  8.140   -68.812 1.00 51.74 ? 16   GLN B CA  1 
ATOM   4273 C C   . GLN B 1 16  ? -3.298  6.996   -67.839 1.00 50.85 ? 16   GLN B C   1 
ATOM   4274 O O   . GLN B 1 16  ? -2.722  5.931   -68.038 1.00 50.54 ? 16   GLN B O   1 
ATOM   4275 C CB  . GLN B 1 16  ? -4.187  7.986   -69.879 1.00 51.51 ? 16   GLN B CB  1 
ATOM   4276 C CG  . GLN B 1 16  ? -4.182  9.020   -70.979 1.00 54.30 ? 16   GLN B CG  1 
ATOM   4277 C CD  . GLN B 1 16  ? -5.323  8.760   -71.991 1.00 55.42 ? 16   GLN B CD  1 
ATOM   4278 O OE1 . GLN B 1 16  ? -6.520  8.899   -71.657 1.00 58.78 ? 16   GLN B OE1 1 
ATOM   4279 N NE2 . GLN B 1 16  ? -4.955  8.355   -73.215 1.00 57.00 ? 16   GLN B NE2 1 
ATOM   4280 N N   . LEU B 1 17  ? -4.135  7.216   -66.822 1.00 50.56 ? 17   LEU B N   1 
ATOM   4281 C CA  . LEU B 1 17  ? -4.414  6.246   -65.773 1.00 50.93 ? 17   LEU B CA  1 
ATOM   4282 C C   . LEU B 1 17  ? -5.906  6.107   -65.600 1.00 51.42 ? 17   LEU B C   1 
ATOM   4283 O O   . LEU B 1 17  ? -6.640  7.066   -65.782 1.00 51.31 ? 17   LEU B O   1 
ATOM   4284 C CB  . LEU B 1 17  ? -3.840  6.712   -64.420 1.00 51.18 ? 17   LEU B CB  1 
ATOM   4285 C CG  . LEU B 1 17  ? -2.385  7.191   -64.288 1.00 51.33 ? 17   LEU B CG  1 
ATOM   4286 C CD1 . LEU B 1 17  ? -2.140  7.848   -62.953 1.00 50.18 ? 17   LEU B CD1 1 
ATOM   4287 C CD2 . LEU B 1 17  ? -1.402  6.041   -64.493 1.00 51.88 ? 17   LEU B CD2 1 
ATOM   4288 N N   . ARG B 1 18  ? -6.353  4.917   -65.220 1.00 52.27 ? 18   ARG B N   1 
ATOM   4289 C CA  . ARG B 1 18  ? -7.737  4.714   -64.873 1.00 53.05 ? 18   ARG B CA  1 
ATOM   4290 C C   . ARG B 1 18  ? -7.828  4.266   -63.434 1.00 52.80 ? 18   ARG B C   1 
ATOM   4291 O O   . ARG B 1 18  ? -7.309  3.224   -63.052 1.00 52.11 ? 18   ARG B O   1 
ATOM   4292 C CB  . ARG B 1 18  ? -8.403  3.689   -65.796 1.00 53.52 ? 18   ARG B CB  1 
ATOM   4293 C CG  . ARG B 1 18  ? -9.926  3.500   -65.551 1.00 54.59 ? 18   ARG B CG  1 
ATOM   4294 C CD  . ARG B 1 18  ? -10.480 2.225   -66.214 1.00 55.62 ? 18   ARG B CD  1 
ATOM   4295 N NE  . ARG B 1 18  ? -9.922  1.968   -67.557 1.00 61.74 ? 18   ARG B NE  1 
ATOM   4296 C CZ  . ARG B 1 18  ? -10.168 2.701   -68.650 1.00 64.18 ? 18   ARG B CZ  1 
ATOM   4297 N NH1 . ARG B 1 18  ? -10.967 3.786   -68.596 1.00 64.66 ? 18   ARG B NH1 1 
ATOM   4298 N NH2 . ARG B 1 18  ? -9.594  2.360   -69.804 1.00 63.28 ? 18   ARG B NH2 1 
ATOM   4299 N N   . GLY B 1 19  ? -8.504  5.082   -62.639 1.00 53.69 ? 19   GLY B N   1 
ATOM   4300 C CA  . GLY B 1 19  ? -8.718  4.800   -61.241 1.00 54.48 ? 19   GLY B CA  1 
ATOM   4301 C C   . GLY B 1 19  ? -9.972  3.989   -61.084 1.00 55.55 ? 19   GLY B C   1 
ATOM   4302 O O   . GLY B 1 19  ? -10.636 3.638   -62.069 1.00 55.51 ? 19   GLY B O   1 
ATOM   4303 N N   . ILE B 1 20  ? -10.275 3.684   -59.833 1.00 56.54 ? 20   ILE B N   1 
ATOM   4304 C CA  . ILE B 1 20  ? -11.469 2.970   -59.448 1.00 57.81 ? 20   ILE B CA  1 
ATOM   4305 C C   . ILE B 1 20  ? -12.209 3.872   -58.467 1.00 59.22 ? 20   ILE B C   1 
ATOM   4306 O O   . ILE B 1 20  ? -11.579 4.638   -57.736 1.00 59.87 ? 20   ILE B O   1 
ATOM   4307 C CB  . ILE B 1 20  ? -11.111 1.604   -58.810 1.00 57.70 ? 20   ILE B CB  1 
ATOM   4308 C CG1 . ILE B 1 20  ? -12.359 0.886   -58.298 1.00 57.60 ? 20   ILE B CG1 1 
ATOM   4309 C CG2 . ILE B 1 20  ? -10.055 1.763   -57.708 1.00 57.20 ? 20   ILE B CG2 1 
ATOM   4310 C CD1 . ILE B 1 20  ? -12.194 -0.599  -58.157 1.00 56.55 ? 20   ILE B CD1 1 
ATOM   4311 N N   . ARG B 1 21  ? -13.540 3.813   -58.474 1.00 60.59 ? 21   ARG B N   1 
ATOM   4312 C CA  . ARG B 1 21  ? -14.359 4.550   -57.518 1.00 61.66 ? 21   ARG B CA  1 
ATOM   4313 C C   . ARG B 1 21  ? -14.565 3.624   -56.339 1.00 61.25 ? 21   ARG B C   1 
ATOM   4314 O O   . ARG B 1 21  ? -15.121 2.544   -56.488 1.00 60.90 ? 21   ARG B O   1 
ATOM   4315 C CB  . ARG B 1 21  ? -15.691 4.965   -58.155 1.00 61.63 ? 21   ARG B CB  1 
ATOM   4316 C CG  . ARG B 1 21  ? -16.600 5.839   -57.284 1.00 63.59 ? 21   ARG B CG  1 
ATOM   4317 C CD  . ARG B 1 21  ? -17.877 6.292   -58.036 1.00 64.35 ? 21   ARG B CD  1 
ATOM   4318 N NE  . ARG B 1 21  ? -18.826 5.196   -58.261 1.00 70.91 ? 21   ARG B NE  1 
ATOM   4319 C CZ  . ARG B 1 21  ? -19.774 4.797   -57.400 1.00 73.40 ? 21   ARG B CZ  1 
ATOM   4320 N NH1 . ARG B 1 21  ? -19.940 5.397   -56.221 1.00 74.58 ? 21   ARG B NH1 1 
ATOM   4321 N NH2 . ARG B 1 21  ? -20.576 3.786   -57.726 1.00 74.45 ? 21   ARG B NH2 1 
ATOM   4322 N N   . LEU B 1 22  ? -14.065 4.024   -55.178 1.00 61.61 ? 22   LEU B N   1 
ATOM   4323 C CA  . LEU B 1 22  ? -14.214 3.212   -53.986 1.00 62.47 ? 22   LEU B CA  1 
ATOM   4324 C C   . LEU B 1 22  ? -15.238 3.862   -53.084 1.00 62.82 ? 22   LEU B C   1 
ATOM   4325 O O   . LEU B 1 22  ? -15.489 5.067   -53.192 1.00 62.99 ? 22   LEU B O   1 
ATOM   4326 C CB  . LEU B 1 22  ? -12.881 3.078   -53.244 1.00 62.76 ? 22   LEU B CB  1 
ATOM   4327 C CG  . LEU B 1 22  ? -11.659 2.374   -53.864 1.00 63.98 ? 22   LEU B CG  1 
ATOM   4328 C CD1 . LEU B 1 22  ? -10.469 2.482   -52.909 1.00 65.22 ? 22   LEU B CD1 1 
ATOM   4329 C CD2 . LEU B 1 22  ? -11.930 0.902   -54.208 1.00 64.36 ? 22   LEU B CD2 1 
ATOM   4330 N N   . LYS B 1 23  ? -15.837 3.086   -52.191 1.00 63.25 ? 23   LYS B N   1 
ATOM   4331 C CA  . LYS B 1 23  ? -16.765 3.697   -51.250 1.00 64.23 ? 23   LYS B CA  1 
ATOM   4332 C C   . LYS B 1 23  ? -16.200 3.849   -49.824 1.00 63.94 ? 23   LYS B C   1 
ATOM   4333 O O   . LYS B 1 23  ? -15.586 2.928   -49.271 1.00 64.27 ? 23   LYS B O   1 
ATOM   4334 C CB  . LYS B 1 23  ? -18.188 3.074   -51.313 1.00 64.35 ? 23   LYS B CB  1 
ATOM   4335 C CG  . LYS B 1 23  ? -18.389 1.657   -50.728 1.00 67.64 ? 23   LYS B CG  1 
ATOM   4336 C CD  . LYS B 1 23  ? -18.685 1.641   -49.184 1.00 72.43 ? 23   LYS B CD  1 
ATOM   4337 C CE  . LYS B 1 23  ? -19.959 2.456   -48.767 1.00 74.66 ? 23   LYS B CE  1 
ATOM   4338 N NZ  . LYS B 1 23  ? -21.224 1.640   -48.731 1.00 74.99 ? 23   LYS B NZ  1 
ATOM   4339 N N   . ALA B 1 24  ? -16.378 5.045   -49.274 1.00 63.63 ? 24   ALA B N   1 
ATOM   4340 C CA  . ALA B 1 24  ? -16.170 5.315   -47.859 1.00 63.41 ? 24   ALA B CA  1 
ATOM   4341 C C   . ALA B 1 24  ? -17.562 5.469   -47.205 1.00 63.20 ? 24   ALA B C   1 
ATOM   4342 O O   . ALA B 1 24  ? -18.522 5.827   -47.892 1.00 63.26 ? 24   ALA B O   1 
ATOM   4343 C CB  . ALA B 1 24  ? -15.333 6.591   -47.696 1.00 63.17 ? 24   ALA B CB  1 
ATOM   4344 N N   . PRO B 1 25  ? -17.681 5.206   -45.883 1.00 62.89 ? 25   PRO B N   1 
ATOM   4345 C CA  . PRO B 1 25  ? -18.954 5.326   -45.141 1.00 62.39 ? 25   PRO B CA  1 
ATOM   4346 C C   . PRO B 1 25  ? -19.874 6.497   -45.524 1.00 61.86 ? 25   PRO B C   1 
ATOM   4347 O O   . PRO B 1 25  ? -21.097 6.315   -45.548 1.00 62.34 ? 25   PRO B O   1 
ATOM   4348 C CB  . PRO B 1 25  ? -18.493 5.485   -43.691 1.00 62.41 ? 25   PRO B CB  1 
ATOM   4349 C CG  . PRO B 1 25  ? -17.264 4.661   -43.623 1.00 62.76 ? 25   PRO B CG  1 
ATOM   4350 C CD  . PRO B 1 25  ? -16.592 4.759   -44.990 1.00 62.98 ? 25   PRO B CD  1 
ATOM   4351 N N   . GLY B 1 26  ? -19.304 7.667   -45.824 1.00 60.69 ? 26   GLY B N   1 
ATOM   4352 C CA  . GLY B 1 26  ? -20.096 8.867   -46.076 1.00 59.18 ? 26   GLY B CA  1 
ATOM   4353 C C   . GLY B 1 26  ? -20.108 9.339   -47.515 1.00 58.51 ? 26   GLY B C   1 
ATOM   4354 O O   . GLY B 1 26  ? -20.533 10.445  -47.815 1.00 58.26 ? 26   GLY B O   1 
ATOM   4355 N N   . GLY B 1 27  ? -19.631 8.499   -48.417 1.00 58.39 ? 27   GLY B N   1 
ATOM   4356 C CA  . GLY B 1 27  ? -19.639 8.831   -49.835 1.00 57.65 ? 27   GLY B CA  1 
ATOM   4357 C C   . GLY B 1 27  ? -18.544 8.131   -50.612 1.00 57.16 ? 27   GLY B C   1 
ATOM   4358 O O   . GLY B 1 27  ? -17.801 7.320   -50.045 1.00 56.89 ? 27   GLY B O   1 
ATOM   4359 N N   . PRO B 1 28  ? -18.444 8.444   -51.919 1.00 56.65 ? 28   PRO B N   1 
ATOM   4360 C CA  . PRO B 1 28  ? -17.464 7.865   -52.844 1.00 56.22 ? 28   PRO B CA  1 
ATOM   4361 C C   . PRO B 1 28  ? -16.084 8.540   -52.757 1.00 55.39 ? 28   PRO B C   1 
ATOM   4362 O O   . PRO B 1 28  ? -16.004 9.711   -52.352 1.00 55.48 ? 28   PRO B O   1 
ATOM   4363 C CB  . PRO B 1 28  ? -18.093 8.147   -54.217 1.00 56.32 ? 28   PRO B CB  1 
ATOM   4364 C CG  . PRO B 1 28  ? -18.836 9.436   -54.017 1.00 56.02 ? 28   PRO B CG  1 
ATOM   4365 C CD  . PRO B 1 28  ? -19.334 9.411   -52.596 1.00 56.40 ? 28   PRO B CD  1 
ATOM   4366 N N   . VAL B 1 29  ? -15.028 7.798   -53.134 1.00 53.94 ? 29   VAL B N   1 
ATOM   4367 C CA  . VAL B 1 29  ? -13.657 8.330   -53.307 1.00 52.13 ? 29   VAL B CA  1 
ATOM   4368 C C   . VAL B 1 29  ? -13.044 7.804   -54.617 1.00 51.60 ? 29   VAL B C   1 
ATOM   4369 O O   . VAL B 1 29  ? -13.312 6.666   -55.026 1.00 51.41 ? 29   VAL B O   1 
ATOM   4370 C CB  . VAL B 1 29  ? -12.700 8.036   -52.081 1.00 52.12 ? 29   VAL B CB  1 
ATOM   4371 C CG1 . VAL B 1 29  ? -13.276 8.553   -50.789 1.00 51.04 ? 29   VAL B CG1 1 
ATOM   4372 C CG2 . VAL B 1 29  ? -12.406 6.552   -51.927 1.00 51.59 ? 29   VAL B CG2 1 
ATOM   4373 N N   . SER B 1 30  ? -12.251 8.637   -55.284 1.00 50.78 ? 30   SER B N   1 
ATOM   4374 C CA  . SER B 1 30  ? -11.488 8.211   -56.444 1.00 50.62 ? 30   SER B CA  1 
ATOM   4375 C C   . SER B 1 30  ? -10.164 7.632   -55.954 1.00 50.34 ? 30   SER B C   1 
ATOM   4376 O O   . SER B 1 30  ? -9.473  8.261   -55.144 1.00 51.20 ? 30   SER B O   1 
ATOM   4377 C CB  . SER B 1 30  ? -11.193 9.399   -57.347 1.00 50.95 ? 30   SER B CB  1 
ATOM   4378 O OG  . SER B 1 30  ? -12.337 10.206  -57.545 1.00 52.59 ? 30   SER B OG  1 
ATOM   4379 N N   . ALA B 1 31  ? -9.802  6.435   -56.406 1.00 49.14 ? 31   ALA B N   1 
ATOM   4380 C CA  . ALA B 1 31  ? -8.496  5.861   -56.030 1.00 47.61 ? 31   ALA B CA  1 
ATOM   4381 C C   . ALA B 1 31  ? -7.649  5.548   -57.258 1.00 46.73 ? 31   ALA B C   1 
ATOM   4382 O O   . ALA B 1 31  ? -8.147  5.066   -58.258 1.00 46.63 ? 31   ALA B O   1 
ATOM   4383 C CB  . ALA B 1 31  ? -8.673  4.635   -55.171 1.00 47.30 ? 31   ALA B CB  1 
ATOM   4384 N N   . PHE B 1 32  ? -6.361  5.844   -57.183 1.00 46.24 ? 32   PHE B N   1 
ATOM   4385 C CA  . PHE B 1 32  ? -5.432  5.522   -58.262 1.00 45.38 ? 32   PHE B CA  1 
ATOM   4386 C C   . PHE B 1 32  ? -4.324  4.665   -57.677 1.00 44.53 ? 32   PHE B C   1 
ATOM   4387 O O   . PHE B 1 32  ? -3.362  5.167   -57.077 1.00 44.97 ? 32   PHE B O   1 
ATOM   4388 C CB  . PHE B 1 32  ? -4.929  6.799   -58.917 1.00 45.31 ? 32   PHE B CB  1 
ATOM   4389 C CG  . PHE B 1 32  ? -6.032  7.636   -59.468 1.00 46.93 ? 32   PHE B CG  1 
ATOM   4390 C CD1 . PHE B 1 32  ? -6.700  8.553   -58.656 1.00 47.71 ? 32   PHE B CD1 1 
ATOM   4391 C CD2 . PHE B 1 32  ? -6.450  7.474   -60.789 1.00 48.26 ? 32   PHE B CD2 1 
ATOM   4392 C CE1 . PHE B 1 32  ? -7.736  9.325   -59.158 1.00 47.95 ? 32   PHE B CE1 1 
ATOM   4393 C CE2 . PHE B 1 32  ? -7.495  8.248   -61.314 1.00 49.33 ? 32   PHE B CE2 1 
ATOM   4394 C CZ  . PHE B 1 32  ? -8.143  9.172   -60.484 1.00 48.35 ? 32   PHE B CZ  1 
ATOM   4395 N N   . LEU B 1 33  ? -4.498  3.357   -57.809 1.00 42.94 ? 33   LEU B N   1 
ATOM   4396 C CA  . LEU B 1 33  ? -3.649  2.405   -57.120 1.00 41.20 ? 33   LEU B CA  1 
ATOM   4397 C C   . LEU B 1 33  ? -2.588  1.786   -58.030 1.00 40.73 ? 33   LEU B C   1 
ATOM   4398 O O   . LEU B 1 33  ? -2.834  1.532   -59.197 1.00 40.92 ? 33   LEU B O   1 
ATOM   4399 C CB  . LEU B 1 33  ? -4.514  1.328   -56.499 1.00 40.61 ? 33   LEU B CB  1 
ATOM   4400 C CG  . LEU B 1 33  ? -5.615  1.783   -55.546 1.00 39.38 ? 33   LEU B CG  1 
ATOM   4401 C CD1 . LEU B 1 33  ? -6.219  0.563   -54.796 1.00 35.47 ? 33   LEU B CD1 1 
ATOM   4402 C CD2 . LEU B 1 33  ? -5.041  2.778   -54.566 1.00 36.40 ? 33   LEU B CD2 1 
ATOM   4403 N N   . GLY B 1 34  ? -1.402  1.551   -57.484 1.00 40.03 ? 34   GLY B N   1 
ATOM   4404 C CA  . GLY B 1 34  ? -0.316  0.917   -58.231 1.00 39.23 ? 34   GLY B CA  1 
ATOM   4405 C C   . GLY B 1 34  ? 0.175   1.692   -59.430 1.00 38.36 ? 34   GLY B C   1 
ATOM   4406 O O   . GLY B 1 34  ? 0.499   1.101   -60.436 1.00 38.91 ? 34   GLY B O   1 
ATOM   4407 N N   . ILE B 1 35  ? 0.211   3.016   -59.344 1.00 37.92 ? 35   ILE B N   1 
ATOM   4408 C CA  . ILE B 1 35  ? 0.813   3.835   -60.400 1.00 37.52 ? 35   ILE B CA  1 
ATOM   4409 C C   . ILE B 1 35  ? 2.314   3.651   -60.310 1.00 38.03 ? 35   ILE B C   1 
ATOM   4410 O O   . ILE B 1 35  ? 2.874   3.765   -59.216 1.00 39.60 ? 35   ILE B O   1 
ATOM   4411 C CB  . ILE B 1 35  ? 0.533   5.334   -60.166 1.00 37.29 ? 35   ILE B CB  1 
ATOM   4412 C CG1 . ILE B 1 35  ? -0.969  5.602   -60.056 1.00 35.59 ? 35   ILE B CG1 1 
ATOM   4413 C CG2 . ILE B 1 35  ? 1.192   6.190   -61.244 1.00 36.40 ? 35   ILE B CG2 1 
ATOM   4414 C CD1 . ILE B 1 35  ? -1.289  6.929   -59.401 1.00 36.23 ? 35   ILE B CD1 1 
ATOM   4415 N N   . PRO B 1 36  ? 2.986   3.339   -61.424 1.00 38.01 ? 36   PRO B N   1 
ATOM   4416 C CA  . PRO B 1 36  ? 4.439   3.168   -61.291 1.00 37.87 ? 36   PRO B CA  1 
ATOM   4417 C C   . PRO B 1 36  ? 5.160   4.501   -61.341 1.00 37.61 ? 36   PRO B C   1 
ATOM   4418 O O   . PRO B 1 36  ? 4.857   5.335   -62.194 1.00 37.77 ? 36   PRO B O   1 
ATOM   4419 C CB  . PRO B 1 36  ? 4.811   2.353   -62.529 1.00 37.82 ? 36   PRO B CB  1 
ATOM   4420 C CG  . PRO B 1 36  ? 3.787   2.786   -63.581 1.00 37.94 ? 36   PRO B CG  1 
ATOM   4421 C CD  . PRO B 1 36  ? 2.519   3.141   -62.812 1.00 38.18 ? 36   PRO B CD  1 
ATOM   4422 N N   . PHE B 1 37  ? 6.134   4.684   -60.461 1.00 37.76 ? 37   PHE B N   1 
ATOM   4423 C CA  . PHE B 1 37  ? 6.941   5.900   -60.475 1.00 37.90 ? 37   PHE B CA  1 
ATOM   4424 C C   . PHE B 1 37  ? 8.389   5.663   -60.872 1.00 38.93 ? 37   PHE B C   1 
ATOM   4425 O O   . PHE B 1 37  ? 9.154   6.626   -61.043 1.00 40.15 ? 37   PHE B O   1 
ATOM   4426 C CB  . PHE B 1 37  ? 6.848   6.656   -59.127 1.00 37.42 ? 37   PHE B CB  1 
ATOM   4427 C CG  . PHE B 1 37  ? 7.317   5.862   -57.922 1.00 34.74 ? 37   PHE B CG  1 
ATOM   4428 C CD1 . PHE B 1 37  ? 8.633   5.913   -57.511 1.00 33.57 ? 37   PHE B CD1 1 
ATOM   4429 C CD2 . PHE B 1 37  ? 6.430   5.113   -57.182 1.00 34.96 ? 37   PHE B CD2 1 
ATOM   4430 C CE1 . PHE B 1 37  ? 9.072   5.220   -56.396 1.00 33.26 ? 37   PHE B CE1 1 
ATOM   4431 C CE2 . PHE B 1 37  ? 6.859   4.398   -56.054 1.00 35.32 ? 37   PHE B CE2 1 
ATOM   4432 C CZ  . PHE B 1 37  ? 8.192   4.451   -55.669 1.00 34.91 ? 37   PHE B CZ  1 
ATOM   4433 N N   . ALA B 1 38  ? 8.783   4.399   -61.018 1.00 39.05 ? 38   ALA B N   1 
ATOM   4434 C CA  . ALA B 1 38  ? 10.160  4.087   -61.427 1.00 38.81 ? 38   ALA B CA  1 
ATOM   4435 C C   . ALA B 1 38  ? 10.238  2.843   -62.306 1.00 38.95 ? 38   ALA B C   1 
ATOM   4436 O O   . ALA B 1 38  ? 9.378   1.940   -62.225 1.00 38.57 ? 38   ALA B O   1 
ATOM   4437 C CB  . ALA B 1 38  ? 11.026  3.882   -60.194 1.00 38.54 ? 38   ALA B CB  1 
ATOM   4438 N N   . GLU B 1 39  ? 11.290  2.778   -63.114 1.00 38.92 ? 39   GLU B N   1 
ATOM   4439 C CA  . GLU B 1 39  ? 11.663  1.522   -63.766 1.00 39.56 ? 39   GLU B CA  1 
ATOM   4440 C C   . GLU B 1 39  ? 11.785  0.429   -62.713 1.00 39.66 ? 39   GLU B C   1 
ATOM   4441 O O   . GLU B 1 39  ? 12.296  0.668   -61.620 1.00 40.11 ? 39   GLU B O   1 
ATOM   4442 C CB  . GLU B 1 39  ? 12.956  1.680   -64.551 1.00 39.25 ? 39   GLU B CB  1 
ATOM   4443 C CG  . GLU B 1 39  ? 12.817  2.666   -65.714 1.00 40.84 ? 39   GLU B CG  1 
ATOM   4444 C CD  . GLU B 1 39  ? 11.854  2.172   -66.785 1.00 42.99 ? 39   GLU B CD  1 
ATOM   4445 O OE1 . GLU B 1 39  ? 12.281  1.367   -67.640 1.00 46.62 ? 39   GLU B OE1 1 
ATOM   4446 O OE2 . GLU B 1 39  ? 10.675  2.578   -66.785 1.00 42.58 ? 39   GLU B OE2 1 
ATOM   4447 N N   . PRO B 1 40  ? 11.240  -0.761  -62.987 1.00 39.87 ? 40   PRO B N   1 
ATOM   4448 C CA  . PRO B 1 40  ? 11.460  -1.824  -61.992 1.00 40.06 ? 40   PRO B CA  1 
ATOM   4449 C C   . PRO B 1 40  ? 12.957  -1.994  -61.647 1.00 40.60 ? 40   PRO B C   1 
ATOM   4450 O O   . PRO B 1 40  ? 13.797  -2.076  -62.543 1.00 40.89 ? 40   PRO B O   1 
ATOM   4451 C CB  . PRO B 1 40  ? 10.910  -3.056  -62.684 1.00 39.84 ? 40   PRO B CB  1 
ATOM   4452 C CG  . PRO B 1 40  ? 9.899   -2.528  -63.628 1.00 39.89 ? 40   PRO B CG  1 
ATOM   4453 C CD  . PRO B 1 40  ? 10.402  -1.204  -64.108 1.00 39.30 ? 40   PRO B CD  1 
ATOM   4454 N N   . PRO B 1 41  ? 13.297  -1.994  -60.350 1.00 41.21 ? 41   PRO B N   1 
ATOM   4455 C CA  . PRO B 1 41  ? 14.710  -2.050  -59.938 1.00 41.65 ? 41   PRO B CA  1 
ATOM   4456 C C   . PRO B 1 41  ? 15.254  -3.504  -59.897 1.00 42.43 ? 41   PRO B C   1 
ATOM   4457 O O   . PRO B 1 41  ? 15.732  -3.980  -58.852 1.00 42.30 ? 41   PRO B O   1 
ATOM   4458 C CB  . PRO B 1 41  ? 14.659  -1.436  -58.548 1.00 41.34 ? 41   PRO B CB  1 
ATOM   4459 C CG  . PRO B 1 41  ? 13.309  -1.961  -58.021 1.00 41.06 ? 41   PRO B CG  1 
ATOM   4460 C CD  . PRO B 1 41  ? 12.381  -1.939  -59.192 1.00 40.80 ? 41   PRO B CD  1 
ATOM   4461 N N   . VAL B 1 42  ? 15.176  -4.186  -61.036 1.00 42.99 ? 42   VAL B N   1 
ATOM   4462 C CA  . VAL B 1 42  ? 15.461  -5.621  -61.134 1.00 43.40 ? 42   VAL B CA  1 
ATOM   4463 C C   . VAL B 1 42  ? 16.732  -5.883  -61.959 1.00 44.04 ? 42   VAL B C   1 
ATOM   4464 O O   . VAL B 1 42  ? 17.289  -4.964  -62.567 1.00 43.76 ? 42   VAL B O   1 
ATOM   4465 C CB  . VAL B 1 42  ? 14.266  -6.366  -61.775 1.00 43.90 ? 42   VAL B CB  1 
ATOM   4466 C CG1 . VAL B 1 42  ? 13.042  -6.323  -60.851 1.00 42.35 ? 42   VAL B CG1 1 
ATOM   4467 C CG2 . VAL B 1 42  ? 13.955  -5.790  -63.198 1.00 42.28 ? 42   VAL B CG2 1 
ATOM   4468 N N   . GLY B 1 43  ? 17.197  -7.129  -61.975 1.00 44.70 ? 43   GLY B N   1 
ATOM   4469 C CA  . GLY B 1 43  ? 18.404  -7.487  -62.737 1.00 45.65 ? 43   GLY B CA  1 
ATOM   4470 C C   . GLY B 1 43  ? 19.606  -6.628  -62.375 1.00 46.59 ? 43   GLY B C   1 
ATOM   4471 O O   . GLY B 1 43  ? 20.067  -6.658  -61.234 1.00 47.32 ? 43   GLY B O   1 
ATOM   4472 N N   . SER B 1 44  ? 20.112  -5.845  -63.321 1.00 47.30 ? 44   SER B N   1 
ATOM   4473 C CA  . SER B 1 44  ? 21.278  -5.011  -63.033 1.00 48.64 ? 44   SER B CA  1 
ATOM   4474 C C   . SER B 1 44  ? 20.939  -3.759  -62.216 1.00 49.16 ? 44   SER B C   1 
ATOM   4475 O O   . SER B 1 44  ? 21.837  -2.962  -61.872 1.00 49.99 ? 44   SER B O   1 
ATOM   4476 C CB  . SER B 1 44  ? 21.992  -4.602  -64.325 1.00 48.76 ? 44   SER B CB  1 
ATOM   4477 O OG  . SER B 1 44  ? 21.270  -3.598  -65.012 1.00 49.59 ? 44   SER B OG  1 
ATOM   4478 N N   . ARG B 1 45  ? 19.647  -3.567  -61.939 1.00 49.13 ? 45   ARG B N   1 
ATOM   4479 C CA  . ARG B 1 45  ? 19.166  -2.375  -61.245 1.00 48.82 ? 45   ARG B CA  1 
ATOM   4480 C C   . ARG B 1 45  ? 19.036  -2.659  -59.757 1.00 47.93 ? 45   ARG B C   1 
ATOM   4481 O O   . ARG B 1 45  ? 18.803  -1.738  -58.971 1.00 47.86 ? 45   ARG B O   1 
ATOM   4482 C CB  . ARG B 1 45  ? 17.814  -1.935  -61.793 1.00 49.49 ? 45   ARG B CB  1 
ATOM   4483 C CG  . ARG B 1 45  ? 17.800  -1.451  -63.228 1.00 52.35 ? 45   ARG B CG  1 
ATOM   4484 C CD  . ARG B 1 45  ? 18.255  -0.021  -63.292 1.00 60.56 ? 45   ARG B CD  1 
ATOM   4485 N NE  . ARG B 1 45  ? 19.718  0.078   -63.221 1.00 66.35 ? 45   ARG B NE  1 
ATOM   4486 C CZ  . ARG B 1 45  ? 20.413  1.150   -62.814 1.00 69.33 ? 45   ARG B CZ  1 
ATOM   4487 N NH1 . ARG B 1 45  ? 19.801  2.272   -62.390 1.00 69.87 ? 45   ARG B NH1 1 
ATOM   4488 N NH2 . ARG B 1 45  ? 21.744  1.086   -62.821 1.00 69.53 ? 45   ARG B NH2 1 
ATOM   4489 N N   . ARG B 1 46  ? 19.173  -3.934  -59.377 1.00 46.57 ? 46   ARG B N   1 
ATOM   4490 C CA  . ARG B 1 46  ? 19.175  -4.320  -57.968 1.00 45.30 ? 46   ARG B CA  1 
ATOM   4491 C C   . ARG B 1 46  ? 20.340  -3.634  -57.268 1.00 44.72 ? 46   ARG B C   1 
ATOM   4492 O O   . ARG B 1 46  ? 21.457  -3.663  -57.776 1.00 44.78 ? 46   ARG B O   1 
ATOM   4493 C CB  . ARG B 1 46  ? 19.279  -5.833  -57.817 1.00 45.08 ? 46   ARG B CB  1 
ATOM   4494 C CG  . ARG B 1 46  ? 19.230  -6.330  -56.381 1.00 43.41 ? 46   ARG B CG  1 
ATOM   4495 C CD  . ARG B 1 46  ? 19.662  -7.782  -56.306 1.00 42.53 ? 46   ARG B CD  1 
ATOM   4496 N NE  . ARG B 1 46  ? 18.524  -8.688  -56.357 1.00 41.80 ? 46   ARG B NE  1 
ATOM   4497 C CZ  . ARG B 1 46  ? 18.615  -10.009 -56.288 1.00 41.53 ? 46   ARG B CZ  1 
ATOM   4498 N NH1 . ARG B 1 46  ? 19.812  -10.580 -56.187 1.00 43.49 ? 46   ARG B NH1 1 
ATOM   4499 N NH2 . ARG B 1 46  ? 17.517  -10.763 -56.329 1.00 38.08 ? 46   ARG B NH2 1 
ATOM   4500 N N   . PHE B 1 47  ? 20.051  -3.040  -56.104 1.00 44.08 ? 47   PHE B N   1 
ATOM   4501 C CA  . PHE B 1 47  ? 20.961  -2.176  -55.312 1.00 43.70 ? 47   PHE B CA  1 
ATOM   4502 C C   . PHE B 1 47  ? 21.242  -0.799  -55.916 1.00 43.64 ? 47   PHE B C   1 
ATOM   4503 O O   . PHE B 1 47  ? 21.972  -0.016  -55.336 1.00 43.24 ? 47   PHE B O   1 
ATOM   4504 C CB  . PHE B 1 47  ? 22.297  -2.862  -54.946 1.00 42.93 ? 47   PHE B CB  1 
ATOM   4505 C CG  . PHE B 1 47  ? 22.150  -4.272  -54.503 1.00 42.69 ? 47   PHE B CG  1 
ATOM   4506 C CD1 . PHE B 1 47  ? 21.342  -4.597  -53.409 1.00 42.37 ? 47   PHE B CD1 1 
ATOM   4507 C CD2 . PHE B 1 47  ? 22.823  -5.298  -55.185 1.00 40.99 ? 47   PHE B CD2 1 
ATOM   4508 C CE1 . PHE B 1 47  ? 21.185  -5.940  -53.000 1.00 41.12 ? 47   PHE B CE1 1 
ATOM   4509 C CE2 . PHE B 1 47  ? 22.689  -6.629  -54.781 1.00 40.32 ? 47   PHE B CE2 1 
ATOM   4510 C CZ  . PHE B 1 47  ? 21.858  -6.954  -53.693 1.00 41.99 ? 47   PHE B CZ  1 
ATOM   4511 N N   . MET B 1 48  ? 20.685  -0.513  -57.084 1.00 44.54 ? 48   MET B N   1 
ATOM   4512 C CA  . MET B 1 48  ? 20.949  0.744   -57.784 1.00 45.03 ? 48   MET B CA  1 
ATOM   4513 C C   . MET B 1 48  ? 19.890  1.800   -57.467 1.00 44.41 ? 48   MET B C   1 
ATOM   4514 O O   . MET B 1 48  ? 18.745  1.462   -57.155 1.00 44.42 ? 48   MET B O   1 
ATOM   4515 C CB  . MET B 1 48  ? 20.965  0.484   -59.287 1.00 46.15 ? 48   MET B CB  1 
ATOM   4516 C CG  . MET B 1 48  ? 22.245  -0.226  -59.833 1.00 50.45 ? 48   MET B CG  1 
ATOM   4517 S SD  . MET B 1 48  ? 23.438  0.978   -60.510 1.00 57.10 ? 48   MET B SD  1 
ATOM   4518 C CE  . MET B 1 48  ? 24.265  1.508   -59.034 1.00 55.40 ? 48   MET B CE  1 
ATOM   4519 N N   . PRO B 1 49  ? 20.258  3.090   -57.535 1.00 44.11 ? 49   PRO B N   1 
ATOM   4520 C CA  . PRO B 1 49  ? 19.229  4.137   -57.448 1.00 43.81 ? 49   PRO B CA  1 
ATOM   4521 C C   . PRO B 1 49  ? 18.085  3.939   -58.463 1.00 44.04 ? 49   PRO B C   1 
ATOM   4522 O O   . PRO B 1 49  ? 18.310  3.387   -59.561 1.00 43.54 ? 49   PRO B O   1 
ATOM   4523 C CB  . PRO B 1 49  ? 20.003  5.416   -57.781 1.00 43.64 ? 49   PRO B CB  1 
ATOM   4524 C CG  . PRO B 1 49  ? 21.388  5.116   -57.390 1.00 44.29 ? 49   PRO B CG  1 
ATOM   4525 C CD  . PRO B 1 49  ? 21.610  3.657   -57.662 1.00 43.68 ? 49   PRO B CD  1 
ATOM   4526 N N   . PRO B 1 50  ? 16.862  4.404   -58.110 1.00 44.34 ? 50   PRO B N   1 
ATOM   4527 C CA  . PRO B 1 50  ? 15.711  4.250   -59.001 1.00 43.92 ? 50   PRO B CA  1 
ATOM   4528 C C   . PRO B 1 50  ? 15.819  5.203   -60.176 1.00 44.19 ? 50   PRO B C   1 
ATOM   4529 O O   . PRO B 1 50  ? 16.304  6.303   -60.023 1.00 44.40 ? 50   PRO B O   1 
ATOM   4530 C CB  . PRO B 1 50  ? 14.534  4.649   -58.112 1.00 43.84 ? 50   PRO B CB  1 
ATOM   4531 C CG  . PRO B 1 50  ? 15.116  5.613   -57.141 1.00 43.75 ? 50   PRO B CG  1 
ATOM   4532 C CD  . PRO B 1 50  ? 16.501  5.123   -56.869 1.00 43.90 ? 50   PRO B CD  1 
ATOM   4533 N N   . GLU B 1 51  ? 15.415  4.769   -61.355 1.00 44.84 ? 51   GLU B N   1 
ATOM   4534 C CA  . GLU B 1 51  ? 15.302  5.672   -62.481 1.00 46.48 ? 51   GLU B CA  1 
ATOM   4535 C C   . GLU B 1 51  ? 13.807  5.959   -62.703 1.00 44.56 ? 51   GLU B C   1 
ATOM   4536 O O   . GLU B 1 51  ? 12.958  5.139   -62.382 1.00 44.16 ? 51   GLU B O   1 
ATOM   4537 C CB  . GLU B 1 51  ? 15.914  5.035   -63.734 1.00 46.96 ? 51   GLU B CB  1 
ATOM   4538 C CG  . GLU B 1 51  ? 17.431  4.724   -63.680 1.00 49.99 ? 51   GLU B CG  1 
ATOM   4539 C CD  . GLU B 1 51  ? 17.835  3.640   -64.712 1.00 52.08 ? 51   GLU B CD  1 
ATOM   4540 O OE1 . GLU B 1 51  ? 17.150  2.572   -64.821 1.00 59.18 ? 51   GLU B OE1 1 
ATOM   4541 O OE2 . GLU B 1 51  ? 18.847  3.856   -65.427 1.00 59.84 ? 51   GLU B OE2 1 
ATOM   4542 N N   . PRO B 1 52  ? 13.484  7.141   -63.219 1.00 43.91 ? 52   PRO B N   1 
ATOM   4543 C CA  . PRO B 1 52  ? 12.099  7.480   -63.604 1.00 43.58 ? 52   PRO B CA  1 
ATOM   4544 C C   . PRO B 1 52  ? 11.433  6.480   -64.577 1.00 43.08 ? 52   PRO B C   1 
ATOM   4545 O O   . PRO B 1 52  ? 12.019  6.100   -65.601 1.00 42.38 ? 52   PRO B O   1 
ATOM   4546 C CB  . PRO B 1 52  ? 12.237  8.861   -64.259 1.00 43.51 ? 52   PRO B CB  1 
ATOM   4547 C CG  . PRO B 1 52  ? 13.554  9.411   -63.728 1.00 44.26 ? 52   PRO B CG  1 
ATOM   4548 C CD  . PRO B 1 52  ? 14.437  8.250   -63.430 1.00 43.95 ? 52   PRO B CD  1 
ATOM   4549 N N   . LYS B 1 53  ? 10.211  6.061   -64.243 1.00 43.19 ? 53   LYS B N   1 
ATOM   4550 C CA  . LYS B 1 53  ? 9.380   5.228   -65.138 1.00 43.16 ? 53   LYS B CA  1 
ATOM   4551 C C   . LYS B 1 53  ? 9.263   5.841   -66.519 1.00 43.38 ? 53   LYS B C   1 
ATOM   4552 O O   . LYS B 1 53  ? 9.015   7.041   -66.650 1.00 43.91 ? 53   LYS B O   1 
ATOM   4553 C CB  . LYS B 1 53  ? 7.983   5.068   -64.563 1.00 42.66 ? 53   LYS B CB  1 
ATOM   4554 C CG  . LYS B 1 53  ? 7.043   4.237   -65.414 1.00 42.48 ? 53   LYS B CG  1 
ATOM   4555 C CD  . LYS B 1 53  ? 7.257   2.745   -65.223 1.00 39.88 ? 53   LYS B CD  1 
ATOM   4556 C CE  . LYS B 1 53  ? 6.356   1.904   -66.136 1.00 38.01 ? 53   LYS B CE  1 
ATOM   4557 N NZ  . LYS B 1 53  ? 6.659   2.192   -67.557 1.00 36.33 ? 53   LYS B NZ  1 
ATOM   4558 N N   . ARG B 1 54  ? 9.454   5.027   -67.549 1.00 43.83 ? 54   ARG B N   1 
ATOM   4559 C CA  . ARG B 1 54  ? 9.306   5.494   -68.934 1.00 43.90 ? 54   ARG B CA  1 
ATOM   4560 C C   . ARG B 1 54  ? 7.815   5.687   -69.252 1.00 44.21 ? 54   ARG B C   1 
ATOM   4561 O O   . ARG B 1 54  ? 6.955   5.004   -68.673 1.00 43.04 ? 54   ARG B O   1 
ATOM   4562 C CB  . ARG B 1 54  ? 9.942   4.502   -69.924 1.00 43.75 ? 54   ARG B CB  1 
ATOM   4563 C CG  . ARG B 1 54  ? 11.481  4.456   -69.934 1.00 43.81 ? 54   ARG B CG  1 
ATOM   4564 C CD  . ARG B 1 54  ? 12.040  3.193   -70.674 1.00 43.75 ? 54   ARG B CD  1 
ATOM   4565 N NE  . ARG B 1 54  ? 11.419  1.937   -70.224 1.00 42.73 ? 54   ARG B NE  1 
ATOM   4566 C CZ  . ARG B 1 54  ? 10.569  1.189   -70.943 1.00 44.07 ? 54   ARG B CZ  1 
ATOM   4567 N NH1 . ARG B 1 54  ? 10.065  0.088   -70.392 1.00 42.17 ? 54   ARG B NH1 1 
ATOM   4568 N NH2 . ARG B 1 54  ? 10.221  1.519   -72.207 1.00 40.76 ? 54   ARG B NH2 1 
ATOM   4569 N N   . PRO B 1 55  ? 7.501   6.632   -70.161 1.00 45.11 ? 55   PRO B N   1 
ATOM   4570 C CA  . PRO B 1 55  ? 6.093   6.868   -70.557 1.00 45.45 ? 55   PRO B CA  1 
ATOM   4571 C C   . PRO B 1 55  ? 5.470   5.613   -71.138 1.00 45.66 ? 55   PRO B C   1 
ATOM   4572 O O   . PRO B 1 55  ? 6.186   4.784   -71.689 1.00 46.10 ? 55   PRO B O   1 
ATOM   4573 C CB  . PRO B 1 55  ? 6.205   7.953   -71.632 1.00 45.89 ? 55   PRO B CB  1 
ATOM   4574 C CG  . PRO B 1 55  ? 7.539   8.673   -71.318 1.00 45.14 ? 55   PRO B CG  1 
ATOM   4575 C CD  . PRO B 1 55  ? 8.436   7.547   -70.856 1.00 45.35 ? 55   PRO B CD  1 
ATOM   4576 N N   . TRP B 1 56  ? 4.161   5.447   -70.973 1.00 45.81 ? 56   TRP B N   1 
ATOM   4577 C CA  . TRP B 1 56  ? 3.473   4.270   -71.475 1.00 45.91 ? 56   TRP B CA  1 
ATOM   4578 C C   . TRP B 1 56  ? 2.388   4.661   -72.467 1.00 45.94 ? 56   TRP B C   1 
ATOM   4579 O O   . TRP B 1 56  ? 1.872   5.779   -72.436 1.00 46.01 ? 56   TRP B O   1 
ATOM   4580 C CB  . TRP B 1 56  ? 2.883   3.465   -70.327 1.00 46.03 ? 56   TRP B CB  1 
ATOM   4581 C CG  . TRP B 1 56  ? 1.927   4.252   -69.492 1.00 47.82 ? 56   TRP B CG  1 
ATOM   4582 C CD1 . TRP B 1 56  ? 0.576   4.429   -69.713 1.00 47.65 ? 56   TRP B CD1 1 
ATOM   4583 C CD2 . TRP B 1 56  ? 2.237   4.993   -68.297 1.00 48.86 ? 56   TRP B CD2 1 
ATOM   4584 N NE1 . TRP B 1 56  ? 0.035   5.237   -68.730 1.00 47.95 ? 56   TRP B NE1 1 
ATOM   4585 C CE2 . TRP B 1 56  ? 1.024   5.586   -67.844 1.00 48.89 ? 56   TRP B CE2 1 
ATOM   4586 C CE3 . TRP B 1 56  ? 3.412   5.199   -67.558 1.00 47.43 ? 56   TRP B CE3 1 
ATOM   4587 C CZ2 . TRP B 1 56  ? 0.962   6.371   -66.684 1.00 47.08 ? 56   TRP B CZ2 1 
ATOM   4588 C CZ3 . TRP B 1 56  ? 3.350   5.982   -66.416 1.00 47.41 ? 56   TRP B CZ3 1 
ATOM   4589 C CH2 . TRP B 1 56  ? 2.131   6.561   -65.989 1.00 47.12 ? 56   TRP B CH2 1 
ATOM   4590 N N   . SER B 1 57  ? 2.058   3.734   -73.356 1.00 46.29 ? 57   SER B N   1 
ATOM   4591 C CA  . SER B 1 57  ? 1.003   3.926   -74.348 1.00 46.45 ? 57   SER B CA  1 
ATOM   4592 C C   . SER B 1 57  ? -0.356  3.660   -73.696 1.00 46.65 ? 57   SER B C   1 
ATOM   4593 O O   . SER B 1 57  ? -0.422  2.961   -72.672 1.00 46.76 ? 57   SER B O   1 
ATOM   4594 C CB  . SER B 1 57  ? 1.199   2.929   -75.496 1.00 46.46 ? 57   SER B CB  1 
ATOM   4595 O OG  . SER B 1 57  ? 0.820   1.600   -75.088 1.00 46.35 ? 57   SER B OG  1 
ATOM   4596 N N   . GLY B 1 58  ? -1.429  4.184   -74.301 1.00 46.57 ? 58   GLY B N   1 
ATOM   4597 C CA  . GLY B 1 58  ? -2.793  3.908   -73.839 1.00 46.59 ? 58   GLY B CA  1 
ATOM   4598 C C   . GLY B 1 58  ? -3.131  4.320   -72.410 1.00 47.14 ? 58   GLY B C   1 
ATOM   4599 O O   . GLY B 1 58  ? -2.541  5.286   -71.854 1.00 47.06 ? 58   GLY B O   1 
ATOM   4600 N N   . VAL B 1 59  ? -4.093  3.584   -71.840 1.00 46.84 ? 59   VAL B N   1 
ATOM   4601 C CA  . VAL B 1 59  ? -4.635  3.815   -70.501 1.00 47.10 ? 59   VAL B CA  1 
ATOM   4602 C C   . VAL B 1 59  ? -4.208  2.678   -69.555 1.00 47.62 ? 59   VAL B C   1 
ATOM   4603 O O   . VAL B 1 59  ? -4.690  1.545   -69.671 1.00 47.44 ? 59   VAL B O   1 
ATOM   4604 C CB  . VAL B 1 59  ? -6.218  3.913   -70.513 1.00 47.44 ? 59   VAL B CB  1 
ATOM   4605 C CG1 . VAL B 1 59  ? -6.791  4.160   -69.099 1.00 46.32 ? 59   VAL B CG1 1 
ATOM   4606 C CG2 . VAL B 1 59  ? -6.689  4.991   -71.469 1.00 46.71 ? 59   VAL B CG2 1 
ATOM   4607 N N   . LEU B 1 60  ? -3.313  3.011   -68.619 1.00 48.05 ? 60   LEU B N   1 
ATOM   4608 C CA  . LEU B 1 60  ? -2.803  2.093   -67.605 1.00 47.55 ? 60   LEU B CA  1 
ATOM   4609 C C   . LEU B 1 60  ? -3.851  1.894   -66.550 1.00 47.38 ? 60   LEU B C   1 
ATOM   4610 O O   . LEU B 1 60  ? -4.434  2.861   -66.042 1.00 48.18 ? 60   LEU B O   1 
ATOM   4611 C CB  . LEU B 1 60  ? -1.549  2.690   -66.961 1.00 47.95 ? 60   LEU B CB  1 
ATOM   4612 C CG  . LEU B 1 60  ? -0.534  1.810   -66.197 1.00 48.91 ? 60   LEU B CG  1 
ATOM   4613 C CD1 . LEU B 1 60  ? 0.201   0.845   -67.135 1.00 49.97 ? 60   LEU B CD1 1 
ATOM   4614 C CD2 . LEU B 1 60  ? 0.478   2.708   -65.540 1.00 47.18 ? 60   LEU B CD2 1 
ATOM   4615 N N   . ASP B 1 61  ? -4.089  0.641   -66.214 1.00 46.98 ? 61   ASP B N   1 
ATOM   4616 C CA  . ASP B 1 61  ? -5.043  0.272   -65.191 1.00 47.19 ? 61   ASP B CA  1 
ATOM   4617 C C   . ASP B 1 61  ? -4.491  0.496   -63.760 1.00 46.96 ? 61   ASP B C   1 
ATOM   4618 O O   . ASP B 1 61  ? -3.652  -0.254  -63.262 1.00 47.75 ? 61   ASP B O   1 
ATOM   4619 C CB  . ASP B 1 61  ? -5.468  -1.179  -65.426 1.00 47.36 ? 61   ASP B CB  1 
ATOM   4620 C CG  . ASP B 1 61  ? -6.009  -1.845  -64.181 1.00 50.47 ? 61   ASP B CG  1 
ATOM   4621 O OD1 . ASP B 1 61  ? -5.521  -2.950  -63.839 1.00 54.49 ? 61   ASP B OD1 1 
ATOM   4622 O OD2 . ASP B 1 61  ? -6.897  -1.259  -63.519 1.00 52.22 ? 61   ASP B OD2 1 
ATOM   4623 N N   . ALA B 1 62  ? -4.985  1.525   -63.090 1.00 46.59 ? 62   ALA B N   1 
ATOM   4624 C CA  . ALA B 1 62  ? -4.537  1.866   -61.737 1.00 46.00 ? 62   ALA B CA  1 
ATOM   4625 C C   . ALA B 1 62  ? -5.666  1.668   -60.734 1.00 45.78 ? 62   ALA B C   1 
ATOM   4626 O O   . ALA B 1 62  ? -6.086  2.628   -60.069 1.00 45.90 ? 62   ALA B O   1 
ATOM   4627 C CB  . ALA B 1 62  ? -4.043  3.328   -61.696 1.00 45.70 ? 62   ALA B CB  1 
ATOM   4628 N N   . THR B 1 63  ? -6.168  0.441   -60.635 1.00 45.24 ? 63   THR B N   1 
ATOM   4629 C CA  . THR B 1 63  ? -7.394  0.191   -59.881 1.00 44.92 ? 63   THR B CA  1 
ATOM   4630 C C   . THR B 1 63  ? -7.170  -0.849  -58.822 1.00 44.96 ? 63   THR B C   1 
ATOM   4631 O O   . THR B 1 63  ? -8.089  -1.205  -58.081 1.00 45.33 ? 63   THR B O   1 
ATOM   4632 C CB  . THR B 1 63  ? -8.601  -0.228  -60.786 1.00 45.41 ? 63   THR B CB  1 
ATOM   4633 O OG1 . THR B 1 63  ? -8.437  -1.573  -61.260 1.00 44.61 ? 63   THR B OG1 1 
ATOM   4634 C CG2 . THR B 1 63  ? -8.779  0.759   -61.980 1.00 45.65 ? 63   THR B CG2 1 
ATOM   4635 N N   . THR B 1 64  ? -5.928  -1.308  -58.744 1.00 44.80 ? 64   THR B N   1 
ATOM   4636 C CA  . THR B 1 64  ? -5.528  -2.354  -57.828 1.00 44.71 ? 64   THR B CA  1 
ATOM   4637 C C   . THR B 1 64  ? -4.091  -2.067  -57.311 1.00 44.17 ? 64   THR B C   1 
ATOM   4638 O O   . THR B 1 64  ? -3.249  -1.516  -58.042 1.00 42.75 ? 64   THR B O   1 
ATOM   4639 C CB  . THR B 1 64  ? -5.651  -3.753  -58.520 1.00 44.99 ? 64   THR B CB  1 
ATOM   4640 O OG1 . THR B 1 64  ? -5.240  -4.777  -57.616 1.00 47.81 ? 64   THR B OG1 1 
ATOM   4641 C CG2 . THR B 1 64  ? -4.779  -3.852  -59.781 1.00 46.12 ? 64   THR B CG2 1 
ATOM   4642 N N   . PHE B 1 65  ? -3.851  -2.406  -56.040 1.00 43.95 ? 65   PHE B N   1 
ATOM   4643 C CA  . PHE B 1 65  ? -2.526  -2.347  -55.436 1.00 44.43 ? 65   PHE B CA  1 
ATOM   4644 C C   . PHE B 1 65  ? -1.570  -3.248  -56.198 1.00 44.87 ? 65   PHE B C   1 
ATOM   4645 O O   . PHE B 1 65  ? -1.907  -4.401  -56.536 1.00 44.67 ? 65   PHE B O   1 
ATOM   4646 C CB  . PHE B 1 65  ? -2.550  -2.802  -53.969 1.00 44.29 ? 65   PHE B CB  1 
ATOM   4647 C CG  . PHE B 1 65  ? -3.179  -1.809  -53.029 1.00 44.28 ? 65   PHE B CG  1 
ATOM   4648 C CD1 . PHE B 1 65  ? -2.734  -0.478  -52.986 1.00 42.75 ? 65   PHE B CD1 1 
ATOM   4649 C CD2 . PHE B 1 65  ? -4.205  -2.208  -52.160 1.00 43.99 ? 65   PHE B CD2 1 
ATOM   4650 C CE1 . PHE B 1 65  ? -3.317  0.435   -52.118 1.00 40.73 ? 65   PHE B CE1 1 
ATOM   4651 C CE2 . PHE B 1 65  ? -4.792  -1.300  -51.275 1.00 42.45 ? 65   PHE B CE2 1 
ATOM   4652 C CZ  . PHE B 1 65  ? -4.353  0.026   -51.262 1.00 42.29 ? 65   PHE B CZ  1 
ATOM   4653 N N   . GLN B 1 66  ? -0.390  -2.701  -56.480 1.00 44.96 ? 66   GLN B N   1 
ATOM   4654 C CA  . GLN B 1 66  ? 0.705   -3.441  -57.089 1.00 45.10 ? 66   GLN B CA  1 
ATOM   4655 C C   . GLN B 1 66  ? 1.469   -4.295  -56.075 1.00 44.52 ? 66   GLN B C   1 
ATOM   4656 O O   . GLN B 1 66  ? 1.098   -4.344  -54.897 1.00 44.17 ? 66   GLN B O   1 
ATOM   4657 C CB  . GLN B 1 66  ? 1.630   -2.479  -57.804 1.00 45.15 ? 66   GLN B CB  1 
ATOM   4658 C CG  . GLN B 1 66  ? 1.295   -2.381  -59.260 1.00 48.52 ? 66   GLN B CG  1 
ATOM   4659 C CD  . GLN B 1 66  ? 1.752   -3.616  -60.006 1.00 51.70 ? 66   GLN B CD  1 
ATOM   4660 O OE1 . GLN B 1 66  ? 2.231   -4.585  -59.390 1.00 53.16 ? 66   GLN B OE1 1 
ATOM   4661 N NE2 . GLN B 1 66  ? 1.628   -3.592  -61.330 1.00 50.71 ? 66   GLN B NE2 1 
ATOM   4662 N N   . ASN B 1 67  ? 2.511   -4.991  -56.529 1.00 44.60 ? 67   ASN B N   1 
ATOM   4663 C CA  . ASN B 1 67  ? 3.226   -5.937  -55.657 1.00 44.60 ? 67   ASN B CA  1 
ATOM   4664 C C   . ASN B 1 67  ? 3.918   -5.250  -54.509 1.00 43.76 ? 67   ASN B C   1 
ATOM   4665 O O   . ASN B 1 67  ? 4.293   -4.085  -54.618 1.00 43.96 ? 67   ASN B O   1 
ATOM   4666 C CB  . ASN B 1 67  ? 4.283   -6.713  -56.423 1.00 45.54 ? 67   ASN B CB  1 
ATOM   4667 C CG  . ASN B 1 67  ? 3.728   -7.430  -57.634 1.00 47.92 ? 67   ASN B CG  1 
ATOM   4668 O OD1 . ASN B 1 67  ? 2.862   -8.305  -57.506 1.00 47.78 ? 67   ASN B OD1 1 
ATOM   4669 N ND2 . ASN B 1 67  ? 4.269   -7.090  -58.828 1.00 49.26 ? 67   ASN B ND2 1 
ATOM   4670 N N   . VAL B 1 68  ? 4.087   -5.996  -53.424 1.00 42.82 ? 68   VAL B N   1 
ATOM   4671 C CA  . VAL B 1 68  ? 4.788   -5.579  -52.224 1.00 42.54 ? 68   VAL B CA  1 
ATOM   4672 C C   . VAL B 1 68  ? 6.276   -5.856  -52.410 1.00 42.87 ? 68   VAL B C   1 
ATOM   4673 O O   . VAL B 1 68  ? 6.646   -6.959  -52.876 1.00 44.00 ? 68   VAL B O   1 
ATOM   4674 C CB  . VAL B 1 68  ? 4.235   -6.381  -51.031 1.00 42.20 ? 68   VAL B CB  1 
ATOM   4675 C CG1 . VAL B 1 68  ? 5.062   -6.223  -49.802 1.00 41.82 ? 68   VAL B CG1 1 
ATOM   4676 C CG2 . VAL B 1 68  ? 2.806   -5.960  -50.738 1.00 42.85 ? 68   VAL B CG2 1 
ATOM   4677 N N   . CYS B 1 69  ? 7.130   -4.891  -52.055 1.00 42.36 ? 69   CYS B N   1 
ATOM   4678 C CA  . CYS B 1 69  ? 8.605   -5.036  -52.221 1.00 42.63 ? 69   CYS B CA  1 
ATOM   4679 C C   . CYS B 1 69  ? 9.151   -6.240  -51.514 1.00 42.55 ? 69   CYS B C   1 
ATOM   4680 O O   . CYS B 1 69  ? 8.673   -6.583  -50.443 1.00 42.34 ? 69   CYS B O   1 
ATOM   4681 C CB  . CYS B 1 69  ? 9.354   -3.820  -51.722 1.00 41.91 ? 69   CYS B CB  1 
ATOM   4682 S SG  . CYS B 1 69  ? 9.198   -2.395  -52.778 1.00 43.23 ? 69   CYS B SG  1 
ATOM   4683 N N   . TYR B 1 70  ? 10.152  -6.880  -52.113 1.00 43.60 ? 70   TYR B N   1 
ATOM   4684 C CA  . TYR B 1 70  ? 10.619  -8.164  -51.583 1.00 44.65 ? 70   TYR B CA  1 
ATOM   4685 C C   . TYR B 1 70  ? 11.206  -8.028  -50.193 1.00 45.13 ? 70   TYR B C   1 
ATOM   4686 O O   . TYR B 1 70  ? 12.038  -7.157  -49.943 1.00 45.22 ? 70   TYR B O   1 
ATOM   4687 C CB  . TYR B 1 70  ? 11.591  -8.897  -52.515 1.00 44.90 ? 70   TYR B CB  1 
ATOM   4688 C CG  . TYR B 1 70  ? 11.488  -10.397 -52.315 1.00 45.44 ? 70   TYR B CG  1 
ATOM   4689 C CD1 . TYR B 1 70  ? 10.658  -11.168 -53.115 1.00 45.02 ? 70   TYR B CD1 1 
ATOM   4690 C CD2 . TYR B 1 70  ? 12.173  -11.031 -51.280 1.00 46.11 ? 70   TYR B CD2 1 
ATOM   4691 C CE1 . TYR B 1 70  ? 10.530  -12.526 -52.906 1.00 44.59 ? 70   TYR B CE1 1 
ATOM   4692 C CE2 . TYR B 1 70  ? 12.034  -12.384 -51.057 1.00 44.87 ? 70   TYR B CE2 1 
ATOM   4693 C CZ  . TYR B 1 70  ? 11.217  -13.124 -51.875 1.00 44.43 ? 70   TYR B CZ  1 
ATOM   4694 O OH  . TYR B 1 70  ? 11.101  -14.468 -51.658 1.00 43.96 ? 70   TYR B OH  1 
ATOM   4695 N N   . GLN B 1 71  ? 10.758  -8.901  -49.301 1.00 45.86 ? 71   GLN B N   1 
ATOM   4696 C CA  . GLN B 1 71  ? 11.017  -8.744  -47.890 1.00 46.88 ? 71   GLN B CA  1 
ATOM   4697 C C   . GLN B 1 71  ? 10.780  -10.028 -47.090 1.00 48.66 ? 71   GLN B C   1 
ATOM   4698 O O   . GLN B 1 71  ? 9.996   -10.894 -47.486 1.00 48.31 ? 71   GLN B O   1 
ATOM   4699 C CB  . GLN B 1 71  ? 10.104  -7.638  -47.322 1.00 46.56 ? 71   GLN B CB  1 
ATOM   4700 C CG  . GLN B 1 71  ? 8.596   -7.992  -47.338 1.00 45.66 ? 71   GLN B CG  1 
ATOM   4701 C CD  . GLN B 1 71  ? 7.702   -6.825  -46.919 1.00 45.15 ? 71   GLN B CD  1 
ATOM   4702 O OE1 . GLN B 1 71  ? 7.093   -6.866  -45.847 1.00 41.72 ? 71   GLN B OE1 1 
ATOM   4703 N NE2 . GLN B 1 71  ? 7.635   -5.780  -47.754 1.00 38.88 ? 71   GLN B NE2 1 
ATOM   4704 N N   . TYR B 1 72  ? 11.448  -10.102 -45.941 1.00 50.59 ? 72   TYR B N   1 
ATOM   4705 C CA  . TYR B 1 72  ? 11.136  -11.029 -44.876 1.00 53.14 ? 72   TYR B CA  1 
ATOM   4706 C C   . TYR B 1 72  ? 9.648   -10.991 -44.518 1.00 54.13 ? 72   TYR B C   1 
ATOM   4707 O O   . TYR B 1 72  ? 9.037   -9.934  -44.500 1.00 54.11 ? 72   TYR B O   1 
ATOM   4708 C CB  . TYR B 1 72  ? 11.981  -10.664 -43.655 1.00 54.24 ? 72   TYR B CB  1 
ATOM   4709 C CG  . TYR B 1 72  ? 11.812  -11.612 -42.505 1.00 56.73 ? 72   TYR B CG  1 
ATOM   4710 C CD1 . TYR B 1 72  ? 10.988  -11.281 -41.413 1.00 58.99 ? 72   TYR B CD1 1 
ATOM   4711 C CD2 . TYR B 1 72  ? 12.460  -12.858 -42.500 1.00 58.45 ? 72   TYR B CD2 1 
ATOM   4712 C CE1 . TYR B 1 72  ? 10.814  -12.174 -40.342 1.00 58.68 ? 72   TYR B CE1 1 
ATOM   4713 C CE2 . TYR B 1 72  ? 12.293  -13.751 -41.437 1.00 59.00 ? 72   TYR B CE2 1 
ATOM   4714 C CZ  . TYR B 1 72  ? 11.478  -13.399 -40.368 1.00 57.98 ? 72   TYR B CZ  1 
ATOM   4715 O OH  . TYR B 1 72  ? 11.323  -14.274 -39.329 1.00 58.48 ? 72   TYR B OH  1 
ATOM   4716 N N   . VAL B 1 73  ? 9.072   -12.157 -44.257 1.00 56.03 ? 73   VAL B N   1 
ATOM   4717 C CA  . VAL B 1 73  ? 7.692   -12.262 -43.779 1.00 57.85 ? 73   VAL B CA  1 
ATOM   4718 C C   . VAL B 1 73  ? 7.718   -12.863 -42.376 1.00 59.41 ? 73   VAL B C   1 
ATOM   4719 O O   . VAL B 1 73  ? 8.347   -13.893 -42.147 1.00 59.71 ? 73   VAL B O   1 
ATOM   4720 C CB  . VAL B 1 73  ? 6.782   -13.124 -44.722 1.00 57.68 ? 73   VAL B CB  1 
ATOM   4721 C CG1 . VAL B 1 73  ? 5.384   -13.268 -44.157 1.00 56.99 ? 73   VAL B CG1 1 
ATOM   4722 C CG2 . VAL B 1 73  ? 6.705   -12.521 -46.113 1.00 57.83 ? 73   VAL B CG2 1 
ATOM   4723 N N   . ASP B 1 74  ? 7.035   -12.208 -41.441 1.00 61.54 ? 74   ASP B N   1 
ATOM   4724 C CA  . ASP B 1 74  ? 6.962   -12.666 -40.064 1.00 63.19 ? 74   ASP B CA  1 
ATOM   4725 C C   . ASP B 1 74  ? 6.132   -13.943 -39.901 1.00 64.34 ? 74   ASP B C   1 
ATOM   4726 O O   . ASP B 1 74  ? 4.989   -14.025 -40.363 1.00 64.45 ? 74   ASP B O   1 
ATOM   4727 C CB  . ASP B 1 74  ? 6.381   -11.570 -39.180 1.00 63.36 ? 74   ASP B CB  1 
ATOM   4728 C CG  . ASP B 1 74  ? 6.508   -11.896 -37.714 1.00 64.02 ? 74   ASP B CG  1 
ATOM   4729 O OD1 . ASP B 1 74  ? 5.509   -12.335 -37.106 1.00 64.72 ? 74   ASP B OD1 1 
ATOM   4730 O OD2 . ASP B 1 74  ? 7.630   -11.758 -37.190 1.00 64.93 ? 74   ASP B OD2 1 
ATOM   4731 N N   . THR B 1 75  ? 6.717   -14.933 -39.232 1.00 65.84 ? 75   THR B N   1 
ATOM   4732 C CA  . THR B 1 75  ? 6.032   -16.202 -38.969 1.00 67.21 ? 75   THR B CA  1 
ATOM   4733 C C   . THR B 1 75  ? 6.153   -16.589 -37.501 1.00 68.15 ? 75   THR B C   1 
ATOM   4734 O O   . THR B 1 75  ? 6.052   -17.773 -37.160 1.00 68.63 ? 75   THR B O   1 
ATOM   4735 C CB  . THR B 1 75  ? 6.586   -17.386 -39.837 1.00 67.33 ? 75   THR B CB  1 
ATOM   4736 O OG1 . THR B 1 75  ? 7.979   -17.591 -39.547 1.00 66.43 ? 75   THR B OG1 1 
ATOM   4737 C CG2 . THR B 1 75  ? 6.360   -17.151 -41.361 1.00 67.09 ? 75   THR B CG2 1 
ATOM   4738 N N   . LEU B 1 76  ? 6.370   -15.604 -36.634 1.00 69.06 ? 76   LEU B N   1 
ATOM   4739 C CA  . LEU B 1 76  ? 6.468   -15.883 -35.205 1.00 70.06 ? 76   LEU B CA  1 
ATOM   4740 C C   . LEU B 1 76  ? 5.144   -16.422 -34.623 1.00 70.11 ? 76   LEU B C   1 
ATOM   4741 O O   . LEU B 1 76  ? 5.149   -17.414 -33.900 1.00 70.79 ? 76   LEU B O   1 
ATOM   4742 C CB  . LEU B 1 76  ? 6.949   -14.655 -34.429 1.00 70.30 ? 76   LEU B CB  1 
ATOM   4743 C CG  . LEU B 1 76  ? 7.327   -14.885 -32.955 1.00 71.48 ? 76   LEU B CG  1 
ATOM   4744 C CD1 . LEU B 1 76  ? 8.721   -15.562 -32.812 1.00 71.11 ? 76   LEU B CD1 1 
ATOM   4745 C CD2 . LEU B 1 76  ? 7.257   -13.553 -32.175 1.00 70.61 ? 76   LEU B CD2 1 
ATOM   4746 N N   . TYR B 1 77  ? 4.021   -15.784 -34.931 1.00 69.74 ? 77   TYR B N   1 
ATOM   4747 C CA  . TYR B 1 77  ? 2.734   -16.302 -34.482 1.00 69.42 ? 77   TYR B CA  1 
ATOM   4748 C C   . TYR B 1 77  ? 1.822   -16.473 -35.679 1.00 69.10 ? 77   TYR B C   1 
ATOM   4749 O O   . TYR B 1 77  ? 0.991   -15.595 -35.946 1.00 69.04 ? 77   TYR B O   1 
ATOM   4750 C CB  . TYR B 1 77  ? 2.072   -15.354 -33.482 1.00 69.90 ? 77   TYR B CB  1 
ATOM   4751 C CG  . TYR B 1 77  ? 2.863   -15.097 -32.226 1.00 70.15 ? 77   TYR B CG  1 
ATOM   4752 C CD1 . TYR B 1 77  ? 2.942   -16.056 -31.229 1.00 70.69 ? 77   TYR B CD1 1 
ATOM   4753 C CD2 . TYR B 1 77  ? 3.516   -13.882 -32.029 1.00 70.35 ? 77   TYR B CD2 1 
ATOM   4754 C CE1 . TYR B 1 77  ? 3.652   -15.821 -30.062 1.00 71.53 ? 77   TYR B CE1 1 
ATOM   4755 C CE2 . TYR B 1 77  ? 4.240   -13.631 -30.866 1.00 70.70 ? 77   TYR B CE2 1 
ATOM   4756 C CZ  . TYR B 1 77  ? 4.306   -14.606 -29.885 1.00 71.00 ? 77   TYR B CZ  1 
ATOM   4757 O OH  . TYR B 1 77  ? 5.015   -14.386 -28.724 1.00 69.93 ? 77   TYR B OH  1 
ATOM   4758 N N   . PRO B 1 78  ? 1.958   -17.606 -36.399 1.00 68.69 ? 78   PRO B N   1 
ATOM   4759 C CA  . PRO B 1 78  ? 1.233   -17.804 -37.669 1.00 68.15 ? 78   PRO B CA  1 
ATOM   4760 C C   . PRO B 1 78  ? -0.276  -17.715 -37.474 1.00 67.49 ? 78   PRO B C   1 
ATOM   4761 O O   . PRO B 1 78  ? -0.800  -18.352 -36.564 1.00 67.45 ? 78   PRO B O   1 
ATOM   4762 C CB  . PRO B 1 78  ? 1.639   -19.225 -38.090 1.00 68.27 ? 78   PRO B CB  1 
ATOM   4763 C CG  . PRO B 1 78  ? 2.957   -19.485 -37.375 1.00 68.76 ? 78   PRO B CG  1 
ATOM   4764 C CD  . PRO B 1 78  ? 2.790   -18.776 -36.047 1.00 68.68 ? 78   PRO B CD  1 
ATOM   4765 N N   . GLY B 1 79  ? -0.956  -16.903 -38.290 1.00 66.85 ? 79   GLY B N   1 
ATOM   4766 C CA  . GLY B 1 79  ? -2.424  -16.745 -38.210 1.00 66.10 ? 79   GLY B CA  1 
ATOM   4767 C C   . GLY B 1 79  ? -2.990  -15.865 -37.092 1.00 65.63 ? 79   GLY B C   1 
ATOM   4768 O O   . GLY B 1 79  ? -4.213  -15.748 -36.945 1.00 65.27 ? 79   GLY B O   1 
ATOM   4769 N N   . PHE B 1 80  ? -2.103  -15.257 -36.300 1.00 64.80 ? 80   PHE B N   1 
ATOM   4770 C CA  . PHE B 1 80  ? -2.478  -14.279 -35.275 1.00 64.16 ? 80   PHE B CA  1 
ATOM   4771 C C   . PHE B 1 80  ? -2.657  -12.891 -35.898 1.00 63.67 ? 80   PHE B C   1 
ATOM   4772 O O   . PHE B 1 80  ? -1.727  -12.370 -36.514 1.00 63.82 ? 80   PHE B O   1 
ATOM   4773 C CB  . PHE B 1 80  ? -1.401  -14.246 -34.184 1.00 64.04 ? 80   PHE B CB  1 
ATOM   4774 C CG  . PHE B 1 80  ? -1.593  -13.165 -33.150 1.00 63.77 ? 80   PHE B CG  1 
ATOM   4775 C CD1 . PHE B 1 80  ? -2.814  -13.010 -32.488 1.00 63.07 ? 80   PHE B CD1 1 
ATOM   4776 C CD2 . PHE B 1 80  ? -0.535  -12.331 -32.804 1.00 63.64 ? 80   PHE B CD2 1 
ATOM   4777 C CE1 . PHE B 1 80  ? -2.984  -12.029 -31.526 1.00 62.65 ? 80   PHE B CE1 1 
ATOM   4778 C CE2 . PHE B 1 80  ? -0.696  -11.355 -31.834 1.00 63.59 ? 80   PHE B CE2 1 
ATOM   4779 C CZ  . PHE B 1 80  ? -1.930  -11.202 -31.196 1.00 63.30 ? 80   PHE B CZ  1 
ATOM   4780 N N   . GLU B 1 81  ? -3.839  -12.295 -35.738 1.00 62.90 ? 81   GLU B N   1 
ATOM   4781 C CA  . GLU B 1 81  ? -4.138  -10.995 -36.369 1.00 62.66 ? 81   GLU B CA  1 
ATOM   4782 C C   . GLU B 1 81  ? -3.147  -9.872  -35.975 1.00 61.68 ? 81   GLU B C   1 
ATOM   4783 O O   . GLU B 1 81  ? -2.817  -8.998  -36.784 1.00 61.71 ? 81   GLU B O   1 
ATOM   4784 C CB  . GLU B 1 81  ? -5.611  -10.588 -36.124 1.00 63.11 ? 81   GLU B CB  1 
ATOM   4785 C CG  . GLU B 1 81  ? -6.044  -9.236  -36.722 1.00 65.68 ? 81   GLU B CG  1 
ATOM   4786 C CD  . GLU B 1 81  ? -6.035  -9.184  -38.281 1.00 70.95 ? 81   GLU B CD  1 
ATOM   4787 O OE1 . GLU B 1 81  ? -7.004  -8.614  -38.850 1.00 73.27 ? 81   GLU B OE1 1 
ATOM   4788 O OE2 . GLU B 1 81  ? -5.080  -9.683  -38.946 1.00 71.04 ? 81   GLU B OE2 1 
ATOM   4789 N N   . GLY B 1 82  ? -2.666  -9.922  -34.736 1.00 60.48 ? 82   GLY B N   1 
ATOM   4790 C CA  . GLY B 1 82  ? -1.677  -8.981  -34.237 1.00 58.98 ? 82   GLY B CA  1 
ATOM   4791 C C   . GLY B 1 82  ? -0.429  -8.834  -35.087 1.00 57.80 ? 82   GLY B C   1 
ATOM   4792 O O   . GLY B 1 82  ? 0.037   -7.717  -35.291 1.00 57.76 ? 82   GLY B O   1 
ATOM   4793 N N   . THR B 1 83  ? 0.120   -9.961  -35.550 1.00 56.66 ? 83   THR B N   1 
ATOM   4794 C CA  . THR B 1 83  ? 1.292   -9.987  -36.437 1.00 55.55 ? 83   THR B CA  1 
ATOM   4795 C C   . THR B 1 83  ? 0.919   -9.923  -37.915 1.00 55.21 ? 83   THR B C   1 
ATOM   4796 O O   . THR B 1 83  ? 1.653   -9.336  -38.699 1.00 55.37 ? 83   THR B O   1 
ATOM   4797 C CB  . THR B 1 83  ? 2.173   -11.259 -36.242 1.00 55.42 ? 83   THR B CB  1 
ATOM   4798 O OG1 . THR B 1 83  ? 1.348   -12.433 -36.242 1.00 55.27 ? 83   THR B OG1 1 
ATOM   4799 C CG2 . THR B 1 83  ? 2.951   -11.200 -34.952 1.00 55.06 ? 83   THR B CG2 1 
ATOM   4800 N N   . GLU B 1 84  ? -0.212  -10.521 -38.294 1.00 54.86 ? 84   GLU B N   1 
ATOM   4801 C CA  . GLU B 1 84  ? -0.551  -10.687 -39.709 1.00 55.02 ? 84   GLU B CA  1 
ATOM   4802 C C   . GLU B 1 84  ? -0.914  -9.377  -40.354 1.00 54.00 ? 84   GLU B C   1 
ATOM   4803 O O   . GLU B 1 84  ? -0.760  -9.222  -41.558 1.00 54.10 ? 84   GLU B O   1 
ATOM   4804 C CB  . GLU B 1 84  ? -1.723  -11.648 -39.908 1.00 56.07 ? 84   GLU B CB  1 
ATOM   4805 C CG  . GLU B 1 84  ? -1.488  -13.095 -39.431 1.00 59.96 ? 84   GLU B CG  1 
ATOM   4806 C CD  . GLU B 1 84  ? -0.778  -13.978 -40.451 1.00 64.01 ? 84   GLU B CD  1 
ATOM   4807 O OE1 . GLU B 1 84  ? -0.133  -13.416 -41.374 1.00 65.74 ? 84   GLU B OE1 1 
ATOM   4808 O OE2 . GLU B 1 84  ? -0.876  -15.233 -40.317 1.00 64.58 ? 84   GLU B OE2 1 
ATOM   4809 N N   . MET B 1 85  ? -1.401  -8.430  -39.558 1.00 52.88 ? 85   MET B N   1 
ATOM   4810 C CA  . MET B 1 85  ? -1.873  -7.158  -40.091 1.00 51.73 ? 85   MET B CA  1 
ATOM   4811 C C   . MET B 1 85  ? -0.711  -6.368  -40.663 1.00 50.19 ? 85   MET B C   1 
ATOM   4812 O O   . MET B 1 85  ? -0.914  -5.413  -41.416 1.00 49.46 ? 85   MET B O   1 
ATOM   4813 C CB  . MET B 1 85  ? -2.608  -6.358  -39.023 1.00 51.76 ? 85   MET B CB  1 
ATOM   4814 C CG  . MET B 1 85  ? -1.759  -5.984  -37.822 1.00 51.93 ? 85   MET B CG  1 
ATOM   4815 S SD  . MET B 1 85  ? -2.589  -4.808  -36.729 1.00 54.48 ? 85   MET B SD  1 
ATOM   4816 C CE  . MET B 1 85  ? -2.636  -3.293  -37.690 1.00 50.20 ? 85   MET B CE  1 
ATOM   4817 N N   . TRP B 1 86  ? 0.507   -6.790  -40.321 1.00 48.62 ? 86   TRP B N   1 
ATOM   4818 C CA  . TRP B 1 86  ? 1.703   -6.140  -40.861 1.00 47.45 ? 86   TRP B CA  1 
ATOM   4819 C C   . TRP B 1 86  ? 2.333   -6.891  -42.029 1.00 47.17 ? 86   TRP B C   1 
ATOM   4820 O O   . TRP B 1 86  ? 3.191   -6.366  -42.705 1.00 47.43 ? 86   TRP B O   1 
ATOM   4821 C CB  . TRP B 1 86  ? 2.735   -5.848  -39.758 1.00 45.84 ? 86   TRP B CB  1 
ATOM   4822 C CG  . TRP B 1 86  ? 2.130   -5.130  -38.576 1.00 43.92 ? 86   TRP B CG  1 
ATOM   4823 C CD1 . TRP B 1 86  ? 1.842   -5.671  -37.363 1.00 42.08 ? 86   TRP B CD1 1 
ATOM   4824 C CD2 . TRP B 1 86  ? 1.731   -3.762  -38.504 1.00 41.81 ? 86   TRP B CD2 1 
ATOM   4825 N NE1 . TRP B 1 86  ? 1.306   -4.735  -36.543 1.00 41.02 ? 86   TRP B NE1 1 
ATOM   4826 C CE2 . TRP B 1 86  ? 1.218   -3.549  -37.216 1.00 42.68 ? 86   TRP B CE2 1 
ATOM   4827 C CE3 . TRP B 1 86  ? 1.765   -2.690  -39.401 1.00 41.87 ? 86   TRP B CE3 1 
ATOM   4828 C CZ2 . TRP B 1 86  ? 0.749   -2.291  -36.785 1.00 43.74 ? 86   TRP B CZ2 1 
ATOM   4829 C CZ3 . TRP B 1 86  ? 1.281   -1.452  -38.988 1.00 42.27 ? 86   TRP B CZ3 1 
ATOM   4830 C CH2 . TRP B 1 86  ? 0.780   -1.262  -37.690 1.00 42.95 ? 86   TRP B CH2 1 
ATOM   4831 N N   . ASN B 1 87  ? 1.894   -8.114  -42.263 1.00 47.30 ? 87   ASN B N   1 
ATOM   4832 C CA  . ASN B 1 87  ? 2.460   -8.946  -43.316 1.00 47.47 ? 87   ASN B CA  1 
ATOM   4833 C C   . ASN B 1 87  ? 2.005   -8.527  -44.703 1.00 47.06 ? 87   ASN B C   1 
ATOM   4834 O O   . ASN B 1 87  ? 0.943   -7.922  -44.845 1.00 47.19 ? 87   ASN B O   1 
ATOM   4835 C CB  . ASN B 1 87  ? 2.114   -10.403 -43.051 1.00 47.62 ? 87   ASN B CB  1 
ATOM   4836 C CG  . ASN B 1 87  ? 3.100   -11.059 -42.130 1.00 49.61 ? 87   ASN B CG  1 
ATOM   4837 O OD1 . ASN B 1 87  ? 4.244   -10.597 -41.988 1.00 49.91 ? 87   ASN B OD1 1 
ATOM   4838 N ND2 . ASN B 1 87  ? 2.684   -12.162 -41.509 1.00 51.14 ? 87   ASN B ND2 1 
ATOM   4839 N N   . PRO B 1 88  ? 2.813   -8.826  -45.736 1.00 46.95 ? 88   PRO B N   1 
ATOM   4840 C CA  . PRO B 1 88  ? 2.388   -8.463  -47.100 1.00 47.00 ? 88   PRO B CA  1 
ATOM   4841 C C   . PRO B 1 88  ? 0.975   -8.980  -47.444 1.00 47.20 ? 88   PRO B C   1 
ATOM   4842 O O   . PRO B 1 88  ? 0.635   -10.143 -47.183 1.00 47.18 ? 88   PRO B O   1 
ATOM   4843 C CB  . PRO B 1 88  ? 3.460   -9.108  -47.991 1.00 46.75 ? 88   PRO B CB  1 
ATOM   4844 C CG  . PRO B 1 88  ? 4.650   -9.268  -47.116 1.00 46.06 ? 88   PRO B CG  1 
ATOM   4845 C CD  . PRO B 1 88  ? 4.142   -9.469  -45.718 1.00 46.81 ? 88   PRO B CD  1 
ATOM   4846 N N   . ASN B 1 89  ? 0.146   -8.095  -47.978 1.00 47.29 ? 89   ASN B N   1 
ATOM   4847 C CA  . ASN B 1 89  ? -1.195  -8.473  -48.396 1.00 47.26 ? 89   ASN B CA  1 
ATOM   4848 C C   . ASN B 1 89  ? -1.273  -8.584  -49.929 1.00 47.23 ? 89   ASN B C   1 
ATOM   4849 O O   . ASN B 1 89  ? -2.365  -8.658  -50.486 1.00 47.26 ? 89   ASN B O   1 
ATOM   4850 C CB  . ASN B 1 89  ? -2.258  -7.511  -47.811 1.00 47.01 ? 89   ASN B CB  1 
ATOM   4851 C CG  . ASN B 1 89  ? -2.126  -6.089  -48.329 1.00 46.98 ? 89   ASN B CG  1 
ATOM   4852 O OD1 . ASN B 1 89  ? -1.149  -5.721  -48.986 1.00 47.00 ? 89   ASN B OD1 1 
ATOM   4853 N ND2 . ASN B 1 89  ? -3.113  -5.278  -48.027 1.00 48.42 ? 89   ASN B ND2 1 
ATOM   4854 N N   . ARG B 1 90  ? -0.103  -8.566  -50.580 1.00 46.86 ? 90   ARG B N   1 
ATOM   4855 C CA  . ARG B 1 90  ? 0.042   -8.792  -52.013 1.00 47.16 ? 90   ARG B CA  1 
ATOM   4856 C C   . ARG B 1 90  ? 1.306   -9.611  -52.284 1.00 47.88 ? 90   ARG B C   1 
ATOM   4857 O O   . ARG B 1 90  ? 2.125   -9.803  -51.388 1.00 48.56 ? 90   ARG B O   1 
ATOM   4858 C CB  . ARG B 1 90  ? 0.081   -7.472  -52.786 1.00 46.67 ? 90   ARG B CB  1 
ATOM   4859 C CG  . ARG B 1 90  ? -1.216  -6.681  -52.765 1.00 45.88 ? 90   ARG B CG  1 
ATOM   4860 C CD  . ARG B 1 90  ? -2.381  -7.456  -53.381 1.00 45.74 ? 90   ARG B CD  1 
ATOM   4861 N NE  . ARG B 1 90  ? -3.587  -6.632  -53.482 1.00 45.89 ? 90   ARG B NE  1 
ATOM   4862 C CZ  . ARG B 1 90  ? -4.449  -6.425  -52.483 1.00 45.03 ? 90   ARG B CZ  1 
ATOM   4863 N NH1 . ARG B 1 90  ? -4.255  -6.971  -51.286 1.00 45.47 ? 90   ARG B NH1 1 
ATOM   4864 N NH2 . ARG B 1 90  ? -5.504  -5.650  -52.669 1.00 44.19 ? 90   ARG B NH2 1 
ATOM   4865 N N   . GLU B 1 91  ? 1.453   -10.112 -53.512 1.00 48.29 ? 91   GLU B N   1 
ATOM   4866 C CA  . GLU B 1 91  ? 2.614   -10.936 -53.901 1.00 48.35 ? 91   GLU B CA  1 
ATOM   4867 C C   . GLU B 1 91  ? 3.915   -10.159 -53.694 1.00 46.99 ? 91   GLU B C   1 
ATOM   4868 O O   . GLU B 1 91  ? 3.971   -8.961  -53.988 1.00 46.74 ? 91   GLU B O   1 
ATOM   4869 C CB  . GLU B 1 91  ? 2.529   -11.341 -55.394 1.00 49.06 ? 91   GLU B CB  1 
ATOM   4870 C CG  . GLU B 1 91  ? 1.477   -12.408 -55.770 1.00 53.35 ? 91   GLU B CG  1 
ATOM   4871 C CD  . GLU B 1 91  ? 1.748   -13.757 -55.100 1.00 58.39 ? 91   GLU B CD  1 
ATOM   4872 O OE1 . GLU B 1 91  ? 0.873   -14.202 -54.309 1.00 58.83 ? 91   GLU B OE1 1 
ATOM   4873 O OE2 . GLU B 1 91  ? 2.843   -14.343 -55.342 1.00 59.40 ? 91   GLU B OE2 1 
ATOM   4874 N N   . LEU B 1 92  ? 4.957   -10.837 -53.216 1.00 45.53 ? 92   LEU B N   1 
ATOM   4875 C CA  . LEU B 1 92  ? 6.282   -10.228 -53.152 1.00 44.14 ? 92   LEU B CA  1 
ATOM   4876 C C   . LEU B 1 92  ? 6.867   -10.131 -54.537 1.00 43.48 ? 92   LEU B C   1 
ATOM   4877 O O   . LEU B 1 92  ? 6.562   -10.949 -55.393 1.00 43.80 ? 92   LEU B O   1 
ATOM   4878 C CB  . LEU B 1 92  ? 7.219   -11.061 -52.302 1.00 43.92 ? 92   LEU B CB  1 
ATOM   4879 C CG  . LEU B 1 92  ? 6.781   -11.373 -50.873 1.00 45.32 ? 92   LEU B CG  1 
ATOM   4880 C CD1 . LEU B 1 92  ? 7.939   -12.067 -50.129 1.00 45.64 ? 92   LEU B CD1 1 
ATOM   4881 C CD2 . LEU B 1 92  ? 6.308   -10.121 -50.157 1.00 43.03 ? 92   LEU B CD2 1 
ATOM   4882 N N   . SER B 1 93  ? 7.713   -9.138  -54.758 1.00 42.14 ? 93   SER B N   1 
ATOM   4883 C CA  . SER B 1 93  ? 8.403   -8.986  -56.026 1.00 40.88 ? 93   SER B CA  1 
ATOM   4884 C C   . SER B 1 93  ? 9.395   -7.821  -55.935 1.00 41.00 ? 93   SER B C   1 
ATOM   4885 O O   . SER B 1 93  ? 9.120   -6.811  -55.286 1.00 40.98 ? 93   SER B O   1 
ATOM   4886 C CB  . SER B 1 93  ? 7.403   -8.758  -57.167 1.00 40.11 ? 93   SER B CB  1 
ATOM   4887 O OG  . SER B 1 93  ? 8.012   -8.146  -58.293 1.00 38.99 ? 93   SER B OG  1 
ATOM   4888 N N   . GLU B 1 94  ? 10.552  -7.960  -56.572 1.00 40.71 ? 94   GLU B N   1 
ATOM   4889 C CA  . GLU B 1 94  ? 11.435  -6.810  -56.701 1.00 41.08 ? 94   GLU B CA  1 
ATOM   4890 C C   . GLU B 1 94  ? 10.851  -5.712  -57.585 1.00 40.76 ? 94   GLU B C   1 
ATOM   4891 O O   . GLU B 1 94  ? 11.272  -4.566  -57.505 1.00 40.64 ? 94   GLU B O   1 
ATOM   4892 C CB  . GLU B 1 94  ? 12.820  -7.222  -57.176 1.00 40.95 ? 94   GLU B CB  1 
ATOM   4893 C CG  . GLU B 1 94  ? 13.614  -7.951  -56.103 1.00 42.08 ? 94   GLU B CG  1 
ATOM   4894 C CD  . GLU B 1 94  ? 14.905  -8.515  -56.661 1.00 45.37 ? 94   GLU B CD  1 
ATOM   4895 O OE1 . GLU B 1 94  ? 15.910  -7.760  -56.772 1.00 42.86 ? 94   GLU B OE1 1 
ATOM   4896 O OE2 . GLU B 1 94  ? 14.894  -9.722  -57.008 1.00 47.72 ? 94   GLU B OE2 1 
ATOM   4897 N N   . ASP B 1 95  ? 9.894   -6.075  -58.440 1.00 41.00 ? 95   ASP B N   1 
ATOM   4898 C CA  . ASP B 1 95  ? 9.191   -5.093  -59.262 1.00 40.59 ? 95   ASP B CA  1 
ATOM   4899 C C   . ASP B 1 95  ? 8.031   -4.567  -58.404 1.00 40.34 ? 95   ASP B C   1 
ATOM   4900 O O   . ASP B 1 95  ? 6.939   -5.152  -58.367 1.00 40.47 ? 95   ASP B O   1 
ATOM   4901 C CB  . ASP B 1 95  ? 8.743   -5.721  -60.591 1.00 40.31 ? 95   ASP B CB  1 
ATOM   4902 C CG  . ASP B 1 95  ? 7.930   -4.765  -61.462 1.00 40.16 ? 95   ASP B CG  1 
ATOM   4903 O OD1 . ASP B 1 95  ? 7.633   -3.638  -61.023 1.00 39.79 ? 95   ASP B OD1 1 
ATOM   4904 O OD2 . ASP B 1 95  ? 7.559   -5.153  -62.586 1.00 38.79 ? 95   ASP B OD2 1 
ATOM   4905 N N   . CYS B 1 96  ? 8.306   -3.467  -57.693 1.00 40.37 ? 96   CYS B N   1 
ATOM   4906 C CA  . CYS B 1 96  ? 7.442   -2.976  -56.615 1.00 39.50 ? 96   CYS B CA  1 
ATOM   4907 C C   . CYS B 1 96  ? 7.401   -1.457  -56.494 1.00 39.01 ? 96   CYS B C   1 
ATOM   4908 O O   . CYS B 1 96  ? 6.663   -0.922  -55.670 1.00 39.16 ? 96   CYS B O   1 
ATOM   4909 C CB  . CYS B 1 96  ? 7.869   -3.580  -55.278 1.00 39.78 ? 96   CYS B CB  1 
ATOM   4910 S SG  . CYS B 1 96  ? 9.524   -3.038  -54.696 1.00 40.20 ? 96   CYS B SG  1 
ATOM   4911 N N   . LEU B 1 97  ? 8.170   -0.751  -57.311 1.00 38.28 ? 97   LEU B N   1 
ATOM   4912 C CA  . LEU B 1 97  ? 8.208   0.706   -57.191 1.00 37.43 ? 97   LEU B CA  1 
ATOM   4913 C C   . LEU B 1 97  ? 6.937   1.374   -57.711 1.00 37.29 ? 97   LEU B C   1 
ATOM   4914 O O   . LEU B 1 97  ? 6.905   1.922   -58.800 1.00 37.53 ? 97   LEU B O   1 
ATOM   4915 C CB  . LEU B 1 97  ? 9.504   1.290   -57.789 1.00 36.64 ? 97   LEU B CB  1 
ATOM   4916 C CG  . LEU B 1 97  ? 10.758  0.942   -56.931 1.00 37.39 ? 97   LEU B CG  1 
ATOM   4917 C CD1 . LEU B 1 97  ? 12.072  1.609   -57.406 1.00 36.81 ? 97   LEU B CD1 1 
ATOM   4918 C CD2 . LEU B 1 97  ? 10.533  1.184   -55.445 1.00 34.84 ? 97   LEU B CD2 1 
ATOM   4919 N N   . TYR B 1 98  ? 5.886   1.319   -56.901 1.00 37.99 ? 98   TYR B N   1 
ATOM   4920 C CA  . TYR B 1 98  ? 4.570   1.837   -57.264 1.00 38.05 ? 98   TYR B CA  1 
ATOM   4921 C C   . TYR B 1 98  ? 4.024   2.742   -56.167 1.00 38.85 ? 98   TYR B C   1 
ATOM   4922 O O   . TYR B 1 98  ? 4.367   2.580   -54.980 1.00 38.40 ? 98   TYR B O   1 
ATOM   4923 C CB  . TYR B 1 98  ? 3.596   0.674   -57.496 1.00 38.04 ? 98   TYR B CB  1 
ATOM   4924 C CG  . TYR B 1 98  ? 4.000   -0.180  -58.660 1.00 38.74 ? 98   TYR B CG  1 
ATOM   4925 C CD1 . TYR B 1 98  ? 3.628   0.159   -59.966 1.00 39.01 ? 98   TYR B CD1 1 
ATOM   4926 C CD2 . TYR B 1 98  ? 4.805   -1.307  -58.476 1.00 40.16 ? 98   TYR B CD2 1 
ATOM   4927 C CE1 . TYR B 1 98  ? 4.029   -0.614  -61.047 1.00 39.36 ? 98   TYR B CE1 1 
ATOM   4928 C CE2 . TYR B 1 98  ? 5.226   -2.080  -59.559 1.00 39.66 ? 98   TYR B CE2 1 
ATOM   4929 C CZ  . TYR B 1 98  ? 4.833   -1.726  -60.834 1.00 39.31 ? 98   TYR B CZ  1 
ATOM   4930 O OH  . TYR B 1 98  ? 5.243   -2.478  -61.890 1.00 39.35 ? 98   TYR B OH  1 
ATOM   4931 N N   . LEU B 1 99  ? 3.152   3.681   -56.549 1.00 39.11 ? 99   LEU B N   1 
ATOM   4932 C CA  . LEU B 1 99  ? 2.467   4.491   -55.547 1.00 38.85 ? 99   LEU B CA  1 
ATOM   4933 C C   . LEU B 1 99  ? 0.922   4.545   -55.697 1.00 39.85 ? 99   LEU B C   1 
ATOM   4934 O O   . LEU B 1 99  ? 0.370   4.201   -56.735 1.00 40.00 ? 99   LEU B O   1 
ATOM   4935 C CB  . LEU B 1 99  ? 3.096   5.894   -55.467 1.00 38.28 ? 99   LEU B CB  1 
ATOM   4936 C CG  . LEU B 1 99  ? 3.117   6.750   -56.722 1.00 37.81 ? 99   LEU B CG  1 
ATOM   4937 C CD1 . LEU B 1 99  ? 1.720   7.331   -57.020 1.00 35.37 ? 99   LEU B CD1 1 
ATOM   4938 C CD2 . LEU B 1 99  ? 4.178   7.870   -56.629 1.00 36.20 ? 99   LEU B CD2 1 
ATOM   4939 N N   . ASN B 1 100 ? 0.256   5.001   -54.643 1.00 40.18 ? 100  ASN B N   1 
ATOM   4940 C CA  . ASN B 1 100 ? -1.189  5.099   -54.575 1.00 40.84 ? 100  ASN B CA  1 
ATOM   4941 C C   . ASN B 1 100 ? -1.630  6.530   -54.273 1.00 41.71 ? 100  ASN B C   1 
ATOM   4942 O O   . ASN B 1 100 ? -0.983  7.245   -53.505 1.00 41.64 ? 100  ASN B O   1 
ATOM   4943 C CB  . ASN B 1 100 ? -1.673  4.186   -53.479 1.00 40.14 ? 100  ASN B CB  1 
ATOM   4944 C CG  . ASN B 1 100 ? -0.938  2.875   -53.474 1.00 39.45 ? 100  ASN B CG  1 
ATOM   4945 O OD1 . ASN B 1 100 ? -0.901  2.180   -54.473 1.00 40.69 ? 100  ASN B OD1 1 
ATOM   4946 N ND2 . ASN B 1 100 ? -0.340  2.537   -52.359 1.00 38.47 ? 100  ASN B ND2 1 
ATOM   4947 N N   . VAL B 1 101 ? -2.737  6.943   -54.883 1.00 42.74 ? 101  VAL B N   1 
ATOM   4948 C CA  . VAL B 1 101 ? -3.301  8.280   -54.681 1.00 43.32 ? 101  VAL B CA  1 
ATOM   4949 C C   . VAL B 1 101 ? -4.780  8.138   -54.379 1.00 44.54 ? 101  VAL B C   1 
ATOM   4950 O O   . VAL B 1 101 ? -5.514  7.594   -55.181 1.00 45.10 ? 101  VAL B O   1 
ATOM   4951 C CB  . VAL B 1 101 ? -3.119  9.139   -55.926 1.00 42.89 ? 101  VAL B CB  1 
ATOM   4952 C CG1 . VAL B 1 101 ? -3.668  10.480  -55.707 1.00 42.72 ? 101  VAL B CG1 1 
ATOM   4953 C CG2 . VAL B 1 101 ? -1.631  9.257   -56.292 1.00 43.02 ? 101  VAL B CG2 1 
ATOM   4954 N N   . TRP B 1 102 ? -5.216  8.570   -53.201 1.00 46.06 ? 102  TRP B N   1 
ATOM   4955 C CA  . TRP B 1 102 ? -6.650  8.708   -52.919 1.00 47.06 ? 102  TRP B CA  1 
ATOM   4956 C C   . TRP B 1 102 ? -7.037  10.192  -52.985 1.00 48.74 ? 102  TRP B C   1 
ATOM   4957 O O   . TRP B 1 102 ? -6.332  11.048  -52.444 1.00 48.38 ? 102  TRP B O   1 
ATOM   4958 C CB  . TRP B 1 102 ? -6.981  8.175   -51.546 1.00 45.98 ? 102  TRP B CB  1 
ATOM   4959 C CG  . TRP B 1 102 ? -6.892  6.697   -51.368 1.00 45.87 ? 102  TRP B CG  1 
ATOM   4960 C CD1 . TRP B 1 102 ? -7.911  5.802   -51.471 1.00 45.50 ? 102  TRP B CD1 1 
ATOM   4961 C CD2 . TRP B 1 102 ? -5.738  5.941   -50.978 1.00 45.94 ? 102  TRP B CD2 1 
ATOM   4962 N NE1 . TRP B 1 102 ? -7.473  4.535   -51.178 1.00 46.11 ? 102  TRP B NE1 1 
ATOM   4963 C CE2 . TRP B 1 102 ? -6.139  4.588   -50.875 1.00 45.91 ? 102  TRP B CE2 1 
ATOM   4964 C CE3 . TRP B 1 102 ? -4.403  6.274   -50.697 1.00 45.44 ? 102  TRP B CE3 1 
ATOM   4965 C CZ2 . TRP B 1 102 ? -5.248  3.560   -50.520 1.00 45.12 ? 102  TRP B CZ2 1 
ATOM   4966 C CZ3 . TRP B 1 102 ? -3.521  5.255   -50.333 1.00 45.12 ? 102  TRP B CZ3 1 
ATOM   4967 C CH2 . TRP B 1 102 ? -3.953  3.911   -50.255 1.00 45.16 ? 102  TRP B CH2 1 
ATOM   4968 N N   . THR B 1 103 ? -8.135  10.500  -53.673 1.00 50.86 ? 103  THR B N   1 
ATOM   4969 C CA  . THR B 1 103 ? -8.634  11.878  -53.731 1.00 53.59 ? 103  THR B CA  1 
ATOM   4970 C C   . THR B 1 103 ? -10.145 11.914  -53.523 1.00 55.42 ? 103  THR B C   1 
ATOM   4971 O O   . THR B 1 103 ? -10.818 10.891  -53.689 1.00 55.30 ? 103  THR B O   1 
ATOM   4972 C CB  . THR B 1 103 ? -8.299  12.611  -55.048 1.00 53.21 ? 103  THR B CB  1 
ATOM   4973 O OG1 . THR B 1 103 ? -9.137  12.121  -56.087 1.00 54.66 ? 103  THR B OG1 1 
ATOM   4974 C CG2 . THR B 1 103 ? -6.870  12.395  -55.454 1.00 54.45 ? 103  THR B CG2 1 
ATOM   4975 N N   . PRO B 1 104 ? -10.684 13.092  -53.133 1.00 57.69 ? 104  PRO B N   1 
ATOM   4976 C CA  . PRO B 1 104 ? -12.139 13.238  -53.001 1.00 59.45 ? 104  PRO B CA  1 
ATOM   4977 C C   . PRO B 1 104 ? -12.891 12.991  -54.324 1.00 61.14 ? 104  PRO B C   1 
ATOM   4978 O O   . PRO B 1 104 ? -12.371 13.262  -55.413 1.00 61.09 ? 104  PRO B O   1 
ATOM   4979 C CB  . PRO B 1 104 ? -12.296 14.686  -52.542 1.00 59.14 ? 104  PRO B CB  1 
ATOM   4980 C CG  . PRO B 1 104 ? -11.003 14.993  -51.890 1.00 58.78 ? 104  PRO B CG  1 
ATOM   4981 C CD  . PRO B 1 104 ? -9.998  14.339  -52.760 1.00 57.44 ? 104  PRO B CD  1 
ATOM   4982 N N   . TYR B 1 105 ? -14.090 12.437  -54.209 1.00 63.23 ? 105  TYR B N   1 
ATOM   4983 C CA  . TYR B 1 105 ? -14.940 12.203  -55.364 1.00 65.18 ? 105  TYR B CA  1 
ATOM   4984 C C   . TYR B 1 105 ? -16.176 13.110  -55.307 1.00 65.72 ? 105  TYR B C   1 
ATOM   4985 O O   . TYR B 1 105 ? -17.074 12.897  -54.482 1.00 65.90 ? 105  TYR B O   1 
ATOM   4986 C CB  . TYR B 1 105 ? -15.356 10.734  -55.413 1.00 65.88 ? 105  TYR B CB  1 
ATOM   4987 C CG  . TYR B 1 105 ? -16.068 10.367  -56.685 1.00 67.41 ? 105  TYR B CG  1 
ATOM   4988 C CD1 . TYR B 1 105 ? -15.421 9.654   -57.682 1.00 68.22 ? 105  TYR B CD1 1 
ATOM   4989 C CD2 . TYR B 1 105 ? -17.391 10.753  -56.901 1.00 68.85 ? 105  TYR B CD2 1 
ATOM   4990 C CE1 . TYR B 1 105 ? -16.070 9.329   -58.857 1.00 69.46 ? 105  TYR B CE1 1 
ATOM   4991 C CE2 . TYR B 1 105 ? -18.054 10.430  -58.070 1.00 69.47 ? 105  TYR B CE2 1 
ATOM   4992 C CZ  . TYR B 1 105 ? -17.392 9.718   -59.042 1.00 69.08 ? 105  TYR B CZ  1 
ATOM   4993 O OH  . TYR B 1 105 ? -18.053 9.400   -60.200 1.00 68.86 ? 105  TYR B OH  1 
ATOM   4994 N N   . PRO B 1 106 ? -16.260 14.097  -56.206 1.00 66.33 ? 106  PRO B N   1 
ATOM   4995 C CA  . PRO B 1 106 ? -15.408 14.389  -57.363 1.00 66.76 ? 106  PRO B CA  1 
ATOM   4996 C C   . PRO B 1 106 ? -14.090 15.099  -57.035 1.00 67.27 ? 106  PRO B C   1 
ATOM   4997 O O   . PRO B 1 106 ? -13.976 15.758  -56.002 1.00 66.99 ? 106  PRO B O   1 
ATOM   4998 C CB  . PRO B 1 106 ? -16.292 15.309  -58.216 1.00 66.78 ? 106  PRO B CB  1 
ATOM   4999 C CG  . PRO B 1 106 ? -17.160 16.024  -57.210 1.00 66.87 ? 106  PRO B CG  1 
ATOM   5000 C CD  . PRO B 1 106 ? -17.376 15.057  -56.072 1.00 66.25 ? 106  PRO B CD  1 
ATOM   5001 N N   . ARG B 1 107 ? -13.115 14.985  -57.937 1.00 68.00 ? 107  ARG B N   1 
ATOM   5002 C CA  . ARG B 1 107 ? -11.787 15.544  -57.693 1.00 69.19 ? 107  ARG B CA  1 
ATOM   5003 C C   . ARG B 1 107 ? -11.860 17.044  -57.378 1.00 68.93 ? 107  ARG B C   1 
ATOM   5004 O O   . ARG B 1 107 ? -12.496 17.795  -58.105 1.00 69.28 ? 107  ARG B O   1 
ATOM   5005 C CB  . ARG B 1 107 ? -10.768 15.167  -58.798 1.00 68.97 ? 107  ARG B CB  1 
ATOM   5006 C CG  . ARG B 1 107 ? -10.455 16.186  -59.901 1.00 69.67 ? 107  ARG B CG  1 
ATOM   5007 C CD  . ARG B 1 107 ? -9.219  15.718  -60.725 1.00 70.44 ? 107  ARG B CD  1 
ATOM   5008 N NE  . ARG B 1 107 ? -9.423  14.404  -61.369 1.00 72.25 ? 107  ARG B NE  1 
ATOM   5009 C CZ  . ARG B 1 107 ? -9.468  14.188  -62.689 1.00 72.18 ? 107  ARG B CZ  1 
ATOM   5010 N NH1 . ARG B 1 107 ? -9.677  12.962  -63.152 1.00 71.52 ? 107  ARG B NH1 1 
ATOM   5011 N NH2 . ARG B 1 107 ? -9.298  15.186  -63.556 1.00 72.14 ? 107  ARG B NH2 1 
ATOM   5012 N N   . PRO B 1 108 ? -11.244 17.458  -56.255 1.00 68.87 ? 108  PRO B N   1 
ATOM   5013 C CA  . PRO B 1 108 ? -11.280 18.802  -55.697 1.00 68.63 ? 108  PRO B CA  1 
ATOM   5014 C C   . PRO B 1 108 ? -11.339 19.917  -56.734 1.00 68.17 ? 108  PRO B C   1 
ATOM   5015 O O   . PRO B 1 108 ? -10.636 19.862  -57.754 1.00 68.00 ? 108  PRO B O   1 
ATOM   5016 C CB  . PRO B 1 108 ? -9.959  18.879  -54.943 1.00 68.61 ? 108  PRO B CB  1 
ATOM   5017 C CG  . PRO B 1 108 ? -9.795  17.513  -54.414 1.00 69.06 ? 108  PRO B CG  1 
ATOM   5018 C CD  . PRO B 1 108 ? -10.415 16.570  -55.420 1.00 69.04 ? 108  PRO B CD  1 
ATOM   5019 N N   . ALA B 1 109 ? -12.182 20.913  -56.451 1.00 67.41 ? 109  ALA B N   1 
ATOM   5020 C CA  . ALA B 1 109 ? -12.307 22.101  -57.283 1.00 66.62 ? 109  ALA B CA  1 
ATOM   5021 C C   . ALA B 1 109 ? -10.992 22.915  -57.264 1.00 65.75 ? 109  ALA B C   1 
ATOM   5022 O O   . ALA B 1 109 ? -10.420 23.222  -58.326 1.00 65.32 ? 109  ALA B O   1 
ATOM   5023 C CB  . ALA B 1 109 ? -13.499 22.958  -56.814 1.00 66.69 ? 109  ALA B CB  1 
ATOM   5024 N N   . SER B 1 110 ? -10.517 23.241  -56.058 1.00 64.27 ? 110  SER B N   1 
ATOM   5025 C CA  . SER B 1 110 ? -9.259  23.987  -55.898 1.00 62.81 ? 110  SER B CA  1 
ATOM   5026 C C   . SER B 1 110 ? -8.131  23.053  -55.425 1.00 61.21 ? 110  SER B C   1 
ATOM   5027 O O   . SER B 1 110 ? -8.411  21.945  -54.952 1.00 61.45 ? 110  SER B O   1 
ATOM   5028 C CB  . SER B 1 110 ? -9.441  25.208  -54.967 1.00 62.66 ? 110  SER B CB  1 
ATOM   5029 O OG  . SER B 1 110 ? -9.918  24.813  -53.696 1.00 62.04 ? 110  SER B OG  1 
ATOM   5030 N N   . PRO B 1 111 ? -6.859  23.478  -55.594 1.00 59.45 ? 111  PRO B N   1 
ATOM   5031 C CA  . PRO B 1 111 ? -5.687  22.735  -55.091 1.00 58.12 ? 111  PRO B CA  1 
ATOM   5032 C C   . PRO B 1 111 ? -5.773  22.378  -53.597 1.00 56.56 ? 111  PRO B C   1 
ATOM   5033 O O   . PRO B 1 111 ? -5.915  23.264  -52.764 1.00 56.07 ? 111  PRO B O   1 
ATOM   5034 C CB  . PRO B 1 111 ? -4.523  23.701  -55.358 1.00 58.31 ? 111  PRO B CB  1 
ATOM   5035 C CG  . PRO B 1 111 ? -4.988  24.528  -56.544 1.00 58.79 ? 111  PRO B CG  1 
ATOM   5036 C CD  . PRO B 1 111 ? -6.465  24.702  -56.325 1.00 59.52 ? 111  PRO B CD  1 
ATOM   5037 N N   . THR B 1 112 ? -5.677  21.087  -53.281 1.00 54.86 ? 112  THR B N   1 
ATOM   5038 C CA  . THR B 1 112 ? -5.859  20.584  -51.918 1.00 53.68 ? 112  THR B CA  1 
ATOM   5039 C C   . THR B 1 112 ? -4.540  20.158  -51.275 1.00 52.18 ? 112  THR B C   1 
ATOM   5040 O O   . THR B 1 112 ? -3.708  19.558  -51.939 1.00 52.81 ? 112  THR B O   1 
ATOM   5041 C CB  . THR B 1 112 ? -6.776  19.363  -51.936 1.00 53.78 ? 112  THR B CB  1 
ATOM   5042 O OG1 . THR B 1 112 ? -7.786  19.575  -52.919 1.00 55.53 ? 112  THR B OG1 1 
ATOM   5043 C CG2 . THR B 1 112 ? -7.430  19.131  -50.578 1.00 53.49 ? 112  THR B CG2 1 
ATOM   5044 N N   . PRO B 1 113 ? -4.347  20.450  -49.979 1.00 50.42 ? 113  PRO B N   1 
ATOM   5045 C CA  . PRO B 1 113 ? -3.121  20.006  -49.345 1.00 48.87 ? 113  PRO B CA  1 
ATOM   5046 C C   . PRO B 1 113 ? -2.952  18.502  -49.518 1.00 47.39 ? 113  PRO B C   1 
ATOM   5047 O O   . PRO B 1 113 ? -3.953  17.781  -49.490 1.00 47.26 ? 113  PRO B O   1 
ATOM   5048 C CB  . PRO B 1 113 ? -3.358  20.338  -47.870 1.00 48.82 ? 113  PRO B CB  1 
ATOM   5049 C CG  . PRO B 1 113 ? -4.275  21.441  -47.893 1.00 49.97 ? 113  PRO B CG  1 
ATOM   5050 C CD  . PRO B 1 113 ? -5.201  21.189  -49.035 1.00 50.36 ? 113  PRO B CD  1 
ATOM   5051 N N   . VAL B 1 114 ? -1.707  18.047  -49.697 1.00 45.12 ? 114  VAL B N   1 
ATOM   5052 C CA  . VAL B 1 114 ? -1.408  16.634  -49.887 1.00 43.33 ? 114  VAL B CA  1 
ATOM   5053 C C   . VAL B 1 114 ? -0.721  16.025  -48.669 1.00 42.81 ? 114  VAL B C   1 
ATOM   5054 O O   . VAL B 1 114 ? 0.269   16.548  -48.184 1.00 42.43 ? 114  VAL B O   1 
ATOM   5055 C CB  . VAL B 1 114 ? -0.434  16.420  -51.071 1.00 43.53 ? 114  VAL B CB  1 
ATOM   5056 C CG1 . VAL B 1 114 ? -0.254  14.929  -51.342 1.00 42.97 ? 114  VAL B CG1 1 
ATOM   5057 C CG2 . VAL B 1 114 ? -0.891  17.149  -52.329 1.00 42.40 ? 114  VAL B CG2 1 
ATOM   5058 N N   . LEU B 1 115 ? -1.218  14.893  -48.192 1.00 42.00 ? 115  LEU B N   1 
ATOM   5059 C CA  . LEU B 1 115 ? -0.437  14.072  -47.262 1.00 40.58 ? 115  LEU B CA  1 
ATOM   5060 C C   . LEU B 1 115 ? 0.245   12.909  -48.001 1.00 40.01 ? 115  LEU B C   1 
ATOM   5061 O O   . LEU B 1 115 ? -0.398  12.219  -48.800 1.00 39.52 ? 115  LEU B O   1 
ATOM   5062 C CB  . LEU B 1 115 ? -1.304  13.547  -46.118 1.00 40.31 ? 115  LEU B CB  1 
ATOM   5063 C CG  . LEU B 1 115 ? -1.746  14.618  -45.120 1.00 40.61 ? 115  LEU B CG  1 
ATOM   5064 C CD1 . LEU B 1 115 ? -3.187  15.002  -45.360 1.00 43.55 ? 115  LEU B CD1 1 
ATOM   5065 C CD2 . LEU B 1 115 ? -1.579  14.179  -43.711 1.00 39.56 ? 115  LEU B CD2 1 
ATOM   5066 N N   . ILE B 1 116 ? 1.542   12.709  -47.732 1.00 38.52 ? 116  ILE B N   1 
ATOM   5067 C CA  . ILE B 1 116 ? 2.279   11.575  -48.262 1.00 36.68 ? 116  ILE B CA  1 
ATOM   5068 C C   . ILE B 1 116 ? 2.706   10.615  -47.155 1.00 36.17 ? 116  ILE B C   1 
ATOM   5069 O O   . ILE B 1 116 ? 3.396   11.000  -46.219 1.00 36.66 ? 116  ILE B O   1 
ATOM   5070 C CB  . ILE B 1 116 ? 3.534   12.021  -48.990 1.00 37.15 ? 116  ILE B CB  1 
ATOM   5071 C CG1 . ILE B 1 116 ? 3.197   12.950  -50.162 1.00 35.77 ? 116  ILE B CG1 1 
ATOM   5072 C CG2 . ILE B 1 116 ? 4.323   10.806  -49.457 1.00 35.83 ? 116  ILE B CG2 1 
ATOM   5073 C CD1 . ILE B 1 116 ? 4.460   13.327  -50.964 1.00 36.87 ? 116  ILE B CD1 1 
ATOM   5074 N N   . TRP B 1 117 ? 2.329   9.353   -47.274 1.00 34.80 ? 117  TRP B N   1 
ATOM   5075 C CA  . TRP B 1 117 ? 2.543   8.404   -46.188 1.00 33.94 ? 117  TRP B CA  1 
ATOM   5076 C C   . TRP B 1 117 ? 3.743   7.507   -46.460 1.00 33.80 ? 117  TRP B C   1 
ATOM   5077 O O   . TRP B 1 117 ? 3.950   7.046   -47.597 1.00 33.35 ? 117  TRP B O   1 
ATOM   5078 C CB  . TRP B 1 117 ? 1.299   7.548   -45.967 1.00 33.24 ? 117  TRP B CB  1 
ATOM   5079 C CG  . TRP B 1 117 ? 1.535   6.397   -45.056 1.00 33.54 ? 117  TRP B CG  1 
ATOM   5080 C CD1 . TRP B 1 117 ? 1.734   5.080   -45.410 1.00 32.66 ? 117  TRP B CD1 1 
ATOM   5081 C CD2 . TRP B 1 117 ? 1.612   6.444   -43.625 1.00 33.95 ? 117  TRP B CD2 1 
ATOM   5082 N NE1 . TRP B 1 117 ? 1.923   4.310   -44.278 1.00 33.37 ? 117  TRP B NE1 1 
ATOM   5083 C CE2 . TRP B 1 117 ? 1.852   5.117   -43.172 1.00 33.19 ? 117  TRP B CE2 1 
ATOM   5084 C CE3 . TRP B 1 117 ? 1.507   7.477   -42.678 1.00 33.84 ? 117  TRP B CE3 1 
ATOM   5085 C CZ2 . TRP B 1 117 ? 1.994   4.802   -41.812 1.00 32.60 ? 117  TRP B CZ2 1 
ATOM   5086 C CZ3 . TRP B 1 117 ? 1.627   7.148   -41.315 1.00 33.43 ? 117  TRP B CZ3 1 
ATOM   5087 C CH2 . TRP B 1 117 ? 1.874   5.826   -40.906 1.00 32.89 ? 117  TRP B CH2 1 
ATOM   5088 N N   . ILE B 1 118 ? 4.528   7.260   -45.413 1.00 33.30 ? 118  ILE B N   1 
ATOM   5089 C CA  . ILE B 1 118 ? 5.695   6.414   -45.536 1.00 33.29 ? 118  ILE B CA  1 
ATOM   5090 C C   . ILE B 1 118 ? 5.615   5.310   -44.504 1.00 34.24 ? 118  ILE B C   1 
ATOM   5091 O O   . ILE B 1 118 ? 5.855   5.553   -43.329 1.00 35.81 ? 118  ILE B O   1 
ATOM   5092 C CB  . ILE B 1 118 ? 7.023   7.229   -45.401 1.00 33.09 ? 118  ILE B CB  1 
ATOM   5093 C CG1 . ILE B 1 118 ? 7.071   8.379   -46.423 1.00 31.72 ? 118  ILE B CG1 1 
ATOM   5094 C CG2 . ILE B 1 118 ? 8.213   6.351   -45.664 1.00 31.97 ? 118  ILE B CG2 1 
ATOM   5095 C CD1 . ILE B 1 118 ? 8.394   9.111   -46.452 1.00 31.78 ? 118  ILE B CD1 1 
ATOM   5096 N N   . TYR B 1 119 ? 5.288   4.094   -44.929 1.00 34.07 ? 119  TYR B N   1 
ATOM   5097 C CA  . TYR B 1 119 ? 5.189   2.980   -43.978 1.00 34.06 ? 119  TYR B CA  1 
ATOM   5098 C C   . TYR B 1 119 ? 6.480   2.737   -43.207 1.00 34.89 ? 119  TYR B C   1 
ATOM   5099 O O   . TYR B 1 119 ? 7.584   3.085   -43.670 1.00 34.91 ? 119  TYR B O   1 
ATOM   5100 C CB  . TYR B 1 119 ? 4.740   1.670   -44.655 1.00 32.92 ? 119  TYR B CB  1 
ATOM   5101 C CG  . TYR B 1 119 ? 5.600   1.174   -45.815 1.00 32.18 ? 119  TYR B CG  1 
ATOM   5102 C CD1 . TYR B 1 119 ? 6.809   0.491   -45.580 1.00 32.21 ? 119  TYR B CD1 1 
ATOM   5103 C CD2 . TYR B 1 119 ? 5.185   1.341   -47.148 1.00 28.62 ? 119  TYR B CD2 1 
ATOM   5104 C CE1 . TYR B 1 119 ? 7.593   0.006   -46.650 1.00 29.60 ? 119  TYR B CE1 1 
ATOM   5105 C CE2 . TYR B 1 119 ? 5.966   0.877   -48.217 1.00 27.19 ? 119  TYR B CE2 1 
ATOM   5106 C CZ  . TYR B 1 119 ? 7.172   0.195   -47.954 1.00 29.69 ? 119  TYR B CZ  1 
ATOM   5107 O OH  . TYR B 1 119 ? 7.971   -0.268  -48.986 1.00 28.77 ? 119  TYR B OH  1 
ATOM   5108 N N   . GLY B 1 120 ? 6.319   2.129   -42.036 1.00 35.02 ? 120  GLY B N   1 
ATOM   5109 C CA  . GLY B 1 120 ? 7.432   1.576   -41.289 1.00 35.62 ? 120  GLY B CA  1 
ATOM   5110 C C   . GLY B 1 120 ? 7.554   0.076   -41.490 1.00 36.07 ? 120  GLY B C   1 
ATOM   5111 O O   . GLY B 1 120 ? 6.964   -0.489  -42.404 1.00 36.26 ? 120  GLY B O   1 
ATOM   5112 N N   . GLY B 1 121 ? 8.323   -0.574  -40.632 1.00 36.51 ? 121  GLY B N   1 
ATOM   5113 C CA  . GLY B 1 121 ? 8.706   -1.952  -40.862 1.00 37.60 ? 121  GLY B CA  1 
ATOM   5114 C C   . GLY B 1 121 ? 10.194  -2.180  -40.636 1.00 38.53 ? 121  GLY B C   1 
ATOM   5115 O O   . GLY B 1 121 ? 10.751  -3.171  -41.113 1.00 39.55 ? 121  GLY B O   1 
ATOM   5116 N N   . GLY B 1 122 ? 10.845  -1.280  -39.903 1.00 38.41 ? 122  GLY B N   1 
ATOM   5117 C CA  . GLY B 1 122 ? 12.240  -1.455  -39.536 1.00 38.48 ? 122  GLY B CA  1 
ATOM   5118 C C   . GLY B 1 122 ? 13.204  -1.389  -40.705 1.00 38.77 ? 122  GLY B C   1 
ATOM   5119 O O   . GLY B 1 122 ? 14.321  -1.881  -40.604 1.00 38.96 ? 122  GLY B O   1 
ATOM   5120 N N   . PHE B 1 123 ? 12.776  -0.780  -41.813 1.00 38.51 ? 123  PHE B N   1 
ATOM   5121 C CA  . PHE B 1 123 ? 13.519  -0.822  -43.077 1.00 38.24 ? 123  PHE B CA  1 
ATOM   5122 C C   . PHE B 1 123 ? 13.732  -2.219  -43.616 1.00 38.26 ? 123  PHE B C   1 
ATOM   5123 O O   . PHE B 1 123 ? 14.516  -2.385  -44.540 1.00 38.60 ? 123  PHE B O   1 
ATOM   5124 C CB  . PHE B 1 123 ? 14.880  -0.111  -42.989 1.00 38.13 ? 123  PHE B CB  1 
ATOM   5125 C CG  . PHE B 1 123 ? 14.788  1.353   -42.650 1.00 38.16 ? 123  PHE B CG  1 
ATOM   5126 C CD1 . PHE B 1 123 ? 14.315  2.279   -43.594 1.00 37.47 ? 123  PHE B CD1 1 
ATOM   5127 C CD2 . PHE B 1 123 ? 15.183  1.815   -41.390 1.00 36.96 ? 123  PHE B CD2 1 
ATOM   5128 C CE1 . PHE B 1 123 ? 14.239  3.642   -43.282 1.00 35.92 ? 123  PHE B CE1 1 
ATOM   5129 C CE2 . PHE B 1 123 ? 15.115  3.182   -41.071 1.00 35.36 ? 123  PHE B CE2 1 
ATOM   5130 C CZ  . PHE B 1 123 ? 14.649  4.089   -42.016 1.00 34.56 ? 123  PHE B CZ  1 
ATOM   5131 N N   . TYR B 1 124 ? 13.039  -3.219  -43.068 1.00 38.47 ? 124  TYR B N   1 
ATOM   5132 C CA  . TYR B 1 124 ? 13.123  -4.581  -43.615 1.00 39.04 ? 124  TYR B CA  1 
ATOM   5133 C C   . TYR B 1 124 ? 11.755  -5.132  -44.087 1.00 38.88 ? 124  TYR B C   1 
ATOM   5134 O O   . TYR B 1 124 ? 11.681  -6.212  -44.649 1.00 39.27 ? 124  TYR B O   1 
ATOM   5135 C CB  . TYR B 1 124 ? 13.787  -5.543  -42.613 1.00 39.34 ? 124  TYR B CB  1 
ATOM   5136 C CG  . TYR B 1 124 ? 12.933  -5.768  -41.402 1.00 40.78 ? 124  TYR B CG  1 
ATOM   5137 C CD1 . TYR B 1 124 ? 11.880  -6.703  -41.428 1.00 40.84 ? 124  TYR B CD1 1 
ATOM   5138 C CD2 . TYR B 1 124 ? 13.133  -5.024  -40.236 1.00 41.41 ? 124  TYR B CD2 1 
ATOM   5139 C CE1 . TYR B 1 124 ? 11.068  -6.900  -40.320 1.00 40.87 ? 124  TYR B CE1 1 
ATOM   5140 C CE2 . TYR B 1 124 ? 12.318  -5.217  -39.116 1.00 42.24 ? 124  TYR B CE2 1 
ATOM   5141 C CZ  . TYR B 1 124 ? 11.287  -6.159  -39.182 1.00 41.46 ? 124  TYR B CZ  1 
ATOM   5142 O OH  . TYR B 1 124 ? 10.483  -6.363  -38.106 1.00 42.97 ? 124  TYR B OH  1 
ATOM   5143 N N   . SER B 1 125 ? 10.678  -4.397  -43.856 1.00 38.57 ? 125  SER B N   1 
ATOM   5144 C CA  . SER B 1 125 ? 9.345   -4.850  -44.239 1.00 37.93 ? 125  SER B CA  1 
ATOM   5145 C C   . SER B 1 125 ? 8.408   -3.664  -44.464 1.00 38.44 ? 125  SER B C   1 
ATOM   5146 O O   . SER B 1 125 ? 8.834   -2.509  -44.415 1.00 38.47 ? 125  SER B O   1 
ATOM   5147 C CB  . SER B 1 125 ? 8.780   -5.793  -43.185 1.00 37.61 ? 125  SER B CB  1 
ATOM   5148 O OG  . SER B 1 125 ? 8.843   -5.214  -41.904 1.00 36.24 ? 125  SER B OG  1 
ATOM   5149 N N   . GLY B 1 126 ? 7.142   -3.964  -44.733 1.00 38.67 ? 126  GLY B N   1 
ATOM   5150 C CA  . GLY B 1 126 ? 6.117   -2.962  -44.888 1.00 39.15 ? 126  GLY B CA  1 
ATOM   5151 C C   . GLY B 1 126 ? 5.616   -2.925  -46.306 1.00 39.93 ? 126  GLY B C   1 
ATOM   5152 O O   . GLY B 1 126 ? 6.198   -3.547  -47.193 1.00 40.24 ? 126  GLY B O   1 
ATOM   5153 N N   . ALA B 1 127 ? 4.540   -2.171  -46.524 1.00 39.92 ? 127  ALA B N   1 
ATOM   5154 C CA  . ALA B 1 127 ? 3.899   -2.081  -47.825 1.00 39.99 ? 127  ALA B CA  1 
ATOM   5155 C C   . ALA B 1 127 ? 2.868   -0.973  -47.745 1.00 39.99 ? 127  ALA B C   1 
ATOM   5156 O O   . ALA B 1 127 ? 2.262   -0.780  -46.701 1.00 40.12 ? 127  ALA B O   1 
ATOM   5157 C CB  . ALA B 1 127 ? 3.219   -3.413  -48.181 1.00 39.71 ? 127  ALA B CB  1 
ATOM   5158 N N   . ALA B 1 128 ? 2.667   -0.250  -48.840 1.00 39.82 ? 128  ALA B N   1 
ATOM   5159 C CA  . ALA B 1 128 ? 1.729   0.854   -48.835 1.00 40.09 ? 128  ALA B CA  1 
ATOM   5160 C C   . ALA B 1 128 ? 0.263   0.366   -48.929 1.00 40.30 ? 128  ALA B C   1 
ATOM   5161 O O   . ALA B 1 128 ? -0.673  1.152   -48.897 1.00 41.32 ? 128  ALA B O   1 
ATOM   5162 C CB  . ALA B 1 128 ? 2.063   1.816   -49.951 1.00 39.39 ? 128  ALA B CB  1 
ATOM   5163 N N   . SER B 1 129 ? 0.075   -0.944  -48.997 1.00 40.52 ? 129  SER B N   1 
ATOM   5164 C CA  . SER B 1 129 ? -1.215  -1.533  -49.336 1.00 39.69 ? 129  SER B CA  1 
ATOM   5165 C C   . SER B 1 129 ? -1.912  -2.171  -48.151 1.00 40.24 ? 129  SER B C   1 
ATOM   5166 O O   . SER B 1 129 ? -2.975  -2.763  -48.315 1.00 40.53 ? 129  SER B O   1 
ATOM   5167 C CB  . SER B 1 129 ? -1.009  -2.576  -50.430 1.00 39.80 ? 129  SER B CB  1 
ATOM   5168 O OG  . SER B 1 129 ? -0.166  -3.623  -49.994 1.00 37.20 ? 129  SER B OG  1 
ATOM   5169 N N   . LEU B 1 130 ? -1.319  -2.069  -46.964 1.00 40.69 ? 130  LEU B N   1 
ATOM   5170 C CA  . LEU B 1 130 ? -1.920  -2.645  -45.774 1.00 41.79 ? 130  LEU B CA  1 
ATOM   5171 C C   . LEU B 1 130 ? -3.251  -1.938  -45.479 1.00 42.62 ? 130  LEU B C   1 
ATOM   5172 O O   . LEU B 1 130 ? -3.446  -0.770  -45.859 1.00 42.35 ? 130  LEU B O   1 
ATOM   5173 C CB  . LEU B 1 130 ? -0.966  -2.575  -44.575 1.00 41.57 ? 130  LEU B CB  1 
ATOM   5174 C CG  . LEU B 1 130 ? 0.462   -3.174  -44.708 1.00 42.92 ? 130  LEU B CG  1 
ATOM   5175 C CD1 . LEU B 1 130 ? 1.284   -2.946  -43.429 1.00 41.63 ? 130  LEU B CD1 1 
ATOM   5176 C CD2 . LEU B 1 130 ? 0.497   -4.687  -45.076 1.00 41.45 ? 130  LEU B CD2 1 
ATOM   5177 N N   . ASP B 1 131 ? -4.172  -2.646  -44.828 1.00 43.20 ? 131  ASP B N   1 
ATOM   5178 C CA  . ASP B 1 131 ? -5.488  -2.068  -44.534 1.00 44.12 ? 131  ASP B CA  1 
ATOM   5179 C C   . ASP B 1 131 ? -5.375  -0.788  -43.690 1.00 43.98 ? 131  ASP B C   1 
ATOM   5180 O O   . ASP B 1 131 ? -6.115  0.191   -43.930 1.00 43.90 ? 131  ASP B O   1 
ATOM   5181 C CB  . ASP B 1 131 ? -6.403  -3.075  -43.811 1.00 44.58 ? 131  ASP B CB  1 
ATOM   5182 C CG  . ASP B 1 131 ? -6.807  -4.258  -44.689 1.00 45.60 ? 131  ASP B CG  1 
ATOM   5183 O OD1 . ASP B 1 131 ? -6.671  -4.197  -45.944 1.00 45.00 ? 131  ASP B OD1 1 
ATOM   5184 O OD2 . ASP B 1 131 ? -7.262  -5.256  -44.091 1.00 47.34 ? 131  ASP B OD2 1 
ATOM   5185 N N   . VAL B 1 132 ? -4.454  -0.806  -42.718 1.00 42.76 ? 132  VAL B N   1 
ATOM   5186 C CA  . VAL B 1 132 ? -4.289  0.321   -41.813 1.00 42.03 ? 132  VAL B CA  1 
ATOM   5187 C C   . VAL B 1 132 ? -3.771  1.606   -42.465 1.00 41.94 ? 132  VAL B C   1 
ATOM   5188 O O   . VAL B 1 132 ? -3.781  2.649   -41.815 1.00 41.74 ? 132  VAL B O   1 
ATOM   5189 C CB  . VAL B 1 132 ? -3.409  -0.026  -40.602 1.00 41.94 ? 132  VAL B CB  1 
ATOM   5190 C CG1 . VAL B 1 132 ? -4.138  -0.941  -39.697 1.00 41.88 ? 132  VAL B CG1 1 
ATOM   5191 C CG2 . VAL B 1 132 ? -2.095  -0.635  -41.031 1.00 42.45 ? 132  VAL B CG2 1 
ATOM   5192 N N   . TYR B 1 133 ? -3.305  1.539   -43.722 1.00 41.14 ? 133  TYR B N   1 
ATOM   5193 C CA  . TYR B 1 133 ? -2.838  2.733   -44.416 1.00 39.93 ? 133  TYR B CA  1 
ATOM   5194 C C   . TYR B 1 133 ? -3.803  3.173   -45.477 1.00 40.96 ? 133  TYR B C   1 
ATOM   5195 O O   . TYR B 1 133 ? -3.441  3.933   -46.371 1.00 40.58 ? 133  TYR B O   1 
ATOM   5196 C CB  . TYR B 1 133 ? -1.469  2.516   -45.062 1.00 39.17 ? 133  TYR B CB  1 
ATOM   5197 C CG  . TYR B 1 133 ? -0.443  1.884   -44.173 1.00 37.29 ? 133  TYR B CG  1 
ATOM   5198 C CD1 . TYR B 1 133 ? -0.407  2.161   -42.811 1.00 35.33 ? 133  TYR B CD1 1 
ATOM   5199 C CD2 . TYR B 1 133 ? 0.508   1.012   -44.697 1.00 35.52 ? 133  TYR B CD2 1 
ATOM   5200 C CE1 . TYR B 1 133 ? 0.543   1.572   -41.998 1.00 36.81 ? 133  TYR B CE1 1 
ATOM   5201 C CE2 . TYR B 1 133 ? 1.472   0.422   -43.888 1.00 33.59 ? 133  TYR B CE2 1 
ATOM   5202 C CZ  . TYR B 1 133 ? 1.482   0.705   -42.543 1.00 35.01 ? 133  TYR B CZ  1 
ATOM   5203 O OH  . TYR B 1 133 ? 2.402   0.121   -41.709 1.00 34.48 ? 133  TYR B OH  1 
ATOM   5204 N N   . ASP B 1 134 ? -5.038  2.686   -45.384 1.00 42.24 ? 134  ASP B N   1 
ATOM   5205 C CA  . ASP B 1 134 ? -6.073  2.953   -46.369 1.00 43.14 ? 134  ASP B CA  1 
ATOM   5206 C C   . ASP B 1 134 ? -6.455  4.414   -46.318 1.00 43.18 ? 134  ASP B C   1 
ATOM   5207 O O   . ASP B 1 134 ? -6.891  4.903   -45.297 1.00 43.30 ? 134  ASP B O   1 
ATOM   5208 C CB  . ASP B 1 134 ? -7.280  2.077   -46.026 1.00 44.14 ? 134  ASP B CB  1 
ATOM   5209 C CG  . ASP B 1 134 ? -8.429  2.219   -47.010 1.00 45.74 ? 134  ASP B CG  1 
ATOM   5210 O OD1 . ASP B 1 134 ? -8.386  3.058   -47.936 1.00 47.30 ? 134  ASP B OD1 1 
ATOM   5211 O OD2 . ASP B 1 134 ? -9.402  1.462   -46.831 1.00 49.55 ? 134  ASP B OD2 1 
ATOM   5212 N N   . GLY B 1 135 ? -6.299  5.117   -47.421 1.00 44.10 ? 135  GLY B N   1 
ATOM   5213 C CA  . GLY B 1 135 ? -6.518  6.564   -47.427 1.00 44.96 ? 135  GLY B CA  1 
ATOM   5214 C C   . GLY B 1 135 ? -7.910  7.037   -47.800 1.00 45.74 ? 135  GLY B C   1 
ATOM   5215 O O   . GLY B 1 135 ? -8.119  8.227   -48.013 1.00 45.77 ? 135  GLY B O   1 
ATOM   5216 N N   . ARG B 1 136 ? -8.870  6.122   -47.897 1.00 46.59 ? 136  ARG B N   1 
ATOM   5217 C CA  . ARG B 1 136 ? -10.199 6.498   -48.368 1.00 47.22 ? 136  ARG B CA  1 
ATOM   5218 C C   . ARG B 1 136 ? -10.862 7.439   -47.337 1.00 46.80 ? 136  ARG B C   1 
ATOM   5219 O O   . ARG B 1 136 ? -11.439 8.479   -47.701 1.00 46.36 ? 136  ARG B O   1 
ATOM   5220 C CB  . ARG B 1 136 ? -11.039 5.247   -48.732 1.00 47.82 ? 136  ARG B CB  1 
ATOM   5221 C CG  . ARG B 1 136 ? -11.958 4.712   -47.646 1.00 51.21 ? 136  ARG B CG  1 
ATOM   5222 C CD  . ARG B 1 136 ? -11.783 3.206   -47.388 1.00 57.78 ? 136  ARG B CD  1 
ATOM   5223 N NE  . ARG B 1 136 ? -12.487 2.377   -48.366 1.00 63.05 ? 136  ARG B NE  1 
ATOM   5224 C CZ  . ARG B 1 136 ? -11.905 1.637   -49.309 1.00 64.88 ? 136  ARG B CZ  1 
ATOM   5225 N NH1 . ARG B 1 136 ? -10.579 1.577   -49.425 1.00 66.74 ? 136  ARG B NH1 1 
ATOM   5226 N NH2 . ARG B 1 136 ? -12.660 0.938   -50.139 1.00 65.27 ? 136  ARG B NH2 1 
ATOM   5227 N N   . PHE B 1 137 ? -10.709 7.112   -46.057 1.00 46.54 ? 137  PHE B N   1 
ATOM   5228 C CA  . PHE B 1 137 ? -11.296 7.924   -44.995 1.00 47.27 ? 137  PHE B CA  1 
ATOM   5229 C C   . PHE B 1 137 ? -10.794 9.353   -44.923 1.00 47.82 ? 137  PHE B C   1 
ATOM   5230 O O   . PHE B 1 137 ? -11.611 10.273  -44.865 1.00 48.17 ? 137  PHE B O   1 
ATOM   5231 C CB  . PHE B 1 137 ? -11.140 7.253   -43.662 1.00 47.11 ? 137  PHE B CB  1 
ATOM   5232 C CG  . PHE B 1 137 ? -11.492 5.836   -43.696 1.00 48.08 ? 137  PHE B CG  1 
ATOM   5233 C CD1 . PHE B 1 137 ? -12.830 5.450   -43.798 1.00 49.23 ? 137  PHE B CD1 1 
ATOM   5234 C CD2 . PHE B 1 137 ? -10.495 4.866   -43.660 1.00 48.46 ? 137  PHE B CD2 1 
ATOM   5235 C CE1 . PHE B 1 137 ? -13.172 4.098   -43.836 1.00 50.76 ? 137  PHE B CE1 1 
ATOM   5236 C CE2 . PHE B 1 137 ? -10.813 3.514   -43.692 1.00 50.04 ? 137  PHE B CE2 1 
ATOM   5237 C CZ  . PHE B 1 137 ? -12.150 3.118   -43.775 1.00 50.55 ? 137  PHE B CZ  1 
ATOM   5238 N N   . LEU B 1 138 ? -9.471  9.549   -44.933 1.00 48.23 ? 138  LEU B N   1 
ATOM   5239 C CA  . LEU B 1 138 ? -8.920  10.897  -44.908 1.00 48.43 ? 138  LEU B CA  1 
ATOM   5240 C C   . LEU B 1 138 ? -9.375  11.646  -46.147 1.00 49.04 ? 138  LEU B C   1 
ATOM   5241 O O   . LEU B 1 138 ? -9.763  12.804  -46.063 1.00 49.51 ? 138  LEU B O   1 
ATOM   5242 C CB  . LEU B 1 138 ? -7.385  10.920  -44.762 1.00 48.30 ? 138  LEU B CB  1 
ATOM   5243 C CG  . LEU B 1 138 ? -6.727  10.593  -43.411 1.00 46.98 ? 138  LEU B CG  1 
ATOM   5244 C CD1 . LEU B 1 138 ? -5.252  10.492  -43.560 1.00 45.50 ? 138  LEU B CD1 1 
ATOM   5245 C CD2 . LEU B 1 138 ? -7.017  11.592  -42.332 1.00 46.64 ? 138  LEU B CD2 1 
ATOM   5246 N N   . ALA B 1 139 ? -9.359  10.986  -47.298 1.00 49.91 ? 139  ALA B N   1 
ATOM   5247 C CA  . ALA B 1 139 ? -9.744  11.659  -48.545 1.00 50.38 ? 139  ALA B CA  1 
ATOM   5248 C C   . ALA B 1 139 ? -11.201 12.130  -48.503 1.00 50.90 ? 139  ALA B C   1 
ATOM   5249 O O   . ALA B 1 139 ? -11.527 13.228  -48.968 1.00 51.40 ? 139  ALA B O   1 
ATOM   5250 C CB  . ALA B 1 139 ? -9.514  10.759  -49.735 1.00 49.81 ? 139  ALA B CB  1 
ATOM   5251 N N   . GLN B 1 140 ? -12.068 11.297  -47.945 1.00 51.15 ? 140  GLN B N   1 
ATOM   5252 C CA  . GLN B 1 140 ? -13.506 11.554  -47.978 1.00 51.64 ? 140  GLN B CA  1 
ATOM   5253 C C   . GLN B 1 140 ? -13.905 12.534  -46.878 1.00 51.54 ? 140  GLN B C   1 
ATOM   5254 O O   . GLN B 1 140 ? -14.434 13.603  -47.142 1.00 51.58 ? 140  GLN B O   1 
ATOM   5255 C CB  . GLN B 1 140 ? -14.272 10.232  -47.817 1.00 51.47 ? 140  GLN B CB  1 
ATOM   5256 C CG  . GLN B 1 140 ? -15.679 10.263  -48.365 1.00 51.80 ? 140  GLN B CG  1 
ATOM   5257 C CD  . GLN B 1 140 ? -16.694 10.681  -47.333 1.00 52.24 ? 140  GLN B CD  1 
ATOM   5258 O OE1 . GLN B 1 140 ? -16.771 10.112  -46.229 1.00 52.25 ? 140  GLN B OE1 1 
ATOM   5259 N NE2 . GLN B 1 140 ? -17.492 11.671  -47.685 1.00 51.43 ? 140  GLN B NE2 1 
ATOM   5260 N N   . VAL B 1 141 ? -13.635 12.157  -45.640 1.00 51.45 ? 141  VAL B N   1 
ATOM   5261 C CA  . VAL B 1 141 ? -14.071 12.937  -44.513 1.00 51.41 ? 141  VAL B CA  1 
ATOM   5262 C C   . VAL B 1 141 ? -13.430 14.321  -44.467 1.00 51.68 ? 141  VAL B C   1 
ATOM   5263 O O   . VAL B 1 141 ? -14.119 15.299  -44.178 1.00 52.18 ? 141  VAL B O   1 
ATOM   5264 C CB  . VAL B 1 141 ? -13.842 12.177  -43.229 1.00 51.46 ? 141  VAL B CB  1 
ATOM   5265 C CG1 . VAL B 1 141 ? -14.438 12.944  -42.063 1.00 51.91 ? 141  VAL B CG1 1 
ATOM   5266 C CG2 . VAL B 1 141 ? -14.450 10.765  -43.351 1.00 49.77 ? 141  VAL B CG2 1 
ATOM   5267 N N   . GLU B 1 142 ? -12.145 14.405  -44.820 1.00 51.54 ? 142  GLU B N   1 
ATOM   5268 C CA  . GLU B 1 142 ? -11.348 15.630  -44.676 1.00 50.83 ? 142  GLU B CA  1 
ATOM   5269 C C   . GLU B 1 142 ? -10.985 16.314  -45.966 1.00 50.49 ? 142  GLU B C   1 
ATOM   5270 O O   . GLU B 1 142 ? -10.404 17.405  -45.943 1.00 50.52 ? 142  GLU B O   1 
ATOM   5271 C CB  . GLU B 1 142 ? -10.053 15.328  -43.924 1.00 50.92 ? 142  GLU B CB  1 
ATOM   5272 C CG  . GLU B 1 142 ? -10.252 15.129  -42.432 1.00 51.87 ? 142  GLU B CG  1 
ATOM   5273 C CD  . GLU B 1 142 ? -10.888 16.344  -41.770 1.00 52.59 ? 142  GLU B CD  1 
ATOM   5274 O OE1 . GLU B 1 142 ? -10.752 17.472  -42.313 1.00 52.59 ? 142  GLU B OE1 1 
ATOM   5275 O OE2 . GLU B 1 142 ? -11.515 16.163  -40.703 1.00 54.25 ? 142  GLU B OE2 1 
ATOM   5276 N N   . GLY B 1 143 ? -11.284 15.666  -47.086 1.00 49.86 ? 143  GLY B N   1 
ATOM   5277 C CA  . GLY B 1 143 ? -10.986 16.223  -48.396 1.00 49.49 ? 143  GLY B CA  1 
ATOM   5278 C C   . GLY B 1 143 ? -9.518  16.171  -48.771 1.00 49.87 ? 143  GLY B C   1 
ATOM   5279 O O   . GLY B 1 143 ? -9.095  16.832  -49.729 1.00 50.74 ? 143  GLY B O   1 
ATOM   5280 N N   . ALA B 1 144 ? -8.722  15.389  -48.037 1.00 49.09 ? 144  ALA B N   1 
ATOM   5281 C CA  . ALA B 1 144 ? -7.282  15.320  -48.307 1.00 47.98 ? 144  ALA B CA  1 
ATOM   5282 C C   . ALA B 1 144 ? -6.951  14.551  -49.601 1.00 47.13 ? 144  ALA B C   1 
ATOM   5283 O O   . ALA B 1 144 ? -7.682  13.641  -50.007 1.00 46.96 ? 144  ALA B O   1 
ATOM   5284 C CB  . ALA B 1 144 ? -6.566  14.709  -47.126 1.00 48.17 ? 144  ALA B CB  1 
ATOM   5285 N N   . VAL B 1 145 ? -5.883  14.959  -50.272 1.00 45.83 ? 145  VAL B N   1 
ATOM   5286 C CA  . VAL B 1 145 ? -5.292  14.135  -51.302 1.00 44.79 ? 145  VAL B CA  1 
ATOM   5287 C C   . VAL B 1 145 ? -4.169  13.358  -50.604 1.00 44.64 ? 145  VAL B C   1 
ATOM   5288 O O   . VAL B 1 145 ? -3.185  13.949  -50.129 1.00 44.59 ? 145  VAL B O   1 
ATOM   5289 C CB  . VAL B 1 145 ? -4.768  14.953  -52.490 1.00 44.85 ? 145  VAL B CB  1 
ATOM   5290 C CG1 . VAL B 1 145 ? -3.906  14.083  -53.415 1.00 43.47 ? 145  VAL B CG1 1 
ATOM   5291 C CG2 . VAL B 1 145 ? -5.929  15.553  -53.269 1.00 44.51 ? 145  VAL B CG2 1 
ATOM   5292 N N   . LEU B 1 146 ? -4.360  12.044  -50.504 1.00 43.58 ? 146  LEU B N   1 
ATOM   5293 C CA  . LEU B 1 146 ? -3.438  11.171  -49.819 1.00 43.16 ? 146  LEU B CA  1 
ATOM   5294 C C   . LEU B 1 146 ? -2.626  10.311  -50.793 1.00 42.63 ? 146  LEU B C   1 
ATOM   5295 O O   . LEU B 1 146 ? -3.186  9.660   -51.683 1.00 43.24 ? 146  LEU B O   1 
ATOM   5296 C CB  . LEU B 1 146 ? -4.199  10.298  -48.829 1.00 43.20 ? 146  LEU B CB  1 
ATOM   5297 C CG  . LEU B 1 146 ? -3.209  9.771   -47.797 1.00 44.95 ? 146  LEU B CG  1 
ATOM   5298 C CD1 . LEU B 1 146 ? -3.621  10.126  -46.413 1.00 44.26 ? 146  LEU B CD1 1 
ATOM   5299 C CD2 . LEU B 1 146 ? -2.916  8.256   -47.943 1.00 45.89 ? 146  LEU B CD2 1 
ATOM   5300 N N   . VAL B 1 147 ? -1.307  10.314  -50.624 1.00 41.52 ? 147  VAL B N   1 
ATOM   5301 C CA  . VAL B 1 147 ? -0.398  9.543   -51.476 1.00 40.37 ? 147  VAL B CA  1 
ATOM   5302 C C   . VAL B 1 147 ? 0.388   8.611   -50.581 1.00 39.80 ? 147  VAL B C   1 
ATOM   5303 O O   . VAL B 1 147 ? 0.854   9.044   -49.524 1.00 39.32 ? 147  VAL B O   1 
ATOM   5304 C CB  . VAL B 1 147 ? 0.614   10.444  -52.194 1.00 40.39 ? 147  VAL B CB  1 
ATOM   5305 C CG1 . VAL B 1 147 ? 1.515   9.637   -53.096 1.00 40.95 ? 147  VAL B CG1 1 
ATOM   5306 C CG2 . VAL B 1 147 ? -0.085  11.504  -52.997 1.00 40.97 ? 147  VAL B CG2 1 
ATOM   5307 N N   . SER B 1 148 ? 0.508   7.336   -50.975 1.00 38.71 ? 148  SER B N   1 
ATOM   5308 C CA  . SER B 1 148 ? 1.478   6.439   -50.354 1.00 37.89 ? 148  SER B CA  1 
ATOM   5309 C C   . SER B 1 148 ? 2.331   5.694   -51.408 1.00 37.69 ? 148  SER B C   1 
ATOM   5310 O O   . SER B 1 148 ? 1.848   5.427   -52.515 1.00 38.61 ? 148  SER B O   1 
ATOM   5311 C CB  . SER B 1 148 ? 0.818   5.501   -49.374 1.00 37.79 ? 148  SER B CB  1 
ATOM   5312 O OG  . SER B 1 148 ? 0.088   4.492   -50.023 1.00 38.76 ? 148  SER B OG  1 
ATOM   5313 N N   . MET B 1 149 ? 3.603   5.417   -51.099 1.00 35.68 ? 149  MET B N   1 
ATOM   5314 C CA  . MET B 1 149 ? 4.496   4.750   -52.066 1.00 34.16 ? 149  MET B CA  1 
ATOM   5315 C C   . MET B 1 149 ? 5.121   3.505   -51.475 1.00 33.26 ? 149  MET B C   1 
ATOM   5316 O O   . MET B 1 149 ? 5.316   3.418   -50.250 1.00 33.55 ? 149  MET B O   1 
ATOM   5317 C CB  . MET B 1 149 ? 5.617   5.680   -52.550 1.00 33.70 ? 149  MET B CB  1 
ATOM   5318 C CG  . MET B 1 149 ? 6.860   5.679   -51.674 1.00 33.95 ? 149  MET B CG  1 
ATOM   5319 S SD  . MET B 1 149 ? 6.552   6.492   -50.090 1.00 36.37 ? 149  MET B SD  1 
ATOM   5320 C CE  . MET B 1 149 ? 6.614   8.239   -50.574 1.00 30.55 ? 149  MET B CE  1 
ATOM   5321 N N   . ASN B 1 150 ? 5.450   2.558   -52.342 1.00 31.87 ? 150  ASN B N   1 
ATOM   5322 C CA  . ASN B 1 150 ? 6.357   1.482   -51.968 1.00 32.05 ? 150  ASN B CA  1 
ATOM   5323 C C   . ASN B 1 150 ? 7.798   1.949   -52.111 1.00 31.83 ? 150  ASN B C   1 
ATOM   5324 O O   . ASN B 1 150 ? 8.106   2.759   -52.987 1.00 31.47 ? 150  ASN B O   1 
ATOM   5325 C CB  . ASN B 1 150 ? 6.131   0.256   -52.843 1.00 32.49 ? 150  ASN B CB  1 
ATOM   5326 C CG  . ASN B 1 150 ? 4.847   -0.510  -52.484 1.00 32.75 ? 150  ASN B CG  1 
ATOM   5327 O OD1 . ASN B 1 150 ? 4.163   -0.202  -51.502 1.00 31.30 ? 150  ASN B OD1 1 
ATOM   5328 N ND2 . ASN B 1 150 ? 4.551   -1.543  -53.267 1.00 34.02 ? 150  ASN B ND2 1 
ATOM   5329 N N   . TYR B 1 151 ? 8.657   1.485   -51.209 1.00 31.57 ? 151  TYR B N   1 
ATOM   5330 C CA  . TYR B 1 151 ? 10.107  1.687   -51.341 1.00 31.85 ? 151  TYR B CA  1 
ATOM   5331 C C   . TYR B 1 151 ? 10.837  0.367   -51.001 1.00 31.94 ? 151  TYR B C   1 
ATOM   5332 O O   . TYR B 1 151 ? 10.349  -0.427  -50.184 1.00 31.49 ? 151  TYR B O   1 
ATOM   5333 C CB  . TYR B 1 151 ? 10.608  2.865   -50.473 1.00 30.67 ? 151  TYR B CB  1 
ATOM   5334 C CG  . TYR B 1 151 ? 10.411  2.683   -48.982 1.00 30.00 ? 151  TYR B CG  1 
ATOM   5335 C CD1 . TYR B 1 151 ? 9.179   2.995   -48.356 1.00 29.90 ? 151  TYR B CD1 1 
ATOM   5336 C CD2 . TYR B 1 151 ? 11.454  2.228   -48.186 1.00 28.88 ? 151  TYR B CD2 1 
ATOM   5337 C CE1 . TYR B 1 151 ? 9.002   2.828   -46.974 1.00 29.45 ? 151  TYR B CE1 1 
ATOM   5338 C CE2 . TYR B 1 151 ? 11.293  2.038   -46.811 1.00 29.27 ? 151  TYR B CE2 1 
ATOM   5339 C CZ  . TYR B 1 151 ? 10.062  2.332   -46.206 1.00 30.98 ? 151  TYR B CZ  1 
ATOM   5340 O OH  . TYR B 1 151 ? 9.924   2.135   -44.834 1.00 31.34 ? 151  TYR B OH  1 
ATOM   5341 N N   . ARG B 1 152 ? 11.995  0.142   -51.618 1.00 31.96 ? 152  ARG B N   1 
ATOM   5342 C CA  . ARG B 1 152 ? 12.774  -1.083  -51.333 1.00 32.31 ? 152  ARG B CA  1 
ATOM   5343 C C   . ARG B 1 152 ? 13.191  -1.159  -49.862 1.00 32.16 ? 152  ARG B C   1 
ATOM   5344 O O   . ARG B 1 152 ? 13.420  -0.146  -49.226 1.00 32.79 ? 152  ARG B O   1 
ATOM   5345 C CB  . ARG B 1 152 ? 13.975  -1.180  -52.270 1.00 31.67 ? 152  ARG B CB  1 
ATOM   5346 C CG  . ARG B 1 152 ? 13.579  -1.499  -53.694 1.00 31.44 ? 152  ARG B CG  1 
ATOM   5347 C CD  . ARG B 1 152 ? 14.732  -1.384  -54.635 1.00 30.26 ? 152  ARG B CD  1 
ATOM   5348 N NE  . ARG B 1 152 ? 14.924  0.012   -54.986 1.00 30.34 ? 152  ARG B NE  1 
ATOM   5349 C CZ  . ARG B 1 152 ? 15.935  0.456   -55.713 1.00 32.84 ? 152  ARG B CZ  1 
ATOM   5350 N NH1 . ARG B 1 152 ? 16.878  -0.398  -56.157 1.00 34.18 ? 152  ARG B NH1 1 
ATOM   5351 N NH2 . ARG B 1 152 ? 16.018  1.757   -55.980 1.00 32.43 ? 152  ARG B NH2 1 
ATOM   5352 N N   . VAL B 1 153 ? 13.215  -2.358  -49.313 1.00 32.43 ? 153  VAL B N   1 
ATOM   5353 C CA  . VAL B 1 153 ? 13.515  -2.569  -47.919 1.00 32.68 ? 153  VAL B CA  1 
ATOM   5354 C C   . VAL B 1 153 ? 14.515  -3.718  -47.874 1.00 33.49 ? 153  VAL B C   1 
ATOM   5355 O O   . VAL B 1 153 ? 14.850  -4.281  -48.918 1.00 33.90 ? 153  VAL B O   1 
ATOM   5356 C CB  . VAL B 1 153 ? 12.261  -2.974  -47.147 1.00 32.86 ? 153  VAL B CB  1 
ATOM   5357 C CG1 . VAL B 1 153 ? 11.240  -1.830  -47.142 1.00 34.37 ? 153  VAL B CG1 1 
ATOM   5358 C CG2 . VAL B 1 153 ? 11.670  -4.214  -47.760 1.00 31.72 ? 153  VAL B CG2 1 
ATOM   5359 N N   . GLY B 1 154 ? 14.990  -4.066  -46.678 1.00 34.05 ? 154  GLY B N   1 
ATOM   5360 C CA  . GLY B 1 154 ? 16.062  -5.060  -46.509 1.00 34.56 ? 154  GLY B CA  1 
ATOM   5361 C C   . GLY B 1 154 ? 17.268  -4.775  -47.367 1.00 34.93 ? 154  GLY B C   1 
ATOM   5362 O O   . GLY B 1 154 ? 17.651  -3.620  -47.583 1.00 34.82 ? 154  GLY B O   1 
ATOM   5363 N N   . THR B 1 155 ? 17.840  -5.840  -47.908 1.00 36.30 ? 155  THR B N   1 
ATOM   5364 C CA  . THR B 1 155 ? 19.060  -5.741  -48.718 1.00 36.83 ? 155  THR B CA  1 
ATOM   5365 C C   . THR B 1 155 ? 18.815  -4.955  -49.989 1.00 37.21 ? 155  THR B C   1 
ATOM   5366 O O   . THR B 1 155 ? 19.659  -4.171  -50.407 1.00 38.39 ? 155  THR B O   1 
ATOM   5367 C CB  . THR B 1 155 ? 19.598  -7.124  -49.073 1.00 36.42 ? 155  THR B CB  1 
ATOM   5368 O OG1 . THR B 1 155 ? 18.595  -7.847  -49.772 1.00 35.24 ? 155  THR B OG1 1 
ATOM   5369 C CG2 . THR B 1 155 ? 19.932  -7.906  -47.806 1.00 39.14 ? 155  THR B CG2 1 
ATOM   5370 N N   . PHE B 1 156 ? 17.654  -5.157  -50.596 1.00 37.29 ? 156  PHE B N   1 
ATOM   5371 C CA  . PHE B 1 156 ? 17.311  -4.509  -51.863 1.00 37.41 ? 156  PHE B CA  1 
ATOM   5372 C C   . PHE B 1 156 ? 17.229  -3.006  -51.765 1.00 37.36 ? 156  PHE B C   1 
ATOM   5373 O O   . PHE B 1 156 ? 17.537  -2.308  -52.725 1.00 37.73 ? 156  PHE B O   1 
ATOM   5374 C CB  . PHE B 1 156 ? 15.978  -5.060  -52.350 1.00 37.64 ? 156  PHE B CB  1 
ATOM   5375 C CG  . PHE B 1 156 ? 15.898  -6.553  -52.244 1.00 37.40 ? 156  PHE B CG  1 
ATOM   5376 C CD1 . PHE B 1 156 ? 16.474  -7.364  -53.241 1.00 36.49 ? 156  PHE B CD1 1 
ATOM   5377 C CD2 . PHE B 1 156 ? 15.307  -7.148  -51.136 1.00 35.51 ? 156  PHE B CD2 1 
ATOM   5378 C CE1 . PHE B 1 156 ? 16.416  -8.737  -53.146 1.00 35.97 ? 156  PHE B CE1 1 
ATOM   5379 C CE2 . PHE B 1 156 ? 15.248  -8.543  -51.021 1.00 36.88 ? 156  PHE B CE2 1 
ATOM   5380 C CZ  . PHE B 1 156 ? 15.807  -9.337  -52.025 1.00 36.29 ? 156  PHE B CZ  1 
ATOM   5381 N N   . GLY B 1 157 ? 16.794  -2.497  -50.617 1.00 37.33 ? 157  GLY B N   1 
ATOM   5382 C CA  . GLY B 1 157 ? 16.700  -1.053  -50.458 1.00 37.35 ? 157  GLY B CA  1 
ATOM   5383 C C   . GLY B 1 157 ? 17.902  -0.431  -49.773 1.00 37.65 ? 157  GLY B C   1 
ATOM   5384 O O   . GLY B 1 157 ? 18.174  0.761   -49.931 1.00 36.68 ? 157  GLY B O   1 
ATOM   5385 N N   . PHE B 1 158 ? 18.616  -1.244  -49.001 1.00 37.87 ? 158  PHE B N   1 
ATOM   5386 C CA  . PHE B 1 158 ? 19.543  -0.685  -48.032 1.00 38.73 ? 158  PHE B CA  1 
ATOM   5387 C C   . PHE B 1 158 ? 20.951  -1.251  -47.948 1.00 39.59 ? 158  PHE B C   1 
ATOM   5388 O O   . PHE B 1 158 ? 21.770  -0.645  -47.291 1.00 40.24 ? 158  PHE B O   1 
ATOM   5389 C CB  . PHE B 1 158 ? 18.880  -0.516  -46.651 1.00 37.49 ? 158  PHE B CB  1 
ATOM   5390 C CG  . PHE B 1 158 ? 17.802  0.511   -46.665 1.00 36.15 ? 158  PHE B CG  1 
ATOM   5391 C CD1 . PHE B 1 158 ? 18.127  1.864   -46.779 1.00 34.78 ? 158  PHE B CD1 1 
ATOM   5392 C CD2 . PHE B 1 158 ? 16.460  0.137   -46.659 1.00 34.96 ? 158  PHE B CD2 1 
ATOM   5393 C CE1 . PHE B 1 158 ? 17.136  2.839   -46.840 1.00 33.53 ? 158  PHE B CE1 1 
ATOM   5394 C CE2 . PHE B 1 158 ? 15.464  1.100   -46.714 1.00 34.75 ? 158  PHE B CE2 1 
ATOM   5395 C CZ  . PHE B 1 158 ? 15.805  2.459   -46.810 1.00 35.00 ? 158  PHE B CZ  1 
ATOM   5396 N N   . LEU B 1 159 ? 21.224  -2.367  -48.629 1.00 40.57 ? 159  LEU B N   1 
ATOM   5397 C CA  . LEU B 1 159 ? 22.570  -2.926  -48.703 1.00 41.47 ? 159  LEU B CA  1 
ATOM   5398 C C   . LEU B 1 159 ? 23.516  -1.975  -49.419 1.00 42.63 ? 159  LEU B C   1 
ATOM   5399 O O   . LEU B 1 159 ? 23.266  -1.596  -50.565 1.00 43.47 ? 159  LEU B O   1 
ATOM   5400 C CB  . LEU B 1 159 ? 22.569  -4.281  -49.413 1.00 40.95 ? 159  LEU B CB  1 
ATOM   5401 C CG  . LEU B 1 159 ? 23.919  -5.006  -49.501 1.00 39.09 ? 159  LEU B CG  1 
ATOM   5402 C CD1 . LEU B 1 159 ? 23.789  -6.464  -49.130 1.00 36.42 ? 159  LEU B CD1 1 
ATOM   5403 C CD2 . LEU B 1 159 ? 24.508  -4.842  -50.879 1.00 39.64 ? 159  LEU B CD2 1 
ATOM   5404 N N   . ALA B 1 160 ? 24.600  -1.597  -48.743 1.00 43.41 ? 160  ALA B N   1 
ATOM   5405 C CA  . ALA B 1 160 ? 25.546  -0.643  -49.308 1.00 44.16 ? 160  ALA B CA  1 
ATOM   5406 C C   . ALA B 1 160 ? 26.981  -1.159  -49.254 1.00 44.49 ? 160  ALA B C   1 
ATOM   5407 O O   . ALA B 1 160 ? 27.415  -1.724  -48.251 1.00 45.30 ? 160  ALA B O   1 
ATOM   5408 C CB  . ALA B 1 160 ? 25.452  0.660   -48.567 1.00 44.17 ? 160  ALA B CB  1 
ATOM   5409 N N   . LEU B 1 161 ? 27.711  -0.964  -50.339 1.00 44.89 ? 161  LEU B N   1 
ATOM   5410 C CA  . LEU B 1 161 ? 29.164  -0.958  -50.284 1.00 45.00 ? 161  LEU B CA  1 
ATOM   5411 C C   . LEU B 1 161 ? 29.541  0.495   -50.513 1.00 45.51 ? 161  LEU B C   1 
ATOM   5412 O O   . LEU B 1 161 ? 29.756  0.926   -51.657 1.00 45.44 ? 161  LEU B O   1 
ATOM   5413 C CB  . LEU B 1 161 ? 29.757  -1.886  -51.334 1.00 44.86 ? 161  LEU B CB  1 
ATOM   5414 C CG  . LEU B 1 161 ? 29.456  -3.374  -51.067 1.00 45.14 ? 161  LEU B CG  1 
ATOM   5415 C CD1 . LEU B 1 161 ? 29.969  -4.216  -52.205 1.00 47.76 ? 161  LEU B CD1 1 
ATOM   5416 C CD2 . LEU B 1 161 ? 30.066  -3.866  -49.777 1.00 42.84 ? 161  LEU B CD2 1 
ATOM   5417 N N   . PRO B 1 162 ? 29.549  1.284   -49.425 1.00 45.84 ? 162  PRO B N   1 
ATOM   5418 C CA  . PRO B 1 162 ? 29.713  2.730   -49.538 1.00 46.80 ? 162  PRO B CA  1 
ATOM   5419 C C   . PRO B 1 162 ? 30.922  3.085   -50.378 1.00 48.13 ? 162  PRO B C   1 
ATOM   5420 O O   . PRO B 1 162 ? 31.946  2.391   -50.309 1.00 48.45 ? 162  PRO B O   1 
ATOM   5421 C CB  . PRO B 1 162 ? 29.884  3.166   -48.095 1.00 47.04 ? 162  PRO B CB  1 
ATOM   5422 C CG  . PRO B 1 162 ? 29.053  2.131   -47.330 1.00 46.15 ? 162  PRO B CG  1 
ATOM   5423 C CD  . PRO B 1 162 ? 29.368  0.853   -48.028 1.00 45.68 ? 162  PRO B CD  1 
ATOM   5424 N N   . GLY B 1 163 ? 30.780  4.124   -51.197 1.00 48.97 ? 163  GLY B N   1 
ATOM   5425 C CA  . GLY B 1 163 ? 31.815  4.511   -52.141 1.00 49.84 ? 163  GLY B CA  1 
ATOM   5426 C C   . GLY B 1 163 ? 31.724  3.819   -53.491 1.00 51.28 ? 163  GLY B C   1 
ATOM   5427 O O   . GLY B 1 163 ? 32.164  4.383   -54.504 1.00 50.92 ? 163  GLY B O   1 
ATOM   5428 N N   . SER B 1 164 ? 31.171  2.597   -53.524 1.00 52.26 ? 164  SER B N   1 
ATOM   5429 C CA  . SER B 1 164 ? 31.012  1.855   -54.788 1.00 53.10 ? 164  SER B CA  1 
ATOM   5430 C C   . SER B 1 164 ? 30.025  2.547   -55.738 1.00 53.86 ? 164  SER B C   1 
ATOM   5431 O O   . SER B 1 164 ? 29.218  3.354   -55.299 1.00 54.03 ? 164  SER B O   1 
ATOM   5432 C CB  . SER B 1 164 ? 30.539  0.435   -54.508 1.00 53.01 ? 164  SER B CB  1 
ATOM   5433 O OG  . SER B 1 164 ? 29.148  0.418   -54.247 1.00 53.73 ? 164  SER B OG  1 
ATOM   5434 N N   . ARG B 1 165 ? 30.096  2.238   -57.033 1.00 54.99 ? 165  ARG B N   1 
ATOM   5435 C CA  . ARG B 1 165 ? 29.154  2.799   -58.013 1.00 56.50 ? 165  ARG B CA  1 
ATOM   5436 C C   . ARG B 1 165 ? 27.855  1.997   -58.026 1.00 55.31 ? 165  ARG B C   1 
ATOM   5437 O O   . ARG B 1 165 ? 26.776  2.537   -58.305 1.00 55.26 ? 165  ARG B O   1 
ATOM   5438 C CB  . ARG B 1 165 ? 29.755  2.779   -59.428 1.00 56.72 ? 165  ARG B CB  1 
ATOM   5439 C CG  . ARG B 1 165 ? 29.150  3.820   -60.415 1.00 59.35 ? 165  ARG B CG  1 
ATOM   5440 C CD  . ARG B 1 165 ? 29.297  3.381   -61.917 1.00 60.52 ? 165  ARG B CD  1 
ATOM   5441 N NE  . ARG B 1 165 ? 28.090  2.701   -62.449 1.00 70.22 ? 165  ARG B NE  1 
ATOM   5442 C CZ  . ARG B 1 165 ? 27.839  1.376   -62.411 1.00 72.27 ? 165  ARG B CZ  1 
ATOM   5443 N NH1 . ARG B 1 165 ? 28.701  0.516   -61.866 1.00 73.34 ? 165  ARG B NH1 1 
ATOM   5444 N NH2 . ARG B 1 165 ? 26.706  0.899   -62.923 1.00 72.05 ? 165  ARG B NH2 1 
ATOM   5445 N N   . GLU B 1 166 ? 27.977  0.710   -57.710 1.00 54.22 ? 166  GLU B N   1 
ATOM   5446 C CA  . GLU B 1 166 ? 26.927  -0.250  -57.996 1.00 53.46 ? 166  GLU B CA  1 
ATOM   5447 C C   . GLU B 1 166 ? 26.019  -0.575  -56.802 1.00 51.55 ? 166  GLU B C   1 
ATOM   5448 O O   . GLU B 1 166 ? 24.928  -1.087  -56.989 1.00 51.39 ? 166  GLU B O   1 
ATOM   5449 C CB  . GLU B 1 166 ? 27.479  -1.514  -58.717 1.00 54.35 ? 166  GLU B CB  1 
ATOM   5450 C CG  . GLU B 1 166 ? 28.873  -2.014  -58.280 1.00 58.49 ? 166  GLU B CG  1 
ATOM   5451 C CD  . GLU B 1 166 ? 30.058  -1.272  -58.959 1.00 63.81 ? 166  GLU B CD  1 
ATOM   5452 O OE1 . GLU B 1 166 ? 30.214  -1.383  -60.205 1.00 64.72 ? 166  GLU B OE1 1 
ATOM   5453 O OE2 . GLU B 1 166 ? 30.844  -0.596  -58.235 1.00 65.82 ? 166  GLU B OE2 1 
ATOM   5454 N N   . ALA B 1 167 ? 26.464  -0.267  -55.586 1.00 49.44 ? 167  ALA B N   1 
ATOM   5455 C CA  . ALA B 1 167 ? 25.610  -0.373  -54.399 1.00 47.15 ? 167  ALA B CA  1 
ATOM   5456 C C   . ALA B 1 167 ? 25.907  0.767   -53.403 1.00 45.61 ? 167  ALA B C   1 
ATOM   5457 O O   . ALA B 1 167 ? 26.483  0.542   -52.331 1.00 45.25 ? 167  ALA B O   1 
ATOM   5458 C CB  . ALA B 1 167 ? 25.748  -1.731  -53.750 1.00 46.44 ? 167  ALA B CB  1 
ATOM   5459 N N   . PRO B 1 168 ? 25.492  1.999   -53.747 1.00 44.10 ? 168  PRO B N   1 
ATOM   5460 C CA  . PRO B 1 168 ? 25.924  3.156   -52.936 1.00 43.05 ? 168  PRO B CA  1 
ATOM   5461 C C   . PRO B 1 168 ? 25.158  3.344   -51.612 1.00 42.03 ? 168  PRO B C   1 
ATOM   5462 O O   . PRO B 1 168 ? 25.455  4.282   -50.864 1.00 42.54 ? 168  PRO B O   1 
ATOM   5463 C CB  . PRO B 1 168 ? 25.679  4.347   -53.865 1.00 42.36 ? 168  PRO B CB  1 
ATOM   5464 C CG  . PRO B 1 168 ? 24.488  3.900   -54.711 1.00 43.79 ? 168  PRO B CG  1 
ATOM   5465 C CD  . PRO B 1 168 ? 24.613  2.393   -54.869 1.00 43.94 ? 168  PRO B CD  1 
ATOM   5466 N N   . GLY B 1 169 ? 24.189  2.475   -51.327 1.00 40.46 ? 169  GLY B N   1 
ATOM   5467 C CA  . GLY B 1 169 ? 23.374  2.611   -50.127 1.00 38.55 ? 169  GLY B CA  1 
ATOM   5468 C C   . GLY B 1 169 ? 22.250  3.631   -50.231 1.00 37.51 ? 169  GLY B C   1 
ATOM   5469 O O   . GLY B 1 169 ? 22.219  4.441   -51.163 1.00 37.07 ? 169  GLY B O   1 
ATOM   5470 N N   . ASN B 1 170 ? 21.317  3.569   -49.282 1.00 37.02 ? 170  ASN B N   1 
ATOM   5471 C CA  . ASN B 1 170 ? 20.166  4.488   -49.214 1.00 37.03 ? 170  ASN B CA  1 
ATOM   5472 C C   . ASN B 1 170 ? 19.187  4.486   -50.408 1.00 37.07 ? 170  ASN B C   1 
ATOM   5473 O O   . ASN B 1 170 ? 18.434  5.467   -50.587 1.00 37.82 ? 170  ASN B O   1 
ATOM   5474 C CB  . ASN B 1 170 ? 20.656  5.920   -48.961 1.00 36.00 ? 170  ASN B CB  1 
ATOM   5475 C CG  . ASN B 1 170 ? 21.405  6.037   -47.673 1.00 36.96 ? 170  ASN B CG  1 
ATOM   5476 O OD1 . ASN B 1 170 ? 20.997  5.485   -46.653 1.00 35.30 ? 170  ASN B OD1 1 
ATOM   5477 N ND2 . ASN B 1 170 ? 22.522  6.747   -47.700 1.00 39.15 ? 170  ASN B ND2 1 
ATOM   5478 N N   . VAL B 1 171 ? 19.187  3.435   -51.230 1.00 36.14 ? 171  VAL B N   1 
ATOM   5479 C CA  . VAL B 1 171 ? 18.374  3.506   -52.429 1.00 36.40 ? 171  VAL B CA  1 
ATOM   5480 C C   . VAL B 1 171 ? 16.875  3.461   -52.065 1.00 36.46 ? 171  VAL B C   1 
ATOM   5481 O O   . VAL B 1 171 ? 16.057  4.069   -52.739 1.00 36.20 ? 171  VAL B O   1 
ATOM   5482 C CB  . VAL B 1 171 ? 18.761  2.477   -53.518 1.00 35.99 ? 171  VAL B CB  1 
ATOM   5483 C CG1 . VAL B 1 171 ? 20.233  2.559   -53.809 1.00 36.35 ? 171  VAL B CG1 1 
ATOM   5484 C CG2 . VAL B 1 171 ? 18.385  1.078   -53.098 1.00 36.74 ? 171  VAL B CG2 1 
ATOM   5485 N N   . GLY B 1 172 ? 16.532  2.759   -50.987 1.00 36.74 ? 172  GLY B N   1 
ATOM   5486 C CA  . GLY B 1 172 ? 15.150  2.739   -50.489 1.00 36.89 ? 172  GLY B CA  1 
ATOM   5487 C C   . GLY B 1 172 ? 14.697  4.175   -50.223 1.00 37.42 ? 172  GLY B C   1 
ATOM   5488 O O   . GLY B 1 172 ? 13.537  4.541   -50.475 1.00 36.64 ? 172  GLY B O   1 
ATOM   5489 N N   . LEU B 1 173 ? 15.629  5.010   -49.748 1.00 37.14 ? 173  LEU B N   1 
ATOM   5490 C CA  . LEU B 1 173 ? 15.278  6.369   -49.399 1.00 36.93 ? 173  LEU B CA  1 
ATOM   5491 C C   . LEU B 1 173 ? 15.118  7.158   -50.671 1.00 36.99 ? 173  LEU B C   1 
ATOM   5492 O O   . LEU B 1 173 ? 14.317  8.084   -50.725 1.00 37.46 ? 173  LEU B O   1 
ATOM   5493 C CB  . LEU B 1 173 ? 16.330  7.008   -48.481 1.00 37.39 ? 173  LEU B CB  1 
ATOM   5494 C CG  . LEU B 1 173 ? 16.343  6.581   -47.005 1.00 37.61 ? 173  LEU B CG  1 
ATOM   5495 C CD1 . LEU B 1 173 ? 17.495  7.230   -46.295 1.00 38.43 ? 173  LEU B CD1 1 
ATOM   5496 C CD2 . LEU B 1 173 ? 15.017  6.897   -46.299 1.00 38.90 ? 173  LEU B CD2 1 
ATOM   5497 N N   . LEU B 1 174 ? 15.886  6.792   -51.690 1.00 36.70 ? 174  LEU B N   1 
ATOM   5498 C CA  . LEU B 1 174 ? 15.841  7.483   -52.957 1.00 36.78 ? 174  LEU B CA  1 
ATOM   5499 C C   . LEU B 1 174 ? 14.547  7.115   -53.702 1.00 36.45 ? 174  LEU B C   1 
ATOM   5500 O O   . LEU B 1 174 ? 13.966  7.937   -54.443 1.00 36.22 ? 174  LEU B O   1 
ATOM   5501 C CB  . LEU B 1 174 ? 17.084  7.139   -53.785 1.00 36.90 ? 174  LEU B CB  1 
ATOM   5502 C CG  . LEU B 1 174 ? 18.401  7.837   -53.411 1.00 38.82 ? 174  LEU B CG  1 
ATOM   5503 C CD1 . LEU B 1 174 ? 19.572  7.361   -54.298 1.00 35.96 ? 174  LEU B CD1 1 
ATOM   5504 C CD2 . LEU B 1 174 ? 18.257  9.357   -53.508 1.00 37.69 ? 174  LEU B CD2 1 
ATOM   5505 N N   . ASP B 1 175 ? 14.111  5.879   -53.502 1.00 35.71 ? 175  ASP B N   1 
ATOM   5506 C CA  . ASP B 1 175 ? 12.813  5.438   -53.949 1.00 35.89 ? 175  ASP B CA  1 
ATOM   5507 C C   . ASP B 1 175 ? 11.772  6.416   -53.401 1.00 36.28 ? 175  ASP B C   1 
ATOM   5508 O O   . ASP B 1 175 ? 10.947  6.939   -54.150 1.00 37.10 ? 175  ASP B O   1 
ATOM   5509 C CB  . ASP B 1 175 ? 12.529  4.036   -53.406 1.00 35.63 ? 175  ASP B CB  1 
ATOM   5510 C CG  . ASP B 1 175 ? 13.324  2.963   -54.106 1.00 35.14 ? 175  ASP B CG  1 
ATOM   5511 O OD1 . ASP B 1 175 ? 13.888  3.265   -55.179 1.00 32.38 ? 175  ASP B OD1 1 
ATOM   5512 O OD2 . ASP B 1 175 ? 13.356  1.802   -53.598 1.00 37.79 ? 175  ASP B OD2 1 
ATOM   5513 N N   . GLN B 1 176 ? 11.831  6.683   -52.101 1.00 35.57 ? 176  GLN B N   1 
ATOM   5514 C CA  . GLN B 1 176 ? 10.926  7.633   -51.497 1.00 35.88 ? 176  GLN B CA  1 
ATOM   5515 C C   . GLN B 1 176 ? 11.039  9.006   -52.132 1.00 36.11 ? 176  GLN B C   1 
ATOM   5516 O O   . GLN B 1 176 ? 10.022  9.600   -52.477 1.00 36.52 ? 176  GLN B O   1 
ATOM   5517 C CB  . GLN B 1 176 ? 11.148  7.721   -49.988 1.00 36.26 ? 176  GLN B CB  1 
ATOM   5518 C CG  . GLN B 1 176 ? 10.943  6.396   -49.206 1.00 34.63 ? 176  GLN B CG  1 
ATOM   5519 C CD  . GLN B 1 176 ? 11.420  6.544   -47.792 1.00 33.68 ? 176  GLN B CD  1 
ATOM   5520 O OE1 . GLN B 1 176 ? 11.608  7.674   -47.329 1.00 32.33 ? 176  GLN B OE1 1 
ATOM   5521 N NE2 . GLN B 1 176 ? 11.603  5.418   -47.080 1.00 31.69 ? 176  GLN B NE2 1 
ATOM   5522 N N   . ARG B 1 177 ? 12.262  9.497   -52.307 1.00 36.00 ? 177  ARG B N   1 
ATOM   5523 C CA  . ARG B 1 177 ? 12.484  10.814  -52.900 1.00 36.28 ? 177  ARG B CA  1 
ATOM   5524 C C   . ARG B 1 177 ? 11.917  10.901  -54.314 1.00 36.54 ? 177  ARG B C   1 
ATOM   5525 O O   . ARG B 1 177 ? 11.289  11.894  -54.681 1.00 36.99 ? 177  ARG B O   1 
ATOM   5526 C CB  . ARG B 1 177 ? 13.976  11.178  -52.916 1.00 36.27 ? 177  ARG B CB  1 
ATOM   5527 C CG  . ARG B 1 177 ? 14.255  12.493  -53.621 1.00 38.10 ? 177  ARG B CG  1 
ATOM   5528 C CD  . ARG B 1 177 ? 15.695  12.862  -53.633 1.00 41.93 ? 177  ARG B CD  1 
ATOM   5529 N NE  . ARG B 1 177 ? 16.096  13.321  -52.311 1.00 48.15 ? 177  ARG B NE  1 
ATOM   5530 C CZ  . ARG B 1 177 ? 17.323  13.197  -51.820 1.00 49.40 ? 177  ARG B CZ  1 
ATOM   5531 N NH1 . ARG B 1 177 ? 18.275  12.637  -52.572 1.00 50.26 ? 177  ARG B NH1 1 
ATOM   5532 N NH2 . ARG B 1 177 ? 17.591  13.631  -50.591 1.00 46.86 ? 177  ARG B NH2 1 
ATOM   5533 N N   . LEU B 1 178 ? 12.160  9.879   -55.129 1.00 36.72 ? 178  LEU B N   1 
ATOM   5534 C CA  . LEU B 1 178 ? 11.575  9.843   -56.475 1.00 36.78 ? 178  LEU B CA  1 
ATOM   5535 C C   . LEU B 1 178 ? 10.030  9.908   -56.424 1.00 37.04 ? 178  LEU B C   1 
ATOM   5536 O O   . LEU B 1 178 ? 9.422   10.614  -57.222 1.00 37.41 ? 178  LEU B O   1 
ATOM   5537 C CB  . LEU B 1 178 ? 12.039  8.614   -57.260 1.00 35.90 ? 178  LEU B CB  1 
ATOM   5538 C CG  . LEU B 1 178 ? 11.640  8.483   -58.737 1.00 34.95 ? 178  LEU B CG  1 
ATOM   5539 C CD1 . LEU B 1 178 ? 12.037  9.702   -59.557 1.00 29.79 ? 178  LEU B CD1 1 
ATOM   5540 C CD2 . LEU B 1 178 ? 12.274  7.236   -59.278 1.00 31.75 ? 178  LEU B CD2 1 
ATOM   5541 N N   . ALA B 1 179 ? 9.407   9.201   -55.487 1.00 37.26 ? 179  ALA B N   1 
ATOM   5542 C CA  . ALA B 1 179 ? 7.950   9.280   -55.351 1.00 37.74 ? 179  ALA B CA  1 
ATOM   5543 C C   . ALA B 1 179 ? 7.499   10.696  -54.955 1.00 38.38 ? 179  ALA B C   1 
ATOM   5544 O O   . ALA B 1 179 ? 6.478   11.181  -55.440 1.00 38.54 ? 179  ALA B O   1 
ATOM   5545 C CB  . ALA B 1 179 ? 7.442   8.257   -54.377 1.00 37.51 ? 179  ALA B CB  1 
ATOM   5546 N N   . LEU B 1 180 ? 8.288   11.369  -54.120 1.00 38.88 ? 180  LEU B N   1 
ATOM   5547 C CA  . LEU B 1 180 ? 8.068   12.782  -53.801 1.00 39.56 ? 180  LEU B CA  1 
ATOM   5548 C C   . LEU B 1 180 ? 8.223   13.716  -55.008 1.00 40.79 ? 180  LEU B C   1 
ATOM   5549 O O   . LEU B 1 180 ? 7.425   14.657  -55.171 1.00 40.85 ? 180  LEU B O   1 
ATOM   5550 C CB  . LEU B 1 180 ? 8.986   13.228  -52.659 1.00 39.24 ? 180  LEU B CB  1 
ATOM   5551 C CG  . LEU B 1 180 ? 8.605   13.035  -51.189 1.00 38.66 ? 180  LEU B CG  1 
ATOM   5552 C CD1 . LEU B 1 180 ? 7.754   11.787  -50.905 1.00 38.03 ? 180  LEU B CD1 1 
ATOM   5553 C CD2 . LEU B 1 180 ? 9.875   13.041  -50.321 1.00 39.60 ? 180  LEU B CD2 1 
ATOM   5554 N N   . GLN B 1 181 ? 9.252   13.484  -55.838 1.00 41.97 ? 181  GLN B N   1 
ATOM   5555 C CA  . GLN B 1 181 ? 9.395   14.216  -57.112 1.00 43.11 ? 181  GLN B CA  1 
ATOM   5556 C C   . GLN B 1 181 ? 8.154   13.977  -57.975 1.00 42.43 ? 181  GLN B C   1 
ATOM   5557 O O   . GLN B 1 181 ? 7.610   14.919  -58.589 1.00 42.00 ? 181  GLN B O   1 
ATOM   5558 C CB  . GLN B 1 181 ? 10.648  13.786  -57.889 1.00 43.67 ? 181  GLN B CB  1 
ATOM   5559 C CG  . GLN B 1 181 ? 11.774  14.842  -57.974 1.00 49.65 ? 181  GLN B CG  1 
ATOM   5560 C CD  . GLN B 1 181 ? 13.199  14.271  -57.595 1.00 56.81 ? 181  GLN B CD  1 
ATOM   5561 O OE1 . GLN B 1 181 ? 13.531  13.104  -57.881 1.00 59.13 ? 181  GLN B OE1 1 
ATOM   5562 N NE2 . GLN B 1 181 ? 14.026  15.109  -56.944 1.00 58.43 ? 181  GLN B NE2 1 
ATOM   5563 N N   . TRP B 1 182 ? 7.704   12.720  -57.999 1.00 41.16 ? 182  TRP B N   1 
ATOM   5564 C CA  . TRP B 1 182 ? 6.578   12.353  -58.824 1.00 40.92 ? 182  TRP B CA  1 
ATOM   5565 C C   . TRP B 1 182 ? 5.366   13.206  -58.442 1.00 41.19 ? 182  TRP B C   1 
ATOM   5566 O O   . TRP B 1 182 ? 4.646   13.682  -59.321 1.00 41.32 ? 182  TRP B O   1 
ATOM   5567 C CB  . TRP B 1 182 ? 6.277   10.862  -58.723 1.00 40.23 ? 182  TRP B CB  1 
ATOM   5568 C CG  . TRP B 1 182 ? 5.166   10.406  -59.658 1.00 40.88 ? 182  TRP B CG  1 
ATOM   5569 C CD1 . TRP B 1 182 ? 5.313   9.891   -60.920 1.00 39.27 ? 182  TRP B CD1 1 
ATOM   5570 C CD2 . TRP B 1 182 ? 3.747   10.422  -59.395 1.00 40.01 ? 182  TRP B CD2 1 
ATOM   5571 N NE1 . TRP B 1 182 ? 4.080   9.595   -61.455 1.00 39.16 ? 182  TRP B NE1 1 
ATOM   5572 C CE2 . TRP B 1 182 ? 3.104   9.902   -60.550 1.00 39.57 ? 182  TRP B CE2 1 
ATOM   5573 C CE3 . TRP B 1 182 ? 2.960   10.839  -58.306 1.00 39.47 ? 182  TRP B CE3 1 
ATOM   5574 C CZ2 . TRP B 1 182 ? 1.705   9.791   -60.653 1.00 39.71 ? 182  TRP B CZ2 1 
ATOM   5575 C CZ3 . TRP B 1 182 ? 1.560   10.725  -58.406 1.00 39.30 ? 182  TRP B CZ3 1 
ATOM   5576 C CH2 . TRP B 1 182 ? 0.953   10.200  -59.575 1.00 39.56 ? 182  TRP B CH2 1 
ATOM   5577 N N   . VAL B 1 183 ? 5.186   13.415  -57.138 1.00 41.07 ? 183  VAL B N   1 
ATOM   5578 C CA  . VAL B 1 183 ? 4.123   14.242  -56.590 1.00 41.56 ? 183  VAL B CA  1 
ATOM   5579 C C   . VAL B 1 183 ? 4.246   15.735  -56.997 1.00 42.26 ? 183  VAL B C   1 
ATOM   5580 O O   . VAL B 1 183 ? 3.261   16.330  -57.414 1.00 42.42 ? 183  VAL B O   1 
ATOM   5581 C CB  . VAL B 1 183 ? 4.042   14.075  -55.047 1.00 41.70 ? 183  VAL B CB  1 
ATOM   5582 C CG1 . VAL B 1 183 ? 2.970   14.983  -54.421 1.00 40.68 ? 183  VAL B CG1 1 
ATOM   5583 C CG2 . VAL B 1 183 ? 3.803   12.621  -54.675 1.00 40.79 ? 183  VAL B CG2 1 
ATOM   5584 N N   . GLN B 1 184 ? 5.431   16.335  -56.901 1.00 42.75 ? 184  GLN B N   1 
ATOM   5585 C CA  . GLN B 1 184 ? 5.608   17.715  -57.401 1.00 43.26 ? 184  GLN B CA  1 
ATOM   5586 C C   . GLN B 1 184 ? 5.104   17.832  -58.826 1.00 44.15 ? 184  GLN B C   1 
ATOM   5587 O O   . GLN B 1 184 ? 4.461   18.820  -59.179 1.00 44.26 ? 184  GLN B O   1 
ATOM   5588 C CB  . GLN B 1 184 ? 7.073   18.212  -57.348 1.00 42.89 ? 184  GLN B CB  1 
ATOM   5589 C CG  . GLN B 1 184 ? 7.595   18.593  -55.967 1.00 42.63 ? 184  GLN B CG  1 
ATOM   5590 C CD  . GLN B 1 184 ? 6.580   19.393  -55.161 1.00 44.16 ? 184  GLN B CD  1 
ATOM   5591 O OE1 . GLN B 1 184 ? 6.288   20.542  -55.487 1.00 45.64 ? 184  GLN B OE1 1 
ATOM   5592 N NE2 . GLN B 1 184 ? 6.030   18.784  -54.103 1.00 41.76 ? 184  GLN B NE2 1 
ATOM   5593 N N   . GLU B 1 185 ? 5.398   16.826  -59.645 1.00 45.06 ? 185  GLU B N   1 
ATOM   5594 C CA  . GLU B 1 185 ? 5.147   16.921  -61.085 1.00 46.41 ? 185  GLU B CA  1 
ATOM   5595 C C   . GLU B 1 185 ? 3.728   16.514  -61.491 1.00 45.53 ? 185  GLU B C   1 
ATOM   5596 O O   . GLU B 1 185 ? 3.287   16.848  -62.565 1.00 45.48 ? 185  GLU B O   1 
ATOM   5597 C CB  . GLU B 1 185 ? 6.144   16.061  -61.867 1.00 46.40 ? 185  GLU B CB  1 
ATOM   5598 C CG  . GLU B 1 185 ? 7.625   16.459  -61.719 1.00 49.70 ? 185  GLU B CG  1 
ATOM   5599 C CD  . GLU B 1 185 ? 8.572   15.487  -62.439 1.00 49.99 ? 185  GLU B CD  1 
ATOM   5600 O OE1 . GLU B 1 185 ? 8.417   15.295  -63.672 1.00 56.17 ? 185  GLU B OE1 1 
ATOM   5601 O OE2 . GLU B 1 185 ? 9.475   14.918  -61.776 1.00 54.53 ? 185  GLU B OE2 1 
ATOM   5602 N N   . ASN B 1 186 ? 3.013   15.792  -60.646 1.00 45.32 ? 186  ASN B N   1 
ATOM   5603 C CA  . ASN B 1 186 ? 1.808   15.122  -61.102 1.00 45.29 ? 186  ASN B CA  1 
ATOM   5604 C C   . ASN B 1 186 ? 0.583   15.276  -60.221 1.00 45.43 ? 186  ASN B C   1 
ATOM   5605 O O   . ASN B 1 186 ? -0.536  14.968  -60.658 1.00 45.93 ? 186  ASN B O   1 
ATOM   5606 C CB  . ASN B 1 186 ? 2.091   13.628  -61.314 1.00 45.16 ? 186  ASN B CB  1 
ATOM   5607 C CG  . ASN B 1 186 ? 3.039   13.392  -62.454 1.00 46.02 ? 186  ASN B CG  1 
ATOM   5608 O OD1 . ASN B 1 186 ? 2.718   13.710  -63.605 1.00 45.75 ? 186  ASN B OD1 1 
ATOM   5609 N ND2 . ASN B 1 186 ? 4.231   12.865  -62.148 1.00 44.32 ? 186  ASN B ND2 1 
ATOM   5610 N N   . ILE B 1 187 ? 0.774   15.710  -58.980 1.00 44.84 ? 187  ILE B N   1 
ATOM   5611 C CA  . ILE B 1 187 ? -0.339  15.692  -58.065 1.00 44.63 ? 187  ILE B CA  1 
ATOM   5612 C C   . ILE B 1 187 ? -1.414  16.725  -58.469 1.00 45.14 ? 187  ILE B C   1 
ATOM   5613 O O   . ILE B 1 187 ? -2.597  16.464  -58.281 1.00 44.54 ? 187  ILE B O   1 
ATOM   5614 C CB  . ILE B 1 187 ? 0.103   15.790  -56.589 1.00 44.29 ? 187  ILE B CB  1 
ATOM   5615 C CG1 . ILE B 1 187 ? -0.870  15.033  -55.687 1.00 43.05 ? 187  ILE B CG1 1 
ATOM   5616 C CG2 . ILE B 1 187 ? 0.247   17.242  -56.142 1.00 44.18 ? 187  ILE B CG2 1 
ATOM   5617 C CD1 . ILE B 1 187 ? -0.859  13.537  -55.905 1.00 41.25 ? 187  ILE B CD1 1 
ATOM   5618 N N   . ALA B 1 188 ? -1.000  17.859  -59.056 1.00 45.71 ? 188  ALA B N   1 
ATOM   5619 C CA  . ALA B 1 188 ? -1.944  18.873  -59.576 1.00 46.30 ? 188  ALA B CA  1 
ATOM   5620 C C   . ALA B 1 188 ? -3.044  18.249  -60.457 1.00 46.82 ? 188  ALA B C   1 
ATOM   5621 O O   . ALA B 1 188 ? -4.212  18.615  -60.344 1.00 47.29 ? 188  ALA B O   1 
ATOM   5622 C CB  . ALA B 1 188 ? -1.211  19.987  -60.324 1.00 45.52 ? 188  ALA B CB  1 
ATOM   5623 N N   . ALA B 1 189 ? -2.670  17.267  -61.280 1.00 47.14 ? 189  ALA B N   1 
ATOM   5624 C CA  . ALA B 1 189 ? -3.609  16.553  -62.144 1.00 47.35 ? 189  ALA B CA  1 
ATOM   5625 C C   . ALA B 1 189 ? -4.699  15.813  -61.372 1.00 47.79 ? 189  ALA B C   1 
ATOM   5626 O O   . ALA B 1 189 ? -5.722  15.442  -61.953 1.00 48.09 ? 189  ALA B O   1 
ATOM   5627 C CB  . ALA B 1 189 ? -2.864  15.592  -63.051 1.00 46.91 ? 189  ALA B CB  1 
ATOM   5628 N N   . PHE B 1 190 ? -4.473  15.574  -60.082 1.00 47.88 ? 190  PHE B N   1 
ATOM   5629 C CA  . PHE B 1 190 ? -5.446  14.889  -59.245 1.00 48.02 ? 190  PHE B CA  1 
ATOM   5630 C C   . PHE B 1 190 ? -6.118  15.908  -58.341 1.00 48.66 ? 190  PHE B C   1 
ATOM   5631 O O   . PHE B 1 190 ? -7.005  15.562  -57.529 1.00 48.67 ? 190  PHE B O   1 
ATOM   5632 C CB  . PHE B 1 190 ? -4.767  13.844  -58.365 1.00 47.62 ? 190  PHE B CB  1 
ATOM   5633 C CG  . PHE B 1 190 ? -4.113  12.731  -59.115 1.00 47.76 ? 190  PHE B CG  1 
ATOM   5634 C CD1 . PHE B 1 190 ? -2.825  12.882  -59.631 1.00 47.22 ? 190  PHE B CD1 1 
ATOM   5635 C CD2 . PHE B 1 190 ? -4.757  11.502  -59.268 1.00 48.15 ? 190  PHE B CD2 1 
ATOM   5636 C CE1 . PHE B 1 190 ? -2.196  11.843  -60.308 1.00 44.67 ? 190  PHE B CE1 1 
ATOM   5637 C CE2 . PHE B 1 190 ? -4.130  10.456  -59.956 1.00 46.72 ? 190  PHE B CE2 1 
ATOM   5638 C CZ  . PHE B 1 190 ? -2.842  10.643  -60.469 1.00 45.54 ? 190  PHE B CZ  1 
ATOM   5639 N N   . GLY B 1 191 ? -5.674  17.160  -58.469 1.00 49.32 ? 191  GLY B N   1 
ATOM   5640 C CA  . GLY B 1 191 ? -6.210  18.274  -57.681 1.00 49.97 ? 191  GLY B CA  1 
ATOM   5641 C C   . GLY B 1 191 ? -5.548  18.423  -56.324 1.00 50.43 ? 191  GLY B C   1 
ATOM   5642 O O   . GLY B 1 191 ? -6.101  19.055  -55.410 1.00 51.42 ? 191  GLY B O   1 
ATOM   5643 N N   . GLY B 1 192 ? -4.373  17.822  -56.172 1.00 50.17 ? 192  GLY B N   1 
ATOM   5644 C CA  . GLY B 1 192 ? -3.527  18.089  -55.013 1.00 49.25 ? 192  GLY B CA  1 
ATOM   5645 C C   . GLY B 1 192 ? -2.742  19.365  -55.255 1.00 48.58 ? 192  GLY B C   1 
ATOM   5646 O O   . GLY B 1 192 ? -2.565  19.791  -56.391 1.00 48.29 ? 192  GLY B O   1 
ATOM   5647 N N   . ASP B 1 193 ? -2.278  19.975  -54.171 1.00 48.41 ? 193  ASP B N   1 
ATOM   5648 C CA  . ASP B 1 193 ? -1.485  21.196  -54.236 1.00 48.25 ? 193  ASP B CA  1 
ATOM   5649 C C   . ASP B 1 193 ? -0.018  20.810  -54.046 1.00 48.08 ? 193  ASP B C   1 
ATOM   5650 O O   . ASP B 1 193 ? 0.381   20.478  -52.936 1.00 48.15 ? 193  ASP B O   1 
ATOM   5651 C CB  . ASP B 1 193 ? -1.928  22.134  -53.112 1.00 47.76 ? 193  ASP B CB  1 
ATOM   5652 C CG  . ASP B 1 193 ? -1.323  23.535  -53.213 1.00 47.67 ? 193  ASP B CG  1 
ATOM   5653 O OD1 . ASP B 1 193 ? -0.458  23.806  -54.075 1.00 45.20 ? 193  ASP B OD1 1 
ATOM   5654 O OD2 . ASP B 1 193 ? -1.744  24.386  -52.399 1.00 49.33 ? 193  ASP B OD2 1 
ATOM   5655 N N   . PRO B 1 194 ? 0.796   20.866  -55.115 1.00 47.94 ? 194  PRO B N   1 
ATOM   5656 C CA  . PRO B 1 194 ? 2.180   20.441  -54.886 1.00 48.00 ? 194  PRO B CA  1 
ATOM   5657 C C   . PRO B 1 194 ? 2.863   21.441  -53.986 1.00 48.45 ? 194  PRO B C   1 
ATOM   5658 O O   . PRO B 1 194 ? 3.974   21.200  -53.542 1.00 48.99 ? 194  PRO B O   1 
ATOM   5659 C CB  . PRO B 1 194 ? 2.814   20.474  -56.284 1.00 47.59 ? 194  PRO B CB  1 
ATOM   5660 C CG  . PRO B 1 194 ? 1.969   21.400  -57.070 1.00 47.36 ? 194  PRO B CG  1 
ATOM   5661 C CD  . PRO B 1 194 ? 0.567   21.318  -56.501 1.00 47.62 ? 194  PRO B CD  1 
ATOM   5662 N N   . MET B 1 195 ? 2.199   22.560  -53.710 1.00 48.53 ? 195  MET B N   1 
ATOM   5663 C CA  . MET B 1 195 ? 2.802   23.571  -52.850 1.00 49.54 ? 195  MET B CA  1 
ATOM   5664 C C   . MET B 1 195 ? 2.531   23.444  -51.366 1.00 47.64 ? 195  MET B C   1 
ATOM   5665 O O   . MET B 1 195 ? 3.133   24.163  -50.543 1.00 47.56 ? 195  MET B O   1 
ATOM   5666 C CB  . MET B 1 195 ? 2.532   24.979  -53.349 1.00 49.34 ? 195  MET B CB  1 
ATOM   5667 C CG  . MET B 1 195 ? 3.739   25.493  -54.099 1.00 51.19 ? 195  MET B CG  1 
ATOM   5668 S SD  . MET B 1 195 ? 3.382   27.044  -54.858 1.00 54.60 ? 195  MET B SD  1 
ATOM   5669 C CE  . MET B 1 195 ? 1.756   26.760  -55.631 1.00 55.24 ? 195  MET B CE  1 
ATOM   5670 N N   . SER B 1 196 ? 1.687   22.474  -51.041 1.00 45.64 ? 196  SER B N   1 
ATOM   5671 C CA  . SER B 1 196 ? 1.393   22.128  -49.673 1.00 44.10 ? 196  SER B CA  1 
ATOM   5672 C C   . SER B 1 196 ? 1.405   20.611  -49.558 1.00 42.76 ? 196  SER B C   1 
ATOM   5673 O O   . SER B 1 196 ? 0.363   19.944  -49.685 1.00 42.63 ? 196  SER B O   1 
ATOM   5674 C CB  . SER B 1 196 ? 0.036   22.699  -49.264 1.00 44.17 ? 196  SER B CB  1 
ATOM   5675 O OG  . SER B 1 196 ? -0.337  22.221  -47.991 1.00 44.89 ? 196  SER B OG  1 
ATOM   5676 N N   . VAL B 1 197 ? 2.606   20.092  -49.331 1.00 40.98 ? 197  VAL B N   1 
ATOM   5677 C CA  . VAL B 1 197 ? 2.887   18.668  -49.196 1.00 39.11 ? 197  VAL B CA  1 
ATOM   5678 C C   . VAL B 1 197 ? 3.402   18.391  -47.787 1.00 37.97 ? 197  VAL B C   1 
ATOM   5679 O O   . VAL B 1 197 ? 4.355   19.014  -47.337 1.00 38.43 ? 197  VAL B O   1 
ATOM   5680 C CB  . VAL B 1 197 ? 3.970   18.219  -50.221 1.00 39.03 ? 197  VAL B CB  1 
ATOM   5681 C CG1 . VAL B 1 197 ? 4.350   16.774  -49.986 1.00 38.89 ? 197  VAL B CG1 1 
ATOM   5682 C CG2 . VAL B 1 197 ? 3.498   18.440  -51.653 1.00 37.56 ? 197  VAL B CG2 1 
ATOM   5683 N N   . THR B 1 198 ? 2.779   17.442  -47.111 1.00 36.75 ? 198  THR B N   1 
ATOM   5684 C CA  . THR B 1 198 ? 3.106   17.076  -45.740 1.00 35.68 ? 198  THR B CA  1 
ATOM   5685 C C   . THR B 1 198 ? 3.486   15.600  -45.705 1.00 35.99 ? 198  THR B C   1 
ATOM   5686 O O   . THR B 1 198 ? 2.719   14.729  -46.155 1.00 36.19 ? 198  THR B O   1 
ATOM   5687 C CB  . THR B 1 198 ? 1.885   17.312  -44.811 1.00 35.34 ? 198  THR B CB  1 
ATOM   5688 O OG1 . THR B 1 198 ? 1.503   18.689  -44.896 1.00 34.96 ? 198  THR B OG1 1 
ATOM   5689 C CG2 . THR B 1 198 ? 2.208   16.959  -43.379 1.00 33.10 ? 198  THR B CG2 1 
ATOM   5690 N N   . LEU B 1 199 ? 4.681   15.311  -45.203 1.00 35.56 ? 199  LEU B N   1 
ATOM   5691 C CA  . LEU B 1 199 ? 5.085   13.924  -45.088 1.00 35.24 ? 199  LEU B CA  1 
ATOM   5692 C C   . LEU B 1 199 ? 4.588   13.406  -43.766 1.00 35.26 ? 199  LEU B C   1 
ATOM   5693 O O   . LEU B 1 199 ? 4.641   14.135  -42.764 1.00 37.31 ? 199  LEU B O   1 
ATOM   5694 C CB  . LEU B 1 199 ? 6.617   13.785  -45.166 1.00 34.87 ? 199  LEU B CB  1 
ATOM   5695 C CG  . LEU B 1 199 ? 7.333   14.360  -46.396 1.00 33.81 ? 199  LEU B CG  1 
ATOM   5696 C CD1 . LEU B 1 199 ? 8.819   14.004  -46.384 1.00 30.46 ? 199  LEU B CD1 1 
ATOM   5697 C CD2 . LEU B 1 199 ? 6.664   13.951  -47.726 1.00 33.60 ? 199  LEU B CD2 1 
ATOM   5698 N N   . PHE B 1 200 ? 4.115   12.168  -43.728 1.00 33.82 ? 200  PHE B N   1 
ATOM   5699 C CA  . PHE B 1 200 ? 3.942   11.512  -42.445 1.00 32.74 ? 200  PHE B CA  1 
ATOM   5700 C C   . PHE B 1 200 ? 4.320   10.072  -42.512 1.00 32.05 ? 200  PHE B C   1 
ATOM   5701 O O   . PHE B 1 200 ? 4.224   9.449   -43.558 1.00 32.50 ? 200  PHE B O   1 
ATOM   5702 C CB  . PHE B 1 200 ? 2.557   11.756  -41.791 1.00 32.68 ? 200  PHE B CB  1 
ATOM   5703 C CG  . PHE B 1 200 ? 1.364   11.107  -42.487 1.00 33.28 ? 200  PHE B CG  1 
ATOM   5704 C CD1 . PHE B 1 200 ? 1.160   11.211  -43.864 1.00 31.29 ? 200  PHE B CD1 1 
ATOM   5705 C CD2 . PHE B 1 200 ? 0.368   10.479  -41.707 1.00 35.13 ? 200  PHE B CD2 1 
ATOM   5706 C CE1 . PHE B 1 200 ? 0.023   10.670  -44.458 1.00 31.52 ? 200  PHE B CE1 1 
ATOM   5707 C CE2 . PHE B 1 200 ? -0.778  9.931   -42.289 1.00 33.00 ? 200  PHE B CE2 1 
ATOM   5708 C CZ  . PHE B 1 200 ? -0.954  10.032  -43.674 1.00 32.61 ? 200  PHE B CZ  1 
ATOM   5709 N N   . GLY B 1 201 ? 4.787   9.545   -41.399 1.00 31.28 ? 201  GLY B N   1 
ATOM   5710 C CA  . GLY B 1 201 ? 5.350   8.221   -41.408 1.00 32.05 ? 201  GLY B CA  1 
ATOM   5711 C C   . GLY B 1 201 ? 5.419   7.727   -39.999 1.00 32.57 ? 201  GLY B C   1 
ATOM   5712 O O   . GLY B 1 201 ? 5.379   8.518   -39.060 1.00 31.83 ? 201  GLY B O   1 
ATOM   5713 N N   . GLU B 1 202 ? 5.519   6.416   -39.844 1.00 33.91 ? 202  GLU B N   1 
ATOM   5714 C CA  . GLU B 1 202 ? 5.586   5.839   -38.513 1.00 35.39 ? 202  GLU B CA  1 
ATOM   5715 C C   . GLU B 1 202 ? 6.759   4.881   -38.401 1.00 36.14 ? 202  GLU B C   1 
ATOM   5716 O O   . GLU B 1 202 ? 7.107   4.214   -39.362 1.00 36.55 ? 202  GLU B O   1 
ATOM   5717 C CB  . GLU B 1 202 ? 4.258   5.171   -38.155 1.00 34.49 ? 202  GLU B CB  1 
ATOM   5718 C CG  . GLU B 1 202 ? 4.147   4.727   -36.728 1.00 35.38 ? 202  GLU B CG  1 
ATOM   5719 C CD  . GLU B 1 202 ? 4.573   3.280   -36.568 1.00 39.10 ? 202  GLU B CD  1 
ATOM   5720 O OE1 . GLU B 1 202 ? 4.665   2.580   -37.606 1.00 40.41 ? 202  GLU B OE1 1 
ATOM   5721 O OE2 . GLU B 1 202 ? 4.826   2.841   -35.422 1.00 38.11 ? 202  GLU B OE2 1 
ATOM   5722 N N   . SER B 1 203 ? 7.357   4.820   -37.211 1.00 37.83 ? 203  SER B N   1 
ATOM   5723 C CA  . SER B 1 203 ? 8.564   3.997   -36.936 1.00 38.78 ? 203  SER B CA  1 
ATOM   5724 C C   . SER B 1 203 ? 9.692   4.237   -38.001 1.00 38.32 ? 203  SER B C   1 
ATOM   5725 O O   . SER B 1 203 ? 10.156  5.379   -38.156 1.00 37.26 ? 203  SER B O   1 
ATOM   5726 C CB  . SER B 1 203 ? 8.136   2.532   -36.791 1.00 39.56 ? 203  SER B CB  1 
ATOM   5727 O OG  . SER B 1 203 ? 9.220   1.692   -36.431 1.00 43.41 ? 203  SER B OG  1 
ATOM   5728 N N   . ALA B 1 204 ? 10.097  3.206   -38.763 1.00 37.91 ? 204  ALA B N   1 
ATOM   5729 C CA  . ALA B 1 204 ? 11.136  3.418   -39.794 1.00 37.43 ? 204  ALA B CA  1 
ATOM   5730 C C   . ALA B 1 204 ? 10.672  4.461   -40.828 1.00 37.25 ? 204  ALA B C   1 
ATOM   5731 O O   . ALA B 1 204 ? 11.497  5.178   -41.435 1.00 37.32 ? 204  ALA B O   1 
ATOM   5732 C CB  . ALA B 1 204 ? 11.503  2.143   -40.466 1.00 37.15 ? 204  ALA B CB  1 
ATOM   5733 N N   . GLY B 1 205 ? 9.353   4.549   -41.012 1.00 35.54 ? 205  GLY B N   1 
ATOM   5734 C CA  . GLY B 1 205 ? 8.768   5.606   -41.833 1.00 34.68 ? 205  GLY B CA  1 
ATOM   5735 C C   . GLY B 1 205 ? 9.002   6.999   -41.246 1.00 33.61 ? 205  GLY B C   1 
ATOM   5736 O O   . GLY B 1 205 ? 9.346   7.935   -41.981 1.00 33.63 ? 205  GLY B O   1 
ATOM   5737 N N   . ALA B 1 206 ? 8.839   7.129   -39.930 1.00 32.10 ? 206  ALA B N   1 
ATOM   5738 C CA  . ALA B 1 206 ? 9.143   8.373   -39.254 1.00 31.23 ? 206  ALA B CA  1 
ATOM   5739 C C   . ALA B 1 206 ? 10.640  8.727   -39.428 1.00 31.07 ? 206  ALA B C   1 
ATOM   5740 O O   . ALA B 1 206 ? 10.945  9.838   -39.891 1.00 31.20 ? 206  ALA B O   1 
ATOM   5741 C CB  . ALA B 1 206 ? 8.728   8.318   -37.788 1.00 30.82 ? 206  ALA B CB  1 
ATOM   5742 N N   . ALA B 1 207 ? 11.550  7.790   -39.129 1.00 30.25 ? 207  ALA B N   1 
ATOM   5743 C CA  . ALA B 1 207 ? 12.978  7.944   -39.481 1.00 30.69 ? 207  ALA B CA  1 
ATOM   5744 C C   . ALA B 1 207 ? 13.222  8.407   -40.923 1.00 30.99 ? 207  ALA B C   1 
ATOM   5745 O O   . ALA B 1 207 ? 14.069  9.291   -41.171 1.00 30.60 ? 207  ALA B O   1 
ATOM   5746 C CB  . ALA B 1 207 ? 13.744  6.647   -39.231 1.00 30.16 ? 207  ALA B CB  1 
ATOM   5747 N N   . SER B 1 208 ? 12.496  7.804   -41.874 1.00 31.35 ? 208  SER B N   1 
ATOM   5748 C CA  . SER B 1 208 ? 12.609  8.217   -43.267 1.00 32.40 ? 208  SER B CA  1 
ATOM   5749 C C   . SER B 1 208 ? 12.156  9.644   -43.403 1.00 32.70 ? 208  SER B C   1 
ATOM   5750 O O   . SER B 1 208 ? 12.793  10.424  -44.065 1.00 32.72 ? 208  SER B O   1 
ATOM   5751 C CB  . SER B 1 208 ? 11.778  7.347   -44.187 1.00 32.17 ? 208  SER B CB  1 
ATOM   5752 O OG  . SER B 1 208 ? 12.135  5.998   -44.034 1.00 35.15 ? 208  SER B OG  1 
ATOM   5753 N N   . VAL B 1 209 ? 11.046  9.998   -42.771 1.00 33.41 ? 209  VAL B N   1 
ATOM   5754 C CA  . VAL B 1 209 ? 10.608  11.387  -42.851 1.00 34.14 ? 209  VAL B CA  1 
ATOM   5755 C C   . VAL B 1 209 ? 11.757  12.278  -42.346 1.00 34.61 ? 209  VAL B C   1 
ATOM   5756 O O   . VAL B 1 209 ? 12.128  13.225  -43.010 1.00 35.05 ? 209  VAL B O   1 
ATOM   5757 C CB  . VAL B 1 209 ? 9.294   11.655  -42.062 1.00 33.65 ? 209  VAL B CB  1 
ATOM   5758 C CG1 . VAL B 1 209 ? 8.988   13.114  -42.089 1.00 32.40 ? 209  VAL B CG1 1 
ATOM   5759 C CG2 . VAL B 1 209 ? 8.146   10.856  -42.654 1.00 32.65 ? 209  VAL B CG2 1 
ATOM   5760 N N   . GLY B 1 210 ? 12.324  11.939  -41.192 1.00 35.05 ? 210  GLY B N   1 
ATOM   5761 C CA  . GLY B 1 210 ? 13.407  12.695  -40.601 1.00 36.92 ? 210  GLY B CA  1 
ATOM   5762 C C   . GLY B 1 210 ? 14.607  12.821  -41.519 1.00 38.63 ? 210  GLY B C   1 
ATOM   5763 O O   . GLY B 1 210 ? 15.254  13.884  -41.586 1.00 39.37 ? 210  GLY B O   1 
ATOM   5764 N N   . MET B 1 211 ? 14.914  11.765  -42.263 1.00 39.25 ? 211  MET B N   1 
ATOM   5765 C CA  . MET B 1 211 ? 15.997  11.910  -43.226 1.00 40.47 ? 211  MET B CA  1 
ATOM   5766 C C   . MET B 1 211 ? 15.703  12.838  -44.404 1.00 39.68 ? 211  MET B C   1 
ATOM   5767 O O   . MET B 1 211 ? 16.618  13.526  -44.875 1.00 40.09 ? 211  MET B O   1 
ATOM   5768 C CB  . MET B 1 211 ? 16.575  10.571  -43.620 1.00 40.19 ? 211  MET B CB  1 
ATOM   5769 C CG  . MET B 1 211 ? 17.349  10.023  -42.457 1.00 41.14 ? 211  MET B CG  1 
ATOM   5770 S SD  . MET B 1 211 ? 17.386  8.265   -42.557 1.00 44.64 ? 211  MET B SD  1 
ATOM   5771 C CE  . MET B 1 211 ? 17.683  7.829   -40.859 1.00 42.27 ? 211  MET B CE  1 
ATOM   5772 N N   . HIS B 1 212 ? 14.454  12.907  -44.872 1.00 38.88 ? 212  HIS B N   1 
ATOM   5773 C CA  . HIS B 1 212 ? 14.171  13.889  -45.925 1.00 38.62 ? 212  HIS B CA  1 
ATOM   5774 C C   . HIS B 1 212 ? 14.319  15.288  -45.374 1.00 39.01 ? 212  HIS B C   1 
ATOM   5775 O O   . HIS B 1 212 ? 14.701  16.203  -46.091 1.00 38.54 ? 212  HIS B O   1 
ATOM   5776 C CB  . HIS B 1 212 ? 12.817  13.691  -46.580 1.00 37.86 ? 212  HIS B CB  1 
ATOM   5777 C CG  . HIS B 1 212 ? 12.690  12.379  -47.268 1.00 37.29 ? 212  HIS B CG  1 
ATOM   5778 N ND1 . HIS B 1 212 ? 13.367  12.088  -48.432 1.00 36.43 ? 212  HIS B ND1 1 
ATOM   5779 C CD2 . HIS B 1 212 ? 11.990  11.266  -46.941 1.00 35.46 ? 212  HIS B CD2 1 
ATOM   5780 C CE1 . HIS B 1 212 ? 13.092  10.846  -48.790 1.00 37.25 ? 212  HIS B CE1 1 
ATOM   5781 N NE2 . HIS B 1 212 ? 12.256  10.327  -47.904 1.00 36.33 ? 212  HIS B NE2 1 
ATOM   5782 N N   . ILE B 1 213 ? 14.040  15.440  -44.082 1.00 39.60 ? 213  ILE B N   1 
ATOM   5783 C CA  . ILE B 1 213 ? 14.297  16.703  -43.409 1.00 40.15 ? 213  ILE B CA  1 
ATOM   5784 C C   . ILE B 1 213 ? 15.782  17.075  -43.454 1.00 40.52 ? 213  ILE B C   1 
ATOM   5785 O O   . ILE B 1 213 ? 16.138  18.237  -43.684 1.00 41.58 ? 213  ILE B O   1 
ATOM   5786 C CB  . ILE B 1 213 ? 13.782  16.708  -41.950 1.00 40.02 ? 213  ILE B CB  1 
ATOM   5787 C CG1 . ILE B 1 213 ? 12.255  16.847  -41.942 1.00 38.21 ? 213  ILE B CG1 1 
ATOM   5788 C CG2 . ILE B 1 213 ? 14.439  17.849  -41.165 1.00 38.79 ? 213  ILE B CG2 1 
ATOM   5789 C CD1 . ILE B 1 213 ? 11.619  16.643  -40.589 1.00 37.96 ? 213  ILE B CD1 1 
ATOM   5790 N N   . LEU B 1 214 ? 16.638  16.085  -43.268 1.00 40.54 ? 214  LEU B N   1 
ATOM   5791 C CA  . LEU B 1 214 ? 18.052  16.326  -43.114 1.00 40.38 ? 214  LEU B CA  1 
ATOM   5792 C C   . LEU B 1 214 ? 18.798  16.155  -44.409 1.00 41.35 ? 214  LEU B C   1 
ATOM   5793 O O   . LEU B 1 214 ? 20.030  16.199  -44.410 1.00 41.68 ? 214  LEU B O   1 
ATOM   5794 C CB  . LEU B 1 214 ? 18.636  15.352  -42.091 1.00 40.27 ? 214  LEU B CB  1 
ATOM   5795 C CG  . LEU B 1 214 ? 18.132  15.422  -40.658 1.00 39.17 ? 214  LEU B CG  1 
ATOM   5796 C CD1 . LEU B 1 214 ? 18.654  14.235  -39.888 1.00 37.77 ? 214  LEU B CD1 1 
ATOM   5797 C CD2 . LEU B 1 214 ? 18.541  16.751  -40.015 1.00 36.56 ? 214  LEU B CD2 1 
ATOM   5798 N N   . SER B 1 215 ? 18.079  15.918  -45.506 1.00 42.42 ? 215  SER B N   1 
ATOM   5799 C CA  . SER B 1 215 ? 18.732  15.756  -46.797 1.00 43.43 ? 215  SER B CA  1 
ATOM   5800 C C   . SER B 1 215 ? 18.274  16.817  -47.757 1.00 44.48 ? 215  SER B C   1 
ATOM   5801 O O   . SER B 1 215 ? 17.112  16.866  -48.147 1.00 45.15 ? 215  SER B O   1 
ATOM   5802 C CB  . SER B 1 215 ? 18.514  14.370  -47.370 1.00 43.68 ? 215  SER B CB  1 
ATOM   5803 O OG  . SER B 1 215 ? 19.411  14.136  -48.446 1.00 43.74 ? 215  SER B OG  1 
ATOM   5804 N N   . LEU B 1 216 ? 19.211  17.680  -48.133 1.00 45.66 ? 216  LEU B N   1 
ATOM   5805 C CA  . LEU B 1 216 ? 18.895  18.938  -48.791 1.00 46.00 ? 216  LEU B CA  1 
ATOM   5806 C C   . LEU B 1 216 ? 18.045  18.752  -50.052 1.00 45.19 ? 216  LEU B C   1 
ATOM   5807 O O   . LEU B 1 216 ? 17.046  19.444  -50.215 1.00 45.23 ? 216  LEU B O   1 
ATOM   5808 C CB  . LEU B 1 216 ? 20.189  19.696  -49.093 1.00 46.89 ? 216  LEU B CB  1 
ATOM   5809 C CG  . LEU B 1 216 ? 20.189  21.206  -48.794 1.00 51.07 ? 216  LEU B CG  1 
ATOM   5810 C CD1 . LEU B 1 216 ? 21.525  21.608  -48.064 1.00 52.04 ? 216  LEU B CD1 1 
ATOM   5811 C CD2 . LEU B 1 216 ? 19.859  22.104  -50.060 1.00 51.08 ? 216  LEU B CD2 1 
ATOM   5812 N N   . PRO B 1 217 ? 18.438  17.823  -50.949 1.00 44.34 ? 217  PRO B N   1 
ATOM   5813 C CA  . PRO B 1 217 ? 17.628  17.640  -52.155 1.00 43.70 ? 217  PRO B CA  1 
ATOM   5814 C C   . PRO B 1 217 ? 16.162  17.222  -51.922 1.00 43.43 ? 217  PRO B C   1 
ATOM   5815 O O   . PRO B 1 217 ? 15.353  17.387  -52.834 1.00 43.60 ? 217  PRO B O   1 
ATOM   5816 C CB  . PRO B 1 217 ? 18.393  16.561  -52.934 1.00 43.69 ? 217  PRO B CB  1 
ATOM   5817 C CG  . PRO B 1 217 ? 19.818  16.676  -52.418 1.00 43.40 ? 217  PRO B CG  1 
ATOM   5818 C CD  . PRO B 1 217 ? 19.631  16.948  -50.965 1.00 43.98 ? 217  PRO B CD  1 
ATOM   5819 N N   . SER B 1 218 ? 15.816  16.708  -50.737 1.00 42.75 ? 218  SER B N   1 
ATOM   5820 C CA  . SER B 1 218 ? 14.416  16.347  -50.426 1.00 41.92 ? 218  SER B CA  1 
ATOM   5821 C C   . SER B 1 218 ? 13.607  17.544  -49.985 1.00 42.33 ? 218  SER B C   1 
ATOM   5822 O O   . SER B 1 218 ? 12.401  17.588  -50.201 1.00 41.66 ? 218  SER B O   1 
ATOM   5823 C CB  . SER B 1 218 ? 14.321  15.278  -49.337 1.00 41.68 ? 218  SER B CB  1 
ATOM   5824 O OG  . SER B 1 218 ? 14.687  13.986  -49.787 1.00 39.51 ? 218  SER B OG  1 
ATOM   5825 N N   . ARG B 1 219 ? 14.293  18.518  -49.379 1.00 43.58 ? 219  ARG B N   1 
ATOM   5826 C CA  . ARG B 1 219 ? 13.666  19.695  -48.747 1.00 44.19 ? 219  ARG B CA  1 
ATOM   5827 C C   . ARG B 1 219 ? 12.760  20.504  -49.648 1.00 44.04 ? 219  ARG B C   1 
ATOM   5828 O O   . ARG B 1 219 ? 11.757  21.035  -49.193 1.00 44.53 ? 219  ARG B O   1 
ATOM   5829 C CB  . ARG B 1 219 ? 14.708  20.611  -48.104 1.00 44.35 ? 219  ARG B CB  1 
ATOM   5830 C CG  . ARG B 1 219 ? 15.327  20.049  -46.834 1.00 46.49 ? 219  ARG B CG  1 
ATOM   5831 C CD  . ARG B 1 219 ? 14.281  19.875  -45.744 1.00 51.51 ? 219  ARG B CD  1 
ATOM   5832 N NE  . ARG B 1 219 ? 13.857  21.155  -45.181 1.00 54.70 ? 219  ARG B NE  1 
ATOM   5833 C CZ  . ARG B 1 219 ? 14.550  21.825  -44.261 1.00 57.11 ? 219  ARG B CZ  1 
ATOM   5834 N NH1 . ARG B 1 219 ? 15.698  21.333  -43.787 1.00 56.19 ? 219  ARG B NH1 1 
ATOM   5835 N NH2 . ARG B 1 219 ? 14.090  22.986  -43.801 1.00 58.91 ? 219  ARG B NH2 1 
ATOM   5836 N N   . SER B 1 220 ? 13.098  20.587  -50.922 1.00 43.93 ? 220  SER B N   1 
ATOM   5837 C CA  . SER B 1 220 ? 12.246  21.285  -51.873 1.00 43.78 ? 220  SER B CA  1 
ATOM   5838 C C   . SER B 1 220 ? 10.980  20.498  -52.261 1.00 43.26 ? 220  SER B C   1 
ATOM   5839 O O   . SER B 1 220 ? 10.181  20.975  -53.050 1.00 43.38 ? 220  SER B O   1 
ATOM   5840 C CB  . SER B 1 220 ? 13.059  21.626  -53.124 1.00 43.96 ? 220  SER B CB  1 
ATOM   5841 O OG  . SER B 1 220 ? 13.640  20.443  -53.654 1.00 44.88 ? 220  SER B OG  1 
ATOM   5842 N N   . LEU B 1 221 ? 10.790  19.301  -51.711 1.00 42.72 ? 221  LEU B N   1 
ATOM   5843 C CA  . LEU B 1 221 ? 9.706   18.420  -52.149 1.00 41.25 ? 221  LEU B CA  1 
ATOM   5844 C C   . LEU B 1 221 ? 8.564   18.294  -51.145 1.00 41.09 ? 221  LEU B C   1 
ATOM   5845 O O   . LEU B 1 221 ? 7.548   17.665  -51.441 1.00 41.39 ? 221  LEU B O   1 
ATOM   5846 C CB  . LEU B 1 221 ? 10.267  17.035  -52.505 1.00 41.31 ? 221  LEU B CB  1 
ATOM   5847 C CG  . LEU B 1 221 ? 11.450  16.969  -53.489 1.00 40.35 ? 221  LEU B CG  1 
ATOM   5848 C CD1 . LEU B 1 221 ? 11.934  15.527  -53.651 1.00 40.81 ? 221  LEU B CD1 1 
ATOM   5849 C CD2 . LEU B 1 221 ? 11.084  17.532  -54.845 1.00 38.03 ? 221  LEU B CD2 1 
ATOM   5850 N N   . PHE B 1 222 ? 8.721   18.868  -49.954 1.00 40.62 ? 222  PHE B N   1 
ATOM   5851 C CA  . PHE B 1 222 ? 7.617   18.925  -48.974 1.00 40.49 ? 222  PHE B CA  1 
ATOM   5852 C C   . PHE B 1 222 ? 7.719   20.203  -48.156 1.00 40.36 ? 222  PHE B C   1 
ATOM   5853 O O   . PHE B 1 222 ? 8.693   20.933  -48.286 1.00 40.46 ? 222  PHE B O   1 
ATOM   5854 C CB  . PHE B 1 222 ? 7.586   17.677  -48.060 1.00 40.08 ? 222  PHE B CB  1 
ATOM   5855 C CG  . PHE B 1 222 ? 8.808   17.520  -47.208 1.00 38.90 ? 222  PHE B CG  1 
ATOM   5856 C CD1 . PHE B 1 222 ? 9.988   17.000  -47.743 1.00 37.53 ? 222  PHE B CD1 1 
ATOM   5857 C CD2 . PHE B 1 222 ? 8.789   17.905  -45.868 1.00 39.23 ? 222  PHE B CD2 1 
ATOM   5858 C CE1 . PHE B 1 222 ? 11.141  16.866  -46.959 1.00 36.90 ? 222  PHE B CE1 1 
ATOM   5859 C CE2 . PHE B 1 222 ? 9.937   17.786  -45.070 1.00 38.15 ? 222  PHE B CE2 1 
ATOM   5860 C CZ  . PHE B 1 222 ? 11.123  17.250  -45.628 1.00 38.22 ? 222  PHE B CZ  1 
ATOM   5861 N N   . HIS B 1 223 ? 6.731   20.463  -47.302 1.00 40.15 ? 223  HIS B N   1 
ATOM   5862 C CA  . HIS B 1 223 ? 6.695   21.725  -46.550 1.00 40.18 ? 223  HIS B CA  1 
ATOM   5863 C C   . HIS B 1 223 ? 6.544   21.510  -45.063 1.00 40.41 ? 223  HIS B C   1 
ATOM   5864 O O   . HIS B 1 223 ? 6.748   22.440  -44.287 1.00 41.09 ? 223  HIS B O   1 
ATOM   5865 C CB  . HIS B 1 223 ? 5.593   22.615  -47.102 1.00 39.87 ? 223  HIS B CB  1 
ATOM   5866 C CG  . HIS B 1 223 ? 5.571   22.619  -48.597 1.00 40.81 ? 223  HIS B CG  1 
ATOM   5867 N ND1 . HIS B 1 223 ? 6.428   23.395  -49.349 1.00 40.05 ? 223  HIS B ND1 1 
ATOM   5868 C CD2 . HIS B 1 223 ? 4.890   21.851  -49.478 1.00 40.10 ? 223  HIS B CD2 1 
ATOM   5869 C CE1 . HIS B 1 223 ? 6.234   23.148  -50.631 1.00 40.83 ? 223  HIS B CE1 1 
ATOM   5870 N NE2 . HIS B 1 223 ? 5.308   22.211  -50.736 1.00 41.15 ? 223  HIS B NE2 1 
ATOM   5871 N N   . ARG B 1 224 ? 6.230   20.273  -44.668 1.00 39.60 ? 224  ARG B N   1 
ATOM   5872 C CA  . ARG B 1 224 ? 5.938   19.948  -43.275 1.00 39.63 ? 224  ARG B CA  1 
ATOM   5873 C C   . ARG B 1 224 ? 6.120   18.442  -43.053 1.00 38.39 ? 224  ARG B C   1 
ATOM   5874 O O   . ARG B 1 224 ? 6.039   17.655  -44.002 1.00 38.36 ? 224  ARG B O   1 
ATOM   5875 C CB  . ARG B 1 224 ? 4.487   20.333  -42.931 1.00 39.84 ? 224  ARG B CB  1 
ATOM   5876 C CG  . ARG B 1 224 ? 4.262   21.797  -42.694 1.00 41.01 ? 224  ARG B CG  1 
ATOM   5877 C CD  . ARG B 1 224 ? 2.799   22.129  -42.472 1.00 41.64 ? 224  ARG B CD  1 
ATOM   5878 N NE  . ARG B 1 224 ? 2.027   22.181  -43.706 1.00 46.96 ? 224  ARG B NE  1 
ATOM   5879 C CZ  . ARG B 1 224 ? 2.176   23.087  -44.673 1.00 48.58 ? 224  ARG B CZ  1 
ATOM   5880 N NH1 . ARG B 1 224 ? 3.106   24.042  -44.591 1.00 47.32 ? 224  ARG B NH1 1 
ATOM   5881 N NH2 . ARG B 1 224 ? 1.407   23.007  -45.758 1.00 50.20 ? 224  ARG B NH2 1 
ATOM   5882 N N   . ALA B 1 225 ? 6.311   18.043  -41.799 1.00 36.46 ? 225  ALA B N   1 
ATOM   5883 C CA  . ALA B 1 225 ? 6.616   16.670  -41.513 1.00 35.24 ? 225  ALA B CA  1 
ATOM   5884 C C   . ALA B 1 225 ? 5.942   16.216  -40.245 1.00 34.50 ? 225  ALA B C   1 
ATOM   5885 O O   . ALA B 1 225 ? 5.780   17.009  -39.321 1.00 33.81 ? 225  ALA B O   1 
ATOM   5886 C CB  . ALA B 1 225 ? 8.138   16.490  -41.407 1.00 35.41 ? 225  ALA B CB  1 
ATOM   5887 N N   . VAL B 1 226 ? 5.548   14.937  -40.221 1.00 33.73 ? 226  VAL B N   1 
ATOM   5888 C CA  . VAL B 1 226 ? 4.986   14.292  -39.040 1.00 33.04 ? 226  VAL B CA  1 
ATOM   5889 C C   . VAL B 1 226 ? 5.776   13.005  -38.817 1.00 33.76 ? 226  VAL B C   1 
ATOM   5890 O O   . VAL B 1 226 ? 5.818   12.141  -39.686 1.00 33.48 ? 226  VAL B O   1 
ATOM   5891 C CB  . VAL B 1 226 ? 3.481   13.900  -39.221 1.00 32.75 ? 226  VAL B CB  1 
ATOM   5892 C CG1 . VAL B 1 226 ? 2.949   13.190  -37.976 1.00 30.89 ? 226  VAL B CG1 1 
ATOM   5893 C CG2 . VAL B 1 226 ? 2.612   15.089  -39.606 1.00 31.14 ? 226  VAL B CG2 1 
ATOM   5894 N N   . LEU B 1 227 ? 6.378   12.884  -37.643 1.00 34.40 ? 227  LEU B N   1 
ATOM   5895 C CA  . LEU B 1 227 ? 7.211   11.739  -37.284 1.00 35.15 ? 227  LEU B CA  1 
ATOM   5896 C C   . LEU B 1 227 ? 6.525   10.970  -36.153 1.00 35.25 ? 227  LEU B C   1 
ATOM   5897 O O   . LEU B 1 227 ? 6.475   11.439  -35.013 1.00 36.33 ? 227  LEU B O   1 
ATOM   5898 C CB  . LEU B 1 227 ? 8.612   12.211  -36.849 1.00 34.33 ? 227  LEU B CB  1 
ATOM   5899 C CG  . LEU B 1 227 ? 9.531   12.672  -37.991 1.00 36.61 ? 227  LEU B CG  1 
ATOM   5900 C CD1 . LEU B 1 227 ? 9.295   14.123  -38.384 1.00 37.57 ? 227  LEU B CD1 1 
ATOM   5901 C CD2 . LEU B 1 227 ? 11.011  12.453  -37.651 1.00 37.51 ? 227  LEU B CD2 1 
ATOM   5902 N N   . GLN B 1 228 ? 5.960   9.815   -36.458 1.00 35.10 ? 228  GLN B N   1 
ATOM   5903 C CA  . GLN B 1 228 ? 5.256   9.064   -35.429 1.00 35.46 ? 228  GLN B CA  1 
ATOM   5904 C C   . GLN B 1 228 ? 6.181   7.979   -34.945 1.00 35.64 ? 228  GLN B C   1 
ATOM   5905 O O   . GLN B 1 228 ? 6.609   7.135   -35.722 1.00 35.87 ? 228  GLN B O   1 
ATOM   5906 C CB  . GLN B 1 228 ? 3.947   8.465   -35.954 1.00 35.39 ? 228  GLN B CB  1 
ATOM   5907 C CG  . GLN B 1 228 ? 3.035   9.460   -36.701 1.00 34.42 ? 228  GLN B CG  1 
ATOM   5908 C CD  . GLN B 1 228 ? 1.723   8.822   -37.219 1.00 36.51 ? 228  GLN B CD  1 
ATOM   5909 O OE1 . GLN B 1 228 ? 1.018   9.417   -38.049 1.00 36.15 ? 228  GLN B OE1 1 
ATOM   5910 N NE2 . GLN B 1 228 ? 1.384   7.618   -36.712 1.00 35.33 ? 228  GLN B NE2 1 
ATOM   5911 N N   . SER B 1 229 ? 6.531   8.030   -33.666 1.00 35.42 ? 229  SER B N   1 
ATOM   5912 C CA  . SER B 1 229 ? 7.340   6.994   -33.050 1.00 35.74 ? 229  SER B CA  1 
ATOM   5913 C C   . SER B 1 229 ? 8.645   6.628   -33.754 1.00 35.60 ? 229  SER B C   1 
ATOM   5914 O O   . SER B 1 229 ? 9.041   5.489   -33.726 1.00 35.43 ? 229  SER B O   1 
ATOM   5915 C CB  . SER B 1 229 ? 6.513   5.716   -32.860 1.00 36.27 ? 229  SER B CB  1 
ATOM   5916 O OG  . SER B 1 229 ? 5.501   5.923   -31.901 1.00 36.35 ? 229  SER B OG  1 
ATOM   5917 N N   . GLY B 1 230 ? 9.332   7.584   -34.351 1.00 36.03 ? 230  GLY B N   1 
ATOM   5918 C CA  . GLY B 1 230 ? 10.640  7.293   -34.928 1.00 36.69 ? 230  GLY B CA  1 
ATOM   5919 C C   . GLY B 1 230 ? 11.361  8.579   -35.271 1.00 37.32 ? 230  GLY B C   1 
ATOM   5920 O O   . GLY B 1 230 ? 10.742  9.660   -35.380 1.00 37.97 ? 230  GLY B O   1 
ATOM   5921 N N   . THR B 1 231 ? 12.676  8.464   -35.428 1.00 37.03 ? 231  THR B N   1 
ATOM   5922 C CA  . THR B 1 231 ? 13.551  9.602   -35.640 1.00 36.71 ? 231  THR B CA  1 
ATOM   5923 C C   . THR B 1 231 ? 14.747  9.184   -36.469 1.00 36.34 ? 231  THR B C   1 
ATOM   5924 O O   . THR B 1 231 ? 15.112  8.011   -36.473 1.00 36.47 ? 231  THR B O   1 
ATOM   5925 C CB  . THR B 1 231 ? 14.085  10.145  -34.290 1.00 37.30 ? 231  THR B CB  1 
ATOM   5926 O OG1 . THR B 1 231 ? 14.806  9.105   -33.617 1.00 38.32 ? 231  THR B OG1 1 
ATOM   5927 C CG2 . THR B 1 231 ? 12.942  10.661  -33.402 1.00 34.22 ? 231  THR B CG2 1 
ATOM   5928 N N   . PRO B 1 232 ? 15.366  10.134  -37.179 1.00 36.14 ? 232  PRO B N   1 
ATOM   5929 C CA  . PRO B 1 232 ? 16.587  9.776   -37.885 1.00 36.15 ? 232  PRO B CA  1 
ATOM   5930 C C   . PRO B 1 232 ? 17.768  9.548   -36.939 1.00 37.25 ? 232  PRO B C   1 
ATOM   5931 O O   . PRO B 1 232 ? 18.627  8.714   -37.224 1.00 38.33 ? 232  PRO B O   1 
ATOM   5932 C CB  . PRO B 1 232 ? 16.838  10.965  -38.786 1.00 35.89 ? 232  PRO B CB  1 
ATOM   5933 C CG  . PRO B 1 232 ? 16.035  12.076  -38.252 1.00 35.42 ? 232  PRO B CG  1 
ATOM   5934 C CD  . PRO B 1 232 ? 14.985  11.542  -37.373 1.00 35.72 ? 232  PRO B CD  1 
ATOM   5935 N N   . ASN B 1 233 ? 17.814  10.281  -35.828 1.00 37.70 ? 233  ASN B N   1 
ATOM   5936 C CA  . ASN B 1 233 ? 18.846  10.093  -34.809 1.00 37.50 ? 233  ASN B CA  1 
ATOM   5937 C C   . ASN B 1 233 ? 18.537  8.872   -33.970 1.00 37.95 ? 233  ASN B C   1 
ATOM   5938 O O   . ASN B 1 233 ? 17.443  8.319   -34.047 1.00 37.89 ? 233  ASN B O   1 
ATOM   5939 C CB  . ASN B 1 233 ? 18.926  11.304  -33.889 1.00 36.49 ? 233  ASN B CB  1 
ATOM   5940 C CG  . ASN B 1 233 ? 17.581  11.699  -33.330 1.00 36.61 ? 233  ASN B CG  1 
ATOM   5941 O OD1 . ASN B 1 233 ? 16.687  12.104  -34.066 1.00 38.67 ? 233  ASN B OD1 1 
ATOM   5942 N ND2 . ASN B 1 233 ? 17.429  11.600  -32.025 1.00 36.49 ? 233  ASN B ND2 1 
ATOM   5943 N N   . GLY B 1 234 ? 19.491  8.473   -33.142 1.00 38.37 ? 234  GLY B N   1 
ATOM   5944 C CA  . GLY B 1 234 ? 19.288  7.333   -32.252 1.00 38.89 ? 234  GLY B CA  1 
ATOM   5945 C C   . GLY B 1 234 ? 19.900  6.019   -32.715 1.00 39.28 ? 234  GLY B C   1 
ATOM   5946 O O   . GLY B 1 234 ? 20.471  5.922   -33.810 1.00 38.59 ? 234  GLY B O   1 
ATOM   5947 N N   . PRO B 1 235 ? 19.761  4.988   -31.881 1.00 39.87 ? 235  PRO B N   1 
ATOM   5948 C CA  . PRO B 1 235 ? 20.562  3.769   -31.989 1.00 40.34 ? 235  PRO B CA  1 
ATOM   5949 C C   . PRO B 1 235 ? 20.360  2.915   -33.237 1.00 40.71 ? 235  PRO B C   1 
ATOM   5950 O O   . PRO B 1 235 ? 21.327  2.270   -33.660 1.00 41.22 ? 235  PRO B O   1 
ATOM   5951 C CB  . PRO B 1 235 ? 20.167  2.975   -30.748 1.00 40.40 ? 235  PRO B CB  1 
ATOM   5952 C CG  . PRO B 1 235 ? 18.897  3.536   -30.286 1.00 39.67 ? 235  PRO B CG  1 
ATOM   5953 C CD  . PRO B 1 235 ? 18.830  4.954   -30.742 1.00 39.81 ? 235  PRO B CD  1 
ATOM   5954 N N   . TRP B 1 236 ? 19.157  2.920   -33.829 1.00 40.32 ? 236  TRP B N   1 
ATOM   5955 C CA  . TRP B 1 236 ? 18.756  1.886   -34.807 1.00 40.20 ? 236  TRP B CA  1 
ATOM   5956 C C   . TRP B 1 236 ? 18.627  2.331   -36.253 1.00 40.76 ? 236  TRP B C   1 
ATOM   5957 O O   . TRP B 1 236 ? 18.682  1.504   -37.165 1.00 41.39 ? 236  TRP B O   1 
ATOM   5958 C CB  . TRP B 1 236 ? 17.441  1.231   -34.398 1.00 40.01 ? 236  TRP B CB  1 
ATOM   5959 C CG  . TRP B 1 236 ? 16.334  2.203   -34.196 1.00 41.10 ? 236  TRP B CG  1 
ATOM   5960 C CD1 . TRP B 1 236 ? 16.011  2.831   -33.036 1.00 40.89 ? 236  TRP B CD1 1 
ATOM   5961 C CD2 . TRP B 1 236 ? 15.392  2.676   -35.186 1.00 43.46 ? 236  TRP B CD2 1 
ATOM   5962 N NE1 . TRP B 1 236 ? 14.923  3.662   -33.231 1.00 41.82 ? 236  TRP B NE1 1 
ATOM   5963 C CE2 . TRP B 1 236 ? 14.522  3.585   -34.534 1.00 41.98 ? 236  TRP B CE2 1 
ATOM   5964 C CE3 . TRP B 1 236 ? 15.196  2.413   -36.558 1.00 42.91 ? 236  TRP B CE3 1 
ATOM   5965 C CZ2 . TRP B 1 236 ? 13.484  4.243   -35.200 1.00 41.89 ? 236  TRP B CZ2 1 
ATOM   5966 C CZ3 . TRP B 1 236 ? 14.167  3.062   -37.221 1.00 41.31 ? 236  TRP B CZ3 1 
ATOM   5967 C CH2 . TRP B 1 236 ? 13.316  3.967   -36.538 1.00 41.44 ? 236  TRP B CH2 1 
ATOM   5968 N N   . ALA B 1 237 ? 18.458  3.624   -36.478 1.00 40.63 ? 237  ALA B N   1 
ATOM   5969 C CA  . ALA B 1 237 ? 18.032  4.087   -37.775 1.00 40.80 ? 237  ALA B CA  1 
ATOM   5970 C C   . ALA B 1 237 ? 19.141  4.242   -38.795 1.00 40.81 ? 237  ALA B C   1 
ATOM   5971 O O   . ALA B 1 237 ? 18.879  4.221   -39.991 1.00 41.49 ? 237  ALA B O   1 
ATOM   5972 C CB  . ALA B 1 237 ? 17.235  5.398   -37.635 1.00 41.51 ? 237  ALA B CB  1 
ATOM   5973 N N   . THR B 1 238 ? 20.365  4.481   -38.355 1.00 40.96 ? 238  THR B N   1 
ATOM   5974 C CA  . THR B 1 238 ? 21.476  4.587   -39.302 1.00 40.80 ? 238  THR B CA  1 
ATOM   5975 C C   . THR B 1 238 ? 22.563  3.653   -38.892 1.00 40.96 ? 238  THR B C   1 
ATOM   5976 O O   . THR B 1 238 ? 22.538  3.141   -37.770 1.00 40.84 ? 238  THR B O   1 
ATOM   5977 C CB  . THR B 1 238 ? 22.081  5.993   -39.383 1.00 40.74 ? 238  THR B CB  1 
ATOM   5978 O OG1 . THR B 1 238 ? 22.519  6.399   -38.085 1.00 40.50 ? 238  THR B OG1 1 
ATOM   5979 C CG2 . THR B 1 238 ? 21.075  6.980   -39.940 1.00 40.47 ? 238  THR B CG2 1 
ATOM   5980 N N   . VAL B 1 239 ? 23.499  3.416   -39.813 1.00 41.37 ? 239  VAL B N   1 
ATOM   5981 C CA  . VAL B 1 239 ? 24.768  2.740   -39.510 1.00 41.81 ? 239  VAL B CA  1 
ATOM   5982 C C   . VAL B 1 239 ? 25.856  3.518   -40.199 1.00 42.58 ? 239  VAL B C   1 
ATOM   5983 O O   . VAL B 1 239 ? 25.567  4.284   -41.130 1.00 43.38 ? 239  VAL B O   1 
ATOM   5984 C CB  . VAL B 1 239 ? 24.813  1.260   -39.977 1.00 41.76 ? 239  VAL B CB  1 
ATOM   5985 C CG1 . VAL B 1 239 ? 24.034  0.368   -39.013 1.00 42.00 ? 239  VAL B CG1 1 
ATOM   5986 C CG2 . VAL B 1 239 ? 24.307  1.103   -41.412 1.00 40.41 ? 239  VAL B CG2 1 
ATOM   5987 N N   . SER B 1 240 ? 27.100  3.345   -39.751 1.00 42.91 ? 240  SER B N   1 
ATOM   5988 C CA  . SER B 1 240 ? 28.237  3.997   -40.415 1.00 43.58 ? 240  SER B CA  1 
ATOM   5989 C C   . SER B 1 240 ? 28.543  3.296   -41.736 1.00 43.83 ? 240  SER B C   1 
ATOM   5990 O O   . SER B 1 240 ? 28.031  2.192   -41.998 1.00 43.17 ? 240  SER B O   1 
ATOM   5991 C CB  . SER B 1 240 ? 29.475  3.924   -39.523 1.00 43.96 ? 240  SER B CB  1 
ATOM   5992 O OG  . SER B 1 240 ? 29.786  2.568   -39.246 1.00 44.16 ? 240  SER B OG  1 
ATOM   5993 N N   . ALA B 1 241 ? 29.382  3.928   -42.562 1.00 44.42 ? 241  ALA B N   1 
ATOM   5994 C CA  . ALA B 1 241 ? 29.850  3.297   -43.796 1.00 44.61 ? 241  ALA B CA  1 
ATOM   5995 C C   . ALA B 1 241 ? 30.584  2.012   -43.428 1.00 45.34 ? 241  ALA B C   1 
ATOM   5996 O O   . ALA B 1 241 ? 30.268  0.930   -43.959 1.00 45.03 ? 241  ALA B O   1 
ATOM   5997 C CB  . ALA B 1 241 ? 30.723  4.224   -44.592 1.00 43.94 ? 241  ALA B CB  1 
ATOM   5998 N N   . GLY B 1 242 ? 31.523  2.119   -42.478 1.00 45.97 ? 242  GLY B N   1 
ATOM   5999 C CA  . GLY B 1 242 ? 32.297  0.959   -42.032 1.00 46.24 ? 242  GLY B CA  1 
ATOM   6000 C C   . GLY B 1 242 ? 31.409  -0.229  -41.711 1.00 46.71 ? 242  GLY B C   1 
ATOM   6001 O O   . GLY B 1 242 ? 31.648  -1.347  -42.157 1.00 47.44 ? 242  GLY B O   1 
ATOM   6002 N N   . GLU B 1 243 ? 30.363  0.018   -40.944 1.00 47.03 ? 243  GLU B N   1 
ATOM   6003 C CA  . GLU B 1 243 ? 29.500  -1.051  -40.478 1.00 47.16 ? 243  GLU B CA  1 
ATOM   6004 C C   . GLU B 1 243 ? 28.598  -1.570  -41.623 1.00 47.21 ? 243  GLU B C   1 
ATOM   6005 O O   . GLU B 1 243 ? 28.218  -2.746  -41.655 1.00 47.50 ? 243  GLU B O   1 
ATOM   6006 C CB  . GLU B 1 243 ? 28.705  -0.556  -39.257 1.00 46.73 ? 243  GLU B CB  1 
ATOM   6007 C CG  . GLU B 1 243 ? 27.647  -1.521  -38.716 1.00 48.05 ? 243  GLU B CG  1 
ATOM   6008 C CD  . GLU B 1 243 ? 28.230  -2.825  -38.191 1.00 49.71 ? 243  GLU B CD  1 
ATOM   6009 O OE1 . GLU B 1 243 ? 27.430  -3.666  -37.717 1.00 49.15 ? 243  GLU B OE1 1 
ATOM   6010 O OE2 . GLU B 1 243 ? 29.476  -3.018  -38.252 1.00 49.85 ? 243  GLU B OE2 1 
ATOM   6011 N N   . ALA B 1 244 ? 28.270  -0.700  -42.571 1.00 47.12 ? 244  ALA B N   1 
ATOM   6012 C CA  . ALA B 1 244 ? 27.433  -1.113  -43.704 1.00 47.52 ? 244  ALA B CA  1 
ATOM   6013 C C   . ALA B 1 244 ? 28.254  -2.016  -44.624 1.00 48.04 ? 244  ALA B C   1 
ATOM   6014 O O   . ALA B 1 244 ? 27.765  -3.031  -45.106 1.00 48.13 ? 244  ALA B O   1 
ATOM   6015 C CB  . ALA B 1 244 ? 26.865  0.099   -44.456 1.00 46.17 ? 244  ALA B CB  1 
ATOM   6016 N N   . ARG B 1 245 ? 29.523  -1.660  -44.818 1.00 49.01 ? 245  ARG B N   1 
ATOM   6017 C CA  . ARG B 1 245 ? 30.435  -2.463  -45.613 1.00 49.53 ? 245  ARG B CA  1 
ATOM   6018 C C   . ARG B 1 245 ? 30.576  -3.835  -44.989 1.00 49.88 ? 245  ARG B C   1 
ATOM   6019 O O   . ARG B 1 245 ? 30.631  -4.842  -45.689 1.00 50.37 ? 245  ARG B O   1 
ATOM   6020 C CB  . ARG B 1 245 ? 31.797  -1.786  -45.720 1.00 49.66 ? 245  ARG B CB  1 
ATOM   6021 C CG  . ARG B 1 245 ? 32.769  -2.492  -46.653 1.00 50.12 ? 245  ARG B CG  1 
ATOM   6022 C CD  . ARG B 1 245 ? 33.904  -1.580  -47.041 1.00 51.80 ? 245  ARG B CD  1 
ATOM   6023 N NE  . ARG B 1 245 ? 33.494  -0.574  -48.022 1.00 55.21 ? 245  ARG B NE  1 
ATOM   6024 C CZ  . ARG B 1 245 ? 33.394  -0.795  -49.338 1.00 56.29 ? 245  ARG B CZ  1 
ATOM   6025 N NH1 . ARG B 1 245 ? 33.016  0.178   -50.150 1.00 56.58 ? 245  ARG B NH1 1 
ATOM   6026 N NH2 . ARG B 1 245 ? 33.654  -1.989  -49.850 1.00 56.51 ? 245  ARG B NH2 1 
ATOM   6027 N N   . ARG B 1 246 ? 30.607  -3.854  -43.665 1.00 49.99 ? 246  ARG B N   1 
ATOM   6028 C CA  . ARG B 1 246 ? 30.868  -5.051  -42.916 1.00 50.45 ? 246  ARG B CA  1 
ATOM   6029 C C   . ARG B 1 246 ? 29.711  -6.021  -43.119 1.00 50.78 ? 246  ARG B C   1 
ATOM   6030 O O   . ARG B 1 246 ? 29.915  -7.186  -43.448 1.00 50.81 ? 246  ARG B O   1 
ATOM   6031 C CB  . ARG B 1 246 ? 30.991  -4.676  -41.446 1.00 50.62 ? 246  ARG B CB  1 
ATOM   6032 C CG  . ARG B 1 246 ? 31.849  -5.582  -40.591 1.00 50.00 ? 246  ARG B CG  1 
ATOM   6033 C CD  . ARG B 1 246 ? 31.322  -5.636  -39.149 1.00 46.87 ? 246  ARG B CD  1 
ATOM   6034 N NE  . ARG B 1 246 ? 30.598  -6.884  -39.018 1.00 47.93 ? 246  ARG B NE  1 
ATOM   6035 C CZ  . ARG B 1 246 ? 29.376  -7.027  -38.523 1.00 47.95 ? 246  ARG B CZ  1 
ATOM   6036 N NH1 . ARG B 1 246 ? 28.717  -5.983  -38.042 1.00 48.33 ? 246  ARG B NH1 1 
ATOM   6037 N NH2 . ARG B 1 246 ? 28.833  -8.238  -38.483 1.00 46.27 ? 246  ARG B NH2 1 
ATOM   6038 N N   . ARG B 1 247 ? 28.487  -5.530  -42.930 1.00 51.46 ? 247  ARG B N   1 
ATOM   6039 C CA  . ARG B 1 247 ? 27.301  -6.373  -43.081 1.00 51.27 ? 247  ARG B CA  1 
ATOM   6040 C C   . ARG B 1 247 ? 27.123  -6.801  -44.542 1.00 51.28 ? 247  ARG B C   1 
ATOM   6041 O O   . ARG B 1 247 ? 26.784  -7.960  -44.813 1.00 51.23 ? 247  ARG B O   1 
ATOM   6042 C CB  . ARG B 1 247 ? 26.047  -5.665  -42.552 1.00 51.44 ? 247  ARG B CB  1 
ATOM   6043 C CG  . ARG B 1 247 ? 26.188  -5.085  -41.155 1.00 50.38 ? 247  ARG B CG  1 
ATOM   6044 C CD  . ARG B 1 247 ? 24.856  -4.622  -40.622 1.00 47.35 ? 247  ARG B CD  1 
ATOM   6045 N NE  . ARG B 1 247 ? 25.000  -4.062  -39.282 1.00 49.10 ? 247  ARG B NE  1 
ATOM   6046 C CZ  . ARG B 1 247 ? 24.043  -3.432  -38.602 1.00 49.06 ? 247  ARG B CZ  1 
ATOM   6047 N NH1 . ARG B 1 247 ? 22.831  -3.283  -39.123 1.00 49.10 ? 247  ARG B NH1 1 
ATOM   6048 N NH2 . ARG B 1 247 ? 24.300  -2.953  -37.389 1.00 47.47 ? 247  ARG B NH2 1 
ATOM   6049 N N   . ALA B 1 248 ? 27.374  -5.882  -45.478 1.00 51.02 ? 248  ALA B N   1 
ATOM   6050 C CA  . ALA B 1 248 ? 27.225  -6.205  -46.896 1.00 51.15 ? 248  ALA B CA  1 
ATOM   6051 C C   . ALA B 1 248 ? 28.179  -7.331  -47.272 1.00 51.83 ? 248  ALA B C   1 
ATOM   6052 O O   . ALA B 1 248 ? 27.713  -8.385  -47.753 1.00 52.07 ? 248  ALA B O   1 
ATOM   6053 C CB  . ALA B 1 248 ? 27.429  -5.000  -47.764 1.00 50.65 ? 248  ALA B CB  1 
ATOM   6054 N N   . THR B 1 249 ? 29.489  -7.142  -46.999 1.00 51.78 ? 249  THR B N   1 
ATOM   6055 C CA  . THR B 1 249 ? 30.486  -8.185  -47.283 1.00 51.64 ? 249  THR B CA  1 
ATOM   6056 C C   . THR B 1 249 ? 30.154  -9.491  -46.543 1.00 52.00 ? 249  THR B C   1 
ATOM   6057 O O   . THR B 1 249 ? 30.320  -10.575 -47.090 1.00 52.65 ? 249  THR B O   1 
ATOM   6058 C CB  . THR B 1 249 ? 31.969  -7.780  -47.018 1.00 51.26 ? 249  THR B CB  1 
ATOM   6059 O OG1 . THR B 1 249 ? 32.213  -7.802  -45.627 1.00 53.09 ? 249  THR B OG1 1 
ATOM   6060 C CG2 . THR B 1 249 ? 32.340  -6.397  -47.567 1.00 50.13 ? 249  THR B CG2 1 
ATOM   6061 N N   . LEU B 1 250 ? 29.653  -9.407  -45.321 1.00 52.12 ? 250  LEU B N   1 
ATOM   6062 C CA  . LEU B 1 250 ? 29.283  -10.621 -44.617 1.00 52.62 ? 250  LEU B CA  1 
ATOM   6063 C C   . LEU B 1 250 ? 28.053  -11.298 -45.237 1.00 53.27 ? 250  LEU B C   1 
ATOM   6064 O O   . LEU B 1 250 ? 27.907  -12.527 -45.165 1.00 53.12 ? 250  LEU B O   1 
ATOM   6065 C CB  . LEU B 1 250 ? 29.100  -10.366 -43.107 1.00 52.47 ? 250  LEU B CB  1 
ATOM   6066 C CG  . LEU B 1 250 ? 28.588  -11.543 -42.251 1.00 52.84 ? 250  LEU B CG  1 
ATOM   6067 C CD1 . LEU B 1 250 ? 29.554  -12.757 -42.227 1.00 52.94 ? 250  LEU B CD1 1 
ATOM   6068 C CD2 . LEU B 1 250 ? 28.258  -11.108 -40.840 1.00 52.89 ? 250  LEU B CD2 1 
ATOM   6069 N N   . LEU B 1 251 ? 27.155  -10.522 -45.846 1.00 54.53 ? 251  LEU B N   1 
ATOM   6070 C CA  . LEU B 1 251 ? 25.962  -11.158 -46.438 1.00 55.27 ? 251  LEU B CA  1 
ATOM   6071 C C   . LEU B 1 251 ? 26.408  -11.884 -47.695 1.00 56.11 ? 251  LEU B C   1 
ATOM   6072 O O   . LEU B 1 251 ? 25.949  -13.000 -47.974 1.00 55.60 ? 251  LEU B O   1 
ATOM   6073 C CB  . LEU B 1 251 ? 24.829  -10.171 -46.753 1.00 54.88 ? 251  LEU B CB  1 
ATOM   6074 C CG  . LEU B 1 251 ? 23.677  -10.888 -47.471 1.00 53.45 ? 251  LEU B CG  1 
ATOM   6075 C CD1 . LEU B 1 251 ? 22.562  -11.279 -46.537 1.00 50.85 ? 251  LEU B CD1 1 
ATOM   6076 C CD2 . LEU B 1 251 ? 23.165  -10.075 -48.635 1.00 54.27 ? 251  LEU B CD2 1 
ATOM   6077 N N   . ALA B 1 252 ? 27.319  -11.235 -48.426 1.00 57.20 ? 252  ALA B N   1 
ATOM   6078 C CA  . ALA B 1 252 ? 27.956  -11.816 -49.605 1.00 58.39 ? 252  ALA B CA  1 
ATOM   6079 C C   . ALA B 1 252 ? 28.589  -13.171 -49.259 1.00 59.42 ? 252  ALA B C   1 
ATOM   6080 O O   . ALA B 1 252 ? 28.154  -14.204 -49.779 1.00 59.94 ? 252  ALA B O   1 
ATOM   6081 C CB  . ALA B 1 252 ? 28.982  -10.855 -50.182 1.00 57.74 ? 252  ALA B CB  1 
ATOM   6082 N N   . ARG B 1 253 ? 29.570  -13.172 -48.351 1.00 60.18 ? 253  ARG B N   1 
ATOM   6083 C CA  . ARG B 1 253 ? 30.207  -14.411 -47.911 1.00 61.26 ? 253  ARG B CA  1 
ATOM   6084 C C   . ARG B 1 253 ? 29.150  -15.464 -47.598 1.00 60.77 ? 253  ARG B C   1 
ATOM   6085 O O   . ARG B 1 253 ? 29.249  -16.589 -48.069 1.00 61.37 ? 253  ARG B O   1 
ATOM   6086 C CB  . ARG B 1 253 ? 31.140  -14.186 -46.707 1.00 61.16 ? 253  ARG B CB  1 
ATOM   6087 C CG  . ARG B 1 253 ? 32.216  -15.275 -46.545 1.00 63.42 ? 253  ARG B CG  1 
ATOM   6088 C CD  . ARG B 1 253 ? 32.823  -15.326 -45.128 1.00 63.79 ? 253  ARG B CD  1 
ATOM   6089 N NE  . ARG B 1 253 ? 31.953  -16.024 -44.171 1.00 68.14 ? 253  ARG B NE  1 
ATOM   6090 C CZ  . ARG B 1 253 ? 31.919  -15.808 -42.847 1.00 70.14 ? 253  ARG B CZ  1 
ATOM   6091 N NH1 . ARG B 1 253 ? 32.707  -14.892 -42.267 1.00 70.23 ? 253  ARG B NH1 1 
ATOM   6092 N NH2 . ARG B 1 253 ? 31.071  -16.508 -42.088 1.00 70.88 ? 253  ARG B NH2 1 
ATOM   6093 N N   . LEU B 1 254 ? 28.117  -15.100 -46.847 1.00 60.55 ? 254  LEU B N   1 
ATOM   6094 C CA  . LEU B 1 254 ? 27.098  -16.078 -46.449 1.00 60.40 ? 254  LEU B CA  1 
ATOM   6095 C C   . LEU B 1 254 ? 26.318  -16.708 -47.598 1.00 60.39 ? 254  LEU B C   1 
ATOM   6096 O O   . LEU B 1 254 ? 25.801  -17.806 -47.455 1.00 60.58 ? 254  LEU B O   1 
ATOM   6097 C CB  . LEU B 1 254 ? 26.125  -15.488 -45.420 1.00 60.30 ? 254  LEU B CB  1 
ATOM   6098 C CG  . LEU B 1 254 ? 26.516  -15.471 -43.944 1.00 60.42 ? 254  LEU B CG  1 
ATOM   6099 C CD1 . LEU B 1 254 ? 25.446  -14.744 -43.153 1.00 61.61 ? 254  LEU B CD1 1 
ATOM   6100 C CD2 . LEU B 1 254 ? 26.701  -16.881 -43.395 1.00 60.57 ? 254  LEU B CD2 1 
ATOM   6101 N N   . VAL B 1 255 ? 26.206  -16.021 -48.727 1.00 60.86 ? 255  VAL B N   1 
ATOM   6102 C CA  . VAL B 1 255 ? 25.444  -16.581 -49.866 1.00 61.31 ? 255  VAL B CA  1 
ATOM   6103 C C   . VAL B 1 255 ? 26.383  -17.005 -50.994 1.00 61.82 ? 255  VAL B C   1 
ATOM   6104 O O   . VAL B 1 255 ? 25.966  -17.145 -52.149 1.00 62.21 ? 255  VAL B O   1 
ATOM   6105 C CB  . VAL B 1 255 ? 24.291  -15.641 -50.392 1.00 61.19 ? 255  VAL B CB  1 
ATOM   6106 C CG1 . VAL B 1 255 ? 23.222  -15.470 -49.337 1.00 60.78 ? 255  VAL B CG1 1 
ATOM   6107 C CG2 . VAL B 1 255 ? 24.815  -14.280 -50.865 1.00 59.81 ? 255  VAL B CG2 1 
ATOM   6108 N N   . GLY B 1 256 ? 27.655  -17.175 -50.633 1.00 61.98 ? 256  GLY B N   1 
ATOM   6109 C CA  . GLY B 1 256 ? 28.681  -17.684 -51.517 1.00 61.73 ? 256  GLY B CA  1 
ATOM   6110 C C   . GLY B 1 256 ? 29.234  -16.665 -52.480 1.00 62.00 ? 256  GLY B C   1 
ATOM   6111 O O   . GLY B 1 256 ? 29.383  -16.975 -53.648 1.00 62.19 ? 256  GLY B O   1 
ATOM   6112 N N   . CYS B 1 257 ? 29.562  -15.459 -52.014 1.00 62.30 ? 257  CYS B N   1 
ATOM   6113 C CA  . CYS B 1 257 ? 30.217  -14.474 -52.887 1.00 62.72 ? 257  CYS B CA  1 
ATOM   6114 C C   . CYS B 1 257 ? 31.474  -13.856 -52.265 1.00 62.64 ? 257  CYS B C   1 
ATOM   6115 O O   . CYS B 1 257 ? 32.366  -13.397 -52.987 1.00 62.38 ? 257  CYS B O   1 
ATOM   6116 C CB  . CYS B 1 257 ? 29.227  -13.381 -53.342 1.00 62.90 ? 257  CYS B CB  1 
ATOM   6117 S SG  . CYS B 1 257 ? 27.712  -13.984 -54.238 1.00 64.53 ? 257  CYS B SG  1 
ATOM   6118 N N   . ASN B 1 265 ? 36.775  -7.267  -54.070 1.00 68.54 ? 265  ASN B N   1 
ATOM   6119 C CA  . ASN B 1 265 ? 36.491  -6.144  -54.986 1.00 68.96 ? 265  ASN B CA  1 
ATOM   6120 C C   . ASN B 1 265 ? 34.978  -5.819  -55.200 1.00 68.02 ? 265  ASN B C   1 
ATOM   6121 O O   . ASN B 1 265 ? 34.185  -6.707  -55.564 1.00 67.59 ? 265  ASN B O   1 
ATOM   6122 C CB  . ASN B 1 265 ? 37.189  -6.382  -56.331 1.00 69.36 ? 265  ASN B CB  1 
ATOM   6123 C CG  . ASN B 1 265 ? 36.732  -5.405  -57.412 1.00 71.63 ? 265  ASN B CG  1 
ATOM   6124 O OD1 . ASN B 1 265 ? 35.877  -5.738  -58.257 1.00 73.48 ? 265  ASN B OD1 1 
ATOM   6125 N ND2 . ASN B 1 265 ? 37.287  -4.186  -57.385 1.00 72.11 ? 265  ASN B ND2 1 
ATOM   6126 N N   . ASP B 1 266 ? 34.612  -4.544  -55.002 1.00 67.10 ? 266  ASP B N   1 
ATOM   6127 C CA  . ASP B 1 266 ? 33.198  -4.087  -54.989 1.00 65.97 ? 266  ASP B CA  1 
ATOM   6128 C C   . ASP B 1 266 ? 32.387  -4.533  -56.204 1.00 65.86 ? 266  ASP B C   1 
ATOM   6129 O O   . ASP B 1 266 ? 31.386  -5.240  -56.063 1.00 65.28 ? 266  ASP B O   1 
ATOM   6130 C CB  . ASP B 1 266 ? 33.098  -2.560  -54.812 1.00 65.57 ? 266  ASP B CB  1 
ATOM   6131 C CG  . ASP B 1 266 ? 33.253  -2.109  -53.344 1.00 64.39 ? 266  ASP B CG  1 
ATOM   6132 O OD1 . ASP B 1 266 ? 33.262  -2.966  -52.423 1.00 61.52 ? 266  ASP B OD1 1 
ATOM   6133 O OD2 . ASP B 1 266 ? 33.371  -0.882  -53.114 1.00 61.88 ? 266  ASP B OD2 1 
ATOM   6134 N N   . THR B 1 267 ? 32.843  -4.144  -57.393 1.00 65.86 ? 267  THR B N   1 
ATOM   6135 C CA  . THR B 1 267 ? 32.160  -4.500  -58.637 1.00 65.79 ? 267  THR B CA  1 
ATOM   6136 C C   . THR B 1 267 ? 31.876  -5.993  -58.765 1.00 65.85 ? 267  THR B C   1 
ATOM   6137 O O   . THR B 1 267 ? 30.757  -6.374  -59.115 1.00 65.75 ? 267  THR B O   1 
ATOM   6138 C CB  . THR B 1 267 ? 32.912  -3.982  -59.875 1.00 65.87 ? 267  THR B CB  1 
ATOM   6139 O OG1 . THR B 1 267 ? 33.335  -2.636  -59.643 1.00 65.15 ? 267  THR B OG1 1 
ATOM   6140 C CG2 . THR B 1 267 ? 32.005  -4.014  -61.121 1.00 66.20 ? 267  THR B CG2 1 
ATOM   6141 N N   . GLU B 1 268 ? 32.877  -6.823  -58.465 1.00 66.36 ? 268  GLU B N   1 
ATOM   6142 C CA  . GLU B 1 268 ? 32.757  -8.291  -58.557 1.00 67.18 ? 268  GLU B CA  1 
ATOM   6143 C C   . GLU B 1 268 ? 31.755  -8.823  -57.556 1.00 65.77 ? 268  GLU B C   1 
ATOM   6144 O O   . GLU B 1 268 ? 30.954  -9.695  -57.863 1.00 65.96 ? 268  GLU B O   1 
ATOM   6145 C CB  . GLU B 1 268 ? 34.109  -8.972  -58.300 1.00 67.13 ? 268  GLU B CB  1 
ATOM   6146 C CG  . GLU B 1 268 ? 35.085  -9.024  -59.499 1.00 70.10 ? 268  GLU B CG  1 
ATOM   6147 C CD  . GLU B 1 268 ? 36.542  -9.395  -59.077 1.00 70.82 ? 268  GLU B CD  1 
ATOM   6148 O OE1 . GLU B 1 268 ? 37.270  -8.507  -58.539 1.00 74.12 ? 268  GLU B OE1 1 
ATOM   6149 O OE2 . GLU B 1 268 ? 36.955  -10.571 -59.293 1.00 74.17 ? 268  GLU B OE2 1 
ATOM   6150 N N   . LEU B 1 269 ? 31.817  -8.290  -56.345 1.00 65.21 ? 269  LEU B N   1 
ATOM   6151 C CA  . LEU B 1 269 ? 30.981  -8.751  -55.243 1.00 64.50 ? 269  LEU B CA  1 
ATOM   6152 C C   . LEU B 1 269 ? 29.502  -8.461  -55.517 1.00 63.86 ? 269  LEU B C   1 
ATOM   6153 O O   . LEU B 1 269 ? 28.637  -9.316  -55.311 1.00 63.86 ? 269  LEU B O   1 
ATOM   6154 C CB  . LEU B 1 269 ? 31.433  -8.068  -53.952 1.00 64.89 ? 269  LEU B CB  1 
ATOM   6155 C CG  . LEU B 1 269 ? 31.056  -8.648  -52.590 1.00 65.46 ? 269  LEU B CG  1 
ATOM   6156 C CD1 . LEU B 1 269 ? 32.176  -8.336  -51.595 1.00 67.38 ? 269  LEU B CD1 1 
ATOM   6157 C CD2 . LEU B 1 269 ? 29.740  -8.077  -52.114 1.00 64.32 ? 269  LEU B CD2 1 
ATOM   6158 N N   . ILE B 1 270 ? 29.219  -7.253  -55.988 1.00 62.67 ? 270  ILE B N   1 
ATOM   6159 C CA  . ILE B 1 270 ? 27.864  -6.902  -56.334 1.00 61.82 ? 270  ILE B CA  1 
ATOM   6160 C C   . ILE B 1 270 ? 27.333  -7.733  -57.504 1.00 60.91 ? 270  ILE B C   1 
ATOM   6161 O O   . ILE B 1 270 ? 26.261  -8.332  -57.381 1.00 60.47 ? 270  ILE B O   1 
ATOM   6162 C CB  . ILE B 1 270 ? 27.709  -5.400  -56.529 1.00 62.05 ? 270  ILE B CB  1 
ATOM   6163 C CG1 . ILE B 1 270 ? 27.890  -4.734  -55.167 1.00 62.26 ? 270  ILE B CG1 1 
ATOM   6164 C CG2 . ILE B 1 270 ? 26.326  -5.076  -57.074 1.00 61.71 ? 270  ILE B CG2 1 
ATOM   6165 C CD1 . ILE B 1 270 ? 28.611  -3.422  -55.229 1.00 64.80 ? 270  ILE B CD1 1 
ATOM   6166 N N   . ALA B 1 271 ? 28.091  -7.808  -58.602 1.00 59.89 ? 271  ALA B N   1 
ATOM   6167 C CA  . ALA B 1 271 ? 27.706  -8.675  -59.725 1.00 58.82 ? 271  ALA B CA  1 
ATOM   6168 C C   . ALA B 1 271 ? 27.216  -10.017 -59.192 1.00 58.11 ? 271  ALA B C   1 
ATOM   6169 O O   . ALA B 1 271 ? 26.105  -10.438 -59.496 1.00 57.94 ? 271  ALA B O   1 
ATOM   6170 C CB  . ALA B 1 271 ? 28.844  -8.865  -60.687 1.00 58.34 ? 271  ALA B CB  1 
ATOM   6171 N N   . CYS B 1 272 ? 28.023  -10.658 -58.352 1.00 57.57 ? 272  CYS B N   1 
ATOM   6172 C CA  . CYS B 1 272 ? 27.640  -11.937 -57.784 1.00 56.64 ? 272  CYS B CA  1 
ATOM   6173 C C   . CYS B 1 272 ? 26.310  -11.882 -57.030 1.00 55.61 ? 272  CYS B C   1 
ATOM   6174 O O   . CYS B 1 272 ? 25.470  -12.786 -57.169 1.00 55.22 ? 272  CYS B O   1 
ATOM   6175 C CB  . CYS B 1 272 ? 28.722  -12.478 -56.856 1.00 56.75 ? 272  CYS B CB  1 
ATOM   6176 S SG  . CYS B 1 272 ? 28.290  -14.136 -56.263 1.00 59.07 ? 272  CYS B SG  1 
ATOM   6177 N N   . LEU B 1 273 ? 26.142  -10.838 -56.216 1.00 54.59 ? 273  LEU B N   1 
ATOM   6178 C CA  . LEU B 1 273 ? 24.919  -10.663 -55.407 1.00 53.71 ? 273  LEU B CA  1 
ATOM   6179 C C   . LEU B 1 273 ? 23.665  -10.521 -56.275 1.00 53.10 ? 273  LEU B C   1 
ATOM   6180 O O   . LEU B 1 273 ? 22.613  -11.092 -55.967 1.00 52.26 ? 273  LEU B O   1 
ATOM   6181 C CB  . LEU B 1 273 ? 25.055  -9.491  -54.421 1.00 53.18 ? 273  LEU B CB  1 
ATOM   6182 C CG  . LEU B 1 273 ? 25.752  -9.848  -53.098 1.00 52.03 ? 273  LEU B CG  1 
ATOM   6183 C CD1 . LEU B 1 273 ? 26.126  -8.612  -52.340 1.00 50.10 ? 273  LEU B CD1 1 
ATOM   6184 C CD2 . LEU B 1 273 ? 24.890  -10.737 -52.226 1.00 50.54 ? 273  LEU B CD2 1 
ATOM   6185 N N   . ARG B 1 274 ? 23.812  -9.810  -57.387 1.00 52.90 ? 274  ARG B N   1 
ATOM   6186 C CA  . ARG B 1 274 ? 22.740  -9.691  -58.369 1.00 53.49 ? 274  ARG B CA  1 
ATOM   6187 C C   . ARG B 1 274 ? 22.298  -11.011 -58.995 1.00 54.00 ? 274  ARG B C   1 
ATOM   6188 O O   . ARG B 1 274 ? 21.151  -11.138 -59.394 1.00 54.69 ? 274  ARG B O   1 
ATOM   6189 C CB  . ARG B 1 274 ? 23.092  -8.679  -59.443 1.00 52.83 ? 274  ARG B CB  1 
ATOM   6190 C CG  . ARG B 1 274 ? 23.280  -7.317  -58.862 1.00 53.13 ? 274  ARG B CG  1 
ATOM   6191 C CD  . ARG B 1 274 ? 23.079  -6.288  -59.887 1.00 54.33 ? 274  ARG B CD  1 
ATOM   6192 N NE  . ARG B 1 274 ? 24.217  -6.268  -60.769 1.00 55.01 ? 274  ARG B NE  1 
ATOM   6193 C CZ  . ARG B 1 274 ? 25.014  -5.224  -60.907 1.00 57.73 ? 274  ARG B CZ  1 
ATOM   6194 N NH1 . ARG B 1 274 ? 24.783  -4.088  -60.230 1.00 58.48 ? 274  ARG B NH1 1 
ATOM   6195 N NH2 . ARG B 1 274 ? 26.031  -5.321  -61.744 1.00 58.18 ? 274  ARG B NH2 1 
ATOM   6196 N N   . THR B 1 275 ? 23.177  -12.005 -59.057 1.00 54.50 ? 275  THR B N   1 
ATOM   6197 C CA  . THR B 1 275 ? 22.786  -13.274 -59.659 1.00 54.76 ? 275  THR B CA  1 
ATOM   6198 C C   . THR B 1 275 ? 21.959  -14.120 -58.714 1.00 54.76 ? 275  THR B C   1 
ATOM   6199 O O   . THR B 1 275 ? 21.456  -15.167 -59.126 1.00 55.08 ? 275  THR B O   1 
ATOM   6200 C CB  . THR B 1 275 ? 23.983  -14.140 -60.084 1.00 55.13 ? 275  THR B CB  1 
ATOM   6201 O OG1 . THR B 1 275 ? 24.396  -14.935 -58.960 1.00 56.09 ? 275  THR B OG1 1 
ATOM   6202 C CG2 . THR B 1 275 ? 25.159  -13.279 -60.639 1.00 54.12 ? 275  THR B CG2 1 
ATOM   6203 N N   . ARG B 1 276 ? 21.828  -13.699 -57.456 1.00 54.44 ? 276  ARG B N   1 
ATOM   6204 C CA  . ARG B 1 276 ? 21.098  -14.521 -56.473 1.00 54.57 ? 276  ARG B CA  1 
ATOM   6205 C C   . ARG B 1 276 ? 19.578  -14.274 -56.429 1.00 53.58 ? 276  ARG B C   1 
ATOM   6206 O O   . ARG B 1 276 ? 19.143  -13.138 -56.475 1.00 53.79 ? 276  ARG B O   1 
ATOM   6207 C CB  . ARG B 1 276 ? 21.711  -14.384 -55.063 1.00 54.76 ? 276  ARG B CB  1 
ATOM   6208 C CG  . ARG B 1 276 ? 23.152  -14.912 -54.910 1.00 57.92 ? 276  ARG B CG  1 
ATOM   6209 C CD  . ARG B 1 276 ? 23.246  -16.475 -54.844 1.00 63.24 ? 276  ARG B CD  1 
ATOM   6210 N NE  . ARG B 1 276 ? 24.628  -16.928 -54.619 1.00 65.95 ? 276  ARG B NE  1 
ATOM   6211 C CZ  . ARG B 1 276 ? 25.590  -16.937 -55.548 1.00 67.85 ? 276  ARG B CZ  1 
ATOM   6212 N NH1 . ARG B 1 276 ? 25.336  -16.520 -56.785 1.00 68.68 ? 276  ARG B NH1 1 
ATOM   6213 N NH2 . ARG B 1 276 ? 26.817  -17.351 -55.243 1.00 66.33 ? 276  ARG B NH2 1 
ATOM   6214 N N   . PRO B 1 277 ? 18.766  -15.345 -56.339 1.00 53.14 ? 277  PRO B N   1 
ATOM   6215 C CA  . PRO B 1 277 ? 17.327  -15.184 -56.065 1.00 52.69 ? 277  PRO B CA  1 
ATOM   6216 C C   . PRO B 1 277 ? 17.008  -14.344 -54.813 1.00 52.45 ? 277  PRO B C   1 
ATOM   6217 O O   . PRO B 1 277 ? 17.525  -14.615 -53.730 1.00 51.98 ? 277  PRO B O   1 
ATOM   6218 C CB  . PRO B 1 277 ? 16.845  -16.638 -55.859 1.00 52.13 ? 277  PRO B CB  1 
ATOM   6219 C CG  . PRO B 1 277 ? 17.766  -17.445 -56.653 1.00 52.10 ? 277  PRO B CG  1 
ATOM   6220 C CD  . PRO B 1 277 ? 19.112  -16.765 -56.537 1.00 53.05 ? 277  PRO B CD  1 
ATOM   6221 N N   . ALA B 1 278 ? 16.140  -13.348 -54.973 1.00 52.32 ? 278  ALA B N   1 
ATOM   6222 C CA  . ALA B 1 278 ? 15.642  -12.547 -53.861 1.00 51.80 ? 278  ALA B CA  1 
ATOM   6223 C C   . ALA B 1 278 ? 15.605  -13.282 -52.525 1.00 51.94 ? 278  ALA B C   1 
ATOM   6224 O O   . ALA B 1 278 ? 16.152  -12.785 -51.547 1.00 52.47 ? 278  ALA B O   1 
ATOM   6225 C CB  . ALA B 1 278 ? 14.266  -11.988 -54.180 1.00 51.82 ? 278  ALA B CB  1 
ATOM   6226 N N   . GLN B 1 279 ? 14.968  -14.451 -52.460 1.00 51.61 ? 279  GLN B N   1 
ATOM   6227 C CA  . GLN B 1 279 ? 14.795  -15.118 -51.164 1.00 51.25 ? 279  GLN B CA  1 
ATOM   6228 C C   . GLN B 1 279 ? 16.122  -15.584 -50.534 1.00 51.07 ? 279  GLN B C   1 
ATOM   6229 O O   . GLN B 1 279 ? 16.214  -15.749 -49.320 1.00 51.33 ? 279  GLN B O   1 
ATOM   6230 C CB  . GLN B 1 279 ? 13.778  -16.264 -51.248 1.00 51.23 ? 279  GLN B CB  1 
ATOM   6231 C CG  . GLN B 1 279 ? 13.419  -16.901 -49.895 1.00 51.05 ? 279  GLN B CG  1 
ATOM   6232 C CD  . GLN B 1 279 ? 12.712  -15.938 -48.945 1.00 51.06 ? 279  GLN B CD  1 
ATOM   6233 O OE1 . GLN B 1 279 ? 11.870  -15.151 -49.363 1.00 51.54 ? 279  GLN B OE1 1 
ATOM   6234 N NE2 . GLN B 1 279 ? 13.039  -16.015 -47.661 1.00 49.03 ? 279  GLN B NE2 1 
ATOM   6235 N N   . ASP B 1 280 ? 17.151  -15.775 -51.348 1.00 50.82 ? 280  ASP B N   1 
ATOM   6236 C CA  . ASP B 1 280 ? 18.463  -16.185 -50.829 1.00 50.77 ? 280  ASP B CA  1 
ATOM   6237 C C   . ASP B 1 280 ? 19.110  -15.086 -49.996 1.00 50.47 ? 280  ASP B C   1 
ATOM   6238 O O   . ASP B 1 280 ? 19.705  -15.370 -48.950 1.00 50.95 ? 280  ASP B O   1 
ATOM   6239 C CB  . ASP B 1 280 ? 19.410  -16.600 -51.956 1.00 50.67 ? 280  ASP B CB  1 
ATOM   6240 C CG  . ASP B 1 280 ? 19.002  -17.903 -52.619 1.00 51.52 ? 280  ASP B CG  1 
ATOM   6241 O OD1 . ASP B 1 280 ? 17.980  -18.528 -52.208 1.00 50.83 ? 280  ASP B OD1 1 
ATOM   6242 O OD2 . ASP B 1 280 ? 19.717  -18.284 -53.572 1.00 52.39 ? 280  ASP B OD2 1 
ATOM   6243 N N   . LEU B 1 281 ? 19.006  -13.845 -50.482 1.00 49.59 ? 281  LEU B N   1 
ATOM   6244 C CA  . LEU B 1 281 ? 19.385  -12.664 -49.736 1.00 48.72 ? 281  LEU B CA  1 
ATOM   6245 C C   . LEU B 1 281 ? 18.612  -12.554 -48.413 1.00 48.72 ? 281  LEU B C   1 
ATOM   6246 O O   . LEU B 1 281 ? 19.200  -12.473 -47.335 1.00 48.23 ? 281  LEU B O   1 
ATOM   6247 C CB  . LEU B 1 281 ? 19.177  -11.447 -50.618 1.00 48.52 ? 281  LEU B CB  1 
ATOM   6248 C CG  . LEU B 1 281 ? 20.405  -11.043 -51.449 1.00 49.24 ? 281  LEU B CG  1 
ATOM   6249 C CD1 . LEU B 1 281 ? 21.291  -12.216 -51.860 1.00 48.34 ? 281  LEU B CD1 1 
ATOM   6250 C CD2 . LEU B 1 281 ? 20.032  -10.202 -52.663 1.00 49.00 ? 281  LEU B CD2 1 
ATOM   6251 N N   . VAL B 1 282 ? 17.290  -12.617 -48.503 1.00 48.96 ? 282  VAL B N   1 
ATOM   6252 C CA  . VAL B 1 282 ? 16.422  -12.565 -47.346 1.00 49.12 ? 282  VAL B CA  1 
ATOM   6253 C C   . VAL B 1 282 ? 16.683  -13.672 -46.320 1.00 50.84 ? 282  VAL B C   1 
ATOM   6254 O O   . VAL B 1 282 ? 16.567  -13.426 -45.119 1.00 51.15 ? 282  VAL B O   1 
ATOM   6255 C CB  . VAL B 1 282 ? 14.952  -12.554 -47.792 1.00 48.71 ? 282  VAL B CB  1 
ATOM   6256 C CG1 . VAL B 1 282 ? 13.991  -12.713 -46.609 1.00 46.72 ? 282  VAL B CG1 1 
ATOM   6257 C CG2 . VAL B 1 282 ? 14.672  -11.283 -48.551 1.00 47.44 ? 282  VAL B CG2 1 
ATOM   6258 N N   . ASP B 1 283 ? 17.039  -14.877 -46.777 1.00 52.35 ? 283  ASP B N   1 
ATOM   6259 C CA  . ASP B 1 283 ? 17.379  -16.007 -45.875 1.00 53.98 ? 283  ASP B CA  1 
ATOM   6260 C C   . ASP B 1 283 ? 18.461  -15.654 -44.845 1.00 54.59 ? 283  ASP B C   1 
ATOM   6261 O O   . ASP B 1 283 ? 18.440  -16.165 -43.731 1.00 54.21 ? 283  ASP B O   1 
ATOM   6262 C CB  . ASP B 1 283 ? 17.883  -17.226 -46.680 1.00 54.38 ? 283  ASP B CB  1 
ATOM   6263 C CG  . ASP B 1 283 ? 16.753  -18.082 -47.275 1.00 55.99 ? 283  ASP B CG  1 
ATOM   6264 O OD1 . ASP B 1 283 ? 15.599  -18.052 -46.769 1.00 55.54 ? 283  ASP B OD1 1 
ATOM   6265 O OD2 . ASP B 1 283 ? 17.050  -18.806 -48.259 1.00 58.62 ? 283  ASP B OD2 1 
ATOM   6266 N N   . HIS B 1 284 ? 19.402  -14.793 -45.250 1.00 55.86 ? 284  HIS B N   1 
ATOM   6267 C CA  . HIS B 1 284 ? 20.583  -14.431 -44.458 1.00 57.55 ? 284  HIS B CA  1 
ATOM   6268 C C   . HIS B 1 284 ? 20.624  -12.959 -44.003 1.00 57.94 ? 284  HIS B C   1 
ATOM   6269 O O   . HIS B 1 284 ? 21.643  -12.498 -43.467 1.00 58.07 ? 284  HIS B O   1 
ATOM   6270 C CB  . HIS B 1 284 ? 21.870  -14.752 -45.242 1.00 57.79 ? 284  HIS B CB  1 
ATOM   6271 C CG  . HIS B 1 284 ? 22.138  -16.217 -45.388 1.00 60.85 ? 284  HIS B CG  1 
ATOM   6272 N ND1 . HIS B 1 284 ? 22.457  -17.026 -44.315 1.00 63.16 ? 284  HIS B ND1 1 
ATOM   6273 C CD2 . HIS B 1 284 ? 22.131  -17.020 -46.479 1.00 61.80 ? 284  HIS B CD2 1 
ATOM   6274 C CE1 . HIS B 1 284 ? 22.629  -18.265 -44.739 1.00 63.94 ? 284  HIS B CE1 1 
ATOM   6275 N NE2 . HIS B 1 284 ? 22.436  -18.288 -46.048 1.00 63.65 ? 284  HIS B NE2 1 
ATOM   6276 N N   . GLU B 1 285 ? 19.538  -12.232 -44.251 1.00 58.35 ? 285  GLU B N   1 
ATOM   6277 C CA  . GLU B 1 285 ? 19.344  -10.848 -43.790 1.00 59.13 ? 285  GLU B CA  1 
ATOM   6278 C C   . GLU B 1 285 ? 19.640  -10.695 -42.290 1.00 59.55 ? 285  GLU B C   1 
ATOM   6279 O O   . GLU B 1 285 ? 20.310  -9.742  -41.868 1.00 58.85 ? 285  GLU B O   1 
ATOM   6280 C CB  . GLU B 1 285 ? 17.884  -10.464 -44.037 1.00 59.29 ? 285  GLU B CB  1 
ATOM   6281 C CG  . GLU B 1 285 ? 17.587  -8.997  -44.236 1.00 60.15 ? 285  GLU B CG  1 
ATOM   6282 C CD  . GLU B 1 285 ? 16.240  -8.818  -44.899 1.00 63.04 ? 285  GLU B CD  1 
ATOM   6283 O OE1 . GLU B 1 285 ? 16.202  -8.423  -46.105 1.00 66.25 ? 285  GLU B OE1 1 
ATOM   6284 O OE2 . GLU B 1 285 ? 15.225  -9.141  -44.241 1.00 62.81 ? 285  GLU B OE2 1 
ATOM   6285 N N   . TRP B 1 286 ? 19.141  -11.657 -41.507 1.00 60.12 ? 286  TRP B N   1 
ATOM   6286 C CA  . TRP B 1 286 ? 19.169  -11.582 -40.057 1.00 60.88 ? 286  TRP B CA  1 
ATOM   6287 C C   . TRP B 1 286 ? 20.420  -12.153 -39.358 1.00 60.76 ? 286  TRP B C   1 
ATOM   6288 O O   . TRP B 1 286 ? 20.517  -12.111 -38.135 1.00 61.11 ? 286  TRP B O   1 
ATOM   6289 C CB  . TRP B 1 286 ? 17.902  -12.203 -39.493 1.00 61.46 ? 286  TRP B CB  1 
ATOM   6290 C CG  . TRP B 1 286 ? 16.681  -11.375 -39.763 1.00 63.30 ? 286  TRP B CG  1 
ATOM   6291 C CD1 . TRP B 1 286 ? 15.749  -11.572 -40.749 1.00 63.44 ? 286  TRP B CD1 1 
ATOM   6292 C CD2 . TRP B 1 286 ? 16.252  -10.207 -39.037 1.00 65.01 ? 286  TRP B CD2 1 
ATOM   6293 N NE1 . TRP B 1 286 ? 14.769  -10.610 -40.676 1.00 63.34 ? 286  TRP B NE1 1 
ATOM   6294 C CE2 . TRP B 1 286 ? 15.047  -9.762  -39.636 1.00 64.15 ? 286  TRP B CE2 1 
ATOM   6295 C CE3 . TRP B 1 286 ? 16.764  -9.496  -37.934 1.00 64.17 ? 286  TRP B CE3 1 
ATOM   6296 C CZ2 . TRP B 1 286 ? 14.347  -8.646  -39.168 1.00 63.99 ? 286  TRP B CZ2 1 
ATOM   6297 C CZ3 . TRP B 1 286 ? 16.065  -8.385  -37.469 1.00 63.42 ? 286  TRP B CZ3 1 
ATOM   6298 C CH2 . TRP B 1 286 ? 14.869  -7.974  -38.084 1.00 63.75 ? 286  TRP B CH2 1 
ATOM   6299 N N   . HIS B 1 287 ? 21.388  -12.641 -40.124 1.00 60.67 ? 287  HIS B N   1 
ATOM   6300 C CA  . HIS B 1 287 ? 22.590  -13.238 -39.537 1.00 60.43 ? 287  HIS B CA  1 
ATOM   6301 C C   . HIS B 1 287 ? 23.795  -12.309 -39.566 1.00 60.08 ? 287  HIS B C   1 
ATOM   6302 O O   . HIS B 1 287 ? 24.910  -12.744 -39.309 1.00 60.11 ? 287  HIS B O   1 
ATOM   6303 C CB  . HIS B 1 287 ? 22.939  -14.563 -40.237 1.00 60.75 ? 287  HIS B CB  1 
ATOM   6304 C CG  . HIS B 1 287 ? 21.831  -15.573 -40.215 1.00 61.42 ? 287  HIS B CG  1 
ATOM   6305 N ND1 . HIS B 1 287 ? 21.671  -16.520 -41.202 1.00 61.95 ? 287  HIS B ND1 1 
ATOM   6306 C CD2 . HIS B 1 287 ? 20.824  -15.776 -39.331 1.00 62.18 ? 287  HIS B CD2 1 
ATOM   6307 C CE1 . HIS B 1 287 ? 20.621  -17.273 -40.922 1.00 63.24 ? 287  HIS B CE1 1 
ATOM   6308 N NE2 . HIS B 1 287 ? 20.091  -16.845 -39.790 1.00 63.78 ? 287  HIS B NE2 1 
ATOM   6309 N N   . VAL B 1 288 ? 23.576  -11.033 -39.875 1.00 59.83 ? 288  VAL B N   1 
ATOM   6310 C CA  . VAL B 1 288 ? 24.689  -10.087 -40.005 1.00 59.39 ? 288  VAL B CA  1 
ATOM   6311 C C   . VAL B 1 288 ? 24.827  -9.084  -38.843 1.00 59.50 ? 288  VAL B C   1 
ATOM   6312 O O   . VAL B 1 288 ? 25.784  -8.290  -38.826 1.00 59.71 ? 288  VAL B O   1 
ATOM   6313 C CB  . VAL B 1 288 ? 24.708  -9.340  -41.391 1.00 59.10 ? 288  VAL B CB  1 
ATOM   6314 C CG1 . VAL B 1 288 ? 24.853  -10.311 -42.519 1.00 58.39 ? 288  VAL B CG1 1 
ATOM   6315 C CG2 . VAL B 1 288 ? 23.467  -8.483  -41.583 1.00 58.85 ? 288  VAL B CG2 1 
ATOM   6316 N N   . LEU B 1 289 ? 23.899  -9.111  -37.883 1.00 59.42 ? 289  LEU B N   1 
ATOM   6317 C CA  . LEU B 1 289 ? 23.976  -8.181  -36.734 1.00 59.52 ? 289  LEU B CA  1 
ATOM   6318 C C   . LEU B 1 289 ? 25.132  -8.530  -35.775 1.00 59.80 ? 289  LEU B C   1 
ATOM   6319 O O   . LEU B 1 289 ? 25.329  -9.699  -35.439 1.00 59.55 ? 289  LEU B O   1 
ATOM   6320 C CB  . LEU B 1 289 ? 22.638  -8.102  -35.988 1.00 59.23 ? 289  LEU B CB  1 
ATOM   6321 C CG  . LEU B 1 289 ? 21.456  -7.521  -36.780 1.00 58.82 ? 289  LEU B CG  1 
ATOM   6322 C CD1 . LEU B 1 289 ? 20.102  -7.856  -36.143 1.00 57.21 ? 289  LEU B CD1 1 
ATOM   6323 C CD2 . LEU B 1 289 ? 21.615  -6.021  -36.965 1.00 57.92 ? 289  LEU B CD2 1 
ATOM   6324 N N   . PRO B 1 290 ? 25.903  -7.514  -35.334 1.00 60.27 ? 290  PRO B N   1 
ATOM   6325 C CA  . PRO B 1 290 ? 27.088  -7.749  -34.483 1.00 60.43 ? 290  PRO B CA  1 
ATOM   6326 C C   . PRO B 1 290 ? 26.789  -8.428  -33.139 1.00 60.42 ? 290  PRO B C   1 
ATOM   6327 O O   . PRO B 1 290 ? 27.632  -9.148  -32.623 1.00 60.69 ? 290  PRO B O   1 
ATOM   6328 C CB  . PRO B 1 290 ? 27.650  -6.336  -34.253 1.00 60.47 ? 290  PRO B CB  1 
ATOM   6329 C CG  . PRO B 1 290 ? 26.470  -5.403  -34.507 1.00 59.99 ? 290  PRO B CG  1 
ATOM   6330 C CD  . PRO B 1 290 ? 25.698  -6.075  -35.604 1.00 60.32 ? 290  PRO B CD  1 
ATOM   6331 N N   . GLN B 1 291 ? 25.610  -8.182  -32.578 1.00 60.55 ? 291  GLN B N   1 
ATOM   6332 C CA  . GLN B 1 291 ? 25.204  -8.783  -31.301 1.00 60.60 ? 291  GLN B CA  1 
ATOM   6333 C C   . GLN B 1 291 ? 23.762  -9.284  -31.378 1.00 60.44 ? 291  GLN B C   1 
ATOM   6334 O O   . GLN B 1 291 ? 22.971  -8.824  -32.212 1.00 60.24 ? 291  GLN B O   1 
ATOM   6335 C CB  . GLN B 1 291 ? 25.293  -7.781  -30.126 1.00 60.44 ? 291  GLN B CB  1 
ATOM   6336 C CG  . GLN B 1 291 ? 26.619  -7.037  -29.944 1.00 60.89 ? 291  GLN B CG  1 
ATOM   6337 C CD  . GLN B 1 291 ? 26.621  -5.694  -30.638 1.00 61.66 ? 291  GLN B CD  1 
ATOM   6338 O OE1 . GLN B 1 291 ? 27.677  -5.110  -30.921 1.00 61.23 ? 291  GLN B OE1 1 
ATOM   6339 N NE2 . GLN B 1 291 ? 25.429  -5.197  -30.935 1.00 63.17 ? 291  GLN B NE2 1 
ATOM   6340 N N   . GLU B 1 292 ? 23.439  -10.228 -30.494 1.00 60.18 ? 292  GLU B N   1 
ATOM   6341 C CA  . GLU B 1 292 ? 22.068  -10.569 -30.191 1.00 60.05 ? 292  GLU B CA  1 
ATOM   6342 C C   . GLU B 1 292 ? 21.460  -9.254  -29.731 1.00 58.91 ? 292  GLU B C   1 
ATOM   6343 O O   . GLU B 1 292 ? 22.125  -8.461  -29.042 1.00 59.02 ? 292  GLU B O   1 
ATOM   6344 C CB  . GLU B 1 292 ? 22.024  -11.603 -29.071 1.00 60.10 ? 292  GLU B CB  1 
ATOM   6345 C CG  . GLU B 1 292 ? 20.646  -12.260 -28.863 1.00 61.71 ? 292  GLU B CG  1 
ATOM   6346 C CD  . GLU B 1 292 ? 20.600  -13.145 -27.603 1.00 62.20 ? 292  GLU B CD  1 
ATOM   6347 O OE1 . GLU B 1 292 ? 21.681  -13.453 -27.040 1.00 63.82 ? 292  GLU B OE1 1 
ATOM   6348 O OE2 . GLU B 1 292 ? 19.482  -13.533 -27.176 1.00 64.55 ? 292  GLU B OE2 1 
ATOM   6349 N N   . SER B 1 293 ? 20.222  -9.002  -30.140 1.00 57.27 ? 293  SER B N   1 
ATOM   6350 C CA  . SER B 1 293 ? 19.610  -7.697  -29.945 1.00 55.50 ? 293  SER B CA  1 
ATOM   6351 C C   . SER B 1 293 ? 18.153  -7.726  -30.312 1.00 54.62 ? 293  SER B C   1 
ATOM   6352 O O   . SER B 1 293 ? 17.686  -8.680  -30.909 1.00 54.93 ? 293  SER B O   1 
ATOM   6353 C CB  . SER B 1 293 ? 20.328  -6.627  -30.770 1.00 55.35 ? 293  SER B CB  1 
ATOM   6354 O OG  . SER B 1 293 ? 20.638  -7.073  -32.068 1.00 54.79 ? 293  SER B OG  1 
ATOM   6355 N N   . ILE B 1 294 ? 17.423  -6.702  -29.893 1.00 53.58 ? 294  ILE B N   1 
ATOM   6356 C CA  . ILE B 1 294 ? 16.099  -6.413  -30.435 1.00 52.08 ? 294  ILE B CA  1 
ATOM   6357 C C   . ILE B 1 294 ? 16.144  -4.950  -30.849 1.00 51.61 ? 294  ILE B C   1 
ATOM   6358 O O   . ILE B 1 294 ? 17.098  -4.249  -30.488 1.00 51.38 ? 294  ILE B O   1 
ATOM   6359 C CB  . ILE B 1 294 ? 14.959  -6.701  -29.446 1.00 51.81 ? 294  ILE B CB  1 
ATOM   6360 C CG1 . ILE B 1 294 ? 15.167  -5.977  -28.110 1.00 51.14 ? 294  ILE B CG1 1 
ATOM   6361 C CG2 . ILE B 1 294 ? 14.777  -8.231  -29.250 1.00 51.75 ? 294  ILE B CG2 1 
ATOM   6362 C CD1 . ILE B 1 294 ? 13.870  -5.845  -27.308 1.00 50.04 ? 294  ILE B CD1 1 
ATOM   6363 N N   . PHE B 1 295 ? 15.158  -4.509  -31.638 1.00 50.44 ? 295  PHE B N   1 
ATOM   6364 C CA  . PHE B 1 295 ? 15.101  -3.139  -32.154 1.00 49.34 ? 295  PHE B CA  1 
ATOM   6365 C C   . PHE B 1 295 ? 16.399  -2.743  -32.835 1.00 48.97 ? 295  PHE B C   1 
ATOM   6366 O O   . PHE B 1 295 ? 16.885  -1.623  -32.676 1.00 49.07 ? 295  PHE B O   1 
ATOM   6367 C CB  . PHE B 1 295 ? 14.795  -2.146  -31.033 1.00 49.10 ? 295  PHE B CB  1 
ATOM   6368 C CG  . PHE B 1 295 ? 13.774  -1.119  -31.399 1.00 48.33 ? 295  PHE B CG  1 
ATOM   6369 C CD1 . PHE B 1 295 ? 14.022  -0.202  -32.420 1.00 46.97 ? 295  PHE B CD1 1 
ATOM   6370 C CD2 . PHE B 1 295 ? 12.556  -1.067  -30.711 1.00 47.49 ? 295  PHE B CD2 1 
ATOM   6371 C CE1 . PHE B 1 295 ? 13.067  0.750   -32.765 1.00 46.46 ? 295  PHE B CE1 1 
ATOM   6372 C CE2 . PHE B 1 295 ? 11.586  -0.114  -31.035 1.00 47.34 ? 295  PHE B CE2 1 
ATOM   6373 C CZ  . PHE B 1 295 ? 11.842  0.795   -32.064 1.00 47.45 ? 295  PHE B CZ  1 
ATOM   6374 N N   . ARG B 1 296 ? 16.964  -3.696  -33.557 1.00 48.20 ? 296  ARG B N   1 
ATOM   6375 C CA  . ARG B 1 296 ? 18.154  -3.493  -34.358 1.00 47.80 ? 296  ARG B CA  1 
ATOM   6376 C C   . ARG B 1 296 ? 17.926  -4.311  -35.648 1.00 47.31 ? 296  ARG B C   1 
ATOM   6377 O O   . ARG B 1 296 ? 17.337  -5.408  -35.619 1.00 47.61 ? 296  ARG B O   1 
ATOM   6378 C CB  . ARG B 1 296 ? 19.406  -3.958  -33.598 1.00 47.60 ? 296  ARG B CB  1 
ATOM   6379 C CG  . ARG B 1 296 ? 20.623  -3.025  -33.768 1.00 48.56 ? 296  ARG B CG  1 
ATOM   6380 C CD  . ARG B 1 296 ? 20.946  -2.134  -32.536 1.00 47.73 ? 296  ARG B CD  1 
ATOM   6381 N NE  . ARG B 1 296 ? 19.791  -1.398  -32.042 1.00 48.12 ? 296  ARG B NE  1 
ATOM   6382 C CZ  . ARG B 1 296 ? 19.745  -0.669  -30.924 1.00 46.44 ? 296  ARG B CZ  1 
ATOM   6383 N NH1 . ARG B 1 296 ? 20.786  -0.517  -30.115 1.00 43.44 ? 296  ARG B NH1 1 
ATOM   6384 N NH2 . ARG B 1 296 ? 18.614  -0.079  -30.618 1.00 47.22 ? 296  ARG B NH2 1 
ATOM   6385 N N   . PHE B 1 297 ? 18.343  -3.756  -36.778 1.00 45.82 ? 297  PHE B N   1 
ATOM   6386 C CA  . PHE B 1 297 ? 17.955  -4.283  -38.074 1.00 44.94 ? 297  PHE B CA  1 
ATOM   6387 C C   . PHE B 1 297 ? 19.141  -4.110  -38.993 1.00 44.20 ? 297  PHE B C   1 
ATOM   6388 O O   . PHE B 1 297 ? 19.779  -3.048  -38.991 1.00 44.06 ? 297  PHE B O   1 
ATOM   6389 C CB  . PHE B 1 297 ? 16.725  -3.544  -38.654 1.00 44.66 ? 297  PHE B CB  1 
ATOM   6390 C CG  . PHE B 1 297 ? 15.714  -3.150  -37.616 1.00 45.39 ? 297  PHE B CG  1 
ATOM   6391 C CD1 . PHE B 1 297 ? 14.779  -4.073  -37.140 1.00 46.88 ? 297  PHE B CD1 1 
ATOM   6392 C CD2 . PHE B 1 297 ? 15.702  -1.864  -37.094 1.00 45.29 ? 297  PHE B CD2 1 
ATOM   6393 C CE1 . PHE B 1 297 ? 13.840  -3.712  -36.155 1.00 46.79 ? 297  PHE B CE1 1 
ATOM   6394 C CE2 . PHE B 1 297 ? 14.781  -1.492  -36.110 1.00 45.35 ? 297  PHE B CE2 1 
ATOM   6395 C CZ  . PHE B 1 297 ? 13.853  -2.414  -35.639 1.00 46.41 ? 297  PHE B CZ  1 
ATOM   6396 N N   . SER B 1 298 ? 19.378  -5.144  -39.806 1.00 43.08 ? 298  SER B N   1 
ATOM   6397 C CA  . SER B 1 298 ? 20.607  -5.326  -40.560 1.00 42.11 ? 298  SER B CA  1 
ATOM   6398 C C   . SER B 1 298 ? 20.859  -4.273  -41.600 1.00 41.27 ? 298  SER B C   1 
ATOM   6399 O O   . SER B 1 298 ? 21.952  -3.740  -41.657 1.00 41.31 ? 298  SER B O   1 
ATOM   6400 C CB  . SER B 1 298 ? 20.607  -6.695  -41.216 1.00 42.53 ? 298  SER B CB  1 
ATOM   6401 O OG  . SER B 1 298 ? 20.382  -7.716  -40.251 1.00 43.95 ? 298  SER B OG  1 
ATOM   6402 N N   . PHE B 1 299 ? 19.857  -3.955  -42.425 1.00 40.29 ? 299  PHE B N   1 
ATOM   6403 C CA  . PHE B 1 299 ? 20.091  -3.021  -43.530 1.00 38.81 ? 299  PHE B CA  1 
ATOM   6404 C C   . PHE B 1 299 ? 19.214  -1.794  -43.428 1.00 38.86 ? 299  PHE B C   1 
ATOM   6405 O O   . PHE B 1 299 ? 17.985  -1.853  -43.626 1.00 39.11 ? 299  PHE B O   1 
ATOM   6406 C CB  . PHE B 1 299 ? 19.960  -3.735  -44.873 1.00 38.02 ? 299  PHE B CB  1 
ATOM   6407 C CG  . PHE B 1 299 ? 20.912  -4.855  -45.010 1.00 38.44 ? 299  PHE B CG  1 
ATOM   6408 C CD1 . PHE B 1 299 ? 22.246  -4.610  -45.384 1.00 37.50 ? 299  PHE B CD1 1 
ATOM   6409 C CD2 . PHE B 1 299 ? 20.526  -6.151  -44.673 1.00 36.27 ? 299  PHE B CD2 1 
ATOM   6410 C CE1 . PHE B 1 299 ? 23.155  -5.658  -45.447 1.00 35.86 ? 299  PHE B CE1 1 
ATOM   6411 C CE2 . PHE B 1 299 ? 21.444  -7.201  -44.738 1.00 36.81 ? 299  PHE B CE2 1 
ATOM   6412 C CZ  . PHE B 1 299 ? 22.741  -6.957  -45.127 1.00 35.99 ? 299  PHE B CZ  1 
ATOM   6413 N N   . VAL B 1 300 ? 19.864  -0.691  -43.093 1.00 38.14 ? 300  VAL B N   1 
ATOM   6414 C CA  . VAL B 1 300 ? 19.184  0.545   -42.753 1.00 38.32 ? 300  VAL B CA  1 
ATOM   6415 C C   . VAL B 1 300 ? 19.921  1.706   -43.441 1.00 38.45 ? 300  VAL B C   1 
ATOM   6416 O O   . VAL B 1 300 ? 21.012  1.528   -43.954 1.00 39.00 ? 300  VAL B O   1 
ATOM   6417 C CB  . VAL B 1 300 ? 19.055  0.732   -41.190 1.00 38.00 ? 300  VAL B CB  1 
ATOM   6418 C CG1 . VAL B 1 300 ? 18.175  -0.362  -40.556 1.00 38.85 ? 300  VAL B CG1 1 
ATOM   6419 C CG2 . VAL B 1 300 ? 20.396  0.752   -40.516 1.00 37.90 ? 300  VAL B CG2 1 
ATOM   6420 N N   . PRO B 1 301 ? 19.330  2.894   -43.487 1.00 38.52 ? 301  PRO B N   1 
ATOM   6421 C CA  . PRO B 1 301 ? 20.104  3.961   -44.101 1.00 39.09 ? 301  PRO B CA  1 
ATOM   6422 C C   . PRO B 1 301 ? 21.547  4.046   -43.572 1.00 39.94 ? 301  PRO B C   1 
ATOM   6423 O O   . PRO B 1 301 ? 21.799  3.754   -42.399 1.00 39.84 ? 301  PRO B O   1 
ATOM   6424 C CB  . PRO B 1 301 ? 19.319  5.222   -43.716 1.00 39.10 ? 301  PRO B CB  1 
ATOM   6425 C CG  . PRO B 1 301 ? 17.929  4.754   -43.578 1.00 39.02 ? 301  PRO B CG  1 
ATOM   6426 C CD  . PRO B 1 301 ? 17.998  3.339   -43.054 1.00 38.44 ? 301  PRO B CD  1 
ATOM   6427 N N   . VAL B 1 302 ? 22.472  4.457   -44.433 1.00 40.72 ? 302  VAL B N   1 
ATOM   6428 C CA  . VAL B 1 302 ? 23.886  4.551   -44.082 1.00 42.19 ? 302  VAL B CA  1 
ATOM   6429 C C   . VAL B 1 302 ? 24.389  5.999   -44.146 1.00 42.94 ? 302  VAL B C   1 
ATOM   6430 O O   . VAL B 1 302 ? 24.008  6.757   -45.040 1.00 43.61 ? 302  VAL B O   1 
ATOM   6431 C CB  . VAL B 1 302 ? 24.759  3.651   -45.001 1.00 42.03 ? 302  VAL B CB  1 
ATOM   6432 C CG1 . VAL B 1 302 ? 24.668  4.105   -46.455 1.00 41.89 ? 302  VAL B CG1 1 
ATOM   6433 C CG2 . VAL B 1 302 ? 26.203  3.682   -44.552 1.00 42.88 ? 302  VAL B CG2 1 
ATOM   6434 N N   . VAL B 1 303 ? 25.232  6.385   -43.196 1.00 43.66 ? 303  VAL B N   1 
ATOM   6435 C CA  . VAL B 1 303 ? 25.843  7.708   -43.235 1.00 44.50 ? 303  VAL B CA  1 
ATOM   6436 C C   . VAL B 1 303 ? 26.916  7.629   -44.322 1.00 45.52 ? 303  VAL B C   1 
ATOM   6437 O O   . VAL B 1 303 ? 27.998  7.033   -44.132 1.00 46.16 ? 303  VAL B O   1 
ATOM   6438 C CB  . VAL B 1 303 ? 26.457  8.090   -41.878 1.00 44.27 ? 303  VAL B CB  1 
ATOM   6439 C CG1 . VAL B 1 303 ? 27.016  9.507   -41.916 1.00 44.37 ? 303  VAL B CG1 1 
ATOM   6440 C CG2 . VAL B 1 303 ? 25.436  7.924   -40.770 1.00 43.25 ? 303  VAL B CG2 1 
ATOM   6441 N N   . ASP B 1 304 ? 26.592  8.204   -45.472 1.00 45.77 ? 304  ASP B N   1 
ATOM   6442 C CA  . ASP B 1 304 ? 27.326  7.941   -46.697 1.00 45.79 ? 304  ASP B CA  1 
ATOM   6443 C C   . ASP B 1 304 ? 28.050  9.188   -47.183 1.00 46.37 ? 304  ASP B C   1 
ATOM   6444 O O   . ASP B 1 304 ? 28.776  9.142   -48.186 1.00 46.38 ? 304  ASP B O   1 
ATOM   6445 C CB  . ASP B 1 304 ? 26.356  7.437   -47.779 1.00 45.66 ? 304  ASP B CB  1 
ATOM   6446 C CG  . ASP B 1 304 ? 25.218  8.447   -48.099 1.00 45.87 ? 304  ASP B CG  1 
ATOM   6447 O OD1 . ASP B 1 304 ? 24.915  9.336   -47.261 1.00 44.51 ? 304  ASP B OD1 1 
ATOM   6448 O OD2 . ASP B 1 304 ? 24.617  8.341   -49.201 1.00 44.91 ? 304  ASP B OD2 1 
ATOM   6449 N N   . GLY B 1 305 ? 27.833  10.304  -46.485 1.00 46.42 ? 305  GLY B N   1 
ATOM   6450 C CA  . GLY B 1 305 ? 28.414  11.566  -46.884 1.00 46.57 ? 305  GLY B CA  1 
ATOM   6451 C C   . GLY B 1 305 ? 27.737  12.078  -48.131 1.00 47.60 ? 305  GLY B C   1 
ATOM   6452 O O   . GLY B 1 305 ? 28.090  13.146  -48.640 1.00 47.94 ? 305  GLY B O   1 
ATOM   6453 N N   . ASP B 1 306 ? 26.737  11.342  -48.619 1.00 47.96 ? 306  ASP B N   1 
ATOM   6454 C CA  . ASP B 1 306 ? 25.969  11.792  -49.779 1.00 48.50 ? 306  ASP B CA  1 
ATOM   6455 C C   . ASP B 1 306 ? 24.520  12.161  -49.428 1.00 48.52 ? 306  ASP B C   1 
ATOM   6456 O O   . ASP B 1 306 ? 24.227  13.337  -49.200 1.00 48.84 ? 306  ASP B O   1 
ATOM   6457 C CB  . ASP B 1 306 ? 26.046  10.758  -50.894 1.00 48.78 ? 306  ASP B CB  1 
ATOM   6458 C CG  . ASP B 1 306 ? 25.411  11.231  -52.180 1.00 50.54 ? 306  ASP B CG  1 
ATOM   6459 O OD1 . ASP B 1 306 ? 24.991  12.412  -52.279 1.00 49.83 ? 306  ASP B OD1 1 
ATOM   6460 O OD2 . ASP B 1 306 ? 25.322  10.387  -53.096 1.00 53.22 ? 306  ASP B OD2 1 
ATOM   6461 N N   . PHE B 1 307 ? 23.617  11.177  -49.388 1.00 48.44 ? 307  PHE B N   1 
ATOM   6462 C CA  . PHE B 1 307 ? 22.246  11.420  -48.921 1.00 47.98 ? 307  PHE B CA  1 
ATOM   6463 C C   . PHE B 1 307 ? 22.294  12.084  -47.537 1.00 47.90 ? 307  PHE B C   1 
ATOM   6464 O O   . PHE B 1 307 ? 21.637  13.102  -47.284 1.00 47.76 ? 307  PHE B O   1 
ATOM   6465 C CB  . PHE B 1 307 ? 21.419  10.119  -48.872 1.00 47.76 ? 307  PHE B CB  1 
ATOM   6466 C CG  . PHE B 1 307 ? 19.920  10.351  -48.775 1.00 47.67 ? 307  PHE B CG  1 
ATOM   6467 C CD1 . PHE B 1 307 ? 19.325  10.754  -47.565 1.00 47.85 ? 307  PHE B CD1 1 
ATOM   6468 C CD2 . PHE B 1 307 ? 19.100  10.181  -49.890 1.00 47.41 ? 307  PHE B CD2 1 
ATOM   6469 C CE1 . PHE B 1 307 ? 17.934  10.984  -47.470 1.00 45.48 ? 307  PHE B CE1 1 
ATOM   6470 C CE2 . PHE B 1 307 ? 17.711  10.406  -49.799 1.00 47.32 ? 307  PHE B CE2 1 
ATOM   6471 C CZ  . PHE B 1 307 ? 17.138  10.804  -48.580 1.00 46.37 ? 307  PHE B CZ  1 
ATOM   6472 N N   . LEU B 1 308 ? 23.091  11.496  -46.655 1.00 47.60 ? 308  LEU B N   1 
ATOM   6473 C CA  . LEU B 1 308 ? 23.295  12.028  -45.338 1.00 47.53 ? 308  LEU B CA  1 
ATOM   6474 C C   . LEU B 1 308 ? 24.735  12.489  -45.253 1.00 48.09 ? 308  LEU B C   1 
ATOM   6475 O O   . LEU B 1 308 ? 25.636  11.659  -45.148 1.00 48.08 ? 308  LEU B O   1 
ATOM   6476 C CB  . LEU B 1 308 ? 23.030  10.953  -44.293 1.00 47.14 ? 308  LEU B CB  1 
ATOM   6477 C CG  . LEU B 1 308 ? 21.633  10.364  -44.150 1.00 45.63 ? 308  LEU B CG  1 
ATOM   6478 C CD1 . LEU B 1 308 ? 21.693  9.233   -43.177 1.00 43.74 ? 308  LEU B CD1 1 
ATOM   6479 C CD2 . LEU B 1 308 ? 20.702  11.414  -43.663 1.00 44.31 ? 308  LEU B CD2 1 
ATOM   6480 N N   . SER B 1 309 ? 24.936  13.807  -45.299 1.00 48.64 ? 309  SER B N   1 
ATOM   6481 C CA  . SER B 1 309 ? 26.269  14.411  -45.346 1.00 49.59 ? 309  SER B CA  1 
ATOM   6482 C C   . SER B 1 309 ? 27.121  14.180  -44.083 1.00 49.95 ? 309  SER B C   1 
ATOM   6483 O O   . SER B 1 309 ? 28.347  14.178  -44.141 1.00 49.96 ? 309  SER B O   1 
ATOM   6484 C CB  . SER B 1 309 ? 26.158  15.906  -45.642 1.00 49.57 ? 309  SER B CB  1 
ATOM   6485 O OG  . SER B 1 309 ? 25.858  16.640  -44.465 1.00 51.74 ? 309  SER B OG  1 
ATOM   6486 N N   . ASP B 1 310 ? 26.461  13.977  -42.954 1.00 50.56 ? 310  ASP B N   1 
ATOM   6487 C CA  . ASP B 1 310 ? 27.119  13.731  -41.673 1.00 51.27 ? 310  ASP B CA  1 
ATOM   6488 C C   . ASP B 1 310 ? 26.162  12.822  -40.898 1.00 51.74 ? 310  ASP B C   1 
ATOM   6489 O O   . ASP B 1 310 ? 25.141  12.413  -41.448 1.00 52.57 ? 310  ASP B O   1 
ATOM   6490 C CB  . ASP B 1 310 ? 27.321  15.065  -40.945 1.00 51.22 ? 310  ASP B CB  1 
ATOM   6491 C CG  . ASP B 1 310 ? 28.548  15.084  -40.034 1.00 51.20 ? 310  ASP B CG  1 
ATOM   6492 O OD1 . ASP B 1 310 ? 28.931  14.039  -39.435 1.00 48.57 ? 310  ASP B OD1 1 
ATOM   6493 O OD2 . ASP B 1 310 ? 29.114  16.193  -39.908 1.00 51.28 ? 310  ASP B OD2 1 
ATOM   6494 N N   . THR B 1 311 ? 26.440  12.513  -39.635 1.00 52.05 ? 311  THR B N   1 
ATOM   6495 C CA  . THR B 1 311 ? 25.460  11.745  -38.857 1.00 52.51 ? 311  THR B CA  1 
ATOM   6496 C C   . THR B 1 311 ? 24.203  12.569  -38.622 1.00 52.31 ? 311  THR B C   1 
ATOM   6497 O O   . THR B 1 311 ? 24.274  13.788  -38.569 1.00 52.04 ? 311  THR B O   1 
ATOM   6498 C CB  . THR B 1 311 ? 25.979  11.334  -37.491 1.00 52.34 ? 311  THR B CB  1 
ATOM   6499 O OG1 . THR B 1 311 ? 26.258  12.521  -36.747 1.00 53.62 ? 311  THR B OG1 1 
ATOM   6500 C CG2 . THR B 1 311 ? 27.218  10.480  -37.623 1.00 52.00 ? 311  THR B CG2 1 
ATOM   6501 N N   . PRO B 1 312 ? 23.045  11.903  -38.495 1.00 52.71 ? 312  PRO B N   1 
ATOM   6502 C CA  . PRO B 1 312 ? 21.835  12.632  -38.128 1.00 53.11 ? 312  PRO B CA  1 
ATOM   6503 C C   . PRO B 1 312 ? 22.000  13.438  -36.853 1.00 53.39 ? 312  PRO B C   1 
ATOM   6504 O O   . PRO B 1 312 ? 21.467  14.529  -36.786 1.00 53.18 ? 312  PRO B O   1 
ATOM   6505 C CB  . PRO B 1 312 ? 20.793  11.528  -37.940 1.00 52.90 ? 312  PRO B CB  1 
ATOM   6506 C CG  . PRO B 1 312 ? 21.264  10.445  -38.802 1.00 53.28 ? 312  PRO B CG  1 
ATOM   6507 C CD  . PRO B 1 312 ? 22.766  10.477  -38.731 1.00 52.58 ? 312  PRO B CD  1 
ATOM   6508 N N   . GLU B 1 313 ? 22.736  12.928  -35.865 1.00 54.35 ? 313  GLU B N   1 
ATOM   6509 C CA  . GLU B 1 313 ? 22.989  13.718  -34.642 1.00 56.31 ? 313  GLU B CA  1 
ATOM   6510 C C   . GLU B 1 313 ? 23.694  15.031  -34.984 1.00 55.06 ? 313  GLU B C   1 
ATOM   6511 O O   . GLU B 1 313 ? 23.237  16.096  -34.588 1.00 55.43 ? 313  GLU B O   1 
ATOM   6512 C CB  . GLU B 1 313 ? 23.740  12.926  -33.551 1.00 56.18 ? 313  GLU B CB  1 
ATOM   6513 C CG  . GLU B 1 313 ? 24.523  13.822  -32.532 1.00 59.83 ? 313  GLU B CG  1 
ATOM   6514 C CD  . GLU B 1 313 ? 24.687  13.204  -31.109 1.00 60.58 ? 313  GLU B CD  1 
ATOM   6515 O OE1 . GLU B 1 313 ? 23.765  13.390  -30.253 1.00 65.46 ? 313  GLU B OE1 1 
ATOM   6516 O OE2 . GLU B 1 313 ? 25.749  12.564  -30.845 1.00 63.60 ? 313  GLU B OE2 1 
ATOM   6517 N N   . ALA B 1 314 ? 24.779  14.950  -35.746 1.00 54.37 ? 314  ALA B N   1 
ATOM   6518 C CA  . ALA B 1 314 ? 25.499  16.138  -36.186 1.00 53.78 ? 314  ALA B CA  1 
ATOM   6519 C C   . ALA B 1 314 ? 24.579  17.065  -36.950 1.00 53.76 ? 314  ALA B C   1 
ATOM   6520 O O   . ALA B 1 314 ? 24.638  18.294  -36.776 1.00 53.87 ? 314  ALA B O   1 
ATOM   6521 C CB  . ALA B 1 314 ? 26.706  15.766  -37.047 1.00 53.18 ? 314  ALA B CB  1 
ATOM   6522 N N   . LEU B 1 315 ? 23.724  16.482  -37.792 1.00 53.67 ? 315  LEU B N   1 
ATOM   6523 C CA  . LEU B 1 315 ? 22.889  17.280  -38.693 1.00 53.31 ? 315  LEU B CA  1 
ATOM   6524 C C   . LEU B 1 315 ? 21.733  17.975  -37.978 1.00 53.58 ? 315  LEU B C   1 
ATOM   6525 O O   . LEU B 1 315 ? 21.303  19.032  -38.414 1.00 53.29 ? 315  LEU B O   1 
ATOM   6526 C CB  . LEU B 1 315 ? 22.384  16.451  -39.873 1.00 52.82 ? 315  LEU B CB  1 
ATOM   6527 C CG  . LEU B 1 315 ? 23.397  15.895  -40.869 1.00 51.66 ? 315  LEU B CG  1 
ATOM   6528 C CD1 . LEU B 1 315 ? 22.725  14.900  -41.804 1.00 49.62 ? 315  LEU B CD1 1 
ATOM   6529 C CD2 . LEU B 1 315 ? 24.090  17.008  -41.656 1.00 50.53 ? 315  LEU B CD2 1 
ATOM   6530 N N   . ILE B 1 316 ? 21.237  17.388  -36.891 1.00 54.19 ? 316  ILE B N   1 
ATOM   6531 C CA  . ILE B 1 316 ? 20.161  18.027  -36.120 1.00 55.12 ? 316  ILE B CA  1 
ATOM   6532 C C   . ILE B 1 316 ? 20.726  19.054  -35.141 1.00 56.07 ? 316  ILE B C   1 
ATOM   6533 O O   . ILE B 1 316 ? 20.028  19.999  -34.799 1.00 56.33 ? 316  ILE B O   1 
ATOM   6534 C CB  . ILE B 1 316 ? 19.206  17.035  -35.357 1.00 54.60 ? 316  ILE B CB  1 
ATOM   6535 C CG1 . ILE B 1 316 ? 19.921  16.343  -34.192 1.00 54.75 ? 316  ILE B CG1 1 
ATOM   6536 C CG2 . ILE B 1 316 ? 18.551  16.057  -36.306 1.00 54.07 ? 316  ILE B CG2 1 
ATOM   6537 C CD1 . ILE B 1 316 ? 19.045  15.450  -33.323 1.00 55.44 ? 316  ILE B CD1 1 
ATOM   6538 N N   . ASN B 1 317 ? 21.971  18.863  -34.686 1.00 56.94 ? 317  ASN B N   1 
ATOM   6539 C CA  . ASN B 1 317 ? 22.644  19.865  -33.841 1.00 57.84 ? 317  ASN B CA  1 
ATOM   6540 C C   . ASN B 1 317 ? 22.971  21.173  -34.558 1.00 58.09 ? 317  ASN B C   1 
ATOM   6541 O O   . ASN B 1 317 ? 23.098  22.202  -33.915 1.00 58.32 ? 317  ASN B O   1 
ATOM   6542 C CB  . ASN B 1 317 ? 23.925  19.316  -33.221 1.00 57.79 ? 317  ASN B CB  1 
ATOM   6543 C CG  . ASN B 1 317 ? 23.662  18.212  -32.215 1.00 59.55 ? 317  ASN B CG  1 
ATOM   6544 O OD1 . ASN B 1 317 ? 22.521  18.005  -31.776 1.00 60.77 ? 317  ASN B OD1 1 
ATOM   6545 N ND2 . ASN B 1 317 ? 24.721  17.481  -31.847 1.00 59.22 ? 317  ASN B ND2 1 
ATOM   6546 N N   . THR B 1 318 ? 23.104  21.139  -35.881 1.00 58.49 ? 318  THR B N   1 
ATOM   6547 C CA  . THR B 1 318 ? 23.608  22.299  -36.593 1.00 58.99 ? 318  THR B CA  1 
ATOM   6548 C C   . THR B 1 318 ? 22.684  22.806  -37.678 1.00 58.92 ? 318  THR B C   1 
ATOM   6549 O O   . THR B 1 318 ? 22.869  23.919  -38.157 1.00 59.50 ? 318  THR B O   1 
ATOM   6550 C CB  . THR B 1 318 ? 24.998  22.039  -37.259 1.00 59.41 ? 318  THR B CB  1 
ATOM   6551 O OG1 . THR B 1 318 ? 24.830  21.180  -38.396 1.00 60.11 ? 318  THR B OG1 1 
ATOM   6552 C CG2 . THR B 1 318 ? 26.023  21.437  -36.260 1.00 59.58 ? 318  THR B CG2 1 
ATOM   6553 N N   . GLY B 1 319 ? 21.713  22.008  -38.100 1.00 58.49 ? 319  GLY B N   1 
ATOM   6554 C CA  . GLY B 1 319 ? 20.839  22.437  -39.194 1.00 58.20 ? 319  GLY B CA  1 
ATOM   6555 C C   . GLY B 1 319 ? 20.086  23.723  -38.868 1.00 57.99 ? 319  GLY B C   1 
ATOM   6556 O O   . GLY B 1 319 ? 20.046  24.165  -37.711 1.00 57.29 ? 319  GLY B O   1 
ATOM   6557 N N   . ASP B 1 320 ? 19.495  24.330  -39.892 1.00 58.33 ? 320  ASP B N   1 
ATOM   6558 C CA  . ASP B 1 320 ? 18.661  25.516  -39.687 1.00 59.05 ? 320  ASP B CA  1 
ATOM   6559 C C   . ASP B 1 320 ? 17.229  25.262  -40.151 1.00 58.59 ? 320  ASP B C   1 
ATOM   6560 O O   . ASP B 1 320 ? 16.953  25.164  -41.359 1.00 58.51 ? 320  ASP B O   1 
ATOM   6561 C CB  . ASP B 1 320 ? 19.234  26.761  -40.371 1.00 59.41 ? 320  ASP B CB  1 
ATOM   6562 C CG  . ASP B 1 320 ? 18.283  27.953  -40.290 1.00 61.41 ? 320  ASP B CG  1 
ATOM   6563 O OD1 . ASP B 1 320 ? 17.701  28.182  -39.196 1.00 62.52 ? 320  ASP B OD1 1 
ATOM   6564 O OD2 . ASP B 1 320 ? 18.110  28.656  -41.316 1.00 63.03 ? 320  ASP B OD2 1 
ATOM   6565 N N   . PHE B 1 321 ? 16.325  25.185  -39.175 1.00 57.87 ? 321  PHE B N   1 
ATOM   6566 C CA  . PHE B 1 321 ? 14.980  24.695  -39.433 1.00 57.33 ? 321  PHE B CA  1 
ATOM   6567 C C   . PHE B 1 321 ? 13.909  25.786  -39.353 1.00 58.05 ? 321  PHE B C   1 
ATOM   6568 O O   . PHE B 1 321 ? 12.775  25.503  -38.992 1.00 58.38 ? 321  PHE B O   1 
ATOM   6569 C CB  . PHE B 1 321 ? 14.683  23.518  -38.494 1.00 56.24 ? 321  PHE B CB  1 
ATOM   6570 C CG  . PHE B 1 321 ? 15.728  22.415  -38.543 1.00 53.77 ? 321  PHE B CG  1 
ATOM   6571 C CD1 . PHE B 1 321 ? 15.904  21.644  -39.689 1.00 51.06 ? 321  PHE B CD1 1 
ATOM   6572 C CD2 . PHE B 1 321 ? 16.525  22.146  -37.444 1.00 52.30 ? 321  PHE B CD2 1 
ATOM   6573 C CE1 . PHE B 1 321 ? 16.863  20.628  -39.741 1.00 50.92 ? 321  PHE B CE1 1 
ATOM   6574 C CE2 . PHE B 1 321 ? 17.481  21.117  -37.479 1.00 51.70 ? 321  PHE B CE2 1 
ATOM   6575 C CZ  . PHE B 1 321 ? 17.650  20.363  -38.639 1.00 51.27 ? 321  PHE B CZ  1 
ATOM   6576 N N   . GLN B 1 322 ? 14.269  27.017  -39.734 1.00 58.82 ? 322  GLN B N   1 
ATOM   6577 C CA  . GLN B 1 322 ? 13.413  28.190  -39.535 1.00 59.62 ? 322  GLN B CA  1 
ATOM   6578 C C   . GLN B 1 322 ? 12.017  27.998  -40.147 1.00 59.04 ? 322  GLN B C   1 
ATOM   6579 O O   . GLN B 1 322 ? 10.994  28.309  -39.503 1.00 59.26 ? 322  GLN B O   1 
ATOM   6580 C CB  . GLN B 1 322 ? 14.044  29.474  -40.111 1.00 60.56 ? 322  GLN B CB  1 
ATOM   6581 C CG  . GLN B 1 322 ? 15.461  29.853  -39.630 1.00 64.64 ? 322  GLN B CG  1 
ATOM   6582 C CD  . GLN B 1 322 ? 15.493  30.943  -38.530 1.00 69.54 ? 322  GLN B CD  1 
ATOM   6583 O OE1 . GLN B 1 322 ? 14.745  30.888  -37.536 1.00 71.95 ? 322  GLN B OE1 1 
ATOM   6584 N NE2 . GLN B 1 322 ? 16.384  31.926  -38.704 1.00 69.28 ? 322  GLN B NE2 1 
ATOM   6585 N N   . ASP B 1 323 ? 11.955  27.502  -41.379 1.00 57.69 ? 323  ASP B N   1 
ATOM   6586 C CA  . ASP B 1 323 ? 10.650  27.452  -42.042 1.00 57.06 ? 323  ASP B CA  1 
ATOM   6587 C C   . ASP B 1 323 ? 10.116  26.041  -42.100 1.00 55.09 ? 323  ASP B C   1 
ATOM   6588 O O   . ASP B 1 323 ? 9.741   25.548  -43.165 1.00 55.26 ? 323  ASP B O   1 
ATOM   6589 C CB  . ASP B 1 323 ? 10.676  28.091  -43.444 1.00 58.30 ? 323  ASP B CB  1 
ATOM   6590 C CG  . ASP B 1 323 ? 10.792  29.631  -43.402 1.00 61.33 ? 323  ASP B CG  1 
ATOM   6591 O OD1 . ASP B 1 323 ? 10.245  30.285  -42.464 1.00 63.37 ? 323  ASP B OD1 1 
ATOM   6592 O OD2 . ASP B 1 323 ? 11.448  30.183  -44.323 1.00 64.44 ? 323  ASP B OD2 1 
ATOM   6593 N N   . LEU B 1 324 ? 10.081  25.397  -40.943 1.00 52.00 ? 324  LEU B N   1 
ATOM   6594 C CA  . LEU B 1 324 ? 9.641   24.039  -40.881 1.00 49.03 ? 324  LEU B CA  1 
ATOM   6595 C C   . LEU B 1 324 ? 8.628   23.860  -39.765 1.00 46.76 ? 324  LEU B C   1 
ATOM   6596 O O   . LEU B 1 324 ? 8.880   24.275  -38.636 1.00 47.10 ? 324  LEU B O   1 
ATOM   6597 C CB  . LEU B 1 324 ? 10.847  23.137  -40.650 1.00 49.15 ? 324  LEU B CB  1 
ATOM   6598 C CG  . LEU B 1 324 ? 10.601  21.630  -40.669 1.00 49.03 ? 324  LEU B CG  1 
ATOM   6599 C CD1 . LEU B 1 324 ? 10.185  21.208  -42.053 1.00 50.53 ? 324  LEU B CD1 1 
ATOM   6600 C CD2 . LEU B 1 324 ? 11.854  20.888  -40.248 1.00 48.98 ? 324  LEU B CD2 1 
ATOM   6601 N N   . GLN B 1 325 ? 7.493   23.244  -40.076 1.00 43.43 ? 325  GLN B N   1 
ATOM   6602 C CA  . GLN B 1 325 ? 6.594   22.778  -39.031 1.00 40.94 ? 325  GLN B CA  1 
ATOM   6603 C C   . GLN B 1 325 ? 6.702   21.252  -38.911 1.00 39.53 ? 325  GLN B C   1 
ATOM   6604 O O   . GLN B 1 325 ? 6.713   20.546  -39.907 1.00 38.77 ? 325  GLN B O   1 
ATOM   6605 C CB  . GLN B 1 325 ? 5.158   23.210  -39.283 1.00 40.71 ? 325  GLN B CB  1 
ATOM   6606 C CG  . GLN B 1 325 ? 4.946   24.729  -39.494 1.00 41.16 ? 325  GLN B CG  1 
ATOM   6607 C CD  . GLN B 1 325 ? 5.096   25.125  -40.944 1.00 41.66 ? 325  GLN B CD  1 
ATOM   6608 O OE1 . GLN B 1 325 ? 4.520   24.509  -41.823 1.00 42.07 ? 325  GLN B OE1 1 
ATOM   6609 N NE2 . GLN B 1 325 ? 5.923   26.120  -41.203 1.00 44.34 ? 325  GLN B NE2 1 
ATOM   6610 N N   . VAL B 1 326 ? 6.793   20.760  -37.685 1.00 37.84 ? 326  VAL B N   1 
ATOM   6611 C CA  . VAL B 1 326 ? 6.967   19.347  -37.433 1.00 37.53 ? 326  VAL B CA  1 
ATOM   6612 C C   . VAL B 1 326 ? 6.022   18.897  -36.331 1.00 37.31 ? 326  VAL B C   1 
ATOM   6613 O O   . VAL B 1 326 ? 5.908   19.561  -35.300 1.00 37.57 ? 326  VAL B O   1 
ATOM   6614 C CB  . VAL B 1 326 ? 8.445   18.996  -37.017 1.00 37.18 ? 326  VAL B CB  1 
ATOM   6615 C CG1 . VAL B 1 326 ? 8.549   17.573  -36.588 1.00 38.23 ? 326  VAL B CG1 1 
ATOM   6616 C CG2 . VAL B 1 326 ? 9.392   19.190  -38.163 1.00 36.68 ? 326  VAL B CG2 1 
ATOM   6617 N N   . LEU B 1 327 ? 5.351   17.766  -36.555 1.00 36.46 ? 327  LEU B N   1 
ATOM   6618 C CA  . LEU B 1 327 ? 4.560   17.108  -35.529 1.00 36.06 ? 327  LEU B CA  1 
ATOM   6619 C C   . LEU B 1 327 ? 5.222   15.742  -35.178 1.00 36.35 ? 327  LEU B C   1 
ATOM   6620 O O   . LEU B 1 327 ? 5.425   14.898  -36.065 1.00 36.46 ? 327  LEU B O   1 
ATOM   6621 C CB  . LEU B 1 327 ? 3.099   16.975  -36.008 1.00 35.71 ? 327  LEU B CB  1 
ATOM   6622 C CG  . LEU B 1 327 ? 2.139   16.087  -35.200 1.00 36.08 ? 327  LEU B CG  1 
ATOM   6623 C CD1 . LEU B 1 327 ? 1.785   16.743  -33.877 1.00 35.48 ? 327  LEU B CD1 1 
ATOM   6624 C CD2 . LEU B 1 327 ? 0.845   15.748  -35.983 1.00 35.83 ? 327  LEU B CD2 1 
ATOM   6625 N N   . VAL B 1 328 ? 5.595   15.555  -33.909 1.00 35.95 ? 328  VAL B N   1 
ATOM   6626 C CA  . VAL B 1 328 ? 6.271   14.337  -33.453 1.00 36.61 ? 328  VAL B CA  1 
ATOM   6627 C C   . VAL B 1 328 ? 5.567   13.767  -32.232 1.00 36.56 ? 328  VAL B C   1 
ATOM   6628 O O   . VAL B 1 328 ? 5.074   14.516  -31.390 1.00 36.77 ? 328  VAL B O   1 
ATOM   6629 C CB  . VAL B 1 328 ? 7.750   14.586  -33.014 1.00 36.85 ? 328  VAL B CB  1 
ATOM   6630 C CG1 . VAL B 1 328 ? 8.627   14.722  -34.180 1.00 38.75 ? 328  VAL B CG1 1 
ATOM   6631 C CG2 . VAL B 1 328 ? 7.874   15.832  -32.133 1.00 36.26 ? 328  VAL B CG2 1 
ATOM   6632 N N   . GLY B 1 329 ? 5.543   12.448  -32.111 1.00 35.83 ? 329  GLY B N   1 
ATOM   6633 C CA  . GLY B 1 329 ? 5.006   11.856  -30.917 1.00 35.38 ? 329  GLY B CA  1 
ATOM   6634 C C   . GLY B 1 329 ? 5.377   10.403  -30.752 1.00 35.62 ? 329  GLY B C   1 
ATOM   6635 O O   . GLY B 1 329 ? 5.998   9.807   -31.613 1.00 35.51 ? 329  GLY B O   1 
ATOM   6636 N N   . VAL B 1 330 ? 4.973   9.848   -29.622 1.00 35.89 ? 330  VAL B N   1 
ATOM   6637 C CA  . VAL B 1 330 ? 5.203   8.469   -29.285 1.00 36.29 ? 330  VAL B CA  1 
ATOM   6638 C C   . VAL B 1 330 ? 3.874   7.891   -28.750 1.00 37.47 ? 330  VAL B C   1 
ATOM   6639 O O   . VAL B 1 330 ? 2.908   8.646   -28.475 1.00 38.24 ? 330  VAL B O   1 
ATOM   6640 C CB  . VAL B 1 330 ? 6.345   8.336   -28.223 1.00 36.15 ? 330  VAL B CB  1 
ATOM   6641 C CG1 . VAL B 1 330 ? 7.675   8.874   -28.771 1.00 35.67 ? 330  VAL B CG1 1 
ATOM   6642 C CG2 . VAL B 1 330 ? 5.979   9.061   -26.948 1.00 35.06 ? 330  VAL B CG2 1 
ATOM   6643 N N   . VAL B 1 331 ? 3.815   6.569   -28.640 1.00 37.21 ? 331  VAL B N   1 
ATOM   6644 C CA  . VAL B 1 331 ? 2.688   5.892   -28.044 1.00 37.46 ? 331  VAL B CA  1 
ATOM   6645 C C   . VAL B 1 331 ? 3.068   5.581   -26.608 1.00 38.81 ? 331  VAL B C   1 
ATOM   6646 O O   . VAL B 1 331 ? 4.241   5.735   -26.220 1.00 39.87 ? 331  VAL B O   1 
ATOM   6647 C CB  . VAL B 1 331 ? 2.306   4.586   -28.819 1.00 37.53 ? 331  VAL B CB  1 
ATOM   6648 C CG1 . VAL B 1 331 ? 1.791   4.914   -30.212 1.00 36.34 ? 331  VAL B CG1 1 
ATOM   6649 C CG2 . VAL B 1 331 ? 3.480   3.595   -28.887 1.00 34.52 ? 331  VAL B CG2 1 
ATOM   6650 N N   . LYS B 1 332 ? 2.102   5.122   -25.817 1.00 39.69 ? 332  LYS B N   1 
ATOM   6651 C CA  . LYS B 1 332 ? 2.347   4.912   -24.401 1.00 40.85 ? 332  LYS B CA  1 
ATOM   6652 C C   . LYS B 1 332 ? 3.338   3.803   -24.148 1.00 40.41 ? 332  LYS B C   1 
ATOM   6653 O O   . LYS B 1 332 ? 3.979   3.795   -23.122 1.00 40.99 ? 332  LYS B O   1 
ATOM   6654 C CB  . LYS B 1 332 ? 1.042   4.641   -23.642 1.00 41.19 ? 332  LYS B CB  1 
ATOM   6655 C CG  . LYS B 1 332 ? 1.122   4.839   -22.112 1.00 41.55 ? 332  LYS B CG  1 
ATOM   6656 C CD  . LYS B 1 332 ? -0.171  4.335   -21.403 1.00 43.86 ? 332  LYS B CD  1 
ATOM   6657 C CE  . LYS B 1 332 ? 0.040   3.004   -20.576 1.00 49.70 ? 332  LYS B CE  1 
ATOM   6658 N NZ  . LYS B 1 332 ? -0.276  1.664   -21.256 1.00 49.29 ? 332  LYS B NZ  1 
ATOM   6659 N N   . ASP B 1 333 ? 3.487   2.862   -25.066 1.00 40.85 ? 333  ASP B N   1 
ATOM   6660 C CA  . ASP B 1 333 ? 4.310   1.688   -24.766 1.00 41.26 ? 333  ASP B CA  1 
ATOM   6661 C C   . ASP B 1 333 ? 5.212   1.270   -25.926 1.00 41.51 ? 333  ASP B C   1 
ATOM   6662 O O   . ASP B 1 333 ? 5.141   0.134   -26.412 1.00 41.00 ? 333  ASP B O   1 
ATOM   6663 C CB  . ASP B 1 333 ? 3.419   0.523   -24.311 1.00 41.32 ? 333  ASP B CB  1 
ATOM   6664 C CG  . ASP B 1 333 ? 2.770   0.773   -22.968 1.00 42.16 ? 333  ASP B CG  1 
ATOM   6665 O OD1 . ASP B 1 333 ? 1.576   1.145   -22.945 1.00 42.89 ? 333  ASP B OD1 1 
ATOM   6666 O OD2 . ASP B 1 333 ? 3.464   0.622   -21.937 1.00 41.95 ? 333  ASP B OD2 1 
ATOM   6667 N N   . GLU B 1 334 ? 6.088   2.187   -26.342 1.00 41.69 ? 334  GLU B N   1 
ATOM   6668 C CA  . GLU B 1 334 ? 6.991   1.946   -27.479 1.00 41.93 ? 334  GLU B CA  1 
ATOM   6669 C C   . GLU B 1 334 ? 7.785   0.636   -27.416 1.00 42.10 ? 334  GLU B C   1 
ATOM   6670 O O   . GLU B 1 334 ? 8.115   0.051   -28.443 1.00 42.50 ? 334  GLU B O   1 
ATOM   6671 C CB  . GLU B 1 334 ? 7.939   3.121   -27.669 1.00 41.97 ? 334  GLU B CB  1 
ATOM   6672 C CG  . GLU B 1 334 ? 7.220   4.431   -27.939 1.00 42.82 ? 334  GLU B CG  1 
ATOM   6673 C CD  . GLU B 1 334 ? 6.739   4.543   -29.367 1.00 44.06 ? 334  GLU B CD  1 
ATOM   6674 O OE1 . GLU B 1 334 ? 7.025   3.629   -30.174 1.00 44.38 ? 334  GLU B OE1 1 
ATOM   6675 O OE2 . GLU B 1 334 ? 6.085   5.560   -29.685 1.00 42.01 ? 334  GLU B OE2 1 
ATOM   6676 N N   . GLY B 1 335 ? 8.048   0.145   -26.223 1.00 42.39 ? 335  GLY B N   1 
ATOM   6677 C CA  . GLY B 1 335 ? 8.921   -0.983  -26.096 1.00 44.03 ? 335  GLY B CA  1 
ATOM   6678 C C   . GLY B 1 335 ? 8.318   -2.368  -25.953 1.00 45.13 ? 335  GLY B C   1 
ATOM   6679 O O   . GLY B 1 335 ? 9.057   -3.350  -26.003 1.00 45.49 ? 335  GLY B O   1 
ATOM   6680 N N   . SER B 1 336 ? 7.007   -2.465  -25.759 1.00 46.12 ? 336  SER B N   1 
ATOM   6681 C CA  . SER B 1 336 ? 6.407   -3.743  -25.411 1.00 47.40 ? 336  SER B CA  1 
ATOM   6682 C C   . SER B 1 336 ? 6.514   -4.748  -26.560 1.00 49.16 ? 336  SER B C   1 
ATOM   6683 O O   . SER B 1 336 ? 6.824   -5.915  -26.349 1.00 49.58 ? 336  SER B O   1 
ATOM   6684 C CB  . SER B 1 336 ? 4.951   -3.554  -25.012 1.00 46.75 ? 336  SER B CB  1 
ATOM   6685 O OG  . SER B 1 336 ? 4.169   -3.239  -26.141 1.00 45.29 ? 336  SER B OG  1 
ATOM   6686 N N   . TYR B 1 337 ? 6.303   -4.264  -27.775 1.00 51.20 ? 337  TYR B N   1 
ATOM   6687 C CA  . TYR B 1 337 ? 6.124   -5.108  -28.944 1.00 53.27 ? 337  TYR B CA  1 
ATOM   6688 C C   . TYR B 1 337 ? 7.307   -6.025  -29.209 1.00 54.21 ? 337  TYR B C   1 
ATOM   6689 O O   . TYR B 1 337 ? 7.127   -7.203  -29.444 1.00 54.64 ? 337  TYR B O   1 
ATOM   6690 C CB  . TYR B 1 337 ? 5.832   -4.226  -30.163 1.00 53.53 ? 337  TYR B CB  1 
ATOM   6691 C CG  . TYR B 1 337 ? 5.322   -4.949  -31.376 1.00 54.14 ? 337  TYR B CG  1 
ATOM   6692 C CD1 . TYR B 1 337 ? 3.960   -4.972  -31.667 1.00 55.28 ? 337  TYR B CD1 1 
ATOM   6693 C CD2 . TYR B 1 337 ? 6.204   -5.588  -32.258 1.00 55.32 ? 337  TYR B CD2 1 
ATOM   6694 C CE1 . TYR B 1 337 ? 3.473   -5.620  -32.810 1.00 55.44 ? 337  TYR B CE1 1 
ATOM   6695 C CE2 . TYR B 1 337 ? 5.737   -6.246  -33.400 1.00 55.34 ? 337  TYR B CE2 1 
ATOM   6696 C CZ  . TYR B 1 337 ? 4.364   -6.264  -33.671 1.00 55.55 ? 337  TYR B CZ  1 
ATOM   6697 O OH  . TYR B 1 337 ? 3.883   -6.914  -34.803 1.00 55.44 ? 337  TYR B OH  1 
ATOM   6698 N N   . PHE B 1 338 ? 8.517   -5.502  -29.155 1.00 55.93 ? 338  PHE B N   1 
ATOM   6699 C CA  . PHE B 1 338 ? 9.658   -6.306  -29.553 1.00 57.54 ? 338  PHE B CA  1 
ATOM   6700 C C   . PHE B 1 338 ? 10.166  -7.269  -28.491 1.00 57.66 ? 338  PHE B C   1 
ATOM   6701 O O   . PHE B 1 338 ? 11.006  -8.135  -28.771 1.00 57.75 ? 338  PHE B O   1 
ATOM   6702 C CB  . PHE B 1 338 ? 10.783  -5.430  -30.117 1.00 58.87 ? 338  PHE B CB  1 
ATOM   6703 C CG  . PHE B 1 338 ? 10.650  -5.171  -31.599 1.00 61.49 ? 338  PHE B CG  1 
ATOM   6704 C CD1 . PHE B 1 338 ? 10.729  -3.878  -32.106 1.00 62.50 ? 338  PHE B CD1 1 
ATOM   6705 C CD2 . PHE B 1 338 ? 10.399  -6.239  -32.490 1.00 64.40 ? 338  PHE B CD2 1 
ATOM   6706 C CE1 . PHE B 1 338 ? 10.596  -3.648  -33.477 1.00 64.12 ? 338  PHE B CE1 1 
ATOM   6707 C CE2 . PHE B 1 338 ? 10.254  -6.025  -33.870 1.00 65.28 ? 338  PHE B CE2 1 
ATOM   6708 C CZ  . PHE B 1 338 ? 10.358  -4.723  -34.366 1.00 64.62 ? 338  PHE B CZ  1 
ATOM   6709 N N   . LEU B 1 339 ? 9.645   -7.138  -27.279 1.00 57.63 ? 339  LEU B N   1 
ATOM   6710 C CA  . LEU B 1 339 ? 10.094  -7.989  -26.183 1.00 57.77 ? 339  LEU B CA  1 
ATOM   6711 C C   . LEU B 1 339 ? 9.882   -9.477  -26.493 1.00 58.35 ? 339  LEU B C   1 
ATOM   6712 O O   . LEU B 1 339 ? 10.764  -10.301 -26.230 1.00 58.61 ? 339  LEU B O   1 
ATOM   6713 C CB  . LEU B 1 339 ? 9.388   -7.591  -24.892 1.00 57.29 ? 339  LEU B CB  1 
ATOM   6714 C CG  . LEU B 1 339 ? 9.750   -6.218  -24.344 1.00 56.00 ? 339  LEU B CG  1 
ATOM   6715 C CD1 . LEU B 1 339 ? 8.909   -5.931  -23.140 1.00 54.83 ? 339  LEU B CD1 1 
ATOM   6716 C CD2 . LEU B 1 339 ? 11.229  -6.146  -23.996 1.00 55.02 ? 339  LEU B CD2 1 
ATOM   6717 N N   . VAL B 1 340 ? 8.725   -9.795  -27.076 1.00 58.64 ? 340  VAL B N   1 
ATOM   6718 C CA  . VAL B 1 340 ? 8.353   -11.168 -27.449 1.00 59.13 ? 340  VAL B CA  1 
ATOM   6719 C C   . VAL B 1 340 ? 9.186   -11.753 -28.607 1.00 59.65 ? 340  VAL B C   1 
ATOM   6720 O O   . VAL B 1 340 ? 9.105   -12.949 -28.906 1.00 60.07 ? 340  VAL B O   1 
ATOM   6721 C CB  . VAL B 1 340 ? 6.843   -11.279 -27.815 1.00 58.72 ? 340  VAL B CB  1 
ATOM   6722 C CG1 . VAL B 1 340 ? 5.972   -10.614 -26.759 1.00 58.93 ? 340  VAL B CG1 1 
ATOM   6723 C CG2 . VAL B 1 340 ? 6.576   -10.666 -29.161 1.00 57.75 ? 340  VAL B CG2 1 
ATOM   6724 N N   . TYR B 1 341 ? 9.972   -10.914 -29.263 1.00 59.95 ? 341  TYR B N   1 
ATOM   6725 C CA  . TYR B 1 341 ? 10.756  -11.359 -30.401 1.00 60.61 ? 341  TYR B CA  1 
ATOM   6726 C C   . TYR B 1 341 ? 12.192  -11.735 -30.012 1.00 61.13 ? 341  TYR B C   1 
ATOM   6727 O O   . TYR B 1 341 ? 13.078  -11.815 -30.878 1.00 61.79 ? 341  TYR B O   1 
ATOM   6728 C CB  . TYR B 1 341 ? 10.767  -10.290 -31.508 1.00 60.48 ? 341  TYR B CB  1 
ATOM   6729 C CG  . TYR B 1 341 ? 9.532   -10.272 -32.383 1.00 60.60 ? 341  TYR B CG  1 
ATOM   6730 C CD1 . TYR B 1 341 ? 8.338   -9.698  -31.933 1.00 59.89 ? 341  TYR B CD1 1 
ATOM   6731 C CD2 . TYR B 1 341 ? 9.559   -10.812 -33.673 1.00 60.50 ? 341  TYR B CD2 1 
ATOM   6732 C CE1 . TYR B 1 341 ? 7.199   -9.666  -32.743 1.00 59.84 ? 341  TYR B CE1 1 
ATOM   6733 C CE2 . TYR B 1 341 ? 8.423   -10.787 -34.488 1.00 59.99 ? 341  TYR B CE2 1 
ATOM   6734 C CZ  . TYR B 1 341 ? 7.252   -10.215 -34.018 1.00 60.54 ? 341  TYR B CZ  1 
ATOM   6735 O OH  . TYR B 1 341 ? 6.129   -10.192 -34.819 1.00 61.47 ? 341  TYR B OH  1 
ATOM   6736 N N   . GLY B 1 342 ? 12.448  -11.956 -28.726 1.00 61.19 ? 342  GLY B N   1 
ATOM   6737 C CA  . GLY B 1 342 ? 13.794  -12.403 -28.350 1.00 61.15 ? 342  GLY B CA  1 
ATOM   6738 C C   . GLY B 1 342 ? 14.324  -12.008 -26.994 1.00 60.52 ? 342  GLY B C   1 
ATOM   6739 O O   . GLY B 1 342 ? 15.530  -12.064 -26.766 1.00 60.57 ? 342  GLY B O   1 
ATOM   6740 N N   . VAL B 1 343 ? 13.432  -11.593 -26.105 1.00 59.77 ? 343  VAL B N   1 
ATOM   6741 C CA  . VAL B 1 343 ? 13.807  -11.457 -24.719 1.00 59.70 ? 343  VAL B CA  1 
ATOM   6742 C C   . VAL B 1 343 ? 13.215  -12.635 -23.940 1.00 59.47 ? 343  VAL B C   1 
ATOM   6743 O O   . VAL B 1 343 ? 11.988  -12.754 -23.833 1.00 59.60 ? 343  VAL B O   1 
ATOM   6744 C CB  . VAL B 1 343 ? 13.369  -10.100 -24.105 1.00 59.90 ? 343  VAL B CB  1 
ATOM   6745 C CG1 . VAL B 1 343 ? 13.947  -9.947  -22.687 1.00 59.54 ? 343  VAL B CG1 1 
ATOM   6746 C CG2 . VAL B 1 343 ? 13.828  -8.930  -24.974 1.00 59.87 ? 343  VAL B CG2 1 
ATOM   6747 N N   . PRO B 1 344 ? 14.080  -13.526 -23.414 1.00 59.42 ? 344  PRO B N   1 
ATOM   6748 C CA  . PRO B 1 344 ? 13.565  -14.658 -22.629 1.00 59.45 ? 344  PRO B CA  1 
ATOM   6749 C C   . PRO B 1 344 ? 12.597  -14.202 -21.541 1.00 59.25 ? 344  PRO B C   1 
ATOM   6750 O O   . PRO B 1 344 ? 12.874  -13.241 -20.831 1.00 59.47 ? 344  PRO B O   1 
ATOM   6751 C CB  . PRO B 1 344 ? 14.831  -15.267 -22.011 1.00 59.30 ? 344  PRO B CB  1 
ATOM   6752 C CG  . PRO B 1 344 ? 15.928  -14.924 -22.990 1.00 59.58 ? 344  PRO B CG  1 
ATOM   6753 C CD  . PRO B 1 344 ? 15.554  -13.560 -23.537 1.00 59.60 ? 344  PRO B CD  1 
ATOM   6754 N N   . GLY B 1 345 ? 11.461  -14.870 -21.437 1.00 58.95 ? 345  GLY B N   1 
ATOM   6755 C CA  . GLY B 1 345 ? 10.518  -14.590 -20.374 1.00 58.85 ? 345  GLY B CA  1 
ATOM   6756 C C   . GLY B 1 345 ? 9.310   -13.876 -20.917 1.00 59.03 ? 345  GLY B C   1 
ATOM   6757 O O   . GLY B 1 345 ? 8.288   -13.743 -20.230 1.00 59.36 ? 345  GLY B O   1 
ATOM   6758 N N   . PHE B 1 346 ? 9.414   -13.420 -22.160 1.00 59.06 ? 346  PHE B N   1 
ATOM   6759 C CA  . PHE B 1 346 ? 8.321   -12.665 -22.761 1.00 59.18 ? 346  PHE B CA  1 
ATOM   6760 C C   . PHE B 1 346 ? 7.536   -13.466 -23.803 1.00 60.12 ? 346  PHE B C   1 
ATOM   6761 O O   . PHE B 1 346 ? 8.120   -14.114 -24.689 1.00 60.09 ? 346  PHE B O   1 
ATOM   6762 C CB  . PHE B 1 346 ? 8.835   -11.332 -23.324 1.00 58.24 ? 346  PHE B CB  1 
ATOM   6763 C CG  . PHE B 1 346 ? 9.226   -10.335 -22.253 1.00 56.18 ? 346  PHE B CG  1 
ATOM   6764 C CD1 . PHE B 1 346 ? 10.501  -10.363 -21.684 1.00 52.08 ? 346  PHE B CD1 1 
ATOM   6765 C CD2 . PHE B 1 346 ? 8.311   -9.382  -21.806 1.00 53.99 ? 346  PHE B CD2 1 
ATOM   6766 C CE1 . PHE B 1 346 ? 10.855  -9.477  -20.698 1.00 50.58 ? 346  PHE B CE1 1 
ATOM   6767 C CE2 . PHE B 1 346 ? 8.668   -8.483  -20.819 1.00 52.53 ? 346  PHE B CE2 1 
ATOM   6768 C CZ  . PHE B 1 346 ? 9.946   -8.531  -20.268 1.00 52.55 ? 346  PHE B CZ  1 
ATOM   6769 N N   . SER B 1 347 ? 6.209   -13.420 -23.662 1.00 61.07 ? 347  SER B N   1 
ATOM   6770 C CA  . SER B 1 347 ? 5.269   -14.060 -24.585 1.00 62.22 ? 347  SER B CA  1 
ATOM   6771 C C   . SER B 1 347 ? 3.945   -13.317 -24.572 1.00 62.44 ? 347  SER B C   1 
ATOM   6772 O O   . SER B 1 347 ? 3.552   -12.774 -23.545 1.00 62.36 ? 347  SER B O   1 
ATOM   6773 C CB  . SER B 1 347 ? 5.048   -15.536 -24.197 1.00 62.53 ? 347  SER B CB  1 
ATOM   6774 O OG  . SER B 1 347 ? 3.721   -15.970 -24.495 1.00 63.43 ? 347  SER B OG  1 
ATOM   6775 N N   . LYS B 1 348 ? 3.254   -13.319 -25.709 1.00 63.20 ? 348  LYS B N   1 
ATOM   6776 C CA  . LYS B 1 348 ? 1.905   -12.741 -25.811 1.00 64.12 ? 348  LYS B CA  1 
ATOM   6777 C C   . LYS B 1 348 ? 0.846   -13.580 -25.101 1.00 64.53 ? 348  LYS B C   1 
ATOM   6778 O O   . LYS B 1 348 ? -0.259  -13.107 -24.808 1.00 64.15 ? 348  LYS B O   1 
ATOM   6779 C CB  . LYS B 1 348 ? 1.496   -12.563 -27.278 1.00 63.79 ? 348  LYS B CB  1 
ATOM   6780 C CG  . LYS B 1 348 ? 1.370   -13.859 -28.054 1.00 64.12 ? 348  LYS B CG  1 
ATOM   6781 C CD  . LYS B 1 348 ? 0.809   -13.627 -29.451 1.00 64.86 ? 348  LYS B CD  1 
ATOM   6782 C CE  . LYS B 1 348 ? -0.066  -14.799 -29.906 1.00 65.75 ? 348  LYS B CE  1 
ATOM   6783 N NZ  . LYS B 1 348 ? -1.441  -14.700 -29.356 1.00 65.36 ? 348  LYS B NZ  1 
ATOM   6784 N N   . ASP B 1 349 ? 1.190   -14.836 -24.834 1.00 65.67 ? 349  ASP B N   1 
ATOM   6785 C CA  . ASP B 1 349 ? 0.198   -15.804 -24.358 1.00 66.63 ? 349  ASP B CA  1 
ATOM   6786 C C   . ASP B 1 349 ? 0.002   -15.770 -22.826 1.00 66.88 ? 349  ASP B C   1 
ATOM   6787 O O   . ASP B 1 349 ? -1.133  -15.718 -22.354 1.00 67.35 ? 349  ASP B O   1 
ATOM   6788 C CB  . ASP B 1 349 ? 0.461   -17.206 -24.960 1.00 66.35 ? 349  ASP B CB  1 
ATOM   6789 C CG  . ASP B 1 349 ? 0.379   -17.207 -26.514 1.00 66.50 ? 349  ASP B CG  1 
ATOM   6790 O OD1 . ASP B 1 349 ? -0.512  -16.530 -27.085 1.00 65.79 ? 349  ASP B OD1 1 
ATOM   6791 O OD2 . ASP B 1 349 ? 1.212   -17.869 -27.177 1.00 66.40 ? 349  ASP B OD2 1 
ATOM   6792 N N   . ASN B 1 350 ? 1.093   -15.737 -22.061 1.00 67.04 ? 350  ASN B N   1 
ATOM   6793 C CA  . ASN B 1 350 ? 1.002   -15.462 -20.615 1.00 66.74 ? 350  ASN B CA  1 
ATOM   6794 C C   . ASN B 1 350 ? 1.126   -13.948 -20.319 1.00 66.74 ? 350  ASN B C   1 
ATOM   6795 O O   . ASN B 1 350 ? 1.021   -13.133 -21.233 1.00 66.52 ? 350  ASN B O   1 
ATOM   6796 C CB  . ASN B 1 350 ? 2.015   -16.319 -19.818 1.00 66.48 ? 350  ASN B CB  1 
ATOM   6797 C CG  . ASN B 1 350 ? 3.456   -16.045 -20.208 1.00 66.28 ? 350  ASN B CG  1 
ATOM   6798 O OD1 . ASN B 1 350 ? 3.844   -14.894 -20.377 1.00 66.94 ? 350  ASN B OD1 1 
ATOM   6799 N ND2 . ASN B 1 350 ? 4.257   -17.098 -20.347 1.00 65.55 ? 350  ASN B ND2 1 
ATOM   6800 N N   . GLU B 1 351 ? 1.340   -13.584 -19.051 1.00 66.73 ? 351  GLU B N   1 
ATOM   6801 C CA  . GLU B 1 351 ? 1.493   -12.188 -18.635 1.00 66.65 ? 351  GLU B CA  1 
ATOM   6802 C C   . GLU B 1 351 ? 2.967   -11.737 -18.491 1.00 66.02 ? 351  GLU B C   1 
ATOM   6803 O O   . GLU B 1 351 ? 3.248   -10.598 -18.100 1.00 65.94 ? 351  GLU B O   1 
ATOM   6804 C CB  . GLU B 1 351 ? 0.714   -11.939 -17.343 1.00 66.60 ? 351  GLU B CB  1 
ATOM   6805 C CG  . GLU B 1 351 ? -0.644  -11.246 -17.532 1.00 67.41 ? 351  GLU B CG  1 
ATOM   6806 C CD  . GLU B 1 351 ? -1.432  -11.125 -16.214 1.00 68.48 ? 351  GLU B CD  1 
ATOM   6807 O OE1 . GLU B 1 351 ? -0.797  -11.048 -15.133 1.00 71.02 ? 351  GLU B OE1 1 
ATOM   6808 O OE2 . GLU B 1 351 ? -2.691  -11.106 -16.250 1.00 70.48 ? 351  GLU B OE2 1 
ATOM   6809 N N   . SER B 1 352 ? 3.894   -12.632 -18.826 1.00 65.26 ? 352  SER B N   1 
ATOM   6810 C CA  . SER B 1 352 ? 5.342   -12.354 -18.812 1.00 64.82 ? 352  SER B CA  1 
ATOM   6811 C C   . SER B 1 352 ? 5.832   -11.637 -17.553 1.00 64.48 ? 352  SER B C   1 
ATOM   6812 O O   . SER B 1 352 ? 6.567   -10.650 -17.630 1.00 64.69 ? 352  SER B O   1 
ATOM   6813 C CB  . SER B 1 352 ? 5.793   -11.593 -20.070 1.00 64.74 ? 352  SER B CB  1 
ATOM   6814 O OG  . SER B 1 352 ? 4.988   -11.899 -21.192 1.00 65.56 ? 352  SER B OG  1 
ATOM   6815 N N   . LEU B 1 353 ? 5.416   -12.139 -16.393 1.00 63.92 ? 353  LEU B N   1 
ATOM   6816 C CA  . LEU B 1 353 ? 5.996   -11.727 -15.121 1.00 63.06 ? 353  LEU B CA  1 
ATOM   6817 C C   . LEU B 1 353 ? 7.391   -12.325 -15.043 1.00 62.74 ? 353  LEU B C   1 
ATOM   6818 O O   . LEU B 1 353 ? 7.544   -13.502 -14.777 1.00 62.98 ? 353  LEU B O   1 
ATOM   6819 C CB  . LEU B 1 353 ? 5.132   -12.196 -13.951 1.00 62.67 ? 353  LEU B CB  1 
ATOM   6820 C CG  . LEU B 1 353 ? 3.655   -11.781 -13.955 1.00 62.62 ? 353  LEU B CG  1 
ATOM   6821 C CD1 . LEU B 1 353 ? 2.922   -12.463 -12.815 1.00 64.32 ? 353  LEU B CD1 1 
ATOM   6822 C CD2 . LEU B 1 353 ? 3.455   -10.278 -13.875 1.00 61.41 ? 353  LEU B CD2 1 
ATOM   6823 N N   . ILE B 1 354 ? 8.402   -11.507 -15.311 1.00 62.68 ? 354  ILE B N   1 
ATOM   6824 C CA  . ILE B 1 354 ? 9.795   -11.952 -15.343 1.00 62.28 ? 354  ILE B CA  1 
ATOM   6825 C C   . ILE B 1 354 ? 10.536  -11.808 -14.007 1.00 62.62 ? 354  ILE B C   1 
ATOM   6826 O O   . ILE B 1 354 ? 10.117  -11.076 -13.108 1.00 62.56 ? 354  ILE B O   1 
ATOM   6827 C CB  . ILE B 1 354 ? 10.596  -11.209 -16.437 1.00 62.09 ? 354  ILE B CB  1 
ATOM   6828 C CG1 . ILE B 1 354 ? 10.573  -9.690  -16.201 1.00 60.66 ? 354  ILE B CG1 1 
ATOM   6829 C CG2 . ILE B 1 354 ? 10.048  -11.558 -17.813 1.00 62.07 ? 354  ILE B CG2 1 
ATOM   6830 C CD1 . ILE B 1 354 ? 11.832  -8.977  -16.662 1.00 57.37 ? 354  ILE B CD1 1 
ATOM   6831 N N   . SER B 1 355 ? 11.654  -12.518 -13.902 1.00 63.12 ? 355  SER B N   1 
ATOM   6832 C CA  . SER B 1 355 ? 12.517  -12.470 -12.734 1.00 63.45 ? 355  SER B CA  1 
ATOM   6833 C C   . SER B 1 355 ? 13.568  -11.358 -12.892 1.00 64.07 ? 355  SER B C   1 
ATOM   6834 O O   . SER B 1 355 ? 13.736  -10.788 -13.987 1.00 64.11 ? 355  SER B O   1 
ATOM   6835 C CB  . SER B 1 355 ? 13.202  -13.833 -12.542 1.00 63.25 ? 355  SER B CB  1 
ATOM   6836 O OG  . SER B 1 355 ? 14.323  -13.982 -13.410 1.00 63.45 ? 355  SER B OG  1 
ATOM   6837 N N   . ARG B 1 356 ? 14.289  -11.075 -11.806 1.00 64.45 ? 356  ARG B N   1 
ATOM   6838 C CA  . ARG B 1 356 ? 15.356  -10.090 -11.829 1.00 64.74 ? 356  ARG B CA  1 
ATOM   6839 C C   . ARG B 1 356 ? 16.509  -10.488 -12.755 1.00 64.91 ? 356  ARG B C   1 
ATOM   6840 O O   . ARG B 1 356 ? 17.127  -9.623  -13.388 1.00 64.83 ? 356  ARG B O   1 
ATOM   6841 C CB  . ARG B 1 356 ? 15.855  -9.809  -10.412 1.00 64.86 ? 356  ARG B CB  1 
ATOM   6842 C CG  . ARG B 1 356 ? 17.050  -8.861  -10.354 1.00 65.36 ? 356  ARG B CG  1 
ATOM   6843 C CD  . ARG B 1 356 ? 16.903  -7.771  -9.290  1.00 65.90 ? 356  ARG B CD  1 
ATOM   6844 N NE  . ARG B 1 356 ? 17.959  -6.772  -9.459  1.00 67.41 ? 356  ARG B NE  1 
ATOM   6845 C CZ  . ARG B 1 356 ? 17.789  -5.542  -9.956  1.00 68.20 ? 356  ARG B CZ  1 
ATOM   6846 N NH1 . ARG B 1 356 ? 16.584  -5.107  -10.322 1.00 66.92 ? 356  ARG B NH1 1 
ATOM   6847 N NH2 . ARG B 1 356 ? 18.840  -4.735  -10.076 1.00 69.08 ? 356  ARG B NH2 1 
ATOM   6848 N N   . ALA B 1 357 ? 16.804  -11.783 -12.848 1.00 65.19 ? 357  ALA B N   1 
ATOM   6849 C CA  . ALA B 1 357 ? 17.962  -12.216 -13.662 1.00 65.34 ? 357  ALA B CA  1 
ATOM   6850 C C   . ALA B 1 357 ? 17.618  -12.065 -15.136 1.00 64.85 ? 357  ALA B C   1 
ATOM   6851 O O   . ALA B 1 357 ? 18.433  -11.608 -15.941 1.00 64.63 ? 357  ALA B O   1 
ATOM   6852 C CB  . ALA B 1 357 ? 18.406  -13.665 -13.322 1.00 65.01 ? 357  ALA B CB  1 
ATOM   6853 N N   . GLN B 1 358 ? 16.379  -12.420 -15.458 1.00 64.77 ? 358  GLN B N   1 
ATOM   6854 C CA  . GLN B 1 358 ? 15.832  -12.240 -16.799 1.00 64.63 ? 358  GLN B CA  1 
ATOM   6855 C C   . GLN B 1 358 ? 15.880  -10.769 -17.225 1.00 64.21 ? 358  GLN B C   1 
ATOM   6856 O O   . GLN B 1 358 ? 16.162  -10.459 -18.393 1.00 64.17 ? 358  GLN B O   1 
ATOM   6857 C CB  . GLN B 1 358 ? 14.403  -12.766 -16.854 1.00 64.62 ? 358  GLN B CB  1 
ATOM   6858 C CG  . GLN B 1 358 ? 14.304  -14.281 -16.819 1.00 64.90 ? 358  GLN B CG  1 
ATOM   6859 C CD  . GLN B 1 358 ? 12.866  -14.744 -16.721 1.00 65.95 ? 358  GLN B CD  1 
ATOM   6860 O OE1 . GLN B 1 358 ? 12.103  -14.275 -15.867 1.00 66.45 ? 358  GLN B OE1 1 
ATOM   6861 N NE2 . GLN B 1 358 ? 12.479  -15.657 -17.606 1.00 65.61 ? 358  GLN B NE2 1 
ATOM   6862 N N   . PHE B 1 359 ? 15.622  -9.877  -16.265 1.00 63.35 ? 359  PHE B N   1 
ATOM   6863 C CA  . PHE B 1 359 ? 15.703  -8.444  -16.495 1.00 62.21 ? 359  PHE B CA  1 
ATOM   6864 C C   . PHE B 1 359 ? 17.129  -7.993  -16.817 1.00 61.78 ? 359  PHE B C   1 
ATOM   6865 O O   . PHE B 1 359 ? 17.310  -7.182  -17.713 1.00 61.90 ? 359  PHE B O   1 
ATOM   6866 C CB  . PHE B 1 359 ? 15.091  -7.670  -15.321 1.00 62.06 ? 359  PHE B CB  1 
ATOM   6867 C CG  . PHE B 1 359 ? 15.283  -6.174  -15.395 1.00 62.05 ? 359  PHE B CG  1 
ATOM   6868 C CD1 . PHE B 1 359 ? 16.314  -5.551  -14.691 1.00 61.78 ? 359  PHE B CD1 1 
ATOM   6869 C CD2 . PHE B 1 359 ? 14.430  -5.383  -16.148 1.00 61.95 ? 359  PHE B CD2 1 
ATOM   6870 C CE1 . PHE B 1 359 ? 16.495  -4.175  -14.752 1.00 60.36 ? 359  PHE B CE1 1 
ATOM   6871 C CE2 . PHE B 1 359 ? 14.606  -3.997  -16.208 1.00 60.96 ? 359  PHE B CE2 1 
ATOM   6872 C CZ  . PHE B 1 359 ? 15.638  -3.402  -15.508 1.00 60.85 ? 359  PHE B CZ  1 
ATOM   6873 N N   . LEU B 1 360 ? 18.140  -8.518  -16.125 1.00 61.30 ? 360  LEU B N   1 
ATOM   6874 C CA  . LEU B 1 360 ? 19.521  -8.081  -16.401 1.00 60.90 ? 360  LEU B CA  1 
ATOM   6875 C C   . LEU B 1 360 ? 19.996  -8.584  -17.754 1.00 60.41 ? 360  LEU B C   1 
ATOM   6876 O O   . LEU B 1 360 ? 20.711  -7.872  -18.468 1.00 60.41 ? 360  LEU B O   1 
ATOM   6877 C CB  . LEU B 1 360 ? 20.528  -8.497  -15.318 1.00 60.82 ? 360  LEU B CB  1 
ATOM   6878 C CG  . LEU B 1 360 ? 20.280  -8.365  -13.802 1.00 62.51 ? 360  LEU B CG  1 
ATOM   6879 C CD1 . LEU B 1 360 ? 21.579  -8.640  -13.016 1.00 63.93 ? 360  LEU B CD1 1 
ATOM   6880 C CD2 . LEU B 1 360 ? 19.666  -7.027  -13.349 1.00 63.00 ? 360  LEU B CD2 1 
ATOM   6881 N N   . ALA B 1 361 ? 19.598  -9.811  -18.101 1.00 59.76 ? 361  ALA B N   1 
ATOM   6882 C CA  . ALA B 1 361 ? 19.970  -10.400 -19.396 1.00 58.88 ? 361  ALA B CA  1 
ATOM   6883 C C   . ALA B 1 361 ? 19.157  -9.792  -20.536 1.00 58.01 ? 361  ALA B C   1 
ATOM   6884 O O   . ALA B 1 361 ? 19.663  -9.653  -21.647 1.00 58.52 ? 361  ALA B O   1 
ATOM   6885 C CB  . ALA B 1 361 ? 19.838  -11.922 -19.375 1.00 58.82 ? 361  ALA B CB  1 
ATOM   6886 N N   . GLY B 1 362 ? 17.910  -9.431  -20.244 1.00 56.86 ? 362  GLY B N   1 
ATOM   6887 C CA  . GLY B 1 362 ? 17.055  -8.694  -21.165 1.00 56.31 ? 362  GLY B CA  1 
ATOM   6888 C C   . GLY B 1 362 ? 17.606  -7.331  -21.542 1.00 56.37 ? 362  GLY B C   1 
ATOM   6889 O O   . GLY B 1 362 ? 17.412  -6.878  -22.664 1.00 56.42 ? 362  GLY B O   1 
ATOM   6890 N N   . VAL B 1 363 ? 18.308  -6.680  -20.608 1.00 56.24 ? 363  VAL B N   1 
ATOM   6891 C CA  . VAL B 1 363 ? 18.908  -5.358  -20.841 1.00 55.19 ? 363  VAL B CA  1 
ATOM   6892 C C   . VAL B 1 363 ? 20.128  -5.445  -21.767 1.00 55.20 ? 363  VAL B C   1 
ATOM   6893 O O   . VAL B 1 363 ? 20.361  -4.528  -22.555 1.00 55.24 ? 363  VAL B O   1 
ATOM   6894 C CB  . VAL B 1 363 ? 19.204  -4.589  -19.493 1.00 55.11 ? 363  VAL B CB  1 
ATOM   6895 C CG1 . VAL B 1 363 ? 19.961  -3.303  -19.723 1.00 53.10 ? 363  VAL B CG1 1 
ATOM   6896 C CG2 . VAL B 1 363 ? 17.909  -4.276  -18.773 1.00 54.48 ? 363  VAL B CG2 1 
ATOM   6897 N N   . ARG B 1 364 ? 20.891  -6.540  -21.708 1.00 55.09 ? 364  ARG B N   1 
ATOM   6898 C CA  . ARG B 1 364 ? 22.046  -6.681  -22.620 1.00 55.25 ? 364  ARG B CA  1 
ATOM   6899 C C   . ARG B 1 364 ? 21.564  -6.908  -24.051 1.00 55.06 ? 364  ARG B C   1 
ATOM   6900 O O   . ARG B 1 364 ? 22.293  -6.628  -25.002 1.00 54.64 ? 364  ARG B O   1 
ATOM   6901 C CB  . ARG B 1 364 ? 23.011  -7.798  -22.204 1.00 55.13 ? 364  ARG B CB  1 
ATOM   6902 C CG  . ARG B 1 364 ? 23.363  -7.897  -20.691 1.00 56.59 ? 364  ARG B CG  1 
ATOM   6903 C CD  . ARG B 1 364 ? 24.238  -6.748  -20.133 1.00 56.76 ? 364  ARG B CD  1 
ATOM   6904 N NE  . ARG B 1 364 ? 25.243  -6.231  -21.068 1.00 58.01 ? 364  ARG B NE  1 
ATOM   6905 C CZ  . ARG B 1 364 ? 26.561  -6.194  -20.831 1.00 59.30 ? 364  ARG B CZ  1 
ATOM   6906 N NH1 . ARG B 1 364 ? 27.063  -6.648  -19.680 1.00 58.82 ? 364  ARG B NH1 1 
ATOM   6907 N NH2 . ARG B 1 364 ? 27.386  -5.687  -21.743 1.00 57.78 ? 364  ARG B NH2 1 
ATOM   6908 N N   . ILE B 1 365 ? 20.330  -7.407  -24.183 1.00 54.88 ? 365  ILE B N   1 
ATOM   6909 C CA  . ILE B 1 365 ? 19.675  -7.586  -25.481 1.00 54.65 ? 365  ILE B CA  1 
ATOM   6910 C C   . ILE B 1 365 ? 19.021  -6.285  -25.981 1.00 54.64 ? 365  ILE B C   1 
ATOM   6911 O O   . ILE B 1 365 ? 19.101  -5.957  -27.178 1.00 54.60 ? 365  ILE B O   1 
ATOM   6912 C CB  . ILE B 1 365 ? 18.640  -8.743  -25.436 1.00 54.68 ? 365  ILE B CB  1 
ATOM   6913 C CG1 . ILE B 1 365 ? 19.350  -10.098 -25.296 1.00 54.94 ? 365  ILE B CG1 1 
ATOM   6914 C CG2 . ILE B 1 365 ? 17.739  -8.747  -26.684 1.00 54.55 ? 365  ILE B CG2 1 
ATOM   6915 C CD1 . ILE B 1 365 ? 18.447  -11.220 -24.782 1.00 54.46 ? 365  ILE B CD1 1 
ATOM   6916 N N   . GLY B 1 366 ? 18.385  -5.555  -25.063 1.00 54.33 ? 366  GLY B N   1 
ATOM   6917 C CA  . GLY B 1 366 ? 17.746  -4.274  -25.368 1.00 54.14 ? 366  GLY B CA  1 
ATOM   6918 C C   . GLY B 1 366 ? 18.724  -3.132  -25.580 1.00 54.09 ? 366  GLY B C   1 
ATOM   6919 O O   . GLY B 1 366 ? 18.449  -2.204  -26.321 1.00 54.14 ? 366  GLY B O   1 
ATOM   6920 N N   . VAL B 1 367 ? 19.864  -3.182  -24.910 1.00 54.30 ? 367  VAL B N   1 
ATOM   6921 C CA  . VAL B 1 367 ? 20.902  -2.177  -25.112 1.00 54.69 ? 367  VAL B CA  1 
ATOM   6922 C C   . VAL B 1 367 ? 22.156  -2.939  -25.529 1.00 55.48 ? 367  VAL B C   1 
ATOM   6923 O O   . VAL B 1 367 ? 23.092  -3.095  -24.744 1.00 55.55 ? 367  VAL B O   1 
ATOM   6924 C CB  . VAL B 1 367 ? 21.153  -1.306  -23.852 1.00 54.29 ? 367  VAL B CB  1 
ATOM   6925 C CG1 . VAL B 1 367 ? 21.867  -0.029  -24.241 1.00 53.12 ? 367  VAL B CG1 1 
ATOM   6926 C CG2 . VAL B 1 367 ? 19.850  -0.980  -23.156 1.00 53.20 ? 367  VAL B CG2 1 
ATOM   6927 N N   . PRO B 1 368 ? 22.159  -3.452  -26.768 1.00 56.12 ? 368  PRO B N   1 
ATOM   6928 C CA  . PRO B 1 368 ? 23.222  -4.369  -27.198 1.00 56.42 ? 368  PRO B CA  1 
ATOM   6929 C C   . PRO B 1 368 ? 24.595  -3.710  -27.319 1.00 56.86 ? 368  PRO B C   1 
ATOM   6930 O O   . PRO B 1 368 ? 25.611  -4.405  -27.229 1.00 56.52 ? 368  PRO B O   1 
ATOM   6931 C CB  . PRO B 1 368 ? 22.741  -4.831  -28.572 1.00 56.64 ? 368  PRO B CB  1 
ATOM   6932 C CG  . PRO B 1 368 ? 21.838  -3.711  -29.056 1.00 56.60 ? 368  PRO B CG  1 
ATOM   6933 C CD  . PRO B 1 368 ? 21.162  -3.206  -27.829 1.00 55.97 ? 368  PRO B CD  1 
ATOM   6934 N N   . GLN B 1 369 ? 24.619  -2.391  -27.525 1.00 57.39 ? 369  GLN B N   1 
ATOM   6935 C CA  . GLN B 1 369 ? 25.871  -1.660  -27.684 1.00 58.19 ? 369  GLN B CA  1 
ATOM   6936 C C   . GLN B 1 369 ? 26.431  -1.245  -26.335 1.00 57.77 ? 369  GLN B C   1 
ATOM   6937 O O   . GLN B 1 369 ? 27.482  -0.623  -26.272 1.00 57.45 ? 369  GLN B O   1 
ATOM   6938 C CB  . GLN B 1 369 ? 25.696  -0.441  -28.606 1.00 58.76 ? 369  GLN B CB  1 
ATOM   6939 C CG  . GLN B 1 369 ? 25.948  -0.720  -30.146 1.00 63.05 ? 369  GLN B CG  1 
ATOM   6940 C CD  . GLN B 1 369 ? 24.750  -1.403  -30.921 1.00 66.60 ? 369  GLN B CD  1 
ATOM   6941 O OE1 . GLN B 1 369 ? 23.609  -0.892  -30.961 1.00 66.77 ? 369  GLN B OE1 1 
ATOM   6942 N NE2 . GLN B 1 369 ? 25.045  -2.532  -31.563 1.00 65.46 ? 369  GLN B NE2 1 
ATOM   6943 N N   . ALA B 1 370 ? 25.733  -1.622  -25.263 1.00 57.67 ? 370  ALA B N   1 
ATOM   6944 C CA  . ALA B 1 370 ? 26.087  -1.239  -23.892 1.00 57.75 ? 370  ALA B CA  1 
ATOM   6945 C C   . ALA B 1 370 ? 27.183  -2.092  -23.305 1.00 57.86 ? 370  ALA B C   1 
ATOM   6946 O O   . ALA B 1 370 ? 27.068  -3.324  -23.286 1.00 57.96 ? 370  ALA B O   1 
ATOM   6947 C CB  . ALA B 1 370 ? 24.867  -1.308  -22.975 1.00 57.82 ? 370  ALA B CB  1 
ATOM   6948 N N   . SER B 1 371 ? 28.221  -1.418  -22.804 1.00 57.90 ? 371  SER B N   1 
ATOM   6949 C CA  . SER B 1 371 ? 29.284  -2.033  -22.023 1.00 57.95 ? 371  SER B CA  1 
ATOM   6950 C C   . SER B 1 371 ? 28.705  -2.547  -20.718 1.00 58.29 ? 371  SER B C   1 
ATOM   6951 O O   . SER B 1 371 ? 27.568  -2.213  -20.374 1.00 58.62 ? 371  SER B O   1 
ATOM   6952 C CB  . SER B 1 371 ? 30.374  -0.999  -21.731 1.00 58.30 ? 371  SER B CB  1 
ATOM   6953 O OG  . SER B 1 371 ? 30.009  -0.132  -20.661 1.00 58.84 ? 371  SER B OG  1 
ATOM   6954 N N   . ASP B 1 372 ? 29.480  -3.345  -19.986 1.00 58.27 ? 372  ASP B N   1 
ATOM   6955 C CA  . ASP B 1 372 ? 29.054  -3.847  -18.673 1.00 58.34 ? 372  ASP B CA  1 
ATOM   6956 C C   . ASP B 1 372 ? 28.596  -2.778  -17.682 1.00 57.51 ? 372  ASP B C   1 
ATOM   6957 O O   . ASP B 1 372 ? 27.568  -2.932  -17.003 1.00 57.23 ? 372  ASP B O   1 
ATOM   6958 C CB  . ASP B 1 372 ? 30.178  -4.660  -18.046 1.00 59.28 ? 372  ASP B CB  1 
ATOM   6959 C CG  . ASP B 1 372 ? 30.014  -6.135  -18.294 1.00 61.65 ? 372  ASP B CG  1 
ATOM   6960 O OD1 . ASP B 1 372 ? 29.839  -6.540  -19.473 1.00 63.46 ? 372  ASP B OD1 1 
ATOM   6961 O OD2 . ASP B 1 372 ? 30.034  -6.883  -17.298 1.00 64.45 ? 372  ASP B OD2 1 
ATOM   6962 N N   . LEU B 1 373 ? 29.378  -1.704  -17.607 1.00 56.39 ? 373  LEU B N   1 
ATOM   6963 C CA  . LEU B 1 373 ? 29.088  -0.585  -16.734 1.00 55.29 ? 373  LEU B CA  1 
ATOM   6964 C C   . LEU B 1 373 ? 27.825  0.174   -17.173 1.00 54.80 ? 373  LEU B C   1 
ATOM   6965 O O   . LEU B 1 373 ? 26.976  0.521   -16.336 1.00 54.23 ? 373  LEU B O   1 
ATOM   6966 C CB  . LEU B 1 373 ? 30.296  0.358   -16.674 1.00 55.34 ? 373  LEU B CB  1 
ATOM   6967 C CG  . LEU B 1 373 ? 30.129  1.605   -15.801 1.00 55.21 ? 373  LEU B CG  1 
ATOM   6968 C CD1 . LEU B 1 373 ? 29.766  1.196   -14.367 1.00 54.66 ? 373  LEU B CD1 1 
ATOM   6969 C CD2 . LEU B 1 373 ? 31.379  2.497   -15.836 1.00 54.40 ? 373  LEU B CD2 1 
ATOM   6970 N N   . ALA B 1 374 ? 27.703  0.431   -18.476 1.00 53.96 ? 374  ALA B N   1 
ATOM   6971 C CA  . ALA B 1 374 ? 26.516  1.109   -18.994 1.00 53.45 ? 374  ALA B CA  1 
ATOM   6972 C C   . ALA B 1 374 ? 25.278  0.261   -18.747 1.00 52.98 ? 374  ALA B C   1 
ATOM   6973 O O   . ALA B 1 374 ? 24.258  0.767   -18.309 1.00 52.96 ? 374  ALA B O   1 
ATOM   6974 C CB  . ALA B 1 374 ? 26.666  1.456   -20.450 1.00 53.12 ? 374  ALA B CB  1 
ATOM   6975 N N   . ALA B 1 375 ? 25.402  -1.041  -18.985 1.00 53.01 ? 375  ALA B N   1 
ATOM   6976 C CA  . ALA B 1 375 ? 24.342  -2.003  -18.706 1.00 52.85 ? 375  ALA B CA  1 
ATOM   6977 C C   . ALA B 1 375 ? 23.851  -1.844  -17.278 1.00 52.86 ? 375  ALA B C   1 
ATOM   6978 O O   . ALA B 1 375 ? 22.649  -1.868  -17.008 1.00 53.07 ? 375  ALA B O   1 
ATOM   6979 C CB  . ALA B 1 375 ? 24.848  -3.421  -18.932 1.00 52.74 ? 375  ALA B CB  1 
ATOM   6980 N N   . GLU B 1 376 ? 24.797  -1.669  -16.368 1.00 52.61 ? 376  GLU B N   1 
ATOM   6981 C CA  . GLU B 1 376 ? 24.487  -1.603  -14.956 1.00 52.67 ? 376  GLU B CA  1 
ATOM   6982 C C   . GLU B 1 376 ? 23.807  -0.292  -14.605 1.00 50.91 ? 376  GLU B C   1 
ATOM   6983 O O   . GLU B 1 376 ? 22.886  -0.267  -13.792 1.00 50.35 ? 376  GLU B O   1 
ATOM   6984 C CB  . GLU B 1 376 ? 25.753  -1.787  -14.126 1.00 53.37 ? 376  GLU B CB  1 
ATOM   6985 C CG  . GLU B 1 376 ? 25.514  -2.644  -12.892 1.00 59.00 ? 376  GLU B CG  1 
ATOM   6986 C CD  . GLU B 1 376 ? 26.776  -3.394  -12.470 1.00 66.73 ? 376  GLU B CD  1 
ATOM   6987 O OE1 . GLU B 1 376 ? 27.027  -3.463  -11.232 1.00 70.12 ? 376  GLU B OE1 1 
ATOM   6988 O OE2 . GLU B 1 376 ? 27.512  -3.897  -13.371 1.00 66.89 ? 376  GLU B OE2 1 
ATOM   6989 N N   . ALA B 1 377 ? 24.258  0.791   -15.226 1.00 49.26 ? 377  ALA B N   1 
ATOM   6990 C CA  . ALA B 1 377 ? 23.617  2.079   -15.030 1.00 48.09 ? 377  ALA B CA  1 
ATOM   6991 C C   . ALA B 1 377 ? 22.131  1.966   -15.364 1.00 47.45 ? 377  ALA B C   1 
ATOM   6992 O O   . ALA B 1 377 ? 21.291  2.468   -14.622 1.00 47.14 ? 377  ALA B O   1 
ATOM   6993 C CB  . ALA B 1 377 ? 24.279  3.137   -15.882 1.00 48.04 ? 377  ALA B CB  1 
ATOM   6994 N N   . VAL B 1 378 ? 21.824  1.272   -16.461 1.00 46.62 ? 378  VAL B N   1 
ATOM   6995 C CA  . VAL B 1 378 ? 20.468  1.145   -16.944 1.00 46.01 ? 378  VAL B CA  1 
ATOM   6996 C C   . VAL B 1 378 ? 19.653  0.374   -15.935 1.00 46.37 ? 378  VAL B C   1 
ATOM   6997 O O   . VAL B 1 378 ? 18.595  0.856   -15.501 1.00 46.63 ? 378  VAL B O   1 
ATOM   6998 C CB  . VAL B 1 378 ? 20.401  0.471   -18.334 1.00 46.52 ? 378  VAL B CB  1 
ATOM   6999 C CG1 . VAL B 1 378 ? 18.936  0.150   -18.725 1.00 44.33 ? 378  VAL B CG1 1 
ATOM   7000 C CG2 . VAL B 1 378 ? 21.101  1.347   -19.392 1.00 44.74 ? 378  VAL B CG2 1 
ATOM   7001 N N   . VAL B 1 379 ? 20.154  -0.794  -15.533 1.00 46.03 ? 379  VAL B N   1 
ATOM   7002 C CA  . VAL B 1 379 ? 19.478  -1.604  -14.528 1.00 46.23 ? 379  VAL B CA  1 
ATOM   7003 C C   . VAL B 1 379 ? 19.183  -0.812  -13.263 1.00 46.63 ? 379  VAL B C   1 
ATOM   7004 O O   . VAL B 1 379 ? 18.051  -0.825  -12.730 1.00 46.97 ? 379  VAL B O   1 
ATOM   7005 C CB  . VAL B 1 379 ? 20.277  -2.872  -14.164 1.00 46.23 ? 379  VAL B CB  1 
ATOM   7006 C CG1 . VAL B 1 379 ? 19.698  -3.515  -12.923 1.00 44.99 ? 379  VAL B CG1 1 
ATOM   7007 C CG2 . VAL B 1 379 ? 20.252  -3.869  -15.333 1.00 46.28 ? 379  VAL B CG2 1 
ATOM   7008 N N   . LEU B 1 380 ? 20.209  -0.110  -12.803 1.00 46.96 ? 380  LEU B N   1 
ATOM   7009 C CA  . LEU B 1 380 ? 20.156  0.610   -11.545 1.00 47.33 ? 380  LEU B CA  1 
ATOM   7010 C C   . LEU B 1 380 ? 19.205  1.789   -11.637 1.00 46.74 ? 380  LEU B C   1 
ATOM   7011 O O   . LEU B 1 380 ? 18.560  2.137   -10.653 1.00 46.67 ? 380  LEU B O   1 
ATOM   7012 C CB  . LEU B 1 380 ? 21.578  1.010   -11.077 1.00 47.92 ? 380  LEU B CB  1 
ATOM   7013 C CG  . LEU B 1 380 ? 22.475  -0.201  -10.682 1.00 49.39 ? 380  LEU B CG  1 
ATOM   7014 C CD1 . LEU B 1 380 ? 23.879  0.186   -10.117 1.00 50.00 ? 380  LEU B CD1 1 
ATOM   7015 C CD2 . LEU B 1 380 ? 21.772  -1.208  -9.717  1.00 48.46 ? 380  LEU B CD2 1 
ATOM   7016 N N   . HIS B 1 381 ? 19.097  2.364   -12.830 1.00 46.20 ? 381  HIS B N   1 
ATOM   7017 C CA  . HIS B 1 381 ? 18.156  3.445   -13.098 1.00 46.09 ? 381  HIS B CA  1 
ATOM   7018 C C   . HIS B 1 381 ? 16.722  2.974   -13.144 1.00 45.90 ? 381  HIS B C   1 
ATOM   7019 O O   . HIS B 1 381 ? 15.834  3.634   -12.638 1.00 46.07 ? 381  HIS B O   1 
ATOM   7020 C CB  . HIS B 1 381 ? 18.482  4.118   -14.429 1.00 46.29 ? 381  HIS B CB  1 
ATOM   7021 C CG  . HIS B 1 381 ? 17.616  5.301   -14.729 1.00 47.06 ? 381  HIS B CG  1 
ATOM   7022 N ND1 . HIS B 1 381 ? 17.819  6.538   -14.152 1.00 48.49 ? 381  HIS B ND1 1 
ATOM   7023 C CD2 . HIS B 1 381 ? 16.547  5.437   -15.546 1.00 47.47 ? 381  HIS B CD2 1 
ATOM   7024 C CE1 . HIS B 1 381 ? 16.896  7.379   -14.586 1.00 49.27 ? 381  HIS B CE1 1 
ATOM   7025 N NE2 . HIS B 1 381 ? 16.117  6.738   -15.441 1.00 48.53 ? 381  HIS B NE2 1 
ATOM   7026 N N   . TYR B 1 382 ? 16.503  1.831   -13.778 1.00 46.01 ? 382  TYR B N   1 
ATOM   7027 C CA  . TYR B 1 382 ? 15.164  1.374   -14.083 1.00 45.72 ? 382  TYR B CA  1 
ATOM   7028 C C   . TYR B 1 382 ? 14.571  0.467   -13.026 1.00 46.85 ? 382  TYR B C   1 
ATOM   7029 O O   . TYR B 1 382 ? 13.360  0.256   -13.010 1.00 47.05 ? 382  TYR B O   1 
ATOM   7030 C CB  . TYR B 1 382 ? 15.146  0.690   -15.443 1.00 44.32 ? 382  TYR B CB  1 
ATOM   7031 C CG  . TYR B 1 382 ? 14.988  1.652   -16.586 1.00 41.67 ? 382  TYR B CG  1 
ATOM   7032 C CD1 . TYR B 1 382 ? 16.099  2.185   -17.204 1.00 38.36 ? 382  TYR B CD1 1 
ATOM   7033 C CD2 . TYR B 1 382 ? 13.718  2.034   -17.043 1.00 38.36 ? 382  TYR B CD2 1 
ATOM   7034 C CE1 . TYR B 1 382 ? 15.979  3.062   -18.232 1.00 38.41 ? 382  TYR B CE1 1 
ATOM   7035 C CE2 . TYR B 1 382 ? 13.580  2.923   -18.093 1.00 37.91 ? 382  TYR B CE2 1 
ATOM   7036 C CZ  . TYR B 1 382 ? 14.730  3.439   -18.683 1.00 40.53 ? 382  TYR B CZ  1 
ATOM   7037 O OH  . TYR B 1 382 ? 14.671  4.331   -19.736 1.00 41.20 ? 382  TYR B OH  1 
ATOM   7038 N N   . THR B 1 383 ? 15.411  -0.078  -12.152 1.00 48.08 ? 383  THR B N   1 
ATOM   7039 C CA  . THR B 1 383 ? 14.901  -0.827  -11.005 1.00 49.21 ? 383  THR B CA  1 
ATOM   7040 C C   . THR B 1 383 ? 14.118  0.111   -10.104 1.00 49.64 ? 383  THR B C   1 
ATOM   7041 O O   . THR B 1 383 ? 14.556  1.221   -9.824  1.00 50.15 ? 383  THR B O   1 
ATOM   7042 C CB  . THR B 1 383 ? 16.050  -1.459  -10.220 1.00 49.29 ? 383  THR B CB  1 
ATOM   7043 O OG1 . THR B 1 383 ? 16.695  -2.420  -11.054 1.00 50.50 ? 383  THR B OG1 1 
ATOM   7044 C CG2 . THR B 1 383 ? 15.569  -2.148  -8.954  1.00 49.20 ? 383  THR B CG2 1 
ATOM   7045 N N   . ASP B 1 384 ? 12.937  -0.320  -9.689  1.00 50.82 ? 384  ASP B N   1 
ATOM   7046 C CA  . ASP B 1 384 ? 12.239  0.343   -8.598  1.00 52.13 ? 384  ASP B CA  1 
ATOM   7047 C C   . ASP B 1 384 ? 12.781  -0.201  -7.255  1.00 52.64 ? 384  ASP B C   1 
ATOM   7048 O O   . ASP B 1 384 ? 12.466  -1.329  -6.866  1.00 52.77 ? 384  ASP B O   1 
ATOM   7049 C CB  . ASP B 1 384 ? 10.734  0.116   -8.692  1.00 51.93 ? 384  ASP B CB  1 
ATOM   7050 C CG  . ASP B 1 384 ? 9.977   0.838   -7.603  1.00 53.13 ? 384  ASP B CG  1 
ATOM   7051 O OD1 . ASP B 1 384 ? 10.582  1.050   -6.526  1.00 52.93 ? 384  ASP B OD1 1 
ATOM   7052 O OD2 . ASP B 1 384 ? 8.791   1.204   -7.819  1.00 54.07 ? 384  ASP B OD2 1 
ATOM   7053 N N   . TRP B 1 385 ? 13.566  0.606   -6.543  1.00 52.58 ? 385  TRP B N   1 
ATOM   7054 C CA  . TRP B 1 385 ? 14.254  0.112   -5.345  1.00 53.56 ? 385  TRP B CA  1 
ATOM   7055 C C   . TRP B 1 385 ? 13.371  -0.210  -4.117  1.00 55.44 ? 385  TRP B C   1 
ATOM   7056 O O   . TRP B 1 385 ? 13.813  -0.891  -3.173  1.00 55.76 ? 385  TRP B O   1 
ATOM   7057 C CB  . TRP B 1 385 ? 15.474  0.979   -5.025  1.00 51.51 ? 385  TRP B CB  1 
ATOM   7058 C CG  . TRP B 1 385 ? 16.459  0.797   -6.110  1.00 49.33 ? 385  TRP B CG  1 
ATOM   7059 C CD1 . TRP B 1 385 ? 16.655  1.608   -7.192  1.00 47.31 ? 385  TRP B CD1 1 
ATOM   7060 C CD2 . TRP B 1 385 ? 17.310  -0.326  -6.292  1.00 46.75 ? 385  TRP B CD2 1 
ATOM   7061 N NE1 . TRP B 1 385 ? 17.608  1.072   -8.026  1.00 45.45 ? 385  TRP B NE1 1 
ATOM   7062 C CE2 . TRP B 1 385 ? 18.035  -0.112  -7.492  1.00 46.42 ? 385  TRP B CE2 1 
ATOM   7063 C CE3 . TRP B 1 385 ? 17.552  -1.489  -5.549  1.00 45.86 ? 385  TRP B CE3 1 
ATOM   7064 C CZ2 . TRP B 1 385 ? 18.991  -1.015  -7.962  1.00 46.85 ? 385  TRP B CZ2 1 
ATOM   7065 C CZ3 . TRP B 1 385 ? 18.498  -2.395  -6.021  1.00 46.13 ? 385  TRP B CZ3 1 
ATOM   7066 C CH2 . TRP B 1 385 ? 19.206  -2.150  -7.216  1.00 47.39 ? 385  TRP B CH2 1 
ATOM   7067 N N   . LEU B 1 386 ? 12.120  0.236   -4.168  1.00 57.34 ? 386  LEU B N   1 
ATOM   7068 C CA  . LEU B 1 386 ? 11.113  -0.136  -3.183  1.00 59.57 ? 386  LEU B CA  1 
ATOM   7069 C C   . LEU B 1 386 ? 10.596  -1.540  -3.417  1.00 60.42 ? 386  LEU B C   1 
ATOM   7070 O O   . LEU B 1 386 ? 10.093  -2.177  -2.495  1.00 61.02 ? 386  LEU B O   1 
ATOM   7071 C CB  . LEU B 1 386 ? 9.942   0.837   -3.244  1.00 59.87 ? 386  LEU B CB  1 
ATOM   7072 C CG  . LEU B 1 386 ? 10.091  2.053   -2.336  1.00 62.08 ? 386  LEU B CG  1 
ATOM   7073 C CD1 . LEU B 1 386 ? 9.742   3.395   -3.053  1.00 62.43 ? 386  LEU B CD1 1 
ATOM   7074 C CD2 . LEU B 1 386 ? 9.248   1.790   -1.081  1.00 64.25 ? 386  LEU B CD2 1 
ATOM   7075 N N   . HIS B 1 387 ? 10.687  -2.002  -4.660  1.00 61.37 ? 387  HIS B N   1 
ATOM   7076 C CA  . HIS B 1 387 ? 10.244  -3.349  -5.028  1.00 62.36 ? 387  HIS B CA  1 
ATOM   7077 C C   . HIS B 1 387 ? 11.239  -3.906  -6.045  1.00 62.56 ? 387  HIS B C   1 
ATOM   7078 O O   . HIS B 1 387 ? 10.882  -4.149  -7.195  1.00 62.20 ? 387  HIS B O   1 
ATOM   7079 C CB  . HIS B 1 387 ? 8.825   -3.347  -5.620  1.00 62.28 ? 387  HIS B CB  1 
ATOM   7080 C CG  . HIS B 1 387 ? 7.842   -2.489  -4.875  1.00 64.13 ? 387  HIS B CG  1 
ATOM   7081 N ND1 . HIS B 1 387 ? 7.350   -1.302  -5.388  1.00 64.54 ? 387  HIS B ND1 1 
ATOM   7082 C CD2 . HIS B 1 387 ? 7.255   -2.647  -3.661  1.00 64.43 ? 387  HIS B CD2 1 
ATOM   7083 C CE1 . HIS B 1 387 ? 6.503   -0.768  -4.522  1.00 64.08 ? 387  HIS B CE1 1 
ATOM   7084 N NE2 . HIS B 1 387 ? 6.430   -1.563  -3.467  1.00 64.75 ? 387  HIS B NE2 1 
ATOM   7085 N N   . PRO B 1 388 ? 12.501  -4.104  -5.620  1.00 63.26 ? 388  PRO B N   1 
ATOM   7086 C CA  . PRO B 1 388 ? 13.563  -4.488  -6.553  1.00 63.70 ? 388  PRO B CA  1 
ATOM   7087 C C   . PRO B 1 388 ? 13.257  -5.750  -7.352  1.00 64.17 ? 388  PRO B C   1 
ATOM   7088 O O   . PRO B 1 388 ? 13.781  -5.913  -8.452  1.00 64.01 ? 388  PRO B O   1 
ATOM   7089 C CB  . PRO B 1 388 ? 14.779  -4.718  -5.634  1.00 63.51 ? 388  PRO B CB  1 
ATOM   7090 C CG  . PRO B 1 388 ? 14.216  -4.874  -4.262  1.00 63.03 ? 388  PRO B CG  1 
ATOM   7091 C CD  . PRO B 1 388 ? 13.014  -3.986  -4.241  1.00 63.16 ? 388  PRO B CD  1 
ATOM   7092 N N   . GLU B 1 389 ? 12.409  -6.621  -6.812  1.00 64.95 ? 389  GLU B N   1 
ATOM   7093 C CA  . GLU B 1 389 ? 12.227  -7.965  -7.381  1.00 66.16 ? 389  GLU B CA  1 
ATOM   7094 C C   . GLU B 1 389 ? 10.806  -8.296  -7.816  1.00 65.49 ? 389  GLU B C   1 
ATOM   7095 O O   . GLU B 1 389 ? 10.560  -9.390  -8.320  1.00 65.53 ? 389  GLU B O   1 
ATOM   7096 C CB  . GLU B 1 389 ? 12.806  -9.050  -6.448  1.00 65.85 ? 389  GLU B CB  1 
ATOM   7097 C CG  . GLU B 1 389 ? 14.342  -8.921  -6.263  1.00 68.30 ? 389  GLU B CG  1 
ATOM   7098 C CD  . GLU B 1 389 ? 15.034  -10.216 -5.839  1.00 68.77 ? 389  GLU B CD  1 
ATOM   7099 O OE1 . GLU B 1 389 ? 15.892  -10.728 -6.609  1.00 71.23 ? 389  GLU B OE1 1 
ATOM   7100 O OE2 . GLU B 1 389 ? 14.719  -10.720 -4.734  1.00 72.89 ? 389  GLU B OE2 1 
ATOM   7101 N N   . ASP B 1 390 ? 9.882   -7.357  -7.646  1.00 65.44 ? 390  ASP B N   1 
ATOM   7102 C CA  . ASP B 1 390 ? 8.531   -7.542  -8.144  1.00 65.69 ? 390  ASP B CA  1 
ATOM   7103 C C   . ASP B 1 390 ? 8.580   -7.790  -9.656  1.00 66.00 ? 390  ASP B C   1 
ATOM   7104 O O   . ASP B 1 390 ? 9.157   -6.988  -10.398 1.00 66.63 ? 390  ASP B O   1 
ATOM   7105 C CB  . ASP B 1 390 ? 7.646   -6.329  -7.846  1.00 65.43 ? 390  ASP B CB  1 
ATOM   7106 C CG  . ASP B 1 390 ? 6.298   -6.413  -8.551  1.00 66.33 ? 390  ASP B CG  1 
ATOM   7107 O OD1 . ASP B 1 390 ? 5.690   -7.509  -8.545  1.00 67.47 ? 390  ASP B OD1 1 
ATOM   7108 O OD2 . ASP B 1 390 ? 5.850   -5.405  -9.140  1.00 66.53 ? 390  ASP B OD2 1 
ATOM   7109 N N   . PRO B 1 391 ? 8.003   -8.915  -10.116 1.00 65.94 ? 391  PRO B N   1 
ATOM   7110 C CA  . PRO B 1 391 ? 7.976   -9.226  -11.552 1.00 65.39 ? 391  PRO B CA  1 
ATOM   7111 C C   . PRO B 1 391 ? 7.139   -8.281  -12.439 1.00 64.68 ? 391  PRO B C   1 
ATOM   7112 O O   . PRO B 1 391 ? 7.529   -8.058  -13.568 1.00 64.70 ? 391  PRO B O   1 
ATOM   7113 C CB  . PRO B 1 391 ? 7.428   -10.662 -11.591 1.00 65.55 ? 391  PRO B CB  1 
ATOM   7114 C CG  . PRO B 1 391 ? 7.656   -11.195 -10.195 1.00 65.82 ? 391  PRO B CG  1 
ATOM   7115 C CD  . PRO B 1 391 ? 7.397   -10.001 -9.326  1.00 65.91 ? 391  PRO B CD  1 
ATOM   7116 N N   . THR B 1 392 ? 6.020   -7.736  -11.954 1.00 64.06 ? 392  THR B N   1 
ATOM   7117 C CA  . THR B 1 392 ? 5.235   -6.760  -12.751 1.00 63.04 ? 392  THR B CA  1 
ATOM   7118 C C   . THR B 1 392 ? 6.087   -5.537  -13.089 1.00 62.87 ? 392  THR B C   1 
ATOM   7119 O O   . THR B 1 392 ? 6.168   -5.127  -14.244 1.00 62.86 ? 392  THR B O   1 
ATOM   7120 C CB  . THR B 1 392 ? 3.933   -6.294  -12.027 1.00 62.85 ? 392  THR B CB  1 
ATOM   7121 O OG1 . THR B 1 392 ? 3.142   -7.432  -11.679 1.00 62.01 ? 392  THR B OG1 1 
ATOM   7122 C CG2 . THR B 1 392 ? 3.101   -5.382  -12.911 1.00 61.73 ? 392  THR B CG2 1 
ATOM   7123 N N   . HIS B 1 393 ? 6.714   -4.960  -12.062 1.00 62.82 ? 393  HIS B N   1 
ATOM   7124 C CA  . HIS B 1 393 ? 7.611   -3.813  -12.226 1.00 62.12 ? 393  HIS B CA  1 
ATOM   7125 C C   . HIS B 1 393 ? 8.733   -4.161  -13.199 1.00 60.29 ? 393  HIS B C   1 
ATOM   7126 O O   . HIS B 1 393 ? 8.954   -3.434  -14.166 1.00 60.13 ? 393  HIS B O   1 
ATOM   7127 C CB  . HIS B 1 393 ? 8.176   -3.337  -10.879 1.00 62.64 ? 393  HIS B CB  1 
ATOM   7128 C CG  . HIS B 1 393 ? 7.266   -2.401  -10.131 1.00 67.19 ? 393  HIS B CG  1 
ATOM   7129 N ND1 . HIS B 1 393 ? 6.493   -2.802  -9.055  1.00 70.24 ? 393  HIS B ND1 1 
ATOM   7130 C CD2 . HIS B 1 393 ? 7.010   -1.078  -10.299 1.00 70.85 ? 393  HIS B CD2 1 
ATOM   7131 C CE1 . HIS B 1 393 ? 5.806   -1.770  -8.591  1.00 70.65 ? 393  HIS B CE1 1 
ATOM   7132 N NE2 . HIS B 1 393 ? 6.098   -0.713  -9.330  1.00 72.17 ? 393  HIS B NE2 1 
ATOM   7133 N N   . LEU B 1 394 ? 9.405   -5.285  -12.969 1.00 58.02 ? 394  LEU B N   1 
ATOM   7134 C CA  . LEU B 1 394 ? 10.497  -5.710  -13.839 1.00 56.54 ? 394  LEU B CA  1 
ATOM   7135 C C   . LEU B 1 394 ? 10.101  -5.905  -15.321 1.00 55.63 ? 394  LEU B C   1 
ATOM   7136 O O   . LEU B 1 394 ? 10.859  -5.554  -16.238 1.00 55.66 ? 394  LEU B O   1 
ATOM   7137 C CB  . LEU B 1 394 ? 11.172  -6.955  -13.272 1.00 56.53 ? 394  LEU B CB  1 
ATOM   7138 C CG  . LEU B 1 394 ? 12.042  -6.705  -12.033 1.00 56.48 ? 394  LEU B CG  1 
ATOM   7139 C CD1 . LEU B 1 394 ? 12.406  -8.015  -11.378 1.00 57.21 ? 394  LEU B CD1 1 
ATOM   7140 C CD2 . LEU B 1 394 ? 13.307  -5.927  -12.364 1.00 55.39 ? 394  LEU B CD2 1 
ATOM   7141 N N   . ARG B 1 395 ? 8.912   -6.454  -15.547 1.00 54.15 ? 395  ARG B N   1 
ATOM   7142 C CA  . ARG B 1 395 ? 8.381   -6.625  -16.883 1.00 52.59 ? 395  ARG B CA  1 
ATOM   7143 C C   . ARG B 1 395 ? 8.120   -5.242  -17.494 1.00 51.97 ? 395  ARG B C   1 
ATOM   7144 O O   . ARG B 1 395 ? 8.537   -4.985  -18.617 1.00 51.76 ? 395  ARG B O   1 
ATOM   7145 C CB  . ARG B 1 395 ? 7.127   -7.525  -16.846 1.00 52.58 ? 395  ARG B CB  1 
ATOM   7146 C CG  . ARG B 1 395 ? 6.274   -7.595  -18.100 1.00 51.36 ? 395  ARG B CG  1 
ATOM   7147 C CD  . ARG B 1 395 ? 5.122   -6.645  -17.961 1.00 51.97 ? 395  ARG B CD  1 
ATOM   7148 N NE  . ARG B 1 395 ? 3.911   -7.311  -17.520 1.00 52.68 ? 395  ARG B NE  1 
ATOM   7149 C CZ  . ARG B 1 395 ? 2.897   -6.727  -16.884 1.00 53.47 ? 395  ARG B CZ  1 
ATOM   7150 N NH1 . ARG B 1 395 ? 2.922   -5.446  -16.562 1.00 53.21 ? 395  ARG B NH1 1 
ATOM   7151 N NH2 . ARG B 1 395 ? 1.846   -7.449  -16.551 1.00 55.72 ? 395  ARG B NH2 1 
ATOM   7152 N N   . ASP B 1 396 ? 7.466   -4.346  -16.753 1.00 50.84 ? 396  ASP B N   1 
ATOM   7153 C CA  . ASP B 1 396 ? 7.193   -2.992  -17.272 1.00 49.89 ? 396  ASP B CA  1 
ATOM   7154 C C   . ASP B 1 396 ? 8.473   -2.165  -17.500 1.00 49.03 ? 396  ASP B C   1 
ATOM   7155 O O   . ASP B 1 396 ? 8.566   -1.427  -18.474 1.00 48.96 ? 396  ASP B O   1 
ATOM   7156 C CB  . ASP B 1 396 ? 6.160   -2.256  -16.408 1.00 49.53 ? 396  ASP B CB  1 
ATOM   7157 C CG  . ASP B 1 396 ? 4.766   -2.891  -16.488 1.00 50.77 ? 396  ASP B CG  1 
ATOM   7158 O OD1 . ASP B 1 396 ? 4.451   -3.491  -17.538 1.00 51.81 ? 396  ASP B OD1 1 
ATOM   7159 O OD2 . ASP B 1 396 ? 3.976   -2.796  -15.520 1.00 49.90 ? 396  ASP B OD2 1 
ATOM   7160 N N   . ALA B 1 397 ? 9.464   -2.323  -16.628 1.00 48.39 ? 397  ALA B N   1 
ATOM   7161 C CA  . ALA B 1 397 ? 10.755  -1.631  -16.779 1.00 48.04 ? 397  ALA B CA  1 
ATOM   7162 C C   . ALA B 1 397 ? 11.501  -2.067  -18.044 1.00 47.67 ? 397  ALA B C   1 
ATOM   7163 O O   . ALA B 1 397 ? 12.111  -1.235  -18.746 1.00 47.37 ? 397  ALA B O   1 
ATOM   7164 C CB  . ALA B 1 397 ? 11.631  -1.830  -15.542 1.00 47.64 ? 397  ALA B CB  1 
ATOM   7165 N N   . MET B 1 398 ? 11.446  -3.368  -18.330 1.00 47.16 ? 398  MET B N   1 
ATOM   7166 C CA  . MET B 1 398 ? 12.034  -3.913  -19.557 1.00 46.61 ? 398  MET B CA  1 
ATOM   7167 C C   . MET B 1 398 ? 11.458  -3.204  -20.781 1.00 45.79 ? 398  MET B C   1 
ATOM   7168 O O   . MET B 1 398 ? 12.216  -2.729  -21.656 1.00 45.38 ? 398  MET B O   1 
ATOM   7169 C CB  . MET B 1 398 ? 11.794  -5.425  -19.657 1.00 46.80 ? 398  MET B CB  1 
ATOM   7170 C CG  . MET B 1 398 ? 12.716  -6.139  -20.642 1.00 47.60 ? 398  MET B CG  1 
ATOM   7171 S SD  . MET B 1 398 ? 14.492  -5.835  -20.372 1.00 50.14 ? 398  MET B SD  1 
ATOM   7172 C CE  . MET B 1 398 ? 14.909  -4.711  -21.690 1.00 48.35 ? 398  MET B CE  1 
ATOM   7173 N N   . SER B 1 399 ? 10.123  -3.121  -20.818 1.00 44.30 ? 399  SER B N   1 
ATOM   7174 C CA  . SER B 1 399 ? 9.408   -2.456  -21.895 1.00 43.29 ? 399  SER B CA  1 
ATOM   7175 C C   . SER B 1 399 ? 9.922   -1.026  -22.012 1.00 43.39 ? 399  SER B C   1 
ATOM   7176 O O   . SER B 1 399 ? 10.413  -0.618  -23.072 1.00 44.07 ? 399  SER B O   1 
ATOM   7177 C CB  . SER B 1 399 ? 7.908   -2.496  -21.626 1.00 43.30 ? 399  SER B CB  1 
ATOM   7178 O OG  . SER B 1 399 ? 7.216   -1.565  -22.422 1.00 41.57 ? 399  SER B OG  1 
ATOM   7179 N N   . ALA B 1 400 ? 9.874   -0.298  -20.901 1.00 42.70 ? 400  ALA B N   1 
ATOM   7180 C CA  . ALA B 1 400 ? 10.361  1.080   -20.836 1.00 42.35 ? 400  ALA B CA  1 
ATOM   7181 C C   . ALA B 1 400 ? 11.826  1.291   -21.254 1.00 41.74 ? 400  ALA B C   1 
ATOM   7182 O O   . ALA B 1 400 ? 12.130  2.274   -21.921 1.00 41.64 ? 400  ALA B O   1 
ATOM   7183 C CB  . ALA B 1 400 ? 10.076  1.706   -19.449 1.00 42.45 ? 400  ALA B CB  1 
ATOM   7184 N N   . VAL B 1 401 ? 12.723  0.384   -20.891 1.00 41.28 ? 401  VAL B N   1 
ATOM   7185 C CA  . VAL B 1 401 ? 14.126  0.506   -21.338 1.00 41.20 ? 401  VAL B CA  1 
ATOM   7186 C C   . VAL B 1 401 ? 14.190  0.589   -22.861 1.00 41.20 ? 401  VAL B C   1 
ATOM   7187 O O   . VAL B 1 401 ? 14.769  1.515   -23.439 1.00 41.33 ? 401  VAL B O   1 
ATOM   7188 C CB  . VAL B 1 401 ? 15.006  -0.680  -20.851 1.00 41.22 ? 401  VAL B CB  1 
ATOM   7189 C CG1 . VAL B 1 401 ? 16.318  -0.757  -21.629 1.00 40.99 ? 401  VAL B CG1 1 
ATOM   7190 C CG2 . VAL B 1 401 ? 15.270  -0.568  -19.357 1.00 40.74 ? 401  VAL B CG2 1 
ATOM   7191 N N   . VAL B 1 402 ? 13.539  -0.377  -23.496 1.00 41.35 ? 402  VAL B N   1 
ATOM   7192 C CA  . VAL B 1 402 ? 13.543  -0.513  -24.944 1.00 40.52 ? 402  VAL B CA  1 
ATOM   7193 C C   . VAL B 1 402 ? 12.831  0.664   -25.610 1.00 40.44 ? 402  VAL B C   1 
ATOM   7194 O O   . VAL B 1 402 ? 13.334  1.219   -26.581 1.00 40.74 ? 402  VAL B O   1 
ATOM   7195 C CB  . VAL B 1 402 ? 12.921  -1.883  -25.370 1.00 40.69 ? 402  VAL B CB  1 
ATOM   7196 C CG1 . VAL B 1 402 ? 12.822  -1.989  -26.902 1.00 39.59 ? 402  VAL B CG1 1 
ATOM   7197 C CG2 . VAL B 1 402 ? 13.753  -3.046  -24.788 1.00 38.76 ? 402  VAL B CG2 1 
ATOM   7198 N N   . GLY B 1 403 ? 11.664  1.041   -25.102 1.00 39.92 ? 403  GLY B N   1 
ATOM   7199 C CA  . GLY B 1 403 ? 10.950  2.159   -25.682 1.00 39.66 ? 403  GLY B CA  1 
ATOM   7200 C C   . GLY B 1 403 ? 11.715  3.459   -25.488 1.00 39.70 ? 403  GLY B C   1 
ATOM   7201 O O   . GLY B 1 403 ? 11.849  4.267   -26.434 1.00 39.50 ? 403  GLY B O   1 
ATOM   7202 N N   . ASP B 1 404 ? 12.219  3.671   -24.270 1.00 39.01 ? 404  ASP B N   1 
ATOM   7203 C CA  . ASP B 1 404 ? 12.920  4.919   -23.985 1.00 39.18 ? 404  ASP B CA  1 
ATOM   7204 C C   . ASP B 1 404 ? 14.152  5.043   -24.870 1.00 38.89 ? 404  ASP B C   1 
ATOM   7205 O O   . ASP B 1 404 ? 14.285  6.023   -25.567 1.00 39.32 ? 404  ASP B O   1 
ATOM   7206 C CB  . ASP B 1 404 ? 13.304  5.076   -22.502 1.00 38.87 ? 404  ASP B CB  1 
ATOM   7207 C CG  . ASP B 1 404 ? 12.092  5.209   -21.568 1.00 38.62 ? 404  ASP B CG  1 
ATOM   7208 O OD1 . ASP B 1 404 ? 10.944  5.410   -22.056 1.00 39.48 ? 404  ASP B OD1 1 
ATOM   7209 O OD2 . ASP B 1 404 ? 12.296  5.100   -20.325 1.00 36.32 ? 404  ASP B OD2 1 
ATOM   7210 N N   . HIS B 1 405 ? 15.022  4.036   -24.851 1.00 39.26 ? 405  HIS B N   1 
ATOM   7211 C CA  . HIS B 1 405 ? 16.322  4.063   -25.541 1.00 39.45 ? 405  HIS B CA  1 
ATOM   7212 C C   . HIS B 1 405 ? 16.127  4.226   -27.041 1.00 39.31 ? 405  HIS B C   1 
ATOM   7213 O O   . HIS B 1 405 ? 16.849  4.958   -27.669 1.00 39.86 ? 405  HIS B O   1 
ATOM   7214 C CB  . HIS B 1 405 ? 17.095  2.766   -25.206 1.00 39.51 ? 405  HIS B CB  1 
ATOM   7215 C CG  . HIS B 1 405 ? 18.299  2.486   -26.070 1.00 41.48 ? 405  HIS B CG  1 
ATOM   7216 N ND1 . HIS B 1 405 ? 19.386  3.337   -26.160 1.00 44.15 ? 405  HIS B ND1 1 
ATOM   7217 C CD2 . HIS B 1 405 ? 18.611  1.407   -26.837 1.00 42.62 ? 405  HIS B CD2 1 
ATOM   7218 C CE1 . HIS B 1 405 ? 20.305  2.809   -26.955 1.00 43.77 ? 405  HIS B CE1 1 
ATOM   7219 N NE2 . HIS B 1 405 ? 19.860  1.636   -27.380 1.00 45.59 ? 405  HIS B NE2 1 
ATOM   7220 N N   . ASN B 1 406 ? 15.131  3.553   -27.603 1.00 38.77 ? 406  ASN B N   1 
ATOM   7221 C CA  . ASN B 1 406 ? 14.951  3.499   -29.045 1.00 38.08 ? 406  ASN B CA  1 
ATOM   7222 C C   . ASN B 1 406 ? 14.038  4.567   -29.576 1.00 37.90 ? 406  ASN B C   1 
ATOM   7223 O O   . ASN B 1 406 ? 14.286  5.094   -30.656 1.00 37.84 ? 406  ASN B O   1 
ATOM   7224 C CB  . ASN B 1 406 ? 14.417  2.127   -29.445 1.00 38.09 ? 406  ASN B CB  1 
ATOM   7225 C CG  . ASN B 1 406 ? 15.492  1.062   -29.382 1.00 38.53 ? 406  ASN B CG  1 
ATOM   7226 O OD1 . ASN B 1 406 ? 16.444  1.102   -30.155 1.00 38.19 ? 406  ASN B OD1 1 
ATOM   7227 N ND2 . ASN B 1 406 ? 15.359  0.121   -28.449 1.00 38.36 ? 406  ASN B ND2 1 
ATOM   7228 N N   . VAL B 1 407 ? 12.989  4.908   -28.830 1.00 37.13 ? 407  VAL B N   1 
ATOM   7229 C CA  . VAL B 1 407 ? 12.024  5.868   -29.364 1.00 37.34 ? 407  VAL B CA  1 
ATOM   7230 C C   . VAL B 1 407 ? 11.822  7.188   -28.565 1.00 37.43 ? 407  VAL B C   1 
ATOM   7231 O O   . VAL B 1 407 ? 12.076  8.274   -29.093 1.00 37.07 ? 407  VAL B O   1 
ATOM   7232 C CB  . VAL B 1 407 ? 10.668  5.177   -29.678 1.00 37.61 ? 407  VAL B CB  1 
ATOM   7233 C CG1 . VAL B 1 407 ? 9.694   6.164   -30.293 1.00 35.01 ? 407  VAL B CG1 1 
ATOM   7234 C CG2 . VAL B 1 407 ? 10.897  3.942   -30.574 1.00 36.42 ? 407  VAL B CG2 1 
ATOM   7235 N N   . VAL B 1 408 ? 11.385  7.087   -27.310 1.00 37.34 ? 408  VAL B N   1 
ATOM   7236 C CA  . VAL B 1 408 ? 10.969  8.259   -26.553 1.00 37.26 ? 408  VAL B CA  1 
ATOM   7237 C C   . VAL B 1 408 ? 12.124  9.282   -26.401 1.00 37.09 ? 408  VAL B C   1 
ATOM   7238 O O   . VAL B 1 408 ? 11.992  10.450  -26.758 1.00 36.45 ? 408  VAL B O   1 
ATOM   7239 C CB  . VAL B 1 408 ? 10.322  7.867   -25.183 1.00 37.57 ? 408  VAL B CB  1 
ATOM   7240 C CG1 . VAL B 1 408 ? 9.825   9.114   -24.446 1.00 37.31 ? 408  VAL B CG1 1 
ATOM   7241 C CG2 . VAL B 1 408 ? 9.166   6.858   -25.375 1.00 36.70 ? 408  VAL B CG2 1 
ATOM   7242 N N   . CYS B 1 409 ? 13.270  8.832   -25.924 1.00 37.25 ? 409  CYS B N   1 
ATOM   7243 C CA  . CYS B 1 409 ? 14.414  9.740   -25.785 1.00 37.40 ? 409  CYS B CA  1 
ATOM   7244 C C   . CYS B 1 409 ? 14.980  10.246  -27.131 1.00 37.09 ? 409  CYS B C   1 
ATOM   7245 O O   . CYS B 1 409 ? 15.222  11.442  -27.271 1.00 37.55 ? 409  CYS B O   1 
ATOM   7246 C CB  . CYS B 1 409 ? 15.458  9.140   -24.859 1.00 37.40 ? 409  CYS B CB  1 
ATOM   7247 S SG  . CYS B 1 409 ? 14.737  8.837   -23.215 1.00 40.03 ? 409  CYS B SG  1 
ATOM   7248 N N   . PRO B 1 410 ? 15.135  9.366   -28.146 1.00 36.79 ? 410  PRO B N   1 
ATOM   7249 C CA  . PRO B 1 410 ? 15.453  9.961   -29.436 1.00 36.26 ? 410  PRO B CA  1 
ATOM   7250 C C   . PRO B 1 410 ? 14.464  11.026  -29.876 1.00 36.53 ? 410  PRO B C   1 
ATOM   7251 O O   . PRO B 1 410 ? 14.897  12.041  -30.434 1.00 37.11 ? 410  PRO B O   1 
ATOM   7252 C CB  . PRO B 1 410 ? 15.427  8.774   -30.383 1.00 36.16 ? 410  PRO B CB  1 
ATOM   7253 C CG  . PRO B 1 410 ? 15.852  7.636   -29.514 1.00 36.79 ? 410  PRO B CG  1 
ATOM   7254 C CD  . PRO B 1 410 ? 15.125  7.892   -28.220 1.00 36.47 ? 410  PRO B CD  1 
ATOM   7255 N N   . VAL B 1 411 ? 13.166  10.817  -29.631 1.00 36.14 ? 411  VAL B N   1 
ATOM   7256 C CA  . VAL B 1 411 ? 12.151  11.792  -30.035 1.00 35.84 ? 411  VAL B CA  1 
ATOM   7257 C C   . VAL B 1 411 ? 12.306  13.103  -29.244 1.00 36.13 ? 411  VAL B C   1 
ATOM   7258 O O   . VAL B 1 411 ? 12.268  14.183  -29.825 1.00 35.79 ? 411  VAL B O   1 
ATOM   7259 C CB  . VAL B 1 411 ? 10.696  11.250  -29.891 1.00 35.89 ? 411  VAL B CB  1 
ATOM   7260 C CG1 . VAL B 1 411 ? 9.671   12.375  -30.028 1.00 34.17 ? 411  VAL B CG1 1 
ATOM   7261 C CG2 . VAL B 1 411 ? 10.415  10.161  -30.909 1.00 35.44 ? 411  VAL B CG2 1 
ATOM   7262 N N   . ALA B 1 412 ? 12.457  12.990  -27.930 1.00 36.08 ? 412  ALA B N   1 
ATOM   7263 C CA  . ALA B 1 412 ? 12.669  14.141  -27.056 1.00 36.98 ? 412  ALA B CA  1 
ATOM   7264 C C   . ALA B 1 412 ? 13.867  14.971  -27.539 1.00 37.33 ? 412  ALA B C   1 
ATOM   7265 O O   . ALA B 1 412 ? 13.801  16.203  -27.632 1.00 37.07 ? 412  ALA B O   1 
ATOM   7266 C CB  . ALA B 1 412 ? 12.866  13.681  -25.591 1.00 36.46 ? 412  ALA B CB  1 
ATOM   7267 N N   . GLN B 1 413 ? 14.948  14.273  -27.870 1.00 37.91 ? 413  GLN B N   1 
ATOM   7268 C CA  . GLN B 1 413 ? 16.147  14.904  -28.398 1.00 38.37 ? 413  GLN B CA  1 
ATOM   7269 C C   . GLN B 1 413 ? 15.885  15.653  -29.710 1.00 38.14 ? 413  GLN B C   1 
ATOM   7270 O O   . GLN B 1 413 ? 16.216  16.842  -29.815 1.00 38.43 ? 413  GLN B O   1 
ATOM   7271 C CB  . GLN B 1 413 ? 17.249  13.870  -28.566 1.00 38.58 ? 413  GLN B CB  1 
ATOM   7272 C CG  . GLN B 1 413 ? 18.490  14.402  -29.233 1.00 42.08 ? 413  GLN B CG  1 
ATOM   7273 C CD  . GLN B 1 413 ? 19.615  13.374  -29.216 1.00 46.59 ? 413  GLN B CD  1 
ATOM   7274 O OE1 . GLN B 1 413 ? 20.488  13.429  -28.354 1.00 48.89 ? 413  GLN B OE1 1 
ATOM   7275 N NE2 . GLN B 1 413 ? 19.580  12.407  -30.147 1.00 46.48 ? 413  GLN B NE2 1 
ATOM   7276 N N   . LEU B 1 414 ? 15.284  14.978  -30.694 1.00 37.35 ? 414  LEU B N   1 
ATOM   7277 C CA  . LEU B 1 414 ? 14.907  15.633  -31.943 1.00 36.93 ? 414  LEU B CA  1 
ATOM   7278 C C   . LEU B 1 414 ? 14.022  16.884  -31.738 1.00 37.07 ? 414  LEU B C   1 
ATOM   7279 O O   . LEU B 1 414 ? 14.250  17.940  -32.325 1.00 36.48 ? 414  LEU B O   1 
ATOM   7280 C CB  . LEU B 1 414 ? 14.196  14.629  -32.859 1.00 36.84 ? 414  LEU B CB  1 
ATOM   7281 C CG  . LEU B 1 414 ? 13.786  15.154  -34.249 1.00 36.97 ? 414  LEU B CG  1 
ATOM   7282 C CD1 . LEU B 1 414 ? 14.980  15.297  -35.171 1.00 36.44 ? 414  LEU B CD1 1 
ATOM   7283 C CD2 . LEU B 1 414 ? 12.766  14.232  -34.862 1.00 38.83 ? 414  LEU B CD2 1 
ATOM   7284 N N   . ALA B 1 415 ? 12.995  16.736  -30.910 1.00 37.50 ? 415  ALA B N   1 
ATOM   7285 C CA  . ALA B 1 415 ? 12.031  17.785  -30.670 1.00 38.22 ? 415  ALA B CA  1 
ATOM   7286 C C   . ALA B 1 415 ? 12.724  19.023  -30.083 1.00 38.51 ? 415  ALA B C   1 
ATOM   7287 O O   . ALA B 1 415 ? 12.504  20.135  -30.556 1.00 38.43 ? 415  ALA B O   1 
ATOM   7288 C CB  . ALA B 1 415 ? 10.918  17.271  -29.760 1.00 37.86 ? 415  ALA B CB  1 
ATOM   7289 N N   . GLY B 1 416 ? 13.577  18.805  -29.082 1.00 39.19 ? 416  GLY B N   1 
ATOM   7290 C CA  . GLY B 1 416 ? 14.418  19.854  -28.508 1.00 40.21 ? 416  GLY B CA  1 
ATOM   7291 C C   . GLY B 1 416 ? 15.329  20.534  -29.523 1.00 41.39 ? 416  GLY B C   1 
ATOM   7292 O O   . GLY B 1 416 ? 15.367  21.778  -29.606 1.00 41.33 ? 416  GLY B O   1 
ATOM   7293 N N   . ARG B 1 417 ? 16.050  19.744  -30.318 1.00 41.71 ? 417  ARG B N   1 
ATOM   7294 C CA  . ARG B 1 417 ? 16.951  20.337  -31.295 1.00 42.83 ? 417  ARG B CA  1 
ATOM   7295 C C   . ARG B 1 417 ? 16.194  21.150  -32.347 1.00 42.91 ? 417  ARG B C   1 
ATOM   7296 O O   . ARG B 1 417 ? 16.514  22.309  -32.585 1.00 42.92 ? 417  ARG B O   1 
ATOM   7297 C CB  . ARG B 1 417 ? 17.894  19.309  -31.937 1.00 43.54 ? 417  ARG B CB  1 
ATOM   7298 C CG  . ARG B 1 417 ? 18.831  18.526  -30.968 1.00 46.44 ? 417  ARG B CG  1 
ATOM   7299 C CD  . ARG B 1 417 ? 19.419  19.358  -29.843 1.00 54.26 ? 417  ARG B CD  1 
ATOM   7300 N NE  . ARG B 1 417 ? 19.919  20.644  -30.324 1.00 62.60 ? 417  ARG B NE  1 
ATOM   7301 C CZ  . ARG B 1 417 ? 21.194  21.047  -30.282 1.00 66.20 ? 417  ARG B CZ  1 
ATOM   7302 N NH1 . ARG B 1 417 ? 22.152  20.272  -29.751 1.00 65.79 ? 417  ARG B NH1 1 
ATOM   7303 N NH2 . ARG B 1 417 ? 21.509  22.248  -30.767 1.00 66.67 ? 417  ARG B NH2 1 
ATOM   7304 N N   . LEU B 1 418 ? 15.175  20.547  -32.958 1.00 43.15 ? 418  LEU B N   1 
ATOM   7305 C CA  . LEU B 1 418 ? 14.368  21.230  -33.957 1.00 42.44 ? 418  LEU B CA  1 
ATOM   7306 C C   . LEU B 1 418 ? 13.798  22.547  -33.427 1.00 42.66 ? 418  LEU B C   1 
ATOM   7307 O O   . LEU B 1 418 ? 13.826  23.552  -34.133 1.00 42.60 ? 418  LEU B O   1 
ATOM   7308 C CB  . LEU B 1 418 ? 13.227  20.335  -34.424 1.00 42.37 ? 418  LEU B CB  1 
ATOM   7309 C CG  . LEU B 1 418 ? 13.443  19.080  -35.263 1.00 42.81 ? 418  LEU B CG  1 
ATOM   7310 C CD1 . LEU B 1 418 ? 12.072  18.464  -35.589 1.00 42.01 ? 418  LEU B CD1 1 
ATOM   7311 C CD2 . LEU B 1 418 ? 14.218  19.378  -36.539 1.00 42.64 ? 418  LEU B CD2 1 
ATOM   7312 N N   . ALA B 1 419 ? 13.277  22.547  -32.196 1.00 42.73 ? 419  ALA B N   1 
ATOM   7313 C CA  . ALA B 1 419 ? 12.673  23.766  -31.632 1.00 43.29 ? 419  ALA B CA  1 
ATOM   7314 C C   . ALA B 1 419 ? 13.713  24.857  -31.352 1.00 43.93 ? 419  ALA B C   1 
ATOM   7315 O O   . ALA B 1 419 ? 13.483  26.028  -31.678 1.00 44.36 ? 419  ALA B O   1 
ATOM   7316 C CB  . ALA B 1 419 ? 11.877  23.455  -30.377 1.00 43.13 ? 419  ALA B CB  1 
ATOM   7317 N N   . ALA B 1 420 ? 14.847  24.461  -30.764 1.00 44.41 ? 420  ALA B N   1 
ATOM   7318 C CA  . ALA B 1 420 ? 15.973  25.352  -30.523 1.00 44.94 ? 420  ALA B CA  1 
ATOM   7319 C C   . ALA B 1 420 ? 16.429  26.004  -31.832 1.00 45.59 ? 420  ALA B C   1 
ATOM   7320 O O   . ALA B 1 420 ? 16.735  27.197  -31.849 1.00 46.25 ? 420  ALA B O   1 
ATOM   7321 C CB  . ALA B 1 420 ? 17.129  24.608  -29.851 1.00 44.52 ? 420  ALA B CB  1 
ATOM   7322 N N   . GLN B 1 421 ? 16.430  25.245  -32.926 1.00 45.44 ? 421  GLN B N   1 
ATOM   7323 C CA  . GLN B 1 421 ? 16.919  25.758  -34.194 1.00 45.79 ? 421  GLN B CA  1 
ATOM   7324 C C   . GLN B 1 421 ? 15.852  26.276  -35.154 1.00 46.07 ? 421  GLN B C   1 
ATOM   7325 O O   . GLN B 1 421 ? 16.020  26.238  -36.384 1.00 46.04 ? 421  GLN B O   1 
ATOM   7326 C CB  . GLN B 1 421 ? 17.872  24.767  -34.842 1.00 45.95 ? 421  GLN B CB  1 
ATOM   7327 C CG  . GLN B 1 421 ? 19.245  24.848  -34.153 1.00 47.70 ? 421  GLN B CG  1 
ATOM   7328 C CD  . GLN B 1 421 ? 19.884  23.514  -33.988 1.00 47.34 ? 421  GLN B CD  1 
ATOM   7329 O OE1 . GLN B 1 421 ? 20.021  23.002  -32.884 1.00 48.11 ? 421  GLN B OE1 1 
ATOM   7330 N NE2 . GLN B 1 421 ? 20.275  22.927  -35.093 1.00 50.60 ? 421  GLN B NE2 1 
ATOM   7331 N N   . GLY B 1 422 ? 14.751  26.746  -34.572 1.00 46.37 ? 422  GLY B N   1 
ATOM   7332 C CA  . GLY B 1 422 ? 13.786  27.539  -35.299 1.00 46.69 ? 422  GLY B CA  1 
ATOM   7333 C C   . GLY B 1 422 ? 12.553  26.844  -35.820 1.00 46.88 ? 422  GLY B C   1 
ATOM   7334 O O   . GLY B 1 422 ? 11.651  27.512  -36.305 1.00 47.72 ? 422  GLY B O   1 
ATOM   7335 N N   . ALA B 1 423 ? 12.495  25.519  -35.754 1.00 46.55 ? 423  ALA B N   1 
ATOM   7336 C CA  . ALA B 1 423 ? 11.296  24.820  -36.227 1.00 46.49 ? 423  ALA B CA  1 
ATOM   7337 C C   . ALA B 1 423 ? 10.091  25.072  -35.308 1.00 46.38 ? 423  ALA B C   1 
ATOM   7338 O O   . ALA B 1 423 ? 10.237  25.305  -34.112 1.00 46.51 ? 423  ALA B O   1 
ATOM   7339 C CB  . ALA B 1 423 ? 11.562  23.325  -36.358 1.00 46.26 ? 423  ALA B CB  1 
ATOM   7340 N N   . ARG B 1 424 ? 8.895   25.000  -35.863 1.00 45.74 ? 424  ARG B N   1 
ATOM   7341 C CA  . ARG B 1 424 ? 7.704   25.037  -35.044 1.00 45.57 ? 424  ARG B CA  1 
ATOM   7342 C C   . ARG B 1 424 ? 7.340   23.564  -34.800 1.00 43.53 ? 424  ARG B C   1 
ATOM   7343 O O   . ARG B 1 424 ? 7.071   22.817  -35.741 1.00 43.56 ? 424  ARG B O   1 
ATOM   7344 C CB  . ARG B 1 424 ? 6.626   25.855  -35.779 1.00 45.54 ? 424  ARG B CB  1 
ATOM   7345 C CG  . ARG B 1 424 ? 5.155   25.528  -35.441 1.00 48.92 ? 424  ARG B CG  1 
ATOM   7346 C CD  . ARG B 1 424 ? 4.123   26.398  -36.282 1.00 49.17 ? 424  ARG B CD  1 
ATOM   7347 N NE  . ARG B 1 424 ? 3.368   27.358  -35.452 1.00 55.33 ? 424  ARG B NE  1 
ATOM   7348 C CZ  . ARG B 1 424 ? 3.887   28.137  -34.496 1.00 55.48 ? 424  ARG B CZ  1 
ATOM   7349 N NH1 . ARG B 1 424 ? 5.190   28.147  -34.218 1.00 56.19 ? 424  ARG B NH1 1 
ATOM   7350 N NH2 . ARG B 1 424 ? 3.092   28.932  -33.819 1.00 55.51 ? 424  ARG B NH2 1 
ATOM   7351 N N   . VAL B 1 425 ? 7.371   23.140  -33.541 1.00 41.57 ? 425  VAL B N   1 
ATOM   7352 C CA  . VAL B 1 425 ? 7.203   21.727  -33.178 1.00 39.42 ? 425  VAL B CA  1 
ATOM   7353 C C   . VAL B 1 425 ? 5.956   21.527  -32.311 1.00 39.12 ? 425  VAL B C   1 
ATOM   7354 O O   . VAL B 1 425 ? 5.725   22.291  -31.373 1.00 39.94 ? 425  VAL B O   1 
ATOM   7355 C CB  . VAL B 1 425 ? 8.444   21.185  -32.403 1.00 38.93 ? 425  VAL B CB  1 
ATOM   7356 C CG1 . VAL B 1 425 ? 8.319   19.710  -32.088 1.00 37.53 ? 425  VAL B CG1 1 
ATOM   7357 C CG2 . VAL B 1 425 ? 9.689   21.394  -33.204 1.00 38.42 ? 425  VAL B CG2 1 
ATOM   7358 N N   . TYR B 1 426 ? 5.162   20.500  -32.624 1.00 37.52 ? 426  TYR B N   1 
ATOM   7359 C CA  . TYR B 1 426 ? 4.089   20.032  -31.747 1.00 35.79 ? 426  TYR B CA  1 
ATOM   7360 C C   . TYR B 1 426 ? 4.367   18.604  -31.351 1.00 35.55 ? 426  TYR B C   1 
ATOM   7361 O O   . TYR B 1 426 ? 4.815   17.818  -32.168 1.00 35.95 ? 426  TYR B O   1 
ATOM   7362 C CB  . TYR B 1 426 ? 2.758   20.112  -32.472 1.00 35.06 ? 426  TYR B CB  1 
ATOM   7363 C CG  . TYR B 1 426 ? 2.380   21.519  -32.832 1.00 33.72 ? 426  TYR B CG  1 
ATOM   7364 C CD1 . TYR B 1 426 ? 2.836   22.099  -33.998 1.00 32.83 ? 426  TYR B CD1 1 
ATOM   7365 C CD2 . TYR B 1 426 ? 1.578   22.277  -31.986 1.00 32.78 ? 426  TYR B CD2 1 
ATOM   7366 C CE1 . TYR B 1 426 ? 2.504   23.371  -34.328 1.00 32.32 ? 426  TYR B CE1 1 
ATOM   7367 C CE2 . TYR B 1 426 ? 1.246   23.555  -32.297 1.00 32.92 ? 426  TYR B CE2 1 
ATOM   7368 C CZ  . TYR B 1 426 ? 1.709   24.102  -33.470 1.00 34.58 ? 426  TYR B CZ  1 
ATOM   7369 O OH  . TYR B 1 426 ? 1.363   25.396  -33.790 1.00 35.53 ? 426  TYR B OH  1 
ATOM   7370 N N   . ALA B 1 427 ? 4.116   18.259  -30.103 1.00 34.98 ? 427  ALA B N   1 
ATOM   7371 C CA  . ALA B 1 427 ? 4.445   16.928  -29.641 1.00 35.24 ? 427  ALA B CA  1 
ATOM   7372 C C   . ALA B 1 427 ? 3.267   16.279  -28.916 1.00 35.60 ? 427  ALA B C   1 
ATOM   7373 O O   . ALA B 1 427 ? 2.432   16.985  -28.342 1.00 35.83 ? 427  ALA B O   1 
ATOM   7374 C CB  . ALA B 1 427 ? 5.684   16.970  -28.759 1.00 34.93 ? 427  ALA B CB  1 
ATOM   7375 N N   . TYR B 1 428 ? 3.221   14.945  -28.934 1.00 35.35 ? 428  TYR B N   1 
ATOM   7376 C CA  . TYR B 1 428 ? 2.095   14.186  -28.410 1.00 35.29 ? 428  TYR B CA  1 
ATOM   7377 C C   . TYR B 1 428 ? 2.572   12.859  -27.832 1.00 36.09 ? 428  TYR B C   1 
ATOM   7378 O O   . TYR B 1 428 ? 3.611   12.324  -28.230 1.00 35.53 ? 428  TYR B O   1 
ATOM   7379 C CB  . TYR B 1 428 ? 1.016   13.940  -29.507 1.00 35.33 ? 428  TYR B CB  1 
ATOM   7380 C CG  . TYR B 1 428 ? 1.414   12.923  -30.571 1.00 34.16 ? 428  TYR B CG  1 
ATOM   7381 C CD1 . TYR B 1 428 ? 1.458   11.566  -30.267 1.00 33.87 ? 428  TYR B CD1 1 
ATOM   7382 C CD2 . TYR B 1 428 ? 1.782   13.319  -31.865 1.00 32.48 ? 428  TYR B CD2 1 
ATOM   7383 C CE1 . TYR B 1 428 ? 1.866   10.619  -31.194 1.00 33.17 ? 428  TYR B CE1 1 
ATOM   7384 C CE2 . TYR B 1 428 ? 2.182   12.366  -32.828 1.00 32.58 ? 428  TYR B CE2 1 
ATOM   7385 C CZ  . TYR B 1 428 ? 2.222   11.015  -32.467 1.00 35.52 ? 428  TYR B CZ  1 
ATOM   7386 O OH  . TYR B 1 428 ? 2.626   10.024  -33.357 1.00 38.11 ? 428  TYR B OH  1 
ATOM   7387 N N   . ILE B 1 429 ? 1.813   12.350  -26.865 1.00 37.08 ? 429  ILE B N   1 
ATOM   7388 C CA  . ILE B 1 429 ? 1.836   10.948  -26.492 1.00 37.93 ? 429  ILE B CA  1 
ATOM   7389 C C   . ILE B 1 429 ? 0.435   10.383  -26.744 1.00 38.99 ? 429  ILE B C   1 
ATOM   7390 O O   . ILE B 1 429 ? -0.570  11.049  -26.435 1.00 39.46 ? 429  ILE B O   1 
ATOM   7391 C CB  . ILE B 1 429 ? 2.273   10.735  -25.033 1.00 38.24 ? 429  ILE B CB  1 
ATOM   7392 C CG1 . ILE B 1 429 ? 2.555   9.247   -24.770 1.00 38.17 ? 429  ILE B CG1 1 
ATOM   7393 C CG2 . ILE B 1 429 ? 1.258   11.308  -24.057 1.00 37.67 ? 429  ILE B CG2 1 
ATOM   7394 C CD1 . ILE B 1 429 ? 3.206   8.981   -23.442 1.00 38.43 ? 429  ILE B CD1 1 
ATOM   7395 N N   . PHE B 1 430 ? 0.371   9.184   -27.333 1.00 39.48 ? 430  PHE B N   1 
ATOM   7396 C CA  . PHE B 1 430 ? -0.890  8.525   -27.696 1.00 39.83 ? 430  PHE B CA  1 
ATOM   7397 C C   . PHE B 1 430 ? -1.116  7.395   -26.698 1.00 40.96 ? 430  PHE B C   1 
ATOM   7398 O O   . PHE B 1 430 ? -0.237  6.548   -26.528 1.00 40.90 ? 430  PHE B O   1 
ATOM   7399 C CB  . PHE B 1 430 ? -0.771  7.973   -29.109 1.00 39.29 ? 430  PHE B CB  1 
ATOM   7400 C CG  . PHE B 1 430 ? -2.017  7.322   -29.623 1.00 38.38 ? 430  PHE B CG  1 
ATOM   7401 C CD1 . PHE B 1 430 ? -2.257  5.967   -29.393 1.00 37.97 ? 430  PHE B CD1 1 
ATOM   7402 C CD2 . PHE B 1 430 ? -2.936  8.050   -30.380 1.00 36.47 ? 430  PHE B CD2 1 
ATOM   7403 C CE1 . PHE B 1 430 ? -3.429  5.353   -29.896 1.00 36.63 ? 430  PHE B CE1 1 
ATOM   7404 C CE2 . PHE B 1 430 ? -4.093  7.456   -30.885 1.00 35.44 ? 430  PHE B CE2 1 
ATOM   7405 C CZ  . PHE B 1 430 ? -4.350  6.109   -30.626 1.00 35.66 ? 430  PHE B CZ  1 
ATOM   7406 N N   . GLU B 1 431 ? -2.278  7.382   -26.034 1.00 42.06 ? 431  GLU B N   1 
ATOM   7407 C CA  . GLU B 1 431 ? -2.472  6.529   -24.835 1.00 43.69 ? 431  GLU B CA  1 
ATOM   7408 C C   . GLU B 1 431 ? -3.723  5.640   -24.889 1.00 44.52 ? 431  GLU B C   1 
ATOM   7409 O O   . GLU B 1 431 ? -4.036  4.927   -23.930 1.00 43.96 ? 431  GLU B O   1 
ATOM   7410 C CB  . GLU B 1 431 ? -2.527  7.375   -23.552 1.00 43.00 ? 431  GLU B CB  1 
ATOM   7411 C CG  . GLU B 1 431 ? -1.307  8.239   -23.292 1.00 44.34 ? 431  GLU B CG  1 
ATOM   7412 C CD  . GLU B 1 431 ? -1.335  8.935   -21.927 1.00 44.87 ? 431  GLU B CD  1 
ATOM   7413 O OE1 . GLU B 1 431 ? -2.344  9.638   -21.627 1.00 43.49 ? 431  GLU B OE1 1 
ATOM   7414 O OE2 . GLU B 1 431 ? -0.322  8.776   -21.176 1.00 47.04 ? 431  GLU B OE2 1 
ATOM   7415 N N   . HIS B 1 432 ? -4.453  5.710   -25.996 1.00 45.82 ? 432  HIS B N   1 
ATOM   7416 C CA  . HIS B 1 432 ? -5.629  4.888   -26.140 1.00 47.02 ? 432  HIS B CA  1 
ATOM   7417 C C   . HIS B 1 432 ? -5.320  3.520   -26.743 1.00 47.33 ? 432  HIS B C   1 
ATOM   7418 O O   . HIS B 1 432 ? -4.870  3.422   -27.880 1.00 46.47 ? 432  HIS B O   1 
ATOM   7419 C CB  . HIS B 1 432 ? -6.685  5.568   -26.987 1.00 47.27 ? 432  HIS B CB  1 
ATOM   7420 C CG  . HIS B 1 432 ? -7.845  4.672   -27.254 1.00 49.85 ? 432  HIS B CG  1 
ATOM   7421 N ND1 . HIS B 1 432 ? -8.651  4.197   -26.240 1.00 51.85 ? 432  HIS B ND1 1 
ATOM   7422 C CD2 . HIS B 1 432 ? -8.283  4.088   -28.394 1.00 50.75 ? 432  HIS B CD2 1 
ATOM   7423 C CE1 . HIS B 1 432 ? -9.571  3.401   -26.755 1.00 52.34 ? 432  HIS B CE1 1 
ATOM   7424 N NE2 . HIS B 1 432 ? -9.366  3.314   -28.057 1.00 52.68 ? 432  HIS B NE2 1 
ATOM   7425 N N   . ARG B 1 433 ? -5.570  2.469   -25.963 1.00 48.68 ? 433  ARG B N   1 
ATOM   7426 C CA  . ARG B 1 433 ? -5.478  1.088   -26.441 1.00 49.71 ? 433  ARG B CA  1 
ATOM   7427 C C   . ARG B 1 433 ? -6.760  0.754   -27.173 1.00 50.38 ? 433  ARG B C   1 
ATOM   7428 O O   . ARG B 1 433 ? -7.832  0.827   -26.584 1.00 50.53 ? 433  ARG B O   1 
ATOM   7429 C CB  . ARG B 1 433 ? -5.331  0.135   -25.267 1.00 49.73 ? 433  ARG B CB  1 
ATOM   7430 C CG  . ARG B 1 433 ? -4.903  -1.242  -25.668 1.00 51.23 ? 433  ARG B CG  1 
ATOM   7431 C CD  . ARG B 1 433 ? -4.732  -2.119  -24.464 1.00 53.38 ? 433  ARG B CD  1 
ATOM   7432 N NE  . ARG B 1 433 ? -5.095  -3.486  -24.807 1.00 55.26 ? 433  ARG B NE  1 
ATOM   7433 C CZ  . ARG B 1 433 ? -4.229  -4.471  -25.007 1.00 57.35 ? 433  ARG B CZ  1 
ATOM   7434 N NH1 . ARG B 1 433 ? -2.913  -4.276  -24.893 1.00 57.21 ? 433  ARG B NH1 1 
ATOM   7435 N NH2 . ARG B 1 433 ? -4.687  -5.672  -25.314 1.00 58.39 ? 433  ARG B NH2 1 
ATOM   7436 N N   . ALA B 1 434 ? -6.655  0.409   -28.453 1.00 51.48 ? 434  ALA B N   1 
ATOM   7437 C CA  . ALA B 1 434 ? -7.823  0.037   -29.253 1.00 52.62 ? 434  ALA B CA  1 
ATOM   7438 C C   . ALA B 1 434 ? -8.576  -1.132  -28.613 1.00 53.59 ? 434  ALA B C   1 
ATOM   7439 O O   . ALA B 1 434 ? -7.961  -2.089  -28.121 1.00 53.94 ? 434  ALA B O   1 
ATOM   7440 C CB  . ALA B 1 434 ? -7.402  -0.309  -30.669 1.00 52.64 ? 434  ALA B CB  1 
ATOM   7441 N N   . SER B 1 435 ? -9.902  -1.045  -28.604 1.00 54.69 ? 435  SER B N   1 
ATOM   7442 C CA  . SER B 1 435 ? -10.745 -2.101  -28.051 1.00 55.92 ? 435  SER B CA  1 
ATOM   7443 C C   . SER B 1 435 ? -10.553 -3.425  -28.799 1.00 56.93 ? 435  SER B C   1 
ATOM   7444 O O   . SER B 1 435 ? -10.474 -4.488  -28.183 1.00 56.90 ? 435  SER B O   1 
ATOM   7445 C CB  . SER B 1 435 ? -12.209 -1.668  -28.064 1.00 55.92 ? 435  SER B CB  1 
ATOM   7446 O OG  . SER B 1 435 ? -12.519 -1.024  -29.283 1.00 56.26 ? 435  SER B OG  1 
ATOM   7447 N N   . THR B 1 436 ? -10.424 -3.345  -30.123 1.00 58.10 ? 436  THR B N   1 
ATOM   7448 C CA  . THR B 1 436 ? -10.154 -4.520  -30.970 1.00 59.26 ? 436  THR B CA  1 
ATOM   7449 C C   . THR B 1 436 ? -8.737  -5.138  -30.880 1.00 59.42 ? 436  THR B C   1 
ATOM   7450 O O   . THR B 1 436 ? -8.440  -6.110  -31.599 1.00 60.44 ? 436  THR B O   1 
ATOM   7451 C CB  . THR B 1 436 ? -10.382 -4.179  -32.462 1.00 59.38 ? 436  THR B CB  1 
ATOM   7452 O OG1 . THR B 1 436 ? -9.569  -3.046  -32.833 1.00 60.18 ? 436  THR B OG1 1 
ATOM   7453 C CG2 . THR B 1 436 ? -11.859 -3.882  -32.723 1.00 60.84 ? 436  THR B CG2 1 
ATOM   7454 N N   . LEU B 1 437 ? -7.856  -4.581  -30.050 1.00 58.75 ? 437  LEU B N   1 
ATOM   7455 C CA  . LEU B 1 437 ? -6.446  -5.011  -30.023 1.00 57.92 ? 437  LEU B CA  1 
ATOM   7456 C C   . LEU B 1 437 ? -6.321  -6.466  -29.596 1.00 57.05 ? 437  LEU B C   1 
ATOM   7457 O O   . LEU B 1 437 ? -6.922  -6.881  -28.611 1.00 56.63 ? 437  LEU B O   1 
ATOM   7458 C CB  . LEU B 1 437 ? -5.619  -4.098  -29.099 1.00 58.29 ? 437  LEU B CB  1 
ATOM   7459 C CG  . LEU B 1 437 ? -4.088  -4.010  -29.160 1.00 58.43 ? 437  LEU B CG  1 
ATOM   7460 C CD1 . LEU B 1 437 ? -3.541  -4.197  -30.552 1.00 59.69 ? 437  LEU B CD1 1 
ATOM   7461 C CD2 . LEU B 1 437 ? -3.665  -2.660  -28.652 1.00 58.68 ? 437  LEU B CD2 1 
ATOM   7462 N N   . THR B 1 438 ? -5.532  -7.233  -30.338 1.00 56.32 ? 438  THR B N   1 
ATOM   7463 C CA  . THR B 1 438 ? -5.421  -8.672  -30.090 1.00 55.50 ? 438  THR B CA  1 
ATOM   7464 C C   . THR B 1 438 ? -4.191  -9.070  -29.288 1.00 54.58 ? 438  THR B C   1 
ATOM   7465 O O   . THR B 1 438 ? -4.042  -10.244 -28.944 1.00 54.89 ? 438  THR B O   1 
ATOM   7466 C CB  . THR B 1 438 ? -5.467  -9.483  -31.409 1.00 55.87 ? 438  THR B CB  1 
ATOM   7467 O OG1 . THR B 1 438 ? -4.431  -9.026  -32.298 1.00 56.28 ? 438  THR B OG1 1 
ATOM   7468 C CG2 . THR B 1 438 ? -6.842  -9.315  -32.094 1.00 56.25 ? 438  THR B CG2 1 
ATOM   7469 N N   . TRP B 1 439 ? -3.303  -8.115  -29.006 1.00 53.21 ? 439  TRP B N   1 
ATOM   7470 C CA  . TRP B 1 439 ? -2.149  -8.369  -28.130 1.00 51.95 ? 439  TRP B CA  1 
ATOM   7471 C C   . TRP B 1 439 ? -2.629  -8.309  -26.674 1.00 52.08 ? 439  TRP B C   1 
ATOM   7472 O O   . TRP B 1 439 ? -3.621  -7.646  -26.380 1.00 52.08 ? 439  TRP B O   1 
ATOM   7473 C CB  . TRP B 1 439 ? -1.038  -7.332  -28.354 1.00 50.62 ? 439  TRP B CB  1 
ATOM   7474 C CG  . TRP B 1 439 ? -0.386  -7.375  -29.698 1.00 49.04 ? 439  TRP B CG  1 
ATOM   7475 C CD1 . TRP B 1 439 ? -0.694  -6.604  -30.774 1.00 48.31 ? 439  TRP B CD1 1 
ATOM   7476 C CD2 . TRP B 1 439 ? 0.701   -8.221  -30.112 1.00 46.87 ? 439  TRP B CD2 1 
ATOM   7477 N NE1 . TRP B 1 439 ? 0.125   -6.918  -31.833 1.00 47.54 ? 439  TRP B NE1 1 
ATOM   7478 C CE2 . TRP B 1 439 ? 0.994   -7.901  -31.448 1.00 46.50 ? 439  TRP B CE2 1 
ATOM   7479 C CE3 . TRP B 1 439 ? 1.449   -9.220  -29.481 1.00 46.65 ? 439  TRP B CE3 1 
ATOM   7480 C CZ2 . TRP B 1 439 ? 1.996   -8.552  -32.177 1.00 47.86 ? 439  TRP B CZ2 1 
ATOM   7481 C CZ3 . TRP B 1 439 ? 2.461   -9.857  -30.198 1.00 48.08 ? 439  TRP B CZ3 1 
ATOM   7482 C CH2 . TRP B 1 439 ? 2.716   -9.522  -31.541 1.00 47.87 ? 439  TRP B CH2 1 
ATOM   7483 N N   . PRO B 1 440 ? -1.921  -8.970  -25.749 1.00 52.15 ? 440  PRO B N   1 
ATOM   7484 C CA  . PRO B 1 440 ? -2.365  -8.949  -24.353 1.00 52.57 ? 440  PRO B CA  1 
ATOM   7485 C C   . PRO B 1 440 ? -2.304  -7.551  -23.710 1.00 53.25 ? 440  PRO B C   1 
ATOM   7486 O O   . PRO B 1 440 ? -1.590  -6.665  -24.205 1.00 53.31 ? 440  PRO B O   1 
ATOM   7487 C CB  . PRO B 1 440 ? -1.369  -9.881  -23.664 1.00 52.70 ? 440  PRO B CB  1 
ATOM   7488 C CG  . PRO B 1 440 ? -0.159  -9.840  -24.532 1.00 52.53 ? 440  PRO B CG  1 
ATOM   7489 C CD  . PRO B 1 440 ? -0.674  -9.729  -25.927 1.00 51.98 ? 440  PRO B CD  1 
ATOM   7490 N N   . LEU B 1 441 ? -3.020  -7.364  -22.600 1.00 53.64 ? 441  LEU B N   1 
ATOM   7491 C CA  . LEU B 1 441 ? -3.059  -6.048  -21.935 1.00 54.12 ? 441  LEU B CA  1 
ATOM   7492 C C   . LEU B 1 441 ? -1.698  -5.540  -21.459 1.00 53.47 ? 441  LEU B C   1 
ATOM   7493 O O   . LEU B 1 441 ? -1.422  -4.349  -21.561 1.00 53.15 ? 441  LEU B O   1 
ATOM   7494 C CB  . LEU B 1 441 ? -4.086  -5.987  -20.799 1.00 54.53 ? 441  LEU B CB  1 
ATOM   7495 C CG  . LEU B 1 441 ? -5.540  -5.999  -21.305 1.00 57.24 ? 441  LEU B CG  1 
ATOM   7496 C CD1 . LEU B 1 441 ? -6.143  -7.451  -21.342 1.00 59.19 ? 441  LEU B CD1 1 
ATOM   7497 C CD2 . LEU B 1 441 ? -6.429  -5.050  -20.483 1.00 59.54 ? 441  LEU B CD2 1 
ATOM   7498 N N   . TRP B 1 442 ? -0.842  -6.438  -20.985 1.00 52.69 ? 442  TRP B N   1 
ATOM   7499 C CA  . TRP B 1 442 ? 0.442   -6.021  -20.449 1.00 52.45 ? 442  TRP B CA  1 
ATOM   7500 C C   . TRP B 1 442 ? 1.331   -5.216  -21.441 1.00 52.38 ? 442  TRP B C   1 
ATOM   7501 O O   . TRP B 1 442 ? 2.228   -4.481  -21.026 1.00 52.06 ? 442  TRP B O   1 
ATOM   7502 C CB  . TRP B 1 442 ? 1.194   -7.213  -19.858 1.00 52.49 ? 442  TRP B CB  1 
ATOM   7503 C CG  . TRP B 1 442 ? 1.854   -8.117  -20.855 1.00 52.92 ? 442  TRP B CG  1 
ATOM   7504 C CD1 . TRP B 1 442 ? 1.426   -9.354  -21.240 1.00 53.62 ? 442  TRP B CD1 1 
ATOM   7505 C CD2 . TRP B 1 442 ? 3.075   -7.875  -21.571 1.00 53.54 ? 442  TRP B CD2 1 
ATOM   7506 N NE1 . TRP B 1 442 ? 2.295   -9.892  -22.162 1.00 53.62 ? 442  TRP B NE1 1 
ATOM   7507 C CE2 . TRP B 1 442 ? 3.318   -9.009  -22.379 1.00 53.65 ? 442  TRP B CE2 1 
ATOM   7508 C CE3 . TRP B 1 442 ? 3.984   -6.806  -21.615 1.00 53.90 ? 442  TRP B CE3 1 
ATOM   7509 C CZ2 . TRP B 1 442 ? 4.433   -9.109  -23.221 1.00 53.24 ? 442  TRP B CZ2 1 
ATOM   7510 C CZ3 . TRP B 1 442 ? 5.086   -6.901  -22.459 1.00 53.32 ? 442  TRP B CZ3 1 
ATOM   7511 C CH2 . TRP B 1 442 ? 5.300   -8.049  -23.250 1.00 53.30 ? 442  TRP B CH2 1 
ATOM   7512 N N   . MET B 1 443 ? 1.076   -5.370  -22.738 1.00 51.91 ? 443  MET B N   1 
ATOM   7513 C CA  . MET B 1 443 ? 1.793   -4.640  -23.780 1.00 51.16 ? 443  MET B CA  1 
ATOM   7514 C C   . MET B 1 443 ? 1.246   -3.229  -23.989 1.00 50.47 ? 443  MET B C   1 
ATOM   7515 O O   . MET B 1 443 ? 1.876   -2.403  -24.637 1.00 50.49 ? 443  MET B O   1 
ATOM   7516 C CB  . MET B 1 443 ? 1.740   -5.404  -25.096 1.00 51.19 ? 443  MET B CB  1 
ATOM   7517 C CG  . MET B 1 443 ? 2.366   -6.769  -25.044 1.00 50.26 ? 443  MET B CG  1 
ATOM   7518 S SD  . MET B 1 443 ? 2.680   -7.278  -26.726 1.00 52.20 ? 443  MET B SD  1 
ATOM   7519 C CE  . MET B 1 443 ? 3.046   -8.997  -26.454 1.00 53.69 ? 443  MET B CE  1 
ATOM   7520 N N   . GLY B 1 444 ? 0.076   -2.962  -23.435 1.00 50.01 ? 444  GLY B N   1 
ATOM   7521 C CA  . GLY B 1 444 ? -0.467  -1.615  -23.399 1.00 49.56 ? 444  GLY B CA  1 
ATOM   7522 C C   . GLY B 1 444 ? -0.828  -1.107  -24.773 1.00 49.46 ? 444  GLY B C   1 
ATOM   7523 O O   . GLY B 1 444 ? -1.692  -1.676  -25.448 1.00 49.84 ? 444  GLY B O   1 
ATOM   7524 N N   . VAL B 1 445 ? -0.179  -0.014  -25.172 1.00 48.87 ? 445  VAL B N   1 
ATOM   7525 C CA  . VAL B 1 445 ? -0.342  0.545   -26.498 1.00 47.78 ? 445  VAL B CA  1 
ATOM   7526 C C   . VAL B 1 445 ? 0.996   0.333   -27.189 1.00 47.81 ? 445  VAL B C   1 
ATOM   7527 O O   . VAL B 1 445 ? 1.940   1.081   -26.939 1.00 48.08 ? 445  VAL B O   1 
ATOM   7528 C CB  . VAL B 1 445 ? -0.688  2.052   -26.426 1.00 48.09 ? 445  VAL B CB  1 
ATOM   7529 C CG1 . VAL B 1 445 ? -0.965  2.626   -27.832 1.00 47.17 ? 445  VAL B CG1 1 
ATOM   7530 C CG2 . VAL B 1 445 ? -1.857  2.302   -25.470 1.00 46.13 ? 445  VAL B CG2 1 
ATOM   7531 N N   . PRO B 1 446 ? 1.117   -0.739  -28.002 1.00 47.50 ? 446  PRO B N   1 
ATOM   7532 C CA  . PRO B 1 446 ? 2.382   -1.007  -28.723 1.00 46.94 ? 446  PRO B CA  1 
ATOM   7533 C C   . PRO B 1 446 ? 2.545   -0.076  -29.920 1.00 46.64 ? 446  PRO B C   1 
ATOM   7534 O O   . PRO B 1 446 ? 1.578   0.581   -30.300 1.00 46.22 ? 446  PRO B O   1 
ATOM   7535 C CB  . PRO B 1 446 ? 2.248   -2.474  -29.157 1.00 46.92 ? 446  PRO B CB  1 
ATOM   7536 C CG  . PRO B 1 446 ? 0.976   -2.994  -28.456 1.00 47.03 ? 446  PRO B CG  1 
ATOM   7537 C CD  . PRO B 1 446 ? 0.114   -1.786  -28.251 1.00 46.96 ? 446  PRO B CD  1 
ATOM   7538 N N   . HIS B 1 447 ? 3.740   0.032   -30.501 1.00 46.70 ? 447  HIS B N   1 
ATOM   7539 C CA  . HIS B 1 447 ? 3.877   1.012   -31.595 1.00 47.29 ? 447  HIS B CA  1 
ATOM   7540 C C   . HIS B 1 447 ? 3.112   0.536   -32.794 1.00 46.21 ? 447  HIS B C   1 
ATOM   7541 O O   . HIS B 1 447 ? 3.107   -0.652  -33.089 1.00 45.69 ? 447  HIS B O   1 
ATOM   7542 C CB  . HIS B 1 447 ? 5.329   1.316   -31.991 1.00 48.03 ? 447  HIS B CB  1 
ATOM   7543 C CG  . HIS B 1 447 ? 6.174   0.099   -32.163 1.00 51.96 ? 447  HIS B CG  1 
ATOM   7544 N ND1 . HIS B 1 447 ? 5.922   -0.850  -33.131 1.00 55.07 ? 447  HIS B ND1 1 
ATOM   7545 C CD2 . HIS B 1 447 ? 7.262   -0.336  -31.477 1.00 55.03 ? 447  HIS B CD2 1 
ATOM   7546 C CE1 . HIS B 1 447 ? 6.815   -1.822  -33.028 1.00 57.52 ? 447  HIS B CE1 1 
ATOM   7547 N NE2 . HIS B 1 447 ? 7.647   -1.530  -32.040 1.00 56.52 ? 447  HIS B NE2 1 
ATOM   7548 N N   . GLY B 1 448 ? 2.476   1.477   -33.476 1.00 45.41 ? 448  GLY B N   1 
ATOM   7549 C CA  . GLY B 1 448 ? 1.758   1.193   -34.696 1.00 44.87 ? 448  GLY B CA  1 
ATOM   7550 C C   . GLY B 1 448 ? 0.254   1.139   -34.491 1.00 44.88 ? 448  GLY B C   1 
ATOM   7551 O O   . GLY B 1 448 ? -0.507  1.173   -35.467 1.00 45.74 ? 448  GLY B O   1 
ATOM   7552 N N   . TYR B 1 449 ? -0.188  1.052   -33.238 1.00 44.30 ? 449  TYR B N   1 
ATOM   7553 C CA  . TYR B 1 449 ? -1.618  0.921   -32.947 1.00 43.83 ? 449  TYR B CA  1 
ATOM   7554 C C   . TYR B 1 449 ? -2.338  2.255   -32.799 1.00 43.27 ? 449  TYR B C   1 
ATOM   7555 O O   . TYR B 1 449 ? -3.500  2.303   -32.391 1.00 43.61 ? 449  TYR B O   1 
ATOM   7556 C CB  . TYR B 1 449 ? -1.880  -0.079  -31.818 1.00 44.12 ? 449  TYR B CB  1 
ATOM   7557 C CG  . TYR B 1 449 ? -1.456  -1.448  -32.303 1.00 45.89 ? 449  TYR B CG  1 
ATOM   7558 C CD1 . TYR B 1 449 ? -0.166  -1.932  -32.055 1.00 45.23 ? 449  TYR B CD1 1 
ATOM   7559 C CD2 . TYR B 1 449 ? -2.300  -2.208  -33.110 1.00 44.73 ? 449  TYR B CD2 1 
ATOM   7560 C CE1 . TYR B 1 449 ? 0.238   -3.160  -32.541 1.00 45.95 ? 449  TYR B CE1 1 
ATOM   7561 C CE2 . TYR B 1 449 ? -1.906  -3.431  -33.596 1.00 45.53 ? 449  TYR B CE2 1 
ATOM   7562 C CZ  . TYR B 1 449 ? -0.635  -3.901  -33.320 1.00 46.75 ? 449  TYR B CZ  1 
ATOM   7563 O OH  . TYR B 1 449 ? -0.241  -5.123  -33.818 1.00 48.03 ? 449  TYR B OH  1 
ATOM   7564 N N   . GLU B 1 450 ? -1.656  3.325   -33.196 1.00 41.79 ? 450  GLU B N   1 
ATOM   7565 C CA  . GLU B 1 450 ? -2.309  4.595   -33.375 1.00 40.99 ? 450  GLU B CA  1 
ATOM   7566 C C   . GLU B 1 450 ? -2.660  4.763   -34.835 1.00 41.19 ? 450  GLU B C   1 
ATOM   7567 O O   . GLU B 1 450 ? -3.625  5.455   -35.165 1.00 41.61 ? 450  GLU B O   1 
ATOM   7568 C CB  . GLU B 1 450 ? -1.413  5.754   -32.914 1.00 40.85 ? 450  GLU B CB  1 
ATOM   7569 C CG  . GLU B 1 450 ? -0.408  6.257   -33.952 1.00 39.02 ? 450  GLU B CG  1 
ATOM   7570 C CD  . GLU B 1 450 ? 0.865   5.405   -34.037 1.00 37.34 ? 450  GLU B CD  1 
ATOM   7571 O OE1 . GLU B 1 450 ? 0.888   4.246   -33.606 1.00 35.23 ? 450  GLU B OE1 1 
ATOM   7572 O OE2 . GLU B 1 450 ? 1.854   5.896   -34.579 1.00 39.27 ? 450  GLU B OE2 1 
ATOM   7573 N N   . ILE B 1 451 ? -1.879  4.137   -35.717 1.00 40.96 ? 451  ILE B N   1 
ATOM   7574 C CA  . ILE B 1 451 ? -2.030  4.368   -37.148 1.00 40.48 ? 451  ILE B CA  1 
ATOM   7575 C C   . ILE B 1 451 ? -3.485  4.236   -37.565 1.00 40.79 ? 451  ILE B C   1 
ATOM   7576 O O   . ILE B 1 451 ? -4.025  5.132   -38.223 1.00 41.02 ? 451  ILE B O   1 
ATOM   7577 C CB  . ILE B 1 451 ? -1.141  3.440   -38.005 1.00 40.39 ? 451  ILE B CB  1 
ATOM   7578 C CG1 . ILE B 1 451 ? 0.350   3.649   -37.659 1.00 41.53 ? 451  ILE B CG1 1 
ATOM   7579 C CG2 . ILE B 1 451 ? -1.381  3.704   -39.501 1.00 38.13 ? 451  ILE B CG2 1 
ATOM   7580 C CD1 . ILE B 1 451 ? 1.278   2.612   -38.225 1.00 40.90 ? 451  ILE B CD1 1 
ATOM   7581 N N   . GLU B 1 452 ? -4.125  3.131   -37.176 1.00 41.27 ? 452  GLU B N   1 
ATOM   7582 C CA  . GLU B 1 452 ? -5.509  2.874   -37.611 1.00 41.71 ? 452  GLU B CA  1 
ATOM   7583 C C   . GLU B 1 452 ? -6.472  4.001   -37.246 1.00 41.22 ? 452  GLU B C   1 
ATOM   7584 O O   . GLU B 1 452 ? -7.407  4.257   -37.994 1.00 41.52 ? 452  GLU B O   1 
ATOM   7585 C CB  . GLU B 1 452 ? -6.029  1.528   -37.120 1.00 42.32 ? 452  GLU B CB  1 
ATOM   7586 C CG  . GLU B 1 452 ? -6.205  1.416   -35.623 1.00 44.94 ? 452  GLU B CG  1 
ATOM   7587 C CD  . GLU B 1 452 ? -5.958  -0.001  -35.125 1.00 48.86 ? 452  GLU B CD  1 
ATOM   7588 O OE1 . GLU B 1 452 ? -6.902  -0.602  -34.576 1.00 50.30 ? 452  GLU B OE1 1 
ATOM   7589 O OE2 . GLU B 1 452 ? -4.816  -0.508  -35.278 1.00 51.14 ? 452  GLU B OE2 1 
ATOM   7590 N N   . PHE B 1 453 ? -6.219  4.682   -36.120 1.00 40.51 ? 453  PHE B N   1 
ATOM   7591 C CA  . PHE B 1 453 ? -7.001  5.855   -35.704 1.00 39.06 ? 453  PHE B CA  1 
ATOM   7592 C C   . PHE B 1 453 ? -6.755  7.101   -36.538 1.00 38.89 ? 453  PHE B C   1 
ATOM   7593 O O   . PHE B 1 453 ? -7.721  7.741   -36.946 1.00 38.62 ? 453  PHE B O   1 
ATOM   7594 C CB  . PHE B 1 453 ? -6.807  6.140   -34.226 1.00 38.97 ? 453  PHE B CB  1 
ATOM   7595 C CG  . PHE B 1 453 ? -7.290  5.035   -33.333 1.00 38.55 ? 453  PHE B CG  1 
ATOM   7596 C CD1 . PHE B 1 453 ? -8.633  4.977   -32.940 1.00 38.31 ? 453  PHE B CD1 1 
ATOM   7597 C CD2 . PHE B 1 453 ? -6.413  4.043   -32.900 1.00 39.33 ? 453  PHE B CD2 1 
ATOM   7598 C CE1 . PHE B 1 453 ? -9.106  3.956   -32.108 1.00 39.23 ? 453  PHE B CE1 1 
ATOM   7599 C CE2 . PHE B 1 453 ? -6.863  3.003   -32.058 1.00 41.29 ? 453  PHE B CE2 1 
ATOM   7600 C CZ  . PHE B 1 453 ? -8.235  2.962   -31.660 1.00 40.56 ? 453  PHE B CZ  1 
ATOM   7601 N N   . ILE B 1 454 ? -5.481  7.430   -36.805 1.00 39.07 ? 454  ILE B N   1 
ATOM   7602 C CA  . ILE B 1 454 ? -5.093  8.579   -37.663 1.00 39.34 ? 454  ILE B CA  1 
ATOM   7603 C C   . ILE B 1 454 ? -5.691  8.377   -39.044 1.00 40.14 ? 454  ILE B C   1 
ATOM   7604 O O   . ILE B 1 454 ? -6.151  9.333   -39.676 1.00 40.14 ? 454  ILE B O   1 
ATOM   7605 C CB  . ILE B 1 454 ? -3.527  8.728   -37.889 1.00 39.34 ? 454  ILE B CB  1 
ATOM   7606 C CG1 . ILE B 1 454 ? -2.666  8.631   -36.597 1.00 39.77 ? 454  ILE B CG1 1 
ATOM   7607 C CG2 . ILE B 1 454 ? -3.193  9.929   -38.773 1.00 37.87 ? 454  ILE B CG2 1 
ATOM   7608 C CD1 . ILE B 1 454 ? -3.069  9.478   -35.471 1.00 40.94 ? 454  ILE B CD1 1 
ATOM   7609 N N   . PHE B 1 455 ? -5.666  7.138   -39.535 1.00 41.20 ? 455  PHE B N   1 
ATOM   7610 C CA  . PHE B 1 455 ? -6.183  6.876   -40.880 1.00 42.41 ? 455  PHE B CA  1 
ATOM   7611 C C   . PHE B 1 455 ? -7.702  6.848   -40.954 1.00 43.55 ? 455  PHE B C   1 
ATOM   7612 O O   . PHE B 1 455 ? -8.259  6.887   -42.031 1.00 43.04 ? 455  PHE B O   1 
ATOM   7613 C CB  . PHE B 1 455 ? -5.565  5.626   -41.484 1.00 42.26 ? 455  PHE B CB  1 
ATOM   7614 C CG  . PHE B 1 455 ? -4.303  5.899   -42.237 1.00 42.25 ? 455  PHE B CG  1 
ATOM   7615 C CD1 . PHE B 1 455 ? -3.075  5.873   -41.591 1.00 41.64 ? 455  PHE B CD1 1 
ATOM   7616 C CD2 . PHE B 1 455 ? -4.344  6.211   -43.574 1.00 41.45 ? 455  PHE B CD2 1 
ATOM   7617 C CE1 . PHE B 1 455 ? -1.930  6.136   -42.265 1.00 40.78 ? 455  PHE B CE1 1 
ATOM   7618 C CE2 . PHE B 1 455 ? -3.183  6.483   -44.262 1.00 41.82 ? 455  PHE B CE2 1 
ATOM   7619 C CZ  . PHE B 1 455 ? -1.977  6.448   -43.604 1.00 41.57 ? 455  PHE B CZ  1 
ATOM   7620 N N   . GLY B 1 456 ? -8.362  6.797   -39.800 1.00 45.51 ? 456  GLY B N   1 
ATOM   7621 C CA  . GLY B 1 456 ? -9.824  6.915   -39.744 1.00 48.41 ? 456  GLY B CA  1 
ATOM   7622 C C   . GLY B 1 456 ? -10.588 5.603   -39.883 1.00 50.06 ? 456  GLY B C   1 
ATOM   7623 O O   . GLY B 1 456 ? -11.781 5.610   -40.209 1.00 50.43 ? 456  GLY B O   1 
ATOM   7624 N N   . LEU B 1 457 ? -9.906  4.481   -39.626 1.00 51.12 ? 457  LEU B N   1 
ATOM   7625 C CA  . LEU B 1 457 ? -10.520 3.152   -39.727 1.00 52.19 ? 457  LEU B CA  1 
ATOM   7626 C C   . LEU B 1 457 ? -11.732 2.958   -38.814 1.00 53.58 ? 457  LEU B C   1 
ATOM   7627 O O   . LEU B 1 457 ? -12.677 2.288   -39.193 1.00 53.86 ? 457  LEU B O   1 
ATOM   7628 C CB  . LEU B 1 457 ? -9.489  2.026   -39.523 1.00 51.66 ? 457  LEU B CB  1 
ATOM   7629 C CG  . LEU B 1 457 ? -8.961  1.358   -40.789 1.00 50.50 ? 457  LEU B CG  1 
ATOM   7630 C CD1 . LEU B 1 457 ? -8.117  2.328   -41.578 1.00 49.14 ? 457  LEU B CD1 1 
ATOM   7631 C CD2 . LEU B 1 457 ? -8.171  0.111   -40.422 1.00 51.14 ? 457  LEU B CD2 1 
ATOM   7632 N N   . PRO B 1 458 ? -11.706 3.510   -37.597 1.00 54.87 ? 458  PRO B N   1 
ATOM   7633 C CA  . PRO B 1 458 ? -12.928 3.426   -36.803 1.00 56.30 ? 458  PRO B CA  1 
ATOM   7634 C C   . PRO B 1 458 ? -14.220 3.991   -37.437 1.00 57.46 ? 458  PRO B C   1 
ATOM   7635 O O   . PRO B 1 458 ? -15.300 3.673   -36.965 1.00 57.96 ? 458  PRO B O   1 
ATOM   7636 C CB  . PRO B 1 458 ? -12.552 4.189   -35.540 1.00 56.06 ? 458  PRO B CB  1 
ATOM   7637 C CG  . PRO B 1 458 ? -11.094 3.957   -35.423 1.00 55.47 ? 458  PRO B CG  1 
ATOM   7638 C CD  . PRO B 1 458 ? -10.619 4.126   -36.825 1.00 54.97 ? 458  PRO B CD  1 
ATOM   7639 N N   . LEU B 1 459 ? -14.124 4.779   -38.501 1.00 58.67 ? 459  LEU B N   1 
ATOM   7640 C CA  . LEU B 1 459 ? -15.319 5.324   -39.124 1.00 60.19 ? 459  LEU B CA  1 
ATOM   7641 C C   . LEU B 1 459 ? -16.031 4.295   -39.998 1.00 61.76 ? 459  LEU B C   1 
ATOM   7642 O O   . LEU B 1 459 ? -17.076 4.580   -40.597 1.00 62.00 ? 459  LEU B O   1 
ATOM   7643 C CB  . LEU B 1 459 ? -14.983 6.570   -39.940 1.00 60.15 ? 459  LEU B CB  1 
ATOM   7644 C CG  . LEU B 1 459 ? -14.922 7.905   -39.194 1.00 59.64 ? 459  LEU B CG  1 
ATOM   7645 C CD1 . LEU B 1 459 ? -13.858 7.910   -38.088 1.00 59.57 ? 459  LEU B CD1 1 
ATOM   7646 C CD2 . LEU B 1 459 ? -14.651 9.008   -40.185 1.00 59.07 ? 459  LEU B CD2 1 
ATOM   7647 N N   . ASP B 1 460 ? -15.456 3.101   -40.072 1.00 63.32 ? 460  ASP B N   1 
ATOM   7648 C CA  . ASP B 1 460 ? -16.043 2.003   -40.823 1.00 64.98 ? 460  ASP B CA  1 
ATOM   7649 C C   . ASP B 1 460 ? -16.919 1.178   -39.883 1.00 65.82 ? 460  ASP B C   1 
ATOM   7650 O O   . ASP B 1 460 ? -16.391 0.401   -39.054 1.00 65.67 ? 460  ASP B O   1 
ATOM   7651 C CB  . ASP B 1 460 ? -14.936 1.137   -41.418 1.00 65.36 ? 460  ASP B CB  1 
ATOM   7652 C CG  . ASP B 1 460 ? -15.457 0.071   -42.357 1.00 66.78 ? 460  ASP B CG  1 
ATOM   7653 O OD1 . ASP B 1 460 ? -16.674 -0.231  -42.341 1.00 69.04 ? 460  ASP B OD1 1 
ATOM   7654 O OD2 . ASP B 1 460 ? -14.628 -0.465  -43.122 1.00 67.98 ? 460  ASP B OD2 1 
ATOM   7655 N N   . PRO B 1 461 ? -18.263 1.322   -40.026 1.00 66.67 ? 461  PRO B N   1 
ATOM   7656 C CA  . PRO B 1 461 ? -19.234 0.777   -39.053 1.00 66.91 ? 461  PRO B CA  1 
ATOM   7657 C C   . PRO B 1 461 ? -19.024 -0.711  -38.877 1.00 67.33 ? 461  PRO B C   1 
ATOM   7658 O O   . PRO B 1 461 ? -19.216 -1.245  -37.767 1.00 67.26 ? 461  PRO B O   1 
ATOM   7659 C CB  . PRO B 1 461 ? -20.591 1.053   -39.709 1.00 66.88 ? 461  PRO B CB  1 
ATOM   7660 C CG  . PRO B 1 461 ? -20.335 2.218   -40.639 1.00 66.94 ? 461  PRO B CG  1 
ATOM   7661 C CD  . PRO B 1 461 ? -18.939 1.989   -41.159 1.00 66.71 ? 461  PRO B CD  1 
ATOM   7662 N N   . SER B 1 462 ? -18.586 -1.346  -39.970 1.00 67.58 ? 462  SER B N   1 
ATOM   7663 C CA  . SER B 1 462 ? -18.361 -2.782  -40.038 1.00 68.10 ? 462  SER B CA  1 
ATOM   7664 C C   . SER B 1 462 ? -17.210 -3.281  -39.173 1.00 68.16 ? 462  SER B C   1 
ATOM   7665 O O   . SER B 1 462 ? -17.135 -4.480  -38.894 1.00 68.33 ? 462  SER B O   1 
ATOM   7666 C CB  . SER B 1 462 ? -18.098 -3.195  -41.486 1.00 68.20 ? 462  SER B CB  1 
ATOM   7667 O OG  . SER B 1 462 ? -16.734 -2.993  -41.826 1.00 69.13 ? 462  SER B OG  1 
ATOM   7668 N N   . LEU B 1 463 ? -16.309 -2.383  -38.763 1.00 68.27 ? 463  LEU B N   1 
ATOM   7669 C CA  . LEU B 1 463 ? -15.059 -2.818  -38.119 1.00 67.85 ? 463  LEU B CA  1 
ATOM   7670 C C   . LEU B 1 463 ? -15.105 -3.028  -36.605 1.00 67.63 ? 463  LEU B C   1 
ATOM   7671 O O   . LEU B 1 463 ? -14.135 -3.507  -36.021 1.00 67.67 ? 463  LEU B O   1 
ATOM   7672 C CB  . LEU B 1 463 ? -13.880 -1.938  -38.545 1.00 68.02 ? 463  LEU B CB  1 
ATOM   7673 C CG  . LEU B 1 463 ? -13.112 -2.446  -39.781 1.00 68.37 ? 463  LEU B CG  1 
ATOM   7674 C CD1 . LEU B 1 463 ? -12.554 -1.293  -40.595 1.00 67.62 ? 463  LEU B CD1 1 
ATOM   7675 C CD2 . LEU B 1 463 ? -11.997 -3.459  -39.417 1.00 68.01 ? 463  LEU B CD2 1 
ATOM   7676 N N   . ASN B 1 464 ? -16.231 -2.695  -35.982 1.00 67.52 ? 464  ASN B N   1 
ATOM   7677 C CA  . ASN B 1 464 ? -16.474 -3.014  -34.557 1.00 67.85 ? 464  ASN B CA  1 
ATOM   7678 C C   . ASN B 1 464 ? -15.665 -2.198  -33.543 1.00 67.00 ? 464  ASN B C   1 
ATOM   7679 O O   . ASN B 1 464 ? -15.393 -2.670  -32.425 1.00 67.28 ? 464  ASN B O   1 
ATOM   7680 C CB  . ASN B 1 464 ? -16.312 -4.533  -34.247 1.00 68.45 ? 464  ASN B CB  1 
ATOM   7681 C CG  . ASN B 1 464 ? -17.377 -5.415  -34.941 1.00 70.45 ? 464  ASN B CG  1 
ATOM   7682 O OD1 . ASN B 1 464 ? -18.492 -4.959  -35.260 1.00 71.00 ? 464  ASN B OD1 1 
ATOM   7683 N ND2 . ASN B 1 464 ? -17.024 -6.688  -35.175 1.00 70.85 ? 464  ASN B ND2 1 
ATOM   7684 N N   . TYR B 1 465 ? -15.287 -0.980  -33.922 1.00 65.42 ? 465  TYR B N   1 
ATOM   7685 C CA  . TYR B 1 465 ? -14.715 -0.057  -32.963 1.00 63.90 ? 465  TYR B CA  1 
ATOM   7686 C C   . TYR B 1 465 ? -15.845 0.553   -32.140 1.00 63.26 ? 465  TYR B C   1 
ATOM   7687 O O   . TYR B 1 465 ? -16.913 0.818   -32.678 1.00 62.67 ? 465  TYR B O   1 
ATOM   7688 C CB  . TYR B 1 465 ? -13.964 1.046   -33.692 1.00 63.69 ? 465  TYR B CB  1 
ATOM   7689 C CG  . TYR B 1 465 ? -12.632 0.658   -34.300 1.00 63.11 ? 465  TYR B CG  1 
ATOM   7690 C CD1 . TYR B 1 465 ? -11.508 0.448   -33.501 1.00 62.29 ? 465  TYR B CD1 1 
ATOM   7691 C CD2 . TYR B 1 465 ? -12.484 0.557   -35.685 1.00 63.54 ? 465  TYR B CD2 1 
ATOM   7692 C CE1 . TYR B 1 465 ? -10.274 0.116   -34.068 1.00 62.88 ? 465  TYR B CE1 1 
ATOM   7693 C CE2 . TYR B 1 465 ? -11.257 0.243   -36.264 1.00 63.17 ? 465  TYR B CE2 1 
ATOM   7694 C CZ  . TYR B 1 465 ? -10.155 0.020   -35.447 1.00 63.04 ? 465  TYR B CZ  1 
ATOM   7695 O OH  . TYR B 1 465 ? -8.945  -0.290  -36.015 1.00 61.94 ? 465  TYR B OH  1 
ATOM   7696 N N   . THR B 1 466 ? -15.614 0.786   -30.845 1.00 62.91 ? 466  THR B N   1 
ATOM   7697 C CA  . THR B 1 466 ? -16.586 1.512   -30.015 1.00 62.46 ? 466  THR B CA  1 
ATOM   7698 C C   . THR B 1 466 ? -16.922 2.866   -30.617 1.00 62.69 ? 466  THR B C   1 
ATOM   7699 O O   . THR B 1 466 ? -16.176 3.406   -31.426 1.00 62.90 ? 466  THR B O   1 
ATOM   7700 C CB  . THR B 1 466 ? -16.141 1.745   -28.537 1.00 62.43 ? 466  THR B CB  1 
ATOM   7701 O OG1 . THR B 1 466 ? -15.180 2.813   -28.457 1.00 61.56 ? 466  THR B OG1 1 
ATOM   7702 C CG2 . THR B 1 466 ? -15.615 0.467   -27.889 1.00 61.45 ? 466  THR B CG2 1 
ATOM   7703 N N   . THR B 1 467 ? -18.058 3.410   -30.209 1.00 62.95 ? 467  THR B N   1 
ATOM   7704 C CA  . THR B 1 467 ? -18.568 4.655   -30.773 1.00 62.63 ? 467  THR B CA  1 
ATOM   7705 C C   . THR B 1 467 ? -17.745 5.857   -30.282 1.00 62.18 ? 467  THR B C   1 
ATOM   7706 O O   . THR B 1 467 ? -17.694 6.894   -30.956 1.00 62.54 ? 467  THR B O   1 
ATOM   7707 C CB  . THR B 1 467 ? -20.120 4.777   -30.528 1.00 63.12 ? 467  THR B CB  1 
ATOM   7708 O OG1 . THR B 1 467 ? -20.462 6.088   -30.052 1.00 62.54 ? 467  THR B OG1 1 
ATOM   7709 C CG2 . THR B 1 467 ? -20.595 3.718   -29.489 1.00 63.64 ? 467  THR B CG2 1 
ATOM   7710 N N   . GLU B 1 468 ? -17.084 5.709   -29.129 1.00 61.31 ? 468  GLU B N   1 
ATOM   7711 C CA  . GLU B 1 468 ? -16.158 6.735   -28.632 1.00 60.96 ? 468  GLU B CA  1 
ATOM   7712 C C   . GLU B 1 468 ? -14.909 6.771   -29.533 1.00 60.22 ? 468  GLU B C   1 
ATOM   7713 O O   . GLU B 1 468 ? -14.435 7.848   -29.939 1.00 59.77 ? 468  GLU B O   1 
ATOM   7714 C CB  . GLU B 1 468 ? -15.768 6.491   -27.162 1.00 61.20 ? 468  GLU B CB  1 
ATOM   7715 C CG  . GLU B 1 468 ? -16.913 6.660   -26.138 1.00 64.62 ? 468  GLU B CG  1 
ATOM   7716 C CD  . GLU B 1 468 ? -17.636 5.322   -25.767 1.00 68.25 ? 468  GLU B CD  1 
ATOM   7717 O OE1 . GLU B 1 468 ? -18.281 4.677   -26.643 1.00 68.99 ? 468  GLU B OE1 1 
ATOM   7718 O OE2 . GLU B 1 468 ? -17.569 4.922   -24.577 1.00 69.21 ? 468  GLU B OE2 1 
ATOM   7719 N N   . GLU B 1 469 ? -14.404 5.578   -29.856 1.00 59.20 ? 469  GLU B N   1 
ATOM   7720 C CA  . GLU B 1 469 ? -13.268 5.407   -30.751 1.00 57.98 ? 469  GLU B CA  1 
ATOM   7721 C C   . GLU B 1 469 ? -13.485 6.091   -32.099 1.00 57.91 ? 469  GLU B C   1 
ATOM   7722 O O   . GLU B 1 469 ? -12.553 6.682   -32.644 1.00 57.99 ? 469  GLU B O   1 
ATOM   7723 C CB  . GLU B 1 469 ? -12.924 3.934   -30.910 1.00 57.19 ? 469  GLU B CB  1 
ATOM   7724 C CG  . GLU B 1 469 ? -12.235 3.367   -29.689 1.00 56.73 ? 469  GLU B CG  1 
ATOM   7725 C CD  . GLU B 1 469 ? -11.943 1.885   -29.799 1.00 57.80 ? 469  GLU B CD  1 
ATOM   7726 O OE1 . GLU B 1 469 ? -12.733 1.163   -30.437 1.00 59.65 ? 469  GLU B OE1 1 
ATOM   7727 O OE2 . GLU B 1 469 ? -10.927 1.418   -29.238 1.00 57.36 ? 469  GLU B OE2 1 
ATOM   7728 N N   . ARG B 1 470 ? -14.707 6.051   -32.622 1.00 57.49 ? 470  ARG B N   1 
ATOM   7729 C CA  . ARG B 1 470 ? -14.989 6.737   -33.869 1.00 57.71 ? 470  ARG B CA  1 
ATOM   7730 C C   . ARG B 1 470 ? -14.833 8.248   -33.697 1.00 56.35 ? 470  ARG B C   1 
ATOM   7731 O O   . ARG B 1 470 ? -14.299 8.907   -34.572 1.00 56.15 ? 470  ARG B O   1 
ATOM   7732 C CB  . ARG B 1 470 ? -16.367 6.363   -34.439 1.00 57.14 ? 470  ARG B CB  1 
ATOM   7733 C CG  . ARG B 1 470 ? -16.830 7.318   -35.573 1.00 60.33 ? 470  ARG B CG  1 
ATOM   7734 C CD  . ARG B 1 470 ? -18.179 6.958   -36.244 1.00 61.71 ? 470  ARG B CD  1 
ATOM   7735 N NE  . ARG B 1 470 ? -19.224 6.616   -35.271 1.00 69.83 ? 470  ARG B NE  1 
ATOM   7736 C CZ  . ARG B 1 470 ? -19.933 7.492   -34.551 1.00 72.02 ? 470  ARG B CZ  1 
ATOM   7737 N NH1 . ARG B 1 470 ? -19.736 8.810   -34.676 1.00 72.88 ? 470  ARG B NH1 1 
ATOM   7738 N NH2 . ARG B 1 470 ? -20.843 7.034   -33.688 1.00 73.05 ? 470  ARG B NH2 1 
ATOM   7739 N N   . ILE B 1 471 ? -15.302 8.793   -32.574 1.00 56.06 ? 471  ILE B N   1 
ATOM   7740 C CA  . ILE B 1 471 ? -15.228 10.251  -32.322 1.00 55.84 ? 471  ILE B CA  1 
ATOM   7741 C C   . ILE B 1 471 ? -13.767 10.683  -32.118 1.00 54.76 ? 471  ILE B C   1 
ATOM   7742 O O   . ILE B 1 471 ? -13.347 11.734  -32.621 1.00 54.42 ? 471  ILE B O   1 
ATOM   7743 C CB  . ILE B 1 471 ? -16.158 10.731  -31.124 1.00 56.18 ? 471  ILE B CB  1 
ATOM   7744 C CG1 . ILE B 1 471 ? -17.647 10.606  -31.505 1.00 57.35 ? 471  ILE B CG1 1 
ATOM   7745 C CG2 . ILE B 1 471 ? -15.849 12.196  -30.696 1.00 55.45 ? 471  ILE B CG2 1 
ATOM   7746 C CD1 . ILE B 1 471 ? -18.634 10.754  -30.316 1.00 56.75 ? 471  ILE B CD1 1 
ATOM   7747 N N   . PHE B 1 472 ? -13.024 9.849   -31.387 1.00 53.52 ? 472  PHE B N   1 
ATOM   7748 C CA  . PHE B 1 472 ? -11.578 9.955   -31.229 1.00 52.67 ? 472  PHE B CA  1 
ATOM   7749 C C   . PHE B 1 472 ? -10.846 10.012  -32.579 1.00 52.54 ? 472  PHE B C   1 
ATOM   7750 O O   . PHE B 1 472 ? -10.043 10.930  -32.827 1.00 52.05 ? 472  PHE B O   1 
ATOM   7751 C CB  . PHE B 1 472 ? -11.087 8.774   -30.403 1.00 52.30 ? 472  PHE B CB  1 
ATOM   7752 C CG  . PHE B 1 472 ? -9.621  8.810   -30.066 1.00 51.88 ? 472  PHE B CG  1 
ATOM   7753 C CD1 . PHE B 1 472 ? -8.986  9.999   -29.745 1.00 51.41 ? 472  PHE B CD1 1 
ATOM   7754 C CD2 . PHE B 1 472 ? -8.891  7.628   -30.011 1.00 50.68 ? 472  PHE B CD2 1 
ATOM   7755 C CE1 . PHE B 1 472 ? -7.650  10.019  -29.417 1.00 50.59 ? 472  PHE B CE1 1 
ATOM   7756 C CE2 . PHE B 1 472 ? -7.563  7.639   -29.680 1.00 50.11 ? 472  PHE B CE2 1 
ATOM   7757 C CZ  . PHE B 1 472 ? -6.938  8.839   -29.380 1.00 50.89 ? 472  PHE B CZ  1 
ATOM   7758 N N   . ALA B 1 473 ? -11.142 9.042   -33.444 1.00 51.91 ? 473  ALA B N   1 
ATOM   7759 C CA  . ALA B 1 473 ? -10.536 8.989   -34.758 1.00 51.16 ? 473  ALA B CA  1 
ATOM   7760 C C   . ALA B 1 473 ? -10.824 10.266  -35.520 1.00 51.09 ? 473  ALA B C   1 
ATOM   7761 O O   . ALA B 1 473 ? -9.924  10.812  -36.155 1.00 51.75 ? 473  ALA B O   1 
ATOM   7762 C CB  . ALA B 1 473 ? -11.014 7.782   -35.523 1.00 51.14 ? 473  ALA B CB  1 
ATOM   7763 N N   . GLN B 1 474 ? -12.056 10.759  -35.457 1.00 50.63 ? 474  GLN B N   1 
ATOM   7764 C CA  . GLN B 1 474 ? -12.391 12.023  -36.125 1.00 51.17 ? 474  GLN B CA  1 
ATOM   7765 C C   . GLN B 1 474 ? -11.489 13.171  -35.648 1.00 49.62 ? 474  GLN B C   1 
ATOM   7766 O O   . GLN B 1 474 ? -10.943 13.923  -36.473 1.00 49.61 ? 474  GLN B O   1 
ATOM   7767 C CB  . GLN B 1 474 ? -13.880 12.369  -35.961 1.00 51.07 ? 474  GLN B CB  1 
ATOM   7768 C CG  . GLN B 1 474 ? -14.804 11.377  -36.682 1.00 53.72 ? 474  GLN B CG  1 
ATOM   7769 C CD  . GLN B 1 474 ? -16.299 11.702  -36.565 1.00 54.96 ? 474  GLN B CD  1 
ATOM   7770 O OE1 . GLN B 1 474 ? -16.858 11.812  -35.459 1.00 60.99 ? 474  GLN B OE1 1 
ATOM   7771 N NE2 . GLN B 1 474 ? -16.960 11.828  -37.720 1.00 58.98 ? 474  GLN B NE2 1 
ATOM   7772 N N   . ARG B 1 475 ? -11.325 13.287  -34.329 1.00 48.22 ? 475  ARG B N   1 
ATOM   7773 C CA  . ARG B 1 475 ? -10.419 14.266  -33.731 1.00 47.51 ? 475  ARG B CA  1 
ATOM   7774 C C   . ARG B 1 475 ? -9.006  14.164  -34.334 1.00 46.45 ? 475  ARG B C   1 
ATOM   7775 O O   . ARG B 1 475 ? -8.454  15.143  -34.858 1.00 46.05 ? 475  ARG B O   1 
ATOM   7776 C CB  . ARG B 1 475 ? -10.348 14.092  -32.203 1.00 47.68 ? 475  ARG B CB  1 
ATOM   7777 C CG  . ARG B 1 475 ? -11.508 14.717  -31.405 1.00 48.50 ? 475  ARG B CG  1 
ATOM   7778 C CD  . ARG B 1 475 ? -11.388 14.481  -29.875 1.00 48.00 ? 475  ARG B CD  1 
ATOM   7779 N NE  . ARG B 1 475 ? -10.119 15.018  -29.385 1.00 46.63 ? 475  ARG B NE  1 
ATOM   7780 C CZ  . ARG B 1 475 ? -9.351  14.438  -28.464 1.00 45.43 ? 475  ARG B CZ  1 
ATOM   7781 N NH1 . ARG B 1 475 ? -9.711  13.286  -27.871 1.00 41.72 ? 475  ARG B NH1 1 
ATOM   7782 N NH2 . ARG B 1 475 ? -8.202  15.017  -28.147 1.00 43.13 ? 475  ARG B NH2 1 
ATOM   7783 N N   . LEU B 1 476 ? -8.441  12.965  -34.273 1.00 45.23 ? 476  LEU B N   1 
ATOM   7784 C CA  . LEU B 1 476 ? -7.099  12.725  -34.771 1.00 44.28 ? 476  LEU B CA  1 
ATOM   7785 C C   . LEU B 1 476 ? -6.968  13.107  -36.230 1.00 44.28 ? 476  LEU B C   1 
ATOM   7786 O O   . LEU B 1 476 ? -5.988  13.745  -36.603 1.00 44.53 ? 476  LEU B O   1 
ATOM   7787 C CB  . LEU B 1 476 ? -6.684  11.275  -34.542 1.00 43.55 ? 476  LEU B CB  1 
ATOM   7788 C CG  . LEU B 1 476 ? -6.583  10.892  -33.084 1.00 42.27 ? 476  LEU B CG  1 
ATOM   7789 C CD1 . LEU B 1 476 ? -6.045  9.487   -32.944 1.00 41.57 ? 476  LEU B CD1 1 
ATOM   7790 C CD2 . LEU B 1 476 ? -5.701  11.889  -32.339 1.00 42.65 ? 476  LEU B CD2 1 
ATOM   7791 N N   . MET B 1 477 ? -7.956  12.747  -37.048 1.00 44.02 ? 477  MET B N   1 
ATOM   7792 C CA  . MET B 1 477 ? -7.903  13.076  -38.459 1.00 44.62 ? 477  MET B CA  1 
ATOM   7793 C C   . MET B 1 477 ? -7.926  14.589  -38.638 1.00 44.11 ? 477  MET B C   1 
ATOM   7794 O O   . MET B 1 477 ? -7.372  15.121  -39.602 1.00 44.39 ? 477  MET B O   1 
ATOM   7795 C CB  . MET B 1 477 ? -9.078  12.452  -39.232 1.00 44.56 ? 477  MET B CB  1 
ATOM   7796 C CG  . MET B 1 477 ? -9.191  10.922  -39.211 1.00 45.88 ? 477  MET B CG  1 
ATOM   7797 S SD  . MET B 1 477 ? -10.754 10.275  -39.922 1.00 48.12 ? 477  MET B SD  1 
ATOM   7798 C CE  . MET B 1 477 ? -10.640 10.784  -41.631 1.00 45.10 ? 477  MET B CE  1 
ATOM   7799 N N   . LYS B 1 478 ? -8.601  15.281  -37.724 1.00 44.07 ? 478  LYS B N   1 
ATOM   7800 C CA  . LYS B 1 478 ? -8.712  16.736  -37.792 1.00 43.53 ? 478  LYS B CA  1 
ATOM   7801 C C   . LYS B 1 478 ? -7.379  17.370  -37.420 1.00 41.93 ? 478  LYS B C   1 
ATOM   7802 O O   . LYS B 1 478 ? -6.952  18.343  -38.064 1.00 40.98 ? 478  LYS B O   1 
ATOM   7803 C CB  . LYS B 1 478 ? -9.848  17.263  -36.889 1.00 44.94 ? 478  LYS B CB  1 
ATOM   7804 C CG  . LYS B 1 478 ? -10.987 17.983  -37.620 1.00 47.73 ? 478  LYS B CG  1 
ATOM   7805 C CD  . LYS B 1 478 ? -10.642 19.498  -37.857 1.00 53.14 ? 478  LYS B CD  1 
ATOM   7806 C CE  . LYS B 1 478 ? -11.700 20.281  -38.728 1.00 53.73 ? 478  LYS B CE  1 
ATOM   7807 N NZ  . LYS B 1 478 ? -11.833 19.766  -40.160 1.00 54.84 ? 478  LYS B NZ  1 
ATOM   7808 N N   . TYR B 1 479 ? -6.723  16.806  -36.399 1.00 40.47 ? 479  TYR B N   1 
ATOM   7809 C CA  . TYR B 1 479 ? -5.415  17.302  -35.964 1.00 39.33 ? 479  TYR B CA  1 
ATOM   7810 C C   . TYR B 1 479 ? -4.425  17.148  -37.102 1.00 39.45 ? 479  TYR B C   1 
ATOM   7811 O O   . TYR B 1 479 ? -3.830  18.139  -37.547 1.00 39.67 ? 479  TYR B O   1 
ATOM   7812 C CB  . TYR B 1 479 ? -4.874  16.551  -34.767 1.00 38.56 ? 479  TYR B CB  1 
ATOM   7813 C CG  . TYR B 1 479 ? -5.571  16.742  -33.468 1.00 37.01 ? 479  TYR B CG  1 
ATOM   7814 C CD1 . TYR B 1 479 ? -6.051  17.999  -33.051 1.00 36.88 ? 479  TYR B CD1 1 
ATOM   7815 C CD2 . TYR B 1 479 ? -5.710  15.663  -32.607 1.00 35.84 ? 479  TYR B CD2 1 
ATOM   7816 C CE1 . TYR B 1 479 ? -6.686  18.148  -31.789 1.00 34.89 ? 479  TYR B CE1 1 
ATOM   7817 C CE2 . TYR B 1 479 ? -6.333  15.789  -31.376 1.00 36.67 ? 479  TYR B CE2 1 
ATOM   7818 C CZ  . TYR B 1 479 ? -6.823  17.026  -30.966 1.00 37.16 ? 479  TYR B CZ  1 
ATOM   7819 O OH  . TYR B 1 479 ? -7.437  17.073  -29.727 1.00 37.91 ? 479  TYR B OH  1 
ATOM   7820 N N   . TRP B 1 480 ? -4.285  15.916  -37.606 1.00 39.26 ? 480  TRP B N   1 
ATOM   7821 C CA  . TRP B 1 480 ? -3.331  15.650  -38.692 1.00 39.29 ? 480  TRP B CA  1 
ATOM   7822 C C   . TRP B 1 480 ? -3.572  16.551  -39.912 1.00 39.69 ? 480  TRP B C   1 
ATOM   7823 O O   . TRP B 1 480 ? -2.646  17.187  -40.415 1.00 39.32 ? 480  TRP B O   1 
ATOM   7824 C CB  . TRP B 1 480 ? -3.305  14.159  -39.064 1.00 38.57 ? 480  TRP B CB  1 
ATOM   7825 C CG  . TRP B 1 480 ? -2.224  13.363  -38.352 1.00 38.18 ? 480  TRP B CG  1 
ATOM   7826 C CD1 . TRP B 1 480 ? -1.212  12.645  -38.940 1.00 37.44 ? 480  TRP B CD1 1 
ATOM   7827 C CD2 . TRP B 1 480 ? -2.035  13.217  -36.933 1.00 38.76 ? 480  TRP B CD2 1 
ATOM   7828 N NE1 . TRP B 1 480 ? -0.410  12.068  -37.984 1.00 37.55 ? 480  TRP B NE1 1 
ATOM   7829 C CE2 . TRP B 1 480 ? -0.893  12.394  -36.744 1.00 38.69 ? 480  TRP B CE2 1 
ATOM   7830 C CE3 . TRP B 1 480 ? -2.707  13.711  -35.802 1.00 37.83 ? 480  TRP B CE3 1 
ATOM   7831 C CZ2 . TRP B 1 480 ? -0.421  12.043  -35.471 1.00 38.23 ? 480  TRP B CZ2 1 
ATOM   7832 C CZ3 . TRP B 1 480 ? -2.239  13.367  -34.543 1.00 37.33 ? 480  TRP B CZ3 1 
ATOM   7833 C CH2 . TRP B 1 480 ? -1.108  12.535  -34.387 1.00 38.27 ? 480  TRP B CH2 1 
ATOM   7834 N N   . THR B 1 481 ? -4.816  16.625  -40.377 1.00 40.25 ? 481  THR B N   1 
ATOM   7835 C CA  . THR B 1 481 ? -5.104  17.385  -41.606 1.00 41.01 ? 481  THR B CA  1 
ATOM   7836 C C   . THR B 1 481 ? -5.073  18.890  -41.369 1.00 41.13 ? 481  THR B C   1 
ATOM   7837 O O   . THR B 1 481 ? -4.754  19.653  -42.287 1.00 40.76 ? 481  THR B O   1 
ATOM   7838 C CB  . THR B 1 481 ? -6.456  17.002  -42.207 1.00 40.78 ? 481  THR B CB  1 
ATOM   7839 O OG1 . THR B 1 481 ? -7.366  16.759  -41.133 1.00 42.38 ? 481  THR B OG1 1 
ATOM   7840 C CG2 . THR B 1 481 ? -6.325  15.754  -42.987 1.00 41.48 ? 481  THR B CG2 1 
ATOM   7841 N N   . ASN B 1 482 ? -5.409  19.320  -40.151 1.00 41.51 ? 482  ASN B N   1 
ATOM   7842 C CA  . ASN B 1 482 ? -5.195  20.725  -39.807 1.00 41.93 ? 482  ASN B CA  1 
ATOM   7843 C C   . ASN B 1 482 ? -3.734  21.030  -39.845 1.00 41.40 ? 482  ASN B C   1 
ATOM   7844 O O   . ASN B 1 482 ? -3.339  22.060  -40.396 1.00 41.64 ? 482  ASN B O   1 
ATOM   7845 C CB  . ASN B 1 482 ? -5.752  21.095  -38.437 1.00 42.48 ? 482  ASN B CB  1 
ATOM   7846 C CG  . ASN B 1 482 ? -7.253  21.303  -38.460 1.00 42.69 ? 482  ASN B CG  1 
ATOM   7847 O OD1 . ASN B 1 482 ? -7.821  21.719  -39.475 1.00 42.60 ? 482  ASN B OD1 1 
ATOM   7848 N ND2 . ASN B 1 482 ? -7.905  20.990  -37.338 1.00 44.25 ? 482  ASN B ND2 1 
ATOM   7849 N N   . PHE B 1 483 ? -2.935  20.128  -39.273 1.00 40.91 ? 483  PHE B N   1 
ATOM   7850 C CA  . PHE B 1 483 ? -1.507  20.263  -39.367 1.00 40.72 ? 483  PHE B CA  1 
ATOM   7851 C C   . PHE B 1 483 ? -1.012  20.345  -40.822 1.00 41.53 ? 483  PHE B C   1 
ATOM   7852 O O   . PHE B 1 483 ? -0.166  21.192  -41.149 1.00 42.17 ? 483  PHE B O   1 
ATOM   7853 C CB  . PHE B 1 483 ? -0.751  19.192  -38.582 1.00 40.54 ? 483  PHE B CB  1 
ATOM   7854 C CG  . PHE B 1 483 ? 0.741   19.359  -38.677 1.00 40.06 ? 483  PHE B CG  1 
ATOM   7855 C CD1 . PHE B 1 483 ? 1.395   20.319  -37.899 1.00 37.87 ? 483  PHE B CD1 1 
ATOM   7856 C CD2 . PHE B 1 483 ? 1.478   18.628  -39.602 1.00 38.11 ? 483  PHE B CD2 1 
ATOM   7857 C CE1 . PHE B 1 483 ? 2.771   20.511  -38.003 1.00 37.72 ? 483  PHE B CE1 1 
ATOM   7858 C CE2 . PHE B 1 483 ? 2.862   18.815  -39.712 1.00 38.42 ? 483  PHE B CE2 1 
ATOM   7859 C CZ  . PHE B 1 483 ? 3.503   19.770  -38.911 1.00 38.40 ? 483  PHE B CZ  1 
ATOM   7860 N N   . ALA B 1 484 ? -1.534  19.496  -41.700 1.00 41.87 ? 484  ALA B N   1 
ATOM   7861 C CA  . ALA B 1 484 ? -1.157  19.569  -43.114 1.00 42.51 ? 484  ALA B CA  1 
ATOM   7862 C C   . ALA B 1 484 ? -1.579  20.887  -43.755 1.00 43.54 ? 484  ALA B C   1 
ATOM   7863 O O   . ALA B 1 484 ? -0.808  21.488  -44.526 1.00 43.75 ? 484  ALA B O   1 
ATOM   7864 C CB  . ALA B 1 484 ? -1.721  18.396  -43.887 1.00 42.00 ? 484  ALA B CB  1 
ATOM   7865 N N   . ARG B 1 485 ? -2.799  21.333  -43.448 1.00 44.65 ? 485  ARG B N   1 
ATOM   7866 C CA  . ARG B 1 485 ? -3.353  22.540  -44.065 1.00 46.70 ? 485  ARG B CA  1 
ATOM   7867 C C   . ARG B 1 485 ? -2.556  23.764  -43.669 1.00 46.26 ? 485  ARG B C   1 
ATOM   7868 O O   . ARG B 1 485 ? -2.271  24.610  -44.522 1.00 46.35 ? 485  ARG B O   1 
ATOM   7869 C CB  . ARG B 1 485 ? -4.822  22.782  -43.672 1.00 46.47 ? 485  ARG B CB  1 
ATOM   7870 C CG  . ARG B 1 485 ? -5.878  22.091  -44.548 1.00 50.26 ? 485  ARG B CG  1 
ATOM   7871 C CD  . ARG B 1 485 ? -7.301  22.344  -44.023 1.00 50.17 ? 485  ARG B CD  1 
ATOM   7872 N NE  . ARG B 1 485 ? -7.637  21.477  -42.888 1.00 58.40 ? 485  ARG B NE  1 
ATOM   7873 C CZ  . ARG B 1 485 ? -8.196  20.266  -43.002 1.00 61.79 ? 485  ARG B CZ  1 
ATOM   7874 N NH1 . ARG B 1 485 ? -8.479  19.771  -44.205 1.00 63.90 ? 485  ARG B NH1 1 
ATOM   7875 N NH2 . ARG B 1 485 ? -8.478  19.537  -41.915 1.00 62.15 ? 485  ARG B NH2 1 
ATOM   7876 N N   . THR B 1 486 ? -2.196  23.847  -42.384 1.00 45.96 ? 486  THR B N   1 
ATOM   7877 C CA  . THR B 1 486 ? -1.804  25.124  -41.792 1.00 46.03 ? 486  THR B CA  1 
ATOM   7878 C C   . THR B 1 486 ? -0.452  25.124  -41.071 1.00 46.22 ? 486  THR B C   1 
ATOM   7879 O O   . THR B 1 486 ? 0.082   26.190  -40.784 1.00 46.68 ? 486  THR B O   1 
ATOM   7880 C CB  . THR B 1 486 ? -2.872  25.611  -40.750 1.00 46.33 ? 486  THR B CB  1 
ATOM   7881 O OG1 . THR B 1 486 ? -2.990  24.656  -39.691 1.00 45.35 ? 486  THR B OG1 1 
ATOM   7882 C CG2 . THR B 1 486 ? -4.253  25.831  -41.387 1.00 45.15 ? 486  THR B CG2 1 
ATOM   7883 N N   . GLY B 1 487 ? 0.093   23.955  -40.746 1.00 45.49 ? 487  GLY B N   1 
ATOM   7884 C CA  . GLY B 1 487 ? 1.340   23.917  -39.990 1.00 44.58 ? 487  GLY B CA  1 
ATOM   7885 C C   . GLY B 1 487 ? 1.078   23.859  -38.500 1.00 44.88 ? 487  GLY B C   1 
ATOM   7886 O O   . GLY B 1 487 ? 2.032   23.823  -37.719 1.00 43.89 ? 487  GLY B O   1 
ATOM   7887 N N   . ASP B 1 488 ? -0.222  23.807  -38.130 1.00 45.08 ? 488  ASP B N   1 
ATOM   7888 C CA  . ASP B 1 488 ? -0.737  23.928  -36.757 1.00 45.47 ? 488  ASP B CA  1 
ATOM   7889 C C   . ASP B 1 488 ? -1.933  22.954  -36.555 1.00 46.34 ? 488  ASP B C   1 
ATOM   7890 O O   . ASP B 1 488 ? -2.957  23.107  -37.214 1.00 46.27 ? 488  ASP B O   1 
ATOM   7891 C CB  . ASP B 1 488 ? -1.176  25.389  -36.551 1.00 45.47 ? 488  ASP B CB  1 
ATOM   7892 C CG  . ASP B 1 488 ? -1.665  25.701  -35.132 1.00 46.51 ? 488  ASP B CG  1 
ATOM   7893 O OD1 . ASP B 1 488 ? -2.025  24.777  -34.361 1.00 47.80 ? 488  ASP B OD1 1 
ATOM   7894 O OD2 . ASP B 1 488 ? -1.706  26.911  -34.791 1.00 45.49 ? 488  ASP B OD2 1 
ATOM   7895 N N   . PRO B 1 489 ? -1.829  21.980  -35.619 1.00 47.12 ? 489  PRO B N   1 
ATOM   7896 C CA  . PRO B 1 489 ? -2.869  20.967  -35.510 1.00 48.42 ? 489  PRO B CA  1 
ATOM   7897 C C   . PRO B 1 489 ? -4.174  21.469  -34.876 1.00 50.36 ? 489  PRO B C   1 
ATOM   7898 O O   . PRO B 1 489 ? -5.163  20.737  -34.838 1.00 50.21 ? 489  PRO B O   1 
ATOM   7899 C CB  . PRO B 1 489 ? -2.230  19.898  -34.616 1.00 47.97 ? 489  PRO B CB  1 
ATOM   7900 C CG  . PRO B 1 489 ? -1.260  20.612  -33.804 1.00 46.54 ? 489  PRO B CG  1 
ATOM   7901 C CD  . PRO B 1 489 ? -0.779  21.785  -34.604 1.00 46.97 ? 489  PRO B CD  1 
ATOM   7902 N N   . ASN B 1 490 ? -4.165  22.698  -34.377 1.00 52.75 ? 490  ASN B N   1 
ATOM   7903 C CA  . ASN B 1 490 ? -5.332  23.255  -33.701 1.00 55.06 ? 490  ASN B CA  1 
ATOM   7904 C C   . ASN B 1 490 ? -6.415  23.626  -34.675 1.00 57.55 ? 490  ASN B C   1 
ATOM   7905 O O   . ASN B 1 490 ? -6.137  24.066  -35.800 1.00 57.62 ? 490  ASN B O   1 
ATOM   7906 C CB  . ASN B 1 490 ? -4.965  24.470  -32.851 1.00 54.20 ? 490  ASN B CB  1 
ATOM   7907 C CG  . ASN B 1 490 ? -4.143  24.098  -31.662 1.00 52.76 ? 490  ASN B CG  1 
ATOM   7908 O OD1 . ASN B 1 490 ? -4.647  23.526  -30.694 1.00 52.44 ? 490  ASN B OD1 1 
ATOM   7909 N ND2 . ASN B 1 490 ? -2.859  24.389  -31.729 1.00 49.53 ? 490  ASN B ND2 1 
ATOM   7910 N N   . ASP B 1 491 ? -7.646  23.430  -34.213 1.00 60.94 ? 491  ASP B N   1 
ATOM   7911 C CA  . ASP B 1 491 ? -8.846  23.715  -34.968 1.00 64.70 ? 491  ASP B CA  1 
ATOM   7912 C C   . ASP B 1 491 ? -9.251  25.180  -34.748 1.00 66.96 ? 491  ASP B C   1 
ATOM   7913 O O   . ASP B 1 491 ? -9.721  25.521  -33.651 1.00 67.21 ? 491  ASP B O   1 
ATOM   7914 C CB  . ASP B 1 491 ? -9.951  22.770  -34.471 1.00 64.96 ? 491  ASP B CB  1 
ATOM   7915 C CG  . ASP B 1 491 ? -11.053 22.535  -35.505 1.00 66.93 ? 491  ASP B CG  1 
ATOM   7916 O OD1 . ASP B 1 491 ? -11.142 23.273  -36.525 1.00 67.99 ? 491  ASP B OD1 1 
ATOM   7917 O OD2 . ASP B 1 491 ? -11.842 21.583  -35.282 1.00 69.99 ? 491  ASP B OD2 1 
ATOM   7918 N N   . PRO B 1 492 ? -9.075  26.051  -35.775 1.00 69.32 ? 492  PRO B N   1 
ATOM   7919 C CA  . PRO B 1 492 ? -9.504  27.475  -35.661 1.00 71.26 ? 492  PRO B CA  1 
ATOM   7920 C C   . PRO B 1 492 ? -10.964 27.618  -35.175 1.00 72.91 ? 492  PRO B C   1 
ATOM   7921 O O   . PRO B 1 492 ? -11.207 28.216  -34.102 1.00 73.46 ? 492  PRO B O   1 
ATOM   7922 C CB  . PRO B 1 492 ? -9.317  28.049  -37.086 1.00 71.30 ? 492  PRO B CB  1 
ATOM   7923 C CG  . PRO B 1 492 ? -9.061  26.818  -37.995 1.00 71.12 ? 492  PRO B CG  1 
ATOM   7924 C CD  . PRO B 1 492 ? -8.483  25.748  -37.092 1.00 69.82 ? 492  PRO B CD  1 
ATOM   7925 N N   . ARG B 1 493 ? -11.914 27.059  -35.935 1.00 74.20 ? 493  ARG B N   1 
ATOM   7926 C CA  . ARG B 1 493 ? -13.305 26.892  -35.460 1.00 75.49 ? 493  ARG B CA  1 
ATOM   7927 C C   . ARG B 1 493 ? -13.329 25.933  -34.255 1.00 76.11 ? 493  ARG B C   1 
ATOM   7928 O O   . ARG B 1 493 ? -13.373 24.717  -34.436 1.00 76.33 ? 493  ARG B O   1 
ATOM   7929 C CB  . ARG B 1 493 ? -14.222 26.365  -36.590 1.00 75.25 ? 493  ARG B CB  1 
ATOM   7930 N N   . ASP B 1 494 ? -13.271 26.490  -33.045 1.00 76.88 ? 494  ASP B N   1 
ATOM   7931 C CA  . ASP B 1 494 ? -13.216 25.727  -31.773 1.00 77.88 ? 494  ASP B CA  1 
ATOM   7932 C C   . ASP B 1 494 ? -12.336 26.468  -30.744 1.00 77.99 ? 494  ASP B C   1 
ATOM   7933 O O   . ASP B 1 494 ? -11.365 27.152  -31.124 1.00 77.93 ? 494  ASP B O   1 
ATOM   7934 C CB  . ASP B 1 494 ? -12.727 24.281  -31.963 1.00 78.09 ? 494  ASP B CB  1 
ATOM   7935 C CG  . ASP B 1 494 ? -12.940 23.402  -30.720 1.00 79.93 ? 494  ASP B CG  1 
ATOM   7936 O OD1 . ASP B 1 494 ? -13.404 23.893  -29.654 1.00 80.54 ? 494  ASP B OD1 1 
ATOM   7937 O OD2 . ASP B 1 494 ? -12.626 22.191  -30.816 1.00 82.20 ? 494  ASP B OD2 1 
ATOM   7938 N N   . SER B 1 495 ? -12.690 26.319  -29.455 1.00 77.61 ? 495  SER B N   1 
ATOM   7939 C CA  . SER B 1 495 ? -12.215 27.206  -28.381 1.00 77.09 ? 495  SER B CA  1 
ATOM   7940 C C   . SER B 1 495 ? -12.136 26.551  -26.984 1.00 76.93 ? 495  SER B C   1 
ATOM   7941 O O   . SER B 1 495 ? -12.880 25.590  -26.677 1.00 76.58 ? 495  SER B O   1 
ATOM   7942 C CB  . SER B 1 495 ? -13.108 28.464  -28.284 1.00 76.82 ? 495  SER B CB  1 
ATOM   7943 O OG  . SER B 1 495 ? -13.320 29.079  -29.544 1.00 75.89 ? 495  SER B OG  1 
ATOM   7944 N N   . LYS B 1 496 ? -11.214 27.098  -26.168 1.00 76.39 ? 496  LYS B N   1 
ATOM   7945 C CA  . LYS B 1 496 ? -11.112 26.914  -24.688 1.00 75.98 ? 496  LYS B CA  1 
ATOM   7946 C C   . LYS B 1 496 ? -10.575 25.554  -24.225 1.00 75.39 ? 496  LYS B C   1 
ATOM   7947 O O   . LYS B 1 496 ? -10.045 25.413  -23.091 1.00 75.23 ? 496  LYS B O   1 
ATOM   7948 C CB  . LYS B 1 496 ? -12.474 27.157  -23.970 1.00 76.09 ? 496  LYS B CB  1 
ATOM   7949 C CG  . LYS B 1 496 ? -13.194 28.479  -24.289 1.00 75.92 ? 496  LYS B CG  1 
ATOM   7950 C CD  . LYS B 1 496 ? -12.284 29.728  -24.134 1.00 73.44 ? 496  LYS B CD  1 
ATOM   7951 C CE  . LYS B 1 496 ? -12.630 30.809  -25.175 1.00 72.68 ? 496  LYS B CE  1 
ATOM   7952 N NZ  . LYS B 1 496 ? -14.092 30.987  -25.475 1.00 70.41 ? 496  LYS B NZ  1 
ATOM   7953 N N   . SER B 1 497 ? -10.733 24.563  -25.110 1.00 73.95 ? 497  SER B N   1 
ATOM   7954 C CA  . SER B 1 497 ? -10.924 23.179  -24.658 1.00 71.70 ? 497  SER B CA  1 
ATOM   7955 C C   . SER B 1 497 ? -9.946  22.151  -25.226 1.00 68.99 ? 497  SER B C   1 
ATOM   7956 O O   . SER B 1 497 ? -10.317 21.362  -26.105 1.00 68.97 ? 497  SER B O   1 
ATOM   7957 C CB  . SER B 1 497 ? -12.416 22.716  -24.780 1.00 71.86 ? 497  SER B CB  1 
ATOM   7958 O OG  . SER B 1 497 ? -12.909 22.784  -26.118 1.00 72.45 ? 497  SER B OG  1 
ATOM   7959 N N   . PRO B 1 498 ? -8.674  22.225  -24.783 1.00 65.91 ? 498  PRO B N   1 
ATOM   7960 C CA  . PRO B 1 498 ? -7.779  23.374  -24.660 1.00 63.36 ? 498  PRO B CA  1 
ATOM   7961 C C   . PRO B 1 498 ? -6.894  23.445  -25.917 1.00 60.76 ? 498  PRO B C   1 
ATOM   7962 O O   . PRO B 1 498 ? -6.954  22.550  -26.759 1.00 60.32 ? 498  PRO B O   1 
ATOM   7963 C CB  . PRO B 1 498 ? -6.932  23.027  -23.426 1.00 63.48 ? 498  PRO B CB  1 
ATOM   7964 C CG  . PRO B 1 498 ? -7.548  21.724  -22.875 1.00 64.26 ? 498  PRO B CG  1 
ATOM   7965 C CD  . PRO B 1 498 ? -8.132  21.066  -24.063 1.00 65.35 ? 498  PRO B CD  1 
ATOM   7966 N N   . GLN B 1 499 ? -6.079  24.483  -26.054 1.00 57.25 ? 499  GLN B N   1 
ATOM   7967 C CA  . GLN B 1 499 ? -5.199  24.568  -27.212 1.00 54.08 ? 499  GLN B CA  1 
ATOM   7968 C C   . GLN B 1 499 ? -3.991  23.636  -27.087 1.00 51.15 ? 499  GLN B C   1 
ATOM   7969 O O   . GLN B 1 499 ? -3.545  23.348  -25.989 1.00 50.52 ? 499  GLN B O   1 
ATOM   7970 C CB  . GLN B 1 499 ? -4.771  26.019  -27.454 1.00 54.52 ? 499  GLN B CB  1 
ATOM   7971 C CG  . GLN B 1 499 ? -5.896  26.853  -28.050 1.00 55.19 ? 499  GLN B CG  1 
ATOM   7972 C CD  . GLN B 1 499 ? -5.891  26.859  -29.562 1.00 57.24 ? 499  GLN B CD  1 
ATOM   7973 O OE1 . GLN B 1 499 ? -4.869  27.199  -30.181 1.00 59.14 ? 499  GLN B OE1 1 
ATOM   7974 N NE2 . GLN B 1 499 ? -7.039  26.514  -30.180 1.00 56.60 ? 499  GLN B NE2 1 
ATOM   7975 N N   . TRP B 1 500 ? -3.491  23.154  -28.221 1.00 47.80 ? 500  TRP B N   1 
ATOM   7976 C CA  . TRP B 1 500 ? -2.269  22.352  -28.271 1.00 45.05 ? 500  TRP B CA  1 
ATOM   7977 C C   . TRP B 1 500 ? -1.055  23.325  -28.397 1.00 43.20 ? 500  TRP B C   1 
ATOM   7978 O O   . TRP B 1 500 ? -0.837  23.915  -29.457 1.00 42.51 ? 500  TRP B O   1 
ATOM   7979 C CB  . TRP B 1 500 ? -2.356  21.393  -29.468 1.00 44.37 ? 500  TRP B CB  1 
ATOM   7980 C CG  . TRP B 1 500 ? -1.284  20.361  -29.564 1.00 44.43 ? 500  TRP B CG  1 
ATOM   7981 C CD1 . TRP B 1 500 ? -0.047  20.393  -28.984 1.00 44.86 ? 500  TRP B CD1 1 
ATOM   7982 C CD2 . TRP B 1 500 ? -1.324  19.146  -30.334 1.00 44.49 ? 500  TRP B CD2 1 
ATOM   7983 N NE1 . TRP B 1 500 ? 0.665   19.261  -29.314 1.00 43.56 ? 500  TRP B NE1 1 
ATOM   7984 C CE2 . TRP B 1 500 ? -0.089  18.493  -30.155 1.00 43.97 ? 500  TRP B CE2 1 
ATOM   7985 C CE3 . TRP B 1 500 ? -2.297  18.538  -31.144 1.00 44.68 ? 500  TRP B CE3 1 
ATOM   7986 C CZ2 . TRP B 1 500 ? 0.199   17.267  -30.749 1.00 45.35 ? 500  TRP B CZ2 1 
ATOM   7987 C CZ3 . TRP B 1 500 ? -2.007  17.320  -31.740 1.00 44.13 ? 500  TRP B CZ3 1 
ATOM   7988 C CH2 . TRP B 1 500 ? -0.771  16.697  -31.541 1.00 44.26 ? 500  TRP B CH2 1 
ATOM   7989 N N   . PRO B 1 501 ? -0.290  23.531  -27.304 1.00 41.37 ? 501  PRO B N   1 
ATOM   7990 C CA  . PRO B 1 501 ? 0.838   24.468  -27.409 1.00 40.61 ? 501  PRO B CA  1 
ATOM   7991 C C   . PRO B 1 501 ? 2.039   23.863  -28.165 1.00 40.00 ? 501  PRO B C   1 
ATOM   7992 O O   . PRO B 1 501 ? 2.295   22.642  -28.085 1.00 39.63 ? 501  PRO B O   1 
ATOM   7993 C CB  . PRO B 1 501 ? 1.218   24.708  -25.948 1.00 39.94 ? 501  PRO B CB  1 
ATOM   7994 C CG  . PRO B 1 501 ? 0.849   23.449  -25.268 1.00 40.15 ? 501  PRO B CG  1 
ATOM   7995 C CD  . PRO B 1 501 ? -0.392  22.962  -25.947 1.00 40.93 ? 501  PRO B CD  1 
ATOM   7996 N N   . PRO B 1 502 ? 2.752   24.696  -28.922 1.00 38.98 ? 502  PRO B N   1 
ATOM   7997 C CA  . PRO B 1 502 ? 4.039   24.264  -29.492 1.00 39.15 ? 502  PRO B CA  1 
ATOM   7998 C C   . PRO B 1 502 ? 4.988   23.665  -28.449 1.00 38.51 ? 502  PRO B C   1 
ATOM   7999 O O   . PRO B 1 502 ? 5.009   24.094  -27.299 1.00 38.12 ? 502  PRO B O   1 
ATOM   8000 C CB  . PRO B 1 502 ? 4.626   25.561  -30.069 1.00 38.72 ? 502  PRO B CB  1 
ATOM   8001 C CG  . PRO B 1 502 ? 3.417   26.382  -30.417 1.00 39.67 ? 502  PRO B CG  1 
ATOM   8002 C CD  . PRO B 1 502 ? 2.387   26.058  -29.328 1.00 38.91 ? 502  PRO B CD  1 
ATOM   8003 N N   . TYR B 1 503 ? 5.732   22.644  -28.842 1.00 38.51 ? 503  TYR B N   1 
ATOM   8004 C CA  . TYR B 1 503 ? 6.808   22.134  -27.999 1.00 38.58 ? 503  TYR B CA  1 
ATOM   8005 C C   . TYR B 1 503 ? 7.986   23.122  -28.043 1.00 38.93 ? 503  TYR B C   1 
ATOM   8006 O O   . TYR B 1 503 ? 8.307   23.646  -29.106 1.00 38.30 ? 503  TYR B O   1 
ATOM   8007 C CB  . TYR B 1 503 ? 7.225   20.737  -28.452 1.00 37.75 ? 503  TYR B CB  1 
ATOM   8008 C CG  . TYR B 1 503 ? 8.318   20.141  -27.610 1.00 37.55 ? 503  TYR B CG  1 
ATOM   8009 C CD1 . TYR B 1 503 ? 9.659   20.419  -27.878 1.00 36.70 ? 503  TYR B CD1 1 
ATOM   8010 C CD2 . TYR B 1 503 ? 8.017   19.320  -26.528 1.00 36.56 ? 503  TYR B CD2 1 
ATOM   8011 C CE1 . TYR B 1 503 ? 10.668  19.886  -27.105 1.00 36.13 ? 503  TYR B CE1 1 
ATOM   8012 C CE2 . TYR B 1 503 ? 9.021   18.785  -25.746 1.00 37.99 ? 503  TYR B CE2 1 
ATOM   8013 C CZ  . TYR B 1 503 ? 10.353  19.073  -26.047 1.00 37.94 ? 503  TYR B CZ  1 
ATOM   8014 O OH  . TYR B 1 503 ? 11.369  18.536  -25.281 1.00 38.27 ? 503  TYR B OH  1 
ATOM   8015 N N   . THR B 1 504 ? 8.582   23.405  -26.880 1.00 40.03 ? 504  THR B N   1 
ATOM   8016 C CA  . THR B 1 504 ? 9.731   24.335  -26.766 1.00 41.42 ? 504  THR B CA  1 
ATOM   8017 C C   . THR B 1 504 ? 10.765  23.750  -25.818 1.00 42.16 ? 504  THR B C   1 
ATOM   8018 O O   . THR B 1 504 ? 10.428  22.924  -24.982 1.00 42.93 ? 504  THR B O   1 
ATOM   8019 C CB  . THR B 1 504 ? 9.325   25.730  -26.223 1.00 41.58 ? 504  THR B CB  1 
ATOM   8020 O OG1 . THR B 1 504 ? 8.837   25.602  -24.872 1.00 42.55 ? 504  THR B OG1 1 
ATOM   8021 C CG2 . THR B 1 504 ? 8.267   26.411  -27.123 1.00 40.93 ? 504  THR B CG2 1 
ATOM   8022 N N   . THR B 1 505 ? 12.023  24.161  -25.942 1.00 43.06 ? 505  THR B N   1 
ATOM   8023 C CA  . THR B 1 505 ? 13.079  23.650  -25.042 1.00 44.05 ? 505  THR B CA  1 
ATOM   8024 C C   . THR B 1 505 ? 12.870  24.104  -23.601 1.00 43.97 ? 505  THR B C   1 
ATOM   8025 O O   . THR B 1 505 ? 13.153  23.342  -22.651 1.00 44.19 ? 505  THR B O   1 
ATOM   8026 C CB  . THR B 1 505 ? 14.499  24.044  -25.509 1.00 44.23 ? 505  THR B CB  1 
ATOM   8027 O OG1 . THR B 1 505 ? 14.541  25.459  -25.753 1.00 46.02 ? 505  THR B OG1 1 
ATOM   8028 C CG2 . THR B 1 505 ? 14.823  23.320  -26.804 1.00 44.14 ? 505  THR B CG2 1 
ATOM   8029 N N   . ALA B 1 506 ? 12.362  25.329  -23.451 1.00 43.49 ? 506  ALA B N   1 
ATOM   8030 C CA  . ALA B 1 506 ? 12.004  25.885  -22.150 1.00 43.75 ? 506  ALA B CA  1 
ATOM   8031 C C   . ALA B 1 506 ? 10.843  25.131  -21.449 1.00 43.95 ? 506  ALA B C   1 
ATOM   8032 O O   . ALA B 1 506 ? 11.033  24.489  -20.408 1.00 43.32 ? 506  ALA B O   1 
ATOM   8033 C CB  . ALA B 1 506 ? 11.629  27.351  -22.336 1.00 44.59 ? 506  ALA B CB  1 
ATOM   8034 N N   . ALA B 1 507 ? 9.641   25.219  -22.034 1.00 43.87 ? 507  ALA B N   1 
ATOM   8035 C CA  . ALA B 1 507 ? 8.437   24.710  -21.399 1.00 43.94 ? 507  ALA B CA  1 
ATOM   8036 C C   . ALA B 1 507 ? 8.214   23.202  -21.579 1.00 44.00 ? 507  ALA B C   1 
ATOM   8037 O O   . ALA B 1 507 ? 7.602   22.571  -20.723 1.00 44.06 ? 507  ALA B O   1 
ATOM   8038 C CB  . ALA B 1 507 ? 7.217   25.505  -21.880 1.00 44.63 ? 507  ALA B CB  1 
ATOM   8039 N N   . GLN B 1 508 ? 8.699   22.643  -22.689 1.00 43.82 ? 508  GLN B N   1 
ATOM   8040 C CA  . GLN B 1 508 ? 8.615   21.191  -23.004 1.00 43.72 ? 508  GLN B CA  1 
ATOM   8041 C C   . GLN B 1 508 ? 7.193   20.600  -22.959 1.00 43.10 ? 508  GLN B C   1 
ATOM   8042 O O   . GLN B 1 508 ? 6.951   19.525  -22.401 1.00 43.06 ? 508  GLN B O   1 
ATOM   8043 C CB  . GLN B 1 508 ? 9.586   20.382  -22.149 1.00 43.56 ? 508  GLN B CB  1 
ATOM   8044 C CG  . GLN B 1 508 ? 11.026  20.821  -22.298 1.00 45.98 ? 508  GLN B CG  1 
ATOM   8045 C CD  . GLN B 1 508 ? 11.956  20.128  -21.309 1.00 47.08 ? 508  GLN B CD  1 
ATOM   8046 O OE1 . GLN B 1 508 ? 12.015  18.895  -21.238 1.00 48.30 ? 508  GLN B OE1 1 
ATOM   8047 N NE2 . GLN B 1 508 ? 12.672  20.917  -20.534 1.00 46.43 ? 508  GLN B NE2 1 
ATOM   8048 N N   . GLN B 1 509 ? 6.263   21.315  -23.574 1.00 42.56 ? 509  GLN B N   1 
ATOM   8049 C CA  . GLN B 1 509 ? 4.858   20.950  -23.527 1.00 41.67 ? 509  GLN B CA  1 
ATOM   8050 C C   . GLN B 1 509 ? 4.455   20.024  -24.652 1.00 41.62 ? 509  GLN B C   1 
ATOM   8051 O O   . GLN B 1 509 ? 4.741   20.267  -25.826 1.00 40.93 ? 509  GLN B O   1 
ATOM   8052 C CB  . GLN B 1 509 ? 3.977   22.190  -23.549 1.00 41.33 ? 509  GLN B CB  1 
ATOM   8053 C CG  . GLN B 1 509 ? 4.263   23.171  -22.428 1.00 40.58 ? 509  GLN B CG  1 
ATOM   8054 C CD  . GLN B 1 509 ? 3.403   24.404  -22.521 1.00 37.27 ? 509  GLN B CD  1 
ATOM   8055 O OE1 . GLN B 1 509 ? 3.597   25.244  -23.383 1.00 36.61 ? 509  GLN B OE1 1 
ATOM   8056 N NE2 . GLN B 1 509 ? 2.439   24.509  -21.631 1.00 38.56 ? 509  GLN B NE2 1 
ATOM   8057 N N   . TYR B 1 510 ? 3.782   18.952  -24.266 1.00 41.50 ? 510  TYR B N   1 
ATOM   8058 C CA  . TYR B 1 510 ? 3.168   18.041  -25.228 1.00 41.46 ? 510  TYR B CA  1 
ATOM   8059 C C   . TYR B 1 510 ? 1.730   17.725  -24.774 1.00 41.21 ? 510  TYR B C   1 
ATOM   8060 O O   . TYR B 1 510 ? 1.332   18.094  -23.652 1.00 41.48 ? 510  TYR B O   1 
ATOM   8061 C CB  . TYR B 1 510 ? 4.005   16.765  -25.333 1.00 40.99 ? 510  TYR B CB  1 
ATOM   8062 C CG  . TYR B 1 510 ? 4.077   15.983  -24.049 1.00 39.65 ? 510  TYR B CG  1 
ATOM   8063 C CD1 . TYR B 1 510 ? 4.982   16.336  -23.050 1.00 39.75 ? 510  TYR B CD1 1 
ATOM   8064 C CD2 . TYR B 1 510 ? 3.254   14.878  -23.836 1.00 38.72 ? 510  TYR B CD2 1 
ATOM   8065 C CE1 . TYR B 1 510 ? 5.068   15.612  -21.862 1.00 40.28 ? 510  TYR B CE1 1 
ATOM   8066 C CE2 . TYR B 1 510 ? 3.319   14.144  -22.650 1.00 39.42 ? 510  TYR B CE2 1 
ATOM   8067 C CZ  . TYR B 1 510 ? 4.232   14.525  -21.663 1.00 41.70 ? 510  TYR B CZ  1 
ATOM   8068 O OH  . TYR B 1 510 ? 4.331   13.804  -20.492 1.00 42.65 ? 510  TYR B OH  1 
ATOM   8069 N N   . VAL B 1 511 ? 0.949   17.060  -25.621 1.00 40.17 ? 511  VAL B N   1 
ATOM   8070 C CA  . VAL B 1 511 ? -0.408  16.735  -25.243 1.00 39.65 ? 511  VAL B CA  1 
ATOM   8071 C C   . VAL B 1 511 ? -0.626  15.218  -25.184 1.00 40.17 ? 511  VAL B C   1 
ATOM   8072 O O   . VAL B 1 511 ? 0.002   14.467  -25.928 1.00 39.95 ? 511  VAL B O   1 
ATOM   8073 C CB  . VAL B 1 511 ? -1.424  17.399  -26.192 1.00 39.41 ? 511  VAL B CB  1 
ATOM   8074 C CG1 . VAL B 1 511 ? -1.280  18.906  -26.182 1.00 38.58 ? 511  VAL B CG1 1 
ATOM   8075 C CG2 . VAL B 1 511 ? -1.244  16.888  -27.584 1.00 39.48 ? 511  VAL B CG2 1 
ATOM   8076 N N   . SER B 1 512 ? -1.525  14.770  -24.317 1.00 40.59 ? 512  SER B N   1 
ATOM   8077 C CA  . SER B 1 512 ? -1.973  13.383  -24.358 1.00 41.87 ? 512  SER B CA  1 
ATOM   8078 C C   . SER B 1 512 ? -3.114  13.219  -25.352 1.00 42.67 ? 512  SER B C   1 
ATOM   8079 O O   . SER B 1 512 ? -4.087  13.974  -25.330 1.00 42.58 ? 512  SER B O   1 
ATOM   8080 C CB  . SER B 1 512 ? -2.431  12.905  -22.991 1.00 41.68 ? 512  SER B CB  1 
ATOM   8081 O OG  . SER B 1 512 ? -3.472  13.734  -22.540 1.00 42.70 ? 512  SER B OG  1 
ATOM   8082 N N   . LEU B 1 513 ? -2.969  12.241  -26.247 1.00 43.74 ? 513  LEU B N   1 
ATOM   8083 C CA  . LEU B 1 513 ? -4.014  11.893  -27.190 1.00 44.11 ? 513  LEU B CA  1 
ATOM   8084 C C   . LEU B 1 513 ? -4.640  10.617  -26.649 1.00 45.19 ? 513  LEU B C   1 
ATOM   8085 O O   . LEU B 1 513 ? -3.970  9.569   -26.580 1.00 45.41 ? 513  LEU B O   1 
ATOM   8086 C CB  . LEU B 1 513 ? -3.436  11.699  -28.590 1.00 43.98 ? 513  LEU B CB  1 
ATOM   8087 C CG  . LEU B 1 513 ? -2.830  12.915  -29.313 1.00 43.74 ? 513  LEU B CG  1 
ATOM   8088 C CD1 . LEU B 1 513 ? -2.244  12.537  -30.654 1.00 41.70 ? 513  LEU B CD1 1 
ATOM   8089 C CD2 . LEU B 1 513 ? -3.864  13.999  -29.517 1.00 43.21 ? 513  LEU B CD2 1 
ATOM   8090 N N   . ASN B 1 514 ? -5.885  10.755  -26.179 1.00 45.98 ? 514  ASN B N   1 
ATOM   8091 C CA  . ASN B 1 514 ? -6.737  9.655   -25.711 1.00 46.99 ? 514  ASN B CA  1 
ATOM   8092 C C   . ASN B 1 514 ? -8.216  10.081  -25.754 1.00 47.81 ? 514  ASN B C   1 
ATOM   8093 O O   . ASN B 1 514 ? -8.555  11.102  -26.379 1.00 47.83 ? 514  ASN B O   1 
ATOM   8094 C CB  . ASN B 1 514 ? -6.322  9.155   -24.319 1.00 46.96 ? 514  ASN B CB  1 
ATOM   8095 C CG  . ASN B 1 514 ? -6.269  10.275  -23.282 1.00 48.25 ? 514  ASN B CG  1 
ATOM   8096 O OD1 . ASN B 1 514 ? -7.192  11.098  -23.180 1.00 49.94 ? 514  ASN B OD1 1 
ATOM   8097 N ND2 . ASN B 1 514 ? -5.185  10.311  -22.506 1.00 46.54 ? 514  ASN B ND2 1 
ATOM   8098 N N   . LEU B 1 515 ? -9.100  9.305   -25.120 1.00 48.77 ? 515  LEU B N   1 
ATOM   8099 C CA  . LEU B 1 515 ? -10.547 9.599   -25.211 1.00 49.47 ? 515  LEU B CA  1 
ATOM   8100 C C   . LEU B 1 515 ? -10.937 10.883  -24.494 1.00 49.97 ? 515  LEU B C   1 
ATOM   8101 O O   . LEU B 1 515 ? -11.806 11.604  -24.978 1.00 50.26 ? 515  LEU B O   1 
ATOM   8102 C CB  . LEU B 1 515 ? -11.418 8.436   -24.744 1.00 48.91 ? 515  LEU B CB  1 
ATOM   8103 C CG  . LEU B 1 515 ? -11.133 7.100   -25.436 1.00 49.35 ? 515  LEU B CG  1 
ATOM   8104 C CD1 . LEU B 1 515 ? -11.757 5.947   -24.638 1.00 48.47 ? 515  LEU B CD1 1 
ATOM   8105 C CD2 . LEU B 1 515 ? -11.553 7.085   -26.904 1.00 47.81 ? 515  LEU B CD2 1 
ATOM   8106 N N   . LYS B 1 516 ? -10.285 11.177  -23.366 1.00 50.38 ? 516  LYS B N   1 
ATOM   8107 C CA  . LYS B 1 516 ? -10.486 12.455  -22.667 1.00 51.23 ? 516  LYS B CA  1 
ATOM   8108 C C   . LYS B 1 516 ? -10.018 13.629  -23.549 1.00 50.86 ? 516  LYS B C   1 
ATOM   8109 O O   . LYS B 1 516 ? -9.199  13.432  -24.449 1.00 51.39 ? 516  LYS B O   1 
ATOM   8110 C CB  . LYS B 1 516 ? -9.758  12.451  -21.326 1.00 50.70 ? 516  LYS B CB  1 
ATOM   8111 C CG  . LYS B 1 516 ? -10.263 11.394  -20.330 1.00 52.79 ? 516  LYS B CG  1 
ATOM   8112 C CD  . LYS B 1 516 ? -9.308  11.246  -19.106 1.00 53.85 ? 516  LYS B CD  1 
ATOM   8113 C CE  . LYS B 1 516 ? -8.013  10.429  -19.461 1.00 56.81 ? 516  LYS B CE  1 
ATOM   8114 N NZ  . LYS B 1 516 ? -7.108  10.139  -18.289 1.00 56.25 ? 516  LYS B NZ  1 
ATOM   8115 N N   . PRO B 1 517 ? -10.541 14.850  -23.320 1.00 50.51 ? 517  PRO B N   1 
ATOM   8116 C CA  . PRO B 1 517 ? -10.020 15.986  -24.106 1.00 49.85 ? 517  PRO B CA  1 
ATOM   8117 C C   . PRO B 1 517 ? -8.499  16.227  -23.877 1.00 48.61 ? 517  PRO B C   1 
ATOM   8118 O O   . PRO B 1 517 ? -7.927  15.669  -22.923 1.00 48.04 ? 517  PRO B O   1 
ATOM   8119 C CB  . PRO B 1 517 ? -10.848 17.177  -23.586 1.00 50.01 ? 517  PRO B CB  1 
ATOM   8120 C CG  . PRO B 1 517 ? -12.065 16.576  -22.977 1.00 49.73 ? 517  PRO B CG  1 
ATOM   8121 C CD  . PRO B 1 517 ? -11.590 15.280  -22.378 1.00 50.34 ? 517  PRO B CD  1 
ATOM   8122 N N   . LEU B 1 518 ? -7.860  17.014  -24.750 1.00 47.25 ? 518  LEU B N   1 
ATOM   8123 C CA  . LEU B 1 518 ? -6.406  17.271  -24.632 1.00 46.65 ? 518  LEU B CA  1 
ATOM   8124 C C   . LEU B 1 518 ? -5.975  17.653  -23.225 1.00 46.28 ? 518  LEU B C   1 
ATOM   8125 O O   . LEU B 1 518 ? -6.516  18.576  -22.621 1.00 45.78 ? 518  LEU B O   1 
ATOM   8126 C CB  . LEU B 1 518 ? -5.911  18.376  -25.575 1.00 45.94 ? 518  LEU B CB  1 
ATOM   8127 C CG  . LEU B 1 518 ? -5.865  18.121  -27.069 1.00 46.51 ? 518  LEU B CG  1 
ATOM   8128 C CD1 . LEU B 1 518 ? -5.397  19.379  -27.792 1.00 45.62 ? 518  LEU B CD1 1 
ATOM   8129 C CD2 . LEU B 1 518 ? -5.001  16.908  -27.418 1.00 45.13 ? 518  LEU B CD2 1 
ATOM   8130 N N   . GLU B 1 519 ? -4.988  16.940  -22.709 1.00 45.79 ? 519  GLU B N   1 
ATOM   8131 C CA  . GLU B 1 519 ? -4.358  17.353  -21.477 1.00 46.49 ? 519  GLU B CA  1 
ATOM   8132 C C   . GLU B 1 519 ? -2.947  17.856  -21.851 1.00 45.61 ? 519  GLU B C   1 
ATOM   8133 O O   . GLU B 1 519 ? -2.244  17.188  -22.616 1.00 46.57 ? 519  GLU B O   1 
ATOM   8134 C CB  . GLU B 1 519 ? -4.325  16.170  -20.506 1.00 45.72 ? 519  GLU B CB  1 
ATOM   8135 C CG  . GLU B 1 519 ? -3.676  16.466  -19.178 1.00 48.11 ? 519  GLU B CG  1 
ATOM   8136 C CD  . GLU B 1 519 ? -3.501  15.221  -18.305 1.00 49.14 ? 519  GLU B CD  1 
ATOM   8137 O OE1 . GLU B 1 519 ? -4.513  14.791  -17.684 1.00 54.62 ? 519  GLU B OE1 1 
ATOM   8138 O OE2 . GLU B 1 519 ? -2.361  14.689  -18.217 1.00 48.64 ? 519  GLU B OE2 1 
ATOM   8139 N N   . VAL B 1 520 ? -2.539  19.019  -21.354 1.00 44.03 ? 520  VAL B N   1 
ATOM   8140 C CA  . VAL B 1 520 ? -1.193  19.524  -21.630 1.00 42.77 ? 520  VAL B CA  1 
ATOM   8141 C C   . VAL B 1 520 ? -0.232  19.085  -20.533 1.00 42.46 ? 520  VAL B C   1 
ATOM   8142 O O   . VAL B 1 520 ? -0.469  19.337  -19.366 1.00 42.85 ? 520  VAL B O   1 
ATOM   8143 C CB  . VAL B 1 520 ? -1.152  21.072  -21.779 1.00 42.46 ? 520  VAL B CB  1 
ATOM   8144 C CG1 . VAL B 1 520 ? 0.276   21.559  -22.012 1.00 41.55 ? 520  VAL B CG1 1 
ATOM   8145 C CG2 . VAL B 1 520 ? -2.053  21.531  -22.909 1.00 41.54 ? 520  VAL B CG2 1 
ATOM   8146 N N   . ARG B 1 521 ? 0.847   18.418  -20.918 1.00 42.08 ? 521  ARG B N   1 
ATOM   8147 C CA  . ARG B 1 521 ? 1.881   17.988  -19.978 1.00 41.72 ? 521  ARG B CA  1 
ATOM   8148 C C   . ARG B 1 521 ? 3.234   18.603  -20.318 1.00 41.18 ? 521  ARG B C   1 
ATOM   8149 O O   . ARG B 1 521 ? 3.470   19.031  -21.448 1.00 40.61 ? 521  ARG B O   1 
ATOM   8150 C CB  . ARG B 1 521 ? 1.995   16.466  -19.977 1.00 41.82 ? 521  ARG B CB  1 
ATOM   8151 C CG  . ARG B 1 521 ? 0.717   15.768  -19.583 1.00 42.07 ? 521  ARG B CG  1 
ATOM   8152 C CD  . ARG B 1 521 ? 0.849   14.253  -19.670 1.00 42.78 ? 521  ARG B CD  1 
ATOM   8153 N NE  . ARG B 1 521 ? -0.478  13.650  -19.643 1.00 45.30 ? 521  ARG B NE  1 
ATOM   8154 C CZ  . ARG B 1 521 ? -0.752  12.367  -19.859 1.00 45.79 ? 521  ARG B CZ  1 
ATOM   8155 N NH1 . ARG B 1 521 ? 0.214   11.497  -20.145 1.00 43.01 ? 521  ARG B NH1 1 
ATOM   8156 N NH2 . ARG B 1 521 ? -2.015  11.966  -19.821 1.00 46.34 ? 521  ARG B NH2 1 
ATOM   8157 N N   . ARG B 1 522 ? 4.124   18.620  -19.337 1.00 41.41 ? 522  ARG B N   1 
ATOM   8158 C CA  . ARG B 1 522 ? 5.425   19.223  -19.500 1.00 42.38 ? 522  ARG B CA  1 
ATOM   8159 C C   . ARG B 1 522 ? 6.493   18.199  -19.275 1.00 43.12 ? 522  ARG B C   1 
ATOM   8160 O O   . ARG B 1 522 ? 6.439   17.439  -18.298 1.00 43.99 ? 522  ARG B O   1 
ATOM   8161 C CB  . ARG B 1 522 ? 5.599   20.424  -18.569 1.00 41.70 ? 522  ARG B CB  1 
ATOM   8162 C CG  . ARG B 1 522 ? 4.707   21.581  -18.969 1.00 43.54 ? 522  ARG B CG  1 
ATOM   8163 C CD  . ARG B 1 522 ? 4.769   22.756  -18.015 1.00 45.45 ? 522  ARG B CD  1 
ATOM   8164 N NE  . ARG B 1 522 ? 6.110   23.325  -18.017 1.00 47.72 ? 522  ARG B NE  1 
ATOM   8165 C CZ  . ARG B 1 522 ? 6.438   24.511  -17.515 1.00 47.09 ? 522  ARG B CZ  1 
ATOM   8166 N NH1 . ARG B 1 522 ? 5.502   25.282  -16.975 1.00 45.66 ? 522  ARG B NH1 1 
ATOM   8167 N NH2 . ARG B 1 522 ? 7.708   24.924  -17.578 1.00 45.09 ? 522  ARG B NH2 1 
ATOM   8168 N N   . GLY B 1 523 ? 7.458   18.163  -20.193 1.00 43.98 ? 523  GLY B N   1 
ATOM   8169 C CA  . GLY B 1 523 ? 8.620   17.279  -20.064 1.00 44.69 ? 523  GLY B CA  1 
ATOM   8170 C C   . GLY B 1 523 ? 8.334   15.840  -20.427 1.00 45.28 ? 523  GLY B C   1 
ATOM   8171 O O   . GLY B 1 523 ? 7.477   15.189  -19.827 1.00 45.95 ? 523  GLY B O   1 
ATOM   8172 N N   . LEU B 1 524 ? 9.068   15.355  -21.415 1.00 45.78 ? 524  LEU B N   1 
ATOM   8173 C CA  . LEU B 1 524 ? 8.865   14.054  -21.999 1.00 46.64 ? 524  LEU B CA  1 
ATOM   8174 C C   . LEU B 1 524 ? 9.890   13.053  -21.476 1.00 47.11 ? 524  LEU B C   1 
ATOM   8175 O O   . LEU B 1 524 ? 10.958  12.885  -22.070 1.00 47.28 ? 524  LEU B O   1 
ATOM   8176 C CB  . LEU B 1 524 ? 9.012   14.204  -23.501 1.00 47.10 ? 524  LEU B CB  1 
ATOM   8177 C CG  . LEU B 1 524 ? 8.521   13.166  -24.497 1.00 49.01 ? 524  LEU B CG  1 
ATOM   8178 C CD1 . LEU B 1 524 ? 7.314   12.384  -23.981 1.00 50.39 ? 524  LEU B CD1 1 
ATOM   8179 C CD2 . LEU B 1 524 ? 8.211   13.899  -25.819 1.00 51.75 ? 524  LEU B CD2 1 
ATOM   8180 N N   . ARG B 1 525 ? 9.560   12.377  -20.375 1.00 47.18 ? 525  ARG B N   1 
ATOM   8181 C CA  . ARG B 1 525 ? 10.531  11.544  -19.671 1.00 47.59 ? 525  ARG B CA  1 
ATOM   8182 C C   . ARG B 1 525 ? 11.806  12.354  -19.393 1.00 46.87 ? 525  ARG B C   1 
ATOM   8183 O O   . ARG B 1 525 ? 12.919  11.838  -19.539 1.00 47.56 ? 525  ARG B O   1 
ATOM   8184 C CB  . ARG B 1 525 ? 10.881  10.301  -20.493 1.00 48.10 ? 525  ARG B CB  1 
ATOM   8185 C CG  . ARG B 1 525 ? 9.737   9.384   -20.784 1.00 51.29 ? 525  ARG B CG  1 
ATOM   8186 C CD  . ARG B 1 525 ? 9.407   8.448   -19.628 1.00 57.34 ? 525  ARG B CD  1 
ATOM   8187 N NE  . ARG B 1 525 ? 9.116   7.084   -20.118 1.00 62.55 ? 525  ARG B NE  1 
ATOM   8188 C CZ  . ARG B 1 525 ? 7.998   6.707   -20.753 1.00 62.06 ? 525  ARG B CZ  1 
ATOM   8189 N NH1 . ARG B 1 525 ? 7.015   7.581   -20.994 1.00 61.44 ? 525  ARG B NH1 1 
ATOM   8190 N NH2 . ARG B 1 525 ? 7.862   5.441   -21.139 1.00 61.53 ? 525  ARG B NH2 1 
ATOM   8191 N N   . ALA B 1 526 ? 11.633  13.614  -18.997 1.00 45.56 ? 526  ALA B N   1 
ATOM   8192 C CA  . ALA B 1 526 ? 12.735  14.553  -18.859 1.00 44.51 ? 526  ALA B CA  1 
ATOM   8193 C C   . ALA B 1 526 ? 13.912  14.043  -18.030 1.00 44.32 ? 526  ALA B C   1 
ATOM   8194 O O   . ALA B 1 526 ? 15.050  14.190  -18.466 1.00 44.58 ? 526  ALA B O   1 
ATOM   8195 C CB  . ALA B 1 526 ? 12.250  15.869  -18.337 1.00 43.77 ? 526  ALA B CB  1 
ATOM   8196 N N   . GLN B 1 527 ? 13.664  13.463  -16.852 1.00 44.26 ? 527  GLN B N   1 
ATOM   8197 C CA  . GLN B 1 527 ? 14.766  12.929  -16.026 1.00 44.06 ? 527  GLN B CA  1 
ATOM   8198 C C   . GLN B 1 527 ? 15.409  11.745  -16.730 1.00 43.90 ? 527  GLN B C   1 
ATOM   8199 O O   . GLN B 1 527 ? 16.640  11.680  -16.859 1.00 43.13 ? 527  GLN B O   1 
ATOM   8200 C CB  . GLN B 1 527 ? 14.321  12.508  -14.608 1.00 44.06 ? 527  GLN B CB  1 
ATOM   8201 C CG  . GLN B 1 527 ? 14.081  13.642  -13.603 1.00 45.88 ? 527  GLN B CG  1 
ATOM   8202 C CD  . GLN B 1 527 ? 15.183  14.720  -13.610 1.00 49.70 ? 527  GLN B CD  1 
ATOM   8203 O OE1 . GLN B 1 527 ? 14.940  15.868  -14.035 1.00 51.12 ? 527  GLN B OE1 1 
ATOM   8204 N NE2 . GLN B 1 527 ? 16.397  14.357  -13.138 1.00 49.55 ? 527  GLN B NE2 1 
ATOM   8205 N N   . THR B 1 528 ? 14.571  10.816  -17.190 1.00 43.88 ? 528  THR B N   1 
ATOM   8206 C CA  . THR B 1 528 ? 15.073  9.584   -17.790 1.00 44.39 ? 528  THR B CA  1 
ATOM   8207 C C   . THR B 1 528 ? 15.771  9.821   -19.141 1.00 44.21 ? 528  THR B C   1 
ATOM   8208 O O   . THR B 1 528 ? 16.732  9.123   -19.474 1.00 44.35 ? 528  THR B O   1 
ATOM   8209 C CB  . THR B 1 528 ? 13.964  8.473   -17.839 1.00 45.19 ? 528  THR B CB  1 
ATOM   8210 O OG1 . THR B 1 528 ? 13.800  7.899   -16.523 1.00 45.13 ? 528  THR B OG1 1 
ATOM   8211 C CG2 . THR B 1 528 ? 14.297  7.339   -18.864 1.00 44.11 ? 528  THR B CG2 1 
ATOM   8212 N N   . CYS B 1 529 ? 15.319  10.813  -19.904 1.00 43.72 ? 529  CYS B N   1 
ATOM   8213 C CA  . CYS B 1 529 ? 15.963  11.096  -21.175 1.00 43.75 ? 529  CYS B CA  1 
ATOM   8214 C C   . CYS B 1 529 ? 17.265  11.844  -21.009 1.00 43.74 ? 529  CYS B C   1 
ATOM   8215 O O   . CYS B 1 529 ? 18.169  11.692  -21.828 1.00 43.76 ? 529  CYS B O   1 
ATOM   8216 C CB  . CYS B 1 529 ? 15.014  11.777  -22.156 1.00 43.59 ? 529  CYS B CB  1 
ATOM   8217 S SG  . CYS B 1 529 ? 13.749  10.597  -22.791 1.00 45.43 ? 529  CYS B SG  1 
ATOM   8218 N N   . ALA B 1 530 ? 17.381  12.630  -19.936 1.00 43.82 ? 530  ALA B N   1 
ATOM   8219 C CA  . ALA B 1 530 ? 18.672  13.237  -19.584 1.00 43.83 ? 530  ALA B CA  1 
ATOM   8220 C C   . ALA B 1 530 ? 19.703  12.118  -19.428 1.00 43.90 ? 530  ALA B C   1 
ATOM   8221 O O   . ALA B 1 530 ? 20.846  12.242  -19.877 1.00 43.95 ? 530  ALA B O   1 
ATOM   8222 C CB  . ALA B 1 530 ? 18.573  14.068  -18.327 1.00 43.08 ? 530  ALA B CB  1 
ATOM   8223 N N   . PHE B 1 531 ? 19.260  11.014  -18.836 1.00 43.85 ? 531  PHE B N   1 
ATOM   8224 C CA  . PHE B 1 531 ? 20.081  9.832   -18.673 1.00 44.43 ? 531  PHE B CA  1 
ATOM   8225 C C   . PHE B 1 531 ? 20.578  9.266   -20.021 1.00 44.71 ? 531  PHE B C   1 
ATOM   8226 O O   . PHE B 1 531 ? 21.778  9.065   -20.214 1.00 44.64 ? 531  PHE B O   1 
ATOM   8227 C CB  . PHE B 1 531 ? 19.316  8.765   -17.888 1.00 43.84 ? 531  PHE B CB  1 
ATOM   8228 C CG  . PHE B 1 531 ? 20.036  7.463   -17.818 1.00 45.19 ? 531  PHE B CG  1 
ATOM   8229 C CD1 . PHE B 1 531 ? 21.199  7.335   -17.058 1.00 46.18 ? 531  PHE B CD1 1 
ATOM   8230 C CD2 . PHE B 1 531 ? 19.585  6.365   -18.538 1.00 46.68 ? 531  PHE B CD2 1 
ATOM   8231 C CE1 . PHE B 1 531 ? 21.881  6.117   -16.998 1.00 47.40 ? 531  PHE B CE1 1 
ATOM   8232 C CE2 . PHE B 1 531 ? 20.270  5.124   -18.490 1.00 46.85 ? 531  PHE B CE2 1 
ATOM   8233 C CZ  . PHE B 1 531 ? 21.411  5.004   -17.723 1.00 46.66 ? 531  PHE B CZ  1 
ATOM   8234 N N   . TRP B 1 532 ? 19.647  9.017   -20.941 1.00 44.93 ? 532  TRP B N   1 
ATOM   8235 C CA  . TRP B 1 532 ? 19.969  8.442   -22.244 1.00 45.01 ? 532  TRP B CA  1 
ATOM   8236 C C   . TRP B 1 532 ? 20.663  9.414   -23.162 1.00 45.87 ? 532  TRP B C   1 
ATOM   8237 O O   . TRP B 1 532 ? 21.542  9.013   -23.906 1.00 46.53 ? 532  TRP B O   1 
ATOM   8238 C CB  . TRP B 1 532 ? 18.706  7.956   -22.959 1.00 44.21 ? 532  TRP B CB  1 
ATOM   8239 C CG  . TRP B 1 532 ? 18.132  6.754   -22.363 1.00 42.53 ? 532  TRP B CG  1 
ATOM   8240 C CD1 . TRP B 1 532 ? 17.024  6.687   -21.606 1.00 41.95 ? 532  TRP B CD1 1 
ATOM   8241 C CD2 . TRP B 1 532 ? 18.636  5.425   -22.473 1.00 41.01 ? 532  TRP B CD2 1 
ATOM   8242 N NE1 . TRP B 1 532 ? 16.789  5.391   -21.231 1.00 42.98 ? 532  TRP B NE1 1 
ATOM   8243 C CE2 . TRP B 1 532 ? 17.775  4.595   -21.742 1.00 39.98 ? 532  TRP B CE2 1 
ATOM   8244 C CE3 . TRP B 1 532 ? 19.739  4.855   -23.114 1.00 41.73 ? 532  TRP B CE3 1 
ATOM   8245 C CZ2 . TRP B 1 532 ? 17.973  3.222   -21.621 1.00 41.04 ? 532  TRP B CZ2 1 
ATOM   8246 C CZ3 . TRP B 1 532 ? 19.928  3.477   -23.009 1.00 42.10 ? 532  TRP B CZ3 1 
ATOM   8247 C CH2 . TRP B 1 532 ? 19.044  2.679   -22.273 1.00 41.55 ? 532  TRP B CH2 1 
ATOM   8248 N N   . ASN B 1 533 ? 20.258  10.679  -23.141 1.00 46.52 ? 533  ASN B N   1 
ATOM   8249 C CA  . ASN B 1 533 ? 20.760  11.622  -24.121 1.00 47.22 ? 533  ASN B CA  1 
ATOM   8250 C C   . ASN B 1 533 ? 21.983  12.387  -23.644 1.00 48.19 ? 533  ASN B C   1 
ATOM   8251 O O   . ASN B 1 533 ? 22.750  12.896  -24.456 1.00 48.02 ? 533  ASN B O   1 
ATOM   8252 C CB  . ASN B 1 533 ? 19.663  12.590  -24.552 1.00 47.28 ? 533  ASN B CB  1 
ATOM   8253 C CG  . ASN B 1 533 ? 18.477  11.889  -25.196 1.00 47.62 ? 533  ASN B CG  1 
ATOM   8254 O OD1 . ASN B 1 533 ? 18.564  10.739  -25.592 1.00 49.02 ? 533  ASN B OD1 1 
ATOM   8255 N ND2 . ASN B 1 533 ? 17.367  12.585  -25.295 1.00 47.14 ? 533  ASN B ND2 1 
ATOM   8256 N N   . ARG B 1 534 ? 22.168  12.482  -22.329 1.00 49.83 ? 534  ARG B N   1 
ATOM   8257 C CA  . ARG B 1 534 ? 23.309  13.239  -21.783 1.00 50.81 ? 534  ARG B CA  1 
ATOM   8258 C C   . ARG B 1 534 ? 24.347  12.374  -21.089 1.00 51.12 ? 534  ARG B C   1 
ATOM   8259 O O   . ARG B 1 534 ? 25.536  12.506  -21.359 1.00 51.73 ? 534  ARG B O   1 
ATOM   8260 C CB  . ARG B 1 534 ? 22.847  14.361  -20.864 1.00 50.75 ? 534  ARG B CB  1 
ATOM   8261 C CG  . ARG B 1 534 ? 22.276  15.563  -21.604 1.00 53.11 ? 534  ARG B CG  1 
ATOM   8262 C CD  . ARG B 1 534 ? 21.742  16.620  -20.642 1.00 55.75 ? 534  ARG B CD  1 
ATOM   8263 N NE  . ARG B 1 534 ? 20.434  17.082  -21.101 1.00 58.92 ? 534  ARG B NE  1 
ATOM   8264 C CZ  . ARG B 1 534 ? 20.184  18.288  -21.613 1.00 59.21 ? 534  ARG B CZ  1 
ATOM   8265 N NH1 . ARG B 1 534 ? 21.150  19.207  -21.698 1.00 57.48 ? 534  ARG B NH1 1 
ATOM   8266 N NH2 . ARG B 1 534 ? 18.950  18.575  -22.022 1.00 57.24 ? 534  ARG B NH2 1 
ATOM   8267 N N   . PHE B 1 535 ? 23.915  11.483  -20.208 1.00 51.56 ? 535  PHE B N   1 
ATOM   8268 C CA  . PHE B 1 535 ? 24.877  10.722  -19.440 1.00 51.99 ? 535  PHE B CA  1 
ATOM   8269 C C   . PHE B 1 535 ? 25.413  9.529   -20.187 1.00 53.41 ? 535  PHE B C   1 
ATOM   8270 O O   . PHE B 1 535 ? 26.617  9.321   -20.243 1.00 53.45 ? 535  PHE B O   1 
ATOM   8271 C CB  . PHE B 1 535 ? 24.335  10.283  -18.085 1.00 50.92 ? 535  PHE B CB  1 
ATOM   8272 C CG  . PHE B 1 535 ? 25.351  9.558   -17.251 1.00 49.27 ? 535  PHE B CG  1 
ATOM   8273 C CD1 . PHE B 1 535 ? 26.487  10.224  -16.783 1.00 47.36 ? 535  PHE B CD1 1 
ATOM   8274 C CD2 . PHE B 1 535 ? 25.196  8.214   -16.959 1.00 47.74 ? 535  PHE B CD2 1 
ATOM   8275 C CE1 . PHE B 1 535 ? 27.429  9.580   -16.022 1.00 45.89 ? 535  PHE B CE1 1 
ATOM   8276 C CE2 . PHE B 1 535 ? 26.143  7.545   -16.193 1.00 48.74 ? 535  PHE B CE2 1 
ATOM   8277 C CZ  . PHE B 1 535 ? 27.268  8.236   -15.725 1.00 48.20 ? 535  PHE B CZ  1 
ATOM   8278 N N   . LEU B 1 536 ? 24.518  8.747   -20.758 1.00 55.33 ? 536  LEU B N   1 
ATOM   8279 C CA  . LEU B 1 536 ? 24.907  7.484   -21.365 1.00 57.77 ? 536  LEU B CA  1 
ATOM   8280 C C   . LEU B 1 536 ? 26.010  7.581   -22.449 1.00 59.45 ? 536  LEU B C   1 
ATOM   8281 O O   . LEU B 1 536 ? 26.917  6.750   -22.454 1.00 59.18 ? 536  LEU B O   1 
ATOM   8282 C CB  . LEU B 1 536 ? 23.662  6.768   -21.883 1.00 57.90 ? 536  LEU B CB  1 
ATOM   8283 C CG  . LEU B 1 536 ? 23.557  5.250   -21.776 1.00 58.03 ? 536  LEU B CG  1 
ATOM   8284 C CD1 . LEU B 1 536 ? 24.087  4.603   -23.066 1.00 59.08 ? 536  LEU B CD1 1 
ATOM   8285 C CD2 . LEU B 1 536 ? 24.237  4.722   -20.511 1.00 57.99 ? 536  LEU B CD2 1 
ATOM   8286 N N   . PRO B 1 537 ? 25.948  8.591   -23.358 1.00 61.41 ? 537  PRO B N   1 
ATOM   8287 C CA  . PRO B 1 537 ? 27.047  8.732   -24.328 1.00 62.90 ? 537  PRO B CA  1 
ATOM   8288 C C   . PRO B 1 537 ? 28.423  8.826   -23.658 1.00 64.48 ? 537  PRO B C   1 
ATOM   8289 O O   . PRO B 1 537 ? 29.362  8.157   -24.097 1.00 64.66 ? 537  PRO B O   1 
ATOM   8290 C CB  . PRO B 1 537 ? 26.721  10.051  -25.053 1.00 62.64 ? 537  PRO B CB  1 
ATOM   8291 C CG  . PRO B 1 537 ? 25.268  10.194  -24.936 1.00 62.00 ? 537  PRO B CG  1 
ATOM   8292 C CD  . PRO B 1 537 ? 24.908  9.618   -23.584 1.00 61.72 ? 537  PRO B CD  1 
ATOM   8293 N N   . LYS B 1 538 ? 28.519  9.645   -22.607 1.00 66.50 ? 538  LYS B N   1 
ATOM   8294 C CA  . LYS B 1 538 ? 29.756  9.832   -21.833 1.00 68.25 ? 538  LYS B CA  1 
ATOM   8295 C C   . LYS B 1 538 ? 30.282  8.555   -21.192 1.00 69.20 ? 538  LYS B C   1 
ATOM   8296 O O   . LYS B 1 538 ? 31.479  8.332   -21.157 1.00 69.53 ? 538  LYS B O   1 
ATOM   8297 C CB  . LYS B 1 538 ? 29.572  10.906  -20.762 1.00 68.14 ? 538  LYS B CB  1 
ATOM   8298 C CG  . LYS B 1 538 ? 29.498  12.301  -21.329 1.00 69.74 ? 538  LYS B CG  1 
ATOM   8299 C CD  . LYS B 1 538 ? 29.499  13.353  -20.232 1.00 72.10 ? 538  LYS B CD  1 
ATOM   8300 C CE  . LYS B 1 538 ? 28.766  14.612  -20.701 1.00 72.93 ? 538  LYS B CE  1 
ATOM   8301 N NZ  . LYS B 1 538 ? 29.468  15.346  -21.792 1.00 73.73 ? 538  LYS B NZ  1 
ATOM   8302 N N   . LEU B 1 539 ? 29.386  7.719   -20.691 1.00 70.78 ? 539  LEU B N   1 
ATOM   8303 C CA  . LEU B 1 539 ? 29.776  6.460   -20.083 1.00 72.45 ? 539  LEU B CA  1 
ATOM   8304 C C   . LEU B 1 539 ? 30.484  5.574   -21.102 1.00 74.07 ? 539  LEU B C   1 
ATOM   8305 O O   . LEU B 1 539 ? 31.676  5.294   -20.975 1.00 74.09 ? 539  LEU B O   1 
ATOM   8306 C CB  . LEU B 1 539 ? 28.546  5.755   -19.524 1.00 72.05 ? 539  LEU B CB  1 
ATOM   8307 C CG  . LEU B 1 539 ? 28.824  4.705   -18.470 1.00 71.62 ? 539  LEU B CG  1 
ATOM   8308 C CD1 . LEU B 1 539 ? 29.924  5.219   -17.579 1.00 72.45 ? 539  LEU B CD1 1 
ATOM   8309 C CD2 . LEU B 1 539 ? 27.570  4.436   -17.670 1.00 71.96 ? 539  LEU B CD2 1 
ATOM   8310 N N   . LEU B 1 540 ? 29.728  5.154   -22.114 1.00 76.29 ? 540  LEU B N   1 
ATOM   8311 C CA  . LEU B 1 540 ? 30.240  4.397   -23.259 1.00 78.05 ? 540  LEU B CA  1 
ATOM   8312 C C   . LEU B 1 540 ? 31.520  4.990   -23.863 1.00 79.28 ? 540  LEU B C   1 
ATOM   8313 O O   . LEU B 1 540 ? 32.470  4.246   -24.109 1.00 79.64 ? 540  LEU B O   1 
ATOM   8314 C CB  . LEU B 1 540 ? 29.156  4.252   -24.346 1.00 77.86 ? 540  LEU B CB  1 
ATOM   8315 C CG  . LEU B 1 540 ? 27.941  3.380   -23.992 1.00 77.76 ? 540  LEU B CG  1 
ATOM   8316 C CD1 . LEU B 1 540 ? 26.867  3.458   -25.085 1.00 76.37 ? 540  LEU B CD1 1 
ATOM   8317 C CD2 . LEU B 1 540 ? 28.363  1.921   -23.700 1.00 76.98 ? 540  LEU B CD2 1 
ATOM   8318 N N   . SER B 1 541 ? 31.549  6.306   -24.103 1.00 80.49 ? 541  SER B N   1 
ATOM   8319 C CA  . SER B 1 541 ? 32.768  6.952   -24.604 1.00 81.97 ? 541  SER B CA  1 
ATOM   8320 C C   . SER B 1 541 ? 33.777  7.168   -23.458 1.00 83.01 ? 541  SER B C   1 
ATOM   8321 O O   . SER B 1 541 ? 33.859  8.261   -22.872 1.00 83.35 ? 541  SER B O   1 
ATOM   8322 C CB  . SER B 1 541 ? 32.450  8.255   -25.350 1.00 82.00 ? 541  SER B CB  1 
ATOM   8323 O OG  . SER B 1 541 ? 32.376  9.357   -24.464 1.00 82.05 ? 541  SER B OG  1 
ATOM   8324 N N   . ALA B 1 542 ? 34.560  6.114   -23.198 1.00 83.91 ? 542  ALA B N   1 
ATOM   8325 C CA  . ALA B 1 542 ? 35.317  5.852   -21.945 1.00 84.91 ? 542  ALA B CA  1 
ATOM   8326 C C   . ALA B 1 542 ? 34.770  4.527   -21.385 1.00 85.38 ? 542  ALA B C   1 
ATOM   8327 O O   . ALA B 1 542 ? 34.501  4.408   -20.188 1.00 85.00 ? 542  ALA B O   1 
ATOM   8328 C CB  . ALA B 1 542 ? 35.209  7.009   -20.900 1.00 84.66 ? 542  ALA B CB  1 
ATOM   8329 N N   . THR B 1 543 ? 34.638  3.556   -22.302 1.00 86.32 ? 543  THR B N   1 
ATOM   8330 C CA  . THR B 1 543 ? 33.860  2.281   -22.184 1.00 87.30 ? 543  THR B CA  1 
ATOM   8331 C C   . THR B 1 543 ? 32.928  2.044   -20.935 1.00 87.90 ? 543  THR B C   1 
ATOM   8332 O O   . THR B 1 543 ? 33.334  1.718   -19.807 1.00 88.05 ? 543  THR B O   1 
ATOM   8333 C CB  . THR B 1 543 ? 34.736  1.018   -22.563 1.00 87.25 ? 543  THR B CB  1 
ATOM   8334 O OG1 . THR B 1 543 ? 35.584  1.336   -23.677 1.00 86.97 ? 543  THR B OG1 1 
ATOM   8335 C CG2 . THR B 1 543 ? 33.854  -0.189  -22.938 1.00 87.31 ? 543  THR B CG2 1 
ATOM   8336 N N   . ALA B 1 544 ? 31.689  2.170   -21.036 1.00 88.30 ? 544  ALA B N   1 
HETATM 8337 O O1  . NTJ C 2 .   ? 29.671  15.833  13.782  1.00 39.49 ? 1543 NTJ A O1  1 
HETATM 8338 P P1  . NTJ C 2 .   ? 28.716  16.193  12.771  1.00 43.09 ? 1543 NTJ A P1  1 
HETATM 8339 N N1  . NTJ C 2 .   ? 29.223  16.110  11.389  1.00 43.95 ? 1543 NTJ A N1  1 
HETATM 8340 C C2  . NTJ C 2 .   ? 30.231  15.150  10.956  1.00 44.33 ? 1543 NTJ A C2  1 
HETATM 8341 C C1  . NTJ C 2 .   ? 28.682  16.986  10.364  1.00 43.94 ? 1543 NTJ A C1  1 
HETATM 8342 O O2  . NTJ C 2 .   ? 28.140  17.492  12.991  1.00 46.49 ? 1543 NTJ A O2  1 
HETATM 8343 C C3  . NTJ C 2 .   ? 29.014  18.484  13.584  1.00 47.79 ? 1543 NTJ A C3  1 
HETATM 8344 C C4  . NTJ C 2 .   ? 30.150  18.995  12.702  1.00 43.76 ? 1543 NTJ A C4  1 
HETATM 8345 O O1  . NTJ D 2 .   ? 9.514   0.380   -38.225 1.00 45.16 ? 1544 NTJ B O1  1 
HETATM 8346 P P1  . NTJ D 2 .   ? 9.117   0.166   -36.869 1.00 46.90 ? 1544 NTJ B P1  1 
HETATM 8347 N N1  . NTJ D 2 .   ? 10.285  0.016   -35.965 1.00 49.27 ? 1544 NTJ B N1  1 
HETATM 8348 C C2  . NTJ D 2 .   ? 11.648  0.356   -36.335 1.00 47.34 ? 1544 NTJ B C2  1 
HETATM 8349 C C1  . NTJ D 2 .   ? 10.101  -0.476  -34.611 1.00 50.09 ? 1544 NTJ B C1  1 
HETATM 8350 O O2  . NTJ D 2 .   ? 8.214   -0.948  -36.770 1.00 51.80 ? 1544 NTJ B O2  1 
HETATM 8351 C C3  . NTJ D 2 .   ? 8.791   -2.220  -37.151 1.00 54.80 ? 1544 NTJ B C3  1 
HETATM 8352 C C4  . NTJ D 2 .   ? 7.758   -3.339  -37.204 1.00 57.27 ? 1544 NTJ B C4  1 
HETATM 8353 O O1  . P6G E 3 .   ? 17.492  10.865  -12.045 1.00 73.76 ? 1545 P6G B O1  1 
HETATM 8354 C C2  . P6G E 3 .   ? 18.332  10.425  -12.990 1.00 73.99 ? 1545 P6G B C2  1 
HETATM 8355 C C3  . P6G E 3 .   ? 18.850  11.271  -13.892 1.00 74.18 ? 1545 P6G B C3  1 
HETATM 8356 O O4  . P6G E 3 .   ? 19.772  10.838  -14.944 1.00 73.72 ? 1545 P6G B O4  1 
HETATM 8357 C C5  . P6G E 3 .   ? 21.163  11.294  -15.037 1.00 72.72 ? 1545 P6G B C5  1 
HETATM 8358 C C6  . P6G E 3 .   ? 22.228  10.569  -14.623 1.00 71.33 ? 1545 P6G B C6  1 
HETATM 8359 O O7  . P6G E 3 .   ? 22.193  9.229   -14.008 1.00 69.02 ? 1545 P6G B O7  1 
HETATM 8360 C C8  . P6G E 3 .   ? 23.443  8.470   -13.890 1.00 66.87 ? 1545 P6G B C8  1 
HETATM 8361 C C9  . P6G E 3 .   ? 23.588  7.236   -13.393 1.00 64.33 ? 1545 P6G B C9  1 
HETATM 8362 O O10 . P6G E 3 .   ? 22.491  6.443   -12.868 1.00 64.06 ? 1545 P6G B O10 1 
HETATM 8363 C C11 . P6G E 3 .   ? 22.685  5.070   -12.521 1.00 65.06 ? 1545 P6G B C11 1 
HETATM 8364 C C12 . P6G E 3 .   ? 22.003  4.696   -11.193 1.00 67.07 ? 1545 P6G B C12 1 
HETATM 8365 O O13 . P6G E 3 .   ? 20.772  5.396   -10.961 1.00 67.80 ? 1545 P6G B O13 1 
HETATM 8366 C C14 . P6G E 3 .   ? 19.986  5.106   -9.768  1.00 69.14 ? 1545 P6G B C14 1 
HETATM 8367 C C15 . P6G E 3 .   ? 18.793  5.669   -9.525  1.00 70.91 ? 1545 P6G B C15 1 
HETATM 8368 O O16 . P6G E 3 .   ? 18.155  6.624   -10.423 1.00 71.80 ? 1545 P6G B O16 1 
HETATM 8369 C C17 . P6G E 3 .   ? 16.785  6.414   -10.883 1.00 74.11 ? 1545 P6G B C17 1 
HETATM 8370 C C18 . P6G E 3 .   ? 16.085  7.434   -11.394 1.00 75.74 ? 1545 P6G B C18 1 
HETATM 8371 O O19 . P6G E 3 .   ? 14.833  7.281   -11.828 1.00 75.41 ? 1545 P6G B O19 1 
HETATM 8372 O O   . HOH F 4 .   ? 32.191  1.700   46.652  1.00 37.75 ? 2001 HOH A O   1 
HETATM 8373 O O   . HOH F 4 .   ? 14.482  21.915  42.764  1.00 59.07 ? 2002 HOH A O   1 
HETATM 8374 O O   . HOH F 4 .   ? 17.924  12.420  50.207  1.00 49.37 ? 2003 HOH A O   1 
HETATM 8375 O O   . HOH F 4 .   ? 8.921   18.429  33.436  1.00 39.94 ? 2004 HOH A O   1 
HETATM 8376 O O   . HOH F 4 .   ? 28.551  5.063   47.388  1.00 42.00 ? 2005 HOH A O   1 
HETATM 8377 O O   . HOH F 4 .   ? 29.613  2.889   46.068  1.00 35.12 ? 2006 HOH A O   1 
HETATM 8378 O O   . HOH F 4 .   ? 37.006  3.882   46.074  1.00 42.78 ? 2007 HOH A O   1 
HETATM 8379 O O   . HOH F 4 .   ? 12.674  22.083  40.537  1.00 54.37 ? 2008 HOH A O   1 
HETATM 8380 O O   . HOH F 4 .   ? 11.295  18.111  34.775  1.00 43.39 ? 2009 HOH A O   1 
HETATM 8381 O O   . HOH F 4 .   ? 12.700  15.400  40.856  1.00 49.54 ? 2010 HOH A O   1 
HETATM 8382 O O   . HOH F 4 .   ? 37.647  7.692   37.797  1.00 49.93 ? 2011 HOH A O   1 
HETATM 8383 O O   . HOH F 4 .   ? 45.688  9.253   29.819  1.00 49.73 ? 2012 HOH A O   1 
HETATM 8384 O O   . HOH F 4 .   ? 46.563  15.466  24.302  1.00 34.43 ? 2013 HOH A O   1 
HETATM 8385 O O   . HOH F 4 .   ? 50.945  13.259  31.393  1.00 48.78 ? 2014 HOH A O   1 
HETATM 8386 O O   . HOH F 4 .   ? 50.654  18.282  25.896  1.00 41.04 ? 2015 HOH A O   1 
HETATM 8387 O O   . HOH F 4 .   ? 49.830  7.296   28.036  1.00 45.29 ? 2016 HOH A O   1 
HETATM 8388 O O   . HOH F 4 .   ? 47.162  9.226   27.222  1.00 39.06 ? 2017 HOH A O   1 
HETATM 8389 O O   . HOH F 4 .   ? 39.854  15.932  46.321  1.00 48.44 ? 2018 HOH A O   1 
HETATM 8390 O O   . HOH F 4 .   ? 38.533  9.473   47.849  1.00 48.41 ? 2019 HOH A O   1 
HETATM 8391 O O   . HOH F 4 .   ? 38.664  4.019   38.176  1.00 34.44 ? 2020 HOH A O   1 
HETATM 8392 O O   . HOH F 4 .   ? 41.841  19.741  18.106  1.00 40.33 ? 2021 HOH A O   1 
HETATM 8393 O O   . HOH F 4 .   ? 41.266  17.566  21.655  1.00 31.45 ? 2022 HOH A O   1 
HETATM 8394 O O   . HOH F 4 .   ? 34.554  24.418  18.801  1.00 36.45 ? 2023 HOH A O   1 
HETATM 8395 O O   . HOH F 4 .   ? 30.529  31.740  14.832  1.00 53.45 ? 2024 HOH A O   1 
HETATM 8396 O O   . HOH F 4 .   ? 29.761  21.246  19.261  1.00 34.76 ? 2025 HOH A O   1 
HETATM 8397 O O   . HOH F 4 .   ? 59.245  14.249  8.314   1.00 55.27 ? 2026 HOH A O   1 
HETATM 8398 O O   . HOH F 4 .   ? 62.055  13.886  8.165   1.00 44.27 ? 2027 HOH A O   1 
HETATM 8399 O O   . HOH F 4 .   ? 44.212  16.266  25.212  1.00 41.48 ? 2028 HOH A O   1 
HETATM 8400 O O   . HOH F 4 .   ? 64.024  4.819   18.507  1.00 51.63 ? 2029 HOH A O   1 
HETATM 8401 O O   . HOH F 4 .   ? 42.007  14.856  31.726  1.00 41.19 ? 2030 HOH A O   1 
HETATM 8402 O O   . HOH F 4 .   ? 44.168  16.850  36.234  1.00 45.14 ? 2031 HOH A O   1 
HETATM 8403 O O   . HOH F 4 .   ? 40.954  13.359  33.869  1.00 50.18 ? 2032 HOH A O   1 
HETATM 8404 O O   . HOH F 4 .   ? 32.662  17.527  32.658  1.00 33.07 ? 2033 HOH A O   1 
HETATM 8405 O O   . HOH F 4 .   ? 16.892  6.682   46.840  1.00 57.65 ? 2034 HOH A O   1 
HETATM 8406 O O   . HOH F 4 .   ? 43.791  -2.577  7.492   1.00 34.39 ? 2035 HOH A O   1 
HETATM 8407 O O   . HOH F 4 .   ? 29.496  12.837  24.804  1.00 32.27 ? 2036 HOH A O   1 
HETATM 8408 O O   . HOH F 4 .   ? 15.702  -6.268  27.323  1.00 43.16 ? 2037 HOH A O   1 
HETATM 8409 O O   . HOH F 4 .   ? 33.491  15.353  17.373  1.00 29.60 ? 2038 HOH A O   1 
HETATM 8410 O O   . HOH F 4 .   ? 31.154  21.695  16.930  1.00 37.57 ? 2039 HOH A O   1 
HETATM 8411 O O   . HOH F 4 .   ? 35.536  18.193  24.485  1.00 28.32 ? 2040 HOH A O   1 
HETATM 8412 O O   . HOH F 4 .   ? 25.768  15.996  28.354  1.00 40.97 ? 2041 HOH A O   1 
HETATM 8413 O O   . HOH F 4 .   ? 25.588  23.345  30.130  1.00 36.33 ? 2042 HOH A O   1 
HETATM 8414 O O   . HOH F 4 .   ? 25.345  19.399  29.041  1.00 37.31 ? 2043 HOH A O   1 
HETATM 8415 O O   . HOH F 4 .   ? 29.151  18.888  20.381  1.00 19.66 ? 2044 HOH A O   1 
HETATM 8416 O O   . HOH F 4 .   ? 17.758  15.660  29.527  1.00 35.92 ? 2045 HOH A O   1 
HETATM 8417 O O   . HOH F 4 .   ? 19.980  24.572  38.774  1.00 45.40 ? 2046 HOH A O   1 
HETATM 8418 O O   . HOH F 4 .   ? 32.353  17.481  29.999  1.00 34.38 ? 2047 HOH A O   1 
HETATM 8419 O O   . HOH F 4 .   ? 43.837  19.507  16.183  1.00 32.87 ? 2048 HOH A O   1 
HETATM 8420 O O   . HOH F 4 .   ? 46.267  13.541  22.593  1.00 37.53 ? 2049 HOH A O   1 
HETATM 8421 O O   . HOH F 4 .   ? 42.659  8.349   14.079  1.00 33.48 ? 2050 HOH A O   1 
HETATM 8422 O O   . HOH F 4 .   ? 48.100  1.902   14.468  1.00 37.37 ? 2051 HOH A O   1 
HETATM 8423 O O   . HOH F 4 .   ? 50.319  0.933   16.013  1.00 50.65 ? 2052 HOH A O   1 
HETATM 8424 O O   . HOH F 4 .   ? 53.020  10.152  21.885  1.00 45.07 ? 2053 HOH A O   1 
HETATM 8425 O O   . HOH F 4 .   ? 47.404  8.308   17.843  1.00 28.16 ? 2054 HOH A O   1 
HETATM 8426 O O   . HOH F 4 .   ? 36.455  5.719   39.209  1.00 43.58 ? 2055 HOH A O   1 
HETATM 8427 O O   . HOH F 4 .   ? 31.602  -5.117  31.285  1.00 43.16 ? 2056 HOH A O   1 
HETATM 8428 O O   . HOH F 4 .   ? 28.057  -0.586  37.495  1.00 38.86 ? 2057 HOH A O   1 
HETATM 8429 O O   . HOH F 4 .   ? 36.594  2.319   37.096  1.00 34.63 ? 2058 HOH A O   1 
HETATM 8430 O O   . HOH F 4 .   ? 17.073  -1.837  34.487  1.00 41.89 ? 2059 HOH A O   1 
HETATM 8431 O O   . HOH F 4 .   ? 19.649  1.507   28.282  1.00 42.09 ? 2060 HOH A O   1 
HETATM 8432 O O   . HOH F 4 .   ? 25.886  16.119  18.672  1.00 26.85 ? 2061 HOH A O   1 
HETATM 8433 O O   . HOH F 4 .   ? 21.498  15.501  13.392  1.00 38.03 ? 2062 HOH A O   1 
HETATM 8434 O O   . HOH F 4 .   ? 36.950  -5.653  16.450  1.00 36.80 ? 2063 HOH A O   1 
HETATM 8435 O O   . HOH F 4 .   ? 29.042  0.801   29.689  1.00 35.23 ? 2064 HOH A O   1 
HETATM 8436 O O   . HOH F 4 .   ? 26.909  9.450   7.975   1.00 35.44 ? 2065 HOH A O   1 
HETATM 8437 O O   . HOH F 4 .   ? 27.898  3.760   2.851   1.00 46.98 ? 2066 HOH A O   1 
HETATM 8438 O O   . HOH F 4 .   ? 32.238  2.669   3.790   1.00 45.76 ? 2067 HOH A O   1 
HETATM 8439 O O   . HOH F 4 .   ? 35.665  9.995   1.006   1.00 45.12 ? 2068 HOH A O   1 
HETATM 8440 O O   . HOH F 4 .   ? 30.935  8.855   6.800   1.00 40.78 ? 2069 HOH A O   1 
HETATM 8441 O O   . HOH F 4 .   ? 41.006  7.724   3.031   1.00 37.43 ? 2070 HOH A O   1 
HETATM 8442 O O   . HOH F 4 .   ? 42.849  7.002   0.364   1.00 40.74 ? 2071 HOH A O   1 
HETATM 8443 O O   . HOH F 4 .   ? 51.363  8.189   3.408   1.00 41.65 ? 2072 HOH A O   1 
HETATM 8444 O O   . HOH F 4 .   ? 45.020  12.362  -0.749  1.00 50.37 ? 2073 HOH A O   1 
HETATM 8445 O O   . HOH F 4 .   ? 46.737  11.470  10.816  1.00 28.60 ? 2074 HOH A O   1 
HETATM 8446 O O   . HOH F 4 .   ? 53.389  26.631  8.382   1.00 37.86 ? 2075 HOH A O   1 
HETATM 8447 O O   . HOH F 4 .   ? 60.270  15.946  10.122  1.00 33.85 ? 2076 HOH A O   1 
HETATM 8448 O O   . HOH F 4 .   ? 60.959  18.528  10.420  1.00 46.18 ? 2077 HOH A O   1 
HETATM 8449 O O   . HOH F 4 .   ? 64.856  5.731   16.202  1.00 58.84 ? 2078 HOH A O   1 
HETATM 8450 O O   . HOH F 4 .   ? 52.402  17.216  24.234  1.00 39.52 ? 2079 HOH A O   1 
HETATM 8451 O O   . HOH F 4 .   ? 56.876  25.601  18.008  1.00 53.09 ? 2080 HOH A O   1 
HETATM 8452 O O   . HOH F 4 .   ? 40.422  17.528  12.536  1.00 39.24 ? 2081 HOH A O   1 
HETATM 8453 O O   . HOH F 4 .   ? 43.334  21.380  -0.415  1.00 51.00 ? 2082 HOH A O   1 
HETATM 8454 O O   . HOH F 4 .   ? 32.376  21.233  6.639   1.00 51.36 ? 2083 HOH A O   1 
HETATM 8455 O O   . HOH F 4 .   ? 35.942  19.999  4.368   1.00 36.02 ? 2084 HOH A O   1 
HETATM 8456 O O   . HOH F 4 .   ? 36.532  13.518  7.052   1.00 52.39 ? 2085 HOH A O   1 
HETATM 8457 O O   . HOH F 4 .   ? 39.217  18.916  10.403  1.00 50.84 ? 2086 HOH A O   1 
HETATM 8458 O O   . HOH F 4 .   ? 44.320  11.792  9.315   1.00 44.40 ? 2087 HOH A O   1 
HETATM 8459 O O   . HOH F 4 .   ? 38.215  16.091  12.695  1.00 39.10 ? 2088 HOH A O   1 
HETATM 8460 O O   . HOH F 4 .   ? 43.519  1.268   6.131   1.00 36.50 ? 2089 HOH A O   1 
HETATM 8461 O O   . HOH F 4 .   ? 45.407  2.073   16.165  1.00 46.18 ? 2090 HOH A O   1 
HETATM 8462 O O   . HOH F 4 .   ? 45.937  -1.952  8.553   1.00 36.73 ? 2091 HOH A O   1 
HETATM 8463 O O   . HOH F 4 .   ? 36.798  -3.801  14.381  1.00 44.57 ? 2092 HOH A O   1 
HETATM 8464 O O   . HOH F 4 .   ? 15.662  -6.310  24.786  1.00 52.67 ? 2093 HOH A O   1 
HETATM 8465 O O   . HOH F 4 .   ? 22.501  20.413  7.903   1.00 29.42 ? 2094 HOH A O   1 
HETATM 8466 O O   . HOH F 4 .   ? 18.537  15.466  4.589   1.00 30.59 ? 2095 HOH A O   1 
HETATM 8467 O O   . HOH F 4 .   ? 19.802  18.218  2.743   1.00 38.29 ? 2096 HOH A O   1 
HETATM 8468 O O   . HOH F 4 .   ? 29.719  27.635  -6.039  1.00 49.08 ? 2097 HOH A O   1 
HETATM 8469 O O   . HOH F 4 .   ? 24.912  35.899  -0.762  1.00 43.61 ? 2098 HOH A O   1 
HETATM 8470 O O   . HOH F 4 .   ? 24.819  20.588  -16.941 1.00 49.39 ? 2099 HOH A O   1 
HETATM 8471 O O   . HOH F 4 .   ? 31.227  25.776  -12.663 1.00 38.39 ? 2100 HOH A O   1 
HETATM 8472 O O   . HOH F 4 .   ? 30.191  29.421  -10.403 1.00 46.86 ? 2101 HOH A O   1 
HETATM 8473 O O   . HOH F 4 .   ? 30.473  19.905  -11.336 1.00 50.05 ? 2102 HOH A O   1 
HETATM 8474 O O   . HOH F 4 .   ? 34.237  23.775  -7.332  1.00 42.14 ? 2103 HOH A O   1 
HETATM 8475 O O   . HOH F 4 .   ? 33.615  11.965  -2.544  1.00 29.23 ? 2104 HOH A O   1 
HETATM 8476 O O   . HOH F 4 .   ? 25.049  17.274  -20.432 1.00 51.77 ? 2105 HOH A O   1 
HETATM 8477 O O   . HOH F 4 .   ? 12.372  22.827  -9.561  1.00 46.91 ? 2106 HOH A O   1 
HETATM 8478 O O   . HOH F 4 .   ? 17.874  22.174  -11.853 1.00 51.55 ? 2107 HOH A O   1 
HETATM 8479 O O   . HOH F 4 .   ? 15.404  26.569  -15.917 1.00 51.81 ? 2108 HOH A O   1 
HETATM 8480 O O   . HOH F 4 .   ? 17.806  24.126  1.129   1.00 38.27 ? 2109 HOH A O   1 
HETATM 8481 O O   . HOH F 4 .   ? 19.775  15.266  2.164   1.00 36.17 ? 2110 HOH A O   1 
HETATM 8482 O O   . HOH F 4 .   ? 27.340  8.258   -0.062  1.00 37.43 ? 2111 HOH A O   1 
HETATM 8483 O O   . HOH F 4 .   ? 10.370  -6.395  16.787  1.00 53.53 ? 2112 HOH A O   1 
HETATM 8484 O O   . HOH F 4 .   ? 11.651  15.378  4.370   1.00 62.78 ? 2113 HOH A O   1 
HETATM 8485 O O   . HOH F 4 .   ? 14.527  21.591  14.881  1.00 39.82 ? 2114 HOH A O   1 
HETATM 8486 O O   . HOH F 4 .   ? 14.835  32.984  6.370   1.00 50.02 ? 2115 HOH A O   1 
HETATM 8487 O O   . HOH F 4 .   ? 13.768  24.164  2.321   1.00 38.60 ? 2116 HOH A O   1 
HETATM 8488 O O   . HOH F 4 .   ? 26.008  19.503  6.423   1.00 42.14 ? 2117 HOH A O   1 
HETATM 8489 O O   . HOH F 4 .   ? 19.357  20.951  19.112  1.00 44.03 ? 2118 HOH A O   1 
HETATM 8490 O O   . HOH F 4 .   ? 18.934  12.709  13.552  1.00 36.22 ? 2119 HOH A O   1 
HETATM 8491 O O   . HOH F 4 .   ? 16.817  25.884  18.122  1.00 47.67 ? 2120 HOH A O   1 
HETATM 8492 O O   . HOH F 4 .   ? 6.916   25.478  26.853  1.00 49.43 ? 2121 HOH A O   1 
HETATM 8493 O O   . HOH F 4 .   ? 0.232   3.146   27.870  1.00 72.03 ? 2122 HOH A O   1 
HETATM 8494 O O   . HOH F 4 .   ? 15.316  2.332   2.421   1.00 53.85 ? 2123 HOH A O   1 
HETATM 8495 O O   . HOH F 4 .   ? 14.596  -6.949  7.086   1.00 60.62 ? 2124 HOH A O   1 
HETATM 8496 O O   . HOH F 4 .   ? 12.489  -8.206  5.288   1.00 60.97 ? 2125 HOH A O   1 
HETATM 8497 O O   . HOH F 4 .   ? 9.568   -1.968  7.247   1.00 42.42 ? 2126 HOH A O   1 
HETATM 8498 O O   . HOH F 4 .   ? 11.524  1.945   11.116  1.00 34.71 ? 2127 HOH A O   1 
HETATM 8499 O O   . HOH F 4 .   ? 4.168   0.983   5.476   1.00 49.15 ? 2128 HOH A O   1 
HETATM 8500 O O   . HOH F 4 .   ? 5.937   19.903  12.577  1.00 48.07 ? 2129 HOH A O   1 
HETATM 8501 O O   . HOH F 4 .   ? 14.153  14.931  3.374   1.00 53.48 ? 2130 HOH A O   1 
HETATM 8502 O O   . HOH F 4 .   ? 18.000  2.401   -2.299  1.00 42.13 ? 2131 HOH A O   1 
HETATM 8503 O O   . HOH F 4 .   ? 10.892  3.854   -10.186 1.00 50.28 ? 2132 HOH A O   1 
HETATM 8504 O O   . HOH F 4 .   ? 14.937  8.848   -4.257  1.00 41.09 ? 2133 HOH A O   1 
HETATM 8505 O O   . HOH F 4 .   ? 26.901  18.561  15.774  1.00 40.51 ? 2134 HOH A O   1 
HETATM 8506 O O   . HOH G 4 .   ? -14.376 2.512   -60.844 1.00 50.32 ? 2001 HOH B O   1 
HETATM 8507 O O   . HOH G 4 .   ? 14.719  2.050   -61.333 1.00 42.30 ? 2002 HOH B O   1 
HETATM 8508 O O   . HOH G 4 .   ? 9.044   0.521   -67.441 1.00 33.79 ? 2003 HOH B O   1 
HETATM 8509 O O   . HOH G 4 .   ? 14.908  -1.350  -65.105 1.00 48.05 ? 2004 HOH B O   1 
HETATM 8510 O O   . HOH G 4 .   ? 16.916  0.801   -60.010 1.00 49.77 ? 2005 HOH B O   1 
HETATM 8511 O O   . HOH G 4 .   ? 12.299  3.428   -73.891 1.00 55.49 ? 2006 HOH B O   1 
HETATM 8512 O O   . HOH G 4 .   ? -8.728  -0.543  -65.744 1.00 50.15 ? 2007 HOH B O   1 
HETATM 8513 O O   . HOH G 4 .   ? -2.774  -1.233  -60.584 1.00 41.13 ? 2008 HOH B O   1 
HETATM 8514 O O   . HOH G 4 .   ? 12.528  -4.758  -51.034 1.00 55.86 ? 2009 HOH B O   1 
HETATM 8515 O O   . HOH G 4 .   ? 6.738   -8.798  -43.952 1.00 49.13 ? 2010 HOH B O   1 
HETATM 8516 O O   . HOH G 4 .   ? -3.592  -3.771  -41.714 1.00 48.85 ? 2011 HOH B O   1 
HETATM 8517 O O   . HOH G 4 .   ? 29.579  1.020   -35.759 1.00 40.16 ? 2012 HOH B O   1 
HETATM 8518 O O   . HOH G 4 .   ? -0.652  -10.110 -55.128 1.00 43.87 ? 2013 HOH B O   1 
HETATM 8519 O O   . HOH G 4 .   ? 15.527  -5.149  -56.289 1.00 36.95 ? 2014 HOH B O   1 
HETATM 8520 O O   . HOH G 4 .   ? 13.126  -4.441  -55.196 1.00 42.86 ? 2015 HOH B O   1 
HETATM 8521 O O   . HOH G 4 .   ? 8.695   -1.312  -60.188 1.00 34.46 ? 2016 HOH B O   1 
HETATM 8522 O O   . HOH G 4 .   ? 10.007  -6.318  -63.635 1.00 31.87 ? 2017 HOH B O   1 
HETATM 8523 O O   . HOH G 4 .   ? 6.326   -0.739  -64.244 1.00 45.56 ? 2018 HOH B O   1 
HETATM 8524 O O   . HOH G 4 .   ? 0.267   -0.153  -55.195 1.00 45.62 ? 2019 HOH B O   1 
HETATM 8525 O O   . HOH G 4 .   ? -10.450 12.479  -59.705 1.00 60.90 ? 2020 HOH B O   1 
HETATM 8526 O O   . HOH G 4 .   ? 4.167   4.267   -47.756 1.00 31.25 ? 2021 HOH B O   1 
HETATM 8527 O O   . HOH G 4 .   ? 4.003   2.201   -40.552 1.00 36.56 ? 2022 HOH B O   1 
HETATM 8528 O O   . HOH G 4 .   ? 10.372  -0.280  -43.316 1.00 29.49 ? 2023 HOH B O   1 
HETATM 8529 O O   . HOH G 4 .   ? 13.254  -8.084  -45.717 1.00 41.25 ? 2024 HOH B O   1 
HETATM 8530 O O   . HOH G 4 .   ? -5.698  -2.652  -48.115 1.00 39.24 ? 2025 HOH B O   1 
HETATM 8531 O O   . HOH G 4 .   ? -3.664  0.677   -47.967 1.00 38.92 ? 2026 HOH B O   1 
HETATM 8532 O O   . HOH G 4 .   ? 4.188   -1.116  -42.863 1.00 30.80 ? 2027 HOH B O   1 
HETATM 8533 O O   . HOH G 4 .   ? -1.587  3.631   -48.305 1.00 47.07 ? 2028 HOH B O   1 
HETATM 8534 O O   . HOH G 4 .   ? 1.431   -0.378  -52.734 1.00 35.89 ? 2029 HOH B O   1 
HETATM 8535 O O   . HOH G 4 .   ? 17.374  -3.180  -55.265 1.00 40.23 ? 2030 HOH B O   1 
HETATM 8536 O O   . HOH G 4 .   ? 20.893  0.983   -50.613 1.00 48.79 ? 2031 HOH B O   1 
HETATM 8537 O O   . HOH G 4 .   ? 22.872  0.324   -52.497 1.00 49.47 ? 2032 HOH B O   1 
HETATM 8538 O O   . HOH G 4 .   ? -1.338  -2.474  -17.737 1.00 48.38 ? 2033 HOH B O   1 
HETATM 8539 O O   . HOH G 4 .   ? 15.724  9.385   -56.015 1.00 41.58 ? 2034 HOH B O   1 
HETATM 8540 O O   . HOH G 4 .   ? 18.129  11.991  -55.412 1.00 48.54 ? 2035 HOH B O   1 
HETATM 8541 O O   . HOH G 4 .   ? 6.152   16.437  -53.218 1.00 30.56 ? 2036 HOH B O   1 
HETATM 8542 O O   . HOH G 4 .   ? 8.619   13.748  -65.862 1.00 60.73 ? 2037 HOH B O   1 
HETATM 8543 O O   . HOH G 4 .   ? 1.403   18.718  -59.524 1.00 35.84 ? 2038 HOH B O   1 
HETATM 8544 O O   . HOH G 4 .   ? -0.100  19.422  -46.760 1.00 48.78 ? 2039 HOH B O   1 
HETATM 8545 O O   . HOH G 4 .   ? 3.768   4.249   -33.305 1.00 31.19 ? 2040 HOH B O   1 
HETATM 8546 O O   . HOH G 4 .   ? 11.497  21.357  -46.503 1.00 43.53 ? 2041 HOH B O   1 
HETATM 8547 O O   . HOH G 4 .   ? 3.353   7.364   -32.623 1.00 32.02 ? 2042 HOH B O   1 
HETATM 8548 O O   . HOH G 4 .   ? 13.407  6.919   -32.984 1.00 33.36 ? 2043 HOH B O   1 
HETATM 8549 O O   . HOH G 4 .   ? 17.435  5.602   -34.368 1.00 34.49 ? 2044 HOH B O   1 
HETATM 8550 O O   . HOH G 4 .   ? 22.244  1.418   -35.712 1.00 38.31 ? 2045 HOH B O   1 
HETATM 8551 O O   . HOH G 4 .   ? 20.703  7.158   -36.231 1.00 35.43 ? 2046 HOH B O   1 
HETATM 8552 O O   . HOH G 4 .   ? 27.191  1.820   -37.341 1.00 32.80 ? 2047 HOH B O   1 
HETATM 8553 O O   . HOH G 4 .   ? 29.595  6.572   -41.924 1.00 45.53 ? 2048 HOH B O   1 
HETATM 8554 O O   . HOH G 4 .   ? 25.106  -3.187  -46.025 1.00 36.20 ? 2049 HOH B O   1 
HETATM 8555 O O   . HOH G 4 .   ? 32.355  -8.330  -42.682 1.00 49.15 ? 2050 HOH B O   1 
HETATM 8556 O O   . HOH G 4 .   ? 32.410  -15.218 -55.277 1.00 61.79 ? 2051 HOH B O   1 
HETATM 8557 O O   . HOH G 4 .   ? 14.372  -7.541  -48.035 1.00 53.35 ? 2052 HOH B O   1 
HETATM 8558 O O   . HOH G 4 .   ? 13.516  -6.410  -33.210 1.00 51.71 ? 2053 HOH B O   1 
HETATM 8559 O O   . HOH G 4 .   ? 17.963  -6.937  -33.361 1.00 53.61 ? 2054 HOH B O   1 
HETATM 8560 O O   . HOH G 4 .   ? 18.919  -1.178  -36.994 1.00 41.73 ? 2055 HOH B O   1 
HETATM 8561 O O   . HOH G 4 .   ? 17.121  -6.814  -40.054 1.00 60.38 ? 2056 HOH B O   1 
HETATM 8562 O O   . HOH G 4 .   ? 16.380  -3.488  -42.060 1.00 35.20 ? 2057 HOH B O   1 
HETATM 8563 O O   . HOH G 4 .   ? 17.219  -5.745  -42.945 1.00 59.08 ? 2058 HOH B O   1 
HETATM 8564 O O   . HOH G 4 .   ? 22.555  15.291  -45.553 1.00 51.92 ? 2059 HOH B O   1 
HETATM 8565 O O   . HOH G 4 .   ? 22.947  10.224  -34.815 1.00 51.21 ? 2060 HOH B O   1 
HETATM 8566 O O   . HOH G 4 .   ? 25.601  10.039  -29.643 1.00 46.69 ? 2061 HOH B O   1 
HETATM 8567 O O   . HOH G 4 .   ? 5.497   -1.253  -28.614 1.00 42.94 ? 2062 HOH B O   1 
HETATM 8568 O O   . HOH G 4 .   ? 6.874   4.495   -24.289 1.00 38.80 ? 2063 HOH B O   1 
HETATM 8569 O O   . HOH G 4 .   ? 23.562  -2.861  -33.963 1.00 50.57 ? 2064 HOH B O   1 
HETATM 8570 O O   . HOH G 4 .   ? 23.251  0.307   -27.662 1.00 46.41 ? 2065 HOH B O   1 
HETATM 8571 O O   . HOH G 4 .   ? 32.231  -4.144  -20.743 1.00 61.91 ? 2066 HOH B O   1 
HETATM 8572 O O   . HOH G 4 .   ? 11.719  4.594   -12.347 1.00 46.99 ? 2067 HOH B O   1 
HETATM 8573 O O   . HOH G 4 .   ? 10.780  -6.651  -4.568  1.00 46.12 ? 2068 HOH B O   1 
HETATM 8574 O O   . HOH G 4 .   ? 9.435   -0.982  -11.878 1.00 62.55 ? 2069 HOH B O   1 
HETATM 8575 O O   . HOH G 4 .   ? 9.238   3.703   -23.561 1.00 42.32 ? 2070 HOH B O   1 
HETATM 8576 O O   . HOH G 4 .   ? 19.114  6.114   -26.643 1.00 41.63 ? 2071 HOH B O   1 
HETATM 8577 O O   . HOH G 4 .   ? 19.531  15.797  -26.581 1.00 60.46 ? 2072 HOH B O   1 
HETATM 8578 O O   . HOH G 4 .   ? -0.113  26.970  -32.244 1.00 39.20 ? 2073 HOH B O   1 
HETATM 8579 O O   . HOH G 4 .   ? -5.877  2.494   -23.028 1.00 40.97 ? 2074 HOH B O   1 
HETATM 8580 O O   . HOH G 4 .   ? 0.937   -2.007  -19.157 1.00 43.12 ? 2075 HOH B O   1 
HETATM 8581 O O   . HOH G 4 .   ? -7.926  7.367   -44.391 1.00 40.28 ? 2076 HOH B O   1 
HETATM 8582 O O   . HOH G 4 .   ? -9.445  17.287  -33.337 1.00 51.54 ? 2077 HOH B O   1 
HETATM 8583 O O   . HOH G 4 .   ? -6.870  13.698  -26.106 1.00 35.73 ? 2078 HOH B O   1 
HETATM 8584 O O   . HOH G 4 .   ? -1.646  24.506  -47.095 1.00 35.20 ? 2079 HOH B O   1 
HETATM 8585 O O   . HOH G 4 .   ? -15.650 31.867  -23.377 1.00 40.99 ? 2080 HOH B O   1 
HETATM 8586 O O   . HOH G 4 .   ? 6.188   24.120  -24.891 1.00 42.42 ? 2081 HOH B O   1 
HETATM 8587 O O   . HOH G 4 .   ? 8.100   24.760  -31.376 1.00 33.86 ? 2082 HOH B O   1 
HETATM 8588 O O   . HOH G 4 .   ? 12.223  26.647  -27.919 1.00 40.59 ? 2083 HOH B O   1 
HETATM 8589 O O   . HOH G 4 .   ? 11.766  27.872  -25.227 1.00 50.01 ? 2084 HOH B O   1 
HETATM 8590 O O   . HOH G 4 .   ? 10.884  16.992  -22.847 1.00 32.89 ? 2085 HOH B O   1 
HETATM 8591 O O   . HOH G 4 .   ? 3.416   20.157  -28.128 1.00 30.33 ? 2086 HOH B O   1 
HETATM 8592 O O   . HOH G 4 .   ? -8.723  6.917   -23.318 1.00 52.74 ? 2087 HOH B O   1 
HETATM 8593 O O   . HOH G 4 .   ? -6.886  15.271  -18.980 1.00 46.96 ? 2088 HOH B O   1 
HETATM 8594 O O   . HOH G 4 .   ? 3.006   17.109  -16.418 1.00 48.94 ? 2089 HOH B O   1 
HETATM 8595 O O   . HOH G 4 .   ? 12.630  15.107  -22.420 1.00 34.49 ? 2090 HOH B O   1 
HETATM 8596 O O   . HOH G 4 .   ? 15.495  15.376  -20.702 1.00 47.39 ? 2091 HOH B O   1 
HETATM 8597 O O   . HOH G 4 .   ? 9.346   14.370  -17.677 1.00 43.64 ? 2092 HOH B O   1 
HETATM 8598 O O   . HOH G 4 .   ? 12.496  16.794  -14.261 1.00 52.38 ? 2093 HOH B O   1 
HETATM 8599 O O   . HOH G 4 .   ? 11.653  11.311  -16.214 1.00 39.49 ? 2094 HOH B O   1 
HETATM 8600 O O   . HOH G 4 .   ? 17.968  15.424  -21.803 1.00 36.99 ? 2095 HOH B O   1 
HETATM 8601 O O   . HOH G 4 .   ? 5.308   -1.259  -37.965 1.00 53.51 ? 2096 HOH B O   1 
HETATM 8602 O O   . HOH G 4 .   ? 20.073  7.693   -12.455 1.00 57.46 ? 2097 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 ?   ?   ?   A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
A 1 544 ALA 544 544 ?   ?   ?   A . n 
A 1 545 THR 545 545 ?   ?   ?   A . n 
A 1 546 GLU 546 546 ?   ?   ?   A . n 
A 1 547 ALA 547 547 ?   ?   ?   A . n 
A 1 548 PRO 548 548 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 ?   ?   ?   B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER SER B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
B 1 544 ALA 544 544 544 ALA ALA B . n 
B 1 545 THR 545 545 ?   ?   ?   B . n 
B 1 546 GLU 546 546 ?   ?   ?   B . n 
B 1 547 ALA 547 547 ?   ?   ?   B . n 
B 1 548 PRO 548 548 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NTJ 1   1543 1543 NTJ NTJ A . 
D 2 NTJ 1   1544 1544 NTJ NTJ B . 
E 3 P6G 1   1545 1545 P6G P6G B . 
F 4 HOH 1   2001 2001 HOH HOH A . 
F 4 HOH 2   2002 2002 HOH HOH A . 
F 4 HOH 3   2003 2003 HOH HOH A . 
F 4 HOH 4   2004 2004 HOH HOH A . 
F 4 HOH 5   2005 2005 HOH HOH A . 
F 4 HOH 6   2006 2006 HOH HOH A . 
F 4 HOH 7   2007 2007 HOH HOH A . 
F 4 HOH 8   2008 2008 HOH HOH A . 
F 4 HOH 9   2009 2009 HOH HOH A . 
F 4 HOH 10  2010 2010 HOH HOH A . 
F 4 HOH 11  2011 2011 HOH HOH A . 
F 4 HOH 12  2012 2012 HOH HOH A . 
F 4 HOH 13  2013 2013 HOH HOH A . 
F 4 HOH 14  2014 2014 HOH HOH A . 
F 4 HOH 15  2015 2015 HOH HOH A . 
F 4 HOH 16  2016 2016 HOH HOH A . 
F 4 HOH 17  2017 2017 HOH HOH A . 
F 4 HOH 18  2018 2018 HOH HOH A . 
F 4 HOH 19  2019 2019 HOH HOH A . 
F 4 HOH 20  2020 2020 HOH HOH A . 
F 4 HOH 21  2021 2021 HOH HOH A . 
F 4 HOH 22  2022 2022 HOH HOH A . 
F 4 HOH 23  2023 2023 HOH HOH A . 
F 4 HOH 24  2024 2024 HOH HOH A . 
F 4 HOH 25  2025 2025 HOH HOH A . 
F 4 HOH 26  2026 2026 HOH HOH A . 
F 4 HOH 27  2027 2027 HOH HOH A . 
F 4 HOH 28  2028 2028 HOH HOH A . 
F 4 HOH 29  2029 2029 HOH HOH A . 
F 4 HOH 30  2030 2030 HOH HOH A . 
F 4 HOH 31  2031 2031 HOH HOH A . 
F 4 HOH 32  2032 2032 HOH HOH A . 
F 4 HOH 33  2033 2033 HOH HOH A . 
F 4 HOH 34  2034 2034 HOH HOH A . 
F 4 HOH 35  2035 2035 HOH HOH A . 
F 4 HOH 36  2036 2036 HOH HOH A . 
F 4 HOH 37  2037 2037 HOH HOH A . 
F 4 HOH 38  2038 2038 HOH HOH A . 
F 4 HOH 39  2039 2039 HOH HOH A . 
F 4 HOH 40  2040 2040 HOH HOH A . 
F 4 HOH 41  2041 2041 HOH HOH A . 
F 4 HOH 42  2042 2042 HOH HOH A . 
F 4 HOH 43  2043 2043 HOH HOH A . 
F 4 HOH 44  2044 2044 HOH HOH A . 
F 4 HOH 45  2045 2045 HOH HOH A . 
F 4 HOH 46  2046 2046 HOH HOH A . 
F 4 HOH 47  2047 2047 HOH HOH A . 
F 4 HOH 48  2048 2048 HOH HOH A . 
F 4 HOH 49  2049 2049 HOH HOH A . 
F 4 HOH 50  2050 2050 HOH HOH A . 
F 4 HOH 51  2051 2051 HOH HOH A . 
F 4 HOH 52  2052 2052 HOH HOH A . 
F 4 HOH 53  2053 2053 HOH HOH A . 
F 4 HOH 54  2054 2054 HOH HOH A . 
F 4 HOH 55  2055 2055 HOH HOH A . 
F 4 HOH 56  2056 2056 HOH HOH A . 
F 4 HOH 57  2057 2057 HOH HOH A . 
F 4 HOH 58  2058 2058 HOH HOH A . 
F 4 HOH 59  2059 2059 HOH HOH A . 
F 4 HOH 60  2060 2060 HOH HOH A . 
F 4 HOH 61  2061 2061 HOH HOH A . 
F 4 HOH 62  2062 2062 HOH HOH A . 
F 4 HOH 63  2063 2063 HOH HOH A . 
F 4 HOH 64  2064 2064 HOH HOH A . 
F 4 HOH 65  2065 2065 HOH HOH A . 
F 4 HOH 66  2066 2066 HOH HOH A . 
F 4 HOH 67  2067 2067 HOH HOH A . 
F 4 HOH 68  2068 2068 HOH HOH A . 
F 4 HOH 69  2069 2069 HOH HOH A . 
F 4 HOH 70  2070 2070 HOH HOH A . 
F 4 HOH 71  2071 2071 HOH HOH A . 
F 4 HOH 72  2072 2072 HOH HOH A . 
F 4 HOH 73  2073 2073 HOH HOH A . 
F 4 HOH 74  2074 2074 HOH HOH A . 
F 4 HOH 75  2075 2075 HOH HOH A . 
F 4 HOH 76  2076 2076 HOH HOH A . 
F 4 HOH 77  2077 2077 HOH HOH A . 
F 4 HOH 78  2078 2078 HOH HOH A . 
F 4 HOH 79  2079 2079 HOH HOH A . 
F 4 HOH 80  2080 2080 HOH HOH A . 
F 4 HOH 81  2081 2081 HOH HOH A . 
F 4 HOH 82  2082 2082 HOH HOH A . 
F 4 HOH 83  2083 2083 HOH HOH A . 
F 4 HOH 84  2084 2084 HOH HOH A . 
F 4 HOH 85  2085 2085 HOH HOH A . 
F 4 HOH 86  2086 2086 HOH HOH A . 
F 4 HOH 87  2087 2087 HOH HOH A . 
F 4 HOH 88  2088 2088 HOH HOH A . 
F 4 HOH 89  2089 2089 HOH HOH A . 
F 4 HOH 90  2090 2090 HOH HOH A . 
F 4 HOH 91  2091 2091 HOH HOH A . 
F 4 HOH 92  2092 2092 HOH HOH A . 
F 4 HOH 93  2093 2093 HOH HOH A . 
F 4 HOH 94  2094 2094 HOH HOH A . 
F 4 HOH 95  2095 2095 HOH HOH A . 
F 4 HOH 96  2096 2096 HOH HOH A . 
F 4 HOH 97  2097 2097 HOH HOH A . 
F 4 HOH 98  2098 2098 HOH HOH A . 
F 4 HOH 99  2099 2099 HOH HOH A . 
F 4 HOH 100 2100 2100 HOH HOH A . 
F 4 HOH 101 2101 2101 HOH HOH A . 
F 4 HOH 102 2102 2102 HOH HOH A . 
F 4 HOH 103 2103 2103 HOH HOH A . 
F 4 HOH 104 2104 2104 HOH HOH A . 
F 4 HOH 105 2105 2105 HOH HOH A . 
F 4 HOH 106 2106 2106 HOH HOH A . 
F 4 HOH 107 2107 2107 HOH HOH A . 
F 4 HOH 108 2108 2108 HOH HOH A . 
F 4 HOH 109 2109 2109 HOH HOH A . 
F 4 HOH 110 2110 2110 HOH HOH A . 
F 4 HOH 111 2111 2111 HOH HOH A . 
F 4 HOH 112 2112 2112 HOH HOH A . 
F 4 HOH 113 2113 2113 HOH HOH A . 
F 4 HOH 114 2114 2114 HOH HOH A . 
F 4 HOH 115 2115 2115 HOH HOH A . 
F 4 HOH 116 2116 2116 HOH HOH A . 
F 4 HOH 117 2117 2117 HOH HOH A . 
F 4 HOH 118 2118 2118 HOH HOH A . 
F 4 HOH 119 2119 2119 HOH HOH A . 
F 4 HOH 120 2120 2120 HOH HOH A . 
F 4 HOH 121 2121 2121 HOH HOH A . 
F 4 HOH 122 2122 2122 HOH HOH A . 
F 4 HOH 123 2123 2123 HOH HOH A . 
F 4 HOH 124 2124 2124 HOH HOH A . 
F 4 HOH 125 2125 2125 HOH HOH A . 
F 4 HOH 126 2126 2126 HOH HOH A . 
F 4 HOH 127 2127 2127 HOH HOH A . 
F 4 HOH 128 2128 2128 HOH HOH A . 
F 4 HOH 129 2129 2129 HOH HOH A . 
F 4 HOH 130 2130 2130 HOH HOH A . 
F 4 HOH 131 2131 2131 HOH HOH A . 
F 4 HOH 132 2132 2132 HOH HOH A . 
F 4 HOH 133 2133 2133 HOH HOH A . 
F 4 HOH 134 2134 2134 HOH HOH A . 
G 4 HOH 1   2001 2001 HOH HOH B . 
G 4 HOH 2   2002 2002 HOH HOH B . 
G 4 HOH 3   2003 2003 HOH HOH B . 
G 4 HOH 4   2004 2004 HOH HOH B . 
G 4 HOH 5   2005 2005 HOH HOH B . 
G 4 HOH 6   2006 2006 HOH HOH B . 
G 4 HOH 7   2007 2007 HOH HOH B . 
G 4 HOH 8   2008 2008 HOH HOH B . 
G 4 HOH 9   2009 2009 HOH HOH B . 
G 4 HOH 10  2010 2010 HOH HOH B . 
G 4 HOH 11  2011 2011 HOH HOH B . 
G 4 HOH 12  2012 2012 HOH HOH B . 
G 4 HOH 13  2013 2013 HOH HOH B . 
G 4 HOH 14  2014 2014 HOH HOH B . 
G 4 HOH 15  2015 2015 HOH HOH B . 
G 4 HOH 16  2016 2016 HOH HOH B . 
G 4 HOH 17  2017 2017 HOH HOH B . 
G 4 HOH 18  2018 2018 HOH HOH B . 
G 4 HOH 19  2019 2019 HOH HOH B . 
G 4 HOH 20  2020 2020 HOH HOH B . 
G 4 HOH 21  2021 2021 HOH HOH B . 
G 4 HOH 22  2022 2022 HOH HOH B . 
G 4 HOH 23  2023 2023 HOH HOH B . 
G 4 HOH 24  2024 2024 HOH HOH B . 
G 4 HOH 25  2025 2025 HOH HOH B . 
G 4 HOH 26  2026 2026 HOH HOH B . 
G 4 HOH 27  2027 2027 HOH HOH B . 
G 4 HOH 28  2028 2028 HOH HOH B . 
G 4 HOH 29  2029 2029 HOH HOH B . 
G 4 HOH 30  2030 2030 HOH HOH B . 
G 4 HOH 31  2031 2031 HOH HOH B . 
G 4 HOH 32  2032 2032 HOH HOH B . 
G 4 HOH 33  2033 2033 HOH HOH B . 
G 4 HOH 34  2034 2034 HOH HOH B . 
G 4 HOH 35  2035 2035 HOH HOH B . 
G 4 HOH 36  2036 2036 HOH HOH B . 
G 4 HOH 37  2037 2037 HOH HOH B . 
G 4 HOH 38  2038 2038 HOH HOH B . 
G 4 HOH 39  2039 2039 HOH HOH B . 
G 4 HOH 40  2040 2040 HOH HOH B . 
G 4 HOH 41  2041 2041 HOH HOH B . 
G 4 HOH 42  2042 2042 HOH HOH B . 
G 4 HOH 43  2043 2043 HOH HOH B . 
G 4 HOH 44  2044 2044 HOH HOH B . 
G 4 HOH 45  2045 2045 HOH HOH B . 
G 4 HOH 46  2046 2046 HOH HOH B . 
G 4 HOH 47  2047 2047 HOH HOH B . 
G 4 HOH 48  2048 2048 HOH HOH B . 
G 4 HOH 49  2049 2049 HOH HOH B . 
G 4 HOH 50  2050 2050 HOH HOH B . 
G 4 HOH 51  2051 2051 HOH HOH B . 
G 4 HOH 52  2052 2052 HOH HOH B . 
G 4 HOH 53  2053 2053 HOH HOH B . 
G 4 HOH 54  2054 2054 HOH HOH B . 
G 4 HOH 55  2055 2055 HOH HOH B . 
G 4 HOH 56  2056 2056 HOH HOH B . 
G 4 HOH 57  2057 2057 HOH HOH B . 
G 4 HOH 58  2058 2058 HOH HOH B . 
G 4 HOH 59  2059 2059 HOH HOH B . 
G 4 HOH 60  2060 2060 HOH HOH B . 
G 4 HOH 61  2061 2061 HOH HOH B . 
G 4 HOH 62  2062 2062 HOH HOH B . 
G 4 HOH 63  2063 2063 HOH HOH B . 
G 4 HOH 64  2064 2064 HOH HOH B . 
G 4 HOH 65  2065 2065 HOH HOH B . 
G 4 HOH 66  2066 2066 HOH HOH B . 
G 4 HOH 67  2067 2067 HOH HOH B . 
G 4 HOH 68  2068 2068 HOH HOH B . 
G 4 HOH 69  2069 2069 HOH HOH B . 
G 4 HOH 70  2070 2070 HOH HOH B . 
G 4 HOH 71  2071 2071 HOH HOH B . 
G 4 HOH 72  2072 2072 HOH HOH B . 
G 4 HOH 73  2073 2073 HOH HOH B . 
G 4 HOH 74  2074 2074 HOH HOH B . 
G 4 HOH 75  2075 2075 HOH HOH B . 
G 4 HOH 76  2076 2076 HOH HOH B . 
G 4 HOH 77  2077 2077 HOH HOH B . 
G 4 HOH 78  2078 2078 HOH HOH B . 
G 4 HOH 79  2079 2079 HOH HOH B . 
G 4 HOH 80  2080 2080 HOH HOH B . 
G 4 HOH 81  2081 2081 HOH HOH B . 
G 4 HOH 82  2082 2082 HOH HOH B . 
G 4 HOH 83  2083 2083 HOH HOH B . 
G 4 HOH 84  2084 2084 HOH HOH B . 
G 4 HOH 85  2085 2085 HOH HOH B . 
G 4 HOH 86  2086 2086 HOH HOH B . 
G 4 HOH 87  2087 2087 HOH HOH B . 
G 4 HOH 88  2088 2088 HOH HOH B . 
G 4 HOH 89  2089 2089 HOH HOH B . 
G 4 HOH 90  2090 2090 HOH HOH B . 
G 4 HOH 91  2091 2091 HOH HOH B . 
G 4 HOH 92  2092 2092 HOH HOH B . 
G 4 HOH 93  2093 2093 HOH HOH B . 
G 4 HOH 94  2094 2094 HOH HOH B . 
G 4 HOH 95  2095 2095 HOH HOH B . 
G 4 HOH 96  2096 2096 HOH HOH B . 
G 4 HOH 97  2097 2097 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3450  ? 
1 MORE         6     ? 
1 'SSA (A^2)'  37820 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-01-09 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-01-17 
5 'Structure model' 1 4 2021-05-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 5 'Structure model' 'Derived calculations'      
5 5 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source             
2 5 'Structure model' pdbx_database_status      
3 5 'Structure model' pdbx_struct_assembly      
4 5 'Structure model' pdbx_struct_assembly_gen  
5 5 'Structure model' pdbx_struct_assembly_prop 
6 5 'Structure model' struct_conn               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 
2 5 'Structure model' '_pdbx_database_status.status_code_sf' 
3 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'  
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005 ? 1 
XDS    'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   SER 
_pdbx_validate_close_contact.auth_seq_id_1    203 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   NTJ 
_pdbx_validate_close_contact.auth_seq_id_2    1543 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.09 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 77.31   -3.40   
2  1 PRO A 49  ? ? -47.63  150.62  
3  1 ALA A 62  ? ? -115.96 55.36   
4  1 ALA A 127 ? ? -170.04 140.39  
5  1 ASN A 170 ? ? 56.23   15.92   
6  1 SER A 203 ? ? 55.19   -109.79 
7  1 ASP A 306 ? ? -125.33 -83.16  
8  1 VAL A 407 ? ? -129.16 -65.73  
9  1 LEU A 437 ? ? -35.16  135.72  
10 1 PRO A 458 ? ? -57.90  -9.48   
11 1 ASN A 464 ? ? 80.09   1.71    
12 1 ARG A 493 ? ? -80.38  -71.35  
13 1 ASP A 494 ? ? -39.66  73.08   
14 1 ARG A 525 ? ? 37.96   54.85   
15 1 PRO B 25  ? ? -37.93  -38.09  
16 1 PHE B 47  ? ? 71.23   -1.45   
17 1 ALA B 62  ? ? -113.96 59.94   
18 1 SER B 93  ? ? -175.27 142.96  
19 1 CYS B 96  ? ? -145.83 -2.76   
20 1 PRO B 108 ? ? -34.11  137.69  
21 1 PHE B 123 ? ? 59.61   12.42   
22 1 ALA B 127 ? ? -170.88 145.88  
23 1 SER B 203 ? ? 49.89   -118.20 
24 1 ALA B 278 ? ? -28.45  -53.39  
25 1 ASP B 306 ? ? -111.64 -84.58  
26 1 ASP B 323 ? ? -106.15 52.48   
27 1 ARG B 493 ? ? -63.81  93.57   
28 1 ASP B 494 ? ? 145.10  148.21  
29 1 LYS B 496 ? ? 74.36   -23.66  
30 1 ALA B 542 ? ? 119.14  45.74   
31 1 THR B 543 ? ? 7.68    103.18  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 LYS B 496 ? ? SER B 497 ? ? -149.07 
2 1 SER B 497 ? ? PRO B 498 ? ? -48.02  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2027 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.82 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 496 ? CG  ? A LYS 496 CG  
2  1 Y 1 A LYS 496 ? CD  ? A LYS 496 CD  
3  1 Y 1 A LYS 496 ? CE  ? A LYS 496 CE  
4  1 Y 1 A LYS 496 ? NZ  ? A LYS 496 NZ  
5  1 Y 1 B ARG 493 ? CG  ? B ARG 493 CG  
6  1 Y 1 B ARG 493 ? CD  ? B ARG 493 CD  
7  1 Y 1 B ARG 493 ? NE  ? B ARG 493 NE  
8  1 Y 1 B ARG 493 ? CZ  ? B ARG 493 CZ  
9  1 Y 1 B ARG 493 ? NH1 ? B ARG 493 NH1 
10 1 Y 1 B ARG 493 ? NH2 ? B ARG 493 NH2 
11 1 Y 1 B ALA 544 ? CA  ? B ALA 544 CA  
12 1 Y 1 B ALA 544 ? C   ? B ALA 544 C   
13 1 Y 1 B ALA 544 ? O   ? B ALA 544 O   
14 1 Y 1 B ALA 544 ? CB  ? B ALA 544 CB  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 258 ? A PRO 258 
2  1 Y 1 A PRO 259 ? A PRO 259 
3  1 Y 1 A GLY 260 ? A GLY 260 
4  1 Y 1 A GLY 261 ? A GLY 261 
5  1 Y 1 A ALA 262 ? A ALA 262 
6  1 Y 1 A GLY 263 ? A GLY 263 
7  1 Y 1 A GLY 264 ? A GLY 264 
8  1 Y 1 A THR 543 ? A THR 543 
9  1 Y 1 A ALA 544 ? A ALA 544 
10 1 Y 1 A THR 545 ? A THR 545 
11 1 Y 1 A GLU 546 ? A GLU 546 
12 1 Y 1 A ALA 547 ? A ALA 547 
13 1 Y 1 A PRO 548 ? A PRO 548 
14 1 Y 1 B GLU 1   ? B GLU 1   
15 1 Y 1 B GLY 2   ? B GLY 2   
16 1 Y 1 B ARG 3   ? B ARG 3   
17 1 Y 1 B PRO 258 ? B PRO 258 
18 1 Y 1 B PRO 259 ? B PRO 259 
19 1 Y 1 B GLY 260 ? B GLY 260 
20 1 Y 1 B GLY 261 ? B GLY 261 
21 1 Y 1 B ALA 262 ? B ALA 262 
22 1 Y 1 B GLY 263 ? B GLY 263 
23 1 Y 1 B GLY 264 ? B GLY 264 
24 1 Y 1 B THR 545 ? B THR 545 
25 1 Y 1 B GLU 546 ? B GLU 546 
26 1 Y 1 B ALA 547 ? B ALA 547 
27 1 Y 1 B PRO 548 ? B PRO 548 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'R-ETHYL N,N-DIMETHYLPHOSPHONAMIDATE' NTJ 
3 'HEXAETHYLENE GLYCOL'                 P6G 
4 water                                 HOH 
#