data_2C2K
# 
_entry.id   2C2K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.280 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2C2K         
PDBE  EBI-25736    
WWPDB D_1290025736 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1CP3 unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF APOPAIN WITH THE TETRAPEPTIDE INHIBITOR ACE-DVAD- FMC' 
PDB 1GFW unspecified 
'THE 2.8 ANGSTROM CRYSTAL STRUCTURE OF CASPASE-3 (APOPAIN ORCPP32)IN COMPLEX WITH AN ISATIN SULFONAMIDE INHIBITOR.' 
PDB 1I3O unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF XIAP- BIR2 AND CASPASE 3' 
PDB 1NME unspecified 'STRUCTURE OF CASP-3 WITH TETHERED SALICYLATE' 
PDB 1NMQ unspecified 'EXTENDEND TETHERING: IN SITU ASSEMBLY OF INHIBITORS' 
PDB 1NMS unspecified 'CASPASE-3 TETHERED TO IRREVERSIBLE INHIBITOR' 
PDB 1PAU unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF APOPAIN WITH THE TETRAPEPTIDE ALDEHYDE INHIBITOR AC -DEVD-CHO' 
PDB 1QX3 unspecified 'CONFORMATIONAL RESTRICTIONS IN THE ACTIVE SITE OFUNLIGANDED HUMAN CASPASE-3' 
PDB 1RE1 unspecified 'CRYSTAL STRUCTURE OF CASPASE-3 WITH A NICOTINIC ACIDALDEHYDE INHIBITOR' 
PDB 1RHJ unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH APRYAZINONE INHIBITOR' 
PDB 1RHK unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH A PHENYL-PROPYL-KETONE INHIBITOR' 
PDB 1RHM unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH ANICOTINIC ACID ALDEHYDE INHIBITOR' 
PDB 1RHQ unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH ABROMOMETHOXYPHENYL INHIBITOR' 
PDB 1RHR unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH ACINNAMIC ACID METHYL ESTER INHIBITOR' 
PDB 1RHU unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH A 5,6, 7TRICYCLIC PEPTIDOMIMETIC INHIBITOR' 
PDB 2C1E unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE MICHAEL ACCEPTOR INHIBITORS.' 
PDB 2C2M unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE MICHAEL ACCEPTOR INHIBITORS.' 
PDB 2C2O unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE MICHAEL ACCEPTOR INHIBITORS.' 
PDB 2CDR unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE EPOXIDE INHIBITORS.' 
PDB 2CJX unspecified 'EXTENDED SUBSTRATE RECOGNITION IN CASPASE-3 REVEALED BY HIGH RESOLUTION X-RAY STRUCTURE ANALYSIS' 
PDB 2CJY unspecified 'EXTENDED SUBSTRATE RECOGNITION IN CASPASE-3 REVEALED BY HIGH RESOLUTION X-RAY STRUCTURE ANALYSIS' 
PDB 2CNK unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE EPOXIDE INHIBITORS.' 
PDB 2CNL unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE EPOXIDE INHIBITORS.' 
PDB 2CNN unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE EPOXIDE INHIBITORS.' 
PDB 2CNO unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE EPOXIDE INHIBITORS.' 
PDB 2J30 unspecified 'THE ROLE OF LOOP BUNDLE HYDROGEN BONDS IN THE MATURATION AND ACTIVITY OF (PRO) CASPASE-3' 
PDB 2J31 unspecified 'THE ROLE OF LOOP BUNDLE HYDROGEN BONDS IN THE MATURATION AND ACTIVITY OF(PRO)CASPASE -3' 
PDB 2J32 unspecified 'THE ROLE OF LOOP BUNDLE HYDROGEN BONDS IN THE MATURATION AND ACTIVITY OF(PRO)CASPASE -3' 
PDB 2J33 unspecified 'THE ROLE OF LOOP BUNDLE HYDROGEN BONDS IN THE MATURATION AND ACTIVITY OF (PRO) CASPASE-3' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2C2K 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-29 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ganesan, R.'     1  
'Jelakovic, S.'   2  
'Ekici, O.D.'     3  
'Li, Z.Z.'        4  
'James, K.E.'     5  
'Asgian, J.L.'    6  
'Campbell, A.J.'  7  
'Mikolajczyk, J.' 8  
'Salvesen, G.S.'  9  
'Gruetter, M.G.'  10 
'Powers, J.C.'    11 
# 
_citation.id                        primary 
_citation.title                     
;Design, Synthesis, and Evaluation of Aza-Peptide Michael Acceptors as Selective and Potent Inhibitors of Caspases-2, -3, -6, -7, -8, -9, and - 10.
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            49 
_citation.page_first                5728 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16970398 
_citation.pdbx_database_id_DOI      10.1021/JM0601405 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ekici, O.D.'     1  
primary 'Li, Z.Z.'        2  
primary 'Campbell, A.J.'  3  
primary 'James, K.E.'     4  
primary 'Asgian, J.L.'    5  
primary 'Mikolajczyk, J.' 6  
primary 'Salvesen, G.S.'  7  
primary 'Ganesan, R.'     8  
primary 'Jelakovic, S.'   9  
primary 'Grutter, M.G.'   10 
primary 'Powers, J.C.'    11 
# 
_cell.entry_id           2C2K 
_cell.length_a           67.471 
_cell.length_b           83.781 
_cell.length_c           96.251 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2C2K 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CASPASE-3 SUBUNIT P17' 16639.902 1   3.4.22.- ? 'ALPHA SUBUNIT, RESIDUES 29-175' ? 
2 polymer man 'CASPASE-3 SUBUNIT P12' 11981.682 1   3.4.22.- ? 'BETA SUBUNIT, RESIDUES 176-277' ? 
3 polymer syn 
;AZA-PEPTIDE INHIBITOR (5S, 8R, 11S)-8-(2-CARBOXYETHYL)-5-(CARBOXYMETHYL)-14-(4-ETHOXY-4-OXOBUTANOYL)-11-(1-METHYLETHYL)-3,6,9,12-TETRAOXO-1-PHENYL-2-OXA-4,7,10,13,14-PENTAAZAHEXADECAN -16-OIC ACID
;
714.117   1   ?        ? ?                                ? 
4 water   nat water 18.015    367 ?        ? ?                                ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
A ? 
2 'polypeptide(L)' no no  
;ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDA
TFHAKKQIPCIVSMLTKELYFYH
;
;ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDA
TFHAKKQIPCIVSMLTKELYFYH
;
B ? 
3 'polypeptide(L)' no yes '(PHQ)DEV(AA1)' XDEVX C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   ILE n 
1 4   SER n 
1 5   LEU n 
1 6   ASP n 
1 7   ASN n 
1 8   SER n 
1 9   TYR n 
1 10  LYS n 
1 11  MET n 
1 12  ASP n 
1 13  TYR n 
1 14  PRO n 
1 15  GLU n 
1 16  MET n 
1 17  GLY n 
1 18  LEU n 
1 19  CYS n 
1 20  ILE n 
1 21  ILE n 
1 22  ILE n 
1 23  ASN n 
1 24  ASN n 
1 25  LYS n 
1 26  ASN n 
1 27  PHE n 
1 28  HIS n 
1 29  LYS n 
1 30  SER n 
1 31  THR n 
1 32  GLY n 
1 33  MET n 
1 34  THR n 
1 35  SER n 
1 36  ARG n 
1 37  SER n 
1 38  GLY n 
1 39  THR n 
1 40  ASP n 
1 41  VAL n 
1 42  ASP n 
1 43  ALA n 
1 44  ALA n 
1 45  ASN n 
1 46  LEU n 
1 47  ARG n 
1 48  GLU n 
1 49  THR n 
1 50  PHE n 
1 51  ARG n 
1 52  ASN n 
1 53  LEU n 
1 54  LYS n 
1 55  TYR n 
1 56  GLU n 
1 57  VAL n 
1 58  ARG n 
1 59  ASN n 
1 60  LYS n 
1 61  ASN n 
1 62  ASP n 
1 63  LEU n 
1 64  THR n 
1 65  ARG n 
1 66  GLU n 
1 67  GLU n 
1 68  ILE n 
1 69  VAL n 
1 70  GLU n 
1 71  LEU n 
1 72  MET n 
1 73  ARG n 
1 74  ASP n 
1 75  VAL n 
1 76  SER n 
1 77  LYS n 
1 78  GLU n 
1 79  ASP n 
1 80  HIS n 
1 81  SER n 
1 82  LYS n 
1 83  ARG n 
1 84  SER n 
1 85  SER n 
1 86  PHE n 
1 87  VAL n 
1 88  CYS n 
1 89  VAL n 
1 90  LEU n 
1 91  LEU n 
1 92  SER n 
1 93  HIS n 
1 94  GLY n 
1 95  GLU n 
1 96  GLU n 
1 97  GLY n 
1 98  ILE n 
1 99  ILE n 
1 100 PHE n 
1 101 GLY n 
1 102 THR n 
1 103 ASN n 
1 104 GLY n 
1 105 PRO n 
1 106 VAL n 
1 107 ASP n 
1 108 LEU n 
1 109 LYS n 
1 110 LYS n 
1 111 ILE n 
1 112 THR n 
1 113 ASN n 
1 114 PHE n 
1 115 PHE n 
1 116 ARG n 
1 117 GLY n 
1 118 ASP n 
1 119 ARG n 
1 120 CYS n 
1 121 ARG n 
1 122 SER n 
1 123 LEU n 
1 124 THR n 
1 125 GLY n 
1 126 LYS n 
1 127 PRO n 
1 128 LYS n 
1 129 LEU n 
1 130 PHE n 
1 131 ILE n 
1 132 ILE n 
1 133 GLN n 
1 134 ALA n 
1 135 CYS n 
1 136 ARG n 
1 137 GLY n 
1 138 THR n 
1 139 GLU n 
1 140 LEU n 
1 141 ASP n 
1 142 CYS n 
1 143 GLY n 
1 144 ILE n 
1 145 GLU n 
1 146 THR n 
1 147 ASP n 
2 1   ALA n 
2 2   SER n 
2 3   GLY n 
2 4   VAL n 
2 5   ASP n 
2 6   ASP n 
2 7   ASP n 
2 8   MET n 
2 9   ALA n 
2 10  CYS n 
2 11  HIS n 
2 12  LYS n 
2 13  ILE n 
2 14  PRO n 
2 15  VAL n 
2 16  GLU n 
2 17  ALA n 
2 18  ASP n 
2 19  PHE n 
2 20  LEU n 
2 21  TYR n 
2 22  ALA n 
2 23  TYR n 
2 24  SER n 
2 25  THR n 
2 26  ALA n 
2 27  PRO n 
2 28  GLY n 
2 29  TYR n 
2 30  TYR n 
2 31  SER n 
2 32  TRP n 
2 33  ARG n 
2 34  ASN n 
2 35  SER n 
2 36  LYS n 
2 37  ASP n 
2 38  GLY n 
2 39  SER n 
2 40  TRP n 
2 41  PHE n 
2 42  ILE n 
2 43  GLN n 
2 44  SER n 
2 45  LEU n 
2 46  CYS n 
2 47  ALA n 
2 48  MET n 
2 49  LEU n 
2 50  LYS n 
2 51  GLN n 
2 52  TYR n 
2 53  ALA n 
2 54  ASP n 
2 55  LYS n 
2 56  LEU n 
2 57  GLU n 
2 58  PHE n 
2 59  MET n 
2 60  HIS n 
2 61  ILE n 
2 62  LEU n 
2 63  THR n 
2 64  ARG n 
2 65  VAL n 
2 66  ASN n 
2 67  ARG n 
2 68  LYS n 
2 69  VAL n 
2 70  ALA n 
2 71  THR n 
2 72  GLU n 
2 73  PHE n 
2 74  GLU n 
2 75  SER n 
2 76  PHE n 
2 77  SER n 
2 78  PHE n 
2 79  ASP n 
2 80  ALA n 
2 81  THR n 
2 82  PHE n 
2 83  HIS n 
2 84  ALA n 
2 85  LYS n 
2 86  LYS n 
2 87  GLN n 
2 88  ILE n 
2 89  PRO n 
2 90  CYS n 
2 91  ILE n 
2 92  VAL n 
2 93  SER n 
2 94  MET n 
2 95  LEU n 
2 96  THR n 
2 97  LYS n 
2 98  GLU n 
2 99  LEU n 
2 100 TYR n 
2 101 PHE n 
2 102 TYR n 
2 103 HIS n 
3 1   PHQ n 
3 2   ASP n 
3 3   GLU n 
3 4   VAL n 
3 5   AA1 n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? 
? ? ? ? PLASMID PET11D ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562    ? ? ? ? ? ? ?           ? ? ? 
? ? ? ? ?       ?      ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'SYNTHETIC CONSTRUCT' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CASP3_HUMAN 1 ? ? P42574 ? 
2 PDB 2C2K        2 ? ? 2C2K   ? 
3 UNP CASP3_HUMAN 2 ? ? P42574 ? 
4 PDB 2C2K        3 ? ? 2C2K   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2C2K A 1 ? 147 ? P42574 29  ? 175 ? 29  175 
2 2 2C2K B 1 ? 1   ? 2C2K   175 ? 175 ? 175 175 
3 3 2C2K B 2 ? 103 ? P42574 176 ? 277 ? 176 277 
4 4 2C2K C 1 ? 5   ? 2C2K   1   ? 5   ? 1   5   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AA1 non-polymer         . '[1-(4-ETHOXY-4-OXOBUTANOYL)HYDRAZINO]ACETIC ACID' ? 'C8 H14 N2 O5'   218.207 
ALA 'L-peptide linking' y ALANINE                                            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                      ? 'C9 H11 N O2'    165.189 
PHQ non-polymer         . 'benzyl chlorocarbonate'                           ? 'C8 H7 Cl O2'    170.593 
PRO 'L-peptide linking' y PROLINE                                            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2C2K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.32 
_exptl_crystal.density_percent_sol   47.00 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.75 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PEG6000, 100 MM SODIUM CITRATE PH 4.75' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2004-12-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ENRAF-NONIUS FR591' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2C2K 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            1.860 
_reflns.number_obs                   22830 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.8 
_reflns.pdbx_Rmerge_I_obs            0.08000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.3000 
_reflns.B_iso_Wilson_estimate        13.10 
_reflns.pdbx_redundancy              5.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.86 
_reflns_shell.d_res_low              1.95 
_reflns_shell.percent_possible_all   84.1 
_reflns_shell.Rmerge_I_obs           0.44000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.500 
_reflns_shell.pdbx_redundancy        4.70 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2C2K 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     22827 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               1852929.470 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.80 
_refine.ls_d_res_high                            1.87 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.185 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.185 
_refine.ls_R_factor_R_free                       0.220 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.900 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               18.80 
_refine.aniso_B[1][1]                            4.19000 
_refine.aniso_B[2][2]                            -1.53000 
_refine.aniso_B[3][3]                            -2.66000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.35 
_refine.solvent_model_param_bsol                 68.37 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'MISSING RESIDUE CHAIN A, ASP 175 CLONING ARTIFACT ADDITIONAL AMINO ACID CHAIN B, ALA 175' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2C2K 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.21 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.23 
_refine_analyze.Luzzati_sigma_a_free            0.21 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2045 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             367 
_refine_hist.number_atoms_total               2412 
_refine_hist.d_res_high                       1.87 
_refine_hist.d_res_low                        19.80 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.20  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.00 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.64  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.190 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.700 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.190 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.130 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.76 
_refine_ls_shell.d_res_low                        1.87 
_refine_ls_shell.number_reflns_R_work             0 
_refine_ls_shell.R_factor_R_work                  0.2200 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 
'X-RAY DIFFRACTION' 2 WATER.PARAM       ?           
# 
_struct.entry_id                  2C2K 
_struct.title                     'Crystal structures of caspase-3 in complex with aza-peptide Michael acceptor inhibitors.' 
_struct.pdbx_descriptor           
;CASPASE-3 SUBUNIT P17 (E.C.3.4.22.-), CASPASE-3 SUBUNIT P12 (E.C.3.4.22.-), AZA-PEPTIDE INHIBITOR (5S, 8R, 11S)-8-(2-CARBOXYETHYL)-5-(CARBOXYMETHYL)-14-(4-ETHOXY-4-OXOBUTANOYL)-11-(1-METHYLETHYL)-3,6,9,12-TETRAOXO-1-PHENYL-2-OXA-4,7,10,13,14-PENTAAZAHEXADECAN -16-OIC ACID
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2C2K 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
;APOPTOSIS, HYDROLASE-HYDROLASE INHIBITOR COMPLEX, CYSTEINE-PROTEASE, ICE, TETRAMER, THIOL PROTEASE, ZYMOGEN, CPP32, YAMA, AZA-PEPTIDE, MICHAEL ACCEPTOR, AZA-ASP, CLAN CD
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS A 28  ? GLY A 32  ? HIS A 56  GLY A 60  5 ? 5  
HELX_P HELX_P2 2 GLY A 38  ? ASN A 52  ? GLY A 66  ASN A 80  1 ? 15 
HELX_P HELX_P3 3 THR A 64  ? LYS A 77  ? THR A 92  LYS A 105 1 ? 14 
HELX_P HELX_P4 4 LEU A 108 ? PHE A 114 ? LEU A 136 PHE A 142 1 ? 7  
HELX_P HELX_P5 5 CYS A 120 ? THR A 124 ? CYS A 148 THR A 152 5 ? 5  
HELX_P HELX_P6 6 TRP B 40  ? ALA B 53  ? TRP B 214 ALA B 227 1 ? 14 
HELX_P HELX_P7 7 GLU B 57  ? PHE B 73  ? GLU B 231 PHE B 247 1 ? 17 
HELX_P HELX_P8 8 ASP B 79  ? HIS B 83  ? ASP B 253 HIS B 257 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C PHQ 1   C1 ? ? ? 1_555 C ASP 2 N   ? ? C PHQ 1   C ASP 2 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale2 covale ? ? C VAL 4   C  ? ? ? 1_555 C AA1 5 N3  ? ? C VAL 4   C AA1 5 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale3 covale ? ? A CYS 135 SG ? ? ? 1_555 C AA1 5 C11 ? ? A CYS 163 C AA1 5 1_555 ? ? ? ? ? ? ? 1.850 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 3 ? 
BA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLU A 56  ? ASN A 61  ? GLU A 84  ASN A 89  
AA 2 GLU A 15  ? ASN A 23  ? GLU A 43  ASN A 51  
AA 3 ARG A 83  ? LEU A 91  ? ARG A 111 LEU A 119 
AA 4 LYS A 128 ? GLN A 133 ? LYS A 156 GLN A 161 
AA 5 PHE B 19  ? TYR B 23  ? PHE B 193 TYR B 197 
AA 6 CYS B 90  ? SER B 93  ? CYS B 264 SER B 267 
AB 1 GLY A 94  ? GLU A 95  ? GLY A 122 GLU A 123 
AB 2 ILE A 98  ? GLY A 101 ? ILE A 126 GLY A 129 
AB 3 GLY A 104 ? ASP A 107 ? GLY A 132 ASP A 135 
BA 1 ARG B 33  ? ASN B 34  ? ARG B 207 ASN B 208 
BA 2 GLY B 38  ? SER B 39  ? GLY B 212 SER B 213 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 56  ? N GLU A 84  O GLY A 17  ? O GLY A 45  
AA 2 3 O GLU A 15  ? O GLU A 43  N SER A 84  ? N SER A 112 
AA 3 4 N CYS A 88  ? N CYS A 116 O LEU A 129 ? O LEU A 157 
AA 4 5 N PHE A 130 ? N PHE A 158 O LEU B 20  ? O LEU B 194 
AA 5 6 N TYR B 23  ? N TYR B 197 O CYS B 90  ? O CYS B 264 
AB 1 2 N GLU A 95  ? N GLU A 123 O ILE A 98  ? O ILE A 126 
AB 2 3 N GLY A 101 ? N GLY A 129 O GLY A 104 ? O GLY A 132 
BA 1 2 N ASN B 34  ? N ASN B 208 O GLY B 38  ? O GLY B 212 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    24 
_struct_site.details              
;BINDING SITE FOR CHAIN C OF 12-TETRAOXO-1-PHENYL- (5S,8R,11S)-8-(2-CARBOXYETHYL)-5- (CARBOXYMETHYL)-14-(4-ETHOXY-4-OXOBUTANOYL)-11 ETHOXY-4-OXOBUTANOYL)-11 12-TETRAOXO-1-PHENYL- ACID
;
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 24 MET A 33  ? MET A 61   . ? 1_555 ? 
2  AC1 24 ARG A 36  ? ARG A 64   . ? 1_555 ? 
3  AC1 24 SER A 37  ? SER A 65   . ? 1_555 ? 
4  AC1 24 GLU A 56  ? GLU A 84   . ? 8_555 ? 
5  AC1 24 HIS A 93  ? HIS A 121  . ? 1_555 ? 
6  AC1 24 GLY A 94  ? GLY A 122  . ? 1_555 ? 
7  AC1 24 GLN A 133 ? GLN A 161  . ? 1_555 ? 
8  AC1 24 ALA A 134 ? ALA A 162  . ? 1_555 ? 
9  AC1 24 CYS A 135 ? CYS A 163  . ? 1_555 ? 
10 AC1 24 HOH D .   ? HOH A 2061 . ? 2_665 ? 
11 AC1 24 ASP B 5   ? ASP B 179  . ? 3_656 ? 
12 AC1 24 TYR B 30  ? TYR B 204  . ? 1_555 ? 
13 AC1 24 SER B 31  ? SER B 205  . ? 1_555 ? 
14 AC1 24 TRP B 32  ? TRP B 206  . ? 1_555 ? 
15 AC1 24 ARG B 33  ? ARG B 207  . ? 1_555 ? 
16 AC1 24 ASN B 34  ? ASN B 208  . ? 1_555 ? 
17 AC1 24 SER B 35  ? SER B 209  . ? 1_555 ? 
18 AC1 24 SER B 75  ? SER B 249  . ? 1_555 ? 
19 AC1 24 PHE B 76  ? PHE B 250  . ? 1_555 ? 
20 AC1 24 PHE B 78  ? PHE B 252  . ? 1_555 ? 
21 AC1 24 HOH F .   ? HOH C 2238 . ? 1_555 ? 
22 AC1 24 HOH F .   ? HOH C 2239 . ? 1_555 ? 
23 AC1 24 HOH F .   ? HOH C 2240 . ? 1_555 ? 
24 AC1 24 HOH F .   ? HOH C 2242 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2C2K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2C2K 
_atom_sites.fract_transf_matrix[1][1]   0.014821 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011936 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010390 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 12.561 -5.109 59.677 1.00 31.89 ? 29   SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 13.603 -5.549 58.704 1.00 30.44 ? 29   SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 14.990 -5.492 59.331 1.00 28.98 ? 29   SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 15.131 -5.255 60.531 1.00 28.84 ? 29   SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 13.562 -4.663 57.454 1.00 31.78 ? 29   SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 13.758 -3.300 57.792 1.00 35.70 ? 29   SER A OG  1 
ATOM   7    N N   . GLY A 1 2   ? 16.014 -5.709 58.511 1.00 27.27 ? 30   GLY A N   1 
ATOM   8    C CA  . GLY A 1 2   ? 17.378 -5.680 59.005 1.00 24.46 ? 30   GLY A CA  1 
ATOM   9    C C   . GLY A 1 2   ? 17.895 -4.277 59.252 1.00 24.23 ? 30   GLY A C   1 
ATOM   10   O O   . GLY A 1 2   ? 17.168 -3.298 59.093 1.00 23.10 ? 30   GLY A O   1 
ATOM   11   N N   . ILE A 1 3   ? 19.162 -4.182 59.639 1.00 23.49 ? 31   ILE A N   1 
ATOM   12   C CA  . ILE A 1 3   ? 19.794 -2.898 59.920 1.00 24.47 ? 31   ILE A CA  1 
ATOM   13   C C   . ILE A 1 3   ? 19.730 -1.957 58.716 1.00 24.76 ? 31   ILE A C   1 
ATOM   14   O O   . ILE A 1 3   ? 20.071 -2.343 57.597 1.00 23.18 ? 31   ILE A O   1 
ATOM   15   C CB  . ILE A 1 3   ? 21.278 -3.094 60.315 1.00 25.54 ? 31   ILE A CB  1 
ATOM   16   C CG1 . ILE A 1 3   ? 21.381 -4.067 61.496 1.00 27.09 ? 31   ILE A CG1 1 
ATOM   17   C CG2 . ILE A 1 3   ? 21.909 -1.758 60.666 1.00 25.68 ? 31   ILE A CG2 1 
ATOM   18   C CD1 . ILE A 1 3   ? 20.659 -3.608 62.754 1.00 30.36 ? 31   ILE A CD1 1 
ATOM   19   N N   . SER A 1 4   ? 19.286 -0.725 58.957 1.00 24.03 ? 32   SER A N   1 
ATOM   20   C CA  . SER A 1 4   ? 19.186 0.295  57.911 1.00 24.96 ? 32   SER A CA  1 
ATOM   21   C C   . SER A 1 4   ? 20.202 1.387  58.252 1.00 25.73 ? 32   SER A C   1 
ATOM   22   O O   . SER A 1 4   ? 20.236 1.868  59.386 1.00 23.64 ? 32   SER A O   1 
ATOM   23   C CB  . SER A 1 4   ? 17.770 0.880  57.882 1.00 25.62 ? 32   SER A CB  1 
ATOM   24   O OG  . SER A 1 4   ? 17.616 1.805  56.820 1.00 27.37 ? 32   SER A OG  1 
ATOM   25   N N   . LEU A 1 5   ? 21.024 1.781  57.280 1.00 24.94 ? 33   LEU A N   1 
ATOM   26   C CA  . LEU A 1 5   ? 22.051 2.792  57.532 1.00 25.97 ? 33   LEU A CA  1 
ATOM   27   C C   . LEU A 1 5   ? 21.800 4.212  57.008 1.00 27.16 ? 33   LEU A C   1 
ATOM   28   O O   . LEU A 1 5   ? 22.260 5.180  57.616 1.00 27.72 ? 33   LEU A O   1 
ATOM   29   C CB  . LEU A 1 5   ? 23.402 2.291  57.013 1.00 25.21 ? 33   LEU A CB  1 
ATOM   30   C CG  . LEU A 1 5   ? 23.918 0.993  57.644 1.00 26.32 ? 33   LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 5   ? 25.302 0.682  57.100 1.00 24.96 ? 33   LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 5   ? 23.964 1.134  59.165 1.00 26.76 ? 33   LEU A CD2 1 
ATOM   33   N N   . ASP A 1 6   ? 21.093 4.341  55.889 1.00 27.01 ? 34   ASP A N   1 
ATOM   34   C CA  . ASP A 1 6   ? 20.800 5.656  55.312 1.00 27.02 ? 34   ASP A CA  1 
ATOM   35   C C   . ASP A 1 6   ? 22.047 6.487  55.005 1.00 24.20 ? 34   ASP A C   1 
ATOM   36   O O   . ASP A 1 6   ? 22.091 7.682  55.298 1.00 23.64 ? 34   ASP A O   1 
ATOM   37   C CB  . ASP A 1 6   ? 19.899 6.460  56.254 1.00 31.17 ? 34   ASP A CB  1 
ATOM   38   C CG  . ASP A 1 6   ? 18.546 5.818  56.450 1.00 35.72 ? 34   ASP A CG  1 
ATOM   39   O OD1 . ASP A 1 6   ? 17.800 5.692  55.456 1.00 39.10 ? 34   ASP A OD1 1 
ATOM   40   O OD2 . ASP A 1 6   ? 18.229 5.438  57.599 1.00 39.25 ? 34   ASP A OD2 1 
ATOM   41   N N   . ASN A 1 7   ? 23.058 5.867  54.412 1.00 20.90 ? 35   ASN A N   1 
ATOM   42   C CA  . ASN A 1 7   ? 24.277 6.600  54.097 1.00 18.41 ? 35   ASN A CA  1 
ATOM   43   C C   . ASN A 1 7   ? 24.259 7.229  52.706 1.00 15.63 ? 35   ASN A C   1 
ATOM   44   O O   . ASN A 1 7   ? 25.115 8.052  52.387 1.00 12.42 ? 35   ASN A O   1 
ATOM   45   C CB  . ASN A 1 7   ? 25.495 5.686  54.240 1.00 21.32 ? 35   ASN A CB  1 
ATOM   46   C CG  . ASN A 1 7   ? 25.692 5.205  55.665 1.00 25.04 ? 35   ASN A CG  1 
ATOM   47   O OD1 . ASN A 1 7   ? 25.712 6.006  56.604 1.00 25.34 ? 35   ASN A OD1 1 
ATOM   48   N ND2 . ASN A 1 7   ? 25.838 3.896  55.836 1.00 25.17 ? 35   ASN A ND2 1 
ATOM   49   N N   . SER A 1 8   ? 23.288 6.847  51.881 1.00 13.74 ? 36   SER A N   1 
ATOM   50   C CA  . SER A 1 8   ? 23.198 7.401  50.530 1.00 12.85 ? 36   SER A CA  1 
ATOM   51   C C   . SER A 1 8   ? 21.790 7.889  50.194 1.00 12.14 ? 36   SER A C   1 
ATOM   52   O O   . SER A 1 8   ? 20.798 7.320  50.645 1.00 12.94 ? 36   SER A O   1 
ATOM   53   C CB  . SER A 1 8   ? 23.636 6.355  49.503 1.00 14.54 ? 36   SER A CB  1 
ATOM   54   O OG  . SER A 1 8   ? 22.745 5.258  49.490 1.00 20.91 ? 36   SER A OG  1 
ATOM   55   N N   . TYR A 1 9   ? 21.708 8.945  49.393 1.00 11.36 ? 37   TYR A N   1 
ATOM   56   C CA  . TYR A 1 9   ? 20.418 9.502  49.003 1.00 10.31 ? 37   TYR A CA  1 
ATOM   57   C C   . TYR A 1 9   ? 19.534 8.479  48.303 1.00 10.87 ? 37   TYR A C   1 
ATOM   58   O O   . TYR A 1 9   ? 20.023 7.614  47.573 1.00 12.47 ? 37   TYR A O   1 
ATOM   59   C CB  . TYR A 1 9   ? 20.617 10.691 48.066 1.00 10.16 ? 37   TYR A CB  1 
ATOM   60   C CG  . TYR A 1 9   ? 21.153 11.935 48.734 1.00 9.74  ? 37   TYR A CG  1 
ATOM   61   C CD1 . TYR A 1 9   ? 20.373 12.655 49.641 1.00 9.29  ? 37   TYR A CD1 1 
ATOM   62   C CD2 . TYR A 1 9   ? 22.424 12.418 48.426 1.00 9.45  ? 37   TYR A CD2 1 
ATOM   63   C CE1 . TYR A 1 9   ? 20.848 13.835 50.220 1.00 9.83  ? 37   TYR A CE1 1 
ATOM   64   C CE2 . TYR A 1 9   ? 22.908 13.598 49.001 1.00 9.89  ? 37   TYR A CE2 1 
ATOM   65   C CZ  . TYR A 1 9   ? 22.115 14.298 49.892 1.00 9.76  ? 37   TYR A CZ  1 
ATOM   66   O OH  . TYR A 1 9   ? 22.580 15.471 50.440 1.00 9.19  ? 37   TYR A OH  1 
ATOM   67   N N   . LYS A 1 10  ? 18.229 8.584  48.533 1.00 11.94 ? 38   LYS A N   1 
ATOM   68   C CA  . LYS A 1 10  ? 17.263 7.695  47.896 1.00 13.27 ? 38   LYS A CA  1 
ATOM   69   C C   . LYS A 1 10  ? 17.167 8.170  46.448 1.00 12.92 ? 38   LYS A C   1 
ATOM   70   O O   . LYS A 1 10  ? 16.621 9.238  46.174 1.00 13.16 ? 38   LYS A O   1 
ATOM   71   C CB  . LYS A 1 10  ? 15.899 7.816  48.588 1.00 13.54 ? 38   LYS A CB  1 
ATOM   72   C CG  . LYS A 1 10  ? 14.758 7.058  47.911 1.00 17.18 ? 38   LYS A CG  1 
ATOM   73   C CD  . LYS A 1 10  ? 13.450 7.231  48.693 1.00 17.03 ? 38   LYS A CD  1 
ATOM   74   C CE  . LYS A 1 10  ? 12.243 6.721  47.918 1.00 18.02 ? 38   LYS A CE  1 
ATOM   75   N NZ  . LYS A 1 10  ? 12.328 5.262  47.619 1.00 21.25 ? 38   LYS A NZ  1 
ATOM   76   N N   . MET A 1 11  ? 17.714 7.386  45.526 1.00 13.58 ? 39   MET A N   1 
ATOM   77   C CA  . MET A 1 11  ? 17.694 7.761  44.117 1.00 13.58 ? 39   MET A CA  1 
ATOM   78   C C   . MET A 1 11  ? 16.799 6.864  43.275 1.00 15.76 ? 39   MET A C   1 
ATOM   79   O O   . MET A 1 11  ? 16.943 6.804  42.052 1.00 17.07 ? 39   MET A O   1 
ATOM   80   C CB  . MET A 1 11  ? 19.119 7.751  43.554 1.00 13.58 ? 39   MET A CB  1 
ATOM   81   C CG  . MET A 1 11  ? 20.039 8.796  44.175 1.00 11.98 ? 39   MET A CG  1 
ATOM   82   S SD  . MET A 1 11  ? 19.491 10.491 43.866 1.00 13.86 ? 39   MET A SD  1 
ATOM   83   C CE  . MET A 1 11  ? 20.110 10.745 42.183 1.00 12.60 ? 39   MET A CE  1 
ATOM   84   N N   . ASP A 1 12  ? 15.863 6.176  43.924 1.00 17.11 ? 40   ASP A N   1 
ATOM   85   C CA  . ASP A 1 12  ? 14.965 5.295  43.195 1.00 18.08 ? 40   ASP A CA  1 
ATOM   86   C C   . ASP A 1 12  ? 13.523 5.789  43.123 1.00 17.59 ? 40   ASP A C   1 
ATOM   87   O O   . ASP A 1 12  ? 12.590 4.985  43.053 1.00 18.03 ? 40   ASP A O   1 
ATOM   88   C CB  . ASP A 1 12  ? 15.003 3.874  43.773 1.00 19.74 ? 40   ASP A CB  1 
ATOM   89   C CG  . ASP A 1 12  ? 14.458 3.796  45.181 1.00 21.71 ? 40   ASP A CG  1 
ATOM   90   O OD1 . ASP A 1 12  ? 14.320 2.664  45.692 1.00 25.47 ? 40   ASP A OD1 1 
ATOM   91   O OD2 . ASP A 1 12  ? 14.171 4.854  45.777 1.00 22.46 ? 40   ASP A OD2 1 
ATOM   92   N N   . TYR A 1 13  ? 13.335 7.106  43.157 1.00 15.06 ? 41   TYR A N   1 
ATOM   93   C CA  . TYR A 1 13  ? 11.993 7.663  43.020 1.00 13.77 ? 41   TYR A CA  1 
ATOM   94   C C   . TYR A 1 13  ? 11.618 7.384  41.563 1.00 12.21 ? 41   TYR A C   1 
ATOM   95   O O   . TYR A 1 13  ? 12.471 6.996  40.769 1.00 13.32 ? 41   TYR A O   1 
ATOM   96   C CB  . TYR A 1 13  ? 11.986 9.178  43.258 1.00 13.93 ? 41   TYR A CB  1 
ATOM   97   C CG  . TYR A 1 13  ? 11.977 9.601  44.710 1.00 12.39 ? 41   TYR A CG  1 
ATOM   98   C CD1 . TYR A 1 13  ? 13.163 9.730  45.434 1.00 12.33 ? 41   TYR A CD1 1 
ATOM   99   C CD2 . TYR A 1 13  ? 10.778 9.895  45.354 1.00 13.23 ? 41   TYR A CD2 1 
ATOM   100  C CE1 . TYR A 1 13  ? 13.151 10.144 46.764 1.00 11.49 ? 41   TYR A CE1 1 
ATOM   101  C CE2 . TYR A 1 13  ? 10.752 10.306 46.681 1.00 12.64 ? 41   TYR A CE2 1 
ATOM   102  C CZ  . TYR A 1 13  ? 11.939 10.429 47.380 1.00 11.39 ? 41   TYR A CZ  1 
ATOM   103  O OH  . TYR A 1 13  ? 11.907 10.828 48.692 1.00 13.45 ? 41   TYR A OH  1 
ATOM   104  N N   . PRO A 1 14  ? 10.340 7.570  41.194 1.00 11.88 ? 42   PRO A N   1 
ATOM   105  C CA  . PRO A 1 14  ? 9.906  7.323  39.814 1.00 13.84 ? 42   PRO A CA  1 
ATOM   106  C C   . PRO A 1 14  ? 10.750 8.055  38.764 1.00 14.41 ? 42   PRO A C   1 
ATOM   107  O O   . PRO A 1 14  ? 11.033 7.512  37.695 1.00 15.78 ? 42   PRO A O   1 
ATOM   108  C CB  . PRO A 1 14  ? 8.455  7.792  39.827 1.00 13.79 ? 42   PRO A CB  1 
ATOM   109  C CG  . PRO A 1 14  ? 8.014  7.421  41.215 1.00 13.96 ? 42   PRO A CG  1 
ATOM   110  C CD  . PRO A 1 14  ? 9.187  7.889  42.056 1.00 12.70 ? 42   PRO A CD  1 
ATOM   111  N N   . GLU A 1 15  ? 11.152 9.283  39.079 1.00 14.53 ? 43   GLU A N   1 
ATOM   112  C CA  . GLU A 1 15  ? 11.965 10.091 38.173 1.00 14.06 ? 43   GLU A CA  1 
ATOM   113  C C   . GLU A 1 15  ? 13.280 10.511 38.826 1.00 12.59 ? 43   GLU A C   1 
ATOM   114  O O   . GLU A 1 15  ? 13.318 10.809 40.018 1.00 11.23 ? 43   GLU A O   1 
ATOM   115  C CB  . GLU A 1 15  ? 11.208 11.358 37.777 1.00 16.05 ? 43   GLU A CB  1 
ATOM   116  C CG  . GLU A 1 15  ? 9.865  11.134 37.110 1.00 21.07 ? 43   GLU A CG  1 
ATOM   117  C CD  . GLU A 1 15  ? 9.054  12.412 37.043 1.00 25.43 ? 43   GLU A CD  1 
ATOM   118  O OE1 . GLU A 1 15  ? 9.619  13.451 36.637 1.00 27.10 ? 43   GLU A OE1 1 
ATOM   119  O OE2 . GLU A 1 15  ? 7.856  12.382 37.395 1.00 28.74 ? 43   GLU A OE2 1 
ATOM   120  N N   . MET A 1 16  ? 14.356 10.539 38.045 1.00 12.35 ? 44   MET A N   1 
ATOM   121  C CA  . MET A 1 16  ? 15.646 10.971 38.571 1.00 11.28 ? 44   MET A CA  1 
ATOM   122  C C   . MET A 1 16  ? 15.538 12.458 38.887 1.00 12.43 ? 44   MET A C   1 
ATOM   123  O O   . MET A 1 16  ? 16.106 12.942 39.866 1.00 11.16 ? 44   MET A O   1 
ATOM   124  C CB  . MET A 1 16  ? 16.757 10.731 37.542 1.00 11.94 ? 44   MET A CB  1 
ATOM   125  C CG  . MET A 1 16  ? 17.268 9.294  37.507 1.00 12.76 ? 44   MET A CG  1 
ATOM   126  S SD  . MET A 1 16  ? 18.106 8.824  39.049 1.00 12.53 ? 44   MET A SD  1 
ATOM   127  C CE  . MET A 1 16  ? 19.777 9.398  38.730 1.00 15.99 ? 44   MET A CE  1 
ATOM   128  N N   . GLY A 1 17  ? 14.796 13.179 38.051 1.00 11.25 ? 45   GLY A N   1 
ATOM   129  C CA  . GLY A 1 17  ? 14.620 14.602 38.269 1.00 10.15 ? 45   GLY A CA  1 
ATOM   130  C C   . GLY A 1 17  ? 14.939 15.426 37.041 1.00 11.09 ? 45   GLY A C   1 
ATOM   131  O O   . GLY A 1 17  ? 15.228 14.889 35.975 1.00 11.31 ? 45   GLY A O   1 
ATOM   132  N N   . LEU A 1 18  ? 14.903 16.743 37.195 1.00 11.64 ? 46   LEU A N   1 
ATOM   133  C CA  . LEU A 1 18  ? 15.190 17.635 36.086 1.00 12.36 ? 46   LEU A CA  1 
ATOM   134  C C   . LEU A 1 18  ? 16.668 17.994 35.986 1.00 12.27 ? 46   LEU A C   1 
ATOM   135  O O   . LEU A 1 18  ? 17.390 18.000 36.982 1.00 11.58 ? 46   LEU A O   1 
ATOM   136  C CB  . LEU A 1 18  ? 14.400 18.935 36.238 1.00 12.88 ? 46   LEU A CB  1 
ATOM   137  C CG  . LEU A 1 18  ? 12.895 18.858 36.466 1.00 11.97 ? 46   LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 18  ? 12.343 20.276 36.600 1.00 12.78 ? 46   LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 18  ? 12.230 18.117 35.309 1.00 11.40 ? 46   LEU A CD2 1 
ATOM   140  N N   . CYS A 1 19  ? 17.101 18.275 34.762 1.00 11.23 ? 47   CYS A N   1 
ATOM   141  C CA  . CYS A 1 19  ? 18.457 18.723 34.490 1.00 10.23 ? 47   CYS A CA  1 
ATOM   142  C C   . CYS A 1 19  ? 18.247 19.940 33.606 1.00 10.96 ? 47   CYS A C   1 
ATOM   143  O O   . CYS A 1 19  ? 18.041 19.812 32.394 1.00 10.89 ? 47   CYS A O   1 
ATOM   144  C CB  . CYS A 1 19  ? 19.281 17.688 33.724 1.00 9.61  ? 47   CYS A CB  1 
ATOM   145  S SG  . CYS A 1 19  ? 20.906 18.351 33.214 1.00 12.47 ? 47   CYS A SG  1 
ATOM   146  N N   . ILE A 1 20  ? 18.271 21.115 34.222 1.00 9.49  ? 48   ILE A N   1 
ATOM   147  C CA  . ILE A 1 20  ? 18.079 22.364 33.496 1.00 11.82 ? 48   ILE A CA  1 
ATOM   148  C C   . ILE A 1 20  ? 19.416 22.903 33.018 1.00 11.65 ? 48   ILE A C   1 
ATOM   149  O O   . ILE A 1 20  ? 20.311 23.164 33.823 1.00 11.41 ? 48   ILE A O   1 
ATOM   150  C CB  . ILE A 1 20  ? 17.418 23.415 34.391 1.00 12.10 ? 48   ILE A CB  1 
ATOM   151  C CG1 . ILE A 1 20  ? 16.104 22.862 34.933 1.00 15.78 ? 48   ILE A CG1 1 
ATOM   152  C CG2 . ILE A 1 20  ? 17.162 24.695 33.609 1.00 12.01 ? 48   ILE A CG2 1 
ATOM   153  C CD1 . ILE A 1 20  ? 15.456 23.781 35.919 1.00 23.07 ? 48   ILE A CD1 1 
ATOM   154  N N   . ILE A 1 21  ? 19.548 23.067 31.707 1.00 10.12 ? 49   ILE A N   1 
ATOM   155  C CA  . ILE A 1 21  ? 20.782 23.576 31.131 1.00 9.81  ? 49   ILE A CA  1 
ATOM   156  C C   . ILE A 1 21  ? 20.571 24.963 30.535 1.00 10.15 ? 49   ILE A C   1 
ATOM   157  O O   . ILE A 1 21  ? 19.760 25.143 29.625 1.00 10.71 ? 49   ILE A O   1 
ATOM   158  C CB  . ILE A 1 21  ? 21.315 22.640 30.023 1.00 9.83  ? 49   ILE A CB  1 
ATOM   159  C CG1 . ILE A 1 21  ? 21.589 21.250 30.602 1.00 10.42 ? 49   ILE A CG1 1 
ATOM   160  C CG2 . ILE A 1 21  ? 22.584 23.226 29.411 1.00 8.89  ? 49   ILE A CG2 1 
ATOM   161  C CD1 . ILE A 1 21  ? 22.039 20.219 29.568 1.00 9.92  ? 49   ILE A CD1 1 
ATOM   162  N N   . ILE A 1 22  ? 21.286 25.945 31.070 1.00 8.89  ? 50   ILE A N   1 
ATOM   163  C CA  . ILE A 1 22  ? 21.191 27.307 30.567 1.00 9.93  ? 50   ILE A CA  1 
ATOM   164  C C   . ILE A 1 22  ? 22.474 27.565 29.790 1.00 10.77 ? 50   ILE A C   1 
ATOM   165  O O   . ILE A 1 22  ? 23.560 27.675 30.361 1.00 10.51 ? 50   ILE A O   1 
ATOM   166  C CB  . ILE A 1 22  ? 21.026 28.324 31.713 1.00 8.33  ? 50   ILE A CB  1 
ATOM   167  C CG1 . ILE A 1 22  ? 19.704 28.047 32.441 1.00 10.75 ? 50   ILE A CG1 1 
ATOM   168  C CG2 . ILE A 1 22  ? 21.041 29.748 31.157 1.00 11.28 ? 50   ILE A CG2 1 
ATOM   169  C CD1 . ILE A 1 22  ? 19.394 29.005 33.576 1.00 11.89 ? 50   ILE A CD1 1 
ATOM   170  N N   . ASN A 1 23  ? 22.324 27.644 28.473 1.00 10.79 ? 51   ASN A N   1 
ATOM   171  C CA  . ASN A 1 23  ? 23.441 27.839 27.562 1.00 12.57 ? 51   ASN A CA  1 
ATOM   172  C C   . ASN A 1 23  ? 23.479 29.246 26.969 1.00 12.82 ? 51   ASN A C   1 
ATOM   173  O O   . ASN A 1 23  ? 22.741 29.553 26.032 1.00 11.78 ? 51   ASN A O   1 
ATOM   174  C CB  . ASN A 1 23  ? 23.345 26.791 26.449 1.00 10.87 ? 51   ASN A CB  1 
ATOM   175  C CG  . ASN A 1 23  ? 24.472 26.893 25.443 1.00 14.31 ? 51   ASN A CG  1 
ATOM   176  O OD1 . ASN A 1 23  ? 25.638 27.006 25.811 1.00 16.00 ? 51   ASN A OD1 1 
ATOM   177  N ND2 . ASN A 1 23  ? 24.127 26.834 24.160 1.00 14.10 ? 51   ASN A ND2 1 
ATOM   178  N N   . ASN A 1 24  ? 24.338 30.098 27.521 1.00 11.42 ? 52   ASN A N   1 
ATOM   179  C CA  . ASN A 1 24  ? 24.466 31.460 27.020 1.00 13.68 ? 52   ASN A CA  1 
ATOM   180  C C   . ASN A 1 24  ? 25.690 31.614 26.126 1.00 14.78 ? 52   ASN A C   1 
ATOM   181  O O   . ASN A 1 24  ? 26.831 31.640 26.595 1.00 13.38 ? 52   ASN A O   1 
ATOM   182  C CB  . ASN A 1 24  ? 24.519 32.456 28.178 1.00 12.64 ? 52   ASN A CB  1 
ATOM   183  C CG  . ASN A 1 24  ? 23.145 32.726 28.770 1.00 12.59 ? 52   ASN A CG  1 
ATOM   184  O OD1 . ASN A 1 24  ? 22.131 32.264 28.246 1.00 12.44 ? 52   ASN A OD1 1 
ATOM   185  N ND2 . ASN A 1 24  ? 23.106 33.484 29.860 1.00 16.10 ? 52   ASN A ND2 1 
ATOM   186  N N   . LYS A 1 25  ? 25.430 31.726 24.827 1.00 15.80 ? 53   LYS A N   1 
ATOM   187  C CA  . LYS A 1 25  ? 26.484 31.855 23.828 1.00 15.94 ? 53   LYS A CA  1 
ATOM   188  C C   . LYS A 1 25  ? 26.618 33.282 23.303 1.00 17.18 ? 53   LYS A C   1 
ATOM   189  O O   . LYS A 1 25  ? 27.725 33.807 23.183 1.00 16.77 ? 53   LYS A O   1 
ATOM   190  C CB  . LYS A 1 25  ? 26.196 30.909 22.657 1.00 15.92 ? 53   LYS A CB  1 
ATOM   191  C CG  . LYS A 1 25  ? 27.314 30.828 21.627 1.00 18.04 ? 53   LYS A CG  1 
ATOM   192  C CD  . LYS A 1 25  ? 26.972 29.869 20.491 1.00 18.70 ? 53   LYS A CD  1 
ATOM   193  C CE  . LYS A 1 25  ? 25.794 30.378 19.666 1.00 22.23 ? 53   LYS A CE  1 
ATOM   194  N NZ  . LYS A 1 25  ? 25.463 29.459 18.538 1.00 25.04 ? 53   LYS A NZ  1 
ATOM   195  N N   . ASN A 1 26  ? 25.482 33.900 22.990 1.00 17.95 ? 54   ASN A N   1 
ATOM   196  C CA  . ASN A 1 26  ? 25.453 35.259 22.458 1.00 18.49 ? 54   ASN A CA  1 
ATOM   197  C C   . ASN A 1 26  ? 24.916 36.255 23.474 1.00 17.99 ? 54   ASN A C   1 
ATOM   198  O O   . ASN A 1 26  ? 23.851 36.050 24.054 1.00 18.84 ? 54   ASN A O   1 
ATOM   199  C CB  . ASN A 1 26  ? 24.584 35.300 21.203 1.00 19.65 ? 54   ASN A CB  1 
ATOM   200  C CG  . ASN A 1 26  ? 25.054 34.330 20.149 1.00 21.41 ? 54   ASN A CG  1 
ATOM   201  O OD1 . ASN A 1 26  ? 26.169 34.445 19.640 1.00 24.90 ? 54   ASN A OD1 1 
ATOM   202  N ND2 . ASN A 1 26  ? 24.210 33.358 19.819 1.00 24.69 ? 54   ASN A ND2 1 
ATOM   203  N N   . PHE A 1 27  ? 25.657 37.338 23.680 1.00 17.22 ? 55   PHE A N   1 
ATOM   204  C CA  . PHE A 1 27  ? 25.258 38.362 24.635 1.00 17.73 ? 55   PHE A CA  1 
ATOM   205  C C   . PHE A 1 27  ? 24.921 39.670 23.932 1.00 18.23 ? 55   PHE A C   1 
ATOM   206  O O   . PHE A 1 27  ? 25.387 39.929 22.824 1.00 18.61 ? 55   PHE A O   1 
ATOM   207  C CB  . PHE A 1 27  ? 26.373 38.584 25.661 1.00 16.02 ? 55   PHE A CB  1 
ATOM   208  C CG  . PHE A 1 27  ? 26.716 37.350 26.454 1.00 15.31 ? 55   PHE A CG  1 
ATOM   209  C CD1 . PHE A 1 27  ? 27.360 36.272 25.849 1.00 15.83 ? 55   PHE A CD1 1 
ATOM   210  C CD2 . PHE A 1 27  ? 26.347 37.244 27.789 1.00 15.60 ? 55   PHE A CD2 1 
ATOM   211  C CE1 . PHE A 1 27  ? 27.625 35.102 26.564 1.00 13.88 ? 55   PHE A CE1 1 
ATOM   212  C CE2 . PHE A 1 27  ? 26.608 36.078 28.514 1.00 15.59 ? 55   PHE A CE2 1 
ATOM   213  C CZ  . PHE A 1 27  ? 27.246 35.007 27.898 1.00 14.60 ? 55   PHE A CZ  1 
ATOM   214  N N   . HIS A 1 28  ? 24.102 40.488 24.580 1.00 19.92 ? 56   HIS A N   1 
ATOM   215  C CA  . HIS A 1 28  ? 23.702 41.765 24.010 1.00 20.69 ? 56   HIS A CA  1 
ATOM   216  C C   . HIS A 1 28  ? 24.907 42.675 23.823 1.00 21.70 ? 56   HIS A C   1 
ATOM   217  O O   . HIS A 1 28  ? 25.737 42.814 24.719 1.00 21.43 ? 56   HIS A O   1 
ATOM   218  C CB  . HIS A 1 28  ? 22.672 42.442 24.913 1.00 21.15 ? 56   HIS A CB  1 
ATOM   219  C CG  . HIS A 1 28  ? 21.380 41.692 25.019 1.00 22.06 ? 56   HIS A CG  1 
ATOM   220  N ND1 . HIS A 1 28  ? 20.275 42.201 25.667 1.00 21.36 ? 56   HIS A ND1 1 
ATOM   221  C CD2 . HIS A 1 28  ? 21.020 40.467 24.567 1.00 23.95 ? 56   HIS A CD2 1 
ATOM   222  C CE1 . HIS A 1 28  ? 19.290 41.322 25.610 1.00 24.59 ? 56   HIS A CE1 1 
ATOM   223  N NE2 . HIS A 1 28  ? 19.716 40.261 24.948 1.00 24.69 ? 56   HIS A NE2 1 
ATOM   224  N N   . LYS A 1 29  ? 24.996 43.285 22.646 1.00 23.37 ? 57   LYS A N   1 
ATOM   225  C CA  . LYS A 1 29  ? 26.094 44.188 22.316 1.00 24.17 ? 57   LYS A CA  1 
ATOM   226  C C   . LYS A 1 29  ? 26.269 45.227 23.417 1.00 24.16 ? 57   LYS A C   1 
ATOM   227  O O   . LYS A 1 29  ? 27.388 45.606 23.765 1.00 22.11 ? 57   LYS A O   1 
ATOM   228  C CB  . LYS A 1 29  ? 25.805 44.885 20.983 1.00 25.22 ? 57   LYS A CB  1 
ATOM   229  C CG  . LYS A 1 29  ? 26.849 45.906 20.562 1.00 29.76 ? 57   LYS A CG  1 
ATOM   230  C CD  . LYS A 1 29  ? 26.436 46.616 19.275 1.00 32.86 ? 57   LYS A CD  1 
ATOM   231  C CE  . LYS A 1 29  ? 27.442 47.693 18.884 1.00 35.70 ? 57   LYS A CE  1 
ATOM   232  N NZ  . LYS A 1 29  ? 27.054 48.399 17.626 1.00 37.69 ? 57   LYS A NZ  1 
ATOM   233  N N   . SER A 1 30  ? 25.146 45.673 23.968 1.00 24.12 ? 58   SER A N   1 
ATOM   234  C CA  . SER A 1 30  ? 25.148 46.673 25.025 1.00 24.25 ? 58   SER A CA  1 
ATOM   235  C C   . SER A 1 30  ? 25.985 46.286 26.245 1.00 23.24 ? 58   SER A C   1 
ATOM   236  O O   . SER A 1 30  ? 26.404 47.155 27.010 1.00 24.16 ? 58   SER A O   1 
ATOM   237  C CB  . SER A 1 30  ? 23.706 46.967 25.449 1.00 24.69 ? 58   SER A CB  1 
ATOM   238  O OG  . SER A 1 30  ? 23.004 45.764 25.720 1.00 26.10 ? 58   SER A OG  1 
ATOM   239  N N   . THR A 1 31  ? 26.235 44.990 26.425 1.00 22.14 ? 59   THR A N   1 
ATOM   240  C CA  . THR A 1 31  ? 27.024 44.509 27.563 1.00 20.64 ? 59   THR A CA  1 
ATOM   241  C C   . THR A 1 31  ? 28.517 44.470 27.240 1.00 21.78 ? 59   THR A C   1 
ATOM   242  O O   . THR A 1 31  ? 29.360 44.460 28.141 1.00 20.16 ? 59   THR A O   1 
ATOM   243  C CB  . THR A 1 31  ? 26.620 43.074 27.985 1.00 19.83 ? 59   THR A CB  1 
ATOM   244  O OG1 . THR A 1 31  ? 26.996 42.152 26.954 1.00 17.58 ? 59   THR A OG1 1 
ATOM   245  C CG2 . THR A 1 31  ? 25.120 42.982 28.230 1.00 18.52 ? 59   THR A CG2 1 
ATOM   246  N N   . GLY A 1 32  ? 28.836 44.430 25.951 1.00 21.15 ? 60   GLY A N   1 
ATOM   247  C CA  . GLY A 1 32  ? 30.227 44.383 25.541 1.00 23.21 ? 60   GLY A CA  1 
ATOM   248  C C   . GLY A 1 32  ? 30.845 43.008 25.718 1.00 24.17 ? 60   GLY A C   1 
ATOM   249  O O   . GLY A 1 32  ? 32.048 42.836 25.525 1.00 25.62 ? 60   GLY A O   1 
ATOM   250  N N   . MET A 1 33  ? 30.033 42.022 26.085 1.00 24.08 ? 61   MET A N   1 
ATOM   251  C CA  . MET A 1 33  ? 30.544 40.670 26.274 1.00 24.60 ? 61   MET A CA  1 
ATOM   252  C C   . MET A 1 33  ? 30.656 39.942 24.941 1.00 24.90 ? 61   MET A C   1 
ATOM   253  O O   . MET A 1 33  ? 29.811 40.103 24.059 1.00 25.85 ? 61   MET A O   1 
ATOM   254  C CB  . MET A 1 33  ? 29.646 39.888 27.240 1.00 24.28 ? 61   MET A CB  1 
ATOM   255  C CG  . MET A 1 33  ? 29.667 40.437 28.662 1.00 25.32 ? 61   MET A CG  1 
ATOM   256  S SD  . MET A 1 33  ? 28.820 39.396 29.868 1.00 26.07 ? 61   MET A SD  1 
ATOM   257  C CE  . MET A 1 33  ? 27.180 40.152 29.883 1.00 22.05 ? 61   MET A CE  1 
ATOM   258  N N   . THR A 1 34  ? 31.711 39.146 24.798 1.00 25.23 ? 62   THR A N   1 
ATOM   259  C CA  . THR A 1 34  ? 31.955 38.397 23.570 1.00 24.77 ? 62   THR A CA  1 
ATOM   260  C C   . THR A 1 34  ? 31.205 37.068 23.576 1.00 24.74 ? 62   THR A C   1 
ATOM   261  O O   . THR A 1 34  ? 30.815 36.571 24.635 1.00 25.30 ? 62   THR A O   1 
ATOM   262  C CB  . THR A 1 34  ? 33.460 38.103 23.389 1.00 25.62 ? 62   THR A CB  1 
ATOM   263  O OG1 . THR A 1 34  ? 33.919 37.293 24.477 1.00 28.74 ? 62   THR A OG1 1 
ATOM   264  C CG2 . THR A 1 34  ? 34.258 39.396 23.362 1.00 24.38 ? 62   THR A CG2 1 
ATOM   265  N N   . SER A 1 35  ? 31.006 36.494 22.393 1.00 22.03 ? 63   SER A N   1 
ATOM   266  C CA  . SER A 1 35  ? 30.311 35.220 22.282 1.00 21.29 ? 63   SER A CA  1 
ATOM   267  C C   . SER A 1 35  ? 31.196 34.101 22.826 1.00 20.42 ? 63   SER A C   1 
ATOM   268  O O   . SER A 1 35  ? 32.427 34.193 22.799 1.00 20.37 ? 63   SER A O   1 
ATOM   269  C CB  . SER A 1 35  ? 29.935 34.943 20.823 1.00 21.82 ? 63   SER A CB  1 
ATOM   270  O OG  . SER A 1 35  ? 31.078 34.915 19.990 1.00 27.60 ? 63   SER A OG  1 
ATOM   271  N N   . ARG A 1 36  ? 30.562 33.047 23.327 1.00 17.72 ? 64   ARG A N   1 
ATOM   272  C CA  . ARG A 1 36  ? 31.284 31.919 23.902 1.00 17.50 ? 64   ARG A CA  1 
ATOM   273  C C   . ARG A 1 36  ? 31.321 30.728 22.951 1.00 17.86 ? 64   ARG A C   1 
ATOM   274  O O   . ARG A 1 36  ? 30.570 29.765 23.106 1.00 18.49 ? 64   ARG A O   1 
ATOM   275  C CB  . ARG A 1 36  ? 30.636 31.530 25.241 1.00 16.29 ? 64   ARG A CB  1 
ATOM   276  C CG  . ARG A 1 36  ? 30.690 32.655 26.276 1.00 14.86 ? 64   ARG A CG  1 
ATOM   277  C CD  . ARG A 1 36  ? 29.980 32.316 27.587 1.00 14.11 ? 64   ARG A CD  1 
ATOM   278  N NE  . ARG A 1 36  ? 30.544 31.129 28.225 1.00 12.08 ? 64   ARG A NE  1 
ATOM   279  C CZ  . ARG A 1 36  ? 30.045 29.904 28.101 1.00 10.58 ? 64   ARG A CZ  1 
ATOM   280  N NH1 . ARG A 1 36  ? 28.959 29.700 27.371 1.00 8.32  ? 64   ARG A NH1 1 
ATOM   281  N NH2 . ARG A 1 36  ? 30.649 28.877 28.687 1.00 10.24 ? 64   ARG A NH2 1 
ATOM   282  N N   . SER A 1 37  ? 32.206 30.799 21.962 1.00 18.57 ? 65   SER A N   1 
ATOM   283  C CA  . SER A 1 37  ? 32.333 29.727 20.985 1.00 19.96 ? 65   SER A CA  1 
ATOM   284  C C   . SER A 1 37  ? 32.623 28.388 21.650 1.00 18.82 ? 65   SER A C   1 
ATOM   285  O O   . SER A 1 37  ? 33.419 28.301 22.590 1.00 16.17 ? 65   SER A O   1 
ATOM   286  C CB  . SER A 1 37  ? 33.443 30.050 19.983 1.00 23.48 ? 65   SER A CB  1 
ATOM   287  O OG  . SER A 1 37  ? 34.684 30.205 20.644 1.00 28.65 ? 65   SER A OG  1 
ATOM   288  N N   . GLY A 1 38  ? 31.964 27.347 21.151 1.00 18.39 ? 66   GLY A N   1 
ATOM   289  C CA  . GLY A 1 38  ? 32.154 26.015 21.689 1.00 16.92 ? 66   GLY A CA  1 
ATOM   290  C C   . GLY A 1 38  ? 31.189 25.629 22.793 1.00 16.52 ? 66   GLY A C   1 
ATOM   291  O O   . GLY A 1 38  ? 31.141 24.465 23.183 1.00 17.15 ? 66   GLY A O   1 
ATOM   292  N N   . THR A 1 39  ? 30.414 26.582 23.302 1.00 15.38 ? 67   THR A N   1 
ATOM   293  C CA  . THR A 1 39  ? 29.477 26.266 24.376 1.00 13.86 ? 67   THR A CA  1 
ATOM   294  C C   . THR A 1 39  ? 28.363 25.321 23.911 1.00 14.97 ? 67   THR A C   1 
ATOM   295  O O   . THR A 1 39  ? 27.813 24.557 24.709 1.00 14.05 ? 67   THR A O   1 
ATOM   296  C CB  . THR A 1 39  ? 28.862 27.550 24.986 1.00 12.61 ? 67   THR A CB  1 
ATOM   297  O OG1 . THR A 1 39  ? 28.144 27.215 26.183 1.00 12.68 ? 67   THR A OG1 1 
ATOM   298  C CG2 . THR A 1 39  ? 27.919 28.228 24.001 1.00 11.93 ? 67   THR A CG2 1 
ATOM   299  N N   . ASP A 1 40  ? 28.037 25.359 22.621 1.00 14.14 ? 68   ASP A N   1 
ATOM   300  C CA  . ASP A 1 40  ? 26.996 24.479 22.101 1.00 15.53 ? 68   ASP A CA  1 
ATOM   301  C C   . ASP A 1 40  ? 27.447 23.024 22.181 1.00 13.29 ? 68   ASP A C   1 
ATOM   302  O O   . ASP A 1 40  ? 26.623 22.118 22.313 1.00 15.37 ? 68   ASP A O   1 
ATOM   303  C CB  . ASP A 1 40  ? 26.644 24.838 20.654 1.00 16.38 ? 68   ASP A CB  1 
ATOM   304  C CG  . ASP A 1 40  ? 25.946 26.180 20.540 1.00 17.05 ? 68   ASP A CG  1 
ATOM   305  O OD1 . ASP A 1 40  ? 25.466 26.699 21.572 1.00 16.80 ? 68   ASP A OD1 1 
ATOM   306  O OD2 . ASP A 1 40  ? 25.865 26.712 19.414 1.00 19.12 ? 68   ASP A OD2 1 
ATOM   307  N N   . VAL A 1 41  ? 28.755 22.803 22.095 1.00 13.76 ? 69   VAL A N   1 
ATOM   308  C CA  . VAL A 1 41  ? 29.309 21.453 22.189 1.00 13.77 ? 69   VAL A CA  1 
ATOM   309  C C   . VAL A 1 41  ? 29.105 20.961 23.625 1.00 12.71 ? 69   VAL A C   1 
ATOM   310  O O   . VAL A 1 41  ? 28.782 19.792 23.859 1.00 11.43 ? 69   VAL A O   1 
ATOM   311  C CB  . VAL A 1 41  ? 30.820 21.442 21.856 1.00 14.78 ? 69   VAL A CB  1 
ATOM   312  C CG1 . VAL A 1 41  ? 31.373 20.032 21.981 1.00 16.49 ? 69   VAL A CG1 1 
ATOM   313  C CG2 . VAL A 1 41  ? 31.045 21.969 20.440 1.00 17.50 ? 69   VAL A CG2 1 
ATOM   314  N N   . ASP A 1 42  ? 29.302 21.867 24.579 1.00 10.61 ? 70   ASP A N   1 
ATOM   315  C CA  . ASP A 1 42  ? 29.114 21.555 25.996 1.00 10.01 ? 70   ASP A CA  1 
ATOM   316  C C   . ASP A 1 42  ? 27.651 21.222 26.261 1.00 10.02 ? 70   ASP A C   1 
ATOM   317  O O   . ASP A 1 42  ? 27.338 20.219 26.892 1.00 11.91 ? 70   ASP A O   1 
ATOM   318  C CB  . ASP A 1 42  ? 29.494 22.754 26.870 1.00 8.73  ? 70   ASP A CB  1 
ATOM   319  C CG  . ASP A 1 42  ? 30.983 22.838 27.148 1.00 9.15  ? 70   ASP A CG  1 
ATOM   320  O OD1 . ASP A 1 42  ? 31.738 21.982 26.652 1.00 8.55  ? 70   ASP A OD1 1 
ATOM   321  O OD2 . ASP A 1 42  ? 31.393 23.769 27.873 1.00 14.18 ? 70   ASP A OD2 1 
ATOM   322  N N   . ALA A 1 43  ? 26.761 22.089 25.785 1.00 9.75  ? 71   ALA A N   1 
ATOM   323  C CA  . ALA A 1 43  ? 25.326 21.916 25.977 1.00 10.35 ? 71   ALA A CA  1 
ATOM   324  C C   . ALA A 1 43  ? 24.839 20.574 25.441 1.00 9.68  ? 71   ALA A C   1 
ATOM   325  O O   . ALA A 1 43  ? 24.041 19.892 26.088 1.00 11.49 ? 71   ALA A O   1 
ATOM   326  C CB  . ALA A 1 43  ? 24.570 23.058 25.297 1.00 8.37  ? 71   ALA A CB  1 
ATOM   327  N N   . ALA A 1 44  ? 25.316 20.198 24.258 1.00 9.38  ? 72   ALA A N   1 
ATOM   328  C CA  . ALA A 1 44  ? 24.916 18.935 23.647 1.00 10.71 ? 72   ALA A CA  1 
ATOM   329  C C   . ALA A 1 44  ? 25.494 17.740 24.407 1.00 12.01 ? 72   ALA A C   1 
ATOM   330  O O   . ALA A 1 44  ? 24.814 16.731 24.611 1.00 11.94 ? 72   ALA A O   1 
ATOM   331  C CB  . ALA A 1 44  ? 25.362 18.900 22.182 1.00 10.30 ? 72   ALA A CB  1 
ATOM   332  N N   . ASN A 1 45  ? 26.748 17.861 24.830 1.00 12.46 ? 73   ASN A N   1 
ATOM   333  C CA  . ASN A 1 45  ? 27.417 16.795 25.569 1.00 12.65 ? 73   ASN A CA  1 
ATOM   334  C C   . ASN A 1 45  ? 26.654 16.556 26.877 1.00 12.88 ? 73   ASN A C   1 
ATOM   335  O O   . ASN A 1 45  ? 26.419 15.413 27.278 1.00 11.07 ? 73   ASN A O   1 
ATOM   336  C CB  . ASN A 1 45  ? 28.866 17.204 25.866 1.00 12.46 ? 73   ASN A CB  1 
ATOM   337  C CG  . ASN A 1 45  ? 29.775 16.015 26.151 1.00 13.54 ? 73   ASN A CG  1 
ATOM   338  O OD1 . ASN A 1 45  ? 29.321 14.875 26.282 1.00 15.14 ? 73   ASN A OD1 1 
ATOM   339  N ND2 . ASN A 1 45  ? 31.071 16.282 26.252 1.00 12.56 ? 73   ASN A ND2 1 
ATOM   340  N N   . LEU A 1 46  ? 26.257 17.644 27.530 1.00 11.75 ? 74   LEU A N   1 
ATOM   341  C CA  . LEU A 1 46  ? 25.519 17.554 28.785 1.00 9.94  ? 74   LEU A CA  1 
ATOM   342  C C   . LEU A 1 46  ? 24.148 16.915 28.588 1.00 10.62 ? 74   LEU A C   1 
ATOM   343  O O   . LEU A 1 46  ? 23.732 16.076 29.380 1.00 11.19 ? 74   LEU A O   1 
ATOM   344  C CB  . LEU A 1 46  ? 25.366 18.949 29.400 1.00 12.15 ? 74   LEU A CB  1 
ATOM   345  C CG  . LEU A 1 46  ? 26.657 19.564 29.951 1.00 11.00 ? 74   LEU A CG  1 
ATOM   346  C CD1 . LEU A 1 46  ? 26.479 21.068 30.152 1.00 11.36 ? 74   LEU A CD1 1 
ATOM   347  C CD2 . LEU A 1 46  ? 27.021 18.879 31.270 1.00 13.43 ? 74   LEU A CD2 1 
ATOM   348  N N   . ARG A 1 47  ? 23.450 17.309 27.527 1.00 10.70 ? 75   ARG A N   1 
ATOM   349  C CA  . ARG A 1 47  ? 22.129 16.760 27.241 1.00 12.24 ? 75   ARG A CA  1 
ATOM   350  C C   . ARG A 1 47  ? 22.191 15.242 27.075 1.00 11.13 ? 75   ARG A C   1 
ATOM   351  O O   . ARG A 1 47  ? 21.385 14.511 27.653 1.00 11.75 ? 75   ARG A O   1 
ATOM   352  C CB  . ARG A 1 47  ? 21.558 17.400 25.971 1.00 13.74 ? 75   ARG A CB  1 
ATOM   353  C CG  . ARG A 1 47  ? 20.126 16.978 25.641 1.00 15.72 ? 75   ARG A CG  1 
ATOM   354  C CD  . ARG A 1 47  ? 19.508 17.920 24.606 1.00 22.01 ? 75   ARG A CD  1 
ATOM   355  N NE  . ARG A 1 47  ? 18.109 17.604 24.317 1.00 20.38 ? 75   ARG A NE  1 
ATOM   356  C CZ  . ARG A 1 47  ? 17.691 16.970 23.226 1.00 25.27 ? 75   ARG A CZ  1 
ATOM   357  N NH1 . ARG A 1 47  ? 18.565 16.577 22.307 1.00 26.90 ? 75   ARG A NH1 1 
ATOM   358  N NH2 . ARG A 1 47  ? 16.397 16.738 23.047 1.00 25.00 ? 75   ARG A NH2 1 
ATOM   359  N N   . GLU A 1 48  ? 23.148 14.775 26.281 1.00 10.04 ? 76   GLU A N   1 
ATOM   360  C CA  . GLU A 1 48  ? 23.315 13.344 26.043 1.00 10.99 ? 76   GLU A CA  1 
ATOM   361  C C   . GLU A 1 48  ? 23.749 12.599 27.303 1.00 9.96  ? 76   GLU A C   1 
ATOM   362  O O   . GLU A 1 48  ? 23.231 11.527 27.613 1.00 9.97  ? 76   GLU A O   1 
ATOM   363  C CB  . GLU A 1 48  ? 24.347 13.109 24.937 1.00 10.81 ? 76   GLU A CB  1 
ATOM   364  C CG  . GLU A 1 48  ? 24.640 11.631 24.674 1.00 13.24 ? 76   GLU A CG  1 
ATOM   365  C CD  . GLU A 1 48  ? 23.439 10.871 24.126 1.00 16.24 ? 76   GLU A CD  1 
ATOM   366  O OE1 . GLU A 1 48  ? 23.497 9.622  24.078 1.00 16.09 ? 76   GLU A OE1 1 
ATOM   367  O OE2 . GLU A 1 48  ? 22.439 11.519 23.738 1.00 15.63 ? 76   GLU A OE2 1 
ATOM   368  N N   . THR A 1 49  ? 24.705 13.172 28.023 1.00 10.81 ? 77   THR A N   1 
ATOM   369  C CA  . THR A 1 49  ? 25.218 12.562 29.244 1.00 10.52 ? 77   THR A CA  1 
ATOM   370  C C   . THR A 1 49  ? 24.124 12.365 30.292 1.00 11.27 ? 77   THR A C   1 
ATOM   371  O O   . THR A 1 49  ? 23.957 11.270 30.831 1.00 11.14 ? 77   THR A O   1 
ATOM   372  C CB  . THR A 1 49  ? 26.343 13.421 29.852 1.00 12.07 ? 77   THR A CB  1 
ATOM   373  O OG1 . THR A 1 49  ? 27.403 13.563 28.897 1.00 13.37 ? 77   THR A OG1 1 
ATOM   374  C CG2 . THR A 1 49  ? 26.897 12.768 31.116 1.00 10.53 ? 77   THR A CG2 1 
ATOM   375  N N   . PHE A 1 50  ? 23.378 13.423 30.585 1.00 9.29  ? 78   PHE A N   1 
ATOM   376  C CA  . PHE A 1 50  ? 22.319 13.321 31.577 1.00 8.98  ? 78   PHE A CA  1 
ATOM   377  C C   . PHE A 1 50  ? 21.091 12.569 31.074 1.00 9.33  ? 78   PHE A C   1 
ATOM   378  O O   . PHE A 1 50  ? 20.309 12.054 31.871 1.00 11.35 ? 78   PHE A O   1 
ATOM   379  C CB  . PHE A 1 50  ? 21.959 14.715 32.100 1.00 9.28  ? 78   PHE A CB  1 
ATOM   380  C CG  . PHE A 1 50  ? 22.932 15.229 33.133 1.00 9.67  ? 78   PHE A CG  1 
ATOM   381  C CD1 . PHE A 1 50  ? 22.815 14.844 34.467 1.00 8.49  ? 78   PHE A CD1 1 
ATOM   382  C CD2 . PHE A 1 50  ? 24.002 16.040 32.761 1.00 9.36  ? 78   PHE A CD2 1 
ATOM   383  C CE1 . PHE A 1 50  ? 23.751 15.253 35.418 1.00 8.00  ? 78   PHE A CE1 1 
ATOM   384  C CE2 . PHE A 1 50  ? 24.949 16.458 33.704 1.00 9.56  ? 78   PHE A CE2 1 
ATOM   385  C CZ  . PHE A 1 50  ? 24.824 16.063 35.035 1.00 8.58  ? 78   PHE A CZ  1 
ATOM   386  N N   . ARG A 1 51  ? 20.918 12.500 29.757 1.00 9.98  ? 79   ARG A N   1 
ATOM   387  C CA  . ARG A 1 51  ? 19.799 11.744 29.198 1.00 12.38 ? 79   ARG A CA  1 
ATOM   388  C C   . ARG A 1 51  ? 20.047 10.289 29.586 1.00 12.02 ? 79   ARG A C   1 
ATOM   389  O O   . ARG A 1 51  ? 19.145 9.582  30.030 1.00 12.77 ? 79   ARG A O   1 
ATOM   390  C CB  . ARG A 1 51  ? 19.776 11.848 27.669 1.00 10.52 ? 79   ARG A CB  1 
ATOM   391  C CG  . ARG A 1 51  ? 18.684 11.005 26.994 1.00 10.33 ? 79   ARG A CG  1 
ATOM   392  C CD  . ARG A 1 51  ? 18.755 11.127 25.472 1.00 8.34  ? 79   ARG A CD  1 
ATOM   393  N NE  . ARG A 1 51  ? 19.860 10.358 24.908 1.00 10.84 ? 79   ARG A NE  1 
ATOM   394  C CZ  . ARG A 1 51  ? 19.822 9.045  24.711 1.00 14.16 ? 79   ARG A CZ  1 
ATOM   395  N NH1 . ARG A 1 51  ? 18.729 8.358  25.024 1.00 12.72 ? 79   ARG A NH1 1 
ATOM   396  N NH2 . ARG A 1 51  ? 20.880 8.413  24.219 1.00 12.10 ? 79   ARG A NH2 1 
ATOM   397  N N   . ASN A 1 52  ? 21.292 9.858  29.408 1.00 14.01 ? 80   ASN A N   1 
ATOM   398  C CA  . ASN A 1 52  ? 21.694 8.494  29.714 1.00 15.93 ? 80   ASN A CA  1 
ATOM   399  C C   . ASN A 1 52  ? 21.610 8.182  31.203 1.00 16.19 ? 80   ASN A C   1 
ATOM   400  O O   . ASN A 1 52  ? 21.591 7.016  31.593 1.00 17.06 ? 80   ASN A O   1 
ATOM   401  C CB  . ASN A 1 52  ? 23.109 8.238  29.184 1.00 18.44 ? 80   ASN A CB  1 
ATOM   402  C CG  . ASN A 1 52  ? 23.139 8.058  27.669 1.00 22.07 ? 80   ASN A CG  1 
ATOM   403  O OD1 . ASN A 1 52  ? 24.162 8.284  27.022 1.00 25.20 ? 80   ASN A OD1 1 
ATOM   404  N ND2 . ASN A 1 52  ? 22.015 7.638  27.103 1.00 22.02 ? 80   ASN A ND2 1 
ATOM   405  N N   . LEU A 1 53  ? 21.556 9.223  32.031 1.00 16.16 ? 81   LEU A N   1 
ATOM   406  C CA  . LEU A 1 53  ? 21.439 9.037  33.475 1.00 15.56 ? 81   LEU A CA  1 
ATOM   407  C C   . LEU A 1 53  ? 19.966 9.086  33.859 1.00 14.99 ? 81   LEU A C   1 
ATOM   408  O O   . LEU A 1 53  ? 19.614 9.066  35.038 1.00 15.05 ? 81   LEU A O   1 
ATOM   409  C CB  . LEU A 1 53  ? 22.217 10.118 34.228 1.00 16.01 ? 81   LEU A CB  1 
ATOM   410  C CG  . LEU A 1 53  ? 23.741 10.008 34.121 1.00 17.05 ? 81   LEU A CG  1 
ATOM   411  C CD1 . LEU A 1 53  ? 24.410 11.111 34.924 1.00 16.04 ? 81   LEU A CD1 1 
ATOM   412  C CD2 . LEU A 1 53  ? 24.176 8.640  34.630 1.00 20.25 ? 81   LEU A CD2 1 
ATOM   413  N N   . LYS A 1 54  ? 19.116 9.156  32.836 1.00 12.91 ? 82   LYS A N   1 
ATOM   414  C CA  . LYS A 1 54  ? 17.666 9.186  32.991 1.00 12.32 ? 82   LYS A CA  1 
ATOM   415  C C   . LYS A 1 54  ? 17.091 10.490 33.543 1.00 11.50 ? 82   LYS A C   1 
ATOM   416  O O   . LYS A 1 54  ? 16.033 10.485 34.165 1.00 12.63 ? 82   LYS A O   1 
ATOM   417  C CB  . LYS A 1 54  ? 17.198 8.010  33.860 1.00 11.97 ? 82   LYS A CB  1 
ATOM   418  C CG  . LYS A 1 54  ? 17.763 6.653  33.446 1.00 12.00 ? 82   LYS A CG  1 
ATOM   419  C CD  . LYS A 1 54  ? 17.479 6.327  31.984 1.00 15.65 ? 82   LYS A CD  1 
ATOM   420  C CE  . LYS A 1 54  ? 18.191 5.048  31.563 1.00 16.94 ? 82   LYS A CE  1 
ATOM   421  N NZ  . LYS A 1 54  ? 18.023 4.761  30.113 1.00 19.77 ? 82   LYS A NZ  1 
ATOM   422  N N   . TYR A 1 55  ? 17.784 11.605 33.323 1.00 10.51 ? 83   TYR A N   1 
ATOM   423  C CA  . TYR A 1 55  ? 17.275 12.896 33.781 1.00 9.74  ? 83   TYR A CA  1 
ATOM   424  C C   . TYR A 1 55  ? 16.376 13.502 32.710 1.00 10.75 ? 83   TYR A C   1 
ATOM   425  O O   . TYR A 1 55  ? 16.507 13.182 31.530 1.00 9.57  ? 83   TYR A O   1 
ATOM   426  C CB  . TYR A 1 55  ? 18.416 13.881 34.074 1.00 10.28 ? 83   TYR A CB  1 
ATOM   427  C CG  . TYR A 1 55  ? 19.021 13.708 35.444 1.00 11.13 ? 83   TYR A CG  1 
ATOM   428  C CD1 . TYR A 1 55  ? 20.040 12.783 35.669 1.00 10.37 ? 83   TYR A CD1 1 
ATOM   429  C CD2 . TYR A 1 55  ? 18.529 14.427 36.535 1.00 9.72  ? 83   TYR A CD2 1 
ATOM   430  C CE1 . TYR A 1 55  ? 20.552 12.576 36.952 1.00 11.74 ? 83   TYR A CE1 1 
ATOM   431  C CE2 . TYR A 1 55  ? 19.032 14.226 37.819 1.00 9.11  ? 83   TYR A CE2 1 
ATOM   432  C CZ  . TYR A 1 55  ? 20.043 13.298 38.020 1.00 12.06 ? 83   TYR A CZ  1 
ATOM   433  O OH  . TYR A 1 55  ? 20.539 13.090 39.294 1.00 9.29  ? 83   TYR A OH  1 
ATOM   434  N N   . GLU A 1 56  ? 15.461 14.369 33.135 1.00 11.00 ? 84   GLU A N   1 
ATOM   435  C CA  . GLU A 1 56  ? 14.565 15.062 32.217 1.00 11.97 ? 84   GLU A CA  1 
ATOM   436  C C   . GLU A 1 56  ? 15.306 16.345 31.858 1.00 11.04 ? 84   GLU A C   1 
ATOM   437  O O   . GLU A 1 56  ? 15.224 17.336 32.583 1.00 10.89 ? 84   GLU A O   1 
ATOM   438  C CB  . GLU A 1 56  ? 13.250 15.402 32.920 1.00 13.59 ? 84   GLU A CB  1 
ATOM   439  C CG  . GLU A 1 56  ? 12.216 16.088 32.041 1.00 15.66 ? 84   GLU A CG  1 
ATOM   440  C CD  . GLU A 1 56  ? 10.974 16.490 32.822 1.00 17.74 ? 84   GLU A CD  1 
ATOM   441  O OE1 . GLU A 1 56  ? 10.524 15.694 33.675 1.00 17.94 ? 84   GLU A OE1 1 
ATOM   442  O OE2 . GLU A 1 56  ? 10.445 17.597 32.583 1.00 16.22 ? 84   GLU A OE2 1 
ATOM   443  N N   . VAL A 1 57  ? 16.038 16.326 30.750 1.00 10.74 ? 85   VAL A N   1 
ATOM   444  C CA  . VAL A 1 57  ? 16.814 17.494 30.343 1.00 9.41  ? 85   VAL A CA  1 
ATOM   445  C C   . VAL A 1 57  ? 16.004 18.567 29.628 1.00 11.50 ? 85   VAL A C   1 
ATOM   446  O O   . VAL A 1 57  ? 15.260 18.285 28.688 1.00 12.00 ? 85   VAL A O   1 
ATOM   447  C CB  . VAL A 1 57  ? 17.995 17.099 29.412 1.00 11.69 ? 85   VAL A CB  1 
ATOM   448  C CG1 . VAL A 1 57  ? 18.802 18.344 29.037 1.00 9.65  ? 85   VAL A CG1 1 
ATOM   449  C CG2 . VAL A 1 57  ? 18.888 16.072 30.094 1.00 8.78  ? 85   VAL A CG2 1 
ATOM   450  N N   . ARG A 1 58  ? 16.157 19.803 30.086 1.00 11.17 ? 86   ARG A N   1 
ATOM   451  C CA  . ARG A 1 58  ? 15.483 20.940 29.476 1.00 13.29 ? 86   ARG A CA  1 
ATOM   452  C C   . ARG A 1 58  ? 16.567 21.960 29.184 1.00 13.63 ? 86   ARG A C   1 
ATOM   453  O O   . ARG A 1 58  ? 17.237 22.437 30.101 1.00 14.92 ? 86   ARG A O   1 
ATOM   454  C CB  . ARG A 1 58  ? 14.453 21.550 30.428 1.00 13.34 ? 86   ARG A CB  1 
ATOM   455  C CG  . ARG A 1 58  ? 13.330 20.615 30.840 1.00 13.94 ? 86   ARG A CG  1 
ATOM   456  C CD  . ARG A 1 58  ? 12.286 21.369 31.643 1.00 12.90 ? 86   ARG A CD  1 
ATOM   457  N NE  . ARG A 1 58  ? 11.352 20.477 32.331 1.00 13.41 ? 86   ARG A NE  1 
ATOM   458  C CZ  . ARG A 1 58  ? 10.561 20.871 33.324 1.00 12.71 ? 86   ARG A CZ  1 
ATOM   459  N NH1 . ARG A 1 58  ? 10.594 22.134 33.733 1.00 13.03 ? 86   ARG A NH1 1 
ATOM   460  N NH2 . ARG A 1 58  ? 9.752  20.008 33.920 1.00 14.06 ? 86   ARG A NH2 1 
ATOM   461  N N   . ASN A 1 59  ? 16.758 22.283 27.910 1.00 14.31 ? 87   ASN A N   1 
ATOM   462  C CA  . ASN A 1 59  ? 17.776 23.255 27.541 1.00 16.07 ? 87   ASN A CA  1 
ATOM   463  C C   . ASN A 1 59  ? 17.176 24.615 27.205 1.00 16.51 ? 87   ASN A C   1 
ATOM   464  O O   . ASN A 1 59  ? 16.070 24.704 26.676 1.00 15.05 ? 87   ASN A O   1 
ATOM   465  C CB  . ASN A 1 59  ? 18.581 22.761 26.336 1.00 18.40 ? 87   ASN A CB  1 
ATOM   466  C CG  . ASN A 1 59  ? 19.672 23.735 25.930 1.00 22.85 ? 87   ASN A CG  1 
ATOM   467  O OD1 . ASN A 1 59  ? 20.723 23.812 26.571 1.00 24.28 ? 87   ASN A OD1 1 
ATOM   468  N ND2 . ASN A 1 59  ? 19.422 24.501 24.870 1.00 22.34 ? 87   ASN A ND2 1 
ATOM   469  N N   . LYS A 1 60  ? 17.920 25.668 27.529 1.00 14.79 ? 88   LYS A N   1 
ATOM   470  C CA  . LYS A 1 60  ? 17.520 27.039 27.246 1.00 16.76 ? 88   LYS A CA  1 
ATOM   471  C C   . LYS A 1 60  ? 18.762 27.763 26.734 1.00 16.53 ? 88   LYS A C   1 
ATOM   472  O O   . LYS A 1 60  ? 19.849 27.601 27.290 1.00 16.88 ? 88   LYS A O   1 
ATOM   473  C CB  . LYS A 1 60  ? 17.004 27.733 28.510 1.00 16.12 ? 88   LYS A CB  1 
ATOM   474  C CG  . LYS A 1 60  ? 15.603 27.319 28.936 1.00 18.82 ? 88   LYS A CG  1 
ATOM   475  C CD  . LYS A 1 60  ? 14.551 27.825 27.955 1.00 22.16 ? 88   LYS A CD  1 
ATOM   476  C CE  . LYS A 1 60  ? 13.142 27.519 28.441 1.00 26.91 ? 88   LYS A CE  1 
ATOM   477  N NZ  . LYS A 1 60  ? 12.101 27.947 27.458 1.00 28.86 ? 88   LYS A NZ  1 
ATOM   478  N N   . ASN A 1 61  ? 18.606 28.549 25.672 1.00 15.14 ? 89   ASN A N   1 
ATOM   479  C CA  . ASN A 1 61  ? 19.734 29.281 25.103 1.00 15.08 ? 89   ASN A CA  1 
ATOM   480  C C   . ASN A 1 61  ? 19.570 30.787 25.213 1.00 15.10 ? 89   ASN A C   1 
ATOM   481  O O   . ASN A 1 61  ? 18.457 31.313 25.117 1.00 13.20 ? 89   ASN A O   1 
ATOM   482  C CB  . ASN A 1 61  ? 19.920 28.939 23.622 1.00 15.89 ? 89   ASN A CB  1 
ATOM   483  C CG  . ASN A 1 61  ? 20.167 27.470 23.383 1.00 17.35 ? 89   ASN A CG  1 
ATOM   484  O OD1 . ASN A 1 61  ? 21.064 26.874 23.974 1.00 18.45 ? 89   ASN A OD1 1 
ATOM   485  N ND2 . ASN A 1 61  ? 19.373 26.876 22.498 1.00 20.14 ? 89   ASN A ND2 1 
ATOM   486  N N   . ASP A 1 62  ? 20.696 31.469 25.404 1.00 13.81 ? 90   ASP A N   1 
ATOM   487  C CA  . ASP A 1 62  ? 20.735 32.926 25.488 1.00 14.27 ? 90   ASP A CA  1 
ATOM   488  C C   . ASP A 1 62  ? 19.605 33.552 26.304 1.00 15.24 ? 90   ASP A C   1 
ATOM   489  O O   . ASP A 1 62  ? 18.722 34.214 25.753 1.00 14.44 ? 90   ASP A O   1 
ATOM   490  C CB  . ASP A 1 62  ? 20.726 33.505 24.070 1.00 14.43 ? 90   ASP A CB  1 
ATOM   491  C CG  . ASP A 1 62  ? 21.899 33.017 23.231 1.00 16.05 ? 90   ASP A CG  1 
ATOM   492  O OD1 . ASP A 1 62  ? 21.832 33.133 21.990 1.00 14.86 ? 90   ASP A OD1 1 
ATOM   493  O OD2 . ASP A 1 62  ? 22.894 32.525 23.807 1.00 13.53 ? 90   ASP A OD2 1 
ATOM   494  N N   . LEU A 1 63  ? 19.638 33.353 27.618 1.00 13.47 ? 91   LEU A N   1 
ATOM   495  C CA  . LEU A 1 63  ? 18.613 33.913 28.493 1.00 12.63 ? 91   LEU A CA  1 
ATOM   496  C C   . LEU A 1 63  ? 19.080 35.191 29.175 1.00 13.08 ? 91   LEU A C   1 
ATOM   497  O O   . LEU A 1 63  ? 20.204 35.265 29.665 1.00 12.25 ? 91   LEU A O   1 
ATOM   498  C CB  . LEU A 1 63  ? 18.216 32.906 29.576 1.00 13.21 ? 91   LEU A CB  1 
ATOM   499  C CG  . LEU A 1 63  ? 17.614 31.573 29.136 1.00 14.11 ? 91   LEU A CG  1 
ATOM   500  C CD1 . LEU A 1 63  ? 17.118 30.827 30.374 1.00 12.15 ? 91   LEU A CD1 1 
ATOM   501  C CD2 . LEU A 1 63  ? 16.469 31.810 28.164 1.00 13.30 ? 91   LEU A CD2 1 
ATOM   502  N N   . THR A 1 64  ? 18.211 36.196 29.209 1.00 13.04 ? 92   THR A N   1 
ATOM   503  C CA  . THR A 1 64  ? 18.542 37.450 29.869 1.00 13.38 ? 92   THR A CA  1 
ATOM   504  C C   . THR A 1 64  ? 18.567 37.171 31.366 1.00 13.57 ? 92   THR A C   1 
ATOM   505  O O   . THR A 1 64  ? 18.157 36.097 31.810 1.00 13.19 ? 92   THR A O   1 
ATOM   506  C CB  . THR A 1 64  ? 17.475 38.523 29.615 1.00 13.59 ? 92   THR A CB  1 
ATOM   507  O OG1 . THR A 1 64  ? 16.217 38.064 30.128 1.00 12.82 ? 92   THR A OG1 1 
ATOM   508  C CG2 . THR A 1 64  ? 17.344 38.806 28.129 1.00 10.54 ? 92   THR A CG2 1 
ATOM   509  N N   . ARG A 1 65  ? 19.037 38.136 32.143 1.00 14.26 ? 93   ARG A N   1 
ATOM   510  C CA  . ARG A 1 65  ? 19.081 37.964 33.585 1.00 15.59 ? 93   ARG A CA  1 
ATOM   511  C C   . ARG A 1 65  ? 17.660 37.744 34.111 1.00 14.57 ? 93   ARG A C   1 
ATOM   512  O O   . ARG A 1 65  ? 17.449 36.944 35.022 1.00 12.28 ? 93   ARG A O   1 
ATOM   513  C CB  . ARG A 1 65  ? 19.720 39.192 34.240 1.00 16.40 ? 93   ARG A CB  1 
ATOM   514  C CG  . ARG A 1 65  ? 18.976 40.486 33.981 1.00 22.98 ? 93   ARG A CG  1 
ATOM   515  C CD  . ARG A 1 65  ? 19.794 41.696 34.393 1.00 25.45 ? 93   ARG A CD  1 
ATOM   516  N NE  . ARG A 1 65  ? 20.293 41.585 35.760 1.00 30.31 ? 93   ARG A NE  1 
ATOM   517  C CZ  . ARG A 1 65  ? 20.856 42.586 36.426 1.00 32.38 ? 93   ARG A CZ  1 
ATOM   518  N NH1 . ARG A 1 65  ? 20.986 43.773 35.846 1.00 34.01 ? 93   ARG A NH1 1 
ATOM   519  N NH2 . ARG A 1 65  ? 21.294 42.403 37.666 1.00 32.26 ? 93   ARG A NH2 1 
ATOM   520  N N   . GLU A 1 66  ? 16.685 38.440 33.526 1.00 14.20 ? 94   GLU A N   1 
ATOM   521  C CA  . GLU A 1 66  ? 15.292 38.293 33.953 1.00 13.89 ? 94   GLU A CA  1 
ATOM   522  C C   . GLU A 1 66  ? 14.752 36.888 33.667 1.00 14.78 ? 94   GLU A C   1 
ATOM   523  O O   . GLU A 1 66  ? 14.048 36.303 34.493 1.00 13.29 ? 94   GLU A O   1 
ATOM   524  C CB  . GLU A 1 66  ? 14.385 39.313 33.248 1.00 13.55 ? 94   GLU A CB  1 
ATOM   525  C CG  . GLU A 1 66  ? 14.648 40.779 33.587 1.00 16.74 ? 94   GLU A CG  1 
ATOM   526  C CD  . GLU A 1 66  ? 15.914 41.312 32.951 1.00 18.15 ? 94   GLU A CD  1 
ATOM   527  O OE1 . GLU A 1 66  ? 16.308 40.793 31.888 1.00 16.84 ? 94   GLU A OE1 1 
ATOM   528  O OE2 . GLU A 1 66  ? 16.505 42.262 33.504 1.00 22.67 ? 94   GLU A OE2 1 
ATOM   529  N N   . GLU A 1 67  ? 15.068 36.358 32.489 1.00 14.05 ? 95   GLU A N   1 
ATOM   530  C CA  . GLU A 1 67  ? 14.599 35.030 32.102 1.00 14.07 ? 95   GLU A CA  1 
ATOM   531  C C   . GLU A 1 67  ? 15.243 33.931 32.942 1.00 14.16 ? 95   GLU A C   1 
ATOM   532  O O   . GLU A 1 67  ? 14.626 32.895 33.200 1.00 13.95 ? 95   GLU A O   1 
ATOM   533  C CB  . GLU A 1 67  ? 14.872 34.791 30.613 1.00 14.28 ? 95   GLU A CB  1 
ATOM   534  C CG  . GLU A 1 67  ? 14.153 35.787 29.710 1.00 17.69 ? 95   GLU A CG  1 
ATOM   535  C CD  . GLU A 1 67  ? 14.575 35.679 28.258 1.00 19.24 ? 95   GLU A CD  1 
ATOM   536  O OE1 . GLU A 1 67  ? 15.795 35.608 27.997 1.00 19.39 ? 95   GLU A OE1 1 
ATOM   537  O OE2 . GLU A 1 67  ? 13.689 35.679 27.380 1.00 23.25 ? 95   GLU A OE2 1 
ATOM   538  N N   . ILE A 1 68  ? 16.481 34.155 33.370 1.00 14.81 ? 96   ILE A N   1 
ATOM   539  C CA  . ILE A 1 68  ? 17.170 33.175 34.199 1.00 13.32 ? 96   ILE A CA  1 
ATOM   540  C C   . ILE A 1 68  ? 16.430 33.058 35.527 1.00 13.64 ? 96   ILE A C   1 
ATOM   541  O O   . ILE A 1 68  ? 16.131 31.961 35.983 1.00 12.33 ? 96   ILE A O   1 
ATOM   542  C CB  . ILE A 1 68  ? 18.630 33.590 34.473 1.00 13.76 ? 96   ILE A CB  1 
ATOM   543  C CG1 . ILE A 1 68  ? 19.454 33.447 33.194 1.00 13.40 ? 96   ILE A CG1 1 
ATOM   544  C CG2 . ILE A 1 68  ? 19.217 32.734 35.597 1.00 11.76 ? 96   ILE A CG2 1 
ATOM   545  C CD1 . ILE A 1 68  ? 20.883 33.929 33.330 1.00 16.30 ? 96   ILE A CD1 1 
ATOM   546  N N   . VAL A 1 69  ? 16.129 34.200 36.134 1.00 13.23 ? 97   VAL A N   1 
ATOM   547  C CA  . VAL A 1 69  ? 15.424 34.225 37.406 1.00 14.38 ? 97   VAL A CA  1 
ATOM   548  C C   . VAL A 1 69  ? 14.013 33.653 37.284 1.00 14.88 ? 97   VAL A C   1 
ATOM   549  O O   . VAL A 1 69  ? 13.566 32.899 38.149 1.00 14.28 ? 97   VAL A O   1 
ATOM   550  C CB  . VAL A 1 69  ? 15.342 35.668 37.958 1.00 15.71 ? 97   VAL A CB  1 
ATOM   551  C CG1 . VAL A 1 69  ? 14.474 35.705 39.208 1.00 15.49 ? 97   VAL A CG1 1 
ATOM   552  C CG2 . VAL A 1 69  ? 16.750 36.177 38.275 1.00 15.05 ? 97   VAL A CG2 1 
ATOM   553  N N   . GLU A 1 70  ? 13.315 34.017 36.212 1.00 15.20 ? 98   GLU A N   1 
ATOM   554  C CA  . GLU A 1 70  ? 11.955 33.539 35.980 1.00 15.67 ? 98   GLU A CA  1 
ATOM   555  C C   . GLU A 1 70  ? 11.950 32.025 35.785 1.00 15.64 ? 98   GLU A C   1 
ATOM   556  O O   . GLU A 1 70  ? 11.101 31.319 36.332 1.00 14.20 ? 98   GLU A O   1 
ATOM   557  C CB  . GLU A 1 70  ? 11.367 34.211 34.738 1.00 19.84 ? 98   GLU A CB  1 
ATOM   558  C CG  . GLU A 1 70  ? 9.901  33.894 34.494 1.00 25.75 ? 98   GLU A CG  1 
ATOM   559  C CD  . GLU A 1 70  ? 9.457  34.230 33.081 1.00 30.36 ? 98   GLU A CD  1 
ATOM   560  O OE1 . GLU A 1 70  ? 8.235  34.355 32.858 1.00 32.33 ? 98   GLU A OE1 1 
ATOM   561  O OE2 . GLU A 1 70  ? 10.328 34.355 32.189 1.00 32.03 ? 98   GLU A OE2 1 
ATOM   562  N N   . LEU A 1 71  ? 12.900 31.536 34.993 1.00 13.52 ? 99   LEU A N   1 
ATOM   563  C CA  . LEU A 1 71  ? 13.019 30.109 34.726 1.00 14.30 ? 99   LEU A CA  1 
ATOM   564  C C   . LEU A 1 71  ? 13.262 29.333 36.020 1.00 14.42 ? 99   LEU A C   1 
ATOM   565  O O   . LEU A 1 71  ? 12.573 28.354 36.302 1.00 15.74 ? 99   LEU A O   1 
ATOM   566  C CB  . LEU A 1 71  ? 14.169 29.853 33.745 1.00 13.34 ? 99   LEU A CB  1 
ATOM   567  C CG  . LEU A 1 71  ? 14.550 28.392 33.491 1.00 9.88  ? 99   LEU A CG  1 
ATOM   568  C CD1 . LEU A 1 71  ? 13.393 27.668 32.827 1.00 11.84 ? 99   LEU A CD1 1 
ATOM   569  C CD2 . LEU A 1 71  ? 15.800 28.330 32.617 1.00 11.80 ? 99   LEU A CD2 1 
ATOM   570  N N   . MET A 1 72  ? 14.237 29.779 36.808 1.00 14.87 ? 100  MET A N   1 
ATOM   571  C CA  . MET A 1 72  ? 14.569 29.120 38.069 1.00 16.10 ? 100  MET A CA  1 
ATOM   572  C C   . MET A 1 72  ? 13.409 29.155 39.062 1.00 16.10 ? 100  MET A C   1 
ATOM   573  O O   . MET A 1 72  ? 13.128 28.165 39.737 1.00 16.72 ? 100  MET A O   1 
ATOM   574  C CB  . MET A 1 72  ? 15.805 29.771 38.694 1.00 19.45 ? 100  MET A CB  1 
ATOM   575  C CG  . MET A 1 72  ? 17.086 29.529 37.917 1.00 21.80 ? 100  MET A CG  1 
ATOM   576  S SD  . MET A 1 72  ? 17.463 27.770 37.767 1.00 27.00 ? 100  MET A SD  1 
ATOM   577  C CE  . MET A 1 72  ? 17.016 27.481 36.109 1.00 18.35 ? 100  MET A CE  1 
ATOM   578  N N   . ARG A 1 73  ? 12.742 30.298 39.157 1.00 15.69 ? 101  ARG A N   1 
ATOM   579  C CA  . ARG A 1 73  ? 11.604 30.430 40.061 1.00 15.84 ? 101  ARG A CA  1 
ATOM   580  C C   . ARG A 1 73  ? 10.503 29.454 39.634 1.00 14.56 ? 101  ARG A C   1 
ATOM   581  O O   . ARG A 1 73  ? 9.953  28.720 40.458 1.00 13.92 ? 101  ARG A O   1 
ATOM   582  C CB  . ARG A 1 73  ? 11.089 31.871 40.033 1.00 18.97 ? 101  ARG A CB  1 
ATOM   583  C CG  . ARG A 1 73  ? 9.846  32.138 40.872 1.00 22.23 ? 101  ARG A CG  1 
ATOM   584  C CD  . ARG A 1 73  ? 9.622  33.641 40.994 1.00 26.92 ? 101  ARG A CD  1 
ATOM   585  N NE  . ARG A 1 73  ? 9.773  34.309 39.703 1.00 31.48 ? 101  ARG A NE  1 
ATOM   586  C CZ  . ARG A 1 73  ? 10.411 35.462 39.524 1.00 32.40 ? 101  ARG A CZ  1 
ATOM   587  N NH1 . ARG A 1 73  ? 10.966 36.086 40.556 1.00 32.78 ? 101  ARG A NH1 1 
ATOM   588  N NH2 . ARG A 1 73  ? 10.506 35.990 38.310 1.00 33.03 ? 101  ARG A NH2 1 
ATOM   589  N N   . ASP A 1 74  ? 10.197 29.431 38.341 1.00 13.99 ? 102  ASP A N   1 
ATOM   590  C CA  . ASP A 1 74  ? 9.162  28.540 37.822 1.00 13.93 ? 102  ASP A CA  1 
ATOM   591  C C   . ASP A 1 74  ? 9.481  27.069 38.100 1.00 14.45 ? 102  ASP A C   1 
ATOM   592  O O   . ASP A 1 74  ? 8.620  26.310 38.547 1.00 13.15 ? 102  ASP A O   1 
ATOM   593  C CB  . ASP A 1 74  ? 8.985  28.753 36.316 1.00 14.81 ? 102  ASP A CB  1 
ATOM   594  C CG  . ASP A 1 74  ? 8.292  30.065 35.987 1.00 17.97 ? 102  ASP A CG  1 
ATOM   595  O OD1 . ASP A 1 74  ? 8.180  30.395 34.787 1.00 17.73 ? 102  ASP A OD1 1 
ATOM   596  O OD2 . ASP A 1 74  ? 7.855  30.765 36.922 1.00 18.82 ? 102  ASP A OD2 1 
ATOM   597  N N   . VAL A 1 75  ? 10.719 26.671 37.836 1.00 13.39 ? 103  VAL A N   1 
ATOM   598  C CA  . VAL A 1 75  ? 11.136 25.294 38.061 1.00 13.94 ? 103  VAL A CA  1 
ATOM   599  C C   . VAL A 1 75  ? 11.060 24.920 39.543 1.00 14.75 ? 103  VAL A C   1 
ATOM   600  O O   . VAL A 1 75  ? 10.646 23.814 39.885 1.00 15.03 ? 103  VAL A O   1 
ATOM   601  C CB  . VAL A 1 75  ? 12.572 25.065 37.542 1.00 13.32 ? 103  VAL A CB  1 
ATOM   602  C CG1 . VAL A 1 75  ? 13.061 23.682 37.941 1.00 13.83 ? 103  VAL A CG1 1 
ATOM   603  C CG2 . VAL A 1 75  ? 12.596 25.217 36.020 1.00 12.94 ? 103  VAL A CG2 1 
ATOM   604  N N   . SER A 1 76  ? 11.437 25.848 40.418 1.00 15.04 ? 104  SER A N   1 
ATOM   605  C CA  . SER A 1 76  ? 11.406 25.592 41.856 1.00 14.68 ? 104  SER A CA  1 
ATOM   606  C C   . SER A 1 76  ? 9.978  25.459 42.385 1.00 15.99 ? 104  SER A C   1 
ATOM   607  O O   . SER A 1 76  ? 9.758  24.892 43.458 1.00 15.86 ? 104  SER A O   1 
ATOM   608  C CB  . SER A 1 76  ? 12.127 26.710 42.621 1.00 14.44 ? 104  SER A CB  1 
ATOM   609  O OG  . SER A 1 76  ? 11.380 27.917 42.612 1.00 15.20 ? 104  SER A OG  1 
ATOM   610  N N   . LYS A 1 77  ? 9.011  25.982 41.637 1.00 15.76 ? 105  LYS A N   1 
ATOM   611  C CA  . LYS A 1 77  ? 7.616  25.907 42.053 1.00 17.59 ? 105  LYS A CA  1 
ATOM   612  C C   . LYS A 1 77  ? 6.886  24.696 41.481 1.00 17.53 ? 105  LYS A C   1 
ATOM   613  O O   . LYS A 1 77  ? 5.677  24.538 41.668 1.00 17.77 ? 105  LYS A O   1 
ATOM   614  C CB  . LYS A 1 77  ? 6.883  27.198 41.680 1.00 18.85 ? 105  LYS A CB  1 
ATOM   615  C CG  . LYS A 1 77  ? 7.341  28.397 42.491 1.00 22.45 ? 105  LYS A CG  1 
ATOM   616  C CD  . LYS A 1 77  ? 6.569  29.653 42.135 1.00 26.72 ? 105  LYS A CD  1 
ATOM   617  C CE  . LYS A 1 77  ? 7.017  30.828 42.991 1.00 30.01 ? 105  LYS A CE  1 
ATOM   618  N NZ  . LYS A 1 77  ? 6.333  32.097 42.604 1.00 33.88 ? 105  LYS A NZ  1 
ATOM   619  N N   . GLU A 1 78  ? 7.617  23.844 40.772 1.00 15.66 ? 106  GLU A N   1 
ATOM   620  C CA  . GLU A 1 78  ? 7.025  22.631 40.227 1.00 15.41 ? 106  GLU A CA  1 
ATOM   621  C C   . GLU A 1 78  ? 6.962  21.627 41.373 1.00 14.72 ? 106  GLU A C   1 
ATOM   622  O O   . GLU A 1 78  ? 7.609  21.819 42.402 1.00 11.55 ? 106  GLU A O   1 
ATOM   623  C CB  . GLU A 1 78  ? 7.890  22.063 39.098 1.00 16.21 ? 106  GLU A CB  1 
ATOM   624  C CG  . GLU A 1 78  ? 7.629  22.688 37.740 1.00 17.26 ? 106  GLU A CG  1 
ATOM   625  C CD  . GLU A 1 78  ? 8.519  22.114 36.655 1.00 18.55 ? 106  GLU A CD  1 
ATOM   626  O OE1 . GLU A 1 78  ? 8.861  20.913 36.728 1.00 17.78 ? 106  GLU A OE1 1 
ATOM   627  O OE2 . GLU A 1 78  ? 8.867  22.863 35.722 1.00 21.22 ? 106  GLU A OE2 1 
ATOM   628  N N   . ASP A 1 79  ? 6.176  20.569 41.199 1.00 14.77 ? 107  ASP A N   1 
ATOM   629  C CA  . ASP A 1 79  ? 6.060  19.537 42.220 1.00 14.89 ? 107  ASP A CA  1 
ATOM   630  C C   . ASP A 1 79  ? 7.116  18.479 41.925 1.00 12.77 ? 107  ASP A C   1 
ATOM   631  O O   . ASP A 1 79  ? 6.970  17.691 40.992 1.00 13.30 ? 107  ASP A O   1 
ATOM   632  C CB  . ASP A 1 79  ? 4.673  18.894 42.182 1.00 18.94 ? 107  ASP A CB  1 
ATOM   633  C CG  . ASP A 1 79  ? 4.417  17.996 43.373 1.00 21.54 ? 107  ASP A CG  1 
ATOM   634  O OD1 . ASP A 1 79  ? 5.397  17.501 43.973 1.00 19.24 ? 107  ASP A OD1 1 
ATOM   635  O OD2 . ASP A 1 79  ? 3.234  17.776 43.704 1.00 23.52 ? 107  ASP A OD2 1 
ATOM   636  N N   . HIS A 1 80  ? 8.178  18.469 42.721 1.00 12.65 ? 108  HIS A N   1 
ATOM   637  C CA  . HIS A 1 80  ? 9.276  17.523 42.541 1.00 11.73 ? 108  HIS A CA  1 
ATOM   638  C C   . HIS A 1 80  ? 9.106  16.273 43.410 1.00 12.55 ? 108  HIS A C   1 
ATOM   639  O O   . HIS A 1 80  ? 10.045 15.495 43.570 1.00 10.25 ? 108  HIS A O   1 
ATOM   640  C CB  . HIS A 1 80  ? 10.602 18.204 42.898 1.00 13.51 ? 108  HIS A CB  1 
ATOM   641  C CG  . HIS A 1 80  ? 10.929 19.392 42.045 1.00 12.84 ? 108  HIS A CG  1 
ATOM   642  N ND1 . HIS A 1 80  ? 11.689 19.300 40.899 1.00 13.49 ? 108  HIS A ND1 1 
ATOM   643  C CD2 . HIS A 1 80  ? 10.601 20.700 42.173 1.00 13.94 ? 108  HIS A CD2 1 
ATOM   644  C CE1 . HIS A 1 80  ? 11.816 20.500 40.359 1.00 15.12 ? 108  HIS A CE1 1 
ATOM   645  N NE2 . HIS A 1 80  ? 11.165 21.367 41.114 1.00 13.39 ? 108  HIS A NE2 1 
ATOM   646  N N   . SER A 1 81  ? 7.912  16.079 43.962 1.00 12.54 ? 109  SER A N   1 
ATOM   647  C CA  . SER A 1 81  ? 7.643  14.933 44.834 1.00 15.99 ? 109  SER A CA  1 
ATOM   648  C C   . SER A 1 81  ? 8.121  13.570 44.338 1.00 17.04 ? 109  SER A C   1 
ATOM   649  O O   . SER A 1 81  ? 8.659  12.782 45.114 1.00 18.44 ? 109  SER A O   1 
ATOM   650  C CB  . SER A 1 81  ? 6.147  14.843 45.144 1.00 17.75 ? 109  SER A CB  1 
ATOM   651  O OG  . SER A 1 81  ? 5.744  15.914 45.974 1.00 19.99 ? 109  SER A OG  1 
ATOM   652  N N   . LYS A 1 82  ? 7.924  13.288 43.054 1.00 16.92 ? 110  LYS A N   1 
ATOM   653  C CA  . LYS A 1 82  ? 8.325  11.999 42.500 1.00 17.26 ? 110  LYS A CA  1 
ATOM   654  C C   . LYS A 1 82  ? 9.718  11.998 41.875 1.00 15.74 ? 110  LYS A C   1 
ATOM   655  O O   . LYS A 1 82  ? 10.094 11.048 41.188 1.00 14.65 ? 110  LYS A O   1 
ATOM   656  C CB  . LYS A 1 82  ? 7.301  11.543 41.460 1.00 19.74 ? 110  LYS A CB  1 
ATOM   657  C CG  . LYS A 1 82  ? 5.899  11.363 42.014 1.00 25.48 ? 110  LYS A CG  1 
ATOM   658  C CD  . LYS A 1 82  ? 4.963  10.818 40.948 1.00 29.58 ? 110  LYS A CD  1 
ATOM   659  C CE  . LYS A 1 82  ? 3.571  10.566 41.505 1.00 32.93 ? 110  LYS A CE  1 
ATOM   660  N NZ  . LYS A 1 82  ? 2.664  10.001 40.464 1.00 35.52 ? 110  LYS A NZ  1 
ATOM   661  N N   . ARG A 1 83  ? 10.481 13.058 42.126 1.00 14.59 ? 111  ARG A N   1 
ATOM   662  C CA  . ARG A 1 83  ? 11.828 13.185 41.584 1.00 12.91 ? 111  ARG A CA  1 
ATOM   663  C C   . ARG A 1 83  ? 12.882 12.971 42.673 1.00 12.43 ? 111  ARG A C   1 
ATOM   664  O O   . ARG A 1 83  ? 12.729 13.456 43.793 1.00 11.38 ? 111  ARG A O   1 
ATOM   665  C CB  . ARG A 1 83  ? 11.975 14.566 40.940 1.00 12.02 ? 111  ARG A CB  1 
ATOM   666  C CG  . ARG A 1 83  ? 11.017 14.763 39.766 1.00 11.41 ? 111  ARG A CG  1 
ATOM   667  C CD  . ARG A 1 83  ? 10.893 16.219 39.361 1.00 11.57 ? 111  ARG A CD  1 
ATOM   668  N NE  . ARG A 1 83  ? 9.934  16.391 38.270 1.00 12.30 ? 111  ARG A NE  1 
ATOM   669  C CZ  . ARG A 1 83  ? 9.464  17.566 37.866 1.00 13.93 ? 111  ARG A CZ  1 
ATOM   670  N NH1 . ARG A 1 83  ? 9.861  18.682 38.464 1.00 13.72 ? 111  ARG A NH1 1 
ATOM   671  N NH2 . ARG A 1 83  ? 8.596  17.628 36.863 1.00 14.34 ? 111  ARG A NH2 1 
ATOM   672  N N   . SER A 1 84  ? 13.944 12.240 42.336 1.00 11.56 ? 112  SER A N   1 
ATOM   673  C CA  . SER A 1 84  ? 15.010 11.931 43.287 1.00 11.47 ? 112  SER A CA  1 
ATOM   674  C C   . SER A 1 84  ? 15.960 13.090 43.557 1.00 11.66 ? 112  SER A C   1 
ATOM   675  O O   . SER A 1 84  ? 16.508 13.215 44.657 1.00 9.24  ? 112  SER A O   1 
ATOM   676  C CB  . SER A 1 84  ? 15.845 10.739 42.791 1.00 11.98 ? 112  SER A CB  1 
ATOM   677  O OG  . SER A 1 84  ? 15.046 9.593  42.540 1.00 12.49 ? 112  SER A OG  1 
ATOM   678  N N   . SER A 1 85  ? 16.159 13.937 42.555 1.00 11.51 ? 113  SER A N   1 
ATOM   679  C CA  . SER A 1 85  ? 17.093 15.047 42.694 1.00 9.55  ? 113  SER A CA  1 
ATOM   680  C C   . SER A 1 85  ? 16.795 16.178 41.725 1.00 9.88  ? 113  SER A C   1 
ATOM   681  O O   . SER A 1 85  ? 15.803 16.146 41.003 1.00 9.24  ? 113  SER A O   1 
ATOM   682  C CB  . SER A 1 85  ? 18.501 14.536 42.416 1.00 10.53 ? 113  SER A CB  1 
ATOM   683  O OG  . SER A 1 85  ? 18.582 14.067 41.079 1.00 10.64 ? 113  SER A OG  1 
ATOM   684  N N   . PHE A 1 86  ? 17.678 17.172 41.720 1.00 9.03  ? 114  PHE A N   1 
ATOM   685  C CA  . PHE A 1 86  ? 17.566 18.316 40.824 1.00 11.06 ? 114  PHE A CA  1 
ATOM   686  C C   . PHE A 1 86  ? 18.961 18.698 40.348 1.00 9.99  ? 114  PHE A C   1 
ATOM   687  O O   . PHE A 1 86  ? 19.912 18.719 41.133 1.00 11.41 ? 114  PHE A O   1 
ATOM   688  C CB  . PHE A 1 86  ? 16.937 19.525 41.525 1.00 9.45  ? 114  PHE A CB  1 
ATOM   689  C CG  . PHE A 1 86  ? 16.897 20.762 40.663 1.00 11.36 ? 114  PHE A CG  1 
ATOM   690  C CD1 . PHE A 1 86  ? 16.070 20.819 39.547 1.00 9.66  ? 114  PHE A CD1 1 
ATOM   691  C CD2 . PHE A 1 86  ? 17.719 21.854 40.945 1.00 11.12 ? 114  PHE A CD2 1 
ATOM   692  C CE1 . PHE A 1 86  ? 16.057 21.940 38.721 1.00 9.03  ? 114  PHE A CE1 1 
ATOM   693  C CE2 . PHE A 1 86  ? 17.717 22.982 40.128 1.00 8.99  ? 114  PHE A CE2 1 
ATOM   694  C CZ  . PHE A 1 86  ? 16.883 23.026 39.011 1.00 10.15 ? 114  PHE A CZ  1 
ATOM   695  N N   . VAL A 1 87  ? 19.077 18.992 39.059 1.00 10.92 ? 115  VAL A N   1 
ATOM   696  C CA  . VAL A 1 87  ? 20.347 19.384 38.472 1.00 10.46 ? 115  VAL A CA  1 
ATOM   697  C C   . VAL A 1 87  ? 20.186 20.620 37.598 1.00 11.81 ? 115  VAL A C   1 
ATOM   698  O O   . VAL A 1 87  ? 19.257 20.715 36.791 1.00 11.34 ? 115  VAL A O   1 
ATOM   699  C CB  . VAL A 1 87  ? 20.945 18.259 37.593 1.00 11.43 ? 115  VAL A CB  1 
ATOM   700  C CG1 . VAL A 1 87  ? 22.235 18.736 36.952 1.00 10.99 ? 115  VAL A CG1 1 
ATOM   701  C CG2 . VAL A 1 87  ? 21.204 17.015 38.431 1.00 11.08 ? 115  VAL A CG2 1 
ATOM   702  N N   . CYS A 1 88  ? 21.100 21.566 37.764 1.00 10.47 ? 116  CYS A N   1 
ATOM   703  C CA  . CYS A 1 88  ? 21.087 22.783 36.972 1.00 8.56  ? 116  CYS A CA  1 
ATOM   704  C C   . CYS A 1 88  ? 22.505 23.040 36.491 1.00 7.99  ? 116  CYS A C   1 
ATOM   705  O O   . CYS A 1 88  ? 23.435 23.078 37.287 1.00 7.53  ? 116  CYS A O   1 
ATOM   706  C CB  . CYS A 1 88  ? 20.609 23.976 37.809 1.00 10.14 ? 116  CYS A CB  1 
ATOM   707  S SG  . CYS A 1 88  ? 20.739 25.573 36.951 1.00 12.37 ? 116  CYS A SG  1 
ATOM   708  N N   . VAL A 1 89  ? 22.670 23.208 35.185 1.00 6.74  ? 117  VAL A N   1 
ATOM   709  C CA  . VAL A 1 89  ? 23.983 23.483 34.628 1.00 7.63  ? 117  VAL A CA  1 
ATOM   710  C C   . VAL A 1 89  ? 23.980 24.896 34.050 1.00 8.38  ? 117  VAL A C   1 
ATOM   711  O O   . VAL A 1 89  ? 23.127 25.236 33.230 1.00 11.53 ? 117  VAL A O   1 
ATOM   712  C CB  . VAL A 1 89  ? 24.338 22.476 33.519 1.00 7.94  ? 117  VAL A CB  1 
ATOM   713  C CG1 . VAL A 1 89  ? 25.774 22.676 33.084 1.00 10.45 ? 117  VAL A CG1 1 
ATOM   714  C CG2 . VAL A 1 89  ? 24.115 21.053 34.018 1.00 9.22  ? 117  VAL A CG2 1 
ATOM   715  N N   . LEU A 1 90  ? 24.918 25.724 34.499 1.00 9.62  ? 118  LEU A N   1 
ATOM   716  C CA  . LEU A 1 90  ? 25.019 27.102 34.019 1.00 9.20  ? 118  LEU A CA  1 
ATOM   717  C C   . LEU A 1 90  ? 26.274 27.253 33.170 1.00 8.26  ? 118  LEU A C   1 
ATOM   718  O O   . LEU A 1 90  ? 27.386 27.032 33.646 1.00 9.28  ? 118  LEU A O   1 
ATOM   719  C CB  . LEU A 1 90  ? 25.067 28.073 35.205 1.00 9.36  ? 118  LEU A CB  1 
ATOM   720  C CG  . LEU A 1 90  ? 23.911 27.970 36.210 1.00 10.72 ? 118  LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 90  ? 24.222 28.801 37.447 1.00 14.56 ? 118  LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 90  ? 22.614 28.435 35.560 1.00 13.00 ? 118  LEU A CD2 1 
ATOM   723  N N   . LEU A 1 91  ? 26.087 27.624 31.908 1.00 8.21  ? 119  LEU A N   1 
ATOM   724  C CA  . LEU A 1 91  ? 27.196 27.801 30.976 1.00 8.77  ? 119  LEU A CA  1 
ATOM   725  C C   . LEU A 1 91  ? 27.176 29.263 30.541 1.00 9.32  ? 119  LEU A C   1 
ATOM   726  O O   . LEU A 1 91  ? 26.289 29.676 29.797 1.00 11.33 ? 119  LEU A O   1 
ATOM   727  C CB  . LEU A 1 91  ? 27.004 26.884 29.757 1.00 6.76  ? 119  LEU A CB  1 
ATOM   728  C CG  . LEU A 1 91  ? 26.711 25.398 30.022 1.00 8.66  ? 119  LEU A CG  1 
ATOM   729  C CD1 . LEU A 1 91  ? 26.373 24.698 28.703 1.00 8.22  ? 119  LEU A CD1 1 
ATOM   730  C CD2 . LEU A 1 91  ? 27.914 24.729 30.679 1.00 6.13  ? 119  LEU A CD2 1 
ATOM   731  N N   . SER A 1 92  ? 28.147 30.047 30.999 1.00 10.31 ? 120  SER A N   1 
ATOM   732  C CA  . SER A 1 92  ? 28.169 31.466 30.655 1.00 11.49 ? 120  SER A CA  1 
ATOM   733  C C   . SER A 1 92  ? 29.419 32.161 31.172 1.00 13.25 ? 120  SER A C   1 
ATOM   734  O O   . SER A 1 92  ? 30.310 31.525 31.738 1.00 13.79 ? 120  SER A O   1 
ATOM   735  C CB  . SER A 1 92  ? 26.935 32.147 31.262 1.00 11.38 ? 120  SER A CB  1 
ATOM   736  O OG  . SER A 1 92  ? 26.853 33.512 30.897 1.00 10.81 ? 120  SER A OG  1 
ATOM   737  N N   . HIS A 1 93  ? 29.488 33.471 30.953 1.00 13.24 ? 121  HIS A N   1 
ATOM   738  C CA  . HIS A 1 93  ? 30.599 34.266 31.456 1.00 13.76 ? 121  HIS A CA  1 
ATOM   739  C C   . HIS A 1 93  ? 30.235 34.440 32.926 1.00 14.22 ? 121  HIS A C   1 
ATOM   740  O O   . HIS A 1 93  ? 29.079 34.251 33.299 1.00 12.54 ? 121  HIS A O   1 
ATOM   741  C CB  . HIS A 1 93  ? 30.637 35.654 30.800 1.00 16.20 ? 121  HIS A CB  1 
ATOM   742  C CG  . HIS A 1 93  ? 31.048 35.648 29.360 1.00 17.76 ? 121  HIS A CG  1 
ATOM   743  N ND1 . HIS A 1 93  ? 32.264 35.158 28.935 1.00 20.61 ? 121  HIS A ND1 1 
ATOM   744  C CD2 . HIS A 1 93  ? 30.432 36.133 28.256 1.00 18.14 ? 121  HIS A CD2 1 
ATOM   745  C CE1 . HIS A 1 93  ? 32.380 35.343 27.632 1.00 19.61 ? 121  HIS A CE1 1 
ATOM   746  N NE2 . HIS A 1 93  ? 31.282 35.934 27.195 1.00 17.75 ? 121  HIS A NE2 1 
ATOM   747  N N   . GLY A 1 94  ? 31.200 34.805 33.760 1.00 13.46 ? 122  GLY A N   1 
ATOM   748  C CA  . GLY A 1 94  ? 30.882 34.998 35.161 1.00 14.12 ? 122  GLY A CA  1 
ATOM   749  C C   . GLY A 1 94  ? 32.012 35.590 35.971 1.00 15.22 ? 122  GLY A C   1 
ATOM   750  O O   . GLY A 1 94  ? 33.103 35.825 35.456 1.00 14.70 ? 122  GLY A O   1 
ATOM   751  N N   . GLU A 1 95  ? 31.725 35.852 37.241 1.00 15.91 ? 123  GLU A N   1 
ATOM   752  C CA  . GLU A 1 95  ? 32.699 36.390 38.180 1.00 17.20 ? 123  GLU A CA  1 
ATOM   753  C C   . GLU A 1 95  ? 32.382 35.660 39.475 1.00 17.32 ? 123  GLU A C   1 
ATOM   754  O O   . GLU A 1 95  ? 31.423 34.892 39.525 1.00 17.07 ? 123  GLU A O   1 
ATOM   755  C CB  . GLU A 1 95  ? 32.512 37.902 38.357 1.00 20.39 ? 123  GLU A CB  1 
ATOM   756  C CG  . GLU A 1 95  ? 32.487 38.678 37.041 1.00 23.99 ? 123  GLU A CG  1 
ATOM   757  C CD  . GLU A 1 95  ? 32.513 40.187 37.237 1.00 28.23 ? 123  GLU A CD  1 
ATOM   758  O OE1 . GLU A 1 95  ? 31.764 40.699 38.098 1.00 28.50 ? 123  GLU A OE1 1 
ATOM   759  O OE2 . GLU A 1 95  ? 33.280 40.864 36.519 1.00 31.61 ? 123  GLU A OE2 1 
ATOM   760  N N   . GLU A 1 96  ? 33.172 35.878 40.519 1.00 17.18 ? 124  GLU A N   1 
ATOM   761  C CA  . GLU A 1 96  ? 32.913 35.192 41.779 1.00 16.39 ? 124  GLU A CA  1 
ATOM   762  C C   . GLU A 1 96  ? 31.471 35.422 42.241 1.00 16.25 ? 124  GLU A C   1 
ATOM   763  O O   . GLU A 1 96  ? 31.035 36.567 42.380 1.00 14.97 ? 124  GLU A O   1 
ATOM   764  C CB  . GLU A 1 96  ? 33.880 35.675 42.863 1.00 16.65 ? 124  GLU A CB  1 
ATOM   765  C CG  . GLU A 1 96  ? 33.801 34.860 44.138 1.00 17.22 ? 124  GLU A CG  1 
ATOM   766  C CD  . GLU A 1 96  ? 34.243 33.428 43.931 1.00 19.57 ? 124  GLU A CD  1 
ATOM   767  O OE1 . GLU A 1 96  ? 35.451 33.205 43.689 1.00 18.61 ? 124  GLU A OE1 1 
ATOM   768  O OE2 . GLU A 1 96  ? 33.386 32.524 44.005 1.00 20.67 ? 124  GLU A OE2 1 
ATOM   769  N N   . GLY A 1 97  ? 30.745 34.326 42.459 1.00 14.46 ? 125  GLY A N   1 
ATOM   770  C CA  . GLY A 1 97  ? 29.366 34.392 42.914 1.00 14.67 ? 125  GLY A CA  1 
ATOM   771  C C   . GLY A 1 97  ? 28.364 34.937 41.909 1.00 15.30 ? 125  GLY A C   1 
ATOM   772  O O   . GLY A 1 97  ? 27.201 35.164 42.246 1.00 14.42 ? 125  GLY A O   1 
ATOM   773  N N   . ILE A 1 98  ? 28.797 35.126 40.669 1.00 14.87 ? 126  ILE A N   1 
ATOM   774  C CA  . ILE A 1 98  ? 27.922 35.682 39.646 1.00 15.79 ? 126  ILE A CA  1 
ATOM   775  C C   . ILE A 1 98  ? 27.925 34.909 38.333 1.00 15.50 ? 126  ILE A C   1 
ATOM   776  O O   . ILE A 1 98  ? 28.950 34.372 37.920 1.00 15.20 ? 126  ILE A O   1 
ATOM   777  C CB  . ILE A 1 98  ? 28.326 37.147 39.348 1.00 17.85 ? 126  ILE A CB  1 
ATOM   778  C CG1 . ILE A 1 98  ? 28.126 38.000 40.603 1.00 18.00 ? 126  ILE A CG1 1 
ATOM   779  C CG2 . ILE A 1 98  ? 27.530 37.690 38.169 1.00 19.17 ? 126  ILE A CG2 1 
ATOM   780  C CD1 . ILE A 1 98  ? 28.678 39.408 40.485 1.00 20.62 ? 126  ILE A CD1 1 
ATOM   781  N N   . ILE A 1 99  ? 26.761 34.860 37.690 1.00 15.63 ? 127  ILE A N   1 
ATOM   782  C CA  . ILE A 1 99  ? 26.598 34.204 36.398 1.00 14.41 ? 127  ILE A CA  1 
ATOM   783  C C   . ILE A 1 99  ? 25.942 35.257 35.508 1.00 14.28 ? 127  ILE A C   1 
ATOM   784  O O   . ILE A 1 99  ? 25.004 35.931 35.924 1.00 13.26 ? 127  ILE A O   1 
ATOM   785  C CB  . ILE A 1 99  ? 25.689 32.949 36.495 1.00 16.76 ? 127  ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 99  ? 25.717 32.188 35.171 1.00 18.84 ? 127  ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 99  ? 24.257 33.344 36.846 1.00 17.71 ? 127  ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 99  ? 27.072 31.565 34.851 1.00 19.69 ? 127  ILE A CD1 1 
ATOM   789  N N   . PHE A 1 100 ? 26.425 35.407 34.283 1.00 13.35 ? 128  PHE A N   1 
ATOM   790  C CA  . PHE A 1 100 ? 25.865 36.429 33.414 1.00 14.47 ? 128  PHE A CA  1 
ATOM   791  C C   . PHE A 1 100 ? 24.723 36.017 32.509 1.00 13.72 ? 128  PHE A C   1 
ATOM   792  O O   . PHE A 1 100 ? 24.778 34.987 31.836 1.00 11.84 ? 128  PHE A O   1 
ATOM   793  C CB  . PHE A 1 100 ? 26.969 37.049 32.557 1.00 15.95 ? 128  PHE A CB  1 
ATOM   794  C CG  . PHE A 1 100 ? 27.804 38.051 33.288 1.00 18.24 ? 128  PHE A CG  1 
ATOM   795  C CD1 . PHE A 1 100 ? 27.356 39.358 33.453 1.00 18.91 ? 128  PHE A CD1 1 
ATOM   796  C CD2 . PHE A 1 100 ? 29.029 37.687 33.834 1.00 19.74 ? 128  PHE A CD2 1 
ATOM   797  C CE1 . PHE A 1 100 ? 28.120 40.291 34.154 1.00 20.40 ? 128  PHE A CE1 1 
ATOM   798  C CE2 . PHE A 1 100 ? 29.799 38.612 34.537 1.00 20.75 ? 128  PHE A CE2 1 
ATOM   799  C CZ  . PHE A 1 100 ? 29.343 39.916 34.696 1.00 19.69 ? 128  PHE A CZ  1 
ATOM   800  N N   . GLY A 1 101 ? 23.673 36.830 32.529 1.00 12.55 ? 129  GLY A N   1 
ATOM   801  C CA  . GLY A 1 101 ? 22.545 36.610 31.651 1.00 12.63 ? 129  GLY A CA  1 
ATOM   802  C C   . GLY A 1 101 ? 23.007 37.343 30.405 1.00 13.90 ? 129  GLY A C   1 
ATOM   803  O O   . GLY A 1 101 ? 24.079 37.945 30.422 1.00 12.78 ? 129  GLY A O   1 
ATOM   804  N N   . THR A 1 102 ? 22.232 37.309 29.331 1.00 13.22 ? 130  THR A N   1 
ATOM   805  C CA  . THR A 1 102 ? 22.640 37.986 28.106 1.00 14.51 ? 130  THR A CA  1 
ATOM   806  C C   . THR A 1 102 ? 22.654 39.513 28.219 1.00 15.61 ? 130  THR A C   1 
ATOM   807  O O   . THR A 1 102 ? 23.271 40.191 27.398 1.00 16.54 ? 130  THR A O   1 
ATOM   808  C CB  . THR A 1 102 ? 21.723 37.596 26.937 1.00 15.10 ? 130  THR A CB  1 
ATOM   809  O OG1 . THR A 1 102 ? 20.377 37.975 27.242 1.00 14.55 ? 130  THR A OG1 1 
ATOM   810  C CG2 . THR A 1 102 ? 21.776 36.092 26.699 1.00 13.96 ? 130  THR A CG2 1 
ATOM   811  N N   . ASN A 1 103 ? 21.993 40.054 29.239 1.00 16.26 ? 131  ASN A N   1 
ATOM   812  C CA  . ASN A 1 103 ? 21.918 41.506 29.404 1.00 17.37 ? 131  ASN A CA  1 
ATOM   813  C C   . ASN A 1 103 ? 22.373 41.995 30.774 1.00 17.82 ? 131  ASN A C   1 
ATOM   814  O O   . ASN A 1 103 ? 22.069 43.121 31.170 1.00 18.82 ? 131  ASN A O   1 
ATOM   815  C CB  . ASN A 1 103 ? 20.479 41.971 29.154 1.00 16.98 ? 131  ASN A CB  1 
ATOM   816  C CG  . ASN A 1 103 ? 19.510 41.445 30.200 1.00 16.00 ? 131  ASN A CG  1 
ATOM   817  O OD1 . ASN A 1 103 ? 19.696 40.355 30.733 1.00 17.33 ? 131  ASN A OD1 1 
ATOM   818  N ND2 . ASN A 1 103 ? 18.465 42.213 30.488 1.00 13.42 ? 131  ASN A ND2 1 
ATOM   819  N N   . GLY A 1 104 ? 23.099 41.154 31.500 1.00 17.14 ? 132  GLY A N   1 
ATOM   820  C CA  . GLY A 1 104 ? 23.552 41.550 32.817 1.00 16.52 ? 132  GLY A CA  1 
ATOM   821  C C   . GLY A 1 104 ? 23.784 40.375 33.744 1.00 16.93 ? 132  GLY A C   1 
ATOM   822  O O   . GLY A 1 104 ? 23.470 39.233 33.401 1.00 15.96 ? 132  GLY A O   1 
ATOM   823  N N   . PRO A 1 105 ? 24.328 40.632 34.942 1.00 17.37 ? 133  PRO A N   1 
ATOM   824  C CA  . PRO A 1 105 ? 24.620 39.607 35.946 1.00 16.97 ? 133  PRO A CA  1 
ATOM   825  C C   . PRO A 1 105 ? 23.446 39.122 36.790 1.00 16.03 ? 133  PRO A C   1 
ATOM   826  O O   . PRO A 1 105 ? 22.425 39.797 36.927 1.00 13.82 ? 133  PRO A O   1 
ATOM   827  C CB  . PRO A 1 105 ? 25.679 40.278 36.808 1.00 18.48 ? 133  PRO A CB  1 
ATOM   828  C CG  . PRO A 1 105 ? 25.201 41.699 36.824 1.00 18.56 ? 133  PRO A CG  1 
ATOM   829  C CD  . PRO A 1 105 ? 24.872 41.937 35.363 1.00 18.69 ? 133  PRO A CD  1 
ATOM   830  N N   . VAL A 1 106 ? 23.621 37.933 37.352 1.00 14.41 ? 134  VAL A N   1 
ATOM   831  C CA  . VAL A 1 106 ? 22.640 37.318 38.230 1.00 16.16 ? 134  VAL A CA  1 
ATOM   832  C C   . VAL A 1 106 ? 23.428 36.701 39.379 1.00 16.80 ? 134  VAL A C   1 
ATOM   833  O O   . VAL A 1 106 ? 24.366 35.935 39.146 1.00 16.11 ? 134  VAL A O   1 
ATOM   834  C CB  . VAL A 1 106 ? 21.853 36.184 37.529 1.00 17.09 ? 134  VAL A CB  1 
ATOM   835  C CG1 . VAL A 1 106 ? 20.869 35.562 38.509 1.00 18.18 ? 134  VAL A CG1 1 
ATOM   836  C CG2 . VAL A 1 106 ? 21.119 36.719 36.316 1.00 18.08 ? 134  VAL A CG2 1 
ATOM   837  N N   . ASP A 1 107 ? 23.069 37.049 40.612 1.00 16.60 ? 135  ASP A N   1 
ATOM   838  C CA  . ASP A 1 107 ? 23.743 36.485 41.776 1.00 17.24 ? 135  ASP A CA  1 
ATOM   839  C C   . ASP A 1 107 ? 23.393 35.008 41.836 1.00 15.20 ? 135  ASP A C   1 
ATOM   840  O O   . ASP A 1 107 ? 22.225 34.646 41.738 1.00 14.43 ? 135  ASP A O   1 
ATOM   841  C CB  . ASP A 1 107 ? 23.257 37.144 43.070 1.00 19.14 ? 135  ASP A CB  1 
ATOM   842  C CG  . ASP A 1 107 ? 23.849 38.516 43.292 1.00 22.11 ? 135  ASP A CG  1 
ATOM   843  O OD1 . ASP A 1 107 ? 23.432 39.178 44.264 1.00 27.02 ? 135  ASP A OD1 1 
ATOM   844  O OD2 . ASP A 1 107 ? 24.729 38.932 42.511 1.00 24.59 ? 135  ASP A OD2 1 
ATOM   845  N N   . LEU A 1 108 ? 24.396 34.154 42.000 1.00 14.86 ? 136  LEU A N   1 
ATOM   846  C CA  . LEU A 1 108 ? 24.128 32.726 42.082 1.00 16.51 ? 136  LEU A CA  1 
ATOM   847  C C   . LEU A 1 108 ? 23.220 32.464 43.277 1.00 16.72 ? 136  LEU A C   1 
ATOM   848  O O   . LEU A 1 108 ? 22.355 31.587 43.239 1.00 17.51 ? 136  LEU A O   1 
ATOM   849  C CB  . LEU A 1 108 ? 25.437 31.946 42.227 1.00 16.65 ? 136  LEU A CB  1 
ATOM   850  C CG  . LEU A 1 108 ? 26.314 31.941 40.971 1.00 19.62 ? 136  LEU A CG  1 
ATOM   851  C CD1 . LEU A 1 108 ? 27.613 31.188 41.237 1.00 21.39 ? 136  LEU A CD1 1 
ATOM   852  C CD2 . LEU A 1 108 ? 25.546 31.288 39.826 1.00 21.20 ? 136  LEU A CD2 1 
ATOM   853  N N   . LYS A 1 109 ? 23.413 33.244 44.333 1.00 16.22 ? 137  LYS A N   1 
ATOM   854  C CA  . LYS A 1 109 ? 22.614 33.101 45.542 1.00 18.29 ? 137  LYS A CA  1 
ATOM   855  C C   . LYS A 1 109 ? 21.123 33.263 45.241 1.00 18.10 ? 137  LYS A C   1 
ATOM   856  O O   . LYS A 1 109 ? 20.287 32.547 45.790 1.00 16.52 ? 137  LYS A O   1 
ATOM   857  C CB  . LYS A 1 109 ? 23.049 34.138 46.579 1.00 21.01 ? 137  LYS A CB  1 
ATOM   858  C CG  . LYS A 1 109 ? 22.644 33.791 48.000 1.00 26.43 ? 137  LYS A CG  1 
ATOM   859  C CD  . LYS A 1 109 ? 23.364 32.537 48.466 1.00 27.71 ? 137  LYS A CD  1 
ATOM   860  C CE  . LYS A 1 109 ? 22.939 32.139 49.862 1.00 30.82 ? 137  LYS A CE  1 
ATOM   861  N NZ  . LYS A 1 109 ? 23.671 30.926 50.305 1.00 32.99 ? 137  LYS A NZ  1 
ATOM   862  N N   . LYS A 1 110 ? 20.793 34.205 44.364 1.00 18.54 ? 138  LYS A N   1 
ATOM   863  C CA  . LYS A 1 110 ? 19.401 34.445 44.003 1.00 20.82 ? 138  LYS A CA  1 
ATOM   864  C C   . LYS A 1 110 ? 18.810 33.190 43.361 1.00 20.53 ? 138  LYS A C   1 
ATOM   865  O O   . LYS A 1 110 ? 17.686 32.789 43.665 1.00 20.90 ? 138  LYS A O   1 
ATOM   866  C CB  . LYS A 1 110 ? 19.306 35.623 43.031 1.00 22.19 ? 138  LYS A CB  1 
ATOM   867  C CG  . LYS A 1 110 ? 17.916 36.221 42.919 1.00 26.03 ? 138  LYS A CG  1 
ATOM   868  C CD  . LYS A 1 110 ? 17.913 37.431 42.005 1.00 29.07 ? 138  LYS A CD  1 
ATOM   869  C CE  . LYS A 1 110 ? 16.617 38.210 42.133 1.00 31.54 ? 138  LYS A CE  1 
ATOM   870  N NZ  . LYS A 1 110 ? 15.436 37.335 41.910 1.00 33.91 ? 138  LYS A NZ  1 
ATOM   871  N N   . ILE A 1 111 ? 19.584 32.569 42.479 1.00 19.31 ? 139  ILE A N   1 
ATOM   872  C CA  . ILE A 1 111 ? 19.153 31.359 41.788 1.00 19.80 ? 139  ILE A CA  1 
ATOM   873  C C   . ILE A 1 111 ? 18.968 30.174 42.738 1.00 18.62 ? 139  ILE A C   1 
ATOM   874  O O   . ILE A 1 111 ? 17.922 29.522 42.737 1.00 18.85 ? 139  ILE A O   1 
ATOM   875  C CB  . ILE A 1 111 ? 20.178 30.955 40.697 1.00 21.68 ? 139  ILE A CB  1 
ATOM   876  C CG1 . ILE A 1 111 ? 20.291 32.068 39.653 1.00 21.69 ? 139  ILE A CG1 1 
ATOM   877  C CG2 . ILE A 1 111 ? 19.761 29.638 40.042 1.00 20.87 ? 139  ILE A CG2 1 
ATOM   878  C CD1 . ILE A 1 111 ? 21.327 31.805 38.576 1.00 23.56 ? 139  ILE A CD1 1 
ATOM   879  N N   . THR A 1 112 ? 19.981 29.901 43.552 1.00 16.62 ? 140  THR A N   1 
ATOM   880  C CA  . THR A 1 112 ? 19.920 28.772 44.474 1.00 15.77 ? 140  THR A CA  1 
ATOM   881  C C   . THR A 1 112 ? 18.914 28.933 45.612 1.00 14.72 ? 140  THR A C   1 
ATOM   882  O O   . THR A 1 112 ? 18.368 27.944 46.101 1.00 13.16 ? 140  THR A O   1 
ATOM   883  C CB  . THR A 1 112 ? 21.318 28.464 45.062 1.00 17.63 ? 140  THR A CB  1 
ATOM   884  O OG1 . THR A 1 112 ? 21.830 29.619 45.739 1.00 17.43 ? 140  THR A OG1 1 
ATOM   885  C CG2 . THR A 1 112 ? 22.280 28.075 43.946 1.00 15.84 ? 140  THR A CG2 1 
ATOM   886  N N   . ASN A 1 113 ? 18.654 30.170 46.027 1.00 14.45 ? 141  ASN A N   1 
ATOM   887  C CA  . ASN A 1 113 ? 17.706 30.406 47.107 1.00 14.54 ? 141  ASN A CA  1 
ATOM   888  C C   . ASN A 1 113 ? 16.319 29.843 46.806 1.00 13.67 ? 141  ASN A C   1 
ATOM   889  O O   . ASN A 1 113 ? 15.609 29.429 47.717 1.00 13.04 ? 141  ASN A O   1 
ATOM   890  C CB  . ASN A 1 113 ? 17.600 31.903 47.426 1.00 17.34 ? 141  ASN A CB  1 
ATOM   891  C CG  . ASN A 1 113 ? 18.746 32.397 48.293 1.00 21.04 ? 141  ASN A CG  1 
ATOM   892  O OD1 . ASN A 1 113 ? 19.303 31.644 49.092 1.00 20.93 ? 141  ASN A OD1 1 
ATOM   893  N ND2 . ASN A 1 113 ? 19.090 33.673 48.152 1.00 23.13 ? 141  ASN A ND2 1 
ATOM   894  N N   . PHE A 1 114 ? 15.937 29.817 45.533 1.00 12.83 ? 142  PHE A N   1 
ATOM   895  C CA  . PHE A 1 114 ? 14.628 29.290 45.152 1.00 13.58 ? 142  PHE A CA  1 
ATOM   896  C C   . PHE A 1 114 ? 14.486 27.826 45.550 1.00 13.29 ? 142  PHE A C   1 
ATOM   897  O O   . PHE A 1 114 ? 13.375 27.325 45.735 1.00 12.37 ? 142  PHE A O   1 
ATOM   898  C CB  . PHE A 1 114 ? 14.421 29.399 43.639 1.00 13.79 ? 142  PHE A CB  1 
ATOM   899  C CG  . PHE A 1 114 ? 14.185 30.800 43.152 1.00 14.62 ? 142  PHE A CG  1 
ATOM   900  C CD1 . PHE A 1 114 ? 13.114 31.546 43.633 1.00 14.39 ? 142  PHE A CD1 1 
ATOM   901  C CD2 . PHE A 1 114 ? 15.023 31.367 42.197 1.00 13.48 ? 142  PHE A CD2 1 
ATOM   902  C CE1 . PHE A 1 114 ? 12.879 32.843 43.167 1.00 16.37 ? 142  PHE A CE1 1 
ATOM   903  C CE2 . PHE A 1 114 ? 14.798 32.662 41.724 1.00 15.51 ? 142  PHE A CE2 1 
ATOM   904  C CZ  . PHE A 1 114 ? 13.725 33.400 42.209 1.00 15.02 ? 142  PHE A CZ  1 
ATOM   905  N N   . PHE A 1 115 ? 15.622 27.153 45.687 1.00 11.19 ? 143  PHE A N   1 
ATOM   906  C CA  . PHE A 1 115 ? 15.648 25.737 46.017 1.00 11.64 ? 143  PHE A CA  1 
ATOM   907  C C   . PHE A 1 115 ? 16.011 25.411 47.465 1.00 12.43 ? 143  PHE A C   1 
ATOM   908  O O   . PHE A 1 115 ? 16.250 24.251 47.804 1.00 14.13 ? 143  PHE A O   1 
ATOM   909  C CB  . PHE A 1 115 ? 16.604 25.036 45.050 1.00 12.39 ? 143  PHE A CB  1 
ATOM   910  C CG  . PHE A 1 115 ? 16.208 25.192 43.609 1.00 12.12 ? 143  PHE A CG  1 
ATOM   911  C CD1 . PHE A 1 115 ? 15.295 24.319 43.026 1.00 10.88 ? 143  PHE A CD1 1 
ATOM   912  C CD2 . PHE A 1 115 ? 16.703 26.249 42.849 1.00 12.38 ? 143  PHE A CD2 1 
ATOM   913  C CE1 . PHE A 1 115 ? 14.877 24.498 41.707 1.00 13.29 ? 143  PHE A CE1 1 
ATOM   914  C CE2 . PHE A 1 115 ? 16.289 26.435 41.527 1.00 10.38 ? 143  PHE A CE2 1 
ATOM   915  C CZ  . PHE A 1 115 ? 15.377 25.560 40.958 1.00 13.14 ? 143  PHE A CZ  1 
ATOM   916  N N   . ARG A 1 116 ? 16.041 26.429 48.318 1.00 11.68 ? 144  ARG A N   1 
ATOM   917  C CA  . ARG A 1 116 ? 16.341 26.221 49.732 1.00 13.10 ? 144  ARG A CA  1 
ATOM   918  C C   . ARG A 1 116 ? 15.392 25.169 50.304 1.00 14.36 ? 144  ARG A C   1 
ATOM   919  O O   . ARG A 1 116 ? 14.261 25.022 49.836 1.00 14.00 ? 144  ARG A O   1 
ATOM   920  C CB  . ARG A 1 116 ? 16.178 27.527 50.513 1.00 13.46 ? 144  ARG A CB  1 
ATOM   921  C CG  . ARG A 1 116 ? 17.396 28.433 50.463 1.00 16.89 ? 144  ARG A CG  1 
ATOM   922  C CD  . ARG A 1 116 ? 17.110 29.814 51.046 1.00 17.10 ? 144  ARG A CD  1 
ATOM   923  N NE  . ARG A 1 116 ? 16.287 29.761 52.251 1.00 18.31 ? 144  ARG A NE  1 
ATOM   924  C CZ  . ARG A 1 116 ? 16.220 30.738 53.152 1.00 20.18 ? 144  ARG A CZ  1 
ATOM   925  N NH1 . ARG A 1 116 ? 16.935 31.843 52.990 1.00 20.00 ? 144  ARG A NH1 1 
ATOM   926  N NH2 . ARG A 1 116 ? 15.436 30.615 54.214 1.00 19.81 ? 144  ARG A NH2 1 
ATOM   927  N N   . GLY A 1 117 ? 15.855 24.444 51.317 1.00 13.42 ? 145  GLY A N   1 
ATOM   928  C CA  . GLY A 1 117 ? 15.031 23.415 51.924 1.00 14.23 ? 145  GLY A CA  1 
ATOM   929  C C   . GLY A 1 117 ? 13.679 23.918 52.398 1.00 14.38 ? 145  GLY A C   1 
ATOM   930  O O   . GLY A 1 117 ? 12.718 23.153 52.453 1.00 13.98 ? 145  GLY A O   1 
ATOM   931  N N   . ASP A 1 118 ? 13.597 25.204 52.728 1.00 15.34 ? 146  ASP A N   1 
ATOM   932  C CA  . ASP A 1 118 ? 12.346 25.778 53.205 1.00 16.30 ? 146  ASP A CA  1 
ATOM   933  C C   . ASP A 1 118 ? 11.510 26.451 52.116 1.00 17.54 ? 146  ASP A C   1 
ATOM   934  O O   . ASP A 1 118 ? 10.351 26.792 52.350 1.00 19.80 ? 146  ASP A O   1 
ATOM   935  C CB  . ASP A 1 118 ? 12.623 26.774 54.344 1.00 15.22 ? 146  ASP A CB  1 
ATOM   936  C CG  . ASP A 1 118 ? 13.355 28.024 53.875 1.00 15.86 ? 146  ASP A CG  1 
ATOM   937  O OD1 . ASP A 1 118 ? 14.150 27.937 52.914 1.00 13.50 ? 146  ASP A OD1 1 
ATOM   938  O OD2 . ASP A 1 118 ? 13.149 29.097 54.488 1.00 15.42 ? 146  ASP A OD2 1 
ATOM   939  N N   . ARG A 1 119 ? 12.081 26.622 50.926 1.00 17.53 ? 147  ARG A N   1 
ATOM   940  C CA  . ARG A 1 119 ? 11.361 27.276 49.835 1.00 18.01 ? 147  ARG A CA  1 
ATOM   941  C C   . ARG A 1 119 ? 10.910 26.345 48.705 1.00 17.56 ? 147  ARG A C   1 
ATOM   942  O O   . ARG A 1 119 ? 10.087 26.725 47.879 1.00 19.21 ? 147  ARG A O   1 
ATOM   943  C CB  . ARG A 1 119 ? 12.201 28.434 49.288 1.00 18.08 ? 147  ARG A CB  1 
ATOM   944  C CG  . ARG A 1 119 ? 12.473 29.499 50.350 1.00 15.41 ? 147  ARG A CG  1 
ATOM   945  C CD  . ARG A 1 119 ? 13.261 30.684 49.816 1.00 17.74 ? 147  ARG A CD  1 
ATOM   946  N NE  . ARG A 1 119 ? 13.512 31.663 50.873 1.00 18.24 ? 147  ARG A NE  1 
ATOM   947  C CZ  . ARG A 1 119 ? 14.236 32.769 50.723 1.00 19.71 ? 147  ARG A CZ  1 
ATOM   948  N NH1 . ARG A 1 119 ? 14.790 33.050 49.553 1.00 18.53 ? 147  ARG A NH1 1 
ATOM   949  N NH2 . ARG A 1 119 ? 14.411 33.594 51.749 1.00 18.90 ? 147  ARG A NH2 1 
ATOM   950  N N   . CYS A 1 120 ? 11.456 25.135 48.667 1.00 16.51 ? 148  CYS A N   1 
ATOM   951  C CA  . CYS A 1 120 ? 11.063 24.134 47.674 1.00 14.87 ? 148  CYS A CA  1 
ATOM   952  C C   . CYS A 1 120 ? 10.932 22.836 48.466 1.00 15.97 ? 148  CYS A C   1 
ATOM   953  O O   . CYS A 1 120 ? 11.837 22.002 48.475 1.00 14.35 ? 148  CYS A O   1 
ATOM   954  C CB  . CYS A 1 120 ? 12.123 23.985 46.578 1.00 15.80 ? 148  CYS A CB  1 
ATOM   955  S SG  . CYS A 1 120 ? 11.641 22.829 45.258 1.00 14.88 ? 148  CYS A SG  1 
ATOM   956  N N   . ARG A 1 121 ? 9.798  22.679 49.140 1.00 15.11 ? 149  ARG A N   1 
ATOM   957  C CA  . ARG A 1 121 ? 9.564  21.513 49.985 1.00 16.19 ? 149  ARG A CA  1 
ATOM   958  C C   . ARG A 1 121 ? 9.613  20.157 49.298 1.00 14.76 ? 149  ARG A C   1 
ATOM   959  O O   . ARG A 1 121 ? 9.946  19.161 49.937 1.00 15.89 ? 149  ARG A O   1 
ATOM   960  C CB  . ARG A 1 121 ? 8.231  21.667 50.730 1.00 18.27 ? 149  ARG A CB  1 
ATOM   961  C CG  . ARG A 1 121 ? 8.134  22.943 51.558 1.00 23.18 ? 149  ARG A CG  1 
ATOM   962  C CD  . ARG A 1 121 ? 9.207  23.035 52.653 1.00 26.48 ? 149  ARG A CD  1 
ATOM   963  N NE  . ARG A 1 121 ? 8.899  22.244 53.846 1.00 31.23 ? 149  ARG A NE  1 
ATOM   964  C CZ  . ARG A 1 121 ? 9.149  20.944 53.985 1.00 33.74 ? 149  ARG A CZ  1 
ATOM   965  N NH1 . ARG A 1 121 ? 9.720  20.258 53.004 1.00 34.36 ? 149  ARG A NH1 1 
ATOM   966  N NH2 . ARG A 1 121 ? 8.831  20.327 55.117 1.00 35.20 ? 149  ARG A NH2 1 
ATOM   967  N N   . SER A 1 122 ? 9.283  20.096 48.010 1.00 13.87 ? 150  SER A N   1 
ATOM   968  C CA  . SER A 1 122 ? 9.323  18.812 47.321 1.00 13.06 ? 150  SER A CA  1 
ATOM   969  C C   . SER A 1 122 ? 10.758 18.379 47.009 1.00 12.92 ? 150  SER A C   1 
ATOM   970  O O   . SER A 1 122 ? 10.983 17.291 46.487 1.00 12.27 ? 150  SER A O   1 
ATOM   971  C CB  . SER A 1 122 ? 8.475  18.845 46.041 1.00 14.42 ? 150  SER A CB  1 
ATOM   972  O OG  . SER A 1 122 ? 8.890  19.868 45.163 1.00 14.45 ? 150  SER A OG  1 
ATOM   973  N N   . LEU A 1 123 ? 11.727 19.230 47.337 1.00 12.17 ? 151  LEU A N   1 
ATOM   974  C CA  . LEU A 1 123 ? 13.130 18.888 47.126 1.00 11.26 ? 151  LEU A CA  1 
ATOM   975  C C   . LEU A 1 123 ? 13.876 18.833 48.460 1.00 10.64 ? 151  LEU A C   1 
ATOM   976  O O   . LEU A 1 123 ? 15.069 18.547 48.502 1.00 12.09 ? 151  LEU A O   1 
ATOM   977  C CB  . LEU A 1 123 ? 13.810 19.890 46.183 1.00 10.33 ? 151  LEU A CB  1 
ATOM   978  C CG  . LEU A 1 123 ? 13.534 19.706 44.687 1.00 10.76 ? 151  LEU A CG  1 
ATOM   979  C CD1 . LEU A 1 123 ? 14.268 20.782 43.891 1.00 8.52  ? 151  LEU A CD1 1 
ATOM   980  C CD2 . LEU A 1 123 ? 13.995 18.320 44.244 1.00 11.23 ? 151  LEU A CD2 1 
ATOM   981  N N   . THR A 1 124 ? 13.170 19.102 49.554 1.00 11.82 ? 152  THR A N   1 
ATOM   982  C CA  . THR A 1 124 ? 13.793 19.057 50.873 1.00 11.72 ? 152  THR A CA  1 
ATOM   983  C C   . THR A 1 124 ? 14.366 17.663 51.099 1.00 10.91 ? 152  THR A C   1 
ATOM   984  O O   . THR A 1 124 ? 13.694 16.661 50.848 1.00 11.58 ? 152  THR A O   1 
ATOM   985  C CB  . THR A 1 124 ? 12.774 19.348 51.992 1.00 13.29 ? 152  THR A CB  1 
ATOM   986  O OG1 . THR A 1 124 ? 12.084 20.573 51.709 1.00 13.63 ? 152  THR A OG1 1 
ATOM   987  C CG2 . THR A 1 124 ? 13.487 19.468 53.339 1.00 13.73 ? 152  THR A CG2 1 
ATOM   988  N N   . GLY A 1 125 ? 15.611 17.595 51.559 1.00 10.95 ? 153  GLY A N   1 
ATOM   989  C CA  . GLY A 1 125 ? 16.228 16.304 51.808 1.00 9.91  ? 153  GLY A CA  1 
ATOM   990  C C   . GLY A 1 125 ? 16.764 15.616 50.563 1.00 9.36  ? 153  GLY A C   1 
ATOM   991  O O   . GLY A 1 125 ? 17.345 14.533 50.653 1.00 9.49  ? 153  GLY A O   1 
ATOM   992  N N   . LYS A 1 126 ? 16.574 16.239 49.403 1.00 9.34  ? 154  LYS A N   1 
ATOM   993  C CA  . LYS A 1 126 ? 17.045 15.669 48.139 1.00 9.35  ? 154  LYS A CA  1 
ATOM   994  C C   . LYS A 1 126 ? 18.226 16.470 47.600 1.00 8.20  ? 154  LYS A C   1 
ATOM   995  O O   . LYS A 1 126 ? 18.296 17.680 47.793 1.00 9.82  ? 154  LYS A O   1 
ATOM   996  C CB  . LYS A 1 126 ? 15.911 15.655 47.107 1.00 10.04 ? 154  LYS A CB  1 
ATOM   997  C CG  . LYS A 1 126 ? 14.741 14.742 47.467 1.00 11.62 ? 154  LYS A CG  1 
ATOM   998  C CD  . LYS A 1 126 ? 13.563 14.975 46.528 1.00 12.74 ? 154  LYS A CD  1 
ATOM   999  C CE  . LYS A 1 126 ? 12.379 14.080 46.863 1.00 14.22 ? 154  LYS A CE  1 
ATOM   1000 N NZ  . LYS A 1 126 ? 11.226 14.349 45.946 1.00 14.55 ? 154  LYS A NZ  1 
ATOM   1001 N N   . PRO A 1 127 ? 19.176 15.802 46.920 1.00 8.26  ? 155  PRO A N   1 
ATOM   1002 C CA  . PRO A 1 127 ? 20.345 16.496 46.373 1.00 8.35  ? 155  PRO A CA  1 
ATOM   1003 C C   . PRO A 1 127 ? 20.023 17.497 45.270 1.00 9.93  ? 155  PRO A C   1 
ATOM   1004 O O   . PRO A 1 127 ? 19.342 17.174 44.295 1.00 9.56  ? 155  PRO A O   1 
ATOM   1005 C CB  . PRO A 1 127 ? 21.233 15.350 45.886 1.00 9.44  ? 155  PRO A CB  1 
ATOM   1006 C CG  . PRO A 1 127 ? 20.249 14.290 45.524 1.00 8.75  ? 155  PRO A CG  1 
ATOM   1007 C CD  . PRO A 1 127 ? 19.265 14.354 46.669 1.00 7.59  ? 155  PRO A CD  1 
ATOM   1008 N N   . LYS A 1 128 ? 20.512 18.719 45.453 1.00 10.32 ? 156  LYS A N   1 
ATOM   1009 C CA  . LYS A 1 128 ? 20.315 19.799 44.496 1.00 9.46  ? 156  LYS A CA  1 
ATOM   1010 C C   . LYS A 1 128 ? 21.709 20.147 43.989 1.00 10.21 ? 156  LYS A C   1 
ATOM   1011 O O   . LYS A 1 128 ? 22.536 20.695 44.725 1.00 9.80  ? 156  LYS A O   1 
ATOM   1012 C CB  . LYS A 1 128 ? 19.652 20.989 45.195 1.00 10.39 ? 156  LYS A CB  1 
ATOM   1013 C CG  . LYS A 1 128 ? 18.247 20.667 45.709 1.00 11.29 ? 156  LYS A CG  1 
ATOM   1014 C CD  . LYS A 1 128 ? 17.727 21.717 46.686 1.00 13.09 ? 156  LYS A CD  1 
ATOM   1015 C CE  . LYS A 1 128 ? 18.176 21.438 48.115 1.00 13.32 ? 156  LYS A CE  1 
ATOM   1016 N NZ  . LYS A 1 128 ? 17.495 20.248 48.710 1.00 12.09 ? 156  LYS A NZ  1 
ATOM   1017 N N   . LEU A 1 129 ? 21.964 19.816 42.727 1.00 8.52  ? 157  LEU A N   1 
ATOM   1018 C CA  . LEU A 1 129 ? 23.274 20.026 42.130 1.00 9.99  ? 157  LEU A CA  1 
ATOM   1019 C C   . LEU A 1 129 ? 23.359 21.149 41.111 1.00 10.35 ? 157  LEU A C   1 
ATOM   1020 O O   . LEU A 1 129 ? 22.581 21.208 40.156 1.00 9.40  ? 157  LEU A O   1 
ATOM   1021 C CB  . LEU A 1 129 ? 23.747 18.724 41.469 1.00 10.70 ? 157  LEU A CB  1 
ATOM   1022 C CG  . LEU A 1 129 ? 23.456 17.424 42.230 1.00 13.96 ? 157  LEU A CG  1 
ATOM   1023 C CD1 . LEU A 1 129 ? 23.883 16.234 41.378 1.00 15.90 ? 157  LEU A CD1 1 
ATOM   1024 C CD2 . LEU A 1 129 ? 24.183 17.421 43.562 1.00 15.78 ? 157  LEU A CD2 1 
ATOM   1025 N N   . PHE A 1 130 ? 24.329 22.033 41.317 1.00 10.73 ? 158  PHE A N   1 
ATOM   1026 C CA  . PHE A 1 130 ? 24.556 23.145 40.411 1.00 9.05  ? 158  PHE A CA  1 
ATOM   1027 C C   . PHE A 1 130 ? 25.960 23.035 39.822 1.00 10.93 ? 158  PHE A C   1 
ATOM   1028 O O   . PHE A 1 130 ? 26.964 23.126 40.536 1.00 9.75  ? 158  PHE A O   1 
ATOM   1029 C CB  . PHE A 1 130 ? 24.357 24.476 41.144 1.00 9.91  ? 158  PHE A CB  1 
ATOM   1030 C CG  . PHE A 1 130 ? 22.931 24.721 41.559 1.00 10.13 ? 158  PHE A CG  1 
ATOM   1031 C CD1 . PHE A 1 130 ? 22.391 24.073 42.667 1.00 9.13  ? 158  PHE A CD1 1 
ATOM   1032 C CD2 . PHE A 1 130 ? 22.101 25.539 40.795 1.00 10.27 ? 158  PHE A CD2 1 
ATOM   1033 C CE1 . PHE A 1 130 ? 21.046 24.231 43.006 1.00 10.68 ? 158  PHE A CE1 1 
ATOM   1034 C CE2 . PHE A 1 130 ? 20.747 25.704 41.126 1.00 9.84  ? 158  PHE A CE2 1 
ATOM   1035 C CZ  . PHE A 1 130 ? 20.221 25.048 42.232 1.00 8.29  ? 158  PHE A CZ  1 
ATOM   1036 N N   . ILE A 1 131 ? 26.011 22.810 38.511 1.00 9.40  ? 159  ILE A N   1 
ATOM   1037 C CA  . ILE A 1 131 ? 27.265 22.665 37.774 1.00 10.74 ? 159  ILE A CA  1 
ATOM   1038 C C   . ILE A 1 131 ? 27.525 24.000 37.090 1.00 9.59  ? 159  ILE A C   1 
ATOM   1039 O O   . ILE A 1 131 ? 26.747 24.422 36.236 1.00 9.53  ? 159  ILE A O   1 
ATOM   1040 C CB  . ILE A 1 131 ? 27.145 21.554 36.701 1.00 10.73 ? 159  ILE A CB  1 
ATOM   1041 C CG1 . ILE A 1 131 ? 26.626 20.263 37.340 1.00 15.40 ? 159  ILE A CG1 1 
ATOM   1042 C CG2 . ILE A 1 131 ? 28.490 21.327 36.025 1.00 12.84 ? 159  ILE A CG2 1 
ATOM   1043 C CD1 . ILE A 1 131 ? 27.522 19.684 38.402 1.00 21.54 ? 159  ILE A CD1 1 
ATOM   1044 N N   . ILE A 1 132 ? 28.625 24.655 37.447 1.00 9.42  ? 160  ILE A N   1 
ATOM   1045 C CA  . ILE A 1 132 ? 28.906 25.973 36.894 1.00 8.91  ? 160  ILE A CA  1 
ATOM   1046 C C   . ILE A 1 132 ? 30.178 26.128 36.073 1.00 9.60  ? 160  ILE A C   1 
ATOM   1047 O O   . ILE A 1 132 ? 31.289 26.007 36.592 1.00 7.89  ? 160  ILE A O   1 
ATOM   1048 C CB  . ILE A 1 132 ? 28.938 27.042 38.016 1.00 11.69 ? 160  ILE A CB  1 
ATOM   1049 C CG1 . ILE A 1 132 ? 27.641 27.002 38.825 1.00 13.99 ? 160  ILE A CG1 1 
ATOM   1050 C CG2 . ILE A 1 132 ? 29.115 28.427 37.419 1.00 9.89  ? 160  ILE A CG2 1 
ATOM   1051 C CD1 . ILE A 1 132 ? 27.650 25.991 39.937 1.00 22.49 ? 160  ILE A CD1 1 
ATOM   1052 N N   . GLN A 1 133 ? 29.996 26.403 34.785 1.00 7.85  ? 161  GLN A N   1 
ATOM   1053 C CA  . GLN A 1 133 ? 31.106 26.638 33.873 1.00 9.43  ? 161  GLN A CA  1 
ATOM   1054 C C   . GLN A 1 133 ? 31.111 28.148 33.654 1.00 8.64  ? 161  GLN A C   1 
ATOM   1055 O O   . GLN A 1 133 ? 30.322 28.669 32.871 1.00 10.26 ? 161  GLN A O   1 
ATOM   1056 C CB  . GLN A 1 133 ? 30.881 25.907 32.544 1.00 8.95  ? 161  GLN A CB  1 
ATOM   1057 C CG  . GLN A 1 133 ? 31.849 26.309 31.425 1.00 11.12 ? 161  GLN A CG  1 
ATOM   1058 C CD  . GLN A 1 133 ? 33.304 26.326 31.867 1.00 10.21 ? 161  GLN A CD  1 
ATOM   1059 O OE1 . GLN A 1 133 ? 33.785 25.389 32.503 1.00 12.49 ? 161  GLN A OE1 1 
ATOM   1060 N NE2 . GLN A 1 133 ? 34.017 27.391 31.514 1.00 13.58 ? 161  GLN A NE2 1 
ATOM   1061 N N   . ALA A 1 134 ? 31.991 28.839 34.371 1.00 9.16  ? 162  ALA A N   1 
ATOM   1062 C CA  . ALA A 1 134 ? 32.105 30.294 34.294 1.00 9.64  ? 162  ALA A CA  1 
ATOM   1063 C C   . ALA A 1 134 ? 33.314 30.740 35.106 1.00 11.52 ? 162  ALA A C   1 
ATOM   1064 O O   . ALA A 1 134 ? 33.757 30.030 36.009 1.00 9.65  ? 162  ALA A O   1 
ATOM   1065 C CB  . ALA A 1 134 ? 30.844 30.943 34.857 1.00 9.55  ? 162  ALA A CB  1 
ATOM   1066 N N   . CYS A 1 135 ? 33.851 31.913 34.783 1.00 12.38 ? 163  CYS A N   1 
ATOM   1067 C CA  . CYS A 1 135 ? 34.992 32.438 35.523 1.00 12.77 ? 163  CYS A CA  1 
ATOM   1068 C C   . CYS A 1 135 ? 34.542 32.768 36.934 1.00 13.01 ? 163  CYS A C   1 
ATOM   1069 O O   . CYS A 1 135 ? 33.354 32.982 37.180 1.00 11.68 ? 163  CYS A O   1 
ATOM   1070 C CB  . CYS A 1 135 ? 35.528 33.720 34.879 1.00 16.25 ? 163  CYS A CB  1 
ATOM   1071 S SG  . CYS A 1 135 ? 36.385 33.493 33.306 1.00 20.21 ? 163  CYS A SG  1 
ATOM   1072 N N   . ARG A 1 136 ? 35.500 32.812 37.854 1.00 10.98 ? 164  ARG A N   1 
ATOM   1073 C CA  . ARG A 1 136 ? 35.219 33.152 39.243 1.00 11.42 ? 164  ARG A CA  1 
ATOM   1074 C C   . ARG A 1 136 ? 36.189 34.263 39.641 1.00 11.33 ? 164  ARG A C   1 
ATOM   1075 O O   . ARG A 1 136 ? 36.400 34.535 40.821 1.00 12.39 ? 164  ARG A O   1 
ATOM   1076 C CB  . ARG A 1 136 ? 35.410 31.926 40.139 1.00 10.26 ? 164  ARG A CB  1 
ATOM   1077 C CG  . ARG A 1 136 ? 34.422 30.790 39.854 1.00 12.09 ? 164  ARG A CG  1 
ATOM   1078 C CD  . ARG A 1 136 ? 34.645 29.609 40.789 1.00 9.58  ? 164  ARG A CD  1 
ATOM   1079 N NE  . ARG A 1 136 ? 34.244 29.907 42.161 1.00 12.20 ? 164  ARG A NE  1 
ATOM   1080 C CZ  . ARG A 1 136 ? 34.462 29.103 43.199 1.00 12.04 ? 164  ARG A CZ  1 
ATOM   1081 N NH1 . ARG A 1 136 ? 35.083 27.942 43.032 1.00 10.93 ? 164  ARG A NH1 1 
ATOM   1082 N NH2 . ARG A 1 136 ? 34.058 29.461 44.412 1.00 14.48 ? 164  ARG A NH2 1 
ATOM   1083 N N   . GLY A 1 137 ? 36.777 34.899 38.632 1.00 12.15 ? 165  GLY A N   1 
ATOM   1084 C CA  . GLY A 1 137 ? 37.737 35.961 38.871 1.00 12.82 ? 165  GLY A CA  1 
ATOM   1085 C C   . GLY A 1 137 ? 38.692 36.106 37.698 1.00 13.40 ? 165  GLY A C   1 
ATOM   1086 O O   . GLY A 1 137 ? 38.448 35.560 36.618 1.00 14.98 ? 165  GLY A O   1 
ATOM   1087 N N   . THR A 1 138 ? 39.785 36.832 37.908 1.00 13.67 ? 166  THR A N   1 
ATOM   1088 C CA  . THR A 1 138 ? 40.764 37.051 36.850 1.00 15.08 ? 166  THR A CA  1 
ATOM   1089 C C   . THR A 1 138 ? 42.157 36.500 37.155 1.00 15.83 ? 166  THR A C   1 
ATOM   1090 O O   . THR A 1 138 ? 43.142 36.939 36.565 1.00 16.42 ? 166  THR A O   1 
ATOM   1091 C CB  . THR A 1 138 ? 40.904 38.554 36.530 1.00 13.99 ? 166  THR A CB  1 
ATOM   1092 O OG1 . THR A 1 138 ? 41.264 39.266 37.719 1.00 15.94 ? 166  THR A OG1 1 
ATOM   1093 C CG2 . THR A 1 138 ? 39.598 39.105 35.980 1.00 14.38 ? 166  THR A CG2 1 
ATOM   1094 N N   . GLU A 1 139 ? 42.252 35.550 38.076 1.00 14.96 ? 167  GLU A N   1 
ATOM   1095 C CA  . GLU A 1 139 ? 43.555 34.976 38.390 1.00 15.59 ? 167  GLU A CA  1 
ATOM   1096 C C   . GLU A 1 139 ? 43.878 33.857 37.401 1.00 12.86 ? 167  GLU A C   1 
ATOM   1097 O O   . GLU A 1 139 ? 42.978 33.178 36.906 1.00 13.64 ? 167  GLU A O   1 
ATOM   1098 C CB  . GLU A 1 139 ? 43.574 34.428 39.820 1.00 18.05 ? 167  GLU A CB  1 
ATOM   1099 C CG  . GLU A 1 139 ? 43.418 35.491 40.891 1.00 20.90 ? 167  GLU A CG  1 
ATOM   1100 C CD  . GLU A 1 139 ? 43.567 34.931 42.289 1.00 22.58 ? 167  GLU A CD  1 
ATOM   1101 O OE1 . GLU A 1 139 ? 44.644 34.378 42.598 1.00 21.47 ? 167  GLU A OE1 1 
ATOM   1102 O OE2 . GLU A 1 139 ? 42.607 35.044 43.081 1.00 27.54 ? 167  GLU A OE2 1 
ATOM   1103 N N   . LEU A 1 140 ? 45.163 33.688 37.109 1.00 13.34 ? 168  LEU A N   1 
ATOM   1104 C CA  . LEU A 1 140 ? 45.628 32.651 36.191 1.00 14.83 ? 168  LEU A CA  1 
ATOM   1105 C C   . LEU A 1 140 ? 46.588 31.728 36.933 1.00 13.46 ? 168  LEU A C   1 
ATOM   1106 O O   . LEU A 1 140 ? 47.379 32.176 37.761 1.00 16.06 ? 168  LEU A O   1 
ATOM   1107 C CB  . LEU A 1 140 ? 46.332 33.284 34.985 1.00 15.53 ? 168  LEU A CB  1 
ATOM   1108 C CG  . LEU A 1 140 ? 45.427 34.020 33.989 1.00 17.73 ? 168  LEU A CG  1 
ATOM   1109 C CD1 . LEU A 1 140 ? 46.259 34.856 33.033 1.00 18.75 ? 168  LEU A CD1 1 
ATOM   1110 C CD2 . LEU A 1 140 ? 44.589 33.005 33.227 1.00 17.19 ? 168  LEU A CD2 1 
ATOM   1111 N N   . ASP A 1 141 ? 46.510 30.436 36.644 1.00 13.73 ? 169  ASP A N   1 
ATOM   1112 C CA  . ASP A 1 141 ? 47.367 29.455 37.305 1.00 12.82 ? 169  ASP A CA  1 
ATOM   1113 C C   . ASP A 1 141 ? 48.552 29.102 36.404 1.00 13.28 ? 169  ASP A C   1 
ATOM   1114 O O   . ASP A 1 141 ? 48.378 28.468 35.361 1.00 11.45 ? 169  ASP A O   1 
ATOM   1115 C CB  . ASP A 1 141 ? 46.553 28.197 37.619 1.00 12.27 ? 169  ASP A CB  1 
ATOM   1116 C CG  . ASP A 1 141 ? 47.250 27.280 38.604 1.00 13.00 ? 169  ASP A CG  1 
ATOM   1117 O OD1 . ASP A 1 141 ? 48.445 26.997 38.408 1.00 15.06 ? 169  ASP A OD1 1 
ATOM   1118 O OD2 . ASP A 1 141 ? 46.596 26.838 39.574 1.00 12.68 ? 169  ASP A OD2 1 
ATOM   1119 N N   . CYS A 1 142 ? 49.751 29.511 36.816 1.00 14.14 ? 170  CYS A N   1 
ATOM   1120 C CA  . CYS A 1 142 ? 50.970 29.257 36.045 1.00 15.48 ? 170  CYS A CA  1 
ATOM   1121 C C   . CYS A 1 142 ? 51.381 27.790 36.058 1.00 15.48 ? 170  CYS A C   1 
ATOM   1122 O O   . CYS A 1 142 ? 52.176 27.354 35.219 1.00 13.22 ? 170  CYS A O   1 
ATOM   1123 C CB  . CYS A 1 142 ? 52.124 30.100 36.589 1.00 16.89 ? 170  CYS A CB  1 
ATOM   1124 S SG  . CYS A 1 142 ? 52.584 29.692 38.289 1.00 19.91 ? 170  CYS A SG  1 
ATOM   1125 N N   . GLY A 1 143 ? 50.843 27.038 37.014 1.00 13.59 ? 171  GLY A N   1 
ATOM   1126 C CA  . GLY A 1 143 ? 51.165 25.625 37.122 1.00 13.62 ? 171  GLY A CA  1 
ATOM   1127 C C   . GLY A 1 143 ? 52.598 25.367 37.550 1.00 16.10 ? 171  GLY A C   1 
ATOM   1128 O O   . GLY A 1 143 ? 53.401 26.295 37.654 1.00 15.16 ? 171  GLY A O   1 
ATOM   1129 N N   . ILE A 1 144 ? 52.916 24.100 37.804 1.00 16.69 ? 172  ILE A N   1 
ATOM   1130 C CA  . ILE A 1 144 ? 54.262 23.706 38.209 1.00 17.95 ? 172  ILE A CA  1 
ATOM   1131 C C   . ILE A 1 144 ? 54.606 22.354 37.588 1.00 19.70 ? 172  ILE A C   1 
ATOM   1132 O O   . ILE A 1 144 ? 53.761 21.459 37.517 1.00 16.01 ? 172  ILE A O   1 
ATOM   1133 C CB  . ILE A 1 144 ? 54.384 23.626 39.758 1.00 18.84 ? 172  ILE A CB  1 
ATOM   1134 C CG1 . ILE A 1 144 ? 55.773 23.113 40.156 1.00 18.40 ? 172  ILE A CG1 1 
ATOM   1135 C CG2 . ILE A 1 144 ? 53.291 22.744 40.326 1.00 16.68 ? 172  ILE A CG2 1 
ATOM   1136 C CD1 . ILE A 1 144 ? 56.907 24.040 39.745 1.00 20.01 ? 172  ILE A CD1 1 
ATOM   1137 N N   . GLU A 1 145 ? 55.847 22.226 37.118 1.00 24.05 ? 173  GLU A N   1 
ATOM   1138 C CA  . GLU A 1 145 ? 56.327 20.996 36.485 1.00 29.50 ? 173  GLU A CA  1 
ATOM   1139 C C   . GLU A 1 145 ? 56.346 19.824 37.458 1.00 30.23 ? 173  GLU A C   1 
ATOM   1140 O O   . GLU A 1 145 ? 56.805 19.959 38.591 1.00 30.04 ? 173  GLU A O   1 
ATOM   1141 C CB  . GLU A 1 145 ? 57.748 21.184 35.943 1.00 33.21 ? 173  GLU A CB  1 
ATOM   1142 C CG  . GLU A 1 145 ? 57.961 22.378 35.026 1.00 39.94 ? 173  GLU A CG  1 
ATOM   1143 C CD  . GLU A 1 145 ? 57.140 22.312 33.753 1.00 43.80 ? 173  GLU A CD  1 
ATOM   1144 O OE1 . GLU A 1 145 ? 57.110 21.240 33.109 1.00 47.10 ? 173  GLU A OE1 1 
ATOM   1145 O OE2 . GLU A 1 145 ? 56.536 23.343 33.390 1.00 45.53 ? 173  GLU A OE2 1 
ATOM   1146 N N   . THR A 1 146 ? 55.868 18.670 37.004 1.00 31.82 ? 174  THR A N   1 
ATOM   1147 C CA  . THR A 1 146 ? 55.847 17.475 37.840 1.00 35.10 ? 174  THR A CA  1 
ATOM   1148 C C   . THR A 1 146 ? 56.922 16.477 37.422 1.00 36.53 ? 174  THR A C   1 
ATOM   1149 O O   . THR A 1 146 ? 57.592 16.729 36.399 1.00 38.41 ? 174  THR A O   1 
ATOM   1150 C CB  . THR A 1 146 ? 54.486 16.766 37.774 1.00 36.13 ? 174  THR A CB  1 
ATOM   1151 O OG1 . THR A 1 146 ? 54.064 16.665 36.408 1.00 37.87 ? 174  THR A OG1 1 
ATOM   1152 C CG2 . THR A 1 146 ? 53.455 17.524 38.584 1.00 35.84 ? 174  THR A CG2 1 
ATOM   1153 N N   . ASP A 1 147 ? 57.073 15.455 38.126 1.00 39.15 ? 175  ASP A N   1 
ATOM   1154 N N   . ALA B 2 1   ? 25.605 12.706 78.677 1.00 31.59 ? 175  ALA B N   1 
ATOM   1155 C CA  . ALA B 2 1   ? 25.771 14.173 78.464 1.00 31.65 ? 175  ALA B CA  1 
ATOM   1156 C C   . ALA B 2 1   ? 24.476 14.824 77.983 1.00 30.68 ? 175  ALA B C   1 
ATOM   1157 O O   . ALA B 2 1   ? 23.587 14.157 77.449 1.00 31.04 ? 175  ALA B O   1 
ATOM   1158 C CB  . ALA B 2 1   ? 26.884 14.426 77.455 1.00 33.03 ? 175  ALA B CB  1 
ATOM   1159 N N   . SER B 2 2   ? 24.380 16.135 78.185 1.00 29.57 ? 176  SER B N   1 
ATOM   1160 C CA  . SER B 2 2   ? 23.211 16.909 77.780 1.00 27.28 ? 176  SER B CA  1 
ATOM   1161 C C   . SER B 2 2   ? 23.637 18.345 77.500 1.00 27.57 ? 176  SER B C   1 
ATOM   1162 O O   . SER B 2 2   ? 24.623 18.828 78.061 1.00 27.14 ? 176  SER B O   1 
ATOM   1163 C CB  . SER B 2 2   ? 22.143 16.888 78.880 1.00 26.52 ? 176  SER B CB  1 
ATOM   1164 O OG  . SER B 2 2   ? 22.623 17.456 80.088 1.00 21.87 ? 176  SER B OG  1 
ATOM   1165 N N   . GLY B 2 3   ? 22.892 19.022 76.631 1.00 26.80 ? 177  GLY B N   1 
ATOM   1166 C CA  . GLY B 2 3   ? 23.221 20.393 76.294 1.00 25.82 ? 177  GLY B CA  1 
ATOM   1167 C C   . GLY B 2 3   ? 22.047 21.177 75.738 1.00 24.78 ? 177  GLY B C   1 
ATOM   1168 O O   . GLY B 2 3   ? 20.983 20.625 75.464 1.00 25.17 ? 177  GLY B O   1 
ATOM   1169 N N   . VAL B 2 4   ? 22.253 22.474 75.557 1.00 24.98 ? 178  VAL B N   1 
ATOM   1170 C CA  . VAL B 2 4   ? 21.212 23.359 75.051 1.00 23.90 ? 178  VAL B CA  1 
ATOM   1171 C C   . VAL B 2 4   ? 21.049 23.330 73.531 1.00 23.52 ? 178  VAL B C   1 
ATOM   1172 O O   . VAL B 2 4   ? 20.017 23.748 73.010 1.00 24.91 ? 178  VAL B O   1 
ATOM   1173 C CB  . VAL B 2 4   ? 21.498 24.817 75.459 1.00 23.34 ? 178  VAL B CB  1 
ATOM   1174 C CG1 . VAL B 2 4   ? 21.708 24.905 76.957 1.00 20.89 ? 178  VAL B CG1 1 
ATOM   1175 C CG2 . VAL B 2 4   ? 22.733 25.331 74.719 1.00 23.00 ? 178  VAL B CG2 1 
ATOM   1176 N N   . ASP B 2 5   ? 22.057 22.832 72.821 1.00 23.82 ? 179  ASP B N   1 
ATOM   1177 C CA  . ASP B 2 5   ? 22.005 22.815 71.362 1.00 24.53 ? 179  ASP B CA  1 
ATOM   1178 C C   . ASP B 2 5   ? 21.945 21.458 70.664 1.00 25.34 ? 179  ASP B C   1 
ATOM   1179 O O   . ASP B 2 5   ? 22.323 21.349 69.497 1.00 23.49 ? 179  ASP B O   1 
ATOM   1180 C CB  . ASP B 2 5   ? 23.193 23.602 70.801 1.00 21.14 ? 179  ASP B CB  1 
ATOM   1181 C CG  . ASP B 2 5   ? 24.524 23.113 71.340 1.00 21.00 ? 179  ASP B CG  1 
ATOM   1182 O OD1 . ASP B 2 5   ? 24.678 21.890 71.528 1.00 19.40 ? 179  ASP B OD1 1 
ATOM   1183 O OD2 . ASP B 2 5   ? 25.423 23.951 71.562 1.00 21.90 ? 179  ASP B OD2 1 
ATOM   1184 N N   . ASP B 2 6   ? 21.465 20.427 71.351 1.00 28.26 ? 180  ASP B N   1 
ATOM   1185 C CA  . ASP B 2 6   ? 21.394 19.110 70.728 1.00 30.28 ? 180  ASP B CA  1 
ATOM   1186 C C   . ASP B 2 6   ? 20.103 18.365 71.047 1.00 30.59 ? 180  ASP B C   1 
ATOM   1187 O O   . ASP B 2 6   ? 19.391 18.699 71.994 1.00 30.25 ? 180  ASP B O   1 
ATOM   1188 C CB  . ASP B 2 6   ? 22.583 18.252 71.169 1.00 32.80 ? 180  ASP B CB  1 
ATOM   1189 C CG  . ASP B 2 6   ? 22.408 17.697 72.571 1.00 34.81 ? 180  ASP B CG  1 
ATOM   1190 O OD1 . ASP B 2 6   ? 22.251 18.499 73.514 1.00 37.62 ? 180  ASP B OD1 1 
ATOM   1191 O OD2 . ASP B 2 6   ? 22.419 16.458 72.728 1.00 37.96 ? 180  ASP B OD2 1 
ATOM   1192 N N   . ASP B 2 7   ? 19.817 17.351 70.234 1.00 30.82 ? 181  ASP B N   1 
ATOM   1193 C CA  . ASP B 2 7   ? 18.641 16.504 70.402 1.00 31.08 ? 181  ASP B CA  1 
ATOM   1194 C C   . ASP B 2 7   ? 17.326 17.273 70.546 1.00 29.34 ? 181  ASP B C   1 
ATOM   1195 O O   . ASP B 2 7   ? 16.620 17.132 71.543 1.00 28.64 ? 181  ASP B O   1 
ATOM   1196 C CB  . ASP B 2 7   ? 18.856 15.582 71.609 1.00 32.64 ? 181  ASP B CB  1 
ATOM   1197 C CG  . ASP B 2 7   ? 17.893 14.409 71.631 1.00 35.60 ? 181  ASP B CG  1 
ATOM   1198 O OD1 . ASP B 2 7   ? 17.531 13.913 70.542 1.00 38.02 ? 181  ASP B OD1 1 
ATOM   1199 O OD2 . ASP B 2 7   ? 17.515 13.968 72.737 1.00 35.86 ? 181  ASP B OD2 1 
ATOM   1200 N N   . MET B 2 8   ? 16.999 18.080 69.542 1.00 28.35 ? 182  MET B N   1 
ATOM   1201 C CA  . MET B 2 8   ? 15.762 18.858 69.555 1.00 28.84 ? 182  MET B CA  1 
ATOM   1202 C C   . MET B 2 8   ? 14.561 17.941 69.359 1.00 28.14 ? 182  MET B C   1 
ATOM   1203 O O   . MET B 2 8   ? 14.629 16.973 68.600 1.00 26.36 ? 182  MET B O   1 
ATOM   1204 C CB  . MET B 2 8   ? 15.774 19.902 68.436 1.00 29.79 ? 182  MET B CB  1 
ATOM   1205 C CG  . MET B 2 8   ? 16.741 21.053 68.648 1.00 31.69 ? 182  MET B CG  1 
ATOM   1206 S SD  . MET B 2 8   ? 16.284 22.078 70.054 1.00 35.25 ? 182  MET B SD  1 
ATOM   1207 C CE  . MET B 2 8   ? 17.363 21.399 71.327 1.00 32.83 ? 182  MET B CE  1 
ATOM   1208 N N   . ALA B 2 9   ? 13.461 18.249 70.040 1.00 27.68 ? 183  ALA B N   1 
ATOM   1209 C CA  . ALA B 2 9   ? 12.249 17.447 69.915 1.00 28.83 ? 183  ALA B CA  1 
ATOM   1210 C C   . ALA B 2 9   ? 11.776 17.457 68.461 1.00 29.04 ? 183  ALA B C   1 
ATOM   1211 O O   . ALA B 2 9   ? 11.448 16.414 67.894 1.00 28.89 ? 183  ALA B O   1 
ATOM   1212 C CB  . ALA B 2 9   ? 11.160 17.999 70.825 1.00 28.53 ? 183  ALA B CB  1 
ATOM   1213 N N   . CYS B 2 10  ? 11.749 18.646 67.865 1.00 28.58 ? 184  CYS B N   1 
ATOM   1214 C CA  . CYS B 2 10  ? 11.328 18.804 66.478 1.00 28.35 ? 184  CYS B CA  1 
ATOM   1215 C C   . CYS B 2 10  ? 12.569 18.827 65.593 1.00 27.97 ? 184  CYS B C   1 
ATOM   1216 O O   . CYS B 2 10  ? 13.385 19.745 65.673 1.00 28.65 ? 184  CYS B O   1 
ATOM   1217 C CB  . CYS B 2 10  ? 10.541 20.106 66.307 1.00 29.65 ? 184  CYS B CB  1 
ATOM   1218 S SG  . CYS B 2 10  ? 9.055  20.223 67.336 1.00 33.82 ? 184  CYS B SG  1 
ATOM   1219 N N   . HIS B 2 11  ? 12.703 17.809 64.751 1.00 26.71 ? 185  HIS B N   1 
ATOM   1220 C CA  . HIS B 2 11  ? 13.851 17.688 63.862 1.00 26.30 ? 185  HIS B CA  1 
ATOM   1221 C C   . HIS B 2 11  ? 13.831 18.667 62.693 1.00 23.43 ? 185  HIS B C   1 
ATOM   1222 O O   . HIS B 2 11  ? 12.841 18.770 61.968 1.00 22.40 ? 185  HIS B O   1 
ATOM   1223 C CB  . HIS B 2 11  ? 13.933 16.257 63.327 1.00 29.94 ? 185  HIS B CB  1 
ATOM   1224 C CG  . HIS B 2 11  ? 14.164 15.230 64.391 1.00 35.89 ? 185  HIS B CG  1 
ATOM   1225 N ND1 . HIS B 2 11  ? 13.659 13.949 64.312 1.00 37.92 ? 185  HIS B ND1 1 
ATOM   1226 C CD2 . HIS B 2 11  ? 14.857 15.290 65.553 1.00 36.78 ? 185  HIS B CD2 1 
ATOM   1227 C CE1 . HIS B 2 11  ? 14.030 13.266 65.381 1.00 39.05 ? 185  HIS B CE1 1 
ATOM   1228 N NE2 . HIS B 2 11  ? 14.758 14.056 66.149 1.00 39.17 ? 185  HIS B NE2 1 
ATOM   1229 N N   . LYS B 2 12  ? 14.935 19.386 62.523 1.00 20.28 ? 186  LYS B N   1 
ATOM   1230 C CA  . LYS B 2 12  ? 15.078 20.335 61.428 1.00 19.20 ? 186  LYS B CA  1 
ATOM   1231 C C   . LYS B 2 12  ? 16.440 20.133 60.788 1.00 16.17 ? 186  LYS B C   1 
ATOM   1232 O O   . LYS B 2 12  ? 17.346 19.556 61.396 1.00 14.71 ? 186  LYS B O   1 
ATOM   1233 C CB  . LYS B 2 12  ? 15.010 21.784 61.922 1.00 20.61 ? 186  LYS B CB  1 
ATOM   1234 C CG  . LYS B 2 12  ? 13.737 22.182 62.634 1.00 25.66 ? 186  LYS B CG  1 
ATOM   1235 C CD  . LYS B 2 12  ? 13.685 23.697 62.838 1.00 26.63 ? 186  LYS B CD  1 
ATOM   1236 C CE  . LYS B 2 12  ? 14.908 24.222 63.575 1.00 28.30 ? 186  LYS B CE  1 
ATOM   1237 N NZ  . LYS B 2 12  ? 14.843 25.701 63.773 1.00 29.38 ? 186  LYS B NZ  1 
ATOM   1238 N N   . ILE B 2 13  ? 16.572 20.595 59.551 1.00 16.37 ? 187  ILE B N   1 
ATOM   1239 C CA  . ILE B 2 13  ? 17.845 20.534 58.846 1.00 15.76 ? 187  ILE B CA  1 
ATOM   1240 C C   . ILE B 2 13  ? 18.079 21.940 58.316 1.00 13.62 ? 187  ILE B C   1 
ATOM   1241 O O   . ILE B 2 13  ? 17.143 22.736 58.221 1.00 12.66 ? 187  ILE B O   1 
ATOM   1242 C CB  . ILE B 2 13  ? 17.846 19.528 57.657 1.00 16.93 ? 187  ILE B CB  1 
ATOM   1243 C CG1 . ILE B 2 13  ? 16.968 20.033 56.507 1.00 17.79 ? 187  ILE B CG1 1 
ATOM   1244 C CG2 . ILE B 2 13  ? 17.396 18.158 58.142 1.00 17.03 ? 187  ILE B CG2 1 
ATOM   1245 C CD1 . ILE B 2 13  ? 15.506 20.097 56.816 1.00 22.32 ? 187  ILE B CD1 1 
ATOM   1246 N N   . PRO B 2 14  ? 19.332 22.278 57.992 1.00 13.40 ? 188  PRO B N   1 
ATOM   1247 C CA  . PRO B 2 14  ? 19.645 23.611 57.472 1.00 11.53 ? 188  PRO B CA  1 
ATOM   1248 C C   . PRO B 2 14  ? 18.951 23.800 56.129 1.00 12.04 ? 188  PRO B C   1 
ATOM   1249 O O   . PRO B 2 14  ? 18.812 22.845 55.363 1.00 12.17 ? 188  PRO B O   1 
ATOM   1250 C CB  . PRO B 2 14  ? 21.163 23.577 57.321 1.00 11.77 ? 188  PRO B CB  1 
ATOM   1251 C CG  . PRO B 2 14  ? 21.596 22.543 58.326 1.00 11.68 ? 188  PRO B CG  1 
ATOM   1252 C CD  . PRO B 2 14  ? 20.556 21.480 58.170 1.00 11.16 ? 188  PRO B CD  1 
ATOM   1253 N N   . VAL B 2 15  ? 18.516 25.023 55.843 1.00 11.44 ? 189  VAL B N   1 
ATOM   1254 C CA  . VAL B 2 15  ? 17.851 25.294 54.573 1.00 11.83 ? 189  VAL B CA  1 
ATOM   1255 C C   . VAL B 2 15  ? 18.889 25.285 53.456 1.00 12.22 ? 189  VAL B C   1 
ATOM   1256 O O   . VAL B 2 15  ? 18.545 25.221 52.277 1.00 12.81 ? 189  VAL B O   1 
ATOM   1257 C CB  . VAL B 2 15  ? 17.120 26.661 54.587 1.00 10.01 ? 189  VAL B CB  1 
ATOM   1258 C CG1 . VAL B 2 15  ? 16.080 26.680 55.702 1.00 10.56 ? 189  VAL B CG1 1 
ATOM   1259 C CG2 . VAL B 2 15  ? 18.119 27.795 54.768 1.00 10.79 ? 189  VAL B CG2 1 
ATOM   1260 N N   . GLU B 2 16  ? 20.162 25.333 53.842 1.00 12.14 ? 190  GLU B N   1 
ATOM   1261 C CA  . GLU B 2 16  ? 21.270 25.327 52.887 1.00 11.97 ? 190  GLU B CA  1 
ATOM   1262 C C   . GLU B 2 16  ? 21.864 23.932 52.692 1.00 11.51 ? 190  GLU B C   1 
ATOM   1263 O O   . GLU B 2 16  ? 22.792 23.744 51.899 1.00 9.95  ? 190  GLU B O   1 
ATOM   1264 C CB  . GLU B 2 16  ? 22.369 26.277 53.361 1.00 14.82 ? 190  GLU B CB  1 
ATOM   1265 C CG  . GLU B 2 16  ? 21.924 27.722 53.493 1.00 18.05 ? 190  GLU B CG  1 
ATOM   1266 C CD  . GLU B 2 16  ? 21.793 28.418 52.153 1.00 22.69 ? 190  GLU B CD  1 
ATOM   1267 O OE1 . GLU B 2 16  ? 21.053 27.916 51.283 1.00 26.32 ? 190  GLU B OE1 1 
ATOM   1268 O OE2 . GLU B 2 16  ? 22.432 29.474 51.971 1.00 24.43 ? 190  GLU B OE2 1 
ATOM   1269 N N   . ALA B 2 17  ? 21.339 22.950 53.416 1.00 9.50  ? 191  ALA B N   1 
ATOM   1270 C CA  . ALA B 2 17  ? 21.850 21.589 53.297 1.00 9.54  ? 191  ALA B CA  1 
ATOM   1271 C C   . ALA B 2 17  ? 21.404 20.912 52.006 1.00 9.30  ? 191  ALA B C   1 
ATOM   1272 O O   . ALA B 2 17  ? 20.415 21.310 51.388 1.00 9.14  ? 191  ALA B O   1 
ATOM   1273 C CB  . ALA B 2 17  ? 21.403 20.754 54.496 1.00 9.36  ? 191  ALA B CB  1 
ATOM   1274 N N   . ASP B 2 18  ? 22.155 19.889 51.608 1.00 9.21  ? 192  ASP B N   1 
ATOM   1275 C CA  . ASP B 2 18  ? 21.859 19.096 50.421 1.00 9.03  ? 192  ASP B CA  1 
ATOM   1276 C C   . ASP B 2 18  ? 22.081 19.794 49.079 1.00 9.05  ? 192  ASP B C   1 
ATOM   1277 O O   . ASP B 2 18  ? 21.422 19.477 48.082 1.00 9.99  ? 192  ASP B O   1 
ATOM   1278 C CB  . ASP B 2 18  ? 20.432 18.547 50.508 1.00 8.73  ? 192  ASP B CB  1 
ATOM   1279 C CG  . ASP B 2 18  ? 20.197 17.735 51.773 1.00 11.40 ? 192  ASP B CG  1 
ATOM   1280 O OD1 . ASP B 2 18  ? 20.996 16.813 52.045 1.00 9.62  ? 192  ASP B OD1 1 
ATOM   1281 O OD2 . ASP B 2 18  ? 19.215 18.014 52.493 1.00 13.09 ? 192  ASP B OD2 1 
ATOM   1282 N N   . PHE B 2 19  ? 23.010 20.744 49.066 1.00 8.42  ? 193  PHE B N   1 
ATOM   1283 C CA  . PHE B 2 19  ? 23.387 21.454 47.846 1.00 9.33  ? 193  PHE B CA  1 
ATOM   1284 C C   . PHE B 2 19  ? 24.813 21.025 47.508 1.00 8.72  ? 193  PHE B C   1 
ATOM   1285 O O   . PHE B 2 19  ? 25.616 20.764 48.404 1.00 10.03 ? 193  PHE B O   1 
ATOM   1286 C CB  . PHE B 2 19  ? 23.399 22.974 48.065 1.00 8.81  ? 193  PHE B CB  1 
ATOM   1287 C CG  . PHE B 2 19  ? 22.054 23.634 47.930 1.00 10.17 ? 193  PHE B CG  1 
ATOM   1288 C CD1 . PHE B 2 19  ? 21.650 24.172 46.712 1.00 10.98 ? 193  PHE B CD1 1 
ATOM   1289 C CD2 . PHE B 2 19  ? 21.205 23.751 49.031 1.00 10.68 ? 193  PHE B CD2 1 
ATOM   1290 C CE1 . PHE B 2 19  ? 20.417 24.825 46.590 1.00 12.19 ? 193  PHE B CE1 1 
ATOM   1291 C CE2 . PHE B 2 19  ? 19.973 24.399 48.920 1.00 11.69 ? 193  PHE B CE2 1 
ATOM   1292 C CZ  . PHE B 2 19  ? 19.578 24.939 47.697 1.00 10.98 ? 193  PHE B CZ  1 
ATOM   1293 N N   . LEU B 2 20  ? 25.120 20.929 46.221 1.00 9.29  ? 194  LEU B N   1 
ATOM   1294 C CA  . LEU B 2 20  ? 26.475 20.611 45.789 1.00 9.71  ? 194  LEU B CA  1 
ATOM   1295 C C   . LEU B 2 20  ? 26.763 21.504 44.599 1.00 10.55 ? 194  LEU B C   1 
ATOM   1296 O O   . LEU B 2 20  ? 25.987 21.549 43.646 1.00 12.14 ? 194  LEU B O   1 
ATOM   1297 C CB  . LEU B 2 20  ? 26.643 19.142 45.385 1.00 11.51 ? 194  LEU B CB  1 
ATOM   1298 C CG  . LEU B 2 20  ? 28.078 18.838 44.913 1.00 13.64 ? 194  LEU B CG  1 
ATOM   1299 C CD1 . LEU B 2 20  ? 28.470 17.416 45.258 1.00 15.17 ? 194  LEU B CD1 1 
ATOM   1300 C CD2 . LEU B 2 20  ? 28.188 19.079 43.405 1.00 14.14 ? 194  LEU B CD2 1 
ATOM   1301 N N   . TYR B 2 21  ? 27.864 22.240 44.683 1.00 9.72  ? 195  TYR B N   1 
ATOM   1302 C CA  . TYR B 2 21  ? 28.277 23.131 43.615 1.00 10.44 ? 195  TYR B CA  1 
ATOM   1303 C C   . TYR B 2 21  ? 29.523 22.562 42.965 1.00 9.49  ? 195  TYR B C   1 
ATOM   1304 O O   . TYR B 2 21  ? 30.563 22.427 43.612 1.00 10.24 ? 195  TYR B O   1 
ATOM   1305 C CB  . TYR B 2 21  ? 28.600 24.524 44.156 1.00 10.74 ? 195  TYR B CB  1 
ATOM   1306 C CG  . TYR B 2 21  ? 27.447 25.213 44.834 1.00 15.49 ? 195  TYR B CG  1 
ATOM   1307 C CD1 . TYR B 2 21  ? 27.071 24.874 46.131 1.00 15.60 ? 195  TYR B CD1 1 
ATOM   1308 C CD2 . TYR B 2 21  ? 26.718 26.199 44.171 1.00 18.08 ? 195  TYR B CD2 1 
ATOM   1309 C CE1 . TYR B 2 21  ? 25.995 25.504 46.754 1.00 20.13 ? 195  TYR B CE1 1 
ATOM   1310 C CE2 . TYR B 2 21  ? 25.642 26.832 44.783 1.00 21.04 ? 195  TYR B CE2 1 
ATOM   1311 C CZ  . TYR B 2 21  ? 25.287 26.482 46.072 1.00 21.00 ? 195  TYR B CZ  1 
ATOM   1312 O OH  . TYR B 2 21  ? 24.231 27.119 46.680 1.00 25.62 ? 195  TYR B OH  1 
ATOM   1313 N N   . ALA B 2 22  ? 29.412 22.214 41.691 1.00 8.10  ? 196  ALA B N   1 
ATOM   1314 C CA  . ALA B 2 22  ? 30.548 21.688 40.960 1.00 8.06  ? 196  ALA B CA  1 
ATOM   1315 C C   . ALA B 2 22  ? 31.064 22.837 40.112 1.00 8.00  ? 196  ALA B C   1 
ATOM   1316 O O   . ALA B 2 22  ? 30.546 23.095 39.027 1.00 7.71  ? 196  ALA B O   1 
ATOM   1317 C CB  . ALA B 2 22  ? 30.125 20.518 40.081 1.00 8.19  ? 196  ALA B CB  1 
ATOM   1318 N N   . TYR B 2 23  ? 32.060 23.546 40.633 1.00 7.51  ? 197  TYR B N   1 
ATOM   1319 C CA  . TYR B 2 23  ? 32.655 24.676 39.928 1.00 7.61  ? 197  TYR B CA  1 
ATOM   1320 C C   . TYR B 2 23  ? 33.742 24.208 38.973 1.00 9.74  ? 197  TYR B C   1 
ATOM   1321 O O   . TYR B 2 23  ? 34.515 23.302 39.281 1.00 8.22  ? 197  TYR B O   1 
ATOM   1322 C CB  . TYR B 2 23  ? 33.260 25.673 40.917 1.00 8.10  ? 197  TYR B CB  1 
ATOM   1323 C CG  . TYR B 2 23  ? 32.251 26.430 41.743 1.00 8.60  ? 197  TYR B CG  1 
ATOM   1324 C CD1 . TYR B 2 23  ? 31.533 27.499 41.203 1.00 11.35 ? 197  TYR B CD1 1 
ATOM   1325 C CD2 . TYR B 2 23  ? 32.034 26.098 43.077 1.00 11.29 ? 197  TYR B CD2 1 
ATOM   1326 C CE1 . TYR B 2 23  ? 30.629 28.226 41.984 1.00 12.35 ? 197  TYR B CE1 1 
ATOM   1327 C CE2 . TYR B 2 23  ? 31.136 26.814 43.861 1.00 12.60 ? 197  TYR B CE2 1 
ATOM   1328 C CZ  . TYR B 2 23  ? 30.440 27.878 43.312 1.00 12.43 ? 197  TYR B CZ  1 
ATOM   1329 O OH  . TYR B 2 23  ? 29.581 28.609 44.109 1.00 15.71 ? 197  TYR B OH  1 
ATOM   1330 N N   . SER B 2 24  ? 33.801 24.853 37.818 1.00 7.51  ? 198  SER B N   1 
ATOM   1331 C CA  . SER B 2 24  ? 34.782 24.516 36.800 1.00 9.33  ? 198  SER B CA  1 
ATOM   1332 C C   . SER B 2 24  ? 36.188 24.951 37.183 1.00 9.23  ? 198  SER B C   1 
ATOM   1333 O O   . SER B 2 24  ? 37.168 24.411 36.674 1.00 9.48  ? 198  SER B O   1 
ATOM   1334 C CB  . SER B 2 24  ? 34.415 25.204 35.491 1.00 8.42  ? 198  SER B CB  1 
ATOM   1335 O OG  . SER B 2 24  ? 34.529 26.612 35.634 1.00 10.50 ? 198  SER B OG  1 
ATOM   1336 N N   . THR B 2 25  ? 36.289 25.924 38.083 1.00 11.07 ? 199  THR B N   1 
ATOM   1337 C CA  . THR B 2 25  ? 37.592 26.446 38.457 1.00 10.89 ? 199  THR B CA  1 
ATOM   1338 C C   . THR B 2 25  ? 37.663 26.901 39.911 1.00 11.87 ? 199  THR B C   1 
ATOM   1339 O O   . THR B 2 25  ? 36.640 27.031 40.583 1.00 10.84 ? 199  THR B O   1 
ATOM   1340 C CB  . THR B 2 25  ? 37.948 27.627 37.528 1.00 9.84  ? 199  THR B CB  1 
ATOM   1341 O OG1 . THR B 2 25  ? 39.332 27.965 37.670 1.00 12.40 ? 199  THR B OG1 1 
ATOM   1342 C CG2 . THR B 2 25  ? 37.084 28.836 37.865 1.00 9.83  ? 199  THR B CG2 1 
ATOM   1343 N N   . ALA B 2 26  ? 38.880 27.157 40.386 1.00 12.35 ? 200  ALA B N   1 
ATOM   1344 C CA  . ALA B 2 26  ? 39.089 27.593 41.764 1.00 13.16 ? 200  ALA B CA  1 
ATOM   1345 C C   . ALA B 2 26  ? 38.577 29.010 42.006 1.00 12.70 ? 200  ALA B C   1 
ATOM   1346 O O   . ALA B 2 26  ? 38.484 29.819 41.082 1.00 11.87 ? 200  ALA B O   1 
ATOM   1347 C CB  . ALA B 2 26  ? 40.575 27.504 42.121 1.00 10.14 ? 200  ALA B CB  1 
ATOM   1348 N N   . PRO B 2 27  ? 38.227 29.328 43.261 1.00 12.86 ? 201  PRO B N   1 
ATOM   1349 C CA  . PRO B 2 27  ? 37.726 30.666 43.584 1.00 13.44 ? 201  PRO B CA  1 
ATOM   1350 C C   . PRO B 2 27  ? 38.696 31.756 43.119 1.00 13.92 ? 201  PRO B C   1 
ATOM   1351 O O   . PRO B 2 27  ? 39.899 31.676 43.378 1.00 15.23 ? 201  PRO B O   1 
ATOM   1352 C CB  . PRO B 2 27  ? 37.597 30.627 45.109 1.00 15.52 ? 201  PRO B CB  1 
ATOM   1353 C CG  . PRO B 2 27  ? 37.310 29.180 45.389 1.00 13.11 ? 201  PRO B CG  1 
ATOM   1354 C CD  . PRO B 2 27  ? 38.273 28.477 44.463 1.00 15.06 ? 201  PRO B CD  1 
ATOM   1355 N N   . GLY B 2 28  ? 38.168 32.756 42.421 1.00 14.96 ? 202  GLY B N   1 
ATOM   1356 C CA  . GLY B 2 28  ? 38.989 33.858 41.947 1.00 12.59 ? 202  GLY B CA  1 
ATOM   1357 C C   . GLY B 2 28  ? 39.723 33.653 40.634 1.00 13.10 ? 202  GLY B C   1 
ATOM   1358 O O   . GLY B 2 28  ? 40.379 34.577 40.149 1.00 12.09 ? 202  GLY B O   1 
ATOM   1359 N N   . TYR B 2 29  ? 39.610 32.466 40.042 1.00 11.30 ? 203  TYR B N   1 
ATOM   1360 C CA  . TYR B 2 29  ? 40.313 32.177 38.791 1.00 10.77 ? 203  TYR B CA  1 
ATOM   1361 C C   . TYR B 2 29  ? 39.475 32.173 37.523 1.00 10.32 ? 203  TYR B C   1 
ATOM   1362 O O   . TYR B 2 29  ? 38.261 31.974 37.562 1.00 9.69  ? 203  TYR B O   1 
ATOM   1363 C CB  . TYR B 2 29  ? 41.029 30.820 38.885 1.00 9.78  ? 203  TYR B CB  1 
ATOM   1364 C CG  . TYR B 2 29  ? 42.265 30.836 39.750 1.00 10.98 ? 203  TYR B CG  1 
ATOM   1365 C CD1 . TYR B 2 29  ? 42.171 30.867 41.140 1.00 11.62 ? 203  TYR B CD1 1 
ATOM   1366 C CD2 . TYR B 2 29  ? 43.535 30.863 39.174 1.00 10.35 ? 203  TYR B CD2 1 
ATOM   1367 C CE1 . TYR B 2 29  ? 43.319 30.928 41.938 1.00 13.18 ? 203  TYR B CE1 1 
ATOM   1368 C CE2 . TYR B 2 29  ? 44.682 30.925 39.957 1.00 10.80 ? 203  TYR B CE2 1 
ATOM   1369 C CZ  . TYR B 2 29  ? 44.569 30.958 41.334 1.00 12.12 ? 203  TYR B CZ  1 
ATOM   1370 O OH  . TYR B 2 29  ? 45.709 31.033 42.103 1.00 16.54 ? 203  TYR B OH  1 
ATOM   1371 N N   . TYR B 2 30  ? 40.142 32.398 36.392 1.00 12.66 ? 204  TYR B N   1 
ATOM   1372 C CA  . TYR B 2 30  ? 39.471 32.353 35.097 1.00 12.22 ? 204  TYR B CA  1 
ATOM   1373 C C   . TYR B 2 30  ? 39.124 30.883 34.884 1.00 9.29  ? 204  TYR B C   1 
ATOM   1374 O O   . TYR B 2 30  ? 39.694 30.008 35.535 1.00 9.39  ? 204  TYR B O   1 
ATOM   1375 C CB  . TYR B 2 30  ? 40.412 32.748 33.952 1.00 16.00 ? 204  TYR B CB  1 
ATOM   1376 C CG  . TYR B 2 30  ? 40.715 34.218 33.780 1.00 19.59 ? 204  TYR B CG  1 
ATOM   1377 C CD1 . TYR B 2 30  ? 41.933 34.751 34.198 1.00 21.47 ? 204  TYR B CD1 1 
ATOM   1378 C CD2 . TYR B 2 30  ? 39.816 35.062 33.130 1.00 22.16 ? 204  TYR B CD2 1 
ATOM   1379 C CE1 . TYR B 2 30  ? 42.255 36.087 33.960 1.00 24.00 ? 204  TYR B CE1 1 
ATOM   1380 C CE2 . TYR B 2 30  ? 40.127 36.402 32.891 1.00 23.82 ? 204  TYR B CE2 1 
ATOM   1381 C CZ  . TYR B 2 30  ? 41.350 36.904 33.307 1.00 23.14 ? 204  TYR B CZ  1 
ATOM   1382 O OH  . TYR B 2 30  ? 41.670 38.219 33.055 1.00 25.96 ? 204  TYR B OH  1 
ATOM   1383 N N   . SER B 2 31  ? 38.204 30.623 33.964 1.00 9.09  ? 205  SER B N   1 
ATOM   1384 C CA  . SER B 2 31  ? 37.810 29.263 33.611 1.00 11.66 ? 205  SER B CA  1 
ATOM   1385 C C   . SER B 2 31  ? 38.067 29.163 32.111 1.00 12.51 ? 205  SER B C   1 
ATOM   1386 O O   . SER B 2 31  ? 37.637 30.034 31.350 1.00 12.65 ? 205  SER B O   1 
ATOM   1387 C CB  . SER B 2 31  ? 36.329 29.020 33.903 1.00 12.50 ? 205  SER B CB  1 
ATOM   1388 O OG  . SER B 2 31  ? 35.991 27.668 33.637 1.00 12.48 ? 205  SER B OG  1 
ATOM   1389 N N   . TRP B 2 32  ? 38.765 28.109 31.692 1.00 10.40 ? 206  TRP B N   1 
ATOM   1390 C CA  . TRP B 2 32  ? 39.121 27.920 30.287 1.00 11.07 ? 206  TRP B CA  1 
ATOM   1391 C C   . TRP B 2 32  ? 38.156 27.115 29.432 1.00 12.33 ? 206  TRP B C   1 
ATOM   1392 O O   . TRP B 2 32  ? 37.575 26.121 29.870 1.00 10.50 ? 206  TRP B O   1 
ATOM   1393 C CB  . TRP B 2 32  ? 40.510 27.290 30.178 1.00 11.13 ? 206  TRP B CB  1 
ATOM   1394 C CG  . TRP B 2 32  ? 41.603 28.198 30.621 1.00 13.60 ? 206  TRP B CG  1 
ATOM   1395 C CD1 . TRP B 2 32  ? 42.171 28.261 31.862 1.00 12.57 ? 206  TRP B CD1 1 
ATOM   1396 C CD2 . TRP B 2 32  ? 42.257 29.191 29.826 1.00 14.27 ? 206  TRP B CD2 1 
ATOM   1397 N NE1 . TRP B 2 32  ? 43.146 29.232 31.885 1.00 13.89 ? 206  TRP B NE1 1 
ATOM   1398 C CE2 . TRP B 2 32  ? 43.218 29.817 30.647 1.00 14.71 ? 206  TRP B CE2 1 
ATOM   1399 C CE3 . TRP B 2 32  ? 42.125 29.613 28.494 1.00 16.33 ? 206  TRP B CE3 1 
ATOM   1400 C CZ2 . TRP B 2 32  ? 44.049 30.845 30.180 1.00 15.09 ? 206  TRP B CZ2 1 
ATOM   1401 C CZ3 . TRP B 2 32  ? 42.952 30.636 28.031 1.00 16.17 ? 206  TRP B CZ3 1 
ATOM   1402 C CH2 . TRP B 2 32  ? 43.901 31.237 28.876 1.00 15.04 ? 206  TRP B CH2 1 
ATOM   1403 N N   . ARG B 2 33  ? 38.031 27.548 28.184 1.00 12.40 ? 207  ARG B N   1 
ATOM   1404 C CA  . ARG B 2 33  ? 37.148 26.913 27.221 1.00 14.12 ? 207  ARG B CA  1 
ATOM   1405 C C   . ARG B 2 33  ? 37.799 26.868 25.846 1.00 14.57 ? 207  ARG B C   1 
ATOM   1406 O O   . ARG B 2 33  ? 38.356 27.866 25.382 1.00 13.96 ? 207  ARG B O   1 
ATOM   1407 C CB  . ARG B 2 33  ? 35.832 27.695 27.162 1.00 14.20 ? 207  ARG B CB  1 
ATOM   1408 C CG  . ARG B 2 33  ? 34.945 27.404 25.968 1.00 18.17 ? 207  ARG B CG  1 
ATOM   1409 C CD  . ARG B 2 33  ? 33.591 28.087 26.156 1.00 19.01 ? 207  ARG B CD  1 
ATOM   1410 N NE  . ARG B 2 33  ? 33.737 29.488 26.544 1.00 19.25 ? 207  ARG B NE  1 
ATOM   1411 C CZ  . ARG B 2 33  ? 34.145 30.455 25.729 1.00 19.81 ? 207  ARG B CZ  1 
ATOM   1412 N NH1 . ARG B 2 33  ? 34.442 30.180 24.466 1.00 19.43 ? 207  ARG B NH1 1 
ATOM   1413 N NH2 . ARG B 2 33  ? 34.278 31.695 26.184 1.00 21.96 ? 207  ARG B NH2 1 
ATOM   1414 N N   . ASN B 2 34  ? 37.744 25.704 25.205 1.00 14.80 ? 208  ASN B N   1 
ATOM   1415 C CA  . ASN B 2 34  ? 38.306 25.552 23.869 1.00 16.56 ? 208  ASN B CA  1 
ATOM   1416 C C   . ASN B 2 34  ? 37.201 25.912 22.884 1.00 17.94 ? 208  ASN B C   1 
ATOM   1417 O O   . ASN B 2 34  ? 36.139 25.294 22.874 1.00 15.68 ? 208  ASN B O   1 
ATOM   1418 C CB  . ASN B 2 34  ? 38.776 24.113 23.640 1.00 16.92 ? 208  ASN B CB  1 
ATOM   1419 C CG  . ASN B 2 34  ? 39.457 23.931 22.295 1.00 18.37 ? 208  ASN B CG  1 
ATOM   1420 O OD1 . ASN B 2 34  ? 38.808 23.942 21.250 1.00 19.02 ? 208  ASN B OD1 1 
ATOM   1421 N ND2 . ASN B 2 34  ? 40.778 23.774 22.316 1.00 19.01 ? 208  ASN B ND2 1 
ATOM   1422 N N   . SER B 2 35  ? 37.459 26.920 22.058 1.00 21.38 ? 209  SER B N   1 
ATOM   1423 C CA  . SER B 2 35  ? 36.477 27.391 21.089 1.00 23.26 ? 209  SER B CA  1 
ATOM   1424 C C   . SER B 2 35  ? 35.926 26.310 20.163 1.00 23.74 ? 209  SER B C   1 
ATOM   1425 O O   . SER B 2 35  ? 34.939 26.537 19.470 1.00 25.04 ? 209  SER B O   1 
ATOM   1426 C CB  . SER B 2 35  ? 37.073 28.531 20.258 1.00 24.61 ? 209  SER B CB  1 
ATOM   1427 O OG  . SER B 2 35  ? 38.230 28.104 19.564 1.00 29.63 ? 209  SER B OG  1 
ATOM   1428 N N   . LYS B 2 36  ? 36.548 25.136 20.153 1.00 24.89 ? 210  LYS B N   1 
ATOM   1429 C CA  . LYS B 2 36  ? 36.084 24.058 19.290 1.00 25.22 ? 210  LYS B CA  1 
ATOM   1430 C C   . LYS B 2 36  ? 35.568 22.815 20.013 1.00 25.04 ? 210  LYS B C   1 
ATOM   1431 O O   . LYS B 2 36  ? 34.560 22.235 19.604 1.00 25.21 ? 210  LYS B O   1 
ATOM   1432 C CB  . LYS B 2 36  ? 37.195 23.646 18.320 1.00 27.58 ? 210  LYS B CB  1 
ATOM   1433 C CG  . LYS B 2 36  ? 36.799 22.511 17.393 1.00 31.77 ? 210  LYS B CG  1 
ATOM   1434 C CD  . LYS B 2 36  ? 37.892 22.198 16.386 1.00 36.36 ? 210  LYS B CD  1 
ATOM   1435 C CE  . LYS B 2 36  ? 37.448 21.103 15.428 1.00 39.61 ? 210  LYS B CE  1 
ATOM   1436 N NZ  . LYS B 2 36  ? 38.471 20.830 14.377 1.00 42.62 ? 210  LYS B NZ  1 
ATOM   1437 N N   . ASP B 2 37  ? 36.251 22.406 21.077 1.00 22.49 ? 211  ASP B N   1 
ATOM   1438 C CA  . ASP B 2 37  ? 35.857 21.208 21.816 1.00 22.00 ? 211  ASP B CA  1 
ATOM   1439 C C   . ASP B 2 37  ? 35.000 21.465 23.057 1.00 19.27 ? 211  ASP B C   1 
ATOM   1440 O O   . ASP B 2 37  ? 34.496 20.524 23.669 1.00 20.09 ? 211  ASP B O   1 
ATOM   1441 C CB  . ASP B 2 37  ? 37.097 20.417 22.242 1.00 24.28 ? 211  ASP B CB  1 
ATOM   1442 C CG  . ASP B 2 37  ? 38.069 20.185 21.101 1.00 28.45 ? 211  ASP B CG  1 
ATOM   1443 O OD1 . ASP B 2 37  ? 37.630 19.752 20.014 1.00 28.61 ? 211  ASP B OD1 1 
ATOM   1444 O OD2 . ASP B 2 37  ? 39.279 20.427 21.300 1.00 29.70 ? 211  ASP B OD2 1 
ATOM   1445 N N   . GLY B 2 38  ? 34.837 22.729 23.432 1.00 16.65 ? 212  GLY B N   1 
ATOM   1446 C CA  . GLY B 2 38  ? 34.054 23.042 24.613 1.00 14.32 ? 212  GLY B CA  1 
ATOM   1447 C C   . GLY B 2 38  ? 34.954 23.319 25.804 1.00 12.97 ? 212  GLY B C   1 
ATOM   1448 O O   . GLY B 2 38  ? 36.178 23.261 25.687 1.00 12.23 ? 212  GLY B O   1 
ATOM   1449 N N   . SER B 2 39  ? 34.358 23.623 26.953 1.00 11.13 ? 213  SER B N   1 
ATOM   1450 C CA  . SER B 2 39  ? 35.139 23.915 28.153 1.00 9.68  ? 213  SER B CA  1 
ATOM   1451 C C   . SER B 2 39  ? 35.871 22.677 28.658 1.00 9.25  ? 213  SER B C   1 
ATOM   1452 O O   . SER B 2 39  ? 35.393 21.550 28.502 1.00 9.21  ? 213  SER B O   1 
ATOM   1453 C CB  . SER B 2 39  ? 34.232 24.465 29.262 1.00 10.36 ? 213  SER B CB  1 
ATOM   1454 O OG  . SER B 2 39  ? 33.278 23.505 29.680 1.00 7.18  ? 213  SER B OG  1 
ATOM   1455 N N   . TRP B 2 40  ? 37.035 22.885 29.264 1.00 7.58  ? 214  TRP B N   1 
ATOM   1456 C CA  . TRP B 2 40  ? 37.816 21.766 29.793 1.00 8.92  ? 214  TRP B CA  1 
ATOM   1457 C C   . TRP B 2 40  ? 37.003 21.015 30.842 1.00 8.72  ? 214  TRP B C   1 
ATOM   1458 O O   . TRP B 2 40  ? 37.017 19.784 30.900 1.00 8.70  ? 214  TRP B O   1 
ATOM   1459 C CB  . TRP B 2 40  ? 39.106 22.264 30.449 1.00 8.77  ? 214  TRP B CB  1 
ATOM   1460 C CG  . TRP B 2 40  ? 40.025 23.042 29.550 1.00 9.39  ? 214  TRP B CG  1 
ATOM   1461 C CD1 . TRP B 2 40  ? 39.931 23.187 28.194 1.00 9.34  ? 214  TRP B CD1 1 
ATOM   1462 C CD2 . TRP B 2 40  ? 41.206 23.746 29.949 1.00 8.26  ? 214  TRP B CD2 1 
ATOM   1463 N NE1 . TRP B 2 40  ? 40.984 23.936 27.724 1.00 7.96  ? 214  TRP B NE1 1 
ATOM   1464 C CE2 . TRP B 2 40  ? 41.781 24.292 28.781 1.00 10.98 ? 214  TRP B CE2 1 
ATOM   1465 C CE3 . TRP B 2 40  ? 41.835 23.965 31.183 1.00 10.66 ? 214  TRP B CE3 1 
ATOM   1466 C CZ2 . TRP B 2 40  ? 42.962 25.046 28.809 1.00 9.80  ? 214  TRP B CZ2 1 
ATOM   1467 C CZ3 . TRP B 2 40  ? 43.008 24.712 31.213 1.00 12.02 ? 214  TRP B CZ3 1 
ATOM   1468 C CH2 . TRP B 2 40  ? 43.559 25.245 30.030 1.00 11.49 ? 214  TRP B CH2 1 
ATOM   1469 N N   . PHE B 2 41  ? 36.293 21.773 31.670 1.00 9.60  ? 215  PHE B N   1 
ATOM   1470 C CA  . PHE B 2 41  ? 35.489 21.204 32.744 1.00 9.33  ? 215  PHE B CA  1 
ATOM   1471 C C   . PHE B 2 41  ? 34.312 20.363 32.263 1.00 8.80  ? 215  PHE B C   1 
ATOM   1472 O O   . PHE B 2 41  ? 34.182 19.209 32.650 1.00 9.41  ? 215  PHE B O   1 
ATOM   1473 C CB  . PHE B 2 41  ? 34.982 22.320 33.662 1.00 7.84  ? 215  PHE B CB  1 
ATOM   1474 C CG  . PHE B 2 41  ? 34.159 21.826 34.825 1.00 8.80  ? 215  PHE B CG  1 
ATOM   1475 C CD1 . PHE B 2 41  ? 34.698 20.929 35.746 1.00 7.25  ? 215  PHE B CD1 1 
ATOM   1476 C CD2 . PHE B 2 41  ? 32.856 22.281 35.015 1.00 7.23  ? 215  PHE B CD2 1 
ATOM   1477 C CE1 . PHE B 2 41  ? 33.951 20.494 36.844 1.00 7.28  ? 215  PHE B CE1 1 
ATOM   1478 C CE2 . PHE B 2 41  ? 32.100 21.852 36.111 1.00 10.93 ? 215  PHE B CE2 1 
ATOM   1479 C CZ  . PHE B 2 41  ? 32.649 20.957 37.026 1.00 8.71  ? 215  PHE B CZ  1 
ATOM   1480 N N   . ILE B 2 42  ? 33.449 20.936 31.429 1.00 10.38 ? 216  ILE B N   1 
ATOM   1481 C CA  . ILE B 2 42  ? 32.296 20.192 30.936 1.00 9.83  ? 216  ILE B CA  1 
ATOM   1482 C C   . ILE B 2 42  ? 32.737 18.967 30.131 1.00 9.94  ? 216  ILE B C   1 
ATOM   1483 O O   . ILE B 2 42  ? 32.142 17.896 30.253 1.00 8.72  ? 216  ILE B O   1 
ATOM   1484 C CB  . ILE B 2 42  ? 31.364 21.091 30.081 1.00 10.16 ? 216  ILE B CB  1 
ATOM   1485 C CG1 . ILE B 2 42  ? 30.811 22.238 30.939 1.00 11.19 ? 216  ILE B CG1 1 
ATOM   1486 C CG2 . ILE B 2 42  ? 30.232 20.265 29.499 1.00 7.71  ? 216  ILE B CG2 1 
ATOM   1487 C CD1 . ILE B 2 42  ? 30.005 21.798 32.177 1.00 11.65 ? 216  ILE B CD1 1 
ATOM   1488 N N   . GLN B 2 43  ? 33.773 19.119 29.308 1.00 10.83 ? 217  GLN B N   1 
ATOM   1489 C CA  . GLN B 2 43  ? 34.286 17.990 28.527 1.00 12.93 ? 217  GLN B CA  1 
ATOM   1490 C C   . GLN B 2 43  ? 34.604 16.843 29.480 1.00 11.72 ? 217  GLN B C   1 
ATOM   1491 O O   . GLN B 2 43  ? 34.143 15.714 29.309 1.00 11.27 ? 217  GLN B O   1 
ATOM   1492 C CB  . GLN B 2 43  ? 35.601 18.342 27.816 1.00 13.62 ? 217  GLN B CB  1 
ATOM   1493 C CG  . GLN B 2 43  ? 35.536 19.273 26.623 1.00 18.99 ? 217  GLN B CG  1 
ATOM   1494 C CD  . GLN B 2 43  ? 36.914 19.472 25.997 1.00 20.92 ? 217  GLN B CD  1 
ATOM   1495 O OE1 . GLN B 2 43  ? 37.543 18.514 25.535 1.00 17.02 ? 217  GLN B OE1 1 
ATOM   1496 N NE2 . GLN B 2 43  ? 37.396 20.716 25.993 1.00 17.39 ? 217  GLN B NE2 1 
ATOM   1497 N N   . SER B 2 44  ? 35.421 17.160 30.479 1.00 10.19 ? 218  SER B N   1 
ATOM   1498 C CA  . SER B 2 44  ? 35.874 16.190 31.465 1.00 9.65  ? 218  SER B CA  1 
ATOM   1499 C C   . SER B 2 44  ? 34.759 15.623 32.323 1.00 9.61  ? 218  SER B C   1 
ATOM   1500 O O   . SER B 2 44  ? 34.746 14.428 32.613 1.00 11.35 ? 218  SER B O   1 
ATOM   1501 C CB  . SER B 2 44  ? 36.944 16.826 32.351 1.00 8.10  ? 218  SER B CB  1 
ATOM   1502 O OG  . SER B 2 44  ? 38.037 17.253 31.556 1.00 9.85  ? 218  SER B OG  1 
ATOM   1503 N N   . LEU B 2 45  ? 33.831 16.479 32.733 1.00 8.59  ? 219  LEU B N   1 
ATOM   1504 C CA  . LEU B 2 45  ? 32.710 16.038 33.549 1.00 9.08  ? 219  LEU B CA  1 
ATOM   1505 C C   . LEU B 2 45  ? 31.900 14.997 32.786 1.00 8.33  ? 219  LEU B C   1 
ATOM   1506 O O   . LEU B 2 45  ? 31.628 13.918 33.300 1.00 7.44  ? 219  LEU B O   1 
ATOM   1507 C CB  . LEU B 2 45  ? 31.808 17.223 33.910 1.00 8.56  ? 219  LEU B CB  1 
ATOM   1508 C CG  . LEU B 2 45  ? 30.530 16.872 34.682 1.00 10.39 ? 219  LEU B CG  1 
ATOM   1509 C CD1 . LEU B 2 45  ? 30.885 16.269 36.040 1.00 10.46 ? 219  LEU B CD1 1 
ATOM   1510 C CD2 . LEU B 2 45  ? 29.685 18.124 34.853 1.00 9.93  ? 219  LEU B CD2 1 
ATOM   1511 N N   . CYS B 2 46  ? 31.527 15.315 31.551 1.00 7.65  ? 220  CYS B N   1 
ATOM   1512 C CA  . CYS B 2 46  ? 30.747 14.377 30.756 1.00 9.74  ? 220  CYS B CA  1 
ATOM   1513 C C   . CYS B 2 46  ? 31.475 13.051 30.545 1.00 10.18 ? 220  CYS B C   1 
ATOM   1514 O O   . CYS B 2 46  ? 30.870 11.978 30.646 1.00 11.54 ? 220  CYS B O   1 
ATOM   1515 C CB  . CYS B 2 46  ? 30.379 15.005 29.409 1.00 9.46  ? 220  CYS B CB  1 
ATOM   1516 S SG  . CYS B 2 46  ? 29.196 16.365 29.556 1.00 11.25 ? 220  CYS B SG  1 
ATOM   1517 N N   . ALA B 2 47  ? 32.772 13.125 30.261 1.00 9.94  ? 221  ALA B N   1 
ATOM   1518 C CA  . ALA B 2 47  ? 33.574 11.925 30.045 1.00 10.59 ? 221  ALA B CA  1 
ATOM   1519 C C   . ALA B 2 47  ? 33.602 11.042 31.291 1.00 11.15 ? 221  ALA B C   1 
ATOM   1520 O O   . ALA B 2 47  ? 33.439 9.826  31.201 1.00 9.82  ? 221  ALA B O   1 
ATOM   1521 C CB  . ALA B 2 47  ? 34.996 12.307 29.643 1.00 9.63  ? 221  ALA B CB  1 
ATOM   1522 N N   . MET B 2 48  ? 33.801 11.650 32.456 1.00 11.10 ? 222  MET B N   1 
ATOM   1523 C CA  . MET B 2 48  ? 33.854 10.877 33.692 1.00 12.03 ? 222  MET B CA  1 
ATOM   1524 C C   . MET B 2 48  ? 32.489 10.314 34.085 1.00 12.74 ? 222  MET B C   1 
ATOM   1525 O O   . MET B 2 48  ? 32.400 9.204  34.614 1.00 11.09 ? 222  MET B O   1 
ATOM   1526 C CB  . MET B 2 48  ? 34.445 11.726 34.826 1.00 11.94 ? 222  MET B CB  1 
ATOM   1527 C CG  . MET B 2 48  ? 35.909 12.112 34.596 1.00 12.50 ? 222  MET B CG  1 
ATOM   1528 S SD  . MET B 2 48  ? 37.035 10.691 34.405 1.00 13.93 ? 222  MET B SD  1 
ATOM   1529 C CE  . MET B 2 48  ? 37.105 10.523 32.606 1.00 16.05 ? 222  MET B CE  1 
ATOM   1530 N N   . LEU B 2 49  ? 31.426 11.068 33.827 1.00 10.88 ? 223  LEU B N   1 
ATOM   1531 C CA  . LEU B 2 49  ? 30.086 10.586 34.143 1.00 10.59 ? 223  LEU B CA  1 
ATOM   1532 C C   . LEU B 2 49  ? 29.774 9.401  33.233 1.00 11.81 ? 223  LEU B C   1 
ATOM   1533 O O   . LEU B 2 49  ? 29.259 8.375  33.673 1.00 10.06 ? 223  LEU B O   1 
ATOM   1534 C CB  . LEU B 2 49  ? 29.044 11.694 33.930 1.00 11.27 ? 223  LEU B CB  1 
ATOM   1535 C CG  . LEU B 2 49  ? 28.844 12.698 35.073 1.00 8.72  ? 223  LEU B CG  1 
ATOM   1536 C CD1 . LEU B 2 49  ? 27.990 13.868 34.606 1.00 10.03 ? 223  LEU B CD1 1 
ATOM   1537 C CD2 . LEU B 2 49  ? 28.188 11.998 36.253 1.00 9.82  ? 223  LEU B CD2 1 
ATOM   1538 N N   . LYS B 2 50  ? 30.106 9.545  31.956 1.00 12.48 ? 224  LYS B N   1 
ATOM   1539 C CA  . LYS B 2 50  ? 29.854 8.488  30.992 1.00 13.49 ? 224  LYS B CA  1 
ATOM   1540 C C   . LYS B 2 50  ? 30.577 7.203  31.392 1.00 12.78 ? 224  LYS B C   1 
ATOM   1541 O O   . LYS B 2 50  ? 30.032 6.104  31.282 1.00 11.69 ? 224  LYS B O   1 
ATOM   1542 C CB  . LYS B 2 50  ? 30.323 8.932  29.606 1.00 17.13 ? 224  LYS B CB  1 
ATOM   1543 C CG  . LYS B 2 50  ? 29.716 8.149  28.457 1.00 24.30 ? 224  LYS B CG  1 
ATOM   1544 C CD  . LYS B 2 50  ? 30.164 8.707  27.108 1.00 27.60 ? 224  LYS B CD  1 
ATOM   1545 C CE  . LYS B 2 50  ? 30.020 10.231 27.047 1.00 30.34 ? 224  LYS B CE  1 
ATOM   1546 N NZ  . LYS B 2 50  ? 28.652 10.718 27.384 1.00 31.76 ? 224  LYS B NZ  1 
ATOM   1547 N N   . GLN B 2 51  ? 31.805 7.349  31.868 1.00 11.10 ? 225  GLN B N   1 
ATOM   1548 C CA  . GLN B 2 51  ? 32.610 6.199  32.255 1.00 13.28 ? 225  GLN B CA  1 
ATOM   1549 C C   . GLN B 2 51  ? 32.391 5.647  33.664 1.00 13.39 ? 225  GLN B C   1 
ATOM   1550 O O   . GLN B 2 51  ? 32.557 4.446  33.888 1.00 12.98 ? 225  GLN B O   1 
ATOM   1551 C CB  . GLN B 2 51  ? 34.090 6.547  32.062 1.00 15.80 ? 225  GLN B CB  1 
ATOM   1552 C CG  . GLN B 2 51  ? 35.079 5.580  32.694 1.00 17.61 ? 225  GLN B CG  1 
ATOM   1553 C CD  . GLN B 2 51  ? 36.513 5.878  32.290 1.00 20.76 ? 225  GLN B CD  1 
ATOM   1554 O OE1 . GLN B 2 51  ? 36.886 7.037  32.073 1.00 20.97 ? 225  GLN B OE1 1 
ATOM   1555 N NE2 . GLN B 2 51  ? 37.331 4.832  32.196 1.00 19.50 ? 225  GLN B NE2 1 
ATOM   1556 N N   . TYR B 2 52  ? 31.985 6.499  34.601 1.00 10.99 ? 226  TYR B N   1 
ATOM   1557 C CA  . TYR B 2 52  ? 31.835 6.061  35.987 1.00 12.11 ? 226  TYR B CA  1 
ATOM   1558 C C   . TYR B 2 52  ? 30.501 6.231  36.712 1.00 12.06 ? 226  TYR B C   1 
ATOM   1559 O O   . TYR B 2 52  ? 30.373 5.790  37.856 1.00 13.20 ? 226  TYR B O   1 
ATOM   1560 C CB  . TYR B 2 52  ? 32.916 6.740  36.827 1.00 11.44 ? 226  TYR B CB  1 
ATOM   1561 C CG  . TYR B 2 52  ? 34.324 6.417  36.397 1.00 14.69 ? 226  TYR B CG  1 
ATOM   1562 C CD1 . TYR B 2 52  ? 34.844 5.129  36.551 1.00 13.92 ? 226  TYR B CD1 1 
ATOM   1563 C CD2 . TYR B 2 52  ? 35.141 7.396  35.833 1.00 12.68 ? 226  TYR B CD2 1 
ATOM   1564 C CE1 . TYR B 2 52  ? 36.140 4.829  36.153 1.00 14.63 ? 226  TYR B CE1 1 
ATOM   1565 C CE2 . TYR B 2 52  ? 36.438 7.104  35.434 1.00 17.04 ? 226  TYR B CE2 1 
ATOM   1566 C CZ  . TYR B 2 52  ? 36.930 5.819  35.596 1.00 15.51 ? 226  TYR B CZ  1 
ATOM   1567 O OH  . TYR B 2 52  ? 38.211 5.528  35.195 1.00 20.00 ? 226  TYR B OH  1 
ATOM   1568 N N   . ALA B 2 53  ? 29.517 6.861  36.082 1.00 11.90 ? 227  ALA B N   1 
ATOM   1569 C CA  . ALA B 2 53  ? 28.229 7.076  36.745 1.00 11.70 ? 227  ALA B CA  1 
ATOM   1570 C C   . ALA B 2 53  ? 27.561 5.799  37.260 1.00 13.15 ? 227  ALA B C   1 
ATOM   1571 O O   . ALA B 2 53  ? 26.739 5.848  38.177 1.00 14.00 ? 227  ALA B O   1 
ATOM   1572 C CB  . ALA B 2 53  ? 27.282 7.819  35.817 1.00 12.42 ? 227  ALA B CB  1 
ATOM   1573 N N   . ASP B 2 54  ? 27.900 4.656  36.678 1.00 14.15 ? 228  ASP B N   1 
ATOM   1574 C CA  . ASP B 2 54  ? 27.302 3.407  37.128 1.00 18.30 ? 228  ASP B CA  1 
ATOM   1575 C C   . ASP B 2 54  ? 28.299 2.592  37.943 1.00 19.55 ? 228  ASP B C   1 
ATOM   1576 O O   . ASP B 2 54  ? 28.094 1.399  38.169 1.00 20.36 ? 228  ASP B O   1 
ATOM   1577 C CB  . ASP B 2 54  ? 26.807 2.595  35.923 1.00 19.80 ? 228  ASP B CB  1 
ATOM   1578 C CG  . ASP B 2 54  ? 27.939 2.086  35.046 1.00 23.54 ? 228  ASP B CG  1 
ATOM   1579 O OD1 . ASP B 2 54  ? 29.043 2.667  35.079 1.00 23.50 ? 228  ASP B OD1 1 
ATOM   1580 O OD2 . ASP B 2 54  ? 27.718 1.103  34.307 1.00 28.66 ? 228  ASP B OD2 1 
ATOM   1581 N N   . LYS B 2 55  ? 29.362 3.247  38.408 1.00 19.05 ? 229  LYS B N   1 
ATOM   1582 C CA  . LYS B 2 55  ? 30.404 2.561  39.170 1.00 20.72 ? 229  LYS B CA  1 
ATOM   1583 C C   . LYS B 2 55  ? 30.936 3.296  40.402 1.00 19.84 ? 229  LYS B C   1 
ATOM   1584 O O   . LYS B 2 55  ? 31.449 2.656  41.324 1.00 21.20 ? 229  LYS B O   1 
ATOM   1585 C CB  . LYS B 2 55  ? 31.598 2.262  38.255 1.00 22.59 ? 229  LYS B CB  1 
ATOM   1586 C CG  . LYS B 2 55  ? 31.247 1.637  36.914 1.00 27.06 ? 229  LYS B CG  1 
ATOM   1587 C CD  . LYS B 2 55  ? 32.498 1.458  36.064 1.00 26.83 ? 229  LYS B CD  1 
ATOM   1588 C CE  . LYS B 2 55  ? 32.171 0.911  34.683 1.00 29.38 ? 229  LYS B CE  1 
ATOM   1589 N NZ  . LYS B 2 55  ? 31.337 1.854  33.876 1.00 28.82 ? 229  LYS B NZ  1 
ATOM   1590 N N   . LEU B 2 56  ? 30.833 4.624  40.424 1.00 16.30 ? 230  LEU B N   1 
ATOM   1591 C CA  . LEU B 2 56  ? 31.366 5.399  41.546 1.00 14.49 ? 230  LEU B CA  1 
ATOM   1592 C C   . LEU B 2 56  ? 30.414 6.418  42.168 1.00 13.02 ? 230  LEU B C   1 
ATOM   1593 O O   . LEU B 2 56  ? 29.487 6.899  41.521 1.00 12.96 ? 230  LEU B O   1 
ATOM   1594 C CB  . LEU B 2 56  ? 32.632 6.142  41.098 1.00 14.63 ? 230  LEU B CB  1 
ATOM   1595 C CG  . LEU B 2 56  ? 33.753 5.317  40.460 1.00 16.11 ? 230  LEU B CG  1 
ATOM   1596 C CD1 . LEU B 2 56  ? 34.864 6.245  39.975 1.00 16.56 ? 230  LEU B CD1 1 
ATOM   1597 C CD2 . LEU B 2 56  ? 34.287 4.312  41.469 1.00 16.20 ? 230  LEU B CD2 1 
ATOM   1598 N N   . GLU B 2 57  ? 30.667 6.743  43.433 1.00 11.37 ? 231  GLU B N   1 
ATOM   1599 C CA  . GLU B 2 57  ? 29.882 7.735  44.161 1.00 10.56 ? 231  GLU B CA  1 
ATOM   1600 C C   . GLU B 2 57  ? 30.228 9.081  43.502 1.00 10.01 ? 231  GLU B C   1 
ATOM   1601 O O   . GLU B 2 57  ? 31.343 9.271  43.028 1.00 9.67  ? 231  GLU B O   1 
ATOM   1602 C CB  . GLU B 2 57  ? 30.280 7.708  45.644 1.00 11.32 ? 231  GLU B CB  1 
ATOM   1603 C CG  . GLU B 2 57  ? 29.355 8.466  46.596 1.00 12.14 ? 231  GLU B CG  1 
ATOM   1604 C CD  . GLU B 2 57  ? 29.621 9.959  46.612 1.00 10.99 ? 231  GLU B CD  1 
ATOM   1605 O OE1 . GLU B 2 57  ? 30.802 10.344 46.497 1.00 10.22 ? 231  GLU B OE1 1 
ATOM   1606 O OE2 . GLU B 2 57  ? 28.658 10.745 46.760 1.00 13.68 ? 231  GLU B OE2 1 
ATOM   1607 N N   . PHE B 2 58  ? 29.273 10.004 43.462 1.00 10.84 ? 232  PHE B N   1 
ATOM   1608 C CA  . PHE B 2 58  ? 29.471 11.293 42.800 1.00 10.57 ? 232  PHE B CA  1 
ATOM   1609 C C   . PHE B 2 58  ? 30.730 12.090 43.152 1.00 9.41  ? 232  PHE B C   1 
ATOM   1610 O O   . PHE B 2 58  ? 31.381 12.638 42.260 1.00 10.58 ? 232  PHE B O   1 
ATOM   1611 C CB  . PHE B 2 58  ? 28.230 12.167 43.005 1.00 10.97 ? 232  PHE B CB  1 
ATOM   1612 C CG  . PHE B 2 58  ? 28.176 13.372 42.108 1.00 12.84 ? 232  PHE B CG  1 
ATOM   1613 C CD1 . PHE B 2 58  ? 28.677 13.318 40.808 1.00 11.53 ? 232  PHE B CD1 1 
ATOM   1614 C CD2 . PHE B 2 58  ? 27.576 14.549 42.546 1.00 12.11 ? 232  PHE B CD2 1 
ATOM   1615 C CE1 . PHE B 2 58  ? 28.579 14.419 39.957 1.00 12.87 ? 232  PHE B CE1 1 
ATOM   1616 C CE2 . PHE B 2 58  ? 27.472 15.661 41.703 1.00 13.24 ? 232  PHE B CE2 1 
ATOM   1617 C CZ  . PHE B 2 58  ? 27.973 15.595 40.407 1.00 10.62 ? 232  PHE B CZ  1 
ATOM   1618 N N   . MET B 2 59  ? 31.077 12.169 44.433 1.00 7.65  ? 233  MET B N   1 
ATOM   1619 C CA  . MET B 2 59  ? 32.267 12.922 44.829 1.00 8.55  ? 233  MET B CA  1 
ATOM   1620 C C   . MET B 2 59  ? 33.529 12.297 44.238 1.00 9.54  ? 233  MET B C   1 
ATOM   1621 O O   . MET B 2 59  ? 34.478 12.996 43.888 1.00 8.25  ? 233  MET B O   1 
ATOM   1622 C CB  . MET B 2 59  ? 32.389 12.978 46.356 1.00 8.12  ? 233  MET B CB  1 
ATOM   1623 C CG  . MET B 2 59  ? 31.259 13.717 47.050 1.00 11.73 ? 233  MET B CG  1 
ATOM   1624 S SD  . MET B 2 59  ? 31.198 15.460 46.614 1.00 17.52 ? 233  MET B SD  1 
ATOM   1625 C CE  . MET B 2 59  ? 32.502 16.101 47.668 1.00 19.88 ? 233  MET B CE  1 
ATOM   1626 N N   . HIS B 2 60  ? 33.542 10.974 44.129 1.00 9.12  ? 234  HIS B N   1 
ATOM   1627 C CA  . HIS B 2 60  ? 34.698 10.300 43.568 1.00 9.51  ? 234  HIS B CA  1 
ATOM   1628 C C   . HIS B 2 60  ? 34.762 10.572 42.069 1.00 8.16  ? 234  HIS B C   1 
ATOM   1629 O O   . HIS B 2 60  ? 35.844 10.703 41.502 1.00 9.09  ? 234  HIS B O   1 
ATOM   1630 C CB  . HIS B 2 60  ? 34.624 8.802  43.878 1.00 13.20 ? 234  HIS B CB  1 
ATOM   1631 C CG  . HIS B 2 60  ? 34.835 8.488  45.328 1.00 19.15 ? 234  HIS B CG  1 
ATOM   1632 N ND1 . HIS B 2 60  ? 34.670 7.225  45.853 1.00 22.86 ? 234  HIS B ND1 1 
ATOM   1633 C CD2 . HIS B 2 60  ? 35.214 9.278  46.362 1.00 20.80 ? 234  HIS B CD2 1 
ATOM   1634 C CE1 . HIS B 2 60  ? 34.937 7.250  47.147 1.00 21.37 ? 234  HIS B CE1 1 
ATOM   1635 N NE2 . HIS B 2 60  ? 35.269 8.484  47.481 1.00 22.51 ? 234  HIS B NE2 1 
ATOM   1636 N N   . ILE B 2 61  ? 33.598 10.680 41.434 1.00 9.60  ? 235  ILE B N   1 
ATOM   1637 C CA  . ILE B 2 61  ? 33.551 10.976 40.009 1.00 8.63  ? 235  ILE B CA  1 
ATOM   1638 C C   . ILE B 2 61  ? 34.120 12.375 39.786 1.00 8.55  ? 235  ILE B C   1 
ATOM   1639 O O   . ILE B 2 61  ? 34.964 12.581 38.912 1.00 8.77  ? 235  ILE B O   1 
ATOM   1640 C CB  . ILE B 2 61  ? 32.102 10.937 39.465 1.00 7.65  ? 235  ILE B CB  1 
ATOM   1641 C CG1 . ILE B 2 61  ? 31.567 9.502  39.517 1.00 8.43  ? 235  ILE B CG1 1 
ATOM   1642 C CG2 . ILE B 2 61  ? 32.070 11.461 38.031 1.00 10.74 ? 235  ILE B CG2 1 
ATOM   1643 C CD1 . ILE B 2 61  ? 30.116 9.365  39.101 1.00 6.75  ? 235  ILE B CD1 1 
ATOM   1644 N N   . LEU B 2 62  ? 33.660 13.330 40.590 1.00 7.84  ? 236  LEU B N   1 
ATOM   1645 C CA  . LEU B 2 62  ? 34.120 14.709 40.480 1.00 8.34  ? 236  LEU B CA  1 
ATOM   1646 C C   . LEU B 2 62  ? 35.609 14.836 40.789 1.00 7.97  ? 236  LEU B C   1 
ATOM   1647 O O   . LEU B 2 62  ? 36.281 15.716 40.263 1.00 8.85  ? 236  LEU B O   1 
ATOM   1648 C CB  . LEU B 2 62  ? 33.304 15.617 41.402 1.00 6.10  ? 236  LEU B CB  1 
ATOM   1649 C CG  . LEU B 2 62  ? 31.839 15.832 41.002 1.00 7.96  ? 236  LEU B CG  1 
ATOM   1650 C CD1 . LEU B 2 62  ? 31.140 16.684 42.055 1.00 7.92  ? 236  LEU B CD1 1 
ATOM   1651 C CD2 . LEU B 2 62  ? 31.771 16.510 39.634 1.00 5.55  ? 236  LEU B CD2 1 
ATOM   1652 N N   . THR B 2 63  ? 36.123 13.957 41.644 1.00 8.60  ? 237  THR B N   1 
ATOM   1653 C CA  . THR B 2 63  ? 37.539 13.982 41.968 1.00 7.89  ? 237  THR B CA  1 
ATOM   1654 C C   . THR B 2 63  ? 38.298 13.546 40.714 1.00 8.73  ? 237  THR B C   1 
ATOM   1655 O O   . THR B 2 63  ? 39.359 14.081 40.410 1.00 7.58  ? 237  THR B O   1 
ATOM   1656 C CB  . THR B 2 63  ? 37.860 13.045 43.148 1.00 8.01  ? 237  THR B CB  1 
ATOM   1657 O OG1 . THR B 2 63  ? 37.219 13.544 44.329 1.00 9.25  ? 237  THR B OG1 1 
ATOM   1658 C CG2 . THR B 2 63  ? 39.366 12.974 43.392 1.00 9.05  ? 237  THR B CG2 1 
ATOM   1659 N N   . ARG B 2 64  ? 37.746 12.578 39.985 1.00 8.16  ? 238  ARG B N   1 
ATOM   1660 C CA  . ARG B 2 64  ? 38.369 12.121 38.743 1.00 9.59  ? 238  ARG B CA  1 
ATOM   1661 C C   . ARG B 2 64  ? 38.361 13.283 37.740 1.00 9.19  ? 238  ARG B C   1 
ATOM   1662 O O   . ARG B 2 64  ? 39.304 13.451 36.964 1.00 8.39  ? 238  ARG B O   1 
ATOM   1663 C CB  . ARG B 2 64  ? 37.604 10.934 38.141 1.00 11.51 ? 238  ARG B CB  1 
ATOM   1664 C CG  . ARG B 2 64  ? 37.640 9.644  38.952 1.00 17.11 ? 238  ARG B CG  1 
ATOM   1665 C CD  . ARG B 2 64  ? 39.060 9.166  39.202 1.00 22.95 ? 238  ARG B CD  1 
ATOM   1666 N NE  . ARG B 2 64  ? 39.084 7.821  39.776 1.00 28.08 ? 238  ARG B NE  1 
ATOM   1667 C CZ  . ARG B 2 64  ? 39.003 6.700  39.064 1.00 29.64 ? 238  ARG B CZ  1 
ATOM   1668 N NH1 . ARG B 2 64  ? 38.899 6.754  37.742 1.00 31.47 ? 238  ARG B NH1 1 
ATOM   1669 N NH2 . ARG B 2 64  ? 39.023 5.523  39.675 1.00 29.57 ? 238  ARG B NH2 1 
ATOM   1670 N N   . VAL B 2 65  ? 37.285 14.071 37.744 1.00 8.50  ? 239  VAL B N   1 
ATOM   1671 C CA  . VAL B 2 65  ? 37.194 15.226 36.842 1.00 8.52  ? 239  VAL B CA  1 
ATOM   1672 C C   . VAL B 2 65  ? 38.294 16.226 37.221 1.00 9.11  ? 239  VAL B C   1 
ATOM   1673 O O   . VAL B 2 65  ? 38.966 16.789 36.354 1.00 9.27  ? 239  VAL B O   1 
ATOM   1674 C CB  . VAL B 2 65  ? 35.817 15.933 36.945 1.00 8.13  ? 239  VAL B CB  1 
ATOM   1675 C CG1 . VAL B 2 65  ? 35.786 17.158 36.029 1.00 7.74  ? 239  VAL B CG1 1 
ATOM   1676 C CG2 . VAL B 2 65  ? 34.700 14.966 36.566 1.00 8.00  ? 239  VAL B CG2 1 
ATOM   1677 N N   . ASN B 2 66  ? 38.476 16.442 38.521 1.00 7.85  ? 240  ASN B N   1 
ATOM   1678 C CA  . ASN B 2 66  ? 39.515 17.356 38.999 1.00 9.45  ? 240  ASN B CA  1 
ATOM   1679 C C   . ASN B 2 66  ? 40.885 16.952 38.442 1.00 7.93  ? 240  ASN B C   1 
ATOM   1680 O O   . ASN B 2 66  ? 41.631 17.793 37.933 1.00 7.05  ? 240  ASN B O   1 
ATOM   1681 C CB  . ASN B 2 66  ? 39.579 17.355 40.534 1.00 8.74  ? 240  ASN B CB  1 
ATOM   1682 C CG  . ASN B 2 66  ? 38.591 18.323 41.176 1.00 9.15  ? 240  ASN B CG  1 
ATOM   1683 O OD1 . ASN B 2 66  ? 37.776 18.952 40.499 1.00 6.58  ? 240  ASN B OD1 1 
ATOM   1684 N ND2 . ASN B 2 66  ? 38.659 18.436 42.501 1.00 5.18  ? 240  ASN B ND2 1 
ATOM   1685 N N   . ARG B 2 67  ? 41.211 15.665 38.531 1.00 7.42  ? 241  ARG B N   1 
ATOM   1686 C CA  . ARG B 2 67  ? 42.502 15.179 38.047 1.00 7.97  ? 241  ARG B CA  1 
ATOM   1687 C C   . ARG B 2 67  ? 42.663 15.271 36.534 1.00 7.96  ? 241  ARG B C   1 
ATOM   1688 O O   . ARG B 2 67  ? 43.745 15.591 36.042 1.00 8.37  ? 241  ARG B O   1 
ATOM   1689 C CB  . ARG B 2 67  ? 42.749 13.728 38.498 1.00 11.14 ? 241  ARG B CB  1 
ATOM   1690 C CG  . ARG B 2 67  ? 44.132 13.214 38.097 1.00 14.12 ? 241  ARG B CG  1 
ATOM   1691 C CD  . ARG B 2 67  ? 44.591 11.978 38.873 1.00 18.02 ? 241  ARG B CD  1 
ATOM   1692 N NE  . ARG B 2 67  ? 43.952 10.736 38.440 1.00 22.13 ? 241  ARG B NE  1 
ATOM   1693 C CZ  . ARG B 2 67  ? 42.950 10.137 39.077 1.00 25.16 ? 241  ARG B CZ  1 
ATOM   1694 N NH1 . ARG B 2 67  ? 42.447 10.662 40.190 1.00 25.48 ? 241  ARG B NH1 1 
ATOM   1695 N NH2 . ARG B 2 67  ? 42.463 8.993  38.612 1.00 22.74 ? 241  ARG B NH2 1 
ATOM   1696 N N   . LYS B 2 68  ? 41.595 14.985 35.796 1.00 8.16  ? 242  LYS B N   1 
ATOM   1697 C CA  . LYS B 2 68  ? 41.648 15.046 34.339 1.00 7.61  ? 242  LYS B CA  1 
ATOM   1698 C C   . LYS B 2 68  ? 41.934 16.469 33.858 1.00 7.23  ? 242  LYS B C   1 
ATOM   1699 O O   . LYS B 2 68  ? 42.796 16.692 33.007 1.00 7.22  ? 242  LYS B O   1 
ATOM   1700 C CB  . LYS B 2 68  ? 40.323 14.554 33.745 1.00 10.31 ? 242  LYS B CB  1 
ATOM   1701 C CG  . LYS B 2 68  ? 40.314 14.475 32.225 1.00 13.07 ? 242  LYS B CG  1 
ATOM   1702 C CD  . LYS B 2 68  ? 38.962 14.003 31.702 1.00 16.39 ? 242  LYS B CD  1 
ATOM   1703 C CE  . LYS B 2 68  ? 38.903 14.038 30.176 1.00 20.09 ? 242  LYS B CE  1 
ATOM   1704 N NZ  . LYS B 2 68  ? 39.857 13.085 29.538 1.00 19.37 ? 242  LYS B NZ  1 
ATOM   1705 N N   . VAL B 2 69  ? 41.207 17.433 34.408 1.00 7.75  ? 243  VAL B N   1 
ATOM   1706 C CA  . VAL B 2 69  ? 41.386 18.826 34.027 1.00 7.66  ? 243  VAL B CA  1 
ATOM   1707 C C   . VAL B 2 69  ? 42.774 19.332 34.413 1.00 9.32  ? 243  VAL B C   1 
ATOM   1708 O O   . VAL B 2 69  ? 43.446 20.001 33.628 1.00 9.76  ? 243  VAL B O   1 
ATOM   1709 C CB  . VAL B 2 69  ? 40.316 19.715 34.699 1.00 6.78  ? 243  VAL B CB  1 
ATOM   1710 C CG1 . VAL B 2 69  ? 40.621 21.190 34.452 1.00 7.03  ? 243  VAL B CG1 1 
ATOM   1711 C CG2 . VAL B 2 69  ? 38.931 19.356 34.151 1.00 7.29  ? 243  VAL B CG2 1 
ATOM   1712 N N   . ALA B 2 70  ? 43.200 18.997 35.625 1.00 7.85  ? 244  ALA B N   1 
ATOM   1713 C CA  . ALA B 2 70  ? 44.493 19.426 36.140 1.00 9.23  ? 244  ALA B CA  1 
ATOM   1714 C C   . ALA B 2 70  ? 45.708 18.890 35.381 1.00 10.00 ? 244  ALA B C   1 
ATOM   1715 O O   . ALA B 2 70  ? 46.705 19.590 35.213 1.00 9.38  ? 244  ALA B O   1 
ATOM   1716 C CB  . ALA B 2 70  ? 44.604 19.037 37.615 1.00 10.94 ? 244  ALA B CB  1 
ATOM   1717 N N   . THR B 2 71  ? 45.625 17.653 34.915 1.00 12.16 ? 245  THR B N   1 
ATOM   1718 C CA  . THR B 2 71  ? 46.760 17.047 34.237 1.00 13.21 ? 245  THR B CA  1 
ATOM   1719 C C   . THR B 2 71  ? 46.768 17.113 32.717 1.00 14.58 ? 245  THR B C   1 
ATOM   1720 O O   . THR B 2 71  ? 47.819 17.286 32.108 1.00 16.20 ? 245  THR B O   1 
ATOM   1721 C CB  . THR B 2 71  ? 46.904 15.567 34.651 1.00 15.32 ? 245  THR B CB  1 
ATOM   1722 O OG1 . THR B 2 71  ? 45.733 14.841 34.258 1.00 13.97 ? 245  THR B OG1 1 
ATOM   1723 C CG2 . THR B 2 71  ? 47.075 15.453 36.160 1.00 15.76 ? 245  THR B CG2 1 
ATOM   1724 N N   . GLU B 2 72  ? 45.597 16.992 32.107 1.00 14.94 ? 246  GLU B N   1 
ATOM   1725 C CA  . GLU B 2 72  ? 45.502 16.970 30.654 1.00 15.58 ? 246  GLU B CA  1 
ATOM   1726 C C   . GLU B 2 72  ? 45.347 18.287 29.907 1.00 16.75 ? 246  GLU B C   1 
ATOM   1727 O O   . GLU B 2 72  ? 45.553 18.330 28.695 1.00 17.97 ? 246  GLU B O   1 
ATOM   1728 C CB  . GLU B 2 72  ? 44.367 16.027 30.252 1.00 17.78 ? 246  GLU B CB  1 
ATOM   1729 C CG  . GLU B 2 72  ? 44.692 14.557 30.497 1.00 20.79 ? 246  GLU B CG  1 
ATOM   1730 C CD  . GLU B 2 72  ? 43.461 13.672 30.510 1.00 23.05 ? 246  GLU B CD  1 
ATOM   1731 O OE1 . GLU B 2 72  ? 42.549 13.898 29.688 1.00 20.80 ? 246  GLU B OE1 1 
ATOM   1732 O OE2 . GLU B 2 72  ? 43.411 12.741 31.341 1.00 24.22 ? 246  GLU B OE2 1 
ATOM   1733 N N   . PHE B 2 73  ? 45.000 19.359 30.608 1.00 14.23 ? 247  PHE B N   1 
ATOM   1734 C CA  . PHE B 2 73  ? 44.794 20.637 29.940 1.00 14.92 ? 247  PHE B CA  1 
ATOM   1735 C C   . PHE B 2 73  ? 45.764 21.754 30.307 1.00 14.45 ? 247  PHE B C   1 
ATOM   1736 O O   . PHE B 2 73  ? 46.151 21.915 31.461 1.00 12.80 ? 247  PHE B O   1 
ATOM   1737 C CB  . PHE B 2 73  ? 43.364 21.120 30.198 1.00 15.82 ? 247  PHE B CB  1 
ATOM   1738 C CG  . PHE B 2 73  ? 42.304 20.229 29.608 1.00 16.71 ? 247  PHE B CG  1 
ATOM   1739 C CD1 . PHE B 2 73  ? 41.904 20.383 28.286 1.00 17.30 ? 247  PHE B CD1 1 
ATOM   1740 C CD2 . PHE B 2 73  ? 41.698 19.243 30.380 1.00 16.96 ? 247  PHE B CD2 1 
ATOM   1741 C CE1 . PHE B 2 73  ? 40.909 19.569 27.743 1.00 17.63 ? 247  PHE B CE1 1 
ATOM   1742 C CE2 . PHE B 2 73  ? 40.706 18.425 29.847 1.00 17.30 ? 247  PHE B CE2 1 
ATOM   1743 C CZ  . PHE B 2 73  ? 40.310 18.588 28.527 1.00 16.68 ? 247  PHE B CZ  1 
ATOM   1744 N N   . GLU B 2 74  ? 46.146 22.522 29.295 1.00 14.38 ? 248  GLU B N   1 
ATOM   1745 C CA  . GLU B 2 74  ? 47.030 23.664 29.457 1.00 13.62 ? 248  GLU B CA  1 
ATOM   1746 C C   . GLU B 2 74  ? 46.666 24.616 28.325 1.00 13.37 ? 248  GLU B C   1 
ATOM   1747 O O   . GLU B 2 74  ? 46.548 24.198 27.176 1.00 12.12 ? 248  GLU B O   1 
ATOM   1748 C CB  . GLU B 2 74  ? 48.500 23.239 29.366 1.00 14.75 ? 248  GLU B CB  1 
ATOM   1749 C CG  . GLU B 2 74  ? 49.466 24.406 29.427 1.00 15.82 ? 248  GLU B CG  1 
ATOM   1750 C CD  . GLU B 2 74  ? 50.912 23.980 29.602 1.00 19.15 ? 248  GLU B CD  1 
ATOM   1751 O OE1 . GLU B 2 74  ? 51.793 24.704 29.100 1.00 19.00 ? 248  GLU B OE1 1 
ATOM   1752 O OE2 . GLU B 2 74  ? 51.168 22.938 30.248 1.00 17.85 ? 248  GLU B OE2 1 
ATOM   1753 N N   . SER B 2 75  ? 46.477 25.892 28.645 1.00 11.94 ? 249  SER B N   1 
ATOM   1754 C CA  . SER B 2 75  ? 46.081 26.863 27.632 1.00 11.98 ? 249  SER B CA  1 
ATOM   1755 C C   . SER B 2 75  ? 47.148 27.183 26.593 1.00 13.49 ? 249  SER B C   1 
ATOM   1756 O O   . SER B 2 75  ? 48.346 27.020 26.831 1.00 12.52 ? 249  SER B O   1 
ATOM   1757 C CB  . SER B 2 75  ? 45.634 28.172 28.294 1.00 11.43 ? 249  SER B CB  1 
ATOM   1758 O OG  . SER B 2 75  ? 46.740 28.886 28.817 1.00 11.86 ? 249  SER B OG  1 
ATOM   1759 N N   . PHE B 2 76  ? 46.682 27.629 25.431 1.00 13.16 ? 250  PHE B N   1 
ATOM   1760 C CA  . PHE B 2 76  ? 47.551 28.038 24.338 1.00 12.87 ? 250  PHE B CA  1 
ATOM   1761 C C   . PHE B 2 76  ? 47.036 29.402 23.911 1.00 12.79 ? 250  PHE B C   1 
ATOM   1762 O O   . PHE B 2 76  ? 45.862 29.548 23.564 1.00 14.06 ? 250  PHE B O   1 
ATOM   1763 C CB  . PHE B 2 76  ? 47.458 27.076 23.153 1.00 14.95 ? 250  PHE B CB  1 
ATOM   1764 C CG  . PHE B 2 76  ? 48.321 27.476 21.983 1.00 17.13 ? 250  PHE B CG  1 
ATOM   1765 C CD1 . PHE B 2 76  ? 49.676 27.159 21.957 1.00 15.98 ? 250  PHE B CD1 1 
ATOM   1766 C CD2 . PHE B 2 76  ? 47.784 28.200 20.925 1.00 18.48 ? 250  PHE B CD2 1 
ATOM   1767 C CE1 . PHE B 2 76  ? 50.485 27.559 20.891 1.00 19.32 ? 250  PHE B CE1 1 
ATOM   1768 C CE2 . PHE B 2 76  ? 48.585 28.607 19.853 1.00 19.58 ? 250  PHE B CE2 1 
ATOM   1769 C CZ  . PHE B 2 76  ? 49.936 28.286 19.836 1.00 15.98 ? 250  PHE B CZ  1 
ATOM   1770 N N   . SER B 2 77  ? 47.900 30.407 23.944 1.00 11.88 ? 251  SER B N   1 
ATOM   1771 C CA  . SER B 2 77  ? 47.487 31.745 23.553 1.00 12.16 ? 251  SER B CA  1 
ATOM   1772 C C   . SER B 2 77  ? 48.626 32.515 22.917 1.00 12.84 ? 251  SER B C   1 
ATOM   1773 O O   . SER B 2 77  ? 49.786 32.362 23.302 1.00 12.96 ? 251  SER B O   1 
ATOM   1774 C CB  . SER B 2 77  ? 46.983 32.518 24.774 1.00 9.06  ? 251  SER B CB  1 
ATOM   1775 O OG  . SER B 2 77  ? 46.665 33.853 24.430 1.00 12.58 ? 251  SER B OG  1 
ATOM   1776 N N   . PHE B 2 78  ? 48.292 33.336 21.930 1.00 13.99 ? 252  PHE B N   1 
ATOM   1777 C CA  . PHE B 2 78  ? 49.292 34.158 21.268 1.00 13.61 ? 252  PHE B CA  1 
ATOM   1778 C C   . PHE B 2 78  ? 49.682 35.272 22.236 1.00 14.62 ? 252  PHE B C   1 
ATOM   1779 O O   . PHE B 2 78  ? 50.716 35.915 22.077 1.00 14.25 ? 252  PHE B O   1 
ATOM   1780 C CB  . PHE B 2 78  ? 48.714 34.730 19.970 1.00 15.20 ? 252  PHE B CB  1 
ATOM   1781 C CG  . PHE B 2 78  ? 48.534 33.700 18.884 1.00 15.57 ? 252  PHE B CG  1 
ATOM   1782 C CD1 . PHE B 2 78  ? 47.546 33.851 17.917 1.00 19.29 ? 252  PHE B CD1 1 
ATOM   1783 C CD2 . PHE B 2 78  ? 49.359 32.579 18.828 1.00 18.36 ? 252  PHE B CD2 1 
ATOM   1784 C CE1 . PHE B 2 78  ? 47.379 32.899 16.910 1.00 19.81 ? 252  PHE B CE1 1 
ATOM   1785 C CE2 . PHE B 2 78  ? 49.202 31.621 17.827 1.00 18.09 ? 252  PHE B CE2 1 
ATOM   1786 C CZ  . PHE B 2 78  ? 48.212 31.781 16.868 1.00 19.14 ? 252  PHE B CZ  1 
ATOM   1787 N N   . ASP B 2 79  ? 48.837 35.489 23.243 1.00 14.40 ? 253  ASP B N   1 
ATOM   1788 C CA  . ASP B 2 79  ? 49.087 36.497 24.267 1.00 14.13 ? 253  ASP B CA  1 
ATOM   1789 C C   . ASP B 2 79  ? 49.815 35.782 25.400 1.00 14.33 ? 253  ASP B C   1 
ATOM   1790 O O   . ASP B 2 79  ? 49.240 34.932 26.080 1.00 13.10 ? 253  ASP B O   1 
ATOM   1791 C CB  . ASP B 2 79  ? 47.768 37.077 24.793 1.00 16.71 ? 253  ASP B CB  1 
ATOM   1792 C CG  . ASP B 2 79  ? 47.977 38.185 25.817 1.00 17.27 ? 253  ASP B CG  1 
ATOM   1793 O OD1 . ASP B 2 79  ? 49.086 38.292 26.379 1.00 19.50 ? 253  ASP B OD1 1 
ATOM   1794 O OD2 . ASP B 2 79  ? 47.023 38.949 26.071 1.00 20.30 ? 253  ASP B OD2 1 
ATOM   1795 N N   . ALA B 2 80  ? 51.084 36.124 25.591 1.00 14.66 ? 254  ALA B N   1 
ATOM   1796 C CA  . ALA B 2 80  ? 51.901 35.504 26.627 1.00 14.90 ? 254  ALA B CA  1 
ATOM   1797 C C   . ALA B 2 80  ? 51.223 35.511 27.995 1.00 15.56 ? 254  ALA B C   1 
ATOM   1798 O O   . ALA B 2 80  ? 51.411 34.589 28.789 1.00 14.79 ? 254  ALA B O   1 
ATOM   1799 C CB  . ALA B 2 80  ? 53.249 36.210 26.709 1.00 16.09 ? 254  ALA B CB  1 
ATOM   1800 N N   . THR B 2 81  ? 50.440 36.551 28.267 1.00 15.04 ? 255  THR B N   1 
ATOM   1801 C CA  . THR B 2 81  ? 49.749 36.675 29.548 1.00 16.23 ? 255  THR B CA  1 
ATOM   1802 C C   . THR B 2 81  ? 48.813 35.498 29.817 1.00 14.64 ? 255  THR B C   1 
ATOM   1803 O O   . THR B 2 81  ? 48.713 35.022 30.947 1.00 15.45 ? 255  THR B O   1 
ATOM   1804 C CB  . THR B 2 81  ? 48.915 37.981 29.613 1.00 17.11 ? 255  THR B CB  1 
ATOM   1805 O OG1 . THR B 2 81  ? 49.785 39.113 29.506 1.00 20.74 ? 255  THR B OG1 1 
ATOM   1806 C CG2 . THR B 2 81  ? 48.148 38.062 30.926 1.00 19.97 ? 255  THR B CG2 1 
ATOM   1807 N N   . PHE B 2 82  ? 48.135 35.029 28.776 1.00 12.72 ? 256  PHE B N   1 
ATOM   1808 C CA  . PHE B 2 82  ? 47.191 33.926 28.918 1.00 13.44 ? 256  PHE B CA  1 
ATOM   1809 C C   . PHE B 2 82  ? 47.705 32.578 28.418 1.00 12.22 ? 256  PHE B C   1 
ATOM   1810 O O   . PHE B 2 82  ? 46.950 31.608 28.353 1.00 13.17 ? 256  PHE B O   1 
ATOM   1811 C CB  . PHE B 2 82  ? 45.894 34.254 28.175 1.00 13.33 ? 256  PHE B CB  1 
ATOM   1812 C CG  . PHE B 2 82  ? 45.096 35.355 28.802 1.00 15.16 ? 256  PHE B CG  1 
ATOM   1813 C CD1 . PHE B 2 82  ? 45.490 36.682 28.677 1.00 17.89 ? 256  PHE B CD1 1 
ATOM   1814 C CD2 . PHE B 2 82  ? 43.948 35.063 29.527 1.00 16.60 ? 256  PHE B CD2 1 
ATOM   1815 C CE1 . PHE B 2 82  ? 44.748 37.706 29.268 1.00 15.68 ? 256  PHE B CE1 1 
ATOM   1816 C CE2 . PHE B 2 82  ? 43.201 36.079 30.120 1.00 18.00 ? 256  PHE B CE2 1 
ATOM   1817 C CZ  . PHE B 2 82  ? 43.604 37.400 29.989 1.00 16.53 ? 256  PHE B CZ  1 
ATOM   1818 N N   . HIS B 2 83  ? 48.981 32.513 28.071 1.00 11.39 ? 257  HIS B N   1 
ATOM   1819 C CA  . HIS B 2 83  ? 49.548 31.277 27.552 1.00 10.84 ? 257  HIS B CA  1 
ATOM   1820 C C   . HIS B 2 83  ? 50.101 30.324 28.606 1.00 9.60  ? 257  HIS B C   1 
ATOM   1821 O O   . HIS B 2 83  ? 50.665 30.751 29.609 1.00 9.12  ? 257  HIS B O   1 
ATOM   1822 C CB  . HIS B 2 83  ? 50.658 31.605 26.547 1.00 10.12 ? 257  HIS B CB  1 
ATOM   1823 C CG  . HIS B 2 83  ? 51.348 30.397 25.997 1.00 11.35 ? 257  HIS B CG  1 
ATOM   1824 N ND1 . HIS B 2 83  ? 50.694 29.449 25.241 1.00 9.98  ? 257  HIS B ND1 1 
ATOM   1825 C CD2 . HIS B 2 83  ? 52.630 29.974 26.106 1.00 10.97 ? 257  HIS B CD2 1 
ATOM   1826 C CE1 . HIS B 2 83  ? 51.543 28.492 24.909 1.00 11.07 ? 257  HIS B CE1 1 
ATOM   1827 N NE2 . HIS B 2 83  ? 52.724 28.786 25.421 1.00 10.30 ? 257  HIS B NE2 1 
ATOM   1828 N N   . ALA B 2 84  ? 49.942 29.028 28.344 1.00 10.66 ? 258  ALA B N   1 
ATOM   1829 C CA  . ALA B 2 84  ? 50.437 27.962 29.209 1.00 10.75 ? 258  ALA B CA  1 
ATOM   1830 C C   . ALA B 2 84  ? 49.877 27.973 30.626 1.00 12.22 ? 258  ALA B C   1 
ATOM   1831 O O   . ALA B 2 84  ? 50.602 27.702 31.585 1.00 10.99 ? 258  ALA B O   1 
ATOM   1832 C CB  . ALA B 2 84  ? 51.962 28.003 29.253 1.00 13.40 ? 258  ALA B CB  1 
ATOM   1833 N N   . LYS B 2 85  ? 48.587 28.264 30.756 1.00 11.39 ? 259  LYS B N   1 
ATOM   1834 C CA  . LYS B 2 85  ? 47.962 28.302 32.073 1.00 10.46 ? 259  LYS B CA  1 
ATOM   1835 C C   . LYS B 2 85  ? 47.232 27.001 32.396 1.00 10.62 ? 259  LYS B C   1 
ATOM   1836 O O   . LYS B 2 85  ? 46.854 26.237 31.503 1.00 9.23  ? 259  LYS B O   1 
ATOM   1837 C CB  . LYS B 2 85  ? 47.005 29.492 32.165 1.00 10.14 ? 259  LYS B CB  1 
ATOM   1838 C CG  . LYS B 2 85  ? 47.675 30.830 31.848 1.00 12.82 ? 259  LYS B CG  1 
ATOM   1839 C CD  . LYS B 2 85  ? 48.862 31.100 32.777 1.00 15.71 ? 259  LYS B CD  1 
ATOM   1840 C CE  . LYS B 2 85  ? 49.593 32.379 32.388 1.00 18.72 ? 259  LYS B CE  1 
ATOM   1841 N NZ  . LYS B 2 85  ? 50.775 32.635 33.257 1.00 17.71 ? 259  LYS B NZ  1 
ATOM   1842 N N   . LYS B 2 86  ? 47.040 26.761 33.689 1.00 10.42 ? 260  LYS B N   1 
ATOM   1843 C CA  . LYS B 2 86  ? 46.393 25.551 34.165 1.00 10.39 ? 260  LYS B CA  1 
ATOM   1844 C C   . LYS B 2 86  ? 45.077 25.849 34.864 1.00 10.82 ? 260  LYS B C   1 
ATOM   1845 O O   . LYS B 2 86  ? 44.753 27.007 35.126 1.00 11.33 ? 260  LYS B O   1 
ATOM   1846 C CB  . LYS B 2 86  ? 47.328 24.823 35.129 1.00 9.37  ? 260  LYS B CB  1 
ATOM   1847 C CG  . LYS B 2 86  ? 48.673 24.449 34.527 1.00 9.72  ? 260  LYS B CG  1 
ATOM   1848 C CD  . LYS B 2 86  ? 48.533 23.349 33.489 1.00 7.99  ? 260  LYS B CD  1 
ATOM   1849 C CE  . LYS B 2 86  ? 48.065 22.053 34.131 1.00 7.30  ? 260  LYS B CE  1 
ATOM   1850 N NZ  . LYS B 2 86  ? 48.067 20.930 33.161 1.00 5.86  ? 260  LYS B NZ  1 
ATOM   1851 N N   . GLN B 2 87  ? 44.335 24.789 35.178 1.00 10.18 ? 261  GLN B N   1 
ATOM   1852 C CA  . GLN B 2 87  ? 43.047 24.924 35.842 1.00 9.56  ? 261  GLN B CA  1 
ATOM   1853 C C   . GLN B 2 87  ? 42.738 23.732 36.744 1.00 10.28 ? 261  GLN B C   1 
ATOM   1854 O O   . GLN B 2 87  ? 43.035 22.582 36.408 1.00 9.67  ? 261  GLN B O   1 
ATOM   1855 C CB  . GLN B 2 87  ? 41.938 25.065 34.793 1.00 10.14 ? 261  GLN B CB  1 
ATOM   1856 C CG  . GLN B 2 87  ? 40.546 25.309 35.355 1.00 8.90  ? 261  GLN B CG  1 
ATOM   1857 C CD  . GLN B 2 87  ? 39.529 25.597 34.263 1.00 12.14 ? 261  GLN B CD  1 
ATOM   1858 O OE1 . GLN B 2 87  ? 39.765 26.431 33.392 1.00 12.53 ? 261  GLN B OE1 1 
ATOM   1859 N NE2 . GLN B 2 87  ? 38.390 24.910 34.308 1.00 11.69 ? 261  GLN B NE2 1 
ATOM   1860 N N   . ILE B 2 88  ? 42.133 24.013 37.890 1.00 8.31  ? 262  ILE B N   1 
ATOM   1861 C CA  . ILE B 2 88  ? 41.761 22.955 38.818 1.00 11.20 ? 262  ILE B CA  1 
ATOM   1862 C C   . ILE B 2 88  ? 40.310 23.214 39.231 1.00 9.15  ? 262  ILE B C   1 
ATOM   1863 O O   . ILE B 2 88  ? 39.998 24.257 39.805 1.00 11.44 ? 262  ILE B O   1 
ATOM   1864 C CB  . ILE B 2 88  ? 42.729 22.933 40.051 1.00 12.34 ? 262  ILE B CB  1 
ATOM   1865 C CG1 . ILE B 2 88  ? 42.554 21.634 40.844 1.00 16.03 ? 262  ILE B CG1 1 
ATOM   1866 C CG2 . ILE B 2 88  ? 42.518 24.167 40.927 1.00 15.21 ? 262  ILE B CG2 1 
ATOM   1867 C CD1 . ILE B 2 88  ? 41.345 21.591 41.721 1.00 20.48 ? 262  ILE B CD1 1 
ATOM   1868 N N   . PRO B 2 89  ? 39.391 22.292 38.886 1.00 10.29 ? 263  PRO B N   1 
ATOM   1869 C CA  . PRO B 2 89  ? 37.980 22.475 39.251 1.00 9.81  ? 263  PRO B CA  1 
ATOM   1870 C C   . PRO B 2 89  ? 37.845 22.553 40.766 1.00 10.91 ? 263  PRO B C   1 
ATOM   1871 O O   . PRO B 2 89  ? 38.783 22.234 41.490 1.00 11.60 ? 263  PRO B O   1 
ATOM   1872 C CB  . PRO B 2 89  ? 37.303 21.242 38.661 1.00 10.06 ? 263  PRO B CB  1 
ATOM   1873 C CG  . PRO B 2 89  ? 38.156 20.933 37.467 1.00 9.61  ? 263  PRO B CG  1 
ATOM   1874 C CD  . PRO B 2 89  ? 39.552 21.115 38.015 1.00 10.13 ? 263  PRO B CD  1 
ATOM   1875 N N   . CYS B 2 90  ? 36.674 22.952 41.245 1.00 9.72  ? 264  CYS B N   1 
ATOM   1876 C CA  . CYS B 2 90  ? 36.465 23.112 42.675 1.00 9.38  ? 264  CYS B CA  1 
ATOM   1877 C C   . CYS B 2 90  ? 35.130 22.527 43.126 1.00 10.34 ? 264  CYS B C   1 
ATOM   1878 O O   . CYS B 2 90  ? 34.073 23.076 42.822 1.00 9.14  ? 264  CYS B O   1 
ATOM   1879 C CB  . CYS B 2 90  ? 36.531 24.609 43.008 1.00 11.54 ? 264  CYS B CB  1 
ATOM   1880 S SG  . CYS B 2 90  ? 36.309 25.051 44.742 1.00 11.48 ? 264  CYS B SG  1 
ATOM   1881 N N   . ILE B 2 91  ? 35.191 21.416 43.858 1.00 8.15  ? 265  ILE B N   1 
ATOM   1882 C CA  . ILE B 2 91  ? 33.995 20.743 44.358 1.00 8.65  ? 265  ILE B CA  1 
ATOM   1883 C C   . ILE B 2 91  ? 33.562 21.359 45.685 1.00 8.98  ? 265  ILE B C   1 
ATOM   1884 O O   . ILE B 2 91  ? 34.327 21.357 46.649 1.00 9.89  ? 265  ILE B O   1 
ATOM   1885 C CB  . ILE B 2 91  ? 34.265 19.243 44.618 1.00 7.25  ? 265  ILE B CB  1 
ATOM   1886 C CG1 . ILE B 2 91  ? 34.871 18.590 43.375 1.00 8.61  ? 265  ILE B CG1 1 
ATOM   1887 C CG2 . ILE B 2 91  ? 32.969 18.545 45.016 1.00 8.80  ? 265  ILE B CG2 1 
ATOM   1888 C CD1 . ILE B 2 91  ? 35.463 17.206 43.645 1.00 6.67  ? 265  ILE B CD1 1 
ATOM   1889 N N   . VAL B 2 92  ? 32.343 21.883 45.738 1.00 8.22  ? 266  VAL B N   1 
ATOM   1890 C CA  . VAL B 2 92  ? 31.837 22.483 46.972 1.00 9.24  ? 266  VAL B CA  1 
ATOM   1891 C C   . VAL B 2 92  ? 30.611 21.694 47.419 1.00 7.96  ? 266  VAL B C   1 
ATOM   1892 O O   . VAL B 2 92  ? 29.515 21.861 46.882 1.00 7.60  ? 266  VAL B O   1 
ATOM   1893 C CB  . VAL B 2 92  ? 31.473 23.970 46.761 1.00 7.99  ? 266  VAL B CB  1 
ATOM   1894 C CG1 . VAL B 2 92  ? 30.934 24.577 48.066 1.00 8.86  ? 266  VAL B CG1 1 
ATOM   1895 C CG2 . VAL B 2 92  ? 32.709 24.734 46.291 1.00 6.87  ? 266  VAL B CG2 1 
ATOM   1896 N N   . SER B 2 93  ? 30.803 20.829 48.410 1.00 8.18  ? 267  SER B N   1 
ATOM   1897 C CA  . SER B 2 93  ? 29.714 19.994 48.880 1.00 8.47  ? 267  SER B CA  1 
ATOM   1898 C C   . SER B 2 93  ? 29.107 20.311 50.233 1.00 9.77  ? 267  SER B C   1 
ATOM   1899 O O   . SER B 2 93  ? 29.797 20.409 51.248 1.00 10.09 ? 267  SER B O   1 
ATOM   1900 C CB  . SER B 2 93  ? 30.140 18.525 48.883 1.00 7.83  ? 267  SER B CB  1 
ATOM   1901 O OG  . SER B 2 93  ? 29.103 17.714 49.418 1.00 7.01  ? 267  SER B OG  1 
ATOM   1902 N N   . MET B 2 94  ? 27.792 20.466 50.224 1.00 8.85  ? 268  MET B N   1 
ATOM   1903 C CA  . MET B 2 94  ? 27.036 20.692 51.434 1.00 8.81  ? 268  MET B CA  1 
ATOM   1904 C C   . MET B 2 94  ? 26.001 19.558 51.488 1.00 10.03 ? 268  MET B C   1 
ATOM   1905 O O   . MET B 2 94  ? 24.937 19.671 52.093 1.00 8.96  ? 268  MET B O   1 
ATOM   1906 C CB  . MET B 2 94  ? 26.414 22.090 51.405 1.00 12.65 ? 268  MET B CB  1 
ATOM   1907 C CG  . MET B 2 94  ? 27.511 23.163 51.496 1.00 19.80 ? 268  MET B CG  1 
ATOM   1908 S SD  . MET B 2 94  ? 27.009 24.878 51.649 1.00 28.20 ? 268  MET B SD  1 
ATOM   1909 C CE  . MET B 2 94  ? 27.572 25.538 50.076 1.00 25.00 ? 268  MET B CE  1 
ATOM   1910 N N   . LEU B 2 95  ? 26.347 18.449 50.839 1.00 7.62  ? 269  LEU B N   1 
ATOM   1911 C CA  . LEU B 2 95  ? 25.489 17.265 50.828 1.00 8.74  ? 269  LEU B CA  1 
ATOM   1912 C C   . LEU B 2 95  ? 25.591 16.570 52.184 1.00 9.30  ? 269  LEU B C   1 
ATOM   1913 O O   . LEU B 2 95  ? 26.566 16.752 52.914 1.00 7.43  ? 269  LEU B O   1 
ATOM   1914 C CB  . LEU B 2 95  ? 25.920 16.295 49.725 1.00 8.75  ? 269  LEU B CB  1 
ATOM   1915 C CG  . LEU B 2 95  ? 25.803 16.816 48.289 1.00 9.35  ? 269  LEU B CG  1 
ATOM   1916 C CD1 . LEU B 2 95  ? 26.282 15.742 47.320 1.00 8.67  ? 269  LEU B CD1 1 
ATOM   1917 C CD2 . LEU B 2 95  ? 24.361 17.208 47.992 1.00 9.01  ? 269  LEU B CD2 1 
ATOM   1918 N N   . THR B 2 96  ? 24.583 15.775 52.522 1.00 8.01  ? 270  THR B N   1 
ATOM   1919 C CA  . THR B 2 96  ? 24.576 15.077 53.802 1.00 8.67  ? 270  THR B CA  1 
ATOM   1920 C C   . THR B 2 96  ? 24.633 13.560 53.641 1.00 9.35  ? 270  THR B C   1 
ATOM   1921 O O   . THR B 2 96  ? 24.646 12.822 54.625 1.00 9.84  ? 270  THR B O   1 
ATOM   1922 C CB  . THR B 2 96  ? 23.327 15.446 54.617 1.00 7.55  ? 270  THR B CB  1 
ATOM   1923 O OG1 . THR B 2 96  ? 22.151 15.123 53.861 1.00 9.08  ? 270  THR B OG1 1 
ATOM   1924 C CG2 . THR B 2 96  ? 23.327 16.935 54.936 1.00 7.63  ? 270  THR B CG2 1 
ATOM   1925 N N   . LYS B 2 97  ? 24.677 13.098 52.397 1.00 8.75  ? 271  LYS B N   1 
ATOM   1926 C CA  . LYS B 2 97  ? 24.734 11.667 52.122 1.00 9.73  ? 271  LYS B CA  1 
ATOM   1927 C C   . LYS B 2 97  ? 25.526 11.394 50.855 1.00 9.68  ? 271  LYS B C   1 
ATOM   1928 O O   . LYS B 2 97  ? 25.834 12.309 50.097 1.00 10.71 ? 271  LYS B O   1 
ATOM   1929 C CB  . LYS B 2 97  ? 23.321 11.099 51.946 1.00 8.61  ? 271  LYS B CB  1 
ATOM   1930 C CG  . LYS B 2 97  ? 22.432 11.181 53.178 1.00 10.84 ? 271  LYS B CG  1 
ATOM   1931 C CD  . LYS B 2 97  ? 21.085 10.538 52.901 1.00 11.68 ? 271  LYS B CD  1 
ATOM   1932 C CE  . LYS B 2 97  ? 20.162 10.626 54.105 1.00 13.33 ? 271  LYS B CE  1 
ATOM   1933 N NZ  . LYS B 2 97  ? 18.831 10.041 53.772 1.00 12.01 ? 271  LYS B NZ  1 
ATOM   1934 N N   . GLU B 2 98  ? 25.865 10.130 50.634 1.00 10.41 ? 272  GLU B N   1 
ATOM   1935 C CA  . GLU B 2 98  ? 26.580 9.761  49.428 1.00 11.30 ? 272  GLU B CA  1 
ATOM   1936 C C   . GLU B 2 98  ? 25.552 9.773  48.310 1.00 10.31 ? 272  GLU B C   1 
ATOM   1937 O O   . GLU B 2 98  ? 24.364 9.539  48.549 1.00 9.61  ? 272  GLU B O   1 
ATOM   1938 C CB  . GLU B 2 98  ? 27.217 8.381  49.590 1.00 13.72 ? 272  GLU B CB  1 
ATOM   1939 C CG  . GLU B 2 98  ? 28.481 8.428  50.440 1.00 19.59 ? 272  GLU B CG  1 
ATOM   1940 C CD  . GLU B 2 98  ? 28.979 7.061  50.845 1.00 23.95 ? 272  GLU B CD  1 
ATOM   1941 O OE1 . GLU B 2 98  ? 29.046 6.166  49.976 1.00 23.28 ? 272  GLU B OE1 1 
ATOM   1942 O OE2 . GLU B 2 98  ? 29.315 6.887  52.038 1.00 28.60 ? 272  GLU B OE2 1 
ATOM   1943 N N   . LEU B 2 99  ? 26.003 10.068 47.098 1.00 9.02  ? 273  LEU B N   1 
ATOM   1944 C CA  . LEU B 2 99  ? 25.106 10.140 45.956 1.00 10.60 ? 273  LEU B CA  1 
ATOM   1945 C C   . LEU B 2 99  ? 25.546 9.236  44.810 1.00 9.67  ? 273  LEU B C   1 
ATOM   1946 O O   . LEU B 2 99  ? 26.628 9.410  44.247 1.00 8.68  ? 273  LEU B O   1 
ATOM   1947 C CB  . LEU B 2 99  ? 25.013 11.591 45.466 1.00 9.24  ? 273  LEU B CB  1 
ATOM   1948 C CG  . LEU B 2 99  ? 24.002 11.924 44.361 1.00 12.28 ? 273  LEU B CG  1 
ATOM   1949 C CD1 . LEU B 2 99  ? 22.613 11.483 44.791 1.00 12.37 ? 273  LEU B CD1 1 
ATOM   1950 C CD2 . LEU B 2 99  ? 24.015 13.423 44.086 1.00 10.31 ? 273  LEU B CD2 1 
ATOM   1951 N N   . TYR B 2 100 ? 24.703 8.258  44.492 1.00 10.38 ? 274  TYR B N   1 
ATOM   1952 C CA  . TYR B 2 100 ? 24.945 7.319  43.396 1.00 10.26 ? 274  TYR B CA  1 
ATOM   1953 C C   . TYR B 2 100 ? 23.791 7.523  42.417 1.00 10.69 ? 274  TYR B C   1 
ATOM   1954 O O   . TYR B 2 100 ? 22.635 7.586  42.829 1.00 11.88 ? 274  TYR B O   1 
ATOM   1955 C CB  . TYR B 2 100 ? 24.930 5.874  43.905 1.00 10.25 ? 274  TYR B CB  1 
ATOM   1956 C CG  . TYR B 2 100 ? 26.028 5.559  44.891 1.00 13.29 ? 274  TYR B CG  1 
ATOM   1957 C CD1 . TYR B 2 100 ? 27.312 5.223  44.455 1.00 14.88 ? 274  TYR B CD1 1 
ATOM   1958 C CD2 . TYR B 2 100 ? 25.795 5.637  46.266 1.00 14.24 ? 274  TYR B CD2 1 
ATOM   1959 C CE1 . TYR B 2 100 ? 28.339 4.973  45.369 1.00 17.37 ? 274  TYR B CE1 1 
ATOM   1960 C CE2 . TYR B 2 100 ? 26.811 5.394  47.183 1.00 14.53 ? 274  TYR B CE2 1 
ATOM   1961 C CZ  . TYR B 2 100 ? 28.077 5.066  46.732 1.00 16.00 ? 274  TYR B CZ  1 
ATOM   1962 O OH  . TYR B 2 100 ? 29.084 4.860  47.645 1.00 16.24 ? 274  TYR B OH  1 
ATOM   1963 N N   . PHE B 2 101 ? 24.100 7.627  41.130 1.00 10.37 ? 275  PHE B N   1 
ATOM   1964 C CA  . PHE B 2 101 ? 23.067 7.840  40.123 1.00 11.65 ? 275  PHE B CA  1 
ATOM   1965 C C   . PHE B 2 101 ? 22.297 6.561  39.840 1.00 12.84 ? 275  PHE B C   1 
ATOM   1966 O O   . PHE B 2 101 ? 21.199 6.593  39.283 1.00 15.98 ? 275  PHE B O   1 
ATOM   1967 C CB  . PHE B 2 101 ? 23.696 8.376  38.838 1.00 9.09  ? 275  PHE B CB  1 
ATOM   1968 C CG  . PHE B 2 101 ? 24.286 9.747  38.988 1.00 8.66  ? 275  PHE B CG  1 
ATOM   1969 C CD1 . PHE B 2 101 ? 23.465 10.850 39.197 1.00 9.86  ? 275  PHE B CD1 1 
ATOM   1970 C CD2 . PHE B 2 101 ? 25.664 9.933  38.949 1.00 10.76 ? 275  PHE B CD2 1 
ATOM   1971 C CE1 . PHE B 2 101 ? 24.006 12.123 39.368 1.00 10.42 ? 275  PHE B CE1 1 
ATOM   1972 C CE2 . PHE B 2 101 ? 26.218 11.200 39.117 1.00 10.79 ? 275  PHE B CE2 1 
ATOM   1973 C CZ  . PHE B 2 101 ? 25.388 12.298 39.328 1.00 12.17 ? 275  PHE B CZ  1 
ATOM   1974 N N   . TYR B 2 102 ? 22.879 5.438  40.240 1.00 14.07 ? 276  TYR B N   1 
ATOM   1975 C CA  . TYR B 2 102 ? 22.263 4.133  40.046 1.00 15.87 ? 276  TYR B CA  1 
ATOM   1976 C C   . TYR B 2 102 ? 21.784 3.591  41.390 1.00 18.26 ? 276  TYR B C   1 
ATOM   1977 O O   . TYR B 2 102 ? 22.129 4.128  42.445 1.00 17.48 ? 276  TYR B O   1 
ATOM   1978 C CB  . TYR B 2 102 ? 23.285 3.168  39.441 1.00 15.18 ? 276  TYR B CB  1 
ATOM   1979 C CG  . TYR B 2 102 ? 24.448 2.859  40.367 1.00 17.76 ? 276  TYR B CG  1 
ATOM   1980 C CD1 . TYR B 2 102 ? 24.342 1.873  41.351 1.00 17.47 ? 276  TYR B CD1 1 
ATOM   1981 C CD2 . TYR B 2 102 ? 25.646 3.567  40.273 1.00 16.54 ? 276  TYR B CD2 1 
ATOM   1982 C CE1 . TYR B 2 102 ? 25.400 1.600  42.216 1.00 19.74 ? 276  TYR B CE1 1 
ATOM   1983 C CE2 . TYR B 2 102 ? 26.708 3.302  41.133 1.00 19.57 ? 276  TYR B CE2 1 
ATOM   1984 C CZ  . TYR B 2 102 ? 26.579 2.317  42.101 1.00 20.09 ? 276  TYR B CZ  1 
ATOM   1985 O OH  . TYR B 2 102 ? 27.635 2.045  42.943 1.00 22.34 ? 276  TYR B OH  1 
ATOM   1986 N N   . HIS B 2 103 ? 20.984 2.531  41.343 1.00 19.06 ? 277  HIS B N   1 
ATOM   1987 C CA  . HIS B 2 103 ? 20.486 1.886  42.551 1.00 19.87 ? 277  HIS B CA  1 
ATOM   1988 C C   . HIS B 2 103 ? 20.336 0.387  42.298 1.00 21.62 ? 277  HIS B C   1 
ATOM   1989 O O   . HIS B 2 103 ? 20.700 -0.057 41.188 1.00 22.18 ? 277  HIS B O   1 
ATOM   1990 C CB  . HIS B 2 103 ? 19.139 2.480  42.986 1.00 20.18 ? 277  HIS B CB  1 
ATOM   1991 C CG  . HIS B 2 103 ? 18.024 2.248  42.014 1.00 20.59 ? 277  HIS B CG  1 
ATOM   1992 N ND1 . HIS B 2 103 ? 17.926 2.921  40.815 1.00 21.59 ? 277  HIS B ND1 1 
ATOM   1993 C CD2 . HIS B 2 103 ? 16.950 1.423  42.071 1.00 21.36 ? 277  HIS B CD2 1 
ATOM   1994 C CE1 . HIS B 2 103 ? 16.840 2.522  40.177 1.00 21.97 ? 277  HIS B CE1 1 
ATOM   1995 N NE2 . HIS B 2 103 ? 16.231 1.614  40.917 1.00 21.01 ? 277  HIS B NE2 1 
ATOM   1996 O OXT . HIS B 2 103 ? 19.863 -0.326 43.208 1.00 22.36 ? 277  HIS B OXT 1 
HETATM 1997 C C1  . PHQ C 3 1   ? 41.449 28.146 21.762 1.00 33.11 ? 1    PHQ C C1  1 
HETATM 1998 O O1  . PHQ C 3 1   ? 40.335 27.666 21.569 1.00 31.53 ? 1    PHQ C O1  1 
HETATM 1999 O O2  . PHQ C 3 1   ? 42.366 28.498 20.806 1.00 35.13 ? 1    PHQ C O2  1 
HETATM 2000 C C2  . PHQ C 3 1   ? 41.990 28.289 19.413 1.00 38.26 ? 1    PHQ C C2  1 
HETATM 2001 C C3  . PHQ C 3 1   ? 43.078 28.709 18.400 1.00 38.85 ? 1    PHQ C C3  1 
HETATM 2002 C C4  . PHQ C 3 1   ? 42.783 28.540 16.991 1.00 40.31 ? 1    PHQ C C4  1 
HETATM 2003 C C5  . PHQ C 3 1   ? 43.755 28.914 15.984 1.00 39.60 ? 1    PHQ C C5  1 
HETATM 2004 C C6  . PHQ C 3 1   ? 45.035 29.462 16.380 1.00 40.16 ? 1    PHQ C C6  1 
HETATM 2005 C C7  . PHQ C 3 1   ? 45.343 29.636 17.784 1.00 39.57 ? 1    PHQ C C7  1 
HETATM 2006 C C8  . PHQ C 3 1   ? 44.371 29.263 18.793 1.00 40.03 ? 1    PHQ C C8  1 
ATOM   2007 N N   . ASP C 3 2   ? 41.869 29.003 22.683 1.00 30.51 ? 2    ASP C N   1 
ATOM   2008 C CA  . ASP C 3 2   ? 41.291 29.071 24.021 1.00 29.04 ? 2    ASP C CA  1 
ATOM   2009 C C   . ASP C 3 2   ? 40.739 30.443 24.384 1.00 29.36 ? 2    ASP C C   1 
ATOM   2010 O O   . ASP C 3 2   ? 41.307 31.475 24.024 1.00 28.53 ? 2    ASP C O   1 
ATOM   2011 C CB  . ASP C 3 2   ? 42.325 28.658 25.074 1.00 28.41 ? 2    ASP C CB  1 
ATOM   2012 C CG  . ASP C 3 2   ? 42.620 27.175 25.048 1.00 26.29 ? 2    ASP C CG  1 
ATOM   2013 O OD1 . ASP C 3 2   ? 41.659 26.387 24.959 1.00 26.61 ? 2    ASP C OD1 1 
ATOM   2014 O OD2 . ASP C 3 2   ? 43.807 26.795 25.130 1.00 24.73 ? 2    ASP C OD2 1 
ATOM   2015 N N   . GLU C 3 3   ? 39.619 30.438 25.099 1.00 27.56 ? 3    GLU C N   1 
ATOM   2016 C CA  . GLU C 3 3   ? 38.977 31.663 25.555 1.00 27.65 ? 3    GLU C CA  1 
ATOM   2017 C C   . GLU C 3 3   ? 38.670 31.453 27.033 1.00 26.54 ? 3    GLU C C   1 
ATOM   2018 O O   . GLU C 3 3   ? 38.574 30.314 27.490 1.00 23.95 ? 3    GLU C O   1 
ATOM   2019 C CB  . GLU C 3 3   ? 37.675 31.919 24.785 1.00 28.17 ? 3    GLU C CB  1 
ATOM   2020 C CG  . GLU C 3 3   ? 37.832 31.933 23.268 1.00 30.18 ? 3    GLU C CG  1 
ATOM   2021 C CD  . GLU C 3 3   ? 36.574 32.391 22.548 1.00 31.64 ? 3    GLU C CD  1 
ATOM   2022 O OE1 . GLU C 3 3   ? 35.474 31.912 22.891 1.00 32.37 ? 3    GLU C OE1 1 
ATOM   2023 O OE2 . GLU C 3 3   ? 36.685 33.228 21.629 1.00 33.82 ? 3    GLU C OE2 1 
ATOM   2024 N N   . VAL C 3 4   ? 38.526 32.543 27.778 1.00 26.30 ? 4    VAL C N   1 
ATOM   2025 C CA  . VAL C 3 4   ? 38.232 32.444 29.202 1.00 25.64 ? 4    VAL C CA  1 
ATOM   2026 C C   . VAL C 3 4   ? 36.794 32.838 29.503 1.00 25.60 ? 4    VAL C C   1 
ATOM   2027 O O   . VAL C 3 4   ? 36.071 33.305 28.622 1.00 26.24 ? 4    VAL C O   1 
ATOM   2028 C CB  . VAL C 3 4   ? 39.177 33.334 30.034 1.00 25.69 ? 4    VAL C CB  1 
ATOM   2029 C CG1 . VAL C 3 4   ? 40.602 32.831 29.908 1.00 26.39 ? 4    VAL C CG1 1 
ATOM   2030 C CG2 . VAL C 3 4   ? 39.077 34.778 29.572 1.00 26.28 ? 4    VAL C CG2 1 
HETATM 2031 N N3  . AA1 C 3 5   ? 36.112 32.298 30.495 1.00 24.93 ? 5    AA1 C N3  1 
HETATM 2032 C C4  . AA1 C 3 5   ? 34.536 33.414 32.028 1.00 25.57 ? 5    AA1 C C4  1 
HETATM 2033 O O5  . AA1 C 3 5   ? 33.477 33.420 32.659 1.00 23.87 ? 5    AA1 C O5  1 
HETATM 2034 N N6  . AA1 C 3 5   ? 34.910 32.329 31.224 1.00 26.24 ? 5    AA1 C N6  1 
HETATM 2035 C C7  . AA1 C 3 5   ? 34.078 31.126 31.088 1.00 25.20 ? 5    AA1 C C7  1 
HETATM 2036 C C8  . AA1 C 3 5   ? 33.516 30.967 29.691 1.00 26.07 ? 5    AA1 C C8  1 
HETATM 2037 O O9  . AA1 C 3 5   ? 33.270 29.677 29.375 1.00 26.63 ? 5    AA1 C O9  1 
HETATM 2038 O O10 . AA1 C 3 5   ? 33.276 31.858 28.889 1.00 24.92 ? 5    AA1 C O10 1 
HETATM 2039 C C11 . AA1 C 3 5   ? 35.516 34.591 32.097 1.00 27.29 ? 5    AA1 C C11 1 
HETATM 2040 C C12 . AA1 C 3 5   ? 34.862 35.920 32.497 1.00 34.54 ? 5    AA1 C C12 1 
HETATM 2041 C C15 . AA1 C 3 5   ? 34.424 36.724 31.286 1.00 37.46 ? 5    AA1 C C15 1 
HETATM 2042 O O16 . AA1 C 3 5   ? 34.921 36.645 30.164 1.00 39.14 ? 5    AA1 C O16 1 
HETATM 2043 O O17 . AA1 C 3 5   ? 33.383 37.545 31.635 1.00 39.47 ? 5    AA1 C O17 1 
HETATM 2044 C C18 . AA1 C 3 5   ? 33.643 38.949 31.495 1.00 40.12 ? 5    AA1 C C18 1 
HETATM 2045 C C19 . AA1 C 3 5   ? 32.450 39.582 30.807 1.00 40.66 ? 5    AA1 C C19 1 
HETATM 2046 O O   . HOH D 4 .   ? 16.658 -3.105 62.484 1.00 32.11 ? 2001 HOH A O   1 
HETATM 2047 O O   . HOH D 4 .   ? 12.015 -7.355 61.769 1.00 55.56 ? 2002 HOH A O   1 
HETATM 2048 O O   . HOH D 4 .   ? 15.292 -1.713 59.974 1.00 36.66 ? 2003 HOH A O   1 
HETATM 2049 O O   . HOH D 4 .   ? 20.441 1.407  62.064 1.00 45.16 ? 2004 HOH A O   1 
HETATM 2050 O O   . HOH D 4 .   ? 18.437 -0.344 61.752 1.00 42.83 ? 2005 HOH A O   1 
HETATM 2051 O O   . HOH D 4 .   ? 24.393 5.474  59.124 1.00 33.15 ? 2006 HOH A O   1 
HETATM 2052 O O   . HOH D 4 .   ? 16.249 3.823  57.899 1.00 49.50 ? 2007 HOH A O   1 
HETATM 2053 O O   . HOH D 4 .   ? 27.124 8.970  54.122 1.00 15.48 ? 2008 HOH A O   1 
HETATM 2054 O O   . HOH D 4 .   ? 21.075 4.270  52.092 1.00 35.32 ? 2009 HOH A O   1 
HETATM 2055 O O   . HOH D 4 .   ? 18.933 7.396  52.744 1.00 28.22 ? 2010 HOH A O   1 
HETATM 2056 O O   . HOH D 4 .   ? 19.769 4.992  48.721 1.00 28.37 ? 2011 HOH A O   1 
HETATM 2057 O O   . HOH D 4 .   ? 22.481 7.320  46.218 1.00 13.13 ? 2012 HOH A O   1 
HETATM 2058 O O   . HOH D 4 .   ? 16.849 11.774 46.974 1.00 13.17 ? 2013 HOH A O   1 
HETATM 2059 O O   . HOH D 4 .   ? 10.449 3.583  45.723 1.00 45.40 ? 2014 HOH A O   1 
HETATM 2060 O O   . HOH D 4 .   ? 17.549 9.993  51.022 1.00 12.94 ? 2015 HOH A O   1 
HETATM 2061 O O   . HOH D 4 .   ? 12.575 -5.507 63.918 1.00 49.51 ? 2016 HOH A O   1 
HETATM 2062 O O   . HOH D 4 .   ? 18.899 4.703  45.901 1.00 16.70 ? 2017 HOH A O   1 
HETATM 2063 O O   . HOH D 4 .   ? 15.083 7.878  40.320 1.00 11.36 ? 2018 HOH A O   1 
HETATM 2064 O O   . HOH D 4 .   ? 17.591 2.592  46.601 1.00 34.35 ? 2019 HOH A O   1 
HETATM 2065 O O   . HOH D 4 .   ? 13.911 0.305  43.800 1.00 54.58 ? 2020 HOH A O   1 
HETATM 2066 O O   . HOH D 4 .   ? 9.625  12.489 49.489 1.00 37.30 ? 2021 HOH A O   1 
HETATM 2067 O O   . HOH D 4 .   ? 13.857 11.834 49.995 1.00 28.14 ? 2022 HOH A O   1 
HETATM 2068 O O   . HOH D 4 .   ? 13.249 9.351  51.720 1.00 54.58 ? 2023 HOH A O   1 
HETATM 2069 O O   . HOH D 4 .   ? 10.076 9.092  50.309 1.00 40.41 ? 2024 HOH A O   1 
HETATM 2070 O O   . HOH D 4 .   ? 9.044  6.556  45.687 1.00 40.91 ? 2025 HOH A O   1 
HETATM 2071 O O   . HOH D 4 .   ? 11.969 14.307 36.062 1.00 20.40 ? 2026 HOH A O   1 
HETATM 2072 O O   . HOH D 4 .   ? 6.917  14.475 38.450 1.00 29.91 ? 2027 HOH A O   1 
HETATM 2073 O O   . HOH D 4 .   ? 6.786  13.263 34.296 1.00 50.14 ? 2028 HOH A O   1 
HETATM 2074 O O   . HOH D 4 .   ? 7.213  10.990 49.224 1.00 55.00 ? 2029 HOH A O   1 
HETATM 2075 O O   . HOH D 4 .   ? 10.402 13.125 52.108 1.00 59.73 ? 2030 HOH A O   1 
HETATM 2076 O O   . HOH D 4 .   ? 5.047  16.611 37.025 1.00 49.72 ? 2031 HOH A O   1 
HETATM 2077 O O   . HOH D 4 .   ? 18.088 43.536 22.411 1.00 47.48 ? 2032 HOH A O   1 
HETATM 2078 O O   . HOH D 4 .   ? 23.647 43.670 16.855 1.00 53.28 ? 2033 HOH A O   1 
HETATM 2079 O O   . HOH D 4 .   ? 19.254 36.779 22.312 1.00 44.96 ? 2034 HOH A O   1 
HETATM 2080 O O   . HOH D 4 .   ? 22.126 38.800 21.017 1.00 42.50 ? 2035 HOH A O   1 
HETATM 2081 O O   . HOH D 4 .   ? 27.374 20.480 18.813 1.00 52.12 ? 2036 HOH A O   1 
HETATM 2082 O O   . HOH D 4 .   ? 20.831 41.114 20.993 1.00 62.07 ? 2037 HOH A O   1 
HETATM 2083 O O   . HOH D 4 .   ? 19.922 45.345 21.087 1.00 53.79 ? 2038 HOH A O   1 
HETATM 2084 O O   . HOH D 4 .   ? 23.101 41.215 18.107 1.00 42.70 ? 2039 HOH A O   1 
HETATM 2085 O O   . HOH D 4 .   ? 22.517 47.691 21.420 1.00 43.08 ? 2040 HOH A O   1 
HETATM 2086 O O   . HOH D 4 .   ? 31.873 41.155 20.580 1.00 43.31 ? 2041 HOH A O   1 
HETATM 2087 O O   . HOH D 4 .   ? 28.034 22.991 17.920 1.00 36.69 ? 2042 HOH A O   1 
HETATM 2088 O O   . HOH D 4 .   ? 25.488 27.460 15.466 1.00 48.63 ? 2043 HOH A O   1 
HETATM 2089 O O   . HOH D 4 .   ? 28.927 18.413 19.513 1.00 37.41 ? 2044 HOH A O   1 
HETATM 2090 O O   . HOH D 4 .   ? 5.499  7.282  43.736 1.00 28.50 ? 2045 HOH A O   1 
HETATM 2091 O O   . HOH D 4 .   ? 21.651 37.426 23.207 1.00 23.27 ? 2046 HOH A O   1 
HETATM 2092 O O   . HOH D 4 .   ? 27.917 32.803 18.002 1.00 42.84 ? 2047 HOH A O   1 
HETATM 2093 O O   . HOH D 4 .   ? 22.315 18.425 20.404 1.00 30.64 ? 2048 HOH A O   1 
HETATM 2094 O O   . HOH D 4 .   ? 32.734 32.425 48.825 1.00 50.02 ? 2049 HOH A O   1 
HETATM 2095 O O   . HOH D 4 .   ? 28.117 37.780 22.239 1.00 16.02 ? 2050 HOH A O   1 
HETATM 2096 O O   . HOH D 4 .   ? 27.001 41.211 20.804 1.00 52.52 ? 2051 HOH A O   1 
HETATM 2097 O O   . HOH D 4 .   ? 16.666 39.452 24.774 1.00 41.66 ? 2052 HOH A O   1 
HETATM 2098 O O   . HOH D 4 .   ? 21.815 13.335 19.674 1.00 32.84 ? 2053 HOH A O   1 
HETATM 2099 O O   . HOH D 4 .   ? 24.769 11.852 20.292 1.00 39.16 ? 2054 HOH A O   1 
HETATM 2100 O O   . HOH D 4 .   ? 12.552 32.105 61.050 1.00 33.10 ? 2055 HOH A O   1 
HETATM 2101 O O   . HOH D 4 .   ? 29.720 46.429 22.759 1.00 36.12 ? 2056 HOH A O   1 
HETATM 2102 O O   . HOH D 4 .   ? 22.718 43.033 20.885 1.00 30.85 ? 2057 HOH A O   1 
HETATM 2103 O O   . HOH D 4 .   ? 11.544 10.329 34.462 1.00 20.39 ? 2058 HOH A O   1 
HETATM 2104 O O   . HOH D 4 .   ? 25.349 49.828 26.575 1.00 32.42 ? 2059 HOH A O   1 
HETATM 2105 O O   . HOH D 4 .   ? 22.233 45.345 22.457 1.00 30.53 ? 2060 HOH A O   1 
HETATM 2106 O O   . HOH D 4 .   ? 28.412 48.941 26.056 1.00 35.94 ? 2061 HOH A O   1 
HETATM 2107 O O   . HOH D 4 .   ? 31.844 43.248 29.533 1.00 37.22 ? 2062 HOH A O   1 
HETATM 2108 O O   . HOH D 4 .   ? 28.267 42.008 22.951 1.00 44.86 ? 2063 HOH A O   1 
HETATM 2109 O O   . HOH D 4 .   ? 11.558 38.511 30.290 1.00 43.52 ? 2064 HOH A O   1 
HETATM 2110 O O   . HOH D 4 .   ? 36.800 35.813 25.061 1.00 41.47 ? 2065 HOH A O   1 
HETATM 2111 O O   . HOH D 4 .   ? 33.354 38.817 27.328 1.00 23.89 ? 2066 HOH A O   1 
HETATM 2112 O O   . HOH D 4 .   ? 14.173 39.478 37.823 1.00 27.44 ? 2067 HOH A O   1 
HETATM 2113 O O   . HOH D 4 .   ? 10.764 39.292 34.177 1.00 51.91 ? 2068 HOH A O   1 
HETATM 2114 O O   . HOH D 4 .   ? 12.972 32.309 28.913 1.00 60.02 ? 2069 HOH A O   1 
HETATM 2115 O O   . HOH D 4 .   ? 29.193 35.435 17.504 1.00 39.85 ? 2070 HOH A O   1 
HETATM 2116 O O   . HOH D 4 .   ? 31.960 38.139 20.253 1.00 20.64 ? 2071 HOH A O   1 
HETATM 2117 O O   . HOH D 4 .   ? 5.817  26.449 35.499 1.00 36.21 ? 2072 HOH A O   1 
HETATM 2118 O O   . HOH D 4 .   ? 5.046  28.897 38.623 1.00 45.83 ? 2073 HOH A O   1 
HETATM 2119 O O   . HOH D 4 .   ? 30.542 31.525 18.830 1.00 40.33 ? 2074 HOH A O   1 
HETATM 2120 O O   . HOH D 4 .   ? 36.327 32.056 18.193 1.00 48.33 ? 2075 HOH A O   1 
HETATM 2121 O O   . HOH D 4 .   ? 4.464  22.343 44.393 1.00 52.83 ? 2076 HOH A O   1 
HETATM 2122 O O   . HOH D 4 .   ? 1.389  25.676 37.357 1.00 48.68 ? 2077 HOH A O   1 
HETATM 2123 O O   . HOH D 4 .   ? 29.196 26.805 20.206 1.00 24.39 ? 2078 HOH A O   1 
HETATM 2124 O O   . HOH D 4 .   ? 30.985 28.255 17.863 1.00 44.14 ? 2079 HOH A O   1 
HETATM 2125 O O   . HOH D 4 .   ? 4.025  14.632 41.556 1.00 47.64 ? 2080 HOH A O   1 
HETATM 2126 O O   . HOH D 4 .   ? 4.129  12.533 46.827 1.00 41.24 ? 2081 HOH A O   1 
HETATM 2127 O O   . HOH D 4 .   ? 7.367  8.852  44.739 1.00 43.75 ? 2082 HOH A O   1 
HETATM 2128 O O   . HOH D 4 .   ? 26.553 25.208 17.175 1.00 25.55 ? 2083 HOH A O   1 
HETATM 2129 O O   . HOH D 4 .   ? 23.180 28.056 21.123 1.00 24.40 ? 2084 HOH A O   1 
HETATM 2130 O O   . HOH D 4 .   ? 28.858 17.710 22.095 1.00 24.28 ? 2085 HOH A O   1 
HETATM 2131 O O   . HOH D 4 .   ? 30.053 26.194 27.945 1.00 11.39 ? 2086 HOH A O   1 
HETATM 2132 O O   . HOH D 4 .   ? 32.073 19.353 25.880 1.00 14.15 ? 2087 HOH A O   1 
HETATM 2133 O O   . HOH D 4 .   ? 22.772 15.967 22.702 1.00 22.27 ? 2088 HOH A O   1 
HETATM 2134 O O   . HOH D 4 .   ? 30.803 31.164 47.511 1.00 34.36 ? 2089 HOH A O   1 
HETATM 2135 O O   . HOH D 4 .   ? 30.133 35.238 46.448 1.00 27.44 ? 2090 HOH A O   1 
HETATM 2136 O O   . HOH D 4 .   ? 26.504 36.585 46.549 1.00 42.42 ? 2091 HOH A O   1 
HETATM 2137 O O   . HOH D 4 .   ? 27.894 13.155 24.404 1.00 31.53 ? 2092 HOH A O   1 
HETATM 2138 O O   . HOH D 4 .   ? 16.414 18.682 26.003 1.00 28.15 ? 2093 HOH A O   1 
HETATM 2139 O O   . HOH D 4 .   ? 26.603 39.211 46.737 1.00 43.67 ? 2094 HOH A O   1 
HETATM 2140 O O   . HOH D 4 .   ? 28.999 37.499 45.465 1.00 45.36 ? 2095 HOH A O   1 
HETATM 2141 O O   . HOH D 4 .   ? 18.708 39.284 39.512 1.00 34.67 ? 2096 HOH A O   1 
HETATM 2142 O O   . HOH D 4 .   ? 26.208 8.409  24.004 1.00 34.77 ? 2097 HOH A O   1 
HETATM 2143 O O   . HOH D 4 .   ? 22.160 11.048 21.036 1.00 45.89 ? 2098 HOH A O   1 
HETATM 2144 O O   . HOH D 4 .   ? 12.408 42.053 41.168 1.00 41.29 ? 2099 HOH A O   1 
HETATM 2145 O O   . HOH D 4 .   ? 26.082 9.542  30.966 1.00 19.84 ? 2100 HOH A O   1 
HETATM 2146 O O   . HOH D 4 .   ? 18.520 35.560 52.111 1.00 48.96 ? 2101 HOH A O   1 
HETATM 2147 O O   . HOH D 4 .   ? 19.667 37.658 46.604 1.00 47.58 ? 2102 HOH A O   1 
HETATM 2148 O O   . HOH D 4 .   ? 11.574 31.429 46.678 1.00 33.03 ? 2103 HOH A O   1 
HETATM 2149 O O   . HOH D 4 .   ? 13.487 32.536 57.876 1.00 56.17 ? 2104 HOH A O   1 
HETATM 2150 O O   . HOH D 4 .   ? 20.134 5.552  24.966 1.00 17.61 ? 2105 HOH A O   1 
HETATM 2151 O O   . HOH D 4 .   ? 9.620  30.584 52.960 1.00 51.80 ? 2106 HOH A O   1 
HETATM 2152 O O   . HOH D 4 .   ? 5.166  23.371 48.909 1.00 37.30 ? 2107 HOH A O   1 
HETATM 2153 O O   . HOH D 4 .   ? 5.302  20.658 47.813 1.00 34.51 ? 2108 HOH A O   1 
HETATM 2154 O O   . HOH D 4 .   ? 26.566 8.965  28.269 1.00 39.82 ? 2109 HOH A O   1 
HETATM 2155 O O   . HOH D 4 .   ? 23.176 6.014  24.547 1.00 36.57 ? 2110 HOH A O   1 
HETATM 2156 O O   . HOH D 4 .   ? 21.899 4.418  30.063 1.00 37.70 ? 2111 HOH A O   1 
HETATM 2157 O O   . HOH D 4 .   ? 20.439 6.740  36.482 1.00 13.30 ? 2112 HOH A O   1 
HETATM 2158 O O   . HOH D 4 .   ? 18.811 6.839  28.224 1.00 20.63 ? 2113 HOH A O   1 
HETATM 2159 O O   . HOH D 4 .   ? 13.623 12.187 35.257 1.00 15.19 ? 2114 HOH A O   1 
HETATM 2160 O O   . HOH D 4 .   ? 14.282 8.992  35.465 1.00 18.01 ? 2115 HOH A O   1 
HETATM 2161 O O   . HOH D 4 .   ? 19.543 2.126  30.211 1.00 46.46 ? 2116 HOH A O   1 
HETATM 2162 O O   . HOH D 4 .   ? 14.823 3.809  29.560 1.00 44.75 ? 2117 HOH A O   1 
HETATM 2163 O O   . HOH D 4 .   ? 7.700  17.708 32.558 1.00 40.23 ? 2118 HOH A O   1 
HETATM 2164 O O   . HOH D 4 .   ? 8.327  15.487 35.014 1.00 28.85 ? 2119 HOH A O   1 
HETATM 2165 O O   . HOH D 4 .   ? 35.654 28.334 48.708 1.00 14.75 ? 2120 HOH A O   1 
HETATM 2166 O O   . HOH D 4 .   ? 55.960 29.756 36.731 1.00 40.53 ? 2121 HOH A O   1 
HETATM 2167 O O   . HOH D 4 .   ? 58.230 23.896 29.448 1.00 36.93 ? 2122 HOH A O   1 
HETATM 2168 O O   . HOH D 4 .   ? 60.356 23.794 37.748 1.00 36.30 ? 2123 HOH A O   1 
HETATM 2169 O O   . HOH D 4 .   ? 21.178 21.189 26.005 1.00 14.19 ? 2124 HOH A O   1 
HETATM 2170 O O   . HOH D 4 .   ? 16.834 33.806 23.759 1.00 43.96 ? 2125 HOH A O   1 
HETATM 2171 O O   . HOH D 4 .   ? 20.384 35.009 20.545 1.00 42.94 ? 2126 HOH A O   1 
HETATM 2172 O O   . HOH D 4 .   ? 22.911 29.788 23.126 1.00 32.46 ? 2127 HOH A O   1 
HETATM 2173 O O   . HOH D 4 .   ? 13.971 39.314 29.317 1.00 19.72 ? 2128 HOH A O   1 
HETATM 2174 O O   . HOH D 4 .   ? 18.581 44.926 34.154 1.00 38.03 ? 2129 HOH A O   1 
HETATM 2175 O O   . HOH D 4 .   ? 21.354 45.799 38.692 1.00 31.84 ? 2130 HOH A O   1 
HETATM 2176 O O   . HOH D 4 .   ? 22.564 41.141 39.807 1.00 37.89 ? 2131 HOH A O   1 
HETATM 2177 O O   . HOH D 4 .   ? 14.863 41.704 29.710 1.00 41.87 ? 2132 HOH A O   1 
HETATM 2178 O O   . HOH D 4 .   ? 16.621 40.466 36.644 1.00 54.77 ? 2133 HOH A O   1 
HETATM 2179 O O   . HOH D 4 .   ? 12.481 37.740 36.435 1.00 31.35 ? 2134 HOH A O   1 
HETATM 2180 O O   . HOH D 4 .   ? 10.752 34.223 28.168 1.00 51.90 ? 2135 HOH A O   1 
HETATM 2181 O O   . HOH D 4 .   ? 10.967 36.924 27.891 1.00 56.96 ? 2136 HOH A O   1 
HETATM 2182 O O   . HOH D 4 .   ? 13.723 39.132 26.540 1.00 37.09 ? 2137 HOH A O   1 
HETATM 2183 O O   . HOH D 4 .   ? 12.323 32.358 31.570 1.00 26.34 ? 2138 HOH A O   1 
HETATM 2184 O O   . HOH D 4 .   ? 16.365 36.165 25.172 1.00 34.98 ? 2139 HOH A O   1 
HETATM 2185 O O   . HOH D 4 .   ? 11.382 36.938 32.496 1.00 35.41 ? 2140 HOH A O   1 
HETATM 2186 O O   . HOH D 4 .   ? 5.365  28.627 33.853 1.00 50.15 ? 2141 HOH A O   1 
HETATM 2187 O O   . HOH D 4 .   ? 8.064  33.372 37.027 1.00 54.75 ? 2142 HOH A O   1 
HETATM 2188 O O   . HOH D 4 .   ? 6.030  26.393 38.191 1.00 17.74 ? 2143 HOH A O   1 
HETATM 2189 O O   . HOH D 4 .   ? 6.812  30.894 39.192 1.00 37.42 ? 2144 HOH A O   1 
HETATM 2190 O O   . HOH D 4 .   ? 6.963  32.168 33.450 1.00 33.69 ? 2145 HOH A O   1 
HETATM 2191 O O   . HOH D 4 .   ? 9.838  29.124 32.886 1.00 20.55 ? 2146 HOH A O   1 
HETATM 2192 O O   . HOH D 4 .   ? 7.432  23.652 44.623 1.00 25.80 ? 2147 HOH A O   1 
HETATM 2193 O O   . HOH D 4 .   ? 8.788  33.072 44.502 1.00 49.90 ? 2148 HOH A O   1 
HETATM 2194 O O   . HOH D 4 .   ? 4.017  24.636 38.843 1.00 41.43 ? 2149 HOH A O   1 
HETATM 2195 O O   . HOH D 4 .   ? 3.291  22.687 41.788 1.00 42.53 ? 2150 HOH A O   1 
HETATM 2196 O O   . HOH D 4 .   ? 8.241  25.330 35.398 1.00 19.48 ? 2151 HOH A O   1 
HETATM 2197 O O   . HOH D 4 .   ? 1.620  17.810 41.408 1.00 50.12 ? 2152 HOH A O   1 
HETATM 2198 O O   . HOH D 4 .   ? 7.198  14.917 40.872 1.00 18.96 ? 2153 HOH A O   1 
HETATM 2199 O O   . HOH D 4 .   ? 4.672  20.544 38.796 1.00 27.60 ? 2154 HOH A O   1 
HETATM 2200 O O   . HOH D 4 .   ? 7.018  11.003 46.182 1.00 22.87 ? 2155 HOH A O   1 
HETATM 2201 O O   . HOH D 4 .   ? 7.289  16.062 48.458 1.00 30.75 ? 2156 HOH A O   1 
HETATM 2202 O O   . HOH D 4 .   ? 3.968  12.976 38.868 1.00 56.08 ? 2157 HOH A O   1 
HETATM 2203 O O   . HOH D 4 .   ? 14.104 17.734 39.768 1.00 10.45 ? 2158 HOH A O   1 
HETATM 2204 O O   . HOH D 4 .   ? 35.507 37.254 35.969 1.00 27.20 ? 2159 HOH A O   1 
HETATM 2205 O O   . HOH D 4 .   ? 31.166 44.125 38.569 1.00 37.01 ? 2160 HOH A O   1 
HETATM 2206 O O   . HOH D 4 .   ? 32.926 40.827 40.344 1.00 44.31 ? 2161 HOH A O   1 
HETATM 2207 O O   . HOH D 4 .   ? 30.924 32.099 38.694 1.00 19.41 ? 2162 HOH A O   1 
HETATM 2208 O O   . HOH D 4 .   ? 37.129 34.663 44.964 1.00 29.19 ? 2163 HOH A O   1 
HETATM 2209 O O   . HOH D 4 .   ? 35.359 38.039 40.619 1.00 16.41 ? 2164 HOH A O   1 
HETATM 2210 O O   . HOH D 4 .   ? 32.643 39.006 42.253 1.00 50.98 ? 2165 HOH A O   1 
HETATM 2211 O O   . HOH D 4 .   ? 31.103 32.613 45.208 1.00 25.75 ? 2166 HOH A O   1 
HETATM 2212 O O   . HOH D 4 .   ? 31.176 31.956 41.405 1.00 15.32 ? 2167 HOH A O   1 
HETATM 2213 O O   . HOH D 4 .   ? 26.067 34.836 44.649 1.00 13.32 ? 2168 HOH A O   1 
HETATM 2214 O O   . HOH D 4 .   ? 19.079 37.353 25.127 1.00 21.25 ? 2169 HOH A O   1 
HETATM 2215 O O   . HOH D 4 .   ? 23.686 38.068 46.887 1.00 39.75 ? 2170 HOH A O   1 
HETATM 2216 O O   . HOH D 4 .   ? 20.523 40.067 43.523 1.00 38.16 ? 2171 HOH A O   1 
HETATM 2217 O O   . HOH D 4 .   ? 26.933 39.335 44.035 1.00 52.85 ? 2172 HOH A O   1 
HETATM 2218 O O   . HOH D 4 .   ? 24.905 40.080 40.220 1.00 23.23 ? 2173 HOH A O   1 
HETATM 2219 O O   . HOH D 4 .   ? 21.024 38.966 40.921 1.00 27.37 ? 2174 HOH A O   1 
HETATM 2220 O O   . HOH D 4 .   ? 25.902 29.924 51.180 1.00 27.25 ? 2175 HOH A O   1 
HETATM 2221 O O   . HOH D 4 .   ? 15.609 33.625 45.097 1.00 20.18 ? 2176 HOH A O   1 
HETATM 2222 O O   . HOH D 4 .   ? 14.066 36.239 44.333 1.00 32.83 ? 2177 HOH A O   1 
HETATM 2223 O O   . HOH D 4 .   ? 13.489 39.159 41.060 1.00 42.42 ? 2178 HOH A O   1 
HETATM 2224 O O   . HOH D 4 .   ? 24.866 30.349 45.559 1.00 18.50 ? 2179 HOH A O   1 
HETATM 2225 O O   . HOH D 4 .   ? 20.719 29.257 48.809 1.00 25.55 ? 2180 HOH A O   1 
HETATM 2226 O O   . HOH D 4 .   ? 19.681 31.975 51.791 1.00 37.31 ? 2181 HOH A O   1 
HETATM 2227 O O   . HOH D 4 .   ? 20.675 35.269 50.116 1.00 35.27 ? 2182 HOH A O   1 
HETATM 2228 O O   . HOH D 4 .   ? 17.106 35.353 47.139 1.00 21.54 ? 2183 HOH A O   1 
HETATM 2229 O O   . HOH D 4 .   ? 10.894 28.535 45.468 1.00 16.47 ? 2184 HOH A O   1 
HETATM 2230 O O   . HOH D 4 .   ? 14.867 21.910 48.778 1.00 8.07  ? 2185 HOH A O   1 
HETATM 2231 O O   . HOH D 4 .   ? 15.569 33.235 56.396 1.00 34.69 ? 2186 HOH A O   1 
HETATM 2232 O O   . HOH D 4 .   ? 17.046 34.154 54.496 1.00 39.03 ? 2187 HOH A O   1 
HETATM 2233 O O   . HOH D 4 .   ? 11.382 29.812 56.627 1.00 43.75 ? 2188 HOH A O   1 
HETATM 2234 O O   . HOH D 4 .   ? 8.397  26.628 54.435 1.00 32.44 ? 2189 HOH A O   1 
HETATM 2235 O O   . HOH D 4 .   ? 12.152 31.343 53.311 1.00 26.13 ? 2190 HOH A O   1 
HETATM 2236 O O   . HOH D 4 .   ? 7.792  26.743 50.503 1.00 28.15 ? 2191 HOH A O   1 
HETATM 2237 O O   . HOH D 4 .   ? 7.730  25.740 46.113 1.00 29.82 ? 2192 HOH A O   1 
HETATM 2238 O O   . HOH D 4 .   ? 8.295  28.838 46.235 1.00 53.99 ? 2193 HOH A O   1 
HETATM 2239 O O   . HOH D 4 .   ? 14.076 32.555 46.908 1.00 28.12 ? 2194 HOH A O   1 
HETATM 2240 O O   . HOH D 4 .   ? 14.825 36.647 49.154 1.00 49.93 ? 2195 HOH A O   1 
HETATM 2241 O O   . HOH D 4 .   ? 8.411  28.831 48.855 1.00 34.75 ? 2196 HOH A O   1 
HETATM 2242 O O   . HOH D 4 .   ? 16.259 35.445 50.859 1.00 43.09 ? 2197 HOH A O   1 
HETATM 2243 O O   . HOH D 4 .   ? 13.310 33.426 54.551 1.00 53.50 ? 2198 HOH A O   1 
HETATM 2244 O O   . HOH D 4 .   ? 7.198  24.205 54.700 1.00 38.58 ? 2199 HOH A O   1 
HETATM 2245 O O   . HOH D 4 .   ? 7.691  24.681 48.592 1.00 16.11 ? 2200 HOH A O   1 
HETATM 2246 O O   . HOH D 4 .   ? 7.532  17.878 56.900 1.00 43.17 ? 2201 HOH A O   1 
HETATM 2247 O O   . HOH D 4 .   ? 10.932 16.649 49.967 1.00 13.25 ? 2202 HOH A O   1 
HETATM 2248 O O   . HOH D 4 .   ? 7.717  21.888 46.479 1.00 16.01 ? 2203 HOH A O   1 
HETATM 2249 O O   . HOH D 4 .   ? 6.314  18.956 49.676 1.00 51.45 ? 2204 HOH A O   1 
HETATM 2250 O O   . HOH D 4 .   ? 27.033 31.922 45.400 1.00 26.71 ? 2205 HOH A O   1 
HETATM 2251 O O   . HOH D 4 .   ? 12.900 14.015 51.554 1.00 41.38 ? 2206 HOH A O   1 
HETATM 2252 O O   . HOH D 4 .   ? 18.106 13.025 52.895 1.00 17.02 ? 2207 HOH A O   1 
HETATM 2253 O O   . HOH D 4 .   ? 16.530 12.147 49.537 1.00 12.10 ? 2208 HOH A O   1 
HETATM 2254 O O   . HOH D 4 .   ? 9.595  14.808 48.321 1.00 16.50 ? 2209 HOH A O   1 
HETATM 2255 O O   . HOH D 4 .   ? 36.408 24.727 32.012 1.00 9.01  ? 2210 HOH A O   1 
HETATM 2256 O O   . HOH D 4 .   ? 33.116 27.898 37.607 1.00 12.22 ? 2211 HOH A O   1 
HETATM 2257 O O   . HOH D 4 .   ? 37.494 37.440 42.274 1.00 27.36 ? 2212 HOH A O   1 
HETATM 2258 O O   . HOH D 4 .   ? 34.208 27.835 46.376 1.00 22.45 ? 2213 HOH A O   1 
HETATM 2259 O O   . HOH D 4 .   ? 43.880 39.458 38.502 1.00 31.18 ? 2214 HOH A O   1 
HETATM 2260 O O   . HOH D 4 .   ? 39.638 41.007 39.049 1.00 26.36 ? 2215 HOH A O   1 
HETATM 2261 O O   . HOH D 4 .   ? 40.012 37.585 40.865 1.00 21.39 ? 2216 HOH A O   1 
HETATM 2262 O O   . HOH D 4 .   ? 45.419 37.644 35.640 1.00 42.69 ? 2217 HOH A O   1 
HETATM 2263 O O   . HOH D 4 .   ? 40.968 36.929 43.238 1.00 41.71 ? 2218 HOH A O   1 
HETATM 2264 O O   . HOH D 4 .   ? 44.208 35.943 45.472 1.00 47.37 ? 2219 HOH A O   1 
HETATM 2265 O O   . HOH D 4 .   ? 42.004 32.927 44.760 1.00 27.27 ? 2220 HOH A O   1 
HETATM 2266 O O   . HOH D 4 .   ? 46.895 35.626 38.014 1.00 22.41 ? 2221 HOH A O   1 
HETATM 2267 O O   . HOH D 4 .   ? 43.923 27.522 39.931 1.00 12.26 ? 2222 HOH A O   1 
HETATM 2268 O O   . HOH D 4 .   ? 49.864 30.754 39.372 1.00 32.29 ? 2223 HOH A O   1 
HETATM 2269 O O   . HOH D 4 .   ? 54.978 27.088 35.530 1.00 34.33 ? 2224 HOH A O   1 
HETATM 2270 O O   . HOH D 4 .   ? 59.882 20.996 38.023 1.00 35.18 ? 2225 HOH A O   1 
HETATM 2271 O O   . HOH D 4 .   ? 57.051 24.784 36.346 1.00 39.86 ? 2226 HOH A O   1 
HETATM 2272 O O   . HOH D 4 .   ? 58.162 25.686 32.199 1.00 49.32 ? 2227 HOH A O   1 
HETATM 2273 O O   . HOH D 4 .   ? 56.410 14.048 34.545 1.00 56.06 ? 2228 HOH A O   1 
HETATM 2274 O O   . HOH D 4 .   ? 39.324 31.820 48.305 1.00 40.90 ? 2229 HOH A O   1 
HETATM 2275 O O   . HOH D 4 .   ? 47.751 34.764 40.559 1.00 45.75 ? 2230 HOH A O   1 
HETATM 2276 O O   . HOH D 4 .   ? 30.151 24.771 18.825 1.00 44.01 ? 2231 HOH A O   1 
HETATM 2277 O O   . HOH D 4 .   ? 22.653 2.274  31.477 1.00 59.09 ? 2232 HOH A O   1 
HETATM 2278 O O   . HOH D 4 .   ? 48.062 36.227 35.787 1.00 48.00 ? 2233 HOH A O   1 
HETATM 2279 O O   . HOH D 4 .   ? 15.896 12.939 54.383 1.00 34.61 ? 2234 HOH A O   1 
HETATM 2280 O O   . HOH D 4 .   ? 15.522 6.024  52.017 1.00 31.06 ? 2235 HOH A O   1 
HETATM 2281 O O   . HOH D 4 .   ? 39.378 33.845 46.270 1.00 50.84 ? 2236 HOH A O   1 
HETATM 2282 O O   . HOH D 4 .   ? 15.725 8.592  52.735 1.00 45.24 ? 2237 HOH A O   1 
HETATM 2283 O O   . HOH D 4 .   ? 16.075 15.437 55.632 1.00 28.59 ? 2238 HOH A O   1 
HETATM 2284 O O   . HOH D 4 .   ? 13.501 15.967 54.424 1.00 31.87 ? 2239 HOH A O   1 
HETATM 2285 O O   . HOH E 4 .   ? 32.378 13.878 23.059 1.00 50.08 ? 2001 HOH B O   1 
HETATM 2286 O O   . HOH E 4 .   ? 37.589 14.914 27.322 1.00 52.08 ? 2002 HOH B O   1 
HETATM 2287 O O   . HOH E 4 .   ? 32.872 8.152  24.479 1.00 40.38 ? 2003 HOH B O   1 
HETATM 2288 O O   . HOH E 4 .   ? 36.141 11.955 26.223 1.00 47.06 ? 2004 HOH B O   1 
HETATM 2289 O O   . HOH E 4 .   ? 56.124 36.692 29.456 1.00 49.68 ? 2005 HOH B O   1 
HETATM 2290 O O   . HOH E 4 .   ? 56.466 32.534 32.364 1.00 53.34 ? 2006 HOH B O   1 
HETATM 2291 O O   . HOH E 4 .   ? 24.546 1.462  47.541 1.00 45.14 ? 2007 HOH B O   1 
HETATM 2292 O O   . HOH E 4 .   ? 18.917 14.852 66.892 1.00 40.39 ? 2008 HOH B O   1 
HETATM 2293 O O   . HOH E 4 .   ? 27.310 29.333 47.970 1.00 33.47 ? 2011 HOH B O   1 
HETATM 2294 O O   . HOH E 4 .   ? 31.662 16.541 22.418 1.00 23.48 ? 2015 HOH B O   1 
HETATM 2295 O O   . HOH E 4 .   ? 34.677 15.635 24.977 1.00 35.54 ? 2016 HOH B O   1 
HETATM 2296 O O   . HOH E 4 .   ? 40.400 15.543 25.715 1.00 55.09 ? 2017 HOH B O   1 
HETATM 2297 O O   . HOH E 4 .   ? 32.174 12.287 26.732 1.00 27.12 ? 2018 HOH B O   1 
HETATM 2298 O O   . HOH E 4 .   ? 32.945 5.977  28.386 1.00 31.87 ? 2019 HOH B O   1 
HETATM 2299 O O   . HOH E 4 .   ? 34.091 10.181 26.695 1.00 31.66 ? 2020 HOH B O   1 
HETATM 2300 O O   . HOH E 4 .   ? 25.733 4.779  31.159 1.00 57.78 ? 2021 HOH B O   1 
HETATM 2301 O O   . HOH E 4 .   ? 48.623 13.272 31.472 1.00 57.14 ? 2023 HOH B O   1 
HETATM 2302 O O   . HOH E 4 .   ? 53.734 37.147 30.344 1.00 43.65 ? 2024 HOH B O   1 
HETATM 2303 O O   . HOH E 4 .   ? 52.764 36.983 32.693 1.00 42.61 ? 2025 HOH B O   1 
HETATM 2304 O O   . HOH E 4 .   ? 55.369 29.439 31.003 1.00 50.28 ? 2027 HOH B O   1 
HETATM 2305 O O   . HOH E 4 .   ? 19.264 13.041 57.270 1.00 30.69 ? 2028 HOH B O   1 
HETATM 2306 O O   . HOH E 4 .   ? 29.930 3.498  53.495 1.00 48.02 ? 2031 HOH B O   1 
HETATM 2307 O O   . HOH E 4 .   ? 25.052 1.729  51.999 1.00 32.65 ? 2032 HOH B O   1 
HETATM 2308 O O   . HOH E 4 .   ? 22.611 2.320  45.952 1.00 36.70 ? 2033 HOH B O   1 
HETATM 2309 O O   . HOH E 4 .   ? 24.433 11.099 75.963 1.00 49.70 ? 2034 HOH B O   1 
HETATM 2310 O O   . HOH E 4 .   ? 27.674 10.565 78.735 1.00 44.27 ? 2035 HOH B O   1 
HETATM 2311 O O   . HOH E 4 .   ? 26.821 17.337 79.970 1.00 49.61 ? 2036 HOH B O   1 
HETATM 2312 O O   . HOH E 4 .   ? 26.604 20.962 79.271 1.00 37.32 ? 2037 HOH B O   1 
HETATM 2313 O O   . HOH E 4 .   ? 23.987 15.622 81.457 1.00 24.77 ? 2038 HOH B O   1 
HETATM 2314 O O   . HOH E 4 .   ? 18.809 20.520 73.925 1.00 14.39 ? 2039 HOH B O   1 
HETATM 2315 O O   . HOH E 4 .   ? 24.064 20.416 73.544 1.00 36.31 ? 2040 HOH B O   1 
HETATM 2316 O O   . HOH E 4 .   ? 27.233 21.149 72.038 1.00 20.83 ? 2041 HOH B O   1 
HETATM 2317 O O   . HOH E 4 .   ? 24.365 16.261 74.938 1.00 36.44 ? 2042 HOH B O   1 
HETATM 2318 O O   . HOH E 4 .   ? 20.706 17.373 75.301 1.00 17.14 ? 2043 HOH B O   1 
HETATM 2319 O O   . HOH E 4 .   ? 16.563 14.925 68.159 1.00 42.61 ? 2044 HOH B O   1 
HETATM 2320 O O   . HOH E 4 .   ? 20.916 15.143 68.739 1.00 43.34 ? 2045 HOH B O   1 
HETATM 2321 O O   . HOH E 4 .   ? 17.912 11.340 72.938 1.00 36.11 ? 2046 HOH B O   1 
HETATM 2322 O O   . HOH E 4 .   ? 18.326 18.737 67.059 1.00 37.19 ? 2047 HOH B O   1 
HETATM 2323 O O   . HOH E 4 .   ? 13.737 20.704 71.399 1.00 36.79 ? 2048 HOH B O   1 
HETATM 2324 O O   . HOH E 4 .   ? 10.736 15.146 65.622 1.00 47.07 ? 2049 HOH B O   1 
HETATM 2325 O O   . HOH E 4 .   ? 11.719 21.075 69.594 1.00 32.42 ? 2050 HOH B O   1 
HETATM 2326 O O   . HOH E 4 .   ? 13.788 22.155 66.497 1.00 25.74 ? 2051 HOH B O   1 
HETATM 2327 O O   . HOH E 4 .   ? 14.586 12.113 68.367 1.00 42.05 ? 2052 HOH B O   1 
HETATM 2328 O O   . HOH E 4 .   ? 14.337 28.318 63.370 1.00 41.20 ? 2053 HOH B O   1 
HETATM 2329 O O   . HOH E 4 .   ? 17.954 22.190 52.821 1.00 8.09  ? 2054 HOH B O   1 
HETATM 2330 O O   . HOH E 4 .   ? 24.218 25.484 50.298 1.00 16.09 ? 2055 HOH B O   1 
HETATM 2331 O O   . HOH E 4 .   ? 18.503 16.196 54.456 1.00 16.90 ? 2056 HOH B O   1 
HETATM 2332 O O   . HOH E 4 .   ? 17.420 19.694 51.624 1.00 12.05 ? 2057 HOH B O   1 
HETATM 2333 O O   . HOH E 4 .   ? 29.374 31.243 43.695 1.00 25.90 ? 2058 HOH B O   1 
HETATM 2334 O O   . HOH E 4 .   ? 33.578 20.527 40.515 1.00 8.23  ? 2059 HOH B O   1 
HETATM 2335 O O   . HOH E 4 .   ? 28.839 27.723 46.620 1.00 20.30 ? 2060 HOH B O   1 
HETATM 2336 O O   . HOH E 4 .   ? 41.741 26.962 38.377 1.00 14.30 ? 2061 HOH B O   1 
HETATM 2337 O O   . HOH E 4 .   ? 47.996 31.934 40.715 1.00 34.15 ? 2063 HOH B O   1 
HETATM 2338 O O   . HOH E 4 .   ? 42.278 29.360 35.991 1.00 27.66 ? 2064 HOH B O   1 
HETATM 2339 O O   . HOH E 4 .   ? 44.310 38.910 33.264 1.00 24.89 ? 2065 HOH B O   1 
HETATM 2340 O O   . HOH E 4 .   ? 40.610 40.581 32.145 1.00 28.14 ? 2066 HOH B O   1 
HETATM 2341 O O   . HOH E 4 .   ? 34.295 34.059 24.901 1.00 24.07 ? 2067 HOH B O   1 
HETATM 2342 O O   . HOH E 4 .   ? 40.342 24.909 19.112 1.00 39.47 ? 2068 HOH B O   1 
HETATM 2343 O O   . HOH E 4 .   ? 42.330 23.090 19.885 1.00 21.13 ? 2069 HOH B O   1 
HETATM 2344 O O   . HOH E 4 .   ? 40.741 19.583 14.631 1.00 53.26 ? 2070 HOH B O   1 
HETATM 2345 O O   . HOH E 4 .   ? 40.284 22.749 13.105 1.00 28.67 ? 2071 HOH B O   1 
HETATM 2346 O O   . HOH E 4 .   ? 32.841 21.233 16.804 1.00 47.43 ? 2072 HOH B O   1 
HETATM 2347 O O   . HOH E 4 .   ? 32.568 23.816 17.801 1.00 33.88 ? 2073 HOH B O   1 
HETATM 2348 O O   . HOH E 4 .   ? 41.096 20.674 19.582 1.00 42.15 ? 2074 HOH B O   1 
HETATM 2349 O O   . HOH E 4 .   ? 33.359 17.662 24.042 1.00 33.33 ? 2075 HOH B O   1 
HETATM 2350 O O   . HOH E 4 .   ? 39.907 17.964 19.233 1.00 35.66 ? 2076 HOH B O   1 
HETATM 2351 O O   . HOH E 4 .   ? 33.412 14.606 26.947 1.00 12.63 ? 2077 HOH B O   1 
HETATM 2352 O O   . HOH E 4 .   ? 39.939 17.971 24.192 1.00 25.94 ? 2078 HOH B O   1 
HETATM 2353 O O   . HOH E 4 .   ? 34.288 8.748  28.853 1.00 28.29 ? 2079 HOH B O   1 
HETATM 2354 O O   . HOH E 4 .   ? 26.639 7.109  32.251 1.00 20.83 ? 2080 HOH B O   1 
HETATM 2355 O O   . HOH E 4 .   ? 36.457 1.648  33.233 1.00 52.12 ? 2081 HOH B O   1 
HETATM 2356 O O   . HOH E 4 .   ? 39.223 7.789  33.443 1.00 28.79 ? 2082 HOH B O   1 
HETATM 2357 O O   . HOH E 4 .   ? 36.679 8.153  29.594 1.00 23.74 ? 2083 HOH B O   1 
HETATM 2358 O O   . HOH E 4 .   ? 33.950 2.301  32.552 1.00 54.47 ? 2084 HOH B O   1 
HETATM 2359 O O   . HOH E 4 .   ? 27.013 7.160  40.478 1.00 15.72 ? 2085 HOH B O   1 
HETATM 2360 O O   . HOH E 4 .   ? 28.173 5.086  33.565 1.00 17.82 ? 2086 HOH B O   1 
HETATM 2361 O O   . HOH E 4 .   ? 29.026 -1.219 36.778 1.00 39.78 ? 2087 HOH B O   1 
HETATM 2362 O O   . HOH E 4 .   ? 24.853 1.081  33.338 1.00 49.00 ? 2088 HOH B O   1 
HETATM 2363 O O   . HOH E 4 .   ? 28.080 -0.439 40.168 1.00 34.09 ? 2089 HOH B O   1 
HETATM 2364 O O   . HOH E 4 .   ? 31.923 1.437  30.492 1.00 48.02 ? 2090 HOH B O   1 
HETATM 2365 O O   . HOH E 4 .   ? 30.302 3.152  31.655 1.00 44.01 ? 2091 HOH B O   1 
HETATM 2366 O O   . HOH E 4 .   ? 28.333 12.914 48.545 1.00 9.34  ? 2092 HOH B O   1 
HETATM 2367 O O   . HOH E 4 .   ? 32.814 5.237  44.777 1.00 20.62 ? 2093 HOH B O   1 
HETATM 2368 O O   . HOH E 4 .   ? 37.038 11.603 46.173 1.00 25.37 ? 2094 HOH B O   1 
HETATM 2369 O O   . HOH E 4 .   ? 40.825 11.320 35.935 1.00 27.17 ? 2095 HOH B O   1 
HETATM 2370 O O   . HOH E 4 .   ? 40.250 3.702  37.458 1.00 34.50 ? 2096 HOH B O   1 
HETATM 2371 O O   . HOH E 4 .   ? 40.061 8.535  35.765 1.00 22.09 ? 2097 HOH B O   1 
HETATM 2372 O O   . HOH E 4 .   ? 35.268 18.456 39.682 1.00 7.13  ? 2098 HOH B O   1 
HETATM 2373 O O   . HOH E 4 .   ? 42.985 8.419  35.805 1.00 47.16 ? 2099 HOH B O   1 
HETATM 2374 O O   . HOH E 4 .   ? 46.974 10.010 38.294 1.00 41.69 ? 2100 HOH B O   1 
HETATM 2375 O O   . HOH E 4 .   ? 40.964 10.461 31.256 1.00 54.18 ? 2101 HOH B O   1 
HETATM 2376 O O   . HOH E 4 .   ? 38.540 10.406 29.289 1.00 32.02 ? 2102 HOH B O   1 
HETATM 2377 O O   . HOH E 4 .   ? 42.507 15.783 27.361 1.00 50.23 ? 2103 HOH B O   1 
HETATM 2378 O O   . HOH E 4 .   ? 45.728 11.571 31.585 1.00 44.02 ? 2104 HOH B O   1 
HETATM 2379 O O   . HOH E 4 .   ? 42.872 11.687 34.241 1.00 34.98 ? 2105 HOH B O   1 
HETATM 2380 O O   . HOH E 4 .   ? 45.000 22.391 33.784 1.00 9.01  ? 2106 HOH B O   1 
HETATM 2381 O O   . HOH E 4 .   ? 50.264 20.653 31.307 1.00 21.92 ? 2107 HOH B O   1 
HETATM 2382 O O   . HOH E 4 .   ? 54.259 25.291 28.459 1.00 40.78 ? 2108 HOH B O   1 
HETATM 2383 O O   . HOH E 4 .   ? 44.101 31.432 22.640 1.00 31.73 ? 2109 HOH B O   1 
HETATM 2384 O O   . HOH E 4 .   ? 43.887 33.596 24.325 1.00 29.53 ? 2110 HOH B O   1 
HETATM 2385 O O   . HOH E 4 .   ? 45.630 33.146 20.897 1.00 27.64 ? 2111 HOH B O   1 
HETATM 2386 O O   . HOH E 4 .   ? 50.001 40.641 27.135 1.00 24.49 ? 2112 HOH B O   1 
HETATM 2387 O O   . HOH E 4 .   ? 52.286 38.282 24.024 1.00 23.55 ? 2113 HOH B O   1 
HETATM 2388 O O   . HOH E 4 .   ? 52.144 34.467 31.452 1.00 37.81 ? 2114 HOH B O   1 
HETATM 2389 O O   . HOH E 4 .   ? 49.761 35.747 33.257 1.00 33.14 ? 2115 HOH B O   1 
HETATM 2390 O O   . HOH E 4 .   ? 51.032 39.002 31.976 1.00 61.67 ? 2116 HOH B O   1 
HETATM 2391 O O   . HOH E 4 .   ? 55.169 27.982 24.874 1.00 16.36 ? 2117 HOH B O   1 
HETATM 2392 O O   . HOH E 4 .   ? 49.964 32.860 35.777 1.00 35.84 ? 2118 HOH B O   1 
HETATM 2393 O O   . HOH E 4 .   ? 52.673 30.770 32.567 1.00 30.75 ? 2119 HOH B O   1 
HETATM 2394 O O   . HOH E 4 .   ? 44.632 29.511 34.441 1.00 9.95  ? 2120 HOH B O   1 
HETATM 2395 O O   . HOH E 4 .   ? 29.406 15.069 49.794 1.00 11.55 ? 2121 HOH B O   1 
HETATM 2396 O O   . HOH E 4 .   ? 19.740 13.954 54.718 1.00 21.54 ? 2122 HOH B O   1 
HETATM 2397 O O   . HOH E 4 .   ? 17.647 10.512 56.124 1.00 32.47 ? 2124 HOH B O   1 
HETATM 2398 O O   . HOH E 4 .   ? 26.577 4.734  51.485 1.00 40.66 ? 2125 HOH B O   1 
HETATM 2399 O O   . HOH E 4 .   ? 31.638 6.159  52.777 1.00 52.36 ? 2126 HOH B O   1 
HETATM 2400 O O   . HOH E 4 .   ? 29.653 8.663  53.916 1.00 33.92 ? 2127 HOH B O   1 
HETATM 2401 O O   . HOH E 4 .   ? 32.177 4.602  47.420 1.00 42.72 ? 2128 HOH B O   1 
HETATM 2402 O O   . HOH E 4 .   ? 21.554 4.806  44.979 1.00 17.22 ? 2129 HOH B O   1 
HETATM 2403 O O   . HOH E 4 .   ? 18.835 5.510  40.435 1.00 13.99 ? 2130 HOH B O   1 
HETATM 2404 O O   . HOH E 4 .   ? 19.218 -2.681 41.799 1.00 32.42 ? 2131 HOH B O   1 
HETATM 2405 O O   . HOH E 4 .   ? 21.685 -0.338 46.052 1.00 54.18 ? 2132 HOH B O   1 
HETATM 2406 O O   . HOH E 4 .   ? 22.671 -2.332 42.808 1.00 29.53 ? 2133 HOH B O   1 
HETATM 2407 O O   . HOH E 4 .   ? 14.261 -0.251 40.556 1.00 38.33 ? 2134 HOH B O   1 
HETATM 2408 O O   . HOH F 4 .   ? 40.914 34.199 23.626 1.00 36.73 ? 2238 HOH C O   1 
HETATM 2409 O O   . HOH F 4 .   ? 34.152 33.654 20.658 1.00 39.15 ? 2239 HOH C O   1 
HETATM 2410 O O   . HOH F 4 .   ? 38.121 35.290 21.206 1.00 44.98 ? 2240 HOH C O   1 
HETATM 2411 O O   . HOH F 4 .   ? 37.179 38.803 31.493 1.00 52.99 ? 2241 HOH C O   1 
HETATM 2412 O O   . HOH F 4 .   ? 35.517 36.741 27.459 1.00 31.55 ? 2242 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   29  29  SER SER A . n 
A 1 2   GLY 2   30  30  GLY GLY A . n 
A 1 3   ILE 3   31  31  ILE ILE A . n 
A 1 4   SER 4   32  32  SER SER A . n 
A 1 5   LEU 5   33  33  LEU LEU A . n 
A 1 6   ASP 6   34  34  ASP ASP A . n 
A 1 7   ASN 7   35  35  ASN ASN A . n 
A 1 8   SER 8   36  36  SER SER A . n 
A 1 9   TYR 9   37  37  TYR TYR A . n 
A 1 10  LYS 10  38  38  LYS LYS A . n 
A 1 11  MET 11  39  39  MET MET A . n 
A 1 12  ASP 12  40  40  ASP ASP A . n 
A 1 13  TYR 13  41  41  TYR TYR A . n 
A 1 14  PRO 14  42  42  PRO PRO A . n 
A 1 15  GLU 15  43  43  GLU GLU A . n 
A 1 16  MET 16  44  44  MET MET A . n 
A 1 17  GLY 17  45  45  GLY GLY A . n 
A 1 18  LEU 18  46  46  LEU LEU A . n 
A 1 19  CYS 19  47  47  CYS CYS A . n 
A 1 20  ILE 20  48  48  ILE ILE A . n 
A 1 21  ILE 21  49  49  ILE ILE A . n 
A 1 22  ILE 22  50  50  ILE ILE A . n 
A 1 23  ASN 23  51  51  ASN ASN A . n 
A 1 24  ASN 24  52  52  ASN ASN A . n 
A 1 25  LYS 25  53  53  LYS LYS A . n 
A 1 26  ASN 26  54  54  ASN ASN A . n 
A 1 27  PHE 27  55  55  PHE PHE A . n 
A 1 28  HIS 28  56  56  HIS HIS A . n 
A 1 29  LYS 29  57  57  LYS LYS A . n 
A 1 30  SER 30  58  58  SER SER A . n 
A 1 31  THR 31  59  59  THR THR A . n 
A 1 32  GLY 32  60  60  GLY GLY A . n 
A 1 33  MET 33  61  61  MET MET A . n 
A 1 34  THR 34  62  62  THR THR A . n 
A 1 35  SER 35  63  63  SER SER A . n 
A 1 36  ARG 36  64  64  ARG ARG A . n 
A 1 37  SER 37  65  65  SER SER A . n 
A 1 38  GLY 38  66  66  GLY GLY A . n 
A 1 39  THR 39  67  67  THR THR A . n 
A 1 40  ASP 40  68  68  ASP ASP A . n 
A 1 41  VAL 41  69  69  VAL VAL A . n 
A 1 42  ASP 42  70  70  ASP ASP A . n 
A 1 43  ALA 43  71  71  ALA ALA A . n 
A 1 44  ALA 44  72  72  ALA ALA A . n 
A 1 45  ASN 45  73  73  ASN ASN A . n 
A 1 46  LEU 46  74  74  LEU LEU A . n 
A 1 47  ARG 47  75  75  ARG ARG A . n 
A 1 48  GLU 48  76  76  GLU GLU A . n 
A 1 49  THR 49  77  77  THR THR A . n 
A 1 50  PHE 50  78  78  PHE PHE A . n 
A 1 51  ARG 51  79  79  ARG ARG A . n 
A 1 52  ASN 52  80  80  ASN ASN A . n 
A 1 53  LEU 53  81  81  LEU LEU A . n 
A 1 54  LYS 54  82  82  LYS LYS A . n 
A 1 55  TYR 55  83  83  TYR TYR A . n 
A 1 56  GLU 56  84  84  GLU GLU A . n 
A 1 57  VAL 57  85  85  VAL VAL A . n 
A 1 58  ARG 58  86  86  ARG ARG A . n 
A 1 59  ASN 59  87  87  ASN ASN A . n 
A 1 60  LYS 60  88  88  LYS LYS A . n 
A 1 61  ASN 61  89  89  ASN ASN A . n 
A 1 62  ASP 62  90  90  ASP ASP A . n 
A 1 63  LEU 63  91  91  LEU LEU A . n 
A 1 64  THR 64  92  92  THR THR A . n 
A 1 65  ARG 65  93  93  ARG ARG A . n 
A 1 66  GLU 66  94  94  GLU GLU A . n 
A 1 67  GLU 67  95  95  GLU GLU A . n 
A 1 68  ILE 68  96  96  ILE ILE A . n 
A 1 69  VAL 69  97  97  VAL VAL A . n 
A 1 70  GLU 70  98  98  GLU GLU A . n 
A 1 71  LEU 71  99  99  LEU LEU A . n 
A 1 72  MET 72  100 100 MET MET A . n 
A 1 73  ARG 73  101 101 ARG ARG A . n 
A 1 74  ASP 74  102 102 ASP ASP A . n 
A 1 75  VAL 75  103 103 VAL VAL A . n 
A 1 76  SER 76  104 104 SER SER A . n 
A 1 77  LYS 77  105 105 LYS LYS A . n 
A 1 78  GLU 78  106 106 GLU GLU A . n 
A 1 79  ASP 79  107 107 ASP ASP A . n 
A 1 80  HIS 80  108 108 HIS HIS A . n 
A 1 81  SER 81  109 109 SER SER A . n 
A 1 82  LYS 82  110 110 LYS LYS A . n 
A 1 83  ARG 83  111 111 ARG ARG A . n 
A 1 84  SER 84  112 112 SER SER A . n 
A 1 85  SER 85  113 113 SER SER A . n 
A 1 86  PHE 86  114 114 PHE PHE A . n 
A 1 87  VAL 87  115 115 VAL VAL A . n 
A 1 88  CYS 88  116 116 CYS CYS A . n 
A 1 89  VAL 89  117 117 VAL VAL A . n 
A 1 90  LEU 90  118 118 LEU LEU A . n 
A 1 91  LEU 91  119 119 LEU LEU A . n 
A 1 92  SER 92  120 120 SER SER A . n 
A 1 93  HIS 93  121 121 HIS HIS A . n 
A 1 94  GLY 94  122 122 GLY GLY A . n 
A 1 95  GLU 95  123 123 GLU GLU A . n 
A 1 96  GLU 96  124 124 GLU GLU A . n 
A 1 97  GLY 97  125 125 GLY GLY A . n 
A 1 98  ILE 98  126 126 ILE ILE A . n 
A 1 99  ILE 99  127 127 ILE ILE A . n 
A 1 100 PHE 100 128 128 PHE PHE A . n 
A 1 101 GLY 101 129 129 GLY GLY A . n 
A 1 102 THR 102 130 130 THR THR A . n 
A 1 103 ASN 103 131 131 ASN ASN A . n 
A 1 104 GLY 104 132 132 GLY GLY A . n 
A 1 105 PRO 105 133 133 PRO PRO A . n 
A 1 106 VAL 106 134 134 VAL VAL A . n 
A 1 107 ASP 107 135 135 ASP ASP A . n 
A 1 108 LEU 108 136 136 LEU LEU A . n 
A 1 109 LYS 109 137 137 LYS LYS A . n 
A 1 110 LYS 110 138 138 LYS LYS A . n 
A 1 111 ILE 111 139 139 ILE ILE A . n 
A 1 112 THR 112 140 140 THR THR A . n 
A 1 113 ASN 113 141 141 ASN ASN A . n 
A 1 114 PHE 114 142 142 PHE PHE A . n 
A 1 115 PHE 115 143 143 PHE PHE A . n 
A 1 116 ARG 116 144 144 ARG ARG A . n 
A 1 117 GLY 117 145 145 GLY GLY A . n 
A 1 118 ASP 118 146 146 ASP ASP A . n 
A 1 119 ARG 119 147 147 ARG ARG A . n 
A 1 120 CYS 120 148 148 CYS CYS A . n 
A 1 121 ARG 121 149 149 ARG ARG A . n 
A 1 122 SER 122 150 150 SER SER A . n 
A 1 123 LEU 123 151 151 LEU LEU A . n 
A 1 124 THR 124 152 152 THR THR A . n 
A 1 125 GLY 125 153 153 GLY GLY A . n 
A 1 126 LYS 126 154 154 LYS LYS A . n 
A 1 127 PRO 127 155 155 PRO PRO A . n 
A 1 128 LYS 128 156 156 LYS LYS A . n 
A 1 129 LEU 129 157 157 LEU LEU A . n 
A 1 130 PHE 130 158 158 PHE PHE A . n 
A 1 131 ILE 131 159 159 ILE ILE A . n 
A 1 132 ILE 132 160 160 ILE ILE A . n 
A 1 133 GLN 133 161 161 GLN GLN A . n 
A 1 134 ALA 134 162 162 ALA ALA A . n 
A 1 135 CYS 135 163 163 CYS CYS A . n 
A 1 136 ARG 136 164 164 ARG ARG A . n 
A 1 137 GLY 137 165 165 GLY GLY A . n 
A 1 138 THR 138 166 166 THR THR A . n 
A 1 139 GLU 139 167 167 GLU GLU A . n 
A 1 140 LEU 140 168 168 LEU LEU A . n 
A 1 141 ASP 141 169 169 ASP ASP A . n 
A 1 142 CYS 142 170 170 CYS CYS A . n 
A 1 143 GLY 143 171 171 GLY GLY A . n 
A 1 144 ILE 144 172 172 ILE ILE A . n 
A 1 145 GLU 145 173 173 GLU GLU A . n 
A 1 146 THR 146 174 174 THR THR A . n 
A 1 147 ASP 147 175 175 ASP ASP A . n 
B 2 1   ALA 1   175 175 ALA ALA B . n 
B 2 2   SER 2   176 176 SER SER B . n 
B 2 3   GLY 3   177 177 GLY GLY B . n 
B 2 4   VAL 4   178 178 VAL VAL B . n 
B 2 5   ASP 5   179 179 ASP ASP B . n 
B 2 6   ASP 6   180 180 ASP ASP B . n 
B 2 7   ASP 7   181 181 ASP ASP B . n 
B 2 8   MET 8   182 182 MET MET B . n 
B 2 9   ALA 9   183 183 ALA ALA B . n 
B 2 10  CYS 10  184 184 CYS CYS B . n 
B 2 11  HIS 11  185 185 HIS HIS B . n 
B 2 12  LYS 12  186 186 LYS LYS B . n 
B 2 13  ILE 13  187 187 ILE ILE B . n 
B 2 14  PRO 14  188 188 PRO PRO B . n 
B 2 15  VAL 15  189 189 VAL VAL B . n 
B 2 16  GLU 16  190 190 GLU GLU B . n 
B 2 17  ALA 17  191 191 ALA ALA B . n 
B 2 18  ASP 18  192 192 ASP ASP B . n 
B 2 19  PHE 19  193 193 PHE PHE B . n 
B 2 20  LEU 20  194 194 LEU LEU B . n 
B 2 21  TYR 21  195 195 TYR TYR B . n 
B 2 22  ALA 22  196 196 ALA ALA B . n 
B 2 23  TYR 23  197 197 TYR TYR B . n 
B 2 24  SER 24  198 198 SER SER B . n 
B 2 25  THR 25  199 199 THR THR B . n 
B 2 26  ALA 26  200 200 ALA ALA B . n 
B 2 27  PRO 27  201 201 PRO PRO B . n 
B 2 28  GLY 28  202 202 GLY GLY B . n 
B 2 29  TYR 29  203 203 TYR TYR B . n 
B 2 30  TYR 30  204 204 TYR TYR B . n 
B 2 31  SER 31  205 205 SER SER B . n 
B 2 32  TRP 32  206 206 TRP TRP B . n 
B 2 33  ARG 33  207 207 ARG ARG B . n 
B 2 34  ASN 34  208 208 ASN ASN B . n 
B 2 35  SER 35  209 209 SER SER B . n 
B 2 36  LYS 36  210 210 LYS LYS B . n 
B 2 37  ASP 37  211 211 ASP ASP B . n 
B 2 38  GLY 38  212 212 GLY GLY B . n 
B 2 39  SER 39  213 213 SER SER B . n 
B 2 40  TRP 40  214 214 TRP TRP B . n 
B 2 41  PHE 41  215 215 PHE PHE B . n 
B 2 42  ILE 42  216 216 ILE ILE B . n 
B 2 43  GLN 43  217 217 GLN GLN B . n 
B 2 44  SER 44  218 218 SER SER B . n 
B 2 45  LEU 45  219 219 LEU LEU B . n 
B 2 46  CYS 46  220 220 CYS CYS B . n 
B 2 47  ALA 47  221 221 ALA ALA B . n 
B 2 48  MET 48  222 222 MET MET B . n 
B 2 49  LEU 49  223 223 LEU LEU B . n 
B 2 50  LYS 50  224 224 LYS LYS B . n 
B 2 51  GLN 51  225 225 GLN GLN B . n 
B 2 52  TYR 52  226 226 TYR TYR B . n 
B 2 53  ALA 53  227 227 ALA ALA B . n 
B 2 54  ASP 54  228 228 ASP ASP B . n 
B 2 55  LYS 55  229 229 LYS LYS B . n 
B 2 56  LEU 56  230 230 LEU LEU B . n 
B 2 57  GLU 57  231 231 GLU GLU B . n 
B 2 58  PHE 58  232 232 PHE PHE B . n 
B 2 59  MET 59  233 233 MET MET B . n 
B 2 60  HIS 60  234 234 HIS HIS B . n 
B 2 61  ILE 61  235 235 ILE ILE B . n 
B 2 62  LEU 62  236 236 LEU LEU B . n 
B 2 63  THR 63  237 237 THR THR B . n 
B 2 64  ARG 64  238 238 ARG ARG B . n 
B 2 65  VAL 65  239 239 VAL VAL B . n 
B 2 66  ASN 66  240 240 ASN ASN B . n 
B 2 67  ARG 67  241 241 ARG ARG B . n 
B 2 68  LYS 68  242 242 LYS LYS B . n 
B 2 69  VAL 69  243 243 VAL VAL B . n 
B 2 70  ALA 70  244 244 ALA ALA B . n 
B 2 71  THR 71  245 245 THR THR B . n 
B 2 72  GLU 72  246 246 GLU GLU B . n 
B 2 73  PHE 73  247 247 PHE PHE B . n 
B 2 74  GLU 74  248 248 GLU GLU B . n 
B 2 75  SER 75  249 249 SER SER B . n 
B 2 76  PHE 76  250 250 PHE PHE B . n 
B 2 77  SER 77  251 251 SER SER B . n 
B 2 78  PHE 78  252 252 PHE PHE B . n 
B 2 79  ASP 79  253 253 ASP ASP B . n 
B 2 80  ALA 80  254 254 ALA ALA B . n 
B 2 81  THR 81  255 255 THR THR B . n 
B 2 82  PHE 82  256 256 PHE PHE B . n 
B 2 83  HIS 83  257 257 HIS HIS B . n 
B 2 84  ALA 84  258 258 ALA ALA B . n 
B 2 85  LYS 85  259 259 LYS LYS B . n 
B 2 86  LYS 86  260 260 LYS LYS B . n 
B 2 87  GLN 87  261 261 GLN GLN B . n 
B 2 88  ILE 88  262 262 ILE ILE B . n 
B 2 89  PRO 89  263 263 PRO PRO B . n 
B 2 90  CYS 90  264 264 CYS CYS B . n 
B 2 91  ILE 91  265 265 ILE ILE B . n 
B 2 92  VAL 92  266 266 VAL VAL B . n 
B 2 93  SER 93  267 267 SER SER B . n 
B 2 94  MET 94  268 268 MET MET B . n 
B 2 95  LEU 95  269 269 LEU LEU B . n 
B 2 96  THR 96  270 270 THR THR B . n 
B 2 97  LYS 97  271 271 LYS LYS B . n 
B 2 98  GLU 98  272 272 GLU GLU B . n 
B 2 99  LEU 99  273 273 LEU LEU B . n 
B 2 100 TYR 100 274 274 TYR TYR B . n 
B 2 101 PHE 101 275 275 PHE PHE B . n 
B 2 102 TYR 102 276 276 TYR TYR B . n 
B 2 103 HIS 103 277 277 HIS HIS B . n 
C 3 1   PHQ 1   1   1   PHQ PHQ C . n 
C 3 2   ASP 2   2   2   ASP ASP C . n 
C 3 3   GLU 3   3   3   GLU GLU C . n 
C 3 4   VAL 4   4   4   VAL VAL C . n 
C 3 5   AA1 5   5   5   AA1 AA1 C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   2001 2001 HOH HOH A . 
D 4 HOH 2   2002 2002 HOH HOH A . 
D 4 HOH 3   2003 2003 HOH HOH A . 
D 4 HOH 4   2004 2004 HOH HOH A . 
D 4 HOH 5   2005 2005 HOH HOH A . 
D 4 HOH 6   2006 2006 HOH HOH A . 
D 4 HOH 7   2007 2007 HOH HOH A . 
D 4 HOH 8   2008 2008 HOH HOH A . 
D 4 HOH 9   2009 2009 HOH HOH A . 
D 4 HOH 10  2010 2010 HOH HOH A . 
D 4 HOH 11  2011 2011 HOH HOH A . 
D 4 HOH 12  2012 2012 HOH HOH A . 
D 4 HOH 13  2013 2013 HOH HOH A . 
D 4 HOH 14  2014 2014 HOH HOH A . 
D 4 HOH 15  2015 2015 HOH HOH A . 
D 4 HOH 16  2016 2016 HOH HOH A . 
D 4 HOH 17  2017 2017 HOH HOH A . 
D 4 HOH 18  2018 2018 HOH HOH A . 
D 4 HOH 19  2019 2019 HOH HOH A . 
D 4 HOH 20  2020 2020 HOH HOH A . 
D 4 HOH 21  2021 2021 HOH HOH A . 
D 4 HOH 22  2022 2022 HOH HOH A . 
D 4 HOH 23  2023 2023 HOH HOH A . 
D 4 HOH 24  2024 2024 HOH HOH A . 
D 4 HOH 25  2025 2025 HOH HOH A . 
D 4 HOH 26  2026 2026 HOH HOH A . 
D 4 HOH 27  2027 2027 HOH HOH A . 
D 4 HOH 28  2028 2028 HOH HOH A . 
D 4 HOH 29  2029 2029 HOH HOH A . 
D 4 HOH 30  2030 2030 HOH HOH A . 
D 4 HOH 31  2031 2031 HOH HOH A . 
D 4 HOH 32  2032 2032 HOH HOH A . 
D 4 HOH 33  2033 2033 HOH HOH A . 
D 4 HOH 34  2034 2034 HOH HOH A . 
D 4 HOH 35  2035 2035 HOH HOH A . 
D 4 HOH 36  2036 2036 HOH HOH A . 
D 4 HOH 37  2037 2037 HOH HOH A . 
D 4 HOH 38  2038 2038 HOH HOH A . 
D 4 HOH 39  2039 2039 HOH HOH A . 
D 4 HOH 40  2040 2040 HOH HOH A . 
D 4 HOH 41  2041 2041 HOH HOH A . 
D 4 HOH 42  2042 2042 HOH HOH A . 
D 4 HOH 43  2043 2043 HOH HOH A . 
D 4 HOH 44  2044 2044 HOH HOH A . 
D 4 HOH 45  2045 2045 HOH HOH A . 
D 4 HOH 46  2046 2046 HOH HOH A . 
D 4 HOH 47  2047 2047 HOH HOH A . 
D 4 HOH 48  2048 2048 HOH HOH A . 
D 4 HOH 49  2049 2049 HOH HOH A . 
D 4 HOH 50  2050 2050 HOH HOH A . 
D 4 HOH 51  2051 2051 HOH HOH A . 
D 4 HOH 52  2052 2052 HOH HOH A . 
D 4 HOH 53  2053 2053 HOH HOH A . 
D 4 HOH 54  2054 2054 HOH HOH A . 
D 4 HOH 55  2055 2055 HOH HOH A . 
D 4 HOH 56  2056 2056 HOH HOH A . 
D 4 HOH 57  2057 2057 HOH HOH A . 
D 4 HOH 58  2058 2058 HOH HOH A . 
D 4 HOH 59  2059 2059 HOH HOH A . 
D 4 HOH 60  2060 2060 HOH HOH A . 
D 4 HOH 61  2061 2061 HOH HOH A . 
D 4 HOH 62  2062 2062 HOH HOH A . 
D 4 HOH 63  2063 2063 HOH HOH A . 
D 4 HOH 64  2064 2064 HOH HOH A . 
D 4 HOH 65  2065 2065 HOH HOH A . 
D 4 HOH 66  2066 2066 HOH HOH A . 
D 4 HOH 67  2067 2067 HOH HOH A . 
D 4 HOH 68  2068 2068 HOH HOH A . 
D 4 HOH 69  2069 2069 HOH HOH A . 
D 4 HOH 70  2070 2070 HOH HOH A . 
D 4 HOH 71  2071 2071 HOH HOH A . 
D 4 HOH 72  2072 2072 HOH HOH A . 
D 4 HOH 73  2073 2073 HOH HOH A . 
D 4 HOH 74  2074 2074 HOH HOH A . 
D 4 HOH 75  2075 2075 HOH HOH A . 
D 4 HOH 76  2076 2076 HOH HOH A . 
D 4 HOH 77  2077 2077 HOH HOH A . 
D 4 HOH 78  2078 2078 HOH HOH A . 
D 4 HOH 79  2079 2079 HOH HOH A . 
D 4 HOH 80  2080 2080 HOH HOH A . 
D 4 HOH 81  2081 2081 HOH HOH A . 
D 4 HOH 82  2082 2082 HOH HOH A . 
D 4 HOH 83  2083 2083 HOH HOH A . 
D 4 HOH 84  2084 2084 HOH HOH A . 
D 4 HOH 85  2085 2085 HOH HOH A . 
D 4 HOH 86  2086 2086 HOH HOH A . 
D 4 HOH 87  2087 2087 HOH HOH A . 
D 4 HOH 88  2088 2088 HOH HOH A . 
D 4 HOH 89  2089 2089 HOH HOH A . 
D 4 HOH 90  2090 2090 HOH HOH A . 
D 4 HOH 91  2091 2091 HOH HOH A . 
D 4 HOH 92  2092 2092 HOH HOH A . 
D 4 HOH 93  2093 2093 HOH HOH A . 
D 4 HOH 94  2094 2094 HOH HOH A . 
D 4 HOH 95  2095 2095 HOH HOH A . 
D 4 HOH 96  2096 2096 HOH HOH A . 
D 4 HOH 97  2097 2097 HOH HOH A . 
D 4 HOH 98  2098 2098 HOH HOH A . 
D 4 HOH 99  2099 2099 HOH HOH A . 
D 4 HOH 100 2100 2100 HOH HOH A . 
D 4 HOH 101 2101 2101 HOH HOH A . 
D 4 HOH 102 2102 2102 HOH HOH A . 
D 4 HOH 103 2103 2103 HOH HOH A . 
D 4 HOH 104 2104 2104 HOH HOH A . 
D 4 HOH 105 2105 2105 HOH HOH A . 
D 4 HOH 106 2106 2106 HOH HOH A . 
D 4 HOH 107 2107 2107 HOH HOH A . 
D 4 HOH 108 2108 2108 HOH HOH A . 
D 4 HOH 109 2109 2109 HOH HOH A . 
D 4 HOH 110 2110 2110 HOH HOH A . 
D 4 HOH 111 2111 2111 HOH HOH A . 
D 4 HOH 112 2112 2112 HOH HOH A . 
D 4 HOH 113 2113 2113 HOH HOH A . 
D 4 HOH 114 2114 2114 HOH HOH A . 
D 4 HOH 115 2115 2115 HOH HOH A . 
D 4 HOH 116 2116 2116 HOH HOH A . 
D 4 HOH 117 2117 2117 HOH HOH A . 
D 4 HOH 118 2118 2118 HOH HOH A . 
D 4 HOH 119 2119 2119 HOH HOH A . 
D 4 HOH 120 2120 2120 HOH HOH A . 
D 4 HOH 121 2121 2121 HOH HOH A . 
D 4 HOH 122 2122 2122 HOH HOH A . 
D 4 HOH 123 2123 2123 HOH HOH A . 
D 4 HOH 124 2124 2124 HOH HOH A . 
D 4 HOH 125 2125 2125 HOH HOH A . 
D 4 HOH 126 2126 2126 HOH HOH A . 
D 4 HOH 127 2127 2127 HOH HOH A . 
D 4 HOH 128 2128 2128 HOH HOH A . 
D 4 HOH 129 2129 2129 HOH HOH A . 
D 4 HOH 130 2130 2130 HOH HOH A . 
D 4 HOH 131 2131 2131 HOH HOH A . 
D 4 HOH 132 2132 2132 HOH HOH A . 
D 4 HOH 133 2133 2133 HOH HOH A . 
D 4 HOH 134 2134 2134 HOH HOH A . 
D 4 HOH 135 2135 2135 HOH HOH A . 
D 4 HOH 136 2136 2136 HOH HOH A . 
D 4 HOH 137 2137 2137 HOH HOH A . 
D 4 HOH 138 2138 2138 HOH HOH A . 
D 4 HOH 139 2139 2139 HOH HOH A . 
D 4 HOH 140 2140 2140 HOH HOH A . 
D 4 HOH 141 2141 2141 HOH HOH A . 
D 4 HOH 142 2142 2142 HOH HOH A . 
D 4 HOH 143 2143 2143 HOH HOH A . 
D 4 HOH 144 2144 2144 HOH HOH A . 
D 4 HOH 145 2145 2145 HOH HOH A . 
D 4 HOH 146 2146 2146 HOH HOH A . 
D 4 HOH 147 2147 2147 HOH HOH A . 
D 4 HOH 148 2148 2148 HOH HOH A . 
D 4 HOH 149 2149 2149 HOH HOH A . 
D 4 HOH 150 2150 2150 HOH HOH A . 
D 4 HOH 151 2151 2151 HOH HOH A . 
D 4 HOH 152 2152 2152 HOH HOH A . 
D 4 HOH 153 2153 2153 HOH HOH A . 
D 4 HOH 154 2154 2154 HOH HOH A . 
D 4 HOH 155 2155 2155 HOH HOH A . 
D 4 HOH 156 2156 2156 HOH HOH A . 
D 4 HOH 157 2157 2157 HOH HOH A . 
D 4 HOH 158 2158 2158 HOH HOH A . 
D 4 HOH 159 2159 2159 HOH HOH A . 
D 4 HOH 160 2160 2160 HOH HOH A . 
D 4 HOH 161 2161 2161 HOH HOH A . 
D 4 HOH 162 2162 2162 HOH HOH A . 
D 4 HOH 163 2163 2163 HOH HOH A . 
D 4 HOH 164 2164 2164 HOH HOH A . 
D 4 HOH 165 2165 2165 HOH HOH A . 
D 4 HOH 166 2166 2166 HOH HOH A . 
D 4 HOH 167 2167 2167 HOH HOH A . 
D 4 HOH 168 2168 2168 HOH HOH A . 
D 4 HOH 169 2169 2169 HOH HOH A . 
D 4 HOH 170 2170 2170 HOH HOH A . 
D 4 HOH 171 2171 2171 HOH HOH A . 
D 4 HOH 172 2172 2172 HOH HOH A . 
D 4 HOH 173 2173 2173 HOH HOH A . 
D 4 HOH 174 2174 2174 HOH HOH A . 
D 4 HOH 175 2175 2175 HOH HOH A . 
D 4 HOH 176 2176 2176 HOH HOH A . 
D 4 HOH 177 2177 2177 HOH HOH A . 
D 4 HOH 178 2178 2178 HOH HOH A . 
D 4 HOH 179 2179 2179 HOH HOH A . 
D 4 HOH 180 2180 2180 HOH HOH A . 
D 4 HOH 181 2181 2181 HOH HOH A . 
D 4 HOH 182 2182 2182 HOH HOH A . 
D 4 HOH 183 2183 2183 HOH HOH A . 
D 4 HOH 184 2184 2184 HOH HOH A . 
D 4 HOH 185 2185 2185 HOH HOH A . 
D 4 HOH 186 2186 2186 HOH HOH A . 
D 4 HOH 187 2187 2187 HOH HOH A . 
D 4 HOH 188 2188 2188 HOH HOH A . 
D 4 HOH 189 2189 2189 HOH HOH A . 
D 4 HOH 190 2190 2190 HOH HOH A . 
D 4 HOH 191 2191 2191 HOH HOH A . 
D 4 HOH 192 2192 2192 HOH HOH A . 
D 4 HOH 193 2193 2193 HOH HOH A . 
D 4 HOH 194 2194 2194 HOH HOH A . 
D 4 HOH 195 2195 2195 HOH HOH A . 
D 4 HOH 196 2196 2196 HOH HOH A . 
D 4 HOH 197 2197 2197 HOH HOH A . 
D 4 HOH 198 2198 2198 HOH HOH A . 
D 4 HOH 199 2199 2199 HOH HOH A . 
D 4 HOH 200 2200 2200 HOH HOH A . 
D 4 HOH 201 2201 2201 HOH HOH A . 
D 4 HOH 202 2202 2202 HOH HOH A . 
D 4 HOH 203 2203 2203 HOH HOH A . 
D 4 HOH 204 2204 2204 HOH HOH A . 
D 4 HOH 205 2205 2205 HOH HOH A . 
D 4 HOH 206 2206 2206 HOH HOH A . 
D 4 HOH 207 2207 2207 HOH HOH A . 
D 4 HOH 208 2208 2208 HOH HOH A . 
D 4 HOH 209 2209 2209 HOH HOH A . 
D 4 HOH 210 2210 2210 HOH HOH A . 
D 4 HOH 211 2211 2211 HOH HOH A . 
D 4 HOH 212 2212 2212 HOH HOH A . 
D 4 HOH 213 2213 2213 HOH HOH A . 
D 4 HOH 214 2214 2214 HOH HOH A . 
D 4 HOH 215 2215 2215 HOH HOH A . 
D 4 HOH 216 2216 2216 HOH HOH A . 
D 4 HOH 217 2217 2217 HOH HOH A . 
D 4 HOH 218 2218 2218 HOH HOH A . 
D 4 HOH 219 2219 2219 HOH HOH A . 
D 4 HOH 220 2220 2220 HOH HOH A . 
D 4 HOH 221 2221 2221 HOH HOH A . 
D 4 HOH 222 2222 2222 HOH HOH A . 
D 4 HOH 223 2223 2223 HOH HOH A . 
D 4 HOH 224 2224 2224 HOH HOH A . 
D 4 HOH 225 2225 2225 HOH HOH A . 
D 4 HOH 226 2226 2226 HOH HOH A . 
D 4 HOH 227 2227 2227 HOH HOH A . 
D 4 HOH 228 2228 2228 HOH HOH A . 
D 4 HOH 229 2229 2229 HOH HOH A . 
D 4 HOH 230 2230 2230 HOH HOH A . 
D 4 HOH 231 2231 2231 HOH HOH A . 
D 4 HOH 232 2232 2232 HOH HOH A . 
D 4 HOH 233 2233 2233 HOH HOH A . 
D 4 HOH 234 2234 2234 HOH HOH A . 
D 4 HOH 235 2235 2235 HOH HOH A . 
D 4 HOH 236 2236 2236 HOH HOH A . 
D 4 HOH 237 2237 2237 HOH HOH A . 
D 4 HOH 238 2238 2238 HOH HOH A . 
D 4 HOH 239 2239 2239 HOH HOH A . 
E 4 HOH 1   2001 2001 HOH HOH B . 
E 4 HOH 2   2002 2002 HOH HOH B . 
E 4 HOH 3   2003 2003 HOH HOH B . 
E 4 HOH 4   2004 2004 HOH HOH B . 
E 4 HOH 5   2005 2005 HOH HOH B . 
E 4 HOH 6   2006 2006 HOH HOH B . 
E 4 HOH 7   2007 2007 HOH HOH B . 
E 4 HOH 8   2008 2008 HOH HOH B . 
E 4 HOH 9   2011 2011 HOH HOH B . 
E 4 HOH 10  2015 2015 HOH HOH B . 
E 4 HOH 11  2016 2016 HOH HOH B . 
E 4 HOH 12  2017 2017 HOH HOH B . 
E 4 HOH 13  2018 2018 HOH HOH B . 
E 4 HOH 14  2019 2019 HOH HOH B . 
E 4 HOH 15  2020 2020 HOH HOH B . 
E 4 HOH 16  2021 2021 HOH HOH B . 
E 4 HOH 17  2023 2023 HOH HOH B . 
E 4 HOH 18  2024 2024 HOH HOH B . 
E 4 HOH 19  2025 2025 HOH HOH B . 
E 4 HOH 20  2027 2027 HOH HOH B . 
E 4 HOH 21  2028 2028 HOH HOH B . 
E 4 HOH 22  2031 2031 HOH HOH B . 
E 4 HOH 23  2032 2032 HOH HOH B . 
E 4 HOH 24  2033 2033 HOH HOH B . 
E 4 HOH 25  2034 2034 HOH HOH B . 
E 4 HOH 26  2035 2035 HOH HOH B . 
E 4 HOH 27  2036 2036 HOH HOH B . 
E 4 HOH 28  2037 2037 HOH HOH B . 
E 4 HOH 29  2038 2038 HOH HOH B . 
E 4 HOH 30  2039 2039 HOH HOH B . 
E 4 HOH 31  2040 2040 HOH HOH B . 
E 4 HOH 32  2041 2041 HOH HOH B . 
E 4 HOH 33  2042 2042 HOH HOH B . 
E 4 HOH 34  2043 2043 HOH HOH B . 
E 4 HOH 35  2044 2044 HOH HOH B . 
E 4 HOH 36  2045 2045 HOH HOH B . 
E 4 HOH 37  2046 2046 HOH HOH B . 
E 4 HOH 38  2047 2047 HOH HOH B . 
E 4 HOH 39  2048 2048 HOH HOH B . 
E 4 HOH 40  2049 2049 HOH HOH B . 
E 4 HOH 41  2050 2050 HOH HOH B . 
E 4 HOH 42  2051 2051 HOH HOH B . 
E 4 HOH 43  2052 2052 HOH HOH B . 
E 4 HOH 44  2053 2053 HOH HOH B . 
E 4 HOH 45  2054 2054 HOH HOH B . 
E 4 HOH 46  2055 2055 HOH HOH B . 
E 4 HOH 47  2056 2056 HOH HOH B . 
E 4 HOH 48  2057 2057 HOH HOH B . 
E 4 HOH 49  2058 2058 HOH HOH B . 
E 4 HOH 50  2059 2059 HOH HOH B . 
E 4 HOH 51  2060 2060 HOH HOH B . 
E 4 HOH 52  2061 2061 HOH HOH B . 
E 4 HOH 53  2063 2063 HOH HOH B . 
E 4 HOH 54  2064 2064 HOH HOH B . 
E 4 HOH 55  2065 2065 HOH HOH B . 
E 4 HOH 56  2066 2066 HOH HOH B . 
E 4 HOH 57  2067 2067 HOH HOH B . 
E 4 HOH 58  2068 2068 HOH HOH B . 
E 4 HOH 59  2069 2069 HOH HOH B . 
E 4 HOH 60  2070 2070 HOH HOH B . 
E 4 HOH 61  2071 2071 HOH HOH B . 
E 4 HOH 62  2072 2072 HOH HOH B . 
E 4 HOH 63  2073 2073 HOH HOH B . 
E 4 HOH 64  2074 2074 HOH HOH B . 
E 4 HOH 65  2075 2075 HOH HOH B . 
E 4 HOH 66  2076 2076 HOH HOH B . 
E 4 HOH 67  2077 2077 HOH HOH B . 
E 4 HOH 68  2078 2078 HOH HOH B . 
E 4 HOH 69  2079 2079 HOH HOH B . 
E 4 HOH 70  2080 2080 HOH HOH B . 
E 4 HOH 71  2081 2081 HOH HOH B . 
E 4 HOH 72  2082 2082 HOH HOH B . 
E 4 HOH 73  2083 2083 HOH HOH B . 
E 4 HOH 74  2084 2084 HOH HOH B . 
E 4 HOH 75  2085 2085 HOH HOH B . 
E 4 HOH 76  2086 2086 HOH HOH B . 
E 4 HOH 77  2087 2087 HOH HOH B . 
E 4 HOH 78  2088 2088 HOH HOH B . 
E 4 HOH 79  2089 2089 HOH HOH B . 
E 4 HOH 80  2090 2090 HOH HOH B . 
E 4 HOH 81  2091 2091 HOH HOH B . 
E 4 HOH 82  2092 2092 HOH HOH B . 
E 4 HOH 83  2093 2093 HOH HOH B . 
E 4 HOH 84  2094 2094 HOH HOH B . 
E 4 HOH 85  2095 2095 HOH HOH B . 
E 4 HOH 86  2096 2096 HOH HOH B . 
E 4 HOH 87  2097 2097 HOH HOH B . 
E 4 HOH 88  2098 2098 HOH HOH B . 
E 4 HOH 89  2099 2099 HOH HOH B . 
E 4 HOH 90  2100 2100 HOH HOH B . 
E 4 HOH 91  2101 2101 HOH HOH B . 
E 4 HOH 92  2102 2102 HOH HOH B . 
E 4 HOH 93  2103 2103 HOH HOH B . 
E 4 HOH 94  2104 2104 HOH HOH B . 
E 4 HOH 95  2105 2105 HOH HOH B . 
E 4 HOH 96  2106 2106 HOH HOH B . 
E 4 HOH 97  2107 2107 HOH HOH B . 
E 4 HOH 98  2108 2108 HOH HOH B . 
E 4 HOH 99  2109 2109 HOH HOH B . 
E 4 HOH 100 2110 2110 HOH HOH B . 
E 4 HOH 101 2111 2111 HOH HOH B . 
E 4 HOH 102 2112 2112 HOH HOH B . 
E 4 HOH 103 2113 2113 HOH HOH B . 
E 4 HOH 104 2114 2114 HOH HOH B . 
E 4 HOH 105 2115 2115 HOH HOH B . 
E 4 HOH 106 2116 2116 HOH HOH B . 
E 4 HOH 107 2117 2117 HOH HOH B . 
E 4 HOH 108 2118 2118 HOH HOH B . 
E 4 HOH 109 2119 2119 HOH HOH B . 
E 4 HOH 110 2120 2120 HOH HOH B . 
E 4 HOH 111 2121 2121 HOH HOH B . 
E 4 HOH 112 2122 2122 HOH HOH B . 
E 4 HOH 113 2124 2124 HOH HOH B . 
E 4 HOH 114 2125 2125 HOH HOH B . 
E 4 HOH 115 2126 2126 HOH HOH B . 
E 4 HOH 116 2127 2127 HOH HOH B . 
E 4 HOH 117 2128 2128 HOH HOH B . 
E 4 HOH 118 2129 2129 HOH HOH B . 
E 4 HOH 119 2130 2130 HOH HOH B . 
E 4 HOH 120 2131 2131 HOH HOH B . 
E 4 HOH 121 2132 2132 HOH HOH B . 
E 4 HOH 122 2133 2133 HOH HOH B . 
E 4 HOH 123 2134 2134 HOH HOH B . 
F 4 HOH 1   2238 2238 HOH HOH C . 
F 4 HOH 2   2239 2239 HOH HOH C . 
F 4 HOH 3   2240 2240 HOH HOH C . 
F 4 HOH 4   2241 2241 HOH HOH C . 
F 4 HOH 5   2242 2242 HOH HOH C . 
# 
_pdbx_molecule_features.prd_id    PRD_000330 
_pdbx_molecule_features.name      
;(5S,8R,11S)-8-(2-carboxyethyl)-5-(carboxymethyl)-14-(4-ethoxy-4-oxobutanoyl)-11-(1-methylethyl)-3,6,9,12-tetraoxo-1-phenyl-2-oxa-4,7,10,13,14-pentaazahexadecan-16-oic acid
;
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     Inhibitor 
_pdbx_molecule_features.details   ? 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_000330 
_pdbx_molecule.asym_id       C 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 3_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 67.4710000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 96.2510000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-09-20 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2011-07-20 
4 'Structure model' 1 3 2012-11-30 
5 'Structure model' 1 4 2017-02-15 
6 'Structure model' 1 5 2017-06-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Atomic model'              
2  2 'Structure model' 'Database references'       
3  2 'Structure model' 'Derived calculations'      
4  2 'Structure model' 'Non-polymer description'   
5  2 'Structure model' 'Structure summary'         
6  2 'Structure model' 'Version format compliance' 
7  3 'Structure model' Other                       
8  3 'Structure model' 'Source and taxonomy'       
9  3 'Structure model' 'Structure summary'         
10 4 'Structure model' Other                       
11 5 'Structure model' 'Source and taxonomy'       
12 6 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    6 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    6 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
# 
_pdbx_entry_details.entry_id             2C2K 
_pdbx_entry_details.compound_details     
;THE INITIAL LIGAND USED IN THE EXPERIMENT WAS CIS CBZ-DEVAD-CH=CH-
CO2ET, INDICATED AS 18G IN THE PRIMARY PUBLICATION. UPON REACTION,
THE DOUBLE BOND OPENED UP AND FORMED A COVALENT BOND BETWEEN ATOM
C11 OF RESIDUE AA1 5 OF CHAIN C AND ATOM SG OF CYS 163 OF CHAIN A.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 64  ? ? -103.03 78.42   
2 1 SER A 120 ? ? -174.98 -177.07 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2033 ? 5.88 . 
2 1 O ? A HOH 2055 ? 7.24 . 
3 1 O ? A HOH 2077 ? 6.19 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ASP 175 ? CA  ? A ASP 147 CA  
2 1 Y 1 A ASP 175 ? C   ? A ASP 147 C   
3 1 Y 1 A ASP 175 ? O   ? A ASP 147 O   
4 1 Y 1 A ASP 175 ? CB  ? A ASP 147 CB  
5 1 Y 1 A ASP 175 ? CG  ? A ASP 147 CG  
6 1 Y 1 A ASP 175 ? OD1 ? A ASP 147 OD1 
7 1 Y 1 A ASP 175 ? OD2 ? A ASP 147 OD2 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#