data_2C2R
# 
_entry.id   2C2R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2C2R         
PDBE  EBI-25826    
WWPDB D_1290025826 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1JX4 unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 1JXL unspecified 
'CRYSTAL STRUCTURE OF A Y-FAMILY DNA POLYMERASE IN A TERNARYCOMPLEX WITH DNA SUBSTRATES AND AN INCOMING NUCLEOTIDE' 
PDB 1N48 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 1N56 unspecified 'Y-FAMILY DNA POLYMERASE DPO4 IN COMPLEX WITH DNA CONTAININGABASIC LESION' 
PDB 1RYR unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 1RYS unspecified 'REPLICATION OF A CIS-SYN THYMINE DIMER AT ATOMIC RESOLUTION' 
PDB 1S0M unspecified 'CRYSTAL STRUCTURE OF A BENZO[A]PYRENE DIOL EPOXIDE ADDUCTIN A TERNARY COMPLEX WITH A DNA POLYMERASE' 
PDB 1S0N unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S0O unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S10 unspecified 'SNAPSHOTS OF REPLICATION THROUGH AN ABASIC LESION:STRUCTURAL BASIS FOR BASE SUBSTITUTION AND FRAMESHIFT' 
PDB 1S97 unspecified 'DPO4 WITH GT MISMATCH' 
PDB 1S9F unspecified 'DPO WITH AT MATCHED' 
PDB 2AGO unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2AGP unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2AGQ unspecified 'FIDELITY OF DPO4: EFFECT OF METAL IONS, NUCLEOTIDESELECTION AND PYROPHOSPHOROLYSIS' 
PDB 2BQ3 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BQR unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BQU unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2BR0 unspecified 
;DNA ADDUCT BYPASS POLYMERIZATION BY SULFOLOBUS SOLFATARICUS DPO4. ANALYSIS AND CRYSTAL STRUCTURES OF MULTIPLE BASE-PAIR SUBSTITUTION AND FRAMESHIFT PRODUCTS WITH THE ADDUCT 1 ,N2-ETHENOGUANINE
;
PDB 2C22 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C28 unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2D unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
PDB 2C2E unspecified 
;EFFICIENT AND HIGH FIDELITY INCORPORATION OF DCTP OPPOSITE 7,8-DIHYDRO-8- OXODEOXYGUANOSINE BY SULFOLOBUS SOLFATARICUS DNA POLYMERASE DPO4
;
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2C2R 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-09-29 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Irimia, A.'          1 
'Loukachevitch, L.V.' 2 
'Egli, M.'            3 
# 
_citation.id                        primary 
_citation.title                     
;Efficient and High Fidelity Incorporation of Dctp Opposite 7,8-Dihydro-8-Oxodeoxyguanosine by Sulfolobus Solfataricus DNA Polymerase Dpo4
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                2358 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16306039 
_citation.pdbx_database_id_DOI      10.1074/JBC.M510889200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zang, H.'            1 
primary 'Irimia, A.'          2 
primary 'Choi, J.-Y.'         3 
primary 'Angel, K.C.'         4 
primary 'Loukachevitch, L.V.' 5 
primary 'Egli, M.'            6 
primary 'Guengerich, F.P.'    7 
# 
_cell.entry_id           2C2R 
_cell.length_a           95.200 
_cell.length_b           100.150 
_cell.length_c           52.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2C2R 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE IV'                                                41086.754 1   2.7.7.7 ? ? ? 
2 polymer     syn 
;5'-D(*GP*GP*GP*GP*GP*AP*AP*GP*GP*AP *TP*TP*C)-3'
;
4369.854  1   ?       ? ? '13-MER PRIMER EXTENDED BY POLYMERASE TO A 14-MER' 
3 polymer     syn 
;5'-D(*TP*CP*AP*C 8OGP*GP*AP*AP*TP*CP*CP *TP*TP*CP*CP*CP*CP*C)-3'
;
5388.480  1   ?       ? ? '18-MER TEMPLATE'                                  
4 non-polymer syn 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
451.158   1   ?       ? ? ?                                                  
5 non-polymer syn 'CALCIUM ION'                                                      40.078    4   ?       ? ? ? 
6 water       nat water                                                              18.015    106 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'POL IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
;HHHHHHMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYL
PMRKEVYQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIA
ADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYN
EPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSE
SVKLLQKILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
A ? 
2 polydeoxyribonucleotide no yes '(DG)(DG)(DG)(DG)(DG)(DA)(DA)(DG)(DG)(DA)(DT)(DT)(DC)(DOC)' GGGGGAAGGATTCC P ? 
3 polydeoxyribonucleotide no yes '(DT)(DC)(DA)(DC)(8OG)(DG)(DA)(DA)(DT)(DC)(DC)(DT)(DT)(DC)(DC)(DC)(DC)(DC)' TCACGGAATCCTTCCCCC T 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   MET n 
1 8   ILE n 
1 9   VAL n 
1 10  LEU n 
1 11  PHE n 
1 12  VAL n 
1 13  ASP n 
1 14  PHE n 
1 15  ASP n 
1 16  TYR n 
1 17  PHE n 
1 18  TYR n 
1 19  ALA n 
1 20  GLN n 
1 21  VAL n 
1 22  GLU n 
1 23  GLU n 
1 24  VAL n 
1 25  LEU n 
1 26  ASN n 
1 27  PRO n 
1 28  SER n 
1 29  LEU n 
1 30  LYS n 
1 31  GLY n 
1 32  LYS n 
1 33  PRO n 
1 34  VAL n 
1 35  VAL n 
1 36  VAL n 
1 37  CYS n 
1 38  VAL n 
1 39  PHE n 
1 40  SER n 
1 41  GLY n 
1 42  ARG n 
1 43  PHE n 
1 44  GLU n 
1 45  ASP n 
1 46  SER n 
1 47  GLY n 
1 48  ALA n 
1 49  VAL n 
1 50  ALA n 
1 51  THR n 
1 52  ALA n 
1 53  ASN n 
1 54  TYR n 
1 55  GLU n 
1 56  ALA n 
1 57  ARG n 
1 58  LYS n 
1 59  PHE n 
1 60  GLY n 
1 61  VAL n 
1 62  LYS n 
1 63  ALA n 
1 64  GLY n 
1 65  ILE n 
1 66  PRO n 
1 67  ILE n 
1 68  VAL n 
1 69  GLU n 
1 70  ALA n 
1 71  LYS n 
1 72  LYS n 
1 73  ILE n 
1 74  LEU n 
1 75  PRO n 
1 76  ASN n 
1 77  ALA n 
1 78  VAL n 
1 79  TYR n 
1 80  LEU n 
1 81  PRO n 
1 82  MET n 
1 83  ARG n 
1 84  LYS n 
1 85  GLU n 
1 86  VAL n 
1 87  TYR n 
1 88  GLN n 
1 89  GLN n 
1 90  VAL n 
1 91  SER n 
1 92  SER n 
1 93  ARG n 
1 94  ILE n 
1 95  MET n 
1 96  ASN n 
1 97  LEU n 
1 98  LEU n 
1 99  ARG n 
1 100 GLU n 
1 101 TYR n 
1 102 SER n 
1 103 GLU n 
1 104 LYS n 
1 105 ILE n 
1 106 GLU n 
1 107 ILE n 
1 108 ALA n 
1 109 SER n 
1 110 ILE n 
1 111 ASP n 
1 112 GLU n 
1 113 ALA n 
1 114 TYR n 
1 115 LEU n 
1 116 ASP n 
1 117 ILE n 
1 118 SER n 
1 119 ASP n 
1 120 LYS n 
1 121 VAL n 
1 122 ARG n 
1 123 ASP n 
1 124 TYR n 
1 125 ARG n 
1 126 GLU n 
1 127 ALA n 
1 128 TYR n 
1 129 ASN n 
1 130 LEU n 
1 131 GLY n 
1 132 LEU n 
1 133 GLU n 
1 134 ILE n 
1 135 LYS n 
1 136 ASN n 
1 137 LYS n 
1 138 ILE n 
1 139 LEU n 
1 140 GLU n 
1 141 LYS n 
1 142 GLU n 
1 143 LYS n 
1 144 ILE n 
1 145 THR n 
1 146 VAL n 
1 147 THR n 
1 148 VAL n 
1 149 GLY n 
1 150 ILE n 
1 151 SER n 
1 152 LYS n 
1 153 ASN n 
1 154 LYS n 
1 155 VAL n 
1 156 PHE n 
1 157 ALA n 
1 158 LYS n 
1 159 ILE n 
1 160 ALA n 
1 161 ALA n 
1 162 ASP n 
1 163 MET n 
1 164 ALA n 
1 165 LYS n 
1 166 PRO n 
1 167 ASN n 
1 168 GLY n 
1 169 ILE n 
1 170 LYS n 
1 171 VAL n 
1 172 ILE n 
1 173 ASP n 
1 174 ASP n 
1 175 GLU n 
1 176 GLU n 
1 177 VAL n 
1 178 LYS n 
1 179 ARG n 
1 180 LEU n 
1 181 ILE n 
1 182 ARG n 
1 183 GLU n 
1 184 LEU n 
1 185 ASP n 
1 186 ILE n 
1 187 ALA n 
1 188 ASP n 
1 189 VAL n 
1 190 PRO n 
1 191 GLY n 
1 192 ILE n 
1 193 GLY n 
1 194 ASN n 
1 195 ILE n 
1 196 THR n 
1 197 ALA n 
1 198 GLU n 
1 199 LYS n 
1 200 LEU n 
1 201 LYS n 
1 202 LYS n 
1 203 LEU n 
1 204 GLY n 
1 205 ILE n 
1 206 ASN n 
1 207 LYS n 
1 208 LEU n 
1 209 VAL n 
1 210 ASP n 
1 211 THR n 
1 212 LEU n 
1 213 SER n 
1 214 ILE n 
1 215 GLU n 
1 216 PHE n 
1 217 ASP n 
1 218 LYS n 
1 219 LEU n 
1 220 LYS n 
1 221 GLY n 
1 222 MET n 
1 223 ILE n 
1 224 GLY n 
1 225 GLU n 
1 226 ALA n 
1 227 LYS n 
1 228 ALA n 
1 229 LYS n 
1 230 TYR n 
1 231 LEU n 
1 232 ILE n 
1 233 SER n 
1 234 LEU n 
1 235 ALA n 
1 236 ARG n 
1 237 ASP n 
1 238 GLU n 
1 239 TYR n 
1 240 ASN n 
1 241 GLU n 
1 242 PRO n 
1 243 ILE n 
1 244 ARG n 
1 245 THR n 
1 246 ARG n 
1 247 VAL n 
1 248 ARG n 
1 249 LYS n 
1 250 SER n 
1 251 ILE n 
1 252 GLY n 
1 253 ARG n 
1 254 ILE n 
1 255 VAL n 
1 256 THR n 
1 257 MET n 
1 258 LYS n 
1 259 ARG n 
1 260 ASN n 
1 261 SER n 
1 262 ARG n 
1 263 ASN n 
1 264 LEU n 
1 265 GLU n 
1 266 GLU n 
1 267 ILE n 
1 268 LYS n 
1 269 PRO n 
1 270 TYR n 
1 271 LEU n 
1 272 PHE n 
1 273 ARG n 
1 274 ALA n 
1 275 ILE n 
1 276 GLU n 
1 277 GLU n 
1 278 SER n 
1 279 TYR n 
1 280 TYR n 
1 281 LYS n 
1 282 LEU n 
1 283 ASP n 
1 284 LYS n 
1 285 ARG n 
1 286 ILE n 
1 287 PRO n 
1 288 LYS n 
1 289 ALA n 
1 290 ILE n 
1 291 HIS n 
1 292 VAL n 
1 293 VAL n 
1 294 ALA n 
1 295 VAL n 
1 296 THR n 
1 297 GLU n 
1 298 ASP n 
1 299 LEU n 
1 300 ASP n 
1 301 ILE n 
1 302 VAL n 
1 303 SER n 
1 304 ARG n 
1 305 GLY n 
1 306 ARG n 
1 307 THR n 
1 308 PHE n 
1 309 PRO n 
1 310 HIS n 
1 311 GLY n 
1 312 ILE n 
1 313 SER n 
1 314 LYS n 
1 315 GLU n 
1 316 THR n 
1 317 ALA n 
1 318 TYR n 
1 319 SER n 
1 320 GLU n 
1 321 SER n 
1 322 VAL n 
1 323 LYS n 
1 324 LEU n 
1 325 LEU n 
1 326 GLN n 
1 327 LYS n 
1 328 ILE n 
1 329 LEU n 
1 330 GLU n 
1 331 GLU n 
1 332 ASP n 
1 333 GLU n 
1 334 ARG n 
1 335 LYS n 
1 336 ILE n 
1 337 ARG n 
1 338 ARG n 
1 339 ILE n 
1 340 GLY n 
1 341 VAL n 
1 342 ARG n 
1 343 PHE n 
1 344 SER n 
1 345 LYS n 
1 346 PHE n 
1 347 ILE n 
1 348 GLU n 
1 349 ALA n 
1 350 ILE n 
1 351 GLY n 
1 352 LEU n 
1 353 ASP n 
1 354 LYS n 
1 355 PHE n 
1 356 PHE n 
1 357 ASP n 
1 358 THR n 
2 1   DG  n 
2 2   DG  n 
2 3   DG  n 
2 4   DG  n 
2 5   DG  n 
2 6   DA  n 
2 7   DA  n 
2 8   DG  n 
2 9   DG  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DC  n 
2 14  DOC n 
3 1   DT  n 
3 2   DC  n 
3 3   DA  n 
3 4   DC  n 
3 5   8OG n 
3 6   DG  n 
3 7   DA  n 
3 8   DA  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DT  n 
3 13  DT  n 
3 14  DC  n 
3 15  DC  n 
3 16  DC  n 
3 17  DC  n 
3 18  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    P2 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'SULFOLOBUS SOLFATARICUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET22B/DPO4-NHIS 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'GENE DPO4' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2C2R        1 ? ? 2C2R   ? 
2 UNP DPO42_SULSO 1 ? ? Q97W02 ? 
3 PDB 2C2R        2 ? ? 2C2R   ? 
4 PDB 2C2R        3 ? ? 2C2R   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2C2R A 1 ? 6   ? 2C2R   -5 ? 0   ? -5 0   
2 2 2C2R A 7 ? 358 ? Q97W02 1  ? 352 ? 1  352 
3 3 2C2R P 1 ? 14  ? 2C2R   1  ? 14  ? 1  14  
4 4 2C2R T 1 ? 18  ? 2C2R   1  ? 18  ? 1  18  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
8OG 'DNA linking'       n "8-OXO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" "8-OXO-7,8-DIHYDRO-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" 
'C10 H14 N5 O8 P'  363.221 
ALA 'L-peptide linking' y ALANINE                                     ?                                                       
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                                                       
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                                                       
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                                                       
'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                               ?                                                       
'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                                    ?                                                       
'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"         ?                                                       
'C9 H14 N3 O7 P'   307.197 
DCT 'DNA linking'       n 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
?                                                       'C9 H16 N3 O12 P3' 451.158 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"        ?                                                       
'C10 H14 N5 O7 P'  347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE"    ?                                                       
'C9 H14 N3 O6 P'   291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                ?                                                       
'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                   ?                                                       
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                                                       
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                                                       
'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                   ?                                                       
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                       ?                                                       
'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                                                       
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                                                       
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                                                       
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                                                       
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                                                       
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                                                       
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                      ?                                                       
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                   ?                                                       
'C4 H9 N O3'       119.119 
TYR 'L-peptide linking' y TYROSINE                                    ?                                                       
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                      ?                                                       
'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2C2R 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   51.05 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '5% PEG 3350,0.010 M TRIS-HCL PH 7.5, 100 MM CA(CH3CO2)2, 1.25% GLYCEROL, 30 MM NACL' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2005-08-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2C2R 
_reflns.observed_criterion_sigma_I   1.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             42.990 
_reflns.d_resolution_high            2.550 
_reflns.number_obs                   16653 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.12000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.7700 
_reflns.B_iso_Wilson_estimate        55.1 
_reflns.pdbx_redundancy              3.640 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.71 
_reflns_shell.percent_possible_all   93.9 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2C2R 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     16645 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1203084.41 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.99 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_obs                          0.251 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.251 
_refine.ls_R_factor_R_free                       0.310 
_refine.ls_R_factor_R_free_error                 0.011 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  817 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               54.6 
_refine.aniso_B[1][1]                            27.67 
_refine.aniso_B[2][2]                            -18.88 
_refine.aniso_B[3][3]                            -8.79 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.332755 
_refine.solvent_model_param_bsol                 64.6677 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2C28' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2C2R 
_refine_analyze.Luzzati_coordinate_error_obs    0.41 
_refine_analyze.Luzzati_sigma_a_obs             0.49 
_refine_analyze.Luzzati_d_res_low_obs           47.00 
_refine_analyze.Luzzati_coordinate_error_free   0.53 
_refine_analyze.Luzzati_sigma_a_free            0.50 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2744 
_refine_hist.pdbx_number_atoms_nucleic_acid   608 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             106 
_refine_hist.number_atoms_total               3489 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        42.99 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.43  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.29  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.23  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.71  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.65  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.55 
_refine_ls_shell.d_res_low                        2.71 
_refine_ls_shell.number_reflns_R_work             2463 
_refine_ls_shell.R_factor_R_work                  0.376 
_refine_ls_shell.percent_reflns_obs               93.9 
_refine_ls_shell.R_factor_R_free                  0.385 
_refine_ls_shell.R_factor_R_free_error            0.034 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             128 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP   
'X-RAY DIFFRACTION' 2 DNA-RNA1.PARAM    DNA-RNA1.TOP  
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM   WATER_REP.TOP 
'X-RAY DIFFRACTION' 4 DCT.PARAM         DCT.TOP       
'X-RAY DIFFRACTION' 5 ION.PARAM         ION.TOP       
# 
_struct.entry_id                  2C2R 
_struct.title                     
;Efficient and High Fidelity Incorporation of dCTP Opposite 7,8- Dihydro-8-oxodeoxyguanosine by Sulfolobus solfataricus DNA Polymerase Dpo4
;
_struct.pdbx_descriptor           'DNA POLYMERASE IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2C2R 
_struct_keywords.pdbx_keywords   POLYMERASE 
_struct_keywords.text            
;POLYMERASE, P2 DNA POLYMERASE IV, 7, 8-DIHYDRO-8-OXODEOXYGUANOSINE, TRANSLESION DNA POLYMERASE, NUCLEOTIDYLTRANSFERASE, TRANSFERASE, DNA DAMAGE, DNA REPAIR, DNA REPLICATION, DNA- BINDING, DNA-DIRECTED DNA POLYMERASE, MAGNESIUM, CALCIUM, METAL-BINDING, MUTATOR PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 16  ? ASN A 26  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  ASN A 53  ? LYS A 58  ? ASN A 47  LYS A 52  1 ? 6  
HELX_P HELX_P3  3  PRO A 66  ? LEU A 74  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P4  4  ARG A 83  ? ARG A 99  ? ARG A 77  ARG A 93  1 ? 17 
HELX_P HELX_P5  5  TYR A 128 ? LYS A 143 ? TYR A 122 LYS A 137 1 ? 16 
HELX_P HELX_P6  6  ASN A 153 ? LYS A 165 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P7  7  GLU A 175 ? LEU A 184 ? GLU A 169 LEU A 178 1 ? 10 
HELX_P HELX_P8  8  ILE A 186 ? VAL A 189 ? ILE A 180 VAL A 183 5 ? 4  
HELX_P HELX_P9  9  GLY A 193 ? GLY A 204 ? GLY A 187 GLY A 198 1 ? 12 
HELX_P HELX_P10 10 LEU A 208 ? SER A 213 ? LEU A 202 SER A 207 5 ? 6  
HELX_P HELX_P11 11 GLU A 215 ? ILE A 223 ? GLU A 209 ILE A 217 1 ? 9  
HELX_P HELX_P12 12 GLY A 224 ? ARG A 236 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P13 13 ASN A 263 ? ASP A 283 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P14 14 SER A 313 ? ASP A 332 ? SER A 307 ASP A 326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E CA  .  CA    ? ? ? 1_555 A ASP 13  OD2 ? ? A CA  1343 A ASP 7    1_555 ? ? ? ? ? ? ?            2.667 ? 
metalc2  metalc ? ? E CA  .  CA    ? ? ? 1_555 F CA  .   CA  ? ? A CA  1343 A CA  1344 1_555 ? ? ? ? ? ? ?            3.110 ? 
metalc3  metalc ? ? E CA  .  CA    ? ? ? 1_555 D DCT .   O1A ? ? A CA  1343 A DCT 1342 1_555 ? ? ? ? ? ? ?            3.009 ? 
metalc4  metalc ? ? E CA  .  CA    ? ? ? 1_555 B DOC 14  OP2 ? ? A CA  1343 P DOC 14   1_555 ? ? ? ? ? ? ?            2.588 ? 
metalc5  metalc ? ? E CA  .  CA    ? ? ? 1_555 A ASP 111 OD1 ? ? A CA  1343 A ASP 105  1_555 ? ? ? ? ? ? ?            2.789 ? 
metalc6  metalc ? ? E CA  .  CA    ? ? ? 1_555 A ASP 111 OD2 ? ? A CA  1343 A ASP 105  1_555 ? ? ? ? ? ? ?            2.644 ? 
metalc7  metalc ? ? E CA  .  CA    ? ? ? 1_555 A GLU 112 OE2 ? ? A CA  1343 A GLU 106  1_555 ? ? ? ? ? ? ?            2.372 ? 
metalc8  metalc ? ? F CA  .  CA    ? ? ? 1_555 A PHE 14  O   ? ? A CA  1344 A PHE 8    1_555 ? ? ? ? ? ? ?            2.399 ? 
metalc9  metalc ? ? F CA  .  CA    ? ? ? 1_555 A ASP 111 OD2 ? ? A CA  1344 A ASP 105  1_555 ? ? ? ? ? ? ?            2.304 ? 
metalc10 metalc ? ? F CA  .  CA    ? ? ? 1_555 A ASP 13  OD1 ? ? A CA  1344 A ASP 7    1_555 ? ? ? ? ? ? ?            2.838 ? 
metalc11 metalc ? ? F CA  .  CA    ? ? ? 1_555 D DCT .   O3A ? ? A CA  1344 A DCT 1342 1_555 ? ? ? ? ? ? ?            3.137 ? 
metalc12 metalc ? ? F CA  .  CA    ? ? ? 1_555 D DCT .   O2G ? ? A CA  1344 A DCT 1342 1_555 ? ? ? ? ? ? ?            2.145 ? 
metalc13 metalc ? ? G CA  .  CA    ? ? ? 1_555 A ALA 187 O   ? ? A CA  1345 A ALA 181  1_555 ? ? ? ? ? ? ?            2.546 ? 
metalc14 metalc ? ? G CA  .  CA    ? ? ? 1_555 A ILE 192 O   ? ? A CA  1345 A ILE 186  1_555 ? ? ? ? ? ? ?            2.493 ? 
metalc15 metalc ? ? G CA  .  CA    ? ? ? 1_555 J HOH .   O   ? ? A CA  1345 P HOH 2019 1_555 ? ? ? ? ? ? ?            3.123 ? 
metalc16 metalc ? ? H CA  .  CA    ? ? ? 1_555 I HOH .   O   ? ? A CA  1346 A HOH 2067 1_555 ? ? ? ? ? ? ?            2.806 ? 
metalc17 metalc ? ? H CA  .  CA    ? ? ? 1_555 D DCT .   O1A ? ? A CA  1346 A DCT 1342 1_555 ? ? ? ? ? ? ?            3.105 ? 
metalc18 metalc ? ? H CA  .  CA    ? ? ? 1_555 B DOC 14  OP1 ? ? A CA  1346 P DOC 14   1_555 ? ? ? ? ? ? ?            2.502 ? 
covale1  covale ? ? B DC  13 "O3'" ? ? ? 1_555 B DOC 14  P   ? ? P DC  13   P DOC 14   1_555 ? ? ? ? ? ? ?            1.610 ? 
covale2  covale ? ? C DC  4  "O3'" ? ? ? 1_555 C 8OG 5   P   ? ? T DC  4    T 8OG 5    1_555 ? ? ? ? ? ? ?            1.615 ? 
covale3  covale ? ? C 8OG 5  "O3'" ? ? ? 1_555 C DG  6   P   ? ? T 8OG 5    T DG  6    1_555 ? ? ? ? ? ? ?            1.594 ? 
hydrog1  hydrog ? ? B DG  1  N1    ? ? ? 1_555 C DC  18  N3  ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  1  N2    ? ? ? 1_555 C DC  18  O2  ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  1  O6    ? ? ? 1_555 C DC  18  N4  ? ? P DG  1    T DC  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2  N1    ? ? ? 1_555 C DC  17  N3  ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2  N2    ? ? ? 1_555 C DC  17  O2  ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2  O6    ? ? ? 1_555 C DC  17  N4  ? ? P DG  2    T DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3  N1    ? ? ? 1_555 C DC  16  N3  ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3  N2    ? ? ? 1_555 C DC  16  O2  ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  3  O6    ? ? ? 1_555 C DC  16  N4  ? ? P DG  3    T DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  4  N1    ? ? ? 1_555 C DC  15  N3  ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  4  N2    ? ? ? 1_555 C DC  15  O2  ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  4  O6    ? ? ? 1_555 C DC  15  N4  ? ? P DG  4    T DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  5  N1    ? ? ? 1_555 C DC  14  N3  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  5  N2    ? ? ? 1_555 C DC  14  O2  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  5  O6    ? ? ? 1_555 C DC  14  N4  ? ? P DG  5    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  6  N1    ? ? ? 1_555 C DT  13  N3  ? ? P DA  6    T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DA  6  N6    ? ? ? 1_555 C DT  13  O4  ? ? P DA  6    T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DA  7  N1    ? ? ? 1_555 C DT  12  N3  ? ? P DA  7    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DA  7  N6    ? ? ? 1_555 C DT  12  O4  ? ? P DA  7    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  8  N1    ? ? ? 1_555 C DC  11  N3  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  8  N2    ? ? ? 1_555 C DC  11  O2  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  8  O6    ? ? ? 1_555 C DC  11  N4  ? ? P DG  8    T DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DG  9  N1    ? ? ? 1_555 C DC  10  N3  ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DG  9  N2    ? ? ? 1_555 C DC  10  O2  ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  9  O6    ? ? ? 1_555 C DC  10  N4  ? ? P DG  9    T DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DA  10 N1    ? ? ? 1_555 C DT  9   N3  ? ? P DA  10   T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DA  10 N6    ? ? ? 1_555 C DT  9   O4  ? ? P DA  10   T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DT  11 N3    ? ? ? 1_555 C DA  8   N1  ? ? P DT  11   T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DT  11 O4    ? ? ? 1_555 C DA  8   N6  ? ? P DT  11   T DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DT  12 N3    ? ? ? 1_555 C DA  7   N1  ? ? P DT  12   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DT  12 O4    ? ? ? 1_555 C DA  7   N6  ? ? P DT  12   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DC  13 N3    ? ? ? 1_555 C DG  6   N1  ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DC  13 N4    ? ? ? 1_555 C DG  6   O6  ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DC  13 O2    ? ? ? 1_555 C DG  6   N2  ? ? P DC  13   T DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LYS 
_struct_mon_prot_cis.label_seq_id           165 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LYS 
_struct_mon_prot_cis.auth_seq_id            159 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    166 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     160 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
AC ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ILE A 105 ? SER A 109 ? ILE A 99  SER A 103 
AA 2 GLU A 112 ? ASP A 116 ? GLU A 106 ASP A 110 
AA 3 VAL A 9   ? PHE A 14  ? VAL A 3   PHE A 8   
AA 4 VAL A 146 ? SER A 151 ? VAL A 140 SER A 145 
AA 5 ILE A 169 ? VAL A 171 ? ILE A 163 VAL A 165 
AB 1 GLY A 47  ? ALA A 52  ? GLY A 41  ALA A 46  
AB 2 VAL A 34  ? PHE A 39  ? VAL A 28  PHE A 33  
AB 3 VAL A 78  ? PRO A 81  ? VAL A 72  PRO A 75  
AC 1 SER A 250 ? SER A 261 ? SER A 244 SER A 255 
AC 2 ILE A 336 ? PHE A 346 ? ILE A 330 PHE A 340 
AC 3 PRO A 287 ? THR A 296 ? PRO A 281 THR A 290 
AC 4 ILE A 301 ? THR A 307 ? ILE A 295 THR A 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N SER A 109 ? N SER A 103 O GLU A 112 ? O GLU A 106 
AA 2 3 N LEU A 115 ? N LEU A 109 O LEU A 10  ? O LEU A 4   
AA 3 4 N ASP A 13  ? N ASP A 7   O THR A 147 ? O THR A 141 
AA 4 5 N ILE A 150 ? N ILE A 144 O LYS A 170 ? O LYS A 164 
AB 1 2 N ALA A 50  ? N ALA A 44  O VAL A 36  ? O VAL A 30  
AB 2 3 N VAL A 35  ? N VAL A 29  O VAL A 78  ? O VAL A 72  
AC 1 2 N SER A 261 ? N SER A 255 O ILE A 336 ? O ILE A 330 
AC 2 3 O SER A 344 ? O SER A 338 N LYS A 288 ? N LYS A 282 
AC 3 4 N ALA A 294 ? N ALA A 288 O VAL A 302 ? O VAL A 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A1343'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A1344'  
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE CA A1345'  
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE CA A1346'  
AC5 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE DCT A1342' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASP A 13  ? ASP A 7    . ? 1_555 ? 
2  AC1 6  ASP A 111 ? ASP A 105  . ? 1_555 ? 
3  AC1 6  GLU A 112 ? GLU A 106  . ? 1_555 ? 
4  AC1 6  DCT D .   ? DCT A 1342 . ? 1_555 ? 
5  AC1 6  CA  F .   ? CA  A 1344 . ? 1_555 ? 
6  AC1 6  DOC B 14  ? DOC P 14   . ? 1_555 ? 
7  AC2 5  ASP A 13  ? ASP A 7    . ? 1_555 ? 
8  AC2 5  PHE A 14  ? PHE A 8    . ? 1_555 ? 
9  AC2 5  ASP A 111 ? ASP A 105  . ? 1_555 ? 
10 AC2 5  DCT D .   ? DCT A 1342 . ? 1_555 ? 
11 AC2 5  CA  E .   ? CA  A 1343 . ? 1_555 ? 
12 AC3 2  ALA A 187 ? ALA A 181  . ? 1_555 ? 
13 AC3 2  ILE A 192 ? ILE A 186  . ? 1_555 ? 
14 AC4 3  DCT D .   ? DCT A 1342 . ? 1_555 ? 
15 AC4 3  HOH I .   ? HOH A 2067 . ? 1_555 ? 
16 AC4 3  DOC B 14  ? DOC P 14   . ? 1_555 ? 
17 AC5 21 ASP A 13  ? ASP A 7    . ? 1_555 ? 
18 AC5 21 PHE A 14  ? PHE A 8    . ? 1_555 ? 
19 AC5 21 ASP A 15  ? ASP A 9    . ? 1_555 ? 
20 AC5 21 TYR A 16  ? TYR A 10   . ? 1_555 ? 
21 AC5 21 TYR A 18  ? TYR A 12   . ? 1_555 ? 
22 AC5 21 ALA A 50  ? ALA A 44   . ? 1_555 ? 
23 AC5 21 TYR A 54  ? TYR A 48   . ? 1_555 ? 
24 AC5 21 ARG A 57  ? ARG A 51   . ? 1_555 ? 
25 AC5 21 ALA A 63  ? ALA A 57   . ? 1_555 ? 
26 AC5 21 GLY A 64  ? GLY A 58   . ? 1_555 ? 
27 AC5 21 LYS A 165 ? LYS A 159  . ? 1_555 ? 
28 AC5 21 CA  E .   ? CA  A 1343 . ? 1_555 ? 
29 AC5 21 CA  F .   ? CA  A 1344 . ? 1_555 ? 
30 AC5 21 CA  H .   ? CA  A 1346 . ? 1_555 ? 
31 AC5 21 HOH I .   ? HOH A 2065 . ? 1_555 ? 
32 AC5 21 HOH I .   ? HOH A 2066 . ? 1_555 ? 
33 AC5 21 HOH I .   ? HOH A 2067 . ? 1_555 ? 
34 AC5 21 DC  B 13  ? DC  P 13   . ? 1_555 ? 
35 AC5 21 DOC B 14  ? DOC P 14   . ? 1_555 ? 
36 AC5 21 8OG C 5   ? 8OG T 5    . ? 1_555 ? 
37 AC5 21 DG  C 6   ? DG  T 6    . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2C2R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2C2R 
_atom_sites.fract_transf_matrix[1][1]   0.010504 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009985 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019231 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 7   ? -48.210 -17.567 14.612  1.00   70.66 ? 1    MET A N     1 
ATOM   2    C  CA    . MET A 1 7   ? -46.895 -16.911 14.869  1.00   70.30 ? 1    MET A CA    1 
ATOM   3    C  C     . MET A 1 7   ? -46.192 -16.476 13.585  1.00   69.80 ? 1    MET A C     1 
ATOM   4    O  O     . MET A 1 7   ? -46.123 -17.232 12.613  1.00   69.72 ? 1    MET A O     1 
ATOM   5    C  CB    . MET A 1 7   ? -45.975 -17.853 15.649  1.00   71.74 ? 1    MET A CB    1 
ATOM   6    C  CG    . MET A 1 7   ? -44.578 -17.285 15.899  1.00   73.79 ? 1    MET A CG    1 
ATOM   7    S  SD    . MET A 1 7   ? -43.571 -18.292 17.019  1.00   77.55 ? 1    MET A SD    1 
ATOM   8    C  CE    . MET A 1 7   ? -42.193 -18.779 15.954  1.00   77.40 ? 1    MET A CE    1 
ATOM   9    N  N     . ILE A 1 8   ? -45.675 -15.249 13.590  1.00   68.44 ? 2    ILE A N     1 
ATOM   10   C  CA    . ILE A 1 8   ? -44.964 -14.712 12.438  1.00   67.22 ? 2    ILE A CA    1 
ATOM   11   C  C     . ILE A 1 8   ? -43.651 -14.055 12.859  1.00   65.62 ? 2    ILE A C     1 
ATOM   12   O  O     . ILE A 1 8   ? -43.638 -13.085 13.620  1.00   65.18 ? 2    ILE A O     1 
ATOM   13   C  CB    . ILE A 1 8   ? -45.831 -13.694 11.656  1.00   67.51 ? 2    ILE A CB    1 
ATOM   14   C  CG1   . ILE A 1 8   ? -47.049 -14.413 11.067  1.00   68.05 ? 2    ILE A CG1   1 
ATOM   15   C  CG2   . ILE A 1 8   ? -45.007 -13.054 10.536  1.00   66.34 ? 2    ILE A CG2   1 
ATOM   16   C  CD1   . ILE A 1 8   ? -47.891 -13.564 10.136  1.00   68.60 ? 2    ILE A CD1   1 
ATOM   17   N  N     . VAL A 1 9   ? -42.548 -14.606 12.353  1.00   63.73 ? 3    VAL A N     1 
ATOM   18   C  CA    . VAL A 1 9   ? -41.210 -14.116 12.667  1.00   60.65 ? 3    VAL A CA    1 
ATOM   19   C  C     . VAL A 1 9   ? -40.592 -13.308 11.519  1.00   59.81 ? 3    VAL A C     1 
ATOM   20   O  O     . VAL A 1 9   ? -40.611 -13.730 10.357  1.00   59.14 ? 3    VAL A O     1 
ATOM   21   C  CB    . VAL A 1 9   ? -40.269 -15.292 13.034  1.00   58.96 ? 3    VAL A CB    1 
ATOM   22   C  CG1   . VAL A 1 9   ? -38.851 -14.779 13.264  1.00   57.56 ? 3    VAL A CG1   1 
ATOM   23   C  CG2   . VAL A 1 9   ? -40.791 -15.997 14.274  1.00   55.70 ? 3    VAL A CG2   1 
ATOM   24   N  N     . LEU A 1 10  ? -40.056 -12.140 11.868  1.00   58.47 ? 4    LEU A N     1 
ATOM   25   C  CA    . LEU A 1 10  ? -39.422 -11.230 10.914  1.00   58.01 ? 4    LEU A CA    1 
ATOM   26   C  C     . LEU A 1 10  ? -37.924 -11.176 11.221  1.00   57.53 ? 4    LEU A C     1 
ATOM   27   O  O     . LEU A 1 10  ? -37.512 -10.749 12.314  1.00   56.48 ? 4    LEU A O     1 
ATOM   28   C  CB    . LEU A 1 10  ? -40.036 -9.832  11.044  1.00   58.13 ? 4    LEU A CB    1 
ATOM   29   C  CG    . LEU A 1 10  ? -39.948 -8.879  9.847   1.00   58.59 ? 4    LEU A CG    1 
ATOM   30   C  CD1   . LEU A 1 10  ? -40.918 -7.726  10.037  1.00   58.53 ? 4    LEU A CD1   1 
ATOM   31   C  CD2   . LEU A 1 10  ? -38.534 -8.369  9.691   1.00   59.34 ? 4    LEU A CD2   1 
ATOM   32   N  N     . PHE A 1 11  ? -37.119 -11.616 10.250  1.00   55.83 ? 5    PHE A N     1 
ATOM   33   C  CA    . PHE A 1 11  ? -35.664 -11.664 10.391  1.00   53.40 ? 5    PHE A CA    1 
ATOM   34   C  C     . PHE A 1 11  ? -34.997 -10.531 9.618   1.00   53.73 ? 5    PHE A C     1 
ATOM   35   O  O     . PHE A 1 11  ? -35.394 -10.227 8.483   1.00   53.63 ? 5    PHE A O     1 
ATOM   36   C  CB    . PHE A 1 11  ? -35.162 -13.011 9.866   1.00   51.49 ? 5    PHE A CB    1 
ATOM   37   C  CG    . PHE A 1 11  ? -33.661 -13.131 9.804   1.00   51.07 ? 5    PHE A CG    1 
ATOM   38   C  CD1   . PHE A 1 11  ? -32.906 -13.154 10.965  1.00   49.73 ? 5    PHE A CD1   1 
ATOM   39   C  CD2   . PHE A 1 11  ? -33.008 -13.262 8.571   1.00   50.78 ? 5    PHE A CD2   1 
ATOM   40   C  CE1   . PHE A 1 11  ? -31.521 -13.313 10.912  1.00   51.22 ? 5    PHE A CE1   1 
ATOM   41   C  CE2   . PHE A 1 11  ? -31.628 -13.421 8.496   1.00   50.21 ? 5    PHE A CE2   1 
ATOM   42   C  CZ    . PHE A 1 11  ? -30.874 -13.449 9.674   1.00   51.72 ? 5    PHE A CZ    1 
ATOM   43   N  N     . VAL A 1 12  ? -33.989 -9.911  10.235  1.00   51.63 ? 6    VAL A N     1 
ATOM   44   C  CA    . VAL A 1 12  ? -33.249 -8.830  9.598   1.00   50.92 ? 6    VAL A CA    1 
ATOM   45   C  C     . VAL A 1 12  ? -31.739 -9.111  9.554   1.00   49.84 ? 6    VAL A C     1 
ATOM   46   O  O     . VAL A 1 12  ? -31.107 -9.428  10.563  1.00   49.36 ? 6    VAL A O     1 
ATOM   47   C  CB    . VAL A 1 12  ? -33.464 -7.499  10.327  1.00   51.84 ? 6    VAL A CB    1 
ATOM   48   C  CG1   . VAL A 1 12  ? -32.916 -6.338  9.469   1.00   50.24 ? 6    VAL A CG1   1 
ATOM   49   C  CG2   . VAL A 1 12  ? -34.932 -7.314  10.620  1.00   53.67 ? 6    VAL A CG2   1 
ATOM   50   N  N     . ASP A 1 13  ? -31.156 -8.958  8.378   1.00   47.49 ? 7    ASP A N     1 
ATOM   51   C  CA    . ASP A 1 13  ? -29.740 -9.203  8.222   1.00   44.97 ? 7    ASP A CA    1 
ATOM   52   C  C     . ASP A 1 13  ? -29.039 -8.053  7.498   1.00   42.34 ? 7    ASP A C     1 
ATOM   53   O  O     . ASP A 1 13  ? -29.349 -7.748  6.350   1.00   40.66 ? 7    ASP A O     1 
ATOM   54   C  CB    . ASP A 1 13  ? -29.560 -10.493 7.444   1.00   47.75 ? 7    ASP A CB    1 
ATOM   55   C  CG    . ASP A 1 13  ? -28.116 -10.744 7.051   1.00   49.01 ? 7    ASP A CG    1 
ATOM   56   O  OD1   . ASP A 1 13  ? -27.545 -10.015 6.219   1.00   49.17 ? 7    ASP A OD1   1 
ATOM   57   O  OD2   . ASP A 1 13  ? -27.537 -11.695 7.581   1.00   51.89 ? 7    ASP A OD2   1 
ATOM   58   N  N     . PHE A 1 14  ? -28.090 -7.411  8.167   1.00   38.37 ? 8    PHE A N     1 
ATOM   59   C  CA    . PHE A 1 14  ? -27.372 -6.313  7.535   1.00   35.04 ? 8    PHE A CA    1 
ATOM   60   C  C     . PHE A 1 14  ? -26.530 -6.900  6.411   1.00   34.05 ? 8    PHE A C     1 
ATOM   61   O  O     . PHE A 1 14  ? -25.862 -7.875  6.604   1.00   30.29 ? 8    PHE A O     1 
ATOM   62   C  CB    . PHE A 1 14  ? -26.484 -5.605  8.554   1.00   34.28 ? 8    PHE A CB    1 
ATOM   63   C  CG    . PHE A 1 14  ? -27.180 -5.303  9.851   1.00   34.23 ? 8    PHE A CG    1 
ATOM   64   C  CD1   . PHE A 1 14  ? -28.575 -5.228  9.915   1.00   32.20 ? 8    PHE A CD1   1 
ATOM   65   C  CD2   . PHE A 1 14  ? -26.442 -5.060  11.004  1.00   32.74 ? 8    PHE A CD2   1 
ATOM   66   C  CE1   . PHE A 1 14  ? -29.219 -4.915  11.102  1.00   31.31 ? 8    PHE A CE1   1 
ATOM   67   C  CE2   . PHE A 1 14  ? -27.080 -4.742  12.203  1.00   33.60 ? 8    PHE A CE2   1 
ATOM   68   C  CZ    . PHE A 1 14  ? -28.477 -4.671  12.245  1.00   32.34 ? 8    PHE A CZ    1 
ATOM   69   N  N     . ASP A 1 15  ? -26.589 -6.312  5.226   1.00   35.13 ? 9    ASP A N     1 
ATOM   70   C  CA    . ASP A 1 15  ? -25.839 -6.813  4.088   1.00   36.30 ? 9    ASP A CA    1 
ATOM   71   C  C     . ASP A 1 15  ? -24.354 -6.498  4.253   1.00   36.40 ? 9    ASP A C     1 
ATOM   72   O  O     . ASP A 1 15  ? -24.006 -5.439  4.768   1.00   36.90 ? 9    ASP A O     1 
ATOM   73   C  CB    . ASP A 1 15  ? -26.391 -6.184  2.804   1.00   41.14 ? 9    ASP A CB    1 
ATOM   74   C  CG    . ASP A 1 15  ? -27.839 -6.614  2.505   1.00   45.73 ? 9    ASP A CG    1 
ATOM   75   O  OD1   . ASP A 1 15  ? -28.079 -7.823  2.293   1.00   49.21 ? 9    ASP A OD1   1 
ATOM   76   O  OD2   . ASP A 1 15  ? -28.743 -5.747  2.473   1.00   48.09 ? 9    ASP A OD2   1 
ATOM   77   N  N     . TYR A 1 16  ? -23.496 -7.410  3.793   1.00   35.05 ? 10   TYR A N     1 
ATOM   78   C  CA    . TYR A 1 16  ? -22.044 -7.288  3.907   1.00   35.02 ? 10   TYR A CA    1 
ATOM   79   C  C     . TYR A 1 16  ? -21.662 -6.252  4.954   1.00   35.68 ? 10   TYR A C     1 
ATOM   80   O  O     . TYR A 1 16  ? -20.809 -5.393  4.738   1.00   35.34 ? 10   TYR A O     1 
ATOM   81   C  CB    . TYR A 1 16  ? -21.419 -6.967  2.539   1.00   39.10 ? 10   TYR A CB    1 
ATOM   82   C  CG    . TYR A 1 16  ? -21.766 -5.616  1.948   1.00   41.11 ? 10   TYR A CG    1 
ATOM   83   C  CD1   . TYR A 1 16  ? -20.755 -4.731  1.564   1.00   40.93 ? 10   TYR A CD1   1 
ATOM   84   C  CD2   . TYR A 1 16  ? -23.094 -5.237  1.739   1.00   41.12 ? 10   TYR A CD2   1 
ATOM   85   C  CE1   . TYR A 1 16  ? -21.047 -3.505  0.986   1.00   42.09 ? 10   TYR A CE1   1 
ATOM   86   C  CE2   . TYR A 1 16  ? -23.404 -4.009  1.161   1.00   43.17 ? 10   TYR A CE2   1 
ATOM   87   C  CZ    . TYR A 1 16  ? -22.375 -3.142  0.785   1.00   44.38 ? 10   TYR A CZ    1 
ATOM   88   O  OH    . TYR A 1 16  ? -22.677 -1.910  0.216   1.00   45.85 ? 10   TYR A OH    1 
ATOM   89   N  N     . PHE A 1 17  ? -22.291 -6.390  6.115   1.00   35.16 ? 11   PHE A N     1 
ATOM   90   C  CA    . PHE A 1 17  ? -22.137 -5.472  7.229   1.00   35.25 ? 11   PHE A CA    1 
ATOM   91   C  C     . PHE A 1 17  ? -20.815 -4.763  7.489   1.00   35.97 ? 11   PHE A C     1 
ATOM   92   O  O     . PHE A 1 17  ? -20.731 -3.544  7.306   1.00   37.88 ? 11   PHE A O     1 
ATOM   93   C  CB    . PHE A 1 17  ? -22.608 -6.154  8.509   1.00   35.80 ? 11   PHE A CB    1 
ATOM   94   C  CG    . PHE A 1 17  ? -22.849 -5.205  9.651   1.00   35.75 ? 11   PHE A CG    1 
ATOM   95   C  CD1   . PHE A 1 17  ? -23.379 -3.932  9.428   1.00   38.02 ? 11   PHE A CD1   1 
ATOM   96   C  CD2   . PHE A 1 17  ? -22.569 -5.579  10.949  1.00   33.39 ? 11   PHE A CD2   1 
ATOM   97   C  CE1   . PHE A 1 17  ? -23.621 -3.050  10.502  1.00   34.36 ? 11   PHE A CE1   1 
ATOM   98   C  CE2   . PHE A 1 17  ? -22.808 -4.705  12.011  1.00   33.80 ? 11   PHE A CE2   1 
ATOM   99   C  CZ    . PHE A 1 17  ? -23.331 -3.447  11.788  1.00   33.64 ? 11   PHE A CZ    1 
ATOM   100  N  N     . TYR A 1 18  ? -19.785 -5.483  7.927   1.00   35.05 ? 12   TYR A N     1 
ATOM   101  C  CA    . TYR A 1 18  ? -18.511 -4.807  8.233   1.00   33.56 ? 12   TYR A CA    1 
ATOM   102  C  C     . TYR A 1 18  ? -18.024 -3.957  7.074   1.00   33.55 ? 12   TYR A C     1 
ATOM   103  O  O     . TYR A 1 18  ? -17.549 -2.839  7.260   1.00   33.41 ? 12   TYR A O     1 
ATOM   104  C  CB    . TYR A 1 18  ? -17.400 -5.808  8.630   1.00   33.28 ? 12   TYR A CB    1 
ATOM   105  C  CG    . TYR A 1 18  ? -17.795 -6.739  9.748   1.00   32.00 ? 12   TYR A CG    1 
ATOM   106  C  CD1   . TYR A 1 18  ? -18.950 -6.506  10.482  1.00   31.91 ? 12   TYR A CD1   1 
ATOM   107  C  CD2   . TYR A 1 18  ? -17.074 -7.889  10.014  1.00   31.41 ? 12   TYR A CD2   1 
ATOM   108  C  CE1   . TYR A 1 18  ? -19.388 -7.389  11.432  1.00   34.23 ? 12   TYR A CE1   1 
ATOM   109  C  CE2   . TYR A 1 18  ? -17.514 -8.803  10.985  1.00   34.34 ? 12   TYR A CE2   1 
ATOM   110  C  CZ    . TYR A 1 18  ? -18.683 -8.543  11.684  1.00   33.36 ? 12   TYR A CZ    1 
ATOM   111  O  OH    . TYR A 1 18  ? -19.199 -9.452  12.581  1.00   33.04 ? 12   TYR A OH    1 
ATOM   112  N  N     . ALA A 1 19  ? -18.156 -4.494  5.872   1.00   34.41 ? 13   ALA A N     1 
ATOM   113  C  CA    . ALA A 1 19  ? -17.709 -3.806  4.686   1.00   35.63 ? 13   ALA A CA    1 
ATOM   114  C  C     . ALA A 1 19  ? -18.605 -2.622  4.359   1.00   37.61 ? 13   ALA A C     1 
ATOM   115  O  O     . ALA A 1 19  ? -18.106 -1.528  4.075   1.00   40.93 ? 13   ALA A O     1 
ATOM   116  C  CB    . ALA A 1 19  ? -17.663 -4.774  3.542   1.00   35.65 ? 13   ALA A CB    1 
ATOM   117  N  N     . GLN A 1 20  ? -19.922 -2.821  4.400   1.00   37.31 ? 14   GLN A N     1 
ATOM   118  C  CA    . GLN A 1 20  ? -20.843 -1.737  4.116   1.00   35.82 ? 14   GLN A CA    1 
ATOM   119  C  C     . GLN A 1 20  ? -20.609 -0.631  5.139   1.00   38.57 ? 14   GLN A C     1 
ATOM   120  O  O     . GLN A 1 20  ? -20.510 0.519   4.767   1.00   43.13 ? 14   GLN A O     1 
ATOM   121  C  CB    . GLN A 1 20  ? -22.278 -2.233  4.192   1.00   35.08 ? 14   GLN A CB    1 
ATOM   122  C  CG    . GLN A 1 20  ? -23.324 -1.232  3.735   1.00   33.51 ? 14   GLN A CG    1 
ATOM   123  C  CD    . GLN A 1 20  ? -24.739 -1.794  3.826   1.00   36.10 ? 14   GLN A CD    1 
ATOM   124  O  OE1   . GLN A 1 20  ? -25.715 -1.148  3.429   1.00   34.94 ? 14   GLN A OE1   1 
ATOM   125  N  NE2   . GLN A 1 20  ? -24.854 -3.001  4.373   1.00   35.62 ? 14   GLN A NE2   1 
ATOM   126  N  N     . VAL A 1 21  ? -20.511 -0.951  6.425   1.00   38.09 ? 15   VAL A N     1 
ATOM   127  C  CA    . VAL A 1 21  ? -20.251 0.099   7.409   1.00   39.08 ? 15   VAL A CA    1 
ATOM   128  C  C     . VAL A 1 21  ? -19.076 0.977   6.973   1.00   39.65 ? 15   VAL A C     1 
ATOM   129  O  O     . VAL A 1 21  ? -19.149 2.201   7.073   1.00   39.45 ? 15   VAL A O     1 
ATOM   130  C  CB    . VAL A 1 21  ? -19.916 -0.474  8.802   1.00   39.74 ? 15   VAL A CB    1 
ATOM   131  C  CG1   . VAL A 1 21  ? -19.469 0.640   9.731   1.00   38.08 ? 15   VAL A CG1   1 
ATOM   132  C  CG2   . VAL A 1 21  ? -21.113 -1.162  9.381   1.00   41.34 ? 15   VAL A CG2   1 
ATOM   133  N  N     . GLU A 1 22  ? -17.994 0.355   6.504   1.00   40.71 ? 16   GLU A N     1 
ATOM   134  C  CA    . GLU A 1 22  ? -16.822 1.094   6.044   1.00   43.63 ? 16   GLU A CA    1 
ATOM   135  C  C     . GLU A 1 22  ? -17.195 2.017   4.868   1.00   45.64 ? 16   GLU A C     1 
ATOM   136  O  O     . GLU A 1 22  ? -16.763 3.175   4.819   1.00   44.99 ? 16   GLU A O     1 
ATOM   137  C  CB    . GLU A 1 22  ? -15.712 0.130   5.607   1.00   44.43 ? 16   GLU A CB    1 
ATOM   138  C  CG    . GLU A 1 22  ? -15.077 -0.698  6.727   1.00   47.25 ? 16   GLU A CG    1 
ATOM   139  C  CD    . GLU A 1 22  ? -14.094 0.082   7.618   1.00   49.44 ? 16   GLU A CD    1 
ATOM   140  O  OE1   . GLU A 1 22  ? -13.806 1.260   7.320   1.00   50.22 ? 16   GLU A OE1   1 
ATOM   141  O  OE2   . GLU A 1 22  ? -13.603 -0.493  8.624   1.00   49.98 ? 16   GLU A OE2   1 
ATOM   142  N  N     . GLU A 1 23  ? -17.979 1.496   3.916   1.00   46.60 ? 17   GLU A N     1 
ATOM   143  C  CA    . GLU A 1 23  ? -18.432 2.286   2.760   1.00   45.74 ? 17   GLU A CA    1 
ATOM   144  C  C     . GLU A 1 23  ? -19.295 3.467   3.215   1.00   44.90 ? 17   GLU A C     1 
ATOM   145  O  O     . GLU A 1 23  ? -19.443 4.444   2.496   1.00   47.96 ? 17   GLU A O     1 
ATOM   146  C  CB    . GLU A 1 23  ? -19.283 1.449   1.807   1.00   46.18 ? 17   GLU A CB    1 
ATOM   147  C  CG    . GLU A 1 23  ? -18.618 0.252   1.199   1.00   47.33 ? 17   GLU A CG    1 
ATOM   148  C  CD    . GLU A 1 23  ? -19.526 -0.433  0.208   1.00   46.63 ? 17   GLU A CD    1 
ATOM   149  O  OE1   . GLU A 1 23  ? -20.723 -0.571  0.513   1.00   43.97 ? 17   GLU A OE1   1 
ATOM   150  O  OE2   . GLU A 1 23  ? -19.044 -0.835  -0.870  1.00   50.60 ? 17   GLU A OE2   1 
ATOM   151  N  N     . VAL A 1 24  ? -19.888 3.361   4.392   1.00   41.76 ? 18   VAL A N     1 
ATOM   152  C  CA    . VAL A 1 24  ? -20.711 4.436   4.920   1.00   41.69 ? 18   VAL A CA    1 
ATOM   153  C  C     . VAL A 1 24  ? -19.832 5.473   5.613   1.00   42.41 ? 18   VAL A C     1 
ATOM   154  O  O     . VAL A 1 24  ? -20.153 6.658   5.642   1.00   42.74 ? 18   VAL A O     1 
ATOM   155  C  CB    . VAL A 1 24  ? -21.750 3.892   5.916   1.00   40.10 ? 18   VAL A CB    1 
ATOM   156  C  CG1   . VAL A 1 24  ? -22.357 5.021   6.707   1.00   37.79 ? 18   VAL A CG1   1 
ATOM   157  C  CG2   . VAL A 1 24  ? -22.817 3.131   5.155   1.00   37.61 ? 18   VAL A CG2   1 
ATOM   158  N  N     . LEU A 1 25  ? -18.727 5.013   6.183   1.00   44.23 ? 19   LEU A N     1 
ATOM   159  C  CA    . LEU A 1 25  ? -17.775 5.899   6.854   1.00   44.44 ? 19   LEU A CA    1 
ATOM   160  C  C     . LEU A 1 25  ? -16.883 6.648   5.842   1.00   44.65 ? 19   LEU A C     1 
ATOM   161  O  O     . LEU A 1 25  ? -16.321 7.702   6.139   1.00   45.05 ? 19   LEU A O     1 
ATOM   162  C  CB    . LEU A 1 25  ? -16.902 5.085   7.815   1.00   41.61 ? 19   LEU A CB    1 
ATOM   163  C  CG    . LEU A 1 25  ? -17.293 5.140   9.291   1.00   40.05 ? 19   LEU A CG    1 
ATOM   164  C  CD1   . LEU A 1 25  ? -18.764 4.813   9.453   1.00   40.56 ? 19   LEU A CD1   1 
ATOM   165  C  CD2   . LEU A 1 25  ? -16.424 4.185   10.065  1.00   37.58 ? 19   LEU A CD2   1 
ATOM   166  N  N     . ASN A 1 26  ? -16.750 6.077   4.650   1.00   45.52 ? 20   ASN A N     1 
ATOM   167  C  CA    . ASN A 1 26  ? -15.950 6.654   3.576   1.00   44.91 ? 20   ASN A CA    1 
ATOM   168  C  C     . ASN A 1 26  ? -16.719 6.287   2.331   1.00   45.22 ? 20   ASN A C     1 
ATOM   169  O  O     . ASN A 1 26  ? -16.421 5.294   1.663   1.00   46.36 ? 20   ASN A O     1 
ATOM   170  C  CB    . ASN A 1 26  ? -14.562 6.021   3.521   1.00   44.44 ? 20   ASN A CB    1 
ATOM   171  C  CG    . ASN A 1 26  ? -13.730 6.548   2.362   1.00   45.16 ? 20   ASN A CG    1 
ATOM   172  O  OD1   . ASN A 1 26  ? -14.255 6.797   1.278   1.00   46.34 ? 20   ASN A OD1   1 
ATOM   173  N  ND2   . ASN A 1 26  ? -12.422 6.707   2.580   1.00   45.23 ? 20   ASN A ND2   1 
ATOM   174  N  N     . PRO A 1 27  ? -17.741 7.080   2.006   1.00   44.98 ? 21   PRO A N     1 
ATOM   175  C  CA    . PRO A 1 27  ? -18.562 6.817   0.822   1.00   45.15 ? 21   PRO A CA    1 
ATOM   176  C  C     . PRO A 1 27  ? -17.868 6.786   -0.543  1.00   45.72 ? 21   PRO A C     1 
ATOM   177  O  O     . PRO A 1 27  ? -18.526 6.566   -1.562  1.00   45.39 ? 21   PRO A O     1 
ATOM   178  C  CB    . PRO A 1 27  ? -19.647 7.884   0.921   1.00   45.16 ? 21   PRO A CB    1 
ATOM   179  C  CG    . PRO A 1 27  ? -19.009 8.966   1.779   1.00   44.71 ? 21   PRO A CG    1 
ATOM   180  C  CD    . PRO A 1 27  ? -18.285 8.187   2.805   1.00   43.25 ? 21   PRO A CD    1 
ATOM   181  N  N     . SER A 1 28  ? -16.550 6.970   -0.567  1.00   44.79 ? 22   SER A N     1 
ATOM   182  C  CA    . SER A 1 28  ? -15.809 6.958   -1.824  1.00   45.94 ? 22   SER A CA    1 
ATOM   183  C  C     . SER A 1 28  ? -15.557 5.538   -2.293  1.00   46.03 ? 22   SER A C     1 
ATOM   184  O  O     . SER A 1 28  ? -15.055 5.314   -3.390  1.00   45.43 ? 22   SER A O     1 
ATOM   185  C  CB    . SER A 1 28  ? -14.454 7.648   -1.658  1.00   48.67 ? 22   SER A CB    1 
ATOM   186  O  OG    . SER A 1 28  ? -13.451 6.732   -1.243  1.00   48.68 ? 22   SER A OG    1 
ATOM   187  N  N     . LEU A 1 29  ? -15.903 4.570   -1.459  1.00   46.92 ? 23   LEU A N     1 
ATOM   188  C  CA    . LEU A 1 29  ? -15.669 3.179   -1.815  1.00   46.89 ? 23   LEU A CA    1 
ATOM   189  C  C     . LEU A 1 29  ? -16.872 2.559   -2.517  1.00   47.32 ? 23   LEU A C     1 
ATOM   190  O  O     . LEU A 1 29  ? -16.707 1.668   -3.345  1.00   48.57 ? 23   LEU A O     1 
ATOM   191  C  CB    . LEU A 1 29  ? -15.319 2.369   -0.564  1.00   46.71 ? 23   LEU A CB    1 
ATOM   192  C  CG    . LEU A 1 29  ? -14.355 3.006   0.442   1.00   45.52 ? 23   LEU A CG    1 
ATOM   193  C  CD1   . LEU A 1 29  ? -14.442 2.261   1.756   1.00   45.07 ? 23   LEU A CD1   1 
ATOM   194  C  CD2   . LEU A 1 29  ? -12.924 2.975   -0.098  1.00   47.29 ? 23   LEU A CD2   1 
ATOM   195  N  N     . LYS A 1 30  ? -18.070 3.045   -2.206  1.00   46.73 ? 24   LYS A N     1 
ATOM   196  C  CA    . LYS A 1 30  ? -19.300 2.518   -2.802  1.00   47.86 ? 24   LYS A CA    1 
ATOM   197  C  C     . LYS A 1 30  ? -19.121 2.347   -4.308  1.00   47.53 ? 24   LYS A C     1 
ATOM   198  O  O     . LYS A 1 30  ? -18.914 3.315   -5.039  1.00   48.44 ? 24   LYS A O     1 
ATOM   199  C  CB    . LYS A 1 30  ? -20.452 3.480   -2.508  1.00   50.37 ? 24   LYS A CB    1 
ATOM   200  C  CG    . LYS A 1 30  ? -21.820 2.851   -2.357  1.00   53.21 ? 24   LYS A CG    1 
ATOM   201  C  CD    . LYS A 1 30  ? -22.875 3.931   -2.083  1.00   56.20 ? 24   LYS A CD    1 
ATOM   202  C  CE    . LYS A 1 30  ? -24.053 3.855   -3.069  1.00   57.43 ? 24   LYS A CE    1 
ATOM   203  N  NZ    . LYS A 1 30  ? -24.121 5.041   -3.996  1.00   58.24 ? 24   LYS A NZ    1 
ATOM   204  N  N     . GLY A 1 31  ? -19.192 1.108   -4.771  1.00   47.57 ? 25   GLY A N     1 
ATOM   205  C  CA    . GLY A 1 31  ? -19.015 0.846   -6.184  1.00   47.19 ? 25   GLY A CA    1 
ATOM   206  C  C     . GLY A 1 31  ? -17.664 0.210   -6.394  1.00   49.49 ? 25   GLY A C     1 
ATOM   207  O  O     . GLY A 1 31  ? -17.370 -0.309  -7.472  1.00   50.55 ? 25   GLY A O     1 
ATOM   208  N  N     . LYS A 1 32  ? -16.843 0.253   -5.346  1.00   50.65 ? 26   LYS A N     1 
ATOM   209  C  CA    . LYS A 1 32  ? -15.492 -0.315  -5.352  1.00   51.19 ? 26   LYS A CA    1 
ATOM   210  C  C     . LYS A 1 32  ? -15.406 -1.599  -4.535  1.00   50.92 ? 26   LYS A C     1 
ATOM   211  O  O     . LYS A 1 32  ? -16.161 -1.783  -3.577  1.00   51.21 ? 26   LYS A O     1 
ATOM   212  C  CB    . LYS A 1 32  ? -14.494 0.654   -4.732  1.00   51.16 ? 26   LYS A CB    1 
ATOM   213  C  CG    . LYS A 1 32  ? -14.200 1.899   -5.513  1.00   53.23 ? 26   LYS A CG    1 
ATOM   214  C  CD    . LYS A 1 32  ? -13.379 2.798   -4.615  1.00   54.13 ? 26   LYS A CD    1 
ATOM   215  C  CE    . LYS A 1 32  ? -12.653 3.872   -5.366  1.00   54.13 ? 26   LYS A CE    1 
ATOM   216  N  NZ    . LYS A 1 32  ? -11.693 4.537   -4.442  1.00   58.07 ? 26   LYS A NZ    1 
ATOM   217  N  N     . PRO A 1 33  ? -14.475 -2.504  -4.904  1.00   50.27 ? 27   PRO A N     1 
ATOM   218  C  CA    . PRO A 1 33  ? -14.284 -3.770  -4.192  1.00   48.18 ? 27   PRO A CA    1 
ATOM   219  C  C     . PRO A 1 33  ? -13.701 -3.452  -2.827  1.00   47.32 ? 27   PRO A C     1 
ATOM   220  O  O     . PRO A 1 33  ? -12.532 -3.059  -2.719  1.00   47.33 ? 27   PRO A O     1 
ATOM   221  C  CB    . PRO A 1 33  ? -13.266 -4.512  -5.053  1.00   47.04 ? 27   PRO A CB    1 
ATOM   222  C  CG    . PRO A 1 33  ? -13.499 -3.978  -6.384  1.00   48.23 ? 27   PRO A CG    1 
ATOM   223  C  CD    . PRO A 1 33  ? -13.703 -2.509  -6.158  1.00   48.98 ? 27   PRO A CD    1 
ATOM   224  N  N     . VAL A 1 34  ? -14.514 -3.606  -1.791  1.00   45.34 ? 28   VAL A N     1 
ATOM   225  C  CA    . VAL A 1 34  ? -14.047 -3.342  -0.442  1.00   44.37 ? 28   VAL A CA    1 
ATOM   226  C  C     . VAL A 1 34  ? -13.891 -4.664  0.304   1.00   44.12 ? 28   VAL A C     1 
ATOM   227  O  O     . VAL A 1 34  ? -14.840 -5.448  0.387   1.00   44.40 ? 28   VAL A O     1 
ATOM   228  C  CB    . VAL A 1 34  ? -15.036 -2.462  0.319   1.00   42.53 ? 28   VAL A CB    1 
ATOM   229  C  CG1   . VAL A 1 34  ? -14.473 -2.113  1.685   1.00   44.95 ? 28   VAL A CG1   1 
ATOM   230  C  CG2   . VAL A 1 34  ? -15.326 -1.218  -0.468  1.00   43.39 ? 28   VAL A CG2   1 
ATOM   231  N  N     . VAL A 1 35  ? -12.701 -4.896  0.851   1.00   43.25 ? 29   VAL A N     1 
ATOM   232  C  CA    . VAL A 1 35  ? -12.408 -6.116  1.598   1.00   44.01 ? 29   VAL A CA    1 
ATOM   233  C  C     . VAL A 1 35  ? -11.897 -5.895  3.037   1.00   44.56 ? 29   VAL A C     1 
ATOM   234  O  O     . VAL A 1 35  ? -10.757 -5.478  3.260   1.00   45.36 ? 29   VAL A O     1 
ATOM   235  C  CB    . VAL A 1 35  ? -11.372 -6.949  0.839   1.00   44.53 ? 29   VAL A CB    1 
ATOM   236  C  CG1   . VAL A 1 35  ? -11.059 -8.213  1.597   1.00   44.75 ? 29   VAL A CG1   1 
ATOM   237  C  CG2   . VAL A 1 35  ? -11.888 -7.246  -0.552  1.00   45.08 ? 29   VAL A CG2   1 
ATOM   238  N  N     . VAL A 1 36  ? -12.745 -6.182  4.013   1.00   44.31 ? 30   VAL A N     1 
ATOM   239  C  CA    . VAL A 1 36  ? -12.372 -6.043  5.412   1.00   43.59 ? 30   VAL A CA    1 
ATOM   240  C  C     . VAL A 1 36  ? -11.541 -7.252  5.847   1.00   43.44 ? 30   VAL A C     1 
ATOM   241  O  O     . VAL A 1 36  ? -12.012 -8.373  5.802   1.00   44.36 ? 30   VAL A O     1 
ATOM   242  C  CB    . VAL A 1 36  ? -13.612 -5.996  6.265   1.00   43.76 ? 30   VAL A CB    1 
ATOM   243  C  CG1   . VAL A 1 36  ? -13.235 -5.912  7.725   1.00   43.45 ? 30   VAL A CG1   1 
ATOM   244  C  CG2   . VAL A 1 36  ? -14.481 -4.825  5.837   1.00   45.70 ? 30   VAL A CG2   1 
ATOM   245  N  N     . CYS A 1 37  ? -10.316 -7.023  6.306   1.00   44.60 ? 31   CYS A N     1 
ATOM   246  C  CA    . CYS A 1 37  ? -9.440  -8.124  6.717   1.00   44.58 ? 31   CYS A CA    1 
ATOM   247  C  C     . CYS A 1 37  ? -9.007  -8.170  8.182   1.00   45.09 ? 31   CYS A C     1 
ATOM   248  O  O     . CYS A 1 37  ? -9.337  -7.291  8.970   1.00   46.01 ? 31   CYS A O     1 
ATOM   249  C  CB    . CYS A 1 37  ? -8.188  -8.107  5.858   1.00   42.69 ? 31   CYS A CB    1 
ATOM   250  S  SG    . CYS A 1 37  ? -8.540  -7.980  4.136   1.00   40.11 ? 31   CYS A SG    1 
ATOM   251  N  N     . VAL A 1 38  ? -8.267  -9.223  8.525   1.00   44.95 ? 32   VAL A N     1 
ATOM   252  C  CA    . VAL A 1 38  ? -7.740  -9.411  9.860   1.00   46.50 ? 32   VAL A CA    1 
ATOM   253  C  C     . VAL A 1 38  ? -6.269  -9.777  9.679   1.00   47.41 ? 32   VAL A C     1 
ATOM   254  O  O     . VAL A 1 38  ? -5.938  -10.886 9.284   1.00   46.93 ? 32   VAL A O     1 
ATOM   255  C  CB    . VAL A 1 38  ? -8.471  -10.551 10.620  1.00   47.59 ? 32   VAL A CB    1 
ATOM   256  C  CG1   . VAL A 1 38  ? -9.936  -10.196 10.840  1.00   49.73 ? 32   VAL A CG1   1 
ATOM   257  C  CG2   . VAL A 1 38  ? -8.392  -11.844 9.835   1.00   50.95 ? 32   VAL A CG2   1 
ATOM   258  N  N     . PHE A 1 39  ? -5.380  -8.828  9.934   1.00   49.84 ? 33   PHE A N     1 
ATOM   259  C  CA    . PHE A 1 39  ? -3.951  -9.097  9.778   1.00   52.84 ? 33   PHE A CA    1 
ATOM   260  C  C     . PHE A 1 39  ? -3.386  -9.628  11.095  1.00   54.15 ? 33   PHE A C     1 
ATOM   261  O  O     . PHE A 1 39  ? -3.654  -9.068  12.163  1.00   55.39 ? 33   PHE A O     1 
ATOM   262  C  CB    . PHE A 1 39  ? -3.205  -7.825  9.337   1.00   52.34 ? 33   PHE A CB    1 
ATOM   263  C  CG    . PHE A 1 39  ? -3.778  -7.178  8.087   1.00   53.30 ? 33   PHE A CG    1 
ATOM   264  C  CD1   . PHE A 1 39  ? -4.973  -6.462  8.137   1.00   52.30 ? 33   PHE A CD1   1 
ATOM   265  C  CD2   . PHE A 1 39  ? -3.116  -7.277  6.862   1.00   52.31 ? 33   PHE A CD2   1 
ATOM   266  C  CE1   . PHE A 1 39  ? -5.493  -5.854  6.985   1.00   52.37 ? 33   PHE A CE1   1 
ATOM   267  C  CE2   . PHE A 1 39  ? -3.637  -6.668  5.707   1.00   52.21 ? 33   PHE A CE2   1 
ATOM   268  C  CZ    . PHE A 1 39  ? -4.822  -5.958  5.775   1.00   50.38 ? 33   PHE A CZ    1 
ATOM   269  N  N     . SER A 1 40  ? -2.612  -10.708 11.027  1.00   54.28 ? 34   SER A N     1 
ATOM   270  C  CA    . SER A 1 40  ? -2.052  -11.289 12.238  1.00   55.47 ? 34   SER A CA    1 
ATOM   271  C  C     . SER A 1 40  ? -0.755  -10.593 12.635  1.00   57.58 ? 34   SER A C     1 
ATOM   272  O  O     . SER A 1 40  ? -0.273  -10.737 13.762  1.00   57.98 ? 34   SER A O     1 
ATOM   273  C  CB    . SER A 1 40  ? -1.800  -12.773 12.029  1.00   54.34 ? 34   SER A CB    1 
ATOM   274  O  OG    . SER A 1 40  ? -0.891  -12.985 10.967  1.00   52.62 ? 34   SER A OG    1 
ATOM   275  N  N     . GLY A 1 41  ? -0.199  -9.824  11.708  1.00   58.58 ? 35   GLY A N     1 
ATOM   276  C  CA    . GLY A 1 41  ? 1.034   -9.120  11.995  1.00   60.04 ? 35   GLY A CA    1 
ATOM   277  C  C     . GLY A 1 41  ? 2.227   -10.054 12.029  1.00   60.82 ? 35   GLY A C     1 
ATOM   278  O  O     . GLY A 1 41  ? 3.330   -9.623  12.373  1.00   60.95 ? 35   GLY A O     1 
ATOM   279  N  N     . ARG A 1 42  ? 2.012   -11.326 11.689  1.00   61.42 ? 36   ARG A N     1 
ATOM   280  C  CA    . ARG A 1 42  ? 3.105   -12.287 11.672  1.00   62.82 ? 36   ARG A CA    1 
ATOM   281  C  C     . ARG A 1 42  ? 4.060   -11.898 10.552  1.00   64.28 ? 36   ARG A C     1 
ATOM   282  O  O     . ARG A 1 42  ? 5.222   -12.301 10.540  1.00   65.59 ? 36   ARG A O     1 
ATOM   283  C  CB    . ARG A 1 42  ? 2.582   -13.709 11.459  1.00   62.23 ? 36   ARG A CB    1 
ATOM   284  C  CG    . ARG A 1 42  ? 3.681   -14.712 11.152  1.00   62.48 ? 36   ARG A CG    1 
ATOM   285  C  CD    . ARG A 1 42  ? 3.335   -16.123 11.564  1.00   60.77 ? 36   ARG A CD    1 
ATOM   286  N  NE    . ARG A 1 42  ? 3.467   -16.318 13.003  1.00   59.93 ? 36   ARG A NE    1 
ATOM   287  C  CZ    . ARG A 1 42  ? 3.427   -17.512 13.594  1.00   61.65 ? 36   ARG A CZ    1 
ATOM   288  N  NH1   . ARG A 1 42  ? 3.257   -18.610 12.864  1.00   59.87 ? 36   ARG A NH1   1 
ATOM   289  N  NH2   . ARG A 1 42  ? 3.574   -17.618 14.912  1.00   60.83 ? 36   ARG A NH2   1 
ATOM   290  N  N     . PHE A 1 43  ? 3.547   -11.100 9.621   1.00   65.20 ? 37   PHE A N     1 
ATOM   291  C  CA    . PHE A 1 43  ? 4.288   -10.586 8.470   1.00   66.00 ? 37   PHE A CA    1 
ATOM   292  C  C     . PHE A 1 43  ? 3.265   -9.941  7.554   1.00   65.71 ? 37   PHE A C     1 
ATOM   293  O  O     . PHE A 1 43  ? 2.138   -10.416 7.474   1.00   66.81 ? 37   PHE A O     1 
ATOM   294  C  CB    . PHE A 1 43  ? 5.073   -11.701 7.749   1.00   67.43 ? 37   PHE A CB    1 
ATOM   295  C  CG    . PHE A 1 43  ? 4.235   -12.852 7.239   1.00   67.62 ? 37   PHE A CG    1 
ATOM   296  C  CD1   . PHE A 1 43  ? 3.608   -12.785 5.999   1.00   68.56 ? 37   PHE A CD1   1 
ATOM   297  C  CD2   . PHE A 1 43  ? 4.155   -14.040 7.962   1.00   68.41 ? 37   PHE A CD2   1 
ATOM   298  C  CE1   . PHE A 1 43  ? 2.919   -13.889 5.481   1.00   69.03 ? 37   PHE A CE1   1 
ATOM   299  C  CE2   . PHE A 1 43  ? 3.473   -15.146 7.456   1.00   68.90 ? 37   PHE A CE2   1 
ATOM   300  C  CZ    . PHE A 1 43  ? 2.854   -15.069 6.210   1.00   69.27 ? 37   PHE A CZ    1 
ATOM   301  N  N     . GLU A 1 44  ? 3.634   -8.856  6.879   1.00   64.61 ? 38   GLU A N     1 
ATOM   302  C  CA    . GLU A 1 44  ? 2.678   -8.160  6.021   1.00   63.00 ? 38   GLU A CA    1 
ATOM   303  C  C     . GLU A 1 44  ? 1.837   -9.056  5.103   1.00   63.18 ? 38   GLU A C     1 
ATOM   304  O  O     . GLU A 1 44  ? 2.342   -9.975  4.436   1.00   63.21 ? 38   GLU A O     1 
ATOM   305  C  CB    . GLU A 1 44  ? 3.383   -7.082  5.207   1.00   61.63 ? 38   GLU A CB    1 
ATOM   306  C  CG    . GLU A 1 44  ? 2.732   -5.708  5.348   0.50   61.59 ? 38   GLU A CG    1 
ATOM   307  C  CD    . GLU A 1 44  ? 2.649   -5.230  6.799   0.50   61.71 ? 38   GLU A CD    1 
ATOM   308  O  OE1   . GLU A 1 44  ? 2.218   -4.078  7.020   0.50   61.39 ? 38   GLU A OE1   1 
ATOM   309  O  OE2   . GLU A 1 44  ? 3.011   -5.999  7.715   0.50   61.36 ? 38   GLU A OE2   1 
ATOM   310  N  N     . ASP A 1 45  ? 0.537   -8.762  5.084   1.00   62.05 ? 39   ASP A N     1 
ATOM   311  C  CA    . ASP A 1 45  ? -0.433  -9.512  4.301   1.00   59.55 ? 39   ASP A CA    1 
ATOM   312  C  C     . ASP A 1 45  ? -0.631  -10.888 4.907   1.00   57.66 ? 39   ASP A C     1 
ATOM   313  O  O     . ASP A 1 45  ? -0.921  -11.850 4.200   1.00   58.49 ? 39   ASP A O     1 
ATOM   314  C  CB    . ASP A 1 45  ? 0.011   -9.679  2.849   1.00   61.30 ? 39   ASP A CB    1 
ATOM   315  C  CG    . ASP A 1 45  ? 0.072   -8.370  2.097   1.00   62.81 ? 39   ASP A CG    1 
ATOM   316  O  OD1   . ASP A 1 45  ? -0.633  -7.409  2.490   1.00   64.43 ? 39   ASP A OD1   1 
ATOM   317  O  OD2   . ASP A 1 45  ? 0.819   -8.319  1.097   1.00   61.76 ? 39   ASP A OD2   1 
ATOM   318  N  N     . SER A 1 46  ? -0.443  -11.005 6.211   1.00   54.19 ? 40   SER A N     1 
ATOM   319  C  CA    . SER A 1 46  ? -0.669  -12.292 6.842   1.00   52.65 ? 40   SER A CA    1 
ATOM   320  C  C     . SER A 1 46  ? -1.967  -12.084 7.588   1.00   49.10 ? 40   SER A C     1 
ATOM   321  O  O     . SER A 1 46  ? -2.079  -11.199 8.427   1.00   48.52 ? 40   SER A O     1 
ATOM   322  C  CB    . SER A 1 46  ? 0.454   -12.643 7.812   1.00   53.75 ? 40   SER A CB    1 
ATOM   323  O  OG    . SER A 1 46  ? 0.553   -11.651 8.816   1.00   59.27 ? 40   SER A OG    1 
ATOM   324  N  N     . GLY A 1 47  ? -2.960  -12.883 7.248   1.00   46.97 ? 41   GLY A N     1 
ATOM   325  C  CA    . GLY A 1 47  ? -4.252  -12.755 7.885   1.00   44.91 ? 41   GLY A CA    1 
ATOM   326  C  C     . GLY A 1 47  ? -5.293  -13.449 7.049   1.00   43.68 ? 41   GLY A C     1 
ATOM   327  O  O     . GLY A 1 47  ? -4.978  -14.344 6.262   1.00   42.81 ? 41   GLY A O     1 
ATOM   328  N  N     . ALA A 1 48  ? -6.537  -13.025 7.204   1.00   42.81 ? 42   ALA A N     1 
ATOM   329  C  CA    . ALA A 1 48  ? -7.616  -13.619 6.442   1.00   42.17 ? 42   ALA A CA    1 
ATOM   330  C  C     . ALA A 1 48  ? -8.708  -12.593 6.184   1.00   41.47 ? 42   ALA A C     1 
ATOM   331  O  O     . ALA A 1 48  ? -8.795  -11.584 6.870   1.00   42.97 ? 42   ALA A O     1 
ATOM   332  C  CB    . ALA A 1 48  ? -8.168  -14.803 7.187   1.00   41.11 ? 42   ALA A CB    1 
ATOM   333  N  N     . VAL A 1 49  ? -9.520  -12.832 5.168   1.00   40.52 ? 43   VAL A N     1 
ATOM   334  C  CA    . VAL A 1 49  ? -10.615 -11.926 4.853   1.00   40.83 ? 43   VAL A CA    1 
ATOM   335  C  C     . VAL A 1 49  ? -11.802 -12.133 5.824   1.00   41.07 ? 43   VAL A C     1 
ATOM   336  O  O     . VAL A 1 49  ? -12.287 -13.258 6.016   1.00   40.97 ? 43   VAL A O     1 
ATOM   337  C  CB    . VAL A 1 49  ? -11.082 -12.143 3.384   1.00   41.20 ? 43   VAL A CB    1 
ATOM   338  C  CG1   . VAL A 1 49  ? -12.584 -11.928 3.250   1.00   42.48 ? 43   VAL A CG1   1 
ATOM   339  C  CG2   . VAL A 1 49  ? -10.350 -11.195 2.469   1.00   40.98 ? 43   VAL A CG2   1 
ATOM   340  N  N     . ALA A 1 50  ? -12.272 -11.054 6.443   1.00   39.29 ? 44   ALA A N     1 
ATOM   341  C  CA    . ALA A 1 50  ? -13.402 -11.173 7.359   1.00   38.12 ? 44   ALA A CA    1 
ATOM   342  C  C     . ALA A 1 50  ? -14.713 -11.113 6.545   1.00   37.83 ? 44   ALA A C     1 
ATOM   343  O  O     . ALA A 1 50  ? -15.614 -11.943 6.723   1.00   33.89 ? 44   ALA A O     1 
ATOM   344  C  CB    . ALA A 1 50  ? -13.381 -10.062 8.388   1.00   38.83 ? 44   ALA A CB    1 
ATOM   345  N  N     . THR A 1 51  ? -14.832 -10.102 5.683   1.00   38.56 ? 45   THR A N     1 
ATOM   346  C  CA    . THR A 1 51  ? -16.016 -9.952  4.827   1.00   41.03 ? 45   THR A CA    1 
ATOM   347  C  C     . THR A 1 51  ? -15.688 -9.089  3.629   1.00   42.84 ? 45   THR A C     1 
ATOM   348  O  O     . THR A 1 51  ? -14.845 -8.234  3.696   1.00   43.55 ? 45   THR A O     1 
ATOM   349  C  CB    . THR A 1 51  ? -17.168 -9.263  5.541   1.00   40.10 ? 45   THR A CB    1 
ATOM   350  O  OG1   . THR A 1 51  ? -17.365 -7.953  5.008   1.00   41.33 ? 45   THR A OG1   1 
ATOM   351  C  CG2   . THR A 1 51  ? -16.922 -9.181  7.020   1.00   38.53 ? 45   THR A CG2   1 
ATOM   352  N  N     . ALA A 1 52  ? -16.362 -9.319  2.516   1.00   45.46 ? 46   ALA A N     1 
ATOM   353  C  CA    . ALA A 1 52  ? -16.143 -8.497  1.331   1.00   46.40 ? 46   ALA A CA    1 
ATOM   354  C  C     . ALA A 1 52  ? -17.471 -8.028  0.801   1.00   47.26 ? 46   ALA A C     1 
ATOM   355  O  O     . ALA A 1 52  ? -18.503 -8.599  1.139   1.00   48.09 ? 46   ALA A O     1 
ATOM   356  C  CB    . ALA A 1 52  ? -15.432 -9.301  0.279   1.00   47.59 ? 46   ALA A CB    1 
ATOM   357  N  N     . ASN A 1 53  ? -17.468 -6.956  0.014   1.00   47.89 ? 47   ASN A N     1 
ATOM   358  C  CA    . ASN A 1 53  ? -18.740 -6.559  -0.554  1.00   49.08 ? 47   ASN A CA    1 
ATOM   359  C  C     . ASN A 1 53  ? -18.943 -7.350  -1.822  1.00   49.53 ? 47   ASN A C     1 
ATOM   360  O  O     . ASN A 1 53  ? -18.100 -8.134  -2.231  1.00   49.55 ? 47   ASN A O     1 
ATOM   361  C  CB    . ASN A 1 53  ? -18.868 -5.062  -0.840  1.00   48.99 ? 47   ASN A CB    1 
ATOM   362  C  CG    . ASN A 1 53  ? -17.682 -4.491  -1.523  1.00   49.21 ? 47   ASN A CG    1 
ATOM   363  O  OD1   . ASN A 1 53  ? -16.996 -5.146  -2.283  1.00   51.54 ? 47   ASN A OD1   1 
ATOM   364  N  ND2   . ASN A 1 53  ? -17.442 -3.216  -1.266  1.00   50.20 ? 47   ASN A ND2   1 
ATOM   365  N  N     . TYR A 1 54  ? -20.097 -7.163  -2.423  1.00   51.49 ? 48   TYR A N     1 
ATOM   366  C  CA    . TYR A 1 54  ? -20.439 -7.885  -3.620  1.00   54.25 ? 48   TYR A CA    1 
ATOM   367  C  C     . TYR A 1 54  ? -19.531 -7.680  -4.826  1.00   54.34 ? 48   TYR A C     1 
ATOM   368  O  O     . TYR A 1 54  ? -19.522 -8.452  -5.758  1.00   55.39 ? 48   TYR A O     1 
ATOM   369  C  CB    . TYR A 1 54  ? -21.886 -7.577  -3.977  1.00   55.47 ? 48   TYR A CB    1 
ATOM   370  C  CG    . TYR A 1 54  ? -22.826 -8.140  -2.950  1.00   56.48 ? 48   TYR A CG    1 
ATOM   371  C  CD1   . TYR A 1 54  ? -23.602 -9.245  -3.245  1.00   57.89 ? 48   TYR A CD1   1 
ATOM   372  C  CD2   . TYR A 1 54  ? -22.867 -7.647  -1.642  1.00   56.07 ? 48   TYR A CD2   1 
ATOM   373  C  CE1   . TYR A 1 54  ? -24.382 -9.853  -2.295  1.00   59.82 ? 48   TYR A CE1   1 
ATOM   374  C  CE2   . TYR A 1 54  ? -23.655 -8.261  -0.667  1.00   57.06 ? 48   TYR A CE2   1 
ATOM   375  C  CZ    . TYR A 1 54  ? -24.410 -9.367  -1.006  1.00   58.67 ? 48   TYR A CZ    1 
ATOM   376  O  OH    . TYR A 1 54  ? -25.186 -10.007 -0.065  1.00   59.61 ? 48   TYR A OH    1 
ATOM   377  N  N     . GLU A 1 55  ? -18.754 -6.619  -4.810  1.00   54.46 ? 49   GLU A N     1 
ATOM   378  C  CA    . GLU A 1 55  ? -17.828 -6.334  -5.907  1.00   55.44 ? 49   GLU A CA    1 
ATOM   379  C  C     . GLU A 1 55  ? -16.604 -7.200  -5.841  1.00   54.47 ? 49   GLU A C     1 
ATOM   380  O  O     . GLU A 1 55  ? -16.044 -7.597  -6.860  1.00   56.46 ? 49   GLU A O     1 
ATOM   381  C  CB    . GLU A 1 55  ? -17.418 -4.885  -5.801  1.00   58.90 ? 49   GLU A CB    1 
ATOM   382  C  CG    . GLU A 1 55  ? -18.557 -3.997  -5.994  1.00   62.17 ? 49   GLU A CG    1 
ATOM   383  C  CD    . GLU A 1 55  ? -18.647 -3.650  -7.409  1.00   66.18 ? 49   GLU A CD    1 
ATOM   384  O  OE1   . GLU A 1 55  ? -17.580 -3.382  -8.021  1.00   68.59 ? 49   GLU A OE1   1 
ATOM   385  O  OE2   . GLU A 1 55  ? -19.767 -3.630  -7.963  1.00   69.82 ? 49   GLU A OE2   1 
ATOM   386  N  N     . ALA A 1 56  ? -16.207 -7.481  -4.607  1.00   53.02 ? 50   ALA A N     1 
ATOM   387  C  CA    . ALA A 1 56  ? -15.078 -8.316  -4.303  1.00   50.30 ? 50   ALA A CA    1 
ATOM   388  C  C     . ALA A 1 56  ? -15.515 -9.737  -4.464  1.00   48.31 ? 50   ALA A C     1 
ATOM   389  O  O     . ALA A 1 56  ? -14.878 -10.495 -5.172  1.00   46.18 ? 50   ALA A O     1 
ATOM   390  C  CB    . ALA A 1 56  ? -14.616 -8.073  -2.869  1.00   48.89 ? 50   ALA A CB    1 
ATOM   391  N  N     . ARG A 1 57  ? -16.645 -10.058 -3.836  1.00   48.31 ? 51   ARG A N     1 
ATOM   392  C  CA    . ARG A 1 57  ? -17.244 -11.399 -3.864  1.00   47.37 ? 51   ARG A CA    1 
ATOM   393  C  C     . ARG A 1 57  ? -17.431 -11.998 -5.253  1.00   47.63 ? 51   ARG A C     1 
ATOM   394  O  O     . ARG A 1 57  ? -17.149 -13.192 -5.449  1.00   48.27 ? 51   ARG A O     1 
ATOM   395  C  CB    . ARG A 1 57  ? -18.626 -11.394 -3.212  1.00   47.91 ? 51   ARG A CB    1 
ATOM   396  C  CG    . ARG A 1 57  ? -18.615 -11.395 -1.713  1.00   50.48 ? 51   ARG A CG    1 
ATOM   397  C  CD    . ARG A 1 57  ? -19.994 -11.319 -1.141  1.00   53.01 ? 51   ARG A CD    1 
ATOM   398  N  NE    . ARG A 1 57  ? -19.947 -11.195 0.322   1.00   55.05 ? 51   ARG A NE    1 
ATOM   399  C  CZ    . ARG A 1 57  ? -20.964 -11.057 1.123   1.00   58.14 ? 51   ARG A CZ    1 
ATOM   400  N  NH1   . ARG A 1 57  ? -22.190 -11.052 0.612   1.00   57.36 ? 51   ARG A NH1   1 
ATOM   401  N  NH2   . ARG A 1 57  ? -20.805 -11.199 2.452   1.00   61.19 ? 51   ARG A NH2   1 
ATOM   402  N  N     . LYS A 1 58  ? -17.930 -11.186 -6.198  1.00   46.07 ? 52   LYS A N     1 
ATOM   403  C  CA    . LYS A 1 58  ? -18.175 -11.673 -7.540  1.00   43.82 ? 52   LYS A CA    1 
ATOM   404  C  C     . LYS A 1 58  ? -16.896 -11.936 -8.306  1.00   44.65 ? 52   LYS A C     1 
ATOM   405  O  O     . LYS A 1 58  ? -16.930 -12.302 -9.479  1.00   46.79 ? 52   LYS A O     1 
ATOM   406  C  CB    . LYS A 1 58  ? -19.091 -10.723 -8.306  1.00   42.05 ? 52   LYS A CB    1 
ATOM   407  C  CG    . LYS A 1 58  ? -18.496 -9.417  -8.700  1.00   40.33 ? 52   LYS A CG    1 
ATOM   408  C  CD    . LYS A 1 58  ? -19.472 -8.687  -9.605  1.00   38.29 ? 52   LYS A CD    1 
ATOM   409  C  CE    . LYS A 1 58  ? -19.004 -7.274  -9.965  1.00   39.56 ? 52   LYS A CE    1 
ATOM   410  N  NZ    . LYS A 1 58  ? -20.107 -6.421  -10.539 1.00   38.58 ? 52   LYS A NZ    1 
ATOM   411  N  N     . PHE A 1 59  ? -15.759 -11.773 -7.644  1.00   43.74 ? 53   PHE A N     1 
ATOM   412  C  CA    . PHE A 1 59  ? -14.499 -12.063 -8.294  1.00   42.78 ? 53   PHE A CA    1 
ATOM   413  C  C     . PHE A 1 59  ? -13.796 -13.160 -7.541  1.00   42.58 ? 53   PHE A C     1 
ATOM   414  O  O     . PHE A 1 59  ? -12.635 -13.450 -7.804  1.00   41.82 ? 53   PHE A O     1 
ATOM   415  C  CB    . PHE A 1 59  ? -13.622 -10.826 -8.376  1.00   44.77 ? 53   PHE A CB    1 
ATOM   416  C  CG    . PHE A 1 59  ? -14.021 -9.873  -9.471  1.00   46.27 ? 53   PHE A CG    1 
ATOM   417  C  CD1   . PHE A 1 59  ? -14.455 -8.585  -9.178  1.00   46.92 ? 53   PHE A CD1   1 
ATOM   418  C  CD2   . PHE A 1 59  ? -13.942 -10.256 -10.801 1.00   46.33 ? 53   PHE A CD2   1 
ATOM   419  C  CE1   . PHE A 1 59  ? -14.796 -7.699  -10.198 1.00   46.57 ? 53   PHE A CE1   1 
ATOM   420  C  CE2   . PHE A 1 59  ? -14.282 -9.373  -11.824 1.00   46.21 ? 53   PHE A CE2   1 
ATOM   421  C  CZ    . PHE A 1 59  ? -14.705 -8.100  -11.522 1.00   46.03 ? 53   PHE A CZ    1 
ATOM   422  N  N     . GLY A 1 60  ? -14.511 -13.772 -6.596  1.00   43.73 ? 54   GLY A N     1 
ATOM   423  C  CA    . GLY A 1 60  ? -13.954 -14.883 -5.841  1.00   43.76 ? 54   GLY A CA    1 
ATOM   424  C  C     . GLY A 1 60  ? -13.381 -14.616 -4.470  1.00   43.87 ? 54   GLY A C     1 
ATOM   425  O  O     . GLY A 1 60  ? -12.842 -15.516 -3.820  1.00   44.16 ? 54   GLY A O     1 
ATOM   426  N  N     . VAL A 1 61  ? -13.481 -13.374 -4.029  1.00   44.18 ? 55   VAL A N     1 
ATOM   427  C  CA    . VAL A 1 61  ? -12.983 -13.004 -2.718  1.00   43.37 ? 55   VAL A CA    1 
ATOM   428  C  C     . VAL A 1 61  ? -14.122 -13.191 -1.732  1.00   44.43 ? 55   VAL A C     1 
ATOM   429  O  O     . VAL A 1 61  ? -15.153 -12.516 -1.826  1.00   43.82 ? 55   VAL A O     1 
ATOM   430  C  CB    . VAL A 1 61  ? -12.527 -11.542 -2.698  1.00   42.83 ? 55   VAL A CB    1 
ATOM   431  C  CG1   . VAL A 1 61  ? -11.997 -11.186 -1.329  1.00   41.95 ? 55   VAL A CG1   1 
ATOM   432  C  CG2   . VAL A 1 61  ? -11.470 -11.320 -3.770  1.00   41.60 ? 55   VAL A CG2   1 
ATOM   433  N  N     . LYS A 1 62  ? -13.937 -14.129 -0.805  1.00   45.71 ? 56   LYS A N     1 
ATOM   434  C  CA    . LYS A 1 62  ? -14.941 -14.437 0.209   1.00   46.80 ? 56   LYS A CA    1 
ATOM   435  C  C     . LYS A 1 62  ? -14.304 -14.509 1.582   1.00   47.51 ? 56   LYS A C     1 
ATOM   436  O  O     . LYS A 1 62  ? -13.081 -14.630 1.708   1.00   49.27 ? 56   LYS A O     1 
ATOM   437  C  CB    . LYS A 1 62  ? -15.609 -15.775 -0.099  1.00   46.94 ? 56   LYS A CB    1 
ATOM   438  C  CG    . LYS A 1 62  ? -14.624 -16.912 -0.256  1.00   48.21 ? 56   LYS A CG    1 
ATOM   439  C  CD    . LYS A 1 62  ? -15.323 -18.235 -0.554  1.00   49.82 ? 56   LYS A CD    1 
ATOM   440  C  CE    . LYS A 1 62  ? -16.008 -18.252 -1.920  1.00   52.18 ? 56   LYS A CE    1 
ATOM   441  N  NZ    . LYS A 1 62  ? -16.577 -19.605 -2.250  1.00   52.16 ? 56   LYS A NZ    1 
ATOM   442  N  N     . ALA A 1 63  ? -15.146 -14.446 2.606   1.00   46.88 ? 57   ALA A N     1 
ATOM   443  C  CA    . ALA A 1 63  ? -14.704 -14.505 3.994   1.00   45.75 ? 57   ALA A CA    1 
ATOM   444  C  C     . ALA A 1 63  ? -13.945 -15.786 4.318   1.00   45.36 ? 57   ALA A C     1 
ATOM   445  O  O     . ALA A 1 63  ? -14.445 -16.886 4.084   1.00   46.28 ? 57   ALA A O     1 
ATOM   446  C  CB    . ALA A 1 63  ? -15.905 -14.376 4.910   1.00   45.26 ? 57   ALA A CB    1 
ATOM   447  N  N     . GLY A 1 64  ? -12.728 -15.659 4.837   1.00   44.16 ? 58   GLY A N     1 
ATOM   448  C  CA    . GLY A 1 64  ? -12.001 -16.864 5.182   1.00   43.35 ? 58   GLY A CA    1 
ATOM   449  C  C     . GLY A 1 64  ? -10.716 -17.174 4.450   1.00   41.99 ? 58   GLY A C     1 
ATOM   450  O  O     . GLY A 1 64  ? -9.879  -17.903 4.969   1.00   43.25 ? 58   GLY A O     1 
ATOM   451  N  N     . ILE A 1 65  ? -10.549 -16.634 3.252   1.00   41.39 ? 59   ILE A N     1 
ATOM   452  C  CA    . ILE A 1 65  ? -9.346  -16.901 2.478   1.00   38.12 ? 59   ILE A CA    1 
ATOM   453  C  C     . ILE A 1 65  ? -8.214  -16.021 2.963   1.00   36.75 ? 59   ILE A C     1 
ATOM   454  O  O     . ILE A 1 65  ? -8.441  -14.953 3.527   1.00   33.35 ? 59   ILE A O     1 
ATOM   455  C  CB    . ILE A 1 65  ? -9.558  -16.636 0.957   1.00   36.71 ? 59   ILE A CB    1 
ATOM   456  C  CG1   . ILE A 1 65  ? -9.349  -15.148 0.645   1.00   35.42 ? 59   ILE A CG1   1 
ATOM   457  C  CG2   . ILE A 1 65  ? -10.955 -17.089 0.534   1.00   37.13 ? 59   ILE A CG2   1 
ATOM   458  C  CD1   . ILE A 1 65  ? -9.433  -14.788 -0.845  1.00   31.15 ? 59   ILE A CD1   1 
ATOM   459  N  N     . PRO A 1 66  ? -6.972  -16.467 2.745   1.00   37.00 ? 60   PRO A N     1 
ATOM   460  C  CA    . PRO A 1 66  ? -5.782  -15.725 3.156   1.00   38.31 ? 60   PRO A CA    1 
ATOM   461  C  C     . PRO A 1 66  ? -5.779  -14.386 2.471   1.00   40.03 ? 60   PRO A C     1 
ATOM   462  O  O     . PRO A 1 66  ? -6.197  -14.277 1.314   1.00   41.55 ? 60   PRO A O     1 
ATOM   463  C  CB    . PRO A 1 66  ? -4.636  -16.615 2.681   1.00   38.14 ? 60   PRO A CB    1 
ATOM   464  C  CG    . PRO A 1 66  ? -5.218  -17.982 2.753   1.00   36.83 ? 60   PRO A CG    1 
ATOM   465  C  CD    . PRO A 1 66  ? -6.608  -17.775 2.185   1.00   35.30 ? 60   PRO A CD    1 
ATOM   466  N  N     . ILE A 1 67  ? -5.302  -13.362 3.167   1.00   42.70 ? 61   ILE A N     1 
ATOM   467  C  CA    . ILE A 1 67  ? -5.270  -12.028 2.579   1.00   43.59 ? 61   ILE A CA    1 
ATOM   468  C  C     . ILE A 1 67  ? -4.407  -12.019 1.318   1.00   45.10 ? 61   ILE A C     1 
ATOM   469  O  O     . ILE A 1 67  ? -4.640  -11.245 0.382   1.00   44.53 ? 61   ILE A O     1 
ATOM   470  C  CB    . ILE A 1 67  ? -4.729  -11.002 3.588   1.00   43.23 ? 61   ILE A CB    1 
ATOM   471  C  CG1   . ILE A 1 67  ? -5.801  -10.687 4.624   1.00   42.01 ? 61   ILE A CG1   1 
ATOM   472  C  CG2   . ILE A 1 67  ? -4.303  -9.734  2.883   1.00   44.67 ? 61   ILE A CG2   1 
ATOM   473  C  CD1   . ILE A 1 67  ? -5.354  -9.694  5.648   1.00   42.16 ? 61   ILE A CD1   1 
ATOM   474  N  N     . VAL A 1 68  ? -3.423  -12.907 1.287   1.00   46.97 ? 62   VAL A N     1 
ATOM   475  C  CA    . VAL A 1 68  ? -2.523  -12.990 0.147   1.00   48.58 ? 62   VAL A CA    1 
ATOM   476  C  C     . VAL A 1 68  ? -3.220  -13.439 -1.118  1.00   48.30 ? 62   VAL A C     1 
ATOM   477  O  O     . VAL A 1 68  ? -3.159  -12.768 -2.147  1.00   49.49 ? 62   VAL A O     1 
ATOM   478  C  CB    . VAL A 1 68  ? -1.341  -13.954 0.421   1.00   48.23 ? 62   VAL A CB    1 
ATOM   479  C  CG1   . VAL A 1 68  ? -0.582  -14.210 -0.862  1.00   48.75 ? 62   VAL A CG1   1 
ATOM   480  C  CG2   . VAL A 1 68  ? -0.406  -13.347 1.454   1.00   50.12 ? 62   VAL A CG2   1 
ATOM   481  N  N     . GLU A 1 69  ? -3.873  -14.585 -1.049  1.00   48.45 ? 63   GLU A N     1 
ATOM   482  C  CA    . GLU A 1 69  ? -4.547  -15.099 -2.218  1.00   48.47 ? 63   GLU A CA    1 
ATOM   483  C  C     . GLU A 1 69  ? -5.660  -14.162 -2.653  1.00   49.74 ? 63   GLU A C     1 
ATOM   484  O  O     . GLU A 1 69  ? -6.083  -14.189 -3.805  1.00   50.74 ? 63   GLU A O     1 
ATOM   485  C  CB    . GLU A 1 69  ? -5.088  -16.498 -1.934  1.00   48.56 ? 63   GLU A CB    1 
ATOM   486  C  CG    . GLU A 1 69  ? -4.485  -17.589 -2.825  0.50   47.01 ? 63   GLU A CG    1 
ATOM   487  C  CD    . GLU A 1 69  ? -2.970  -17.635 -2.750  0.50   46.38 ? 63   GLU A CD    1 
ATOM   488  O  OE1   . GLU A 1 69  ? -2.300  -16.941 -3.544  0.50   47.33 ? 63   GLU A OE1   1 
ATOM   489  O  OE2   . GLU A 1 69  ? -2.445  -18.361 -1.885  0.50   45.04 ? 63   GLU A OE2   1 
ATOM   490  N  N     . ALA A 1 70  ? -6.121  -13.315 -1.739  1.00   51.10 ? 64   ALA A N     1 
ATOM   491  C  CA    . ALA A 1 70  ? -7.183  -12.377 -2.062  1.00   51.19 ? 64   ALA A CA    1 
ATOM   492  C  C     . ALA A 1 70  ? -6.630  -11.242 -2.883  1.00   50.90 ? 64   ALA A C     1 
ATOM   493  O  O     . ALA A 1 70  ? -7.320  -10.693 -3.728  1.00   51.09 ? 64   ALA A O     1 
ATOM   494  C  CB    . ALA A 1 70  ? -7.809  -11.840 -0.795  1.00   52.77 ? 64   ALA A CB    1 
ATOM   495  N  N     . LYS A 1 71  ? -5.375  -10.892 -2.633  1.00   51.73 ? 65   LYS A N     1 
ATOM   496  C  CA    . LYS A 1 71  ? -4.748  -9.803  -3.358  1.00   52.17 ? 65   LYS A CA    1 
ATOM   497  C  C     . LYS A 1 71  ? -4.317  -10.242 -4.737  1.00   53.68 ? 65   LYS A C     1 
ATOM   498  O  O     . LYS A 1 71  ? -4.212  -9.416  -5.642  1.00   54.89 ? 65   LYS A O     1 
ATOM   499  C  CB    . LYS A 1 71  ? -3.556  -9.247  -2.589  1.00   52.28 ? 65   LYS A CB    1 
ATOM   500  C  CG    . LYS A 1 71  ? -3.946  -8.365  -1.432  1.00   54.39 ? 65   LYS A CG    1 
ATOM   501  C  CD    . LYS A 1 71  ? -2.740  -7.625  -0.870  1.00   57.75 ? 65   LYS A CD    1 
ATOM   502  C  CE    . LYS A 1 71  ? -3.143  -6.725  0.298   1.00   58.99 ? 65   LYS A CE    1 
ATOM   503  N  NZ    . LYS A 1 71  ? -2.059  -5.760  0.657   1.00   61.61 ? 65   LYS A NZ    1 
ATOM   504  N  N     . LYS A 1 72  ? -4.061  -11.535 -4.907  1.00   53.83 ? 66   LYS A N     1 
ATOM   505  C  CA    . LYS A 1 72  ? -3.675  -12.041 -6.222  1.00   54.60 ? 66   LYS A CA    1 
ATOM   506  C  C     . LYS A 1 72  ? -4.853  -11.914 -7.196  1.00   54.55 ? 66   LYS A C     1 
ATOM   507  O  O     . LYS A 1 72  ? -4.664  -11.729 -8.403  1.00   55.88 ? 66   LYS A O     1 
ATOM   508  C  CB    . LYS A 1 72  ? -3.247  -13.509 -6.150  1.00   55.78 ? 66   LYS A CB    1 
ATOM   509  C  CG    . LYS A 1 72  ? -1.832  -13.754 -5.653  1.00   57.74 ? 66   LYS A CG    1 
ATOM   510  C  CD    . LYS A 1 72  ? -1.273  -15.021 -6.290  1.00   60.41 ? 66   LYS A CD    1 
ATOM   511  C  CE    . LYS A 1 72  ? -1.186  -14.851 -7.821  1.00   63.17 ? 66   LYS A CE    1 
ATOM   512  N  NZ    . LYS A 1 72  ? -0.620  -16.021 -8.567  1.00   62.92 ? 66   LYS A NZ    1 
ATOM   513  N  N     . ILE A 1 73  ? -6.070  -12.035 -6.672  1.00   53.08 ? 67   ILE A N     1 
ATOM   514  C  CA    . ILE A 1 73  ? -7.262  -11.903 -7.501  1.00   51.18 ? 67   ILE A CA    1 
ATOM   515  C  C     . ILE A 1 73  ? -7.523  -10.417 -7.735  1.00   51.92 ? 67   ILE A C     1 
ATOM   516  O  O     . ILE A 1 73  ? -7.426  -9.949  -8.871  1.00   53.10 ? 67   ILE A O     1 
ATOM   517  C  CB    . ILE A 1 73  ? -8.511  -12.533 -6.832  1.00   50.38 ? 67   ILE A CB    1 
ATOM   518  C  CG1   . ILE A 1 73  ? -8.273  -14.020 -6.545  1.00   47.97 ? 67   ILE A CG1   1 
ATOM   519  C  CG2   . ILE A 1 73  ? -9.728  -12.354 -7.733  1.00   47.40 ? 67   ILE A CG2   1 
ATOM   520  C  CD1   . ILE A 1 73  ? -9.498  -14.754 -6.025  1.00   45.06 ? 67   ILE A CD1   1 
ATOM   521  N  N     . LEU A 1 74  ? -7.843  -9.682  -6.666  1.00   50.92 ? 68   LEU A N     1 
ATOM   522  C  CA    . LEU A 1 74  ? -8.101  -8.242  -6.765  1.00   50.60 ? 68   LEU A CA    1 
ATOM   523  C  C     . LEU A 1 74  ? -7.038  -7.404  -6.048  1.00   50.85 ? 68   LEU A C     1 
ATOM   524  O  O     . LEU A 1 74  ? -7.307  -6.825  -4.996  1.00   50.35 ? 68   LEU A O     1 
ATOM   525  C  CB    . LEU A 1 74  ? -9.474  -7.896  -6.180  1.00   50.81 ? 68   LEU A CB    1 
ATOM   526  C  CG    . LEU A 1 74  ? -10.732 -8.414  -6.880  1.00   51.42 ? 68   LEU A CG    1 
ATOM   527  C  CD1   . LEU A 1 74  ? -11.907 -7.587  -6.399  1.00   51.32 ? 68   LEU A CD1   1 
ATOM   528  C  CD2   . LEU A 1 74  ? -10.610 -8.300  -8.400  1.00   50.66 ? 68   LEU A CD2   1 
ATOM   529  N  N     . PRO A 1 75  ? -5.825  -7.304  -6.629  1.00   51.09 ? 69   PRO A N     1 
ATOM   530  C  CA    . PRO A 1 75  ? -4.720  -6.540  -6.043  1.00   50.79 ? 69   PRO A CA    1 
ATOM   531  C  C     . PRO A 1 75  ? -4.989  -5.060  -5.834  1.00   50.85 ? 69   PRO A C     1 
ATOM   532  O  O     . PRO A 1 75  ? -4.289  -4.407  -5.065  1.00   50.44 ? 69   PRO A O     1 
ATOM   533  C  CB    . PRO A 1 75  ? -3.587  -6.775  -7.036  1.00   50.60 ? 69   PRO A CB    1 
ATOM   534  C  CG    . PRO A 1 75  ? -4.309  -6.850  -8.317  1.00   48.58 ? 69   PRO A CG    1 
ATOM   535  C  CD    . PRO A 1 75  ? -5.456  -7.760  -7.982  1.00   48.97 ? 69   PRO A CD    1 
ATOM   536  N  N     . ASN A 1 76  ? -6.001  -4.538  -6.517  1.00   51.32 ? 70   ASN A N     1 
ATOM   537  C  CA    . ASN A 1 76  ? -6.337  -3.123  -6.420  1.00   52.50 ? 70   ASN A CA    1 
ATOM   538  C  C     . ASN A 1 76  ? -7.606  -2.839  -5.643  1.00   52.53 ? 70   ASN A C     1 
ATOM   539  O  O     . ASN A 1 76  ? -8.229  -1.795  -5.832  1.00   53.59 ? 70   ASN A O     1 
ATOM   540  C  CB    . ASN A 1 76  ? -6.477  -2.505  -7.819  1.00   55.01 ? 70   ASN A CB    1 
ATOM   541  C  CG    . ASN A 1 76  ? -5.140  -2.213  -8.469  1.00   55.99 ? 70   ASN A CG    1 
ATOM   542  O  OD1   . ASN A 1 76  ? -4.350  -1.417  -7.966  1.00   58.95 ? 70   ASN A OD1   1 
ATOM   543  N  ND2   . ASN A 1 76  ? -4.882  -2.857  -9.596  1.00   57.83 ? 70   ASN A ND2   1 
ATOM   544  N  N     . ALA A 1 77  ? -8.013  -3.762  -4.784  1.00   52.02 ? 71   ALA A N     1 
ATOM   545  C  CA    . ALA A 1 77  ? -9.209  -3.534  -3.985  1.00   51.40 ? 71   ALA A CA    1 
ATOM   546  C  C     . ALA A 1 77  ? -8.783  -2.814  -2.721  1.00   50.56 ? 71   ALA A C     1 
ATOM   547  O  O     . ALA A 1 77  ? -7.598  -2.769  -2.400  1.00   52.57 ? 71   ALA A O     1 
ATOM   548  C  CB    . ALA A 1 77  ? -9.881  -4.847  -3.634  1.00   52.30 ? 71   ALA A CB    1 
ATOM   549  N  N     . VAL A 1 78  ? -9.742  -2.245  -2.005  1.00   48.97 ? 72   VAL A N     1 
ATOM   550  C  CA    . VAL A 1 78  ? -9.431  -1.535  -0.769  1.00   47.16 ? 72   VAL A CA    1 
ATOM   551  C  C     . VAL A 1 78  ? -9.449  -2.490  0.411   1.00   45.95 ? 72   VAL A C     1 
ATOM   552  O  O     . VAL A 1 78  ? -10.523 -2.799  0.929   1.00   45.98 ? 72   VAL A O     1 
ATOM   553  C  CB    . VAL A 1 78  ? -10.457 -0.425  -0.465  1.00   46.71 ? 72   VAL A CB    1 
ATOM   554  C  CG1   . VAL A 1 78  ? -10.092 0.250   0.840   1.00   44.41 ? 72   VAL A CG1   1 
ATOM   555  C  CG2   . VAL A 1 78  ? -10.520 0.572   -1.610  1.00   44.68 ? 72   VAL A CG2   1 
ATOM   556  N  N     . TYR A 1 79  ? -8.268  -2.949  0.831   1.00   44.84 ? 73   TYR A N     1 
ATOM   557  C  CA    . TYR A 1 79  ? -8.130  -3.873  1.965   1.00   41.59 ? 73   TYR A CA    1 
ATOM   558  C  C     . TYR A 1 79  ? -8.040  -3.093  3.274   1.00   41.74 ? 73   TYR A C     1 
ATOM   559  O  O     . TYR A 1 79  ? -7.059  -2.396  3.522   1.00   42.09 ? 73   TYR A O     1 
ATOM   560  C  CB    . TYR A 1 79  ? -6.884  -4.748  1.791   1.00   40.63 ? 73   TYR A CB    1 
ATOM   561  C  CG    . TYR A 1 79  ? -6.949  -5.660  0.577   1.00   40.77 ? 73   TYR A CG    1 
ATOM   562  C  CD1   . TYR A 1 79  ? -6.939  -5.135  -0.717  1.00   41.23 ? 73   TYR A CD1   1 
ATOM   563  C  CD2   . TYR A 1 79  ? -7.108  -7.033  0.723   1.00   38.00 ? 73   TYR A CD2   1 
ATOM   564  C  CE1   . TYR A 1 79  ? -7.102  -5.962  -1.839  1.00   41.25 ? 73   TYR A CE1   1 
ATOM   565  C  CE2   . TYR A 1 79  ? -7.266  -7.848  -0.372  1.00   39.02 ? 73   TYR A CE2   1 
ATOM   566  C  CZ    . TYR A 1 79  ? -7.271  -7.314  -1.654  1.00   39.20 ? 73   TYR A CZ    1 
ATOM   567  O  OH    . TYR A 1 79  ? -7.506  -8.112  -2.756  1.00   37.82 ? 73   TYR A OH    1 
ATOM   568  N  N     . LEU A 1 80  ? -9.069  -3.217  4.110   1.00   40.87 ? 74   LEU A N     1 
ATOM   569  C  CA    . LEU A 1 80  ? -9.133  -2.501  5.375   1.00   40.28 ? 74   LEU A CA    1 
ATOM   570  C  C     . LEU A 1 80  ? -9.107  -3.432  6.555   1.00   39.95 ? 74   LEU A C     1 
ATOM   571  O  O     . LEU A 1 80  ? -9.686  -4.498  6.494   1.00   40.52 ? 74   LEU A O     1 
ATOM   572  C  CB    . LEU A 1 80  ? -10.419 -1.690  5.449   1.00   40.66 ? 74   LEU A CB    1 
ATOM   573  C  CG    . LEU A 1 80  ? -10.593 -0.590  4.416   1.00   40.35 ? 74   LEU A CG    1 
ATOM   574  C  CD1   . LEU A 1 80  ? -11.982 0.005   4.536   1.00   38.52 ? 74   LEU A CD1   1 
ATOM   575  C  CD2   . LEU A 1 80  ? -9.506  0.454   4.619   1.00   39.93 ? 74   LEU A CD2   1 
ATOM   576  N  N     . PRO A 1 81  ? -8.465  -3.015  7.665   1.00   41.35 ? 75   PRO A N     1 
ATOM   577  C  CA    . PRO A 1 81  ? -8.348  -3.803  8.902   1.00   41.50 ? 75   PRO A CA    1 
ATOM   578  C  C     . PRO A 1 81  ? -9.654  -3.841  9.685   1.00   40.84 ? 75   PRO A C     1 
ATOM   579  O  O     . PRO A 1 81  ? -10.411 -2.876  9.662   1.00   39.41 ? 75   PRO A O     1 
ATOM   580  C  CB    . PRO A 1 81  ? -7.240  -3.067  9.668   1.00   38.87 ? 75   PRO A CB    1 
ATOM   581  C  CG    . PRO A 1 81  ? -7.510  -1.642  9.317   1.00   38.58 ? 75   PRO A CG    1 
ATOM   582  C  CD    . PRO A 1 81  ? -7.747  -1.730  7.809   1.00   40.78 ? 75   PRO A CD    1 
ATOM   583  N  N     . MET A 1 82  ? -9.910  -4.935  10.399  1.00   41.48 ? 76   MET A N     1 
ATOM   584  C  CA    . MET A 1 82  ? -11.141 -5.019  11.170  1.00   42.97 ? 76   MET A CA    1 
ATOM   585  C  C     . MET A 1 82  ? -11.242 -4.040  12.347  1.00   43.70 ? 76   MET A C     1 
ATOM   586  O  O     . MET A 1 82  ? -10.324 -3.905  13.147  1.00   44.02 ? 76   MET A O     1 
ATOM   587  C  CB    . MET A 1 82  ? -11.390 -6.445  11.659  1.00   42.68 ? 76   MET A CB    1 
ATOM   588  C  CG    . MET A 1 82  ? -12.734 -6.572  12.383  1.00   44.64 ? 76   MET A CG    1 
ATOM   589  S  SD    . MET A 1 82  ? -13.748 -7.957  11.834  1.00   41.69 ? 76   MET A SD    1 
ATOM   590  C  CE    . MET A 1 82  ? -13.243 -9.255  12.992  1.00   45.38 ? 76   MET A CE    1 
ATOM   591  N  N     . ARG A 1 83  ? -12.380 -3.349  12.412  1.00   43.99 ? 77   ARG A N     1 
ATOM   592  C  CA    . ARG A 1 83  ? -12.694 -2.378  13.456  1.00   42.48 ? 77   ARG A CA    1 
ATOM   593  C  C     . ARG A 1 83  ? -14.048 -2.780  13.997  1.00   43.40 ? 77   ARG A C     1 
ATOM   594  O  O     . ARG A 1 83  ? -15.068 -2.114  13.767  1.00   41.62 ? 77   ARG A O     1 
ATOM   595  C  CB    . ARG A 1 83  ? -12.783 -0.985  12.873  1.00   42.06 ? 77   ARG A CB    1 
ATOM   596  C  CG    . ARG A 1 83  ? -11.474 -0.488  12.345  1.00   43.27 ? 77   ARG A CG    1 
ATOM   597  C  CD    . ARG A 1 83  ? -11.557 0.975   12.050  1.00   43.35 ? 77   ARG A CD    1 
ATOM   598  N  NE    . ARG A 1 83  ? -12.550 1.253   11.024  1.00   44.82 ? 77   ARG A NE    1 
ATOM   599  C  CZ    . ARG A 1 83  ? -12.789 2.465   10.538  1.00   44.70 ? 77   ARG A CZ    1 
ATOM   600  N  NH1   . ARG A 1 83  ? -12.108 3.502   10.990  1.00   41.75 ? 77   ARG A NH1   1 
ATOM   601  N  NH2   . ARG A 1 83  ? -13.704 2.639   9.597   1.00   46.48 ? 77   ARG A NH2   1 
ATOM   602  N  N     . LYS A 1 84  ? -14.030 -3.891  14.716  1.00   43.44 ? 78   LYS A N     1 
ATOM   603  C  CA    . LYS A 1 84  ? -15.221 -4.479  15.284  1.00   43.91 ? 78   LYS A CA    1 
ATOM   604  C  C     . LYS A 1 84  ? -16.000 -3.489  16.123  1.00   43.37 ? 78   LYS A C     1 
ATOM   605  O  O     . LYS A 1 84  ? -17.219 -3.390  16.018  1.00   40.82 ? 78   LYS A O     1 
ATOM   606  C  CB    . LYS A 1 84  ? -14.814 -5.693  16.115  1.00   45.44 ? 78   LYS A CB    1 
ATOM   607  C  CG    . LYS A 1 84  ? -15.967 -6.512  16.650  1.00   50.12 ? 78   LYS A CG    1 
ATOM   608  C  CD    . LYS A 1 84  ? -16.499 -7.484  15.633  1.00   49.20 ? 78   LYS A CD    1 
ATOM   609  C  CE    . LYS A 1 84  ? -17.514 -8.421  16.286  1.00   52.52 ? 78   LYS A CE    1 
ATOM   610  N  NZ    . LYS A 1 84  ? -17.017 -9.154  17.507  1.00   51.48 ? 78   LYS A NZ    1 
ATOM   611  N  N     . GLU A 1 85  ? -15.270 -2.745  16.944  1.00   44.84 ? 79   GLU A N     1 
ATOM   612  C  CA    . GLU A 1 85  ? -15.848 -1.754  17.845  1.00   44.38 ? 79   GLU A CA    1 
ATOM   613  C  C     . GLU A 1 85  ? -16.798 -0.856  17.072  1.00   44.95 ? 79   GLU A C     1 
ATOM   614  O  O     . GLU A 1 85  ? -17.996 -0.768  17.393  1.00   44.58 ? 79   GLU A O     1 
ATOM   615  C  CB    . GLU A 1 85  ? -14.736 -0.922  18.481  1.00   44.77 ? 79   GLU A CB    1 
ATOM   616  C  CG    . GLU A 1 85  ? -13.548 -1.741  18.986  0.50   43.70 ? 79   GLU A CG    1 
ATOM   617  C  CD    . GLU A 1 85  ? -12.899 -2.574  17.887  0.50   43.00 ? 79   GLU A CD    1 
ATOM   618  O  OE1   . GLU A 1 85  ? -12.513 -2.006  16.846  0.50   42.62 ? 79   GLU A OE1   1 
ATOM   619  O  OE2   . GLU A 1 85  ? -12.775 -3.802  18.061  0.50   43.78 ? 79   GLU A OE2   1 
ATOM   620  N  N     . VAL A 1 86  ? -16.270 -0.194  16.045  1.00   44.82 ? 80   VAL A N     1 
ATOM   621  C  CA    . VAL A 1 86  ? -17.105 0.678   15.230  1.00   45.14 ? 80   VAL A CA    1 
ATOM   622  C  C     . VAL A 1 86  ? -18.378 -0.056  14.798  1.00   46.39 ? 80   VAL A C     1 
ATOM   623  O  O     . VAL A 1 86  ? -19.478 0.427   15.060  1.00   48.54 ? 80   VAL A O     1 
ATOM   624  C  CB    . VAL A 1 86  ? -16.353 1.188   13.976  1.00   44.74 ? 80   VAL A CB    1 
ATOM   625  C  CG1   . VAL A 1 86  ? -17.239 2.170   13.192  1.00   42.14 ? 80   VAL A CG1   1 
ATOM   626  C  CG2   . VAL A 1 86  ? -15.051 1.886   14.401  1.00   44.45 ? 80   VAL A CG2   1 
ATOM   627  N  N     . TYR A 1 87  ? -18.229 -1.227  14.167  1.00   46.54 ? 81   TYR A N     1 
ATOM   628  C  CA    . TYR A 1 87  ? -19.379 -2.018  13.708  1.00   46.09 ? 81   TYR A CA    1 
ATOM   629  C  C     . TYR A 1 87  ? -20.321 -2.332  14.869  1.00   47.25 ? 81   TYR A C     1 
ATOM   630  O  O     . TYR A 1 87  ? -21.538 -2.413  14.696  1.00   48.42 ? 81   TYR A O     1 
ATOM   631  C  CB    . TYR A 1 87  ? -18.945 -3.360  13.079  1.00   46.73 ? 81   TYR A CB    1 
ATOM   632  C  CG    . TYR A 1 87  ? -17.757 -3.312  12.139  1.00   45.07 ? 81   TYR A CG    1 
ATOM   633  C  CD1   . TYR A 1 87  ? -17.667 -2.346  11.145  1.00   44.81 ? 81   TYR A CD1   1 
ATOM   634  C  CD2   . TYR A 1 87  ? -16.696 -4.209  12.282  1.00   45.03 ? 81   TYR A CD2   1 
ATOM   635  C  CE1   . TYR A 1 87  ? -16.549 -2.265  10.331  1.00   45.33 ? 81   TYR A CE1   1 
ATOM   636  C  CE2   . TYR A 1 87  ? -15.568 -4.136  11.460  1.00   44.66 ? 81   TYR A CE2   1 
ATOM   637  C  CZ    . TYR A 1 87  ? -15.508 -3.158  10.498  1.00   44.69 ? 81   TYR A CZ    1 
ATOM   638  O  OH    . TYR A 1 87  ? -14.403 -3.028  9.715   1.00   45.77 ? 81   TYR A OH    1 
ATOM   639  N  N     . GLN A 1 88  ? -19.752 -2.530  16.051  1.00   47.44 ? 82   GLN A N     1 
ATOM   640  C  CA    . GLN A 1 88  ? -20.553 -2.831  17.219  1.00   48.22 ? 82   GLN A CA    1 
ATOM   641  C  C     . GLN A 1 88  ? -21.513 -1.688  17.523  1.00   48.80 ? 82   GLN A C     1 
ATOM   642  O  O     . GLN A 1 88  ? -22.725 -1.900  17.617  1.00   48.76 ? 82   GLN A O     1 
ATOM   643  C  CB    . GLN A 1 88  ? -19.662 -3.078  18.431  1.00   49.86 ? 82   GLN A CB    1 
ATOM   644  C  CG    . GLN A 1 88  ? -20.370 -3.829  19.528  1.00   52.93 ? 82   GLN A CG    1 
ATOM   645  C  CD    . GLN A 1 88  ? -20.841 -5.190  19.064  1.00   55.44 ? 82   GLN A CD    1 
ATOM   646  O  OE1   . GLN A 1 88  ? -20.022 -6.077  18.809  1.00   57.06 ? 82   GLN A OE1   1 
ATOM   647  N  NE2   . GLN A 1 88  ? -22.168 -5.366  18.941  1.00   53.35 ? 82   GLN A NE2   1 
ATOM   648  N  N     . GLN A 1 89  ? -20.984 -0.475  17.672  1.00   48.59 ? 83   GLN A N     1 
ATOM   649  C  CA    . GLN A 1 89  ? -21.847 0.656   17.978  1.00   48.11 ? 83   GLN A CA    1 
ATOM   650  C  C     . GLN A 1 89  ? -22.883 0.853   16.898  1.00   47.05 ? 83   GLN A C     1 
ATOM   651  O  O     . GLN A 1 89  ? -24.055 1.071   17.194  1.00   45.59 ? 83   GLN A O     1 
ATOM   652  C  CB    . GLN A 1 89  ? -21.041 1.935   18.149  1.00   49.93 ? 83   GLN A CB    1 
ATOM   653  C  CG    . GLN A 1 89  ? -20.316 2.018   19.473  1.00   54.32 ? 83   GLN A CG    1 
ATOM   654  C  CD    . GLN A 1 89  ? -19.766 3.398   19.731  1.00   57.14 ? 83   GLN A CD    1 
ATOM   655  O  OE1   . GLN A 1 89  ? -20.522 4.371   19.842  1.00   58.07 ? 83   GLN A OE1   1 
ATOM   656  N  NE2   . GLN A 1 89  ? -18.445 3.499   19.819  1.00   57.48 ? 83   GLN A NE2   1 
ATOM   657  N  N     . VAL A 1 90  ? -22.452 0.765   15.647  1.00   44.93 ? 84   VAL A N     1 
ATOM   658  C  CA    . VAL A 1 90  ? -23.375 0.942   14.542  1.00   44.93 ? 84   VAL A CA    1 
ATOM   659  C  C     . VAL A 1 90  ? -24.471 -0.105  14.654  1.00   46.39 ? 84   VAL A C     1 
ATOM   660  O  O     . VAL A 1 90  ? -25.648 0.168   14.418  1.00   45.69 ? 84   VAL A O     1 
ATOM   661  C  CB    . VAL A 1 90  ? -22.658 0.789   13.204  1.00   44.02 ? 84   VAL A CB    1 
ATOM   662  C  CG1   . VAL A 1 90  ? -23.576 1.185   12.070  1.00   42.27 ? 84   VAL A CG1   1 
ATOM   663  C  CG2   . VAL A 1 90  ? -21.425 1.647   13.187  1.00   44.78 ? 84   VAL A CG2   1 
ATOM   664  N  N     . SER A 1 91  ? -24.070 -1.312  15.027  1.00   48.67 ? 85   SER A N     1 
ATOM   665  C  CA    . SER A 1 91  ? -25.013 -2.412  15.187  1.00   50.19 ? 85   SER A CA    1 
ATOM   666  C  C     . SER A 1 91  ? -26.026 -2.123  16.286  1.00   50.11 ? 85   SER A C     1 
ATOM   667  O  O     . SER A 1 91  ? -27.229 -2.309  16.107  1.00   49.66 ? 85   SER A O     1 
ATOM   668  C  CB    . SER A 1 91  ? -24.269 -3.694  15.539  1.00   50.57 ? 85   SER A CB    1 
ATOM   669  O  OG    . SER A 1 91  ? -25.187 -4.733  15.850  1.00   51.27 ? 85   SER A OG    1 
ATOM   670  N  N     . SER A 1 92  ? -25.525 -1.673  17.427  1.00   50.43 ? 86   SER A N     1 
ATOM   671  C  CA    . SER A 1 92  ? -26.378 -1.362  18.554  1.00   51.62 ? 86   SER A CA    1 
ATOM   672  C  C     . SER A 1 92  ? -27.463 -0.394  18.138  1.00   52.38 ? 86   SER A C     1 
ATOM   673  O  O     . SER A 1 92  ? -28.644 -0.627  18.389  1.00   54.39 ? 86   SER A O     1 
ATOM   674  C  CB    . SER A 1 92  ? -25.557 -0.739  19.667  1.00   52.96 ? 86   SER A CB    1 
ATOM   675  O  OG    . SER A 1 92  ? -24.505 -1.600  20.044  1.00   57.49 ? 86   SER A OG    1 
ATOM   676  N  N     . ARG A 1 93  ? -27.057 0.693   17.495  1.00   51.99 ? 87   ARG A N     1 
ATOM   677  C  CA    . ARG A 1 93  ? -28.005 1.702   17.056  1.00   51.05 ? 87   ARG A CA    1 
ATOM   678  C  C     . ARG A 1 93  ? -29.067 1.080   16.181  1.00   49.20 ? 87   ARG A C     1 
ATOM   679  O  O     . ARG A 1 93  ? -30.247 1.321   16.372  1.00   48.87 ? 87   ARG A O     1 
ATOM   680  C  CB    . ARG A 1 93  ? -27.292 2.829   16.288  1.00   52.27 ? 87   ARG A CB    1 
ATOM   681  C  CG    . ARG A 1 93  ? -26.253 3.608   17.120  1.00   52.35 ? 87   ARG A CG    1 
ATOM   682  C  CD    . ARG A 1 93  ? -25.985 5.000   16.565  1.00   49.98 ? 87   ARG A CD    1 
ATOM   683  N  NE    . ARG A 1 93  ? -25.407 4.978   15.229  1.00   48.91 ? 87   ARG A NE    1 
ATOM   684  C  CZ    . ARG A 1 93  ? -24.109 4.890   14.973  1.00   46.63 ? 87   ARG A CZ    1 
ATOM   685  N  NH1   . ARG A 1 93  ? -23.233 4.818   15.959  1.00   45.31 ? 87   ARG A NH1   1 
ATOM   686  N  NH2   . ARG A 1 93  ? -23.697 4.871   13.719  1.00   45.89 ? 87   ARG A NH2   1 
ATOM   687  N  N     . ILE A 1 94  ? -28.651 0.270   15.220  1.00   49.32 ? 88   ILE A N     1 
ATOM   688  C  CA    . ILE A 1 94  ? -29.621 -0.351  14.339  1.00   49.18 ? 88   ILE A CA    1 
ATOM   689  C  C     . ILE A 1 94  ? -30.493 -1.299  15.117  1.00   50.12 ? 88   ILE A C     1 
ATOM   690  O  O     . ILE A 1 94  ? -31.664 -1.456  14.803  1.00   50.60 ? 88   ILE A O     1 
ATOM   691  C  CB    . ILE A 1 94  ? -28.974 -1.139  13.190  1.00   47.52 ? 88   ILE A CB    1 
ATOM   692  C  CG1   . ILE A 1 94  ? -28.206 -0.192  12.266  1.00   46.83 ? 88   ILE A CG1   1 
ATOM   693  C  CG2   . ILE A 1 94  ? -30.060 -1.839  12.400  1.00   47.45 ? 88   ILE A CG2   1 
ATOM   694  C  CD1   . ILE A 1 94  ? -27.523 -0.863  11.104  1.00   42.32 ? 88   ILE A CD1   1 
ATOM   695  N  N     . MET A 1 95  ? -29.926 -1.937  16.134  1.00   51.44 ? 89   MET A N     1 
ATOM   696  C  CA    . MET A 1 95  ? -30.708 -2.869  16.936  1.00   52.73 ? 89   MET A CA    1 
ATOM   697  C  C     . MET A 1 95  ? -31.792 -2.127  17.709  1.00   54.56 ? 89   MET A C     1 
ATOM   698  O  O     . MET A 1 95  ? -32.974 -2.472  17.599  1.00   54.57 ? 89   MET A O     1 
ATOM   699  C  CB    . MET A 1 95  ? -29.802 -3.661  17.873  1.00   50.67 ? 89   MET A CB    1 
ATOM   700  C  CG    . MET A 1 95  ? -28.982 -4.690  17.116  1.00   50.18 ? 89   MET A CG    1 
ATOM   701  S  SD    . MET A 1 95  ? -30.019 -5.649  15.942  1.00   51.75 ? 89   MET A SD    1 
ATOM   702  C  CE    . MET A 1 95  ? -28.817 -6.595  15.125  1.00   48.89 ? 89   MET A CE    1 
ATOM   703  N  N     . ASN A 1 96  ? -31.399 -1.108  18.474  1.00   55.92 ? 90   ASN A N     1 
ATOM   704  C  CA    . ASN A 1 96  ? -32.366 -0.308  19.220  1.00   57.26 ? 90   ASN A CA    1 
ATOM   705  C  C     . ASN A 1 96  ? -33.383 0.296   18.260  1.00   58.80 ? 90   ASN A C     1 
ATOM   706  O  O     . ASN A 1 96  ? -34.514 0.618   18.639  1.00   59.28 ? 90   ASN A O     1 
ATOM   707  C  CB    . ASN A 1 96  ? -31.671 0.811   19.973  1.00   56.54 ? 90   ASN A CB    1 
ATOM   708  C  CG    . ASN A 1 96  ? -30.851 0.300   21.105  1.00   57.57 ? 90   ASN A CG    1 
ATOM   709  O  OD1   . ASN A 1 96  ? -31.296 -0.578  21.847  1.00   55.91 ? 90   ASN A OD1   1 
ATOM   710  N  ND2   . ASN A 1 96  ? -29.644 0.846   21.265  1.00   58.06 ? 90   ASN A ND2   1 
ATOM   711  N  N     . LEU A 1 97  ? -32.969 0.452   17.011  1.00   59.44 ? 91   LEU A N     1 
ATOM   712  C  CA    . LEU A 1 97  ? -33.855 1.002   16.009  1.00   60.00 ? 91   LEU A CA    1 
ATOM   713  C  C     . LEU A 1 97  ? -34.933 -0.045  15.777  1.00   60.80 ? 91   LEU A C     1 
ATOM   714  O  O     . LEU A 1 97  ? -36.117 0.274   15.732  1.00   59.77 ? 91   LEU A O     1 
ATOM   715  C  CB    . LEU A 1 97  ? -33.086 1.269   14.719  1.00   59.15 ? 91   LEU A CB    1 
ATOM   716  C  CG    . LEU A 1 97  ? -33.503 2.486   13.895  1.00   58.52 ? 91   LEU A CG    1 
ATOM   717  C  CD1   . LEU A 1 97  ? -33.015 2.306   12.463  1.00   57.91 ? 91   LEU A CD1   1 
ATOM   718  C  CD2   . LEU A 1 97  ? -35.003 2.637   13.916  1.00   57.72 ? 91   LEU A CD2   1 
ATOM   719  N  N     . LEU A 1 98  ? -34.504 -1.301  15.639  1.00   62.29 ? 92   LEU A N     1 
ATOM   720  C  CA    . LEU A 1 98  ? -35.420 -2.421  15.420  1.00   62.60 ? 92   LEU A CA    1 
ATOM   721  C  C     . LEU A 1 98  ? -36.187 -2.671  16.710  1.00   63.42 ? 92   LEU A C     1 
ATOM   722  O  O     . LEU A 1 98  ? -37.383 -2.978  16.709  1.00   63.04 ? 92   LEU A O     1 
ATOM   723  C  CB    . LEU A 1 98  ? -34.641 -3.688  15.050  1.00   60.73 ? 92   LEU A CB    1 
ATOM   724  C  CG    . LEU A 1 98  ? -33.982 -3.786  13.675  1.00   59.75 ? 92   LEU A CG    1 
ATOM   725  C  CD1   . LEU A 1 98  ? -33.209 -5.077  13.592  1.00   59.33 ? 92   LEU A CD1   1 
ATOM   726  C  CD2   . LEU A 1 98  ? -35.024 -3.730  12.589  1.00   57.97 ? 92   LEU A CD2   1 
ATOM   727  N  N     . ARG A 1 99  ? -35.469 -2.519  17.811  1.00   64.72 ? 93   ARG A N     1 
ATOM   728  C  CA    . ARG A 1 99  ? -36.000 -2.723  19.141  1.00   66.59 ? 93   ARG A CA    1 
ATOM   729  C  C     . ARG A 1 99  ? -37.297 -1.950  19.334  1.00   68.08 ? 93   ARG A C     1 
ATOM   730  O  O     . ARG A 1 99  ? -37.949 -2.077  20.361  1.00   68.27 ? 93   ARG A O     1 
ATOM   731  C  CB    . ARG A 1 99  ? -34.952 -2.265  20.150  1.00   67.88 ? 93   ARG A CB    1 
ATOM   732  C  CG    . ARG A 1 99  ? -35.015 -2.929  21.498  1.00   69.05 ? 93   ARG A CG    1 
ATOM   733  C  CD    . ARG A 1 99  ? -34.025 -2.284  22.463  1.00   69.56 ? 93   ARG A CD    1 
ATOM   734  N  NE    . ARG A 1 99  ? -32.637 -2.681  22.238  1.00   69.71 ? 93   ARG A NE    1 
ATOM   735  C  CZ    . ARG A 1 99  ? -32.196 -3.934  22.299  1.00   70.54 ? 93   ARG A CZ    1 
ATOM   736  N  NH1   . ARG A 1 99  ? -33.040 -4.926  22.566  1.00   71.25 ? 93   ARG A NH1   1 
ATOM   737  N  NH2   . ARG A 1 99  ? -30.904 -4.191  22.129  1.00   70.19 ? 93   ARG A NH2   1 
ATOM   738  N  N     . GLU A 1 100 ? -37.660 -1.142  18.343  1.00   70.54 ? 94   GLU A N     1 
ATOM   739  C  CA    . GLU A 1 100 ? -38.887 -0.354  18.410  1.00   72.77 ? 94   GLU A CA    1 
ATOM   740  C  C     . GLU A 1 100 ? -39.957 -0.844  17.422  1.00   74.25 ? 94   GLU A C     1 
ATOM   741  O  O     . GLU A 1 100 ? -40.709 -0.051  16.847  1.00   75.04 ? 94   GLU A O     1 
ATOM   742  C  CB    . GLU A 1 100 ? -38.599 1.136   18.163  1.00   72.01 ? 94   GLU A CB    1 
ATOM   743  C  CG    . GLU A 1 100 ? -38.265 1.488   16.731  0.50   70.62 ? 94   GLU A CG    1 
ATOM   744  C  CD    . GLU A 1 100 ? -38.195 2.982   16.493  0.50   70.08 ? 94   GLU A CD    1 
ATOM   745  O  OE1   . GLU A 1 100 ? -37.482 3.676   17.246  0.50   69.72 ? 94   GLU A OE1   1 
ATOM   746  O  OE2   . GLU A 1 100 ? -38.852 3.463   15.546  0.50   69.99 ? 94   GLU A OE2   1 
ATOM   747  N  N     . TYR A 1 101 ? -40.010 -2.153  17.216  1.00   75.51 ? 95   TYR A N     1 
ATOM   748  C  CA    . TYR A 1 101 ? -41.010 -2.749  16.338  1.00   76.68 ? 95   TYR A CA    1 
ATOM   749  C  C     . TYR A 1 101 ? -41.494 -4.017  17.029  1.00   77.00 ? 95   TYR A C     1 
ATOM   750  O  O     . TYR A 1 101 ? -42.381 -4.710  16.535  1.00   76.51 ? 95   TYR A O     1 
ATOM   751  C  CB    . TYR A 1 101 ? -40.424 -3.086  14.959  1.00   77.21 ? 95   TYR A CB    1 
ATOM   752  C  CG    . TYR A 1 101 ? -40.162 -1.881  14.085  1.00   77.74 ? 95   TYR A CG    1 
ATOM   753  C  CD1   . TYR A 1 101 ? -39.012 -1.116  14.244  1.00   78.65 ? 95   TYR A CD1   1 
ATOM   754  C  CD2   . TYR A 1 101 ? -41.077 -1.493  13.109  1.00   79.06 ? 95   TYR A CD2   1 
ATOM   755  C  CE1   . TYR A 1 101 ? -38.776 0.012   13.451  1.00   78.97 ? 95   TYR A CE1   1 
ATOM   756  C  CE2   . TYR A 1 101 ? -40.852 -0.364  12.308  1.00   79.42 ? 95   TYR A CE2   1 
ATOM   757  C  CZ    . TYR A 1 101 ? -39.700 0.382   12.485  1.00   79.07 ? 95   TYR A CZ    1 
ATOM   758  O  OH    . TYR A 1 101 ? -39.468 1.494   11.705  1.00   79.09 ? 95   TYR A OH    1 
ATOM   759  N  N     . SER A 1 102 ? -40.896 -4.291  18.188  1.00   77.54 ? 96   SER A N     1 
ATOM   760  C  CA    . SER A 1 102 ? -41.221 -5.451  19.010  1.00   78.61 ? 96   SER A CA    1 
ATOM   761  C  C     . SER A 1 102 ? -40.059 -5.736  19.969  1.00   78.60 ? 96   SER A C     1 
ATOM   762  O  O     . SER A 1 102 ? -39.064 -6.338  19.563  1.00   79.33 ? 96   SER A O     1 
ATOM   763  C  CB    . SER A 1 102 ? -41.477 -6.685  18.123  1.00   79.94 ? 96   SER A CB    1 
ATOM   764  O  OG    . SER A 1 102 ? -41.841 -7.828  18.890  1.00   81.50 ? 96   SER A OG    1 
ATOM   765  N  N     . GLU A 1 103 ? -40.171 -5.303  21.228  1.00   78.17 ? 97   GLU A N     1 
ATOM   766  C  CA    . GLU A 1 103 ? -39.107 -5.564  22.196  1.00   77.59 ? 97   GLU A CA    1 
ATOM   767  C  C     . GLU A 1 103 ? -39.162 -7.038  22.612  1.00   77.39 ? 97   GLU A C     1 
ATOM   768  O  O     . GLU A 1 103 ? -38.816 -7.423  23.733  1.00   77.37 ? 97   GLU A O     1 
ATOM   769  C  CB    . GLU A 1 103 ? -39.222 -4.650  23.419  1.00   77.74 ? 97   GLU A CB    1 
ATOM   770  C  CG    . GLU A 1 103 ? -38.098 -4.864  24.438  1.00   77.65 ? 97   GLU A CG    1 
ATOM   771  C  CD    . GLU A 1 103 ? -36.723 -4.511  23.899  0.50   76.62 ? 97   GLU A CD    1 
ATOM   772  O  OE1   . GLU A 1 103 ? -36.426 -3.305  23.802  0.50   76.20 ? 97   GLU A OE1   1 
ATOM   773  O  OE2   . GLU A 1 103 ? -35.946 -5.435  23.574  0.50   75.80 ? 97   GLU A OE2   1 
ATOM   774  N  N     . LYS A 1 104 ? -39.626 -7.852  21.673  1.00   76.63 ? 98   LYS A N     1 
ATOM   775  C  CA    . LYS A 1 104 ? -39.719 -9.294  21.816  1.00   75.78 ? 98   LYS A CA    1 
ATOM   776  C  C     . LYS A 1 104 ? -38.881 -9.692  20.607  1.00   74.33 ? 98   LYS A C     1 
ATOM   777  O  O     . LYS A 1 104 ? -39.311 -10.407 19.698  1.00   74.91 ? 98   LYS A O     1 
ATOM   778  C  CB    . LYS A 1 104 ? -41.169 -9.747  21.662  0.50   76.69 ? 98   LYS A CB    1 
ATOM   779  C  CG    . LYS A 1 104 ? -42.126 -9.064  22.631  0.50   77.17 ? 98   LYS A CG    1 
ATOM   780  C  CD    . LYS A 1 104 ? -43.531 -9.641  22.548  0.50   77.83 ? 98   LYS A CD    1 
ATOM   781  C  CE    . LYS A 1 104 ? -44.238 -9.260  21.257  0.50   78.79 ? 98   LYS A CE    1 
ATOM   782  N  NZ    . LYS A 1 104 ? -43.476 -9.665  20.047  0.50   80.60 ? 98   LYS A NZ    1 
ATOM   783  N  N     . ILE A 1 105 ? -37.671 -9.155  20.614  1.00   72.13 ? 99   ILE A N     1 
ATOM   784  C  CA    . ILE A 1 105 ? -36.698 -9.346  19.557  1.00   69.84 ? 99   ILE A CA    1 
ATOM   785  C  C     . ILE A 1 105 ? -35.596 -10.232 20.111  1.00   68.26 ? 99   ILE A C     1 
ATOM   786  O  O     . ILE A 1 105 ? -35.512 -10.436 21.327  1.00   68.77 ? 99   ILE A O     1 
ATOM   787  C  CB    . ILE A 1 105 ? -36.089 -7.985  19.175  1.00   70.20 ? 99   ILE A CB    1 
ATOM   788  C  CG1   . ILE A 1 105 ? -35.178 -8.128  17.957  1.00   69.83 ? 99   ILE A CG1   1 
ATOM   789  C  CG2   . ILE A 1 105 ? -35.296 -7.426  20.370  1.00   70.28 ? 99   ILE A CG2   1 
ATOM   790  C  CD1   . ILE A 1 105 ? -34.450 -6.850  17.592  1.00   68.02 ? 99   ILE A CD1   1 
ATOM   791  N  N     . GLU A 1 106 ? -34.760 -10.750 19.214  1.00   65.12 ? 100  GLU A N     1 
ATOM   792  C  CA    . GLU A 1 106 ? -33.629 -11.596 19.583  1.00   61.41 ? 100  GLU A CA    1 
ATOM   793  C  C     . GLU A 1 106 ? -32.444 -11.169 18.737  1.00   56.75 ? 100  GLU A C     1 
ATOM   794  O  O     . GLU A 1 106 ? -32.448 -11.349 17.530  1.00   56.76 ? 100  GLU A O     1 
ATOM   795  C  CB    . GLU A 1 106 ? -33.935 -13.078 19.323  1.00   63.69 ? 100  GLU A CB    1 
ATOM   796  C  CG    . GLU A 1 106 ? -32.704 -13.987 19.368  1.00   67.20 ? 100  GLU A CG    1 
ATOM   797  C  CD    . GLU A 1 106 ? -33.046 -15.465 19.262  1.00   69.94 ? 100  GLU A CD    1 
ATOM   798  O  OE1   . GLU A 1 106 ? -32.111 -16.297 19.158  1.00   70.29 ? 100  GLU A OE1   1 
ATOM   799  O  OE2   . GLU A 1 106 ? -34.252 -15.791 19.293  1.00   72.25 ? 100  GLU A OE2   1 
ATOM   800  N  N     . ILE A 1 107 ? -31.438 -10.585 19.370  1.00   52.42 ? 101  ILE A N     1 
ATOM   801  C  CA    . ILE A 1 107 ? -30.249 -10.138 18.658  1.00   47.41 ? 101  ILE A CA    1 
ATOM   802  C  C     . ILE A 1 107 ? -29.311 -11.326 18.536  1.00   45.27 ? 101  ILE A C     1 
ATOM   803  O  O     . ILE A 1 107 ? -28.423 -11.521 19.372  1.00   44.40 ? 101  ILE A O     1 
ATOM   804  C  CB    . ILE A 1 107 ? -29.542 -9.027  19.426  1.00   46.97 ? 101  ILE A CB    1 
ATOM   805  C  CG1   . ILE A 1 107 ? -30.488 -7.852  19.606  1.00   44.85 ? 101  ILE A CG1   1 
ATOM   806  C  CG2   . ILE A 1 107 ? -28.276 -8.608  18.697  1.00   47.79 ? 101  ILE A CG2   1 
ATOM   807  C  CD1   . ILE A 1 107 ? -30.135 -7.006  20.807  1.00   45.29 ? 101  ILE A CD1   1 
ATOM   808  N  N     . ALA A 1 108 ? -29.528 -12.110 17.485  1.00   42.30 ? 102  ALA A N     1 
ATOM   809  C  CA    . ALA A 1 108 ? -28.757 -13.310 17.201  1.00   40.51 ? 102  ALA A CA    1 
ATOM   810  C  C     . ALA A 1 108 ? -27.257 -13.072 17.109  1.00   40.23 ? 102  ALA A C     1 
ATOM   811  O  O     . ALA A 1 108 ? -26.471 -13.855 17.624  1.00   40.04 ? 102  ALA A O     1 
ATOM   812  C  CB    . ALA A 1 108 ? -29.262 -13.930 15.928  1.00   39.05 ? 102  ALA A CB    1 
ATOM   813  N  N     . SER A 1 109 ? -26.869 -11.988 16.445  1.00   40.35 ? 103  SER A N     1 
ATOM   814  C  CA    . SER A 1 109 ? -25.465 -11.629 16.286  1.00   38.69 ? 103  SER A CA    1 
ATOM   815  C  C     . SER A 1 109 ? -25.342 -10.151 16.002  1.00   37.83 ? 103  SER A C     1 
ATOM   816  O  O     . SER A 1 109 ? -26.325 -9.433  15.862  1.00   38.26 ? 103  SER A O     1 
ATOM   817  C  CB    . SER A 1 109 ? -24.821 -12.375 15.120  1.00   39.04 ? 103  SER A CB    1 
ATOM   818  O  OG    . SER A 1 109 ? -24.990 -11.655 13.900  1.00   40.57 ? 103  SER A OG    1 
ATOM   819  N  N     . ILE A 1 110 ? -24.107 -9.704  15.878  1.00   37.02 ? 104  ILE A N     1 
ATOM   820  C  CA    . ILE A 1 110 ? -23.838 -8.307  15.603  1.00   35.45 ? 104  ILE A CA    1 
ATOM   821  C  C     . ILE A 1 110 ? -24.575 -7.769  14.361  1.00   33.99 ? 104  ILE A C     1 
ATOM   822  O  O     . ILE A 1 110 ? -24.662 -6.567  14.165  1.00   33.37 ? 104  ILE A O     1 
ATOM   823  C  CB    . ILE A 1 110 ? -22.341 -8.109  15.388  1.00   36.19 ? 104  ILE A CB    1 
ATOM   824  C  CG1   . ILE A 1 110 ? -21.990 -6.625  15.428  1.00   37.11 ? 104  ILE A CG1   1 
ATOM   825  C  CG2   . ILE A 1 110 ? -21.955 -8.692  14.041  1.00   35.96 ? 104  ILE A CG2   1 
ATOM   826  C  CD1   . ILE A 1 110 ? -20.535 -6.337  15.084  1.00   40.20 ? 104  ILE A CD1   1 
ATOM   827  N  N     . ASP A 1 111 ? -25.110 -8.645  13.521  1.00   31.75 ? 105  ASP A N     1 
ATOM   828  C  CA    . ASP A 1 111 ? -25.778 -8.176  12.317  1.00   30.63 ? 105  ASP A CA    1 
ATOM   829  C  C     . ASP A 1 111 ? -27.031 -8.999  11.921  1.00   32.50 ? 105  ASP A C     1 
ATOM   830  O  O     . ASP A 1 111 ? -27.511 -8.926  10.775  1.00   28.06 ? 105  ASP A O     1 
ATOM   831  C  CB    . ASP A 1 111 ? -24.797 -8.266  11.202  1.00   26.37 ? 105  ASP A CB    1 
ATOM   832  C  CG    . ASP A 1 111 ? -24.760 -9.623  10.647  1.00   27.30 ? 105  ASP A CG    1 
ATOM   833  O  OD1   . ASP A 1 111 ? -24.902 -10.592 11.428  1.00   32.00 ? 105  ASP A OD1   1 
ATOM   834  O  OD2   . ASP A 1 111 ? -24.607 -9.741  9.450   1.00   20.50 ? 105  ASP A OD2   1 
ATOM   835  N  N     . GLU A 1 112 ? -27.509 -9.807  12.860  1.00   35.83 ? 106  GLU A N     1 
ATOM   836  C  CA    . GLU A 1 112 ? -28.681 -10.653 12.663  1.00   39.76 ? 106  GLU A CA    1 
ATOM   837  C  C     . GLU A 1 112 ? -29.615 -10.342 13.811  1.00   40.84 ? 106  GLU A C     1 
ATOM   838  O  O     . GLU A 1 112 ? -29.174 -10.053 14.928  1.00   39.93 ? 106  GLU A O     1 
ATOM   839  C  CB    . GLU A 1 112 ? -28.333 -12.139 12.756  1.00   41.62 ? 106  GLU A CB    1 
ATOM   840  C  CG    . GLU A 1 112 ? -27.173 -12.608 11.922  1.00   46.83 ? 106  GLU A CG    1 
ATOM   841  C  CD    . GLU A 1 112 ? -27.558 -13.789 11.061  1.00   51.00 ? 106  GLU A CD    1 
ATOM   842  O  OE1   . GLU A 1 112 ? -28.379 -14.617 11.524  1.00   53.72 ? 106  GLU A OE1   1 
ATOM   843  O  OE2   . GLU A 1 112 ? -27.039 -13.901 9.932   1.00   49.85 ? 106  GLU A OE2   1 
ATOM   844  N  N     . ALA A 1 113 ? -30.905 -10.420 13.551  1.00   41.56 ? 107  ALA A N     1 
ATOM   845  C  CA    . ALA A 1 113 ? -31.849 -10.139 14.597  1.00   43.60 ? 107  ALA A CA    1 
ATOM   846  C  C     . ALA A 1 113 ? -33.155 -10.751 14.192  1.00   46.21 ? 107  ALA A C     1 
ATOM   847  O  O     . ALA A 1 113 ? -33.528 -10.681 13.013  1.00   46.65 ? 107  ALA A O     1 
ATOM   848  C  CB    . ALA A 1 113 ? -31.995 -8.650  14.762  1.00   45.08 ? 107  ALA A CB    1 
ATOM   849  N  N     . TYR A 1 114 ? -33.831 -11.384 15.149  1.00   48.28 ? 108  TYR A N     1 
ATOM   850  C  CA    . TYR A 1 114 ? -35.126 -11.991 14.871  1.00   52.25 ? 108  TYR A CA    1 
ATOM   851  C  C     . TYR A 1 114 ? -36.170 -11.182 15.607  1.00   53.50 ? 108  TYR A C     1 
ATOM   852  O  O     . TYR A 1 114 ? -36.105 -11.006 16.831  1.00   52.43 ? 108  TYR A O     1 
ATOM   853  C  CB    . TYR A 1 114 ? -35.198 -13.459 15.319  1.00   51.55 ? 108  TYR A CB    1 
ATOM   854  C  CG    . TYR A 1 114 ? -34.245 -14.381 14.597  1.00   51.25 ? 108  TYR A CG    1 
ATOM   855  C  CD1   . TYR A 1 114 ? -32.945 -14.572 15.067  1.00   50.86 ? 108  TYR A CD1   1 
ATOM   856  C  CD2   . TYR A 1 114 ? -34.629 -15.044 13.430  1.00   49.19 ? 108  TYR A CD2   1 
ATOM   857  C  CE1   . TYR A 1 114 ? -32.051 -15.398 14.392  1.00   50.16 ? 108  TYR A CE1   1 
ATOM   858  C  CE2   . TYR A 1 114 ? -33.737 -15.872 12.745  1.00   48.16 ? 108  TYR A CE2   1 
ATOM   859  C  CZ    . TYR A 1 114 ? -32.451 -16.040 13.234  1.00   49.59 ? 108  TYR A CZ    1 
ATOM   860  O  OH    . TYR A 1 114 ? -31.542 -16.837 12.573  1.00   51.43 ? 108  TYR A OH    1 
ATOM   861  N  N     . LEU A 1 115 ? -37.123 -10.688 14.831  1.00   56.58 ? 109  LEU A N     1 
ATOM   862  C  CA    . LEU A 1 115 ? -38.205 -9.870  15.340  1.00   60.79 ? 109  LEU A CA    1 
ATOM   863  C  C     . LEU A 1 115 ? -39.537 -10.597 15.281  1.00   63.41 ? 109  LEU A C     1 
ATOM   864  O  O     . LEU A 1 115 ? -40.021 -10.935 14.200  1.00   63.59 ? 109  LEU A O     1 
ATOM   865  C  CB    . LEU A 1 115 ? -38.287 -8.587  14.524  1.00   61.10 ? 109  LEU A CB    1 
ATOM   866  C  CG    . LEU A 1 115 ? -37.233 -7.547  14.869  1.00   61.11 ? 109  LEU A CG    1 
ATOM   867  C  CD1   . LEU A 1 115 ? -37.257 -6.424  13.855  1.00   62.81 ? 109  LEU A CD1   1 
ATOM   868  C  CD2   . LEU A 1 115 ? -37.525 -7.023  16.259  1.00   60.86 ? 109  LEU A CD2   1 
ATOM   869  N  N     . ASP A 1 116 ? -40.123 -10.840 16.449  1.00   66.97 ? 110  ASP A N     1 
ATOM   870  C  CA    . ASP A 1 116 ? -41.412 -11.519 16.529  1.00   69.24 ? 110  ASP A CA    1 
ATOM   871  C  C     . ASP A 1 116 ? -42.497 -10.477 16.303  1.00   70.26 ? 110  ASP A C     1 
ATOM   872  O  O     . ASP A 1 116 ? -42.752 -9.627  17.162  1.00   69.37 ? 110  ASP A O     1 
ATOM   873  C  CB    . ASP A 1 116 ? -41.580 -12.182 17.900  1.00   70.32 ? 110  ASP A CB    1 
ATOM   874  C  CG    . ASP A 1 116 ? -42.964 -12.761 18.099  1.00   71.32 ? 110  ASP A CG    1 
ATOM   875  O  OD1   . ASP A 1 116 ? -43.922 -11.975 18.260  1.00   72.64 ? 110  ASP A OD1   1 
ATOM   876  O  OD2   . ASP A 1 116 ? -43.095 -14.003 18.088  1.00   71.70 ? 110  ASP A OD2   1 
ATOM   877  N  N     . ILE A 1 117 ? -43.120 -10.538 15.132  1.00   71.24 ? 111  ILE A N     1 
ATOM   878  C  CA    . ILE A 1 117 ? -44.163 -9.589  14.784  1.00   73.37 ? 111  ILE A CA    1 
ATOM   879  C  C     . ILE A 1 117 ? -45.558 -10.210 14.862  1.00   75.02 ? 111  ILE A C     1 
ATOM   880  O  O     . ILE A 1 117 ? -46.506 -9.693  14.271  1.00   75.14 ? 111  ILE A O     1 
ATOM   881  C  CB    . ILE A 1 117 ? -43.927 -9.008  13.367  1.00   72.40 ? 111  ILE A CB    1 
ATOM   882  C  CG1   . ILE A 1 117 ? -44.032 -10.107 12.316  1.00   72.80 ? 111  ILE A CG1   1 
ATOM   883  C  CG2   . ILE A 1 117 ? -42.551 -8.392  13.289  1.00   72.25 ? 111  ILE A CG2   1 
ATOM   884  C  CD1   . ILE A 1 117 ? -43.872 -9.602  10.898  1.00   73.38 ? 111  ILE A CD1   1 
ATOM   885  N  N     . SER A 1 118 ? -45.670 -11.316 15.598  1.00   77.06 ? 112  SER A N     1 
ATOM   886  C  CA    . SER A 1 118 ? -46.942 -12.020 15.777  1.00   78.28 ? 112  SER A CA    1 
ATOM   887  C  C     . SER A 1 118 ? -47.976 -10.982 16.177  1.00   79.53 ? 112  SER A C     1 
ATOM   888  O  O     . SER A 1 118 ? -48.988 -10.775 15.495  1.00   79.47 ? 112  SER A O     1 
ATOM   889  C  CB    . SER A 1 118 ? -46.826 -13.057 16.899  1.00   77.92 ? 112  SER A CB    1 
ATOM   890  O  OG    . SER A 1 118 ? -45.624 -13.801 16.808  1.00   78.29 ? 112  SER A OG    1 
ATOM   891  N  N     . ASP A 1 119 ? -47.694 -10.340 17.306  1.00   80.55 ? 113  ASP A N     1 
ATOM   892  C  CA    . ASP A 1 119 ? -48.534 -9.295  17.865  1.00   81.66 ? 113  ASP A CA    1 
ATOM   893  C  C     . ASP A 1 119 ? -48.641 -8.131  16.893  1.00   82.76 ? 113  ASP A C     1 
ATOM   894  O  O     . ASP A 1 119 ? -49.574 -8.047  16.089  1.00   83.64 ? 113  ASP A O     1 
ATOM   895  C  CB    . ASP A 1 119 ? -47.924 -8.797  19.175  1.00   81.49 ? 113  ASP A CB    1 
ATOM   896  C  CG    . ASP A 1 119 ? -48.412 -9.570  20.378  1.00   81.62 ? 113  ASP A CG    1 
ATOM   897  O  OD1   . ASP A 1 119 ? -49.385 -9.114  21.012  1.00   82.18 ? 113  ASP A OD1   1 
ATOM   898  O  OD2   . ASP A 1 119 ? -47.837 -10.635 20.686  1.00   81.43 ? 113  ASP A OD2   1 
ATOM   899  N  N     . LYS A 1 120 ? -47.660 -7.240  16.982  1.00   83.17 ? 114  LYS A N     1 
ATOM   900  C  CA    . LYS A 1 120 ? -47.582 -6.041  16.161  1.00   83.35 ? 114  LYS A CA    1 
ATOM   901  C  C     . LYS A 1 120 ? -48.335 -6.069  14.814  1.00   83.54 ? 114  LYS A C     1 
ATOM   902  O  O     . LYS A 1 120 ? -48.832 -5.035  14.361  1.00   83.90 ? 114  LYS A O     1 
ATOM   903  C  CB    . LYS A 1 120 ? -46.103 -5.671  15.962  1.00   82.99 ? 114  LYS A CB    1 
ATOM   904  C  CG    . LYS A 1 120 ? -45.417 -5.076  17.207  1.00   82.71 ? 114  LYS A CG    1 
ATOM   905  C  CD    . LYS A 1 120 ? -45.134 -6.106  18.308  1.00   83.34 ? 114  LYS A CD    1 
ATOM   906  C  CE    . LYS A 1 120 ? -44.524 -5.453  19.572  1.00   82.58 ? 114  LYS A CE    1 
ATOM   907  N  NZ    . LYS A 1 120 ? -44.025 -6.438  20.604  1.00   81.59 ? 114  LYS A NZ    1 
ATOM   908  N  N     . VAL A 1 121 ? -48.431 -7.235  14.183  1.00   83.28 ? 115  VAL A N     1 
ATOM   909  C  CA    . VAL A 1 121 ? -49.138 -7.356  12.909  1.00   83.29 ? 115  VAL A CA    1 
ATOM   910  C  C     . VAL A 1 121 ? -49.384 -8.808  12.538  1.00   83.53 ? 115  VAL A C     1 
ATOM   911  O  O     . VAL A 1 121 ? -48.476 -9.632  12.606  1.00   84.57 ? 115  VAL A O     1 
ATOM   912  C  CB    . VAL A 1 121 ? -48.354 -6.672  11.743  1.00   83.06 ? 115  VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 121 ? -48.542 -7.452  10.438  1.00   82.34 ? 115  VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 121 ? -48.855 -5.246  11.548  1.00   83.04 ? 115  VAL A CG2   1 
ATOM   915  N  N     . ARG A 1 122 ? -50.619 -9.120  12.156  1.00   83.18 ? 116  ARG A N     1 
ATOM   916  C  CA    . ARG A 1 122 ? -50.964 -10.471 11.738  1.00   82.75 ? 116  ARG A CA    1 
ATOM   917  C  C     . ARG A 1 122 ? -51.250 -10.406 10.245  1.00   82.91 ? 116  ARG A C     1 
ATOM   918  O  O     . ARG A 1 122 ? -51.844 -9.435  9.775   1.00   83.51 ? 116  ARG A O     1 
ATOM   919  C  CB    . ARG A 1 122 ? -52.201 -10.977 12.475  0.50   81.42 ? 116  ARG A CB    1 
ATOM   920  C  CG    . ARG A 1 122 ? -52.533 -12.436 12.175  0.50   79.66 ? 116  ARG A CG    1 
ATOM   921  C  CD    . ARG A 1 122 ? -51.491 -13.372 12.770  0.50   77.95 ? 116  ARG A CD    1 
ATOM   922  N  NE    . ARG A 1 122 ? -51.783 -14.774 12.488  0.50   76.05 ? 116  ARG A NE    1 
ATOM   923  C  CZ    . ARG A 1 122 ? -51.161 -15.795 13.067  0.50   75.35 ? 116  ARG A CZ    1 
ATOM   924  N  NH1   . ARG A 1 122 ? -50.213 -15.573 13.964  0.50   74.78 ? 116  ARG A NH1   1 
ATOM   925  N  NH2   . ARG A 1 122 ? -51.484 -17.039 12.748  0.50   74.64 ? 116  ARG A NH2   1 
ATOM   926  N  N     . ASP A 1 123 ? -50.815 -11.432 9.515   1.00   82.72 ? 117  ASP A N     1 
ATOM   927  C  CA    . ASP A 1 123 ? -50.989 -11.546 8.061   1.00   82.40 ? 117  ASP A CA    1 
ATOM   928  C  C     . ASP A 1 123 ? -49.651 -11.380 7.329   1.00   81.94 ? 117  ASP A C     1 
ATOM   929  O  O     . ASP A 1 123 ? -48.793 -10.602 7.757   1.00   81.71 ? 117  ASP A O     1 
ATOM   930  C  CB    . ASP A 1 123 ? -51.997 -10.510 7.549   1.00   82.72 ? 117  ASP A CB    1 
ATOM   931  C  CG    . ASP A 1 123 ? -52.244 -10.624 6.070   1.00   83.07 ? 117  ASP A CG    1 
ATOM   932  O  OD1   . ASP A 1 123 ? -52.412 -11.765 5.593   1.00   83.64 ? 117  ASP A OD1   1 
ATOM   933  O  OD2   . ASP A 1 123 ? -52.281 -9.574  5.391   1.00   83.12 ? 117  ASP A OD2   1 
ATOM   934  N  N     . TYR A 1 124 ? -49.475 -12.120 6.235   1.00   81.01 ? 118  TYR A N     1 
ATOM   935  C  CA    . TYR A 1 124 ? -48.240 -12.053 5.458   1.00   80.35 ? 118  TYR A CA    1 
ATOM   936  C  C     . TYR A 1 124 ? -48.135 -10.842 4.542   1.00   80.31 ? 118  TYR A C     1 
ATOM   937  O  O     . TYR A 1 124 ? -47.112 -10.649 3.883   1.00   81.44 ? 118  TYR A O     1 
ATOM   938  C  CB    . TYR A 1 124 ? -48.055 -13.319 4.624   0.50   79.64 ? 118  TYR A CB    1 
ATOM   939  C  CG    . TYR A 1 124 ? -47.425 -14.457 5.385   0.50   79.19 ? 118  TYR A CG    1 
ATOM   940  C  CD1   . TYR A 1 124 ? -46.478 -14.212 6.380   0.50   79.08 ? 118  TYR A CD1   1 
ATOM   941  C  CD2   . TYR A 1 124 ? -47.746 -15.779 5.090   0.50   79.08 ? 118  TYR A CD2   1 
ATOM   942  C  CE1   . TYR A 1 124 ? -45.867 -15.250 7.062   1.00   79.03 ? 118  TYR A CE1   1 
ATOM   943  C  CE2   . TYR A 1 124 ? -47.140 -16.825 5.763   1.00   79.04 ? 118  TYR A CE2   1 
ATOM   944  C  CZ    . TYR A 1 124 ? -46.199 -16.554 6.749   1.00   79.61 ? 118  TYR A CZ    1 
ATOM   945  O  OH    . TYR A 1 124 ? -45.578 -17.582 7.422   1.00   80.57 ? 118  TYR A OH    1 
ATOM   946  N  N     . ARG A 1 125 ? -49.189 -10.034 4.486   1.00   79.16 ? 119  ARG A N     1 
ATOM   947  C  CA    . ARG A 1 125 ? -49.178 -8.838  3.651   1.00   77.34 ? 119  ARG A CA    1 
ATOM   948  C  C     . ARG A 1 125 ? -48.679 -7.669  4.484   1.00   76.18 ? 119  ARG A C     1 
ATOM   949  O  O     . ARG A 1 125 ? -47.685 -7.038  4.154   1.00   75.96 ? 119  ARG A O     1 
ATOM   950  C  CB    . ARG A 1 125 ? -50.580 -8.520  3.130   0.50   77.57 ? 119  ARG A CB    1 
ATOM   951  C  CG    . ARG A 1 125 ? -50.639 -7.234  2.328   0.50   78.00 ? 119  ARG A CG    1 
ATOM   952  C  CD    . ARG A 1 125 ? -52.062 -6.742  2.141   0.50   78.32 ? 119  ARG A CD    1 
ATOM   953  N  NE    . ARG A 1 125 ? -52.096 -5.453  1.455   0.50   78.42 ? 119  ARG A NE    1 
ATOM   954  C  CZ    . ARG A 1 125 ? -53.202 -4.750  1.238   0.50   78.67 ? 119  ARG A CZ    1 
ATOM   955  N  NH1   . ARG A 1 125 ? -54.374 -5.210  1.655   0.50   79.13 ? 119  ARG A NH1   1 
ATOM   956  N  NH2   . ARG A 1 125 ? -53.138 -3.587  0.606   0.50   78.22 ? 119  ARG A NH2   1 
ATOM   957  N  N     . GLU A 1 126 ? -49.365 -7.397  5.585   1.00   75.01 ? 120  GLU A N     1 
ATOM   958  C  CA    . GLU A 1 126 ? -48.981 -6.289  6.439   1.00   74.86 ? 120  GLU A CA    1 
ATOM   959  C  C     . GLU A 1 126 ? -47.639 -6.524  7.100   1.00   74.52 ? 120  GLU A C     1 
ATOM   960  O  O     . GLU A 1 126 ? -46.961 -5.569  7.481   1.00   75.21 ? 120  GLU A O     1 
ATOM   961  C  CB    . GLU A 1 126 ? -50.041 -6.034  7.512   1.00   74.33 ? 120  GLU A CB    1 
ATOM   962  C  CG    . GLU A 1 126 ? -49.802 -4.758  8.309   0.50   73.61 ? 120  GLU A CG    1 
ATOM   963  C  CD    . GLU A 1 126 ? -49.573 -3.544  7.419   0.50   73.48 ? 120  GLU A CD    1 
ATOM   964  O  OE1   . GLU A 1 126 ? -50.436 -3.259  6.562   0.50   72.98 ? 120  GLU A OE1   1 
ATOM   965  O  OE2   . GLU A 1 126 ? -48.529 -2.873  7.579   0.50   72.60 ? 120  GLU A OE2   1 
ATOM   966  N  N     . ALA A 1 127 ? -47.261 -7.791  7.245   1.00   74.04 ? 121  ALA A N     1 
ATOM   967  C  CA    . ALA A 1 127 ? -45.980 -8.137  7.855   1.00   71.93 ? 121  ALA A CA    1 
ATOM   968  C  C     . ALA A 1 127 ? -44.860 -7.773  6.877   1.00   70.58 ? 121  ALA A C     1 
ATOM   969  O  O     . ALA A 1 127 ? -43.816 -7.256  7.281   1.00   69.47 ? 121  ALA A O     1 
ATOM   970  C  CB    . ALA A 1 127 ? -45.938 -9.614  8.179   1.00   72.19 ? 121  ALA A CB    1 
ATOM   971  N  N     . TYR A 1 128 ? -45.089 -8.039  5.592   1.00   68.56 ? 122  TYR A N     1 
ATOM   972  C  CA    . TYR A 1 128 ? -44.110 -7.718  4.559   1.00   66.87 ? 122  TYR A CA    1 
ATOM   973  C  C     . TYR A 1 128 ? -43.918 -6.207  4.548   1.00   66.58 ? 122  TYR A C     1 
ATOM   974  O  O     . TYR A 1 128 ? -42.788 -5.710  4.622   1.00   65.62 ? 122  TYR A O     1 
ATOM   975  C  CB    . TYR A 1 128 ? -44.601 -8.222  3.185   1.00   66.38 ? 122  TYR A CB    1 
ATOM   976  C  CG    . TYR A 1 128 ? -43.820 -7.729  1.961   1.00   66.33 ? 122  TYR A CG    1 
ATOM   977  C  CD1   . TYR A 1 128 ? -43.721 -8.513  0.809   1.00   65.49 ? 122  TYR A CD1   1 
ATOM   978  C  CD2   . TYR A 1 128 ? -43.213 -6.467  1.942   1.00   66.52 ? 122  TYR A CD2   1 
ATOM   979  C  CE1   . TYR A 1 128 ? -43.039 -8.050  -0.321  1.00   65.20 ? 122  TYR A CE1   1 
ATOM   980  C  CE2   . TYR A 1 128 ? -42.535 -5.998  0.825   1.00   65.75 ? 122  TYR A CE2   1 
ATOM   981  C  CZ    . TYR A 1 128 ? -42.450 -6.789  -0.301  1.00   65.28 ? 122  TYR A CZ    1 
ATOM   982  O  OH    . TYR A 1 128 ? -41.774 -6.307  -1.396  1.00   64.78 ? 122  TYR A OH    1 
ATOM   983  N  N     . ASN A 1 129 ? -45.028 -5.481  4.449   1.00   66.33 ? 123  ASN A N     1 
ATOM   984  C  CA    . ASN A 1 129 ? -44.988 -4.026  4.421   1.00   65.06 ? 123  ASN A CA    1 
ATOM   985  C  C     . ASN A 1 129 ? -44.363 -3.440  5.683   1.00   64.01 ? 123  ASN A C     1 
ATOM   986  O  O     . ASN A 1 129 ? -44.159 -2.240  5.779   1.00   64.44 ? 123  ASN A O     1 
ATOM   987  C  CB    . ASN A 1 129 ? -46.395 -3.461  4.198   1.00   65.50 ? 123  ASN A CB    1 
ATOM   988  C  CG    . ASN A 1 129 ? -46.936 -3.765  2.801   1.00   67.14 ? 123  ASN A CG    1 
ATOM   989  O  OD1   . ASN A 1 129 ? -46.241 -3.580  1.802   1.00   67.44 ? 123  ASN A OD1   1 
ATOM   990  N  ND2   . ASN A 1 129 ? -48.185 -4.222  2.729   1.00   67.13 ? 123  ASN A ND2   1 
ATOM   991  N  N     . LEU A 1 130 ? -44.064 -4.284  6.660   1.00   63.45 ? 124  LEU A N     1 
ATOM   992  C  CA    . LEU A 1 130 ? -43.410 -3.804  7.874   1.00   62.67 ? 124  LEU A CA    1 
ATOM   993  C  C     . LEU A 1 130 ? -41.916 -3.971  7.607   1.00   62.50 ? 124  LEU A C     1 
ATOM   994  O  O     . LEU A 1 130 ? -41.069 -3.419  8.311   1.00   62.81 ? 124  LEU A O     1 
ATOM   995  C  CB    . LEU A 1 130 ? -43.816 -4.642  9.080   1.00   61.10 ? 124  LEU A CB    1 
ATOM   996  C  CG    . LEU A 1 130 ? -43.322 -4.102  10.416  1.00   60.19 ? 124  LEU A CG    1 
ATOM   997  C  CD1   . LEU A 1 130 ? -43.929 -2.740  10.685  1.00   60.25 ? 124  LEU A CD1   1 
ATOM   998  C  CD2   . LEU A 1 130 ? -43.713 -5.071  11.503  1.00   60.38 ? 124  LEU A CD2   1 
ATOM   999  N  N     . GLY A 1 131 ? -41.618 -4.757  6.575   1.00   62.18 ? 125  GLY A N     1 
ATOM   1000 C  CA    . GLY A 1 131 ? -40.253 -5.006  6.169   1.00   61.51 ? 125  GLY A CA    1 
ATOM   1001 C  C     . GLY A 1 131 ? -39.684 -3.758  5.537   1.00   61.51 ? 125  GLY A C     1 
ATOM   1002 O  O     . GLY A 1 131 ? -38.636 -3.279  5.944   1.00   62.42 ? 125  GLY A O     1 
ATOM   1003 N  N     . LEU A 1 132 ? -40.375 -3.217  4.545   1.00   61.42 ? 126  LEU A N     1 
ATOM   1004 C  CA    . LEU A 1 132 ? -39.893 -2.017  3.892   1.00   61.79 ? 126  LEU A CA    1 
ATOM   1005 C  C     . LEU A 1 132 ? -39.999 -0.845  4.859   1.00   62.67 ? 126  LEU A C     1 
ATOM   1006 O  O     . LEU A 1 132 ? -39.196 0.087   4.806   1.00   63.73 ? 126  LEU A O     1 
ATOM   1007 C  CB    . LEU A 1 132 ? -40.701 -1.740  2.630   1.00   61.49 ? 126  LEU A CB    1 
ATOM   1008 C  CG    . LEU A 1 132 ? -40.983 -2.961  1.751   1.00   61.25 ? 126  LEU A CG    1 
ATOM   1009 C  CD1   . LEU A 1 132 ? -41.430 -2.518  0.355   1.00   61.25 ? 126  LEU A CD1   1 
ATOM   1010 C  CD2   . LEU A 1 132 ? -39.737 -3.799  1.653   1.00   61.19 ? 126  LEU A CD2   1 
ATOM   1011 N  N     . GLU A 1 133 ? -40.986 -0.892  5.749   1.00   63.20 ? 127  GLU A N     1 
ATOM   1012 C  CA    . GLU A 1 133 ? -41.164 0.175   6.731   1.00   63.67 ? 127  GLU A CA    1 
ATOM   1013 C  C     . GLU A 1 133 ? -39.918 0.202   7.588   1.00   63.65 ? 127  GLU A C     1 
ATOM   1014 O  O     . GLU A 1 133 ? -39.588 1.209   8.203   1.00   64.68 ? 127  GLU A O     1 
ATOM   1015 C  CB    . GLU A 1 133 ? -42.381 -0.089  7.627   0.50   64.35 ? 127  GLU A CB    1 
ATOM   1016 C  CG    . GLU A 1 133 ? -43.654 0.668   7.247   0.50   65.56 ? 127  GLU A CG    1 
ATOM   1017 C  CD    . GLU A 1 133 ? -44.758 0.538   8.299   0.50   65.94 ? 127  GLU A CD    1 
ATOM   1018 O  OE1   . GLU A 1 133 ? -44.517 0.904   9.473   0.50   65.07 ? 127  GLU A OE1   1 
ATOM   1019 O  OE2   . GLU A 1 133 ? -45.867 0.072   7.952   0.50   66.17 ? 127  GLU A OE2   1 
ATOM   1020 N  N     . ILE A 1 134 ? -39.226 -0.926  7.610   1.00   64.09 ? 128  ILE A N     1 
ATOM   1021 C  CA    . ILE A 1 134 ? -38.009 -1.080  8.393   1.00   64.82 ? 128  ILE A CA    1 
ATOM   1022 C  C     . ILE A 1 134 ? -36.759 -1.070  7.516   1.00   63.85 ? 128  ILE A C     1 
ATOM   1023 O  O     . ILE A 1 134 ? -35.714 -0.533  7.894   1.00   62.67 ? 128  ILE A O     1 
ATOM   1024 C  CB    . ILE A 1 134 ? -38.078 -2.392  9.195   1.00   66.29 ? 128  ILE A CB    1 
ATOM   1025 C  CG1   . ILE A 1 134 ? -39.069 -2.218  10.346  1.00   67.22 ? 128  ILE A CG1   1 
ATOM   1026 C  CG2   . ILE A 1 134 ? -36.689 -2.796  9.682   1.00   67.73 ? 128  ILE A CG2   1 
ATOM   1027 C  CD1   . ILE A 1 134 ? -39.340 -3.476  11.123  1.00   67.01 ? 128  ILE A CD1   1 
ATOM   1028 N  N     . LYS A 1 135 ? -36.875 -1.667  6.341   1.00   62.87 ? 129  LYS A N     1 
ATOM   1029 C  CA    . LYS A 1 135 ? -35.765 -1.701  5.427   1.00   63.56 ? 129  LYS A CA    1 
ATOM   1030 C  C     . LYS A 1 135 ? -35.531 -0.273  4.947   1.00   64.68 ? 129  LYS A C     1 
ATOM   1031 O  O     . LYS A 1 135 ? -34.405 0.103   4.629   1.00   67.05 ? 129  LYS A O     1 
ATOM   1032 C  CB    . LYS A 1 135 ? -36.079 -2.620  4.245   1.00   63.39 ? 129  LYS A CB    1 
ATOM   1033 C  CG    . LYS A 1 135 ? -34.847 -3.259  3.651   1.00   63.99 ? 129  LYS A CG    1 
ATOM   1034 C  CD    . LYS A 1 135 ? -35.195 -4.436  2.771   1.00   64.13 ? 129  LYS A CD    1 
ATOM   1035 C  CE    . LYS A 1 135 ? -35.750 -3.949  1.474   1.00   66.57 ? 129  LYS A CE    1 
ATOM   1036 N  NZ    . LYS A 1 135 ? -34.783 -2.995  0.861   1.00   69.31 ? 129  LYS A NZ    1 
ATOM   1037 N  N     . ASN A 1 136 ? -36.573 0.544   4.896   1.00   63.88 ? 130  ASN A N     1 
ATOM   1038 C  CA    . ASN A 1 136 ? -36.351 1.902   4.437   1.00   63.16 ? 130  ASN A CA    1 
ATOM   1039 C  C     . ASN A 1 136 ? -35.771 2.784   5.526   1.00   62.02 ? 130  ASN A C     1 
ATOM   1040 O  O     . ASN A 1 136 ? -34.894 3.602   5.264   1.00   62.40 ? 130  ASN A O     1 
ATOM   1041 C  CB    . ASN A 1 136 ? -37.648 2.517   3.954   1.00   64.82 ? 130  ASN A CB    1 
ATOM   1042 C  CG    . ASN A 1 136 ? -37.467 3.948   3.476   1.00   66.01 ? 130  ASN A CG    1 
ATOM   1043 O  OD1   . ASN A 1 136 ? -36.938 4.197   2.383   1.00   66.58 ? 130  ASN A OD1   1 
ATOM   1044 N  ND2   . ASN A 1 136 ? -37.901 4.901   4.298   1.00   66.14 ? 130  ASN A ND2   1 
ATOM   1045 N  N     . LYS A 1 137 ? -36.280 2.636   6.743   1.00   60.35 ? 131  LYS A N     1 
ATOM   1046 C  CA    . LYS A 1 137 ? -35.804 3.442   7.854   1.00   59.25 ? 131  LYS A CA    1 
ATOM   1047 C  C     . LYS A 1 137 ? -34.322 3.225   8.162   1.00   58.95 ? 131  LYS A C     1 
ATOM   1048 O  O     . LYS A 1 137 ? -33.581 4.181   8.356   1.00   59.75 ? 131  LYS A O     1 
ATOM   1049 C  CB    . LYS A 1 137 ? -36.646 3.172   9.095   1.00   58.78 ? 131  LYS A CB    1 
ATOM   1050 C  CG    . LYS A 1 137 ? -36.017 3.692   10.378  1.00   59.43 ? 131  LYS A CG    1 
ATOM   1051 C  CD    . LYS A 1 137 ? -36.941 3.491   11.575  0.50   59.75 ? 131  LYS A CD    1 
ATOM   1052 C  CE    . LYS A 1 137 ? -38.044 4.541   11.629  0.50   59.77 ? 131  LYS A CE    1 
ATOM   1053 N  NZ    . LYS A 1 137 ? -37.496 5.900   11.902  0.50   59.60 ? 131  LYS A NZ    1 
ATOM   1054 N  N     . ILE A 1 138 ? -33.882 1.974   8.218   1.00   58.49 ? 132  ILE A N     1 
ATOM   1055 C  CA    . ILE A 1 138 ? -32.471 1.707   8.492   1.00   57.74 ? 132  ILE A CA    1 
ATOM   1056 C  C     . ILE A 1 138 ? -31.616 2.350   7.413   1.00   56.57 ? 132  ILE A C     1 
ATOM   1057 O  O     . ILE A 1 138 ? -30.554 2.877   7.691   1.00   55.72 ? 132  ILE A O     1 
ATOM   1058 C  CB    . ILE A 1 138 ? -32.160 0.189   8.533   1.00   57.60 ? 132  ILE A CB    1 
ATOM   1059 C  CG1   . ILE A 1 138 ? -32.672 -0.412  9.842   1.00   59.01 ? 132  ILE A CG1   1 
ATOM   1060 C  CG2   . ILE A 1 138 ? -30.665 -0.045  8.430   1.00   56.84 ? 132  ILE A CG2   1 
ATOM   1061 C  CD1   . ILE A 1 138 ? -32.338 -1.885  10.006  1.00   59.44 ? 132  ILE A CD1   1 
ATOM   1062 N  N     . LEU A 1 139 ? -32.087 2.298   6.175   1.00   56.81 ? 133  LEU A N     1 
ATOM   1063 C  CA    . LEU A 1 139 ? -31.361 2.891   5.055   1.00   57.14 ? 133  LEU A CA    1 
ATOM   1064 C  C     . LEU A 1 139 ? -31.313 4.398   5.206   1.00   57.64 ? 133  LEU A C     1 
ATOM   1065 O  O     . LEU A 1 139 ? -30.325 5.046   4.878   1.00   57.92 ? 133  LEU A O     1 
ATOM   1066 C  CB    . LEU A 1 139 ? -32.046 2.552   3.734   1.00   55.57 ? 133  LEU A CB    1 
ATOM   1067 C  CG    . LEU A 1 139 ? -31.410 3.115   2.466   1.00   54.60 ? 133  LEU A CG    1 
ATOM   1068 C  CD1   . LEU A 1 139 ? -29.919 3.186   2.624   1.00   55.07 ? 133  LEU A CD1   1 
ATOM   1069 C  CD2   . LEU A 1 139 ? -31.770 2.215   1.293   1.00   55.92 ? 133  LEU A CD2   1 
ATOM   1070 N  N     . GLU A 1 140 ? -32.402 4.954   5.711   1.00   57.80 ? 134  GLU A N     1 
ATOM   1071 C  CA    . GLU A 1 140 ? -32.493 6.384   5.910   1.00   57.51 ? 134  GLU A CA    1 
ATOM   1072 C  C     . GLU A 1 140 ? -31.655 6.797   7.116   1.00   57.60 ? 134  GLU A C     1 
ATOM   1073 O  O     . GLU A 1 140 ? -30.642 7.474   6.975   1.00   58.16 ? 134  GLU A O     1 
ATOM   1074 C  CB    . GLU A 1 140 ? -33.955 6.772   6.119   1.00   57.80 ? 134  GLU A CB    1 
ATOM   1075 C  CG    . GLU A 1 140 ? -34.273 8.224   5.831   0.50   58.40 ? 134  GLU A CG    1 
ATOM   1076 C  CD    . GLU A 1 140 ? -35.742 8.547   6.046   0.50   58.93 ? 134  GLU A CD    1 
ATOM   1077 O  OE1   . GLU A 1 140 ? -36.151 9.685   5.738   0.50   58.93 ? 134  GLU A OE1   1 
ATOM   1078 O  OE2   . GLU A 1 140 ? -36.488 7.663   6.527   0.50   59.31 ? 134  GLU A OE2   1 
ATOM   1079 N  N     . LYS A 1 141 ? -32.074 6.369   8.299   1.00   57.19 ? 135  LYS A N     1 
ATOM   1080 C  CA    . LYS A 1 141 ? -31.376 6.712   9.528   1.00   57.19 ? 135  LYS A CA    1 
ATOM   1081 C  C     . LYS A 1 141 ? -29.888 6.362   9.656   1.00   57.05 ? 135  LYS A C     1 
ATOM   1082 O  O     . LYS A 1 141 ? -29.203 6.952   10.485  1.00   57.66 ? 135  LYS A O     1 
ATOM   1083 C  CB    . LYS A 1 141 ? -32.115 6.124   10.731  1.00   56.94 ? 135  LYS A CB    1 
ATOM   1084 C  CG    . LYS A 1 141 ? -33.372 6.874   11.105  1.00   59.15 ? 135  LYS A CG    1 
ATOM   1085 C  CD    . LYS A 1 141 ? -33.577 6.837   12.615  1.00   60.74 ? 135  LYS A CD    1 
ATOM   1086 C  CE    . LYS A 1 141 ? -32.464 7.592   13.336  1.00   60.44 ? 135  LYS A CE    1 
ATOM   1087 N  NZ    . LYS A 1 141 ? -32.421 7.246   14.782  1.00   59.71 ? 135  LYS A NZ    1 
ATOM   1088 N  N     . GLU A 1 142 ? -29.373 5.418   8.872   1.00   56.55 ? 136  GLU A N     1 
ATOM   1089 C  CA    . GLU A 1 142 ? -27.952 5.050   8.994   1.00   55.01 ? 136  GLU A CA    1 
ATOM   1090 C  C     . GLU A 1 142 ? -27.378 4.605   7.666   1.00   53.80 ? 136  GLU A C     1 
ATOM   1091 O  O     . GLU A 1 142 ? -26.273 4.089   7.605   1.00   54.13 ? 136  GLU A O     1 
ATOM   1092 C  CB    . GLU A 1 142 ? -27.765 3.909   10.010  1.00   55.49 ? 136  GLU A CB    1 
ATOM   1093 C  CG    . GLU A 1 142 ? -28.269 4.197   11.436  1.00   55.75 ? 136  GLU A CG    1 
ATOM   1094 C  CD    . GLU A 1 142 ? -27.396 5.184   12.206  1.00   56.47 ? 136  GLU A CD    1 
ATOM   1095 O  OE1   . GLU A 1 142 ? -27.007 6.214   11.620  1.00   57.12 ? 136  GLU A OE1   1 
ATOM   1096 O  OE2   . GLU A 1 142 ? -27.110 4.942   13.402  1.00   56.60 ? 136  GLU A OE2   1 
ATOM   1097 N  N     . LYS A 1 143 ? -28.145 4.801   6.605   1.00   52.26 ? 137  LYS A N     1 
ATOM   1098 C  CA    . LYS A 1 143 ? -27.729 4.410   5.272   1.00   51.67 ? 137  LYS A CA    1 
ATOM   1099 C  C     . LYS A 1 143 ? -27.077 3.028   5.211   1.00   50.71 ? 137  LYS A C     1 
ATOM   1100 O  O     . LYS A 1 143 ? -25.925 2.878   4.792   1.00   51.40 ? 137  LYS A O     1 
ATOM   1101 C  CB    . LYS A 1 143 ? -26.809 5.483   4.681   0.50   51.55 ? 137  LYS A CB    1 
ATOM   1102 C  CG    . LYS A 1 143 ? -27.531 6.800   4.414   0.50   51.07 ? 137  LYS A CG    1 
ATOM   1103 C  CD    . LYS A 1 143 ? -26.676 7.777   3.635   0.50   50.59 ? 137  LYS A CD    1 
ATOM   1104 C  CE    . LYS A 1 143 ? -27.443 9.047   3.324   0.50   50.15 ? 137  LYS A CE    1 
ATOM   1105 N  NZ    . LYS A 1 143 ? -26.676 9.919   2.395   0.50   50.37 ? 137  LYS A NZ    1 
ATOM   1106 N  N     . ILE A 1 144 ? -27.840 2.022   5.624   1.00   48.48 ? 138  ILE A N     1 
ATOM   1107 C  CA    . ILE A 1 144 ? -27.394 0.639   5.615   1.00   45.77 ? 138  ILE A CA    1 
ATOM   1108 C  C     . ILE A 1 144 ? -28.483 -0.192  4.918   1.00   46.27 ? 138  ILE A C     1 
ATOM   1109 O  O     . ILE A 1 144 ? -29.686 -0.023  5.172   1.00   42.28 ? 138  ILE A O     1 
ATOM   1110 C  CB    . ILE A 1 144 ? -27.194 0.095   7.058   1.00   45.04 ? 138  ILE A CB    1 
ATOM   1111 C  CG1   . ILE A 1 144 ? -26.054 0.831   7.772   1.00   43.21 ? 138  ILE A CG1   1 
ATOM   1112 C  CG2   . ILE A 1 144 ? -26.876 -1.399  7.008   1.00   46.62 ? 138  ILE A CG2   1 
ATOM   1113 C  CD1   . ILE A 1 144 ? -24.678 0.401   7.343   1.00   40.51 ? 138  ILE A CD1   1 
ATOM   1114 N  N     . THR A 1 145 ? -28.063 -1.080  4.024   1.00   46.23 ? 139  THR A N     1 
ATOM   1115 C  CA    . THR A 1 145 ? -29.011 -1.930  3.331   1.00   47.72 ? 139  THR A CA    1 
ATOM   1116 C  C     . THR A 1 145 ? -29.123 -3.223  4.107   1.00   48.85 ? 139  THR A C     1 
ATOM   1117 O  O     . THR A 1 145 ? -28.111 -3.840  4.428   1.00   49.94 ? 139  THR A O     1 
ATOM   1118 C  CB    . THR A 1 145 ? -28.545 -2.248  1.927   1.00   48.98 ? 139  THR A CB    1 
ATOM   1119 O  OG1   . THR A 1 145 ? -27.213 -2.760  1.984   1.00   52.68 ? 139  THR A OG1   1 
ATOM   1120 C  CG2   . THR A 1 145 ? -28.566 -1.003  1.066   1.00   49.32 ? 139  THR A CG2   1 
ATOM   1121 N  N     . VAL A 1 146 ? -30.355 -3.623  4.412   1.00   49.79 ? 140  VAL A N     1 
ATOM   1122 C  CA    . VAL A 1 146 ? -30.607 -4.830  5.184   1.00   48.98 ? 140  VAL A CA    1 
ATOM   1123 C  C     . VAL A 1 146 ? -31.687 -5.664  4.564   1.00   50.19 ? 140  VAL A C     1 
ATOM   1124 O  O     . VAL A 1 146 ? -32.771 -5.167  4.283   1.00   50.47 ? 140  VAL A O     1 
ATOM   1125 C  CB    . VAL A 1 146 ? -31.057 -4.507  6.618   1.00   48.34 ? 140  VAL A CB    1 
ATOM   1126 C  CG1   . VAL A 1 146 ? -29.975 -3.759  7.340   1.00   49.96 ? 140  VAL A CG1   1 
ATOM   1127 C  CG2   . VAL A 1 146 ? -32.321 -3.687  6.600   1.00   47.27 ? 140  VAL A CG2   1 
ATOM   1128 N  N     . THR A 1 147 ? -31.379 -6.938  4.358   1.00   51.68 ? 141  THR A N     1 
ATOM   1129 C  CA    . THR A 1 147 ? -32.321 -7.883  3.786   1.00   51.81 ? 141  THR A CA    1 
ATOM   1130 C  C     . THR A 1 147 ? -33.262 -8.406  4.873   1.00   52.59 ? 141  THR A C     1 
ATOM   1131 O  O     . THR A 1 147 ? -32.863 -8.574  6.034   1.00   52.27 ? 141  THR A O     1 
ATOM   1132 C  CB    . THR A 1 147 ? -31.591 -9.049  3.156   1.00   52.33 ? 141  THR A CB    1 
ATOM   1133 O  OG1   . THR A 1 147 ? -30.728 -8.559  2.120   1.00   53.16 ? 141  THR A OG1   1 
ATOM   1134 C  CG2   . THR A 1 147 ? -32.595 -10.053 2.572   1.00   52.71 ? 141  THR A CG2   1 
ATOM   1135 N  N     . VAL A 1 148 ? -34.515 -8.652  4.493   1.00   52.59 ? 142  VAL A N     1 
ATOM   1136 C  CA    . VAL A 1 148 ? -35.510 -9.126  5.434   1.00   51.68 ? 142  VAL A CA    1 
ATOM   1137 C  C     . VAL A 1 148 ? -36.023 -10.507 5.084   1.00   52.65 ? 142  VAL A C     1 
ATOM   1138 O  O     . VAL A 1 148 ? -36.225 -10.825 3.912   1.00   52.47 ? 142  VAL A O     1 
ATOM   1139 C  CB    . VAL A 1 148 ? -36.706 -8.184  5.480   1.00   52.49 ? 142  VAL A CB    1 
ATOM   1140 C  CG1   . VAL A 1 148 ? -37.645 -8.606  6.597   1.00   54.30 ? 142  VAL A CG1   1 
ATOM   1141 C  CG2   . VAL A 1 148 ? -36.235 -6.755  5.691   1.00   53.06 ? 142  VAL A CG2   1 
ATOM   1142 N  N     . GLY A 1 149 ? -36.226 -11.321 6.120   1.00   53.91 ? 143  GLY A N     1 
ATOM   1143 C  CA    . GLY A 1 149 ? -36.745 -12.670 5.962   1.00   53.19 ? 143  GLY A CA    1 
ATOM   1144 C  C     . GLY A 1 149 ? -37.996 -12.745 6.816   1.00   54.26 ? 143  GLY A C     1 
ATOM   1145 O  O     . GLY A 1 149 ? -38.012 -12.218 7.934   1.00   54.81 ? 143  GLY A O     1 
ATOM   1146 N  N     . ILE A 1 150 ? -39.047 -13.378 6.303   1.00   55.37 ? 144  ILE A N     1 
ATOM   1147 C  CA    . ILE A 1 150 ? -40.308 -13.472 7.039   1.00   56.76 ? 144  ILE A CA    1 
ATOM   1148 C  C     . ILE A 1 150 ? -41.016 -14.820 6.896   1.00   58.58 ? 144  ILE A C     1 
ATOM   1149 O  O     . ILE A 1 150 ? -41.273 -15.282 5.774   1.00   58.32 ? 144  ILE A O     1 
ATOM   1150 C  CB    . ILE A 1 150 ? -41.289 -12.381 6.558   1.00   58.19 ? 144  ILE A CB    1 
ATOM   1151 C  CG1   . ILE A 1 150 ? -40.658 -10.995 6.720   1.00   57.72 ? 144  ILE A CG1   1 
ATOM   1152 C  CG2   . ILE A 1 150 ? -42.597 -12.462 7.347   1.00   58.69 ? 144  ILE A CG2   1 
ATOM   1153 C  CD1   . ILE A 1 150 ? -41.339 -9.906  5.913   1.00   56.45 ? 144  ILE A CD1   1 
ATOM   1154 N  N     . SER A 1 151 ? -41.334 -15.448 8.031   1.00   60.04 ? 145  SER A N     1 
ATOM   1155 C  CA    . SER A 1 151 ? -42.040 -16.728 8.014   1.00   60.38 ? 145  SER A CA    1 
ATOM   1156 C  C     . SER A 1 151 ? -42.465 -17.209 9.403   1.00   60.31 ? 145  SER A C     1 
ATOM   1157 O  O     . SER A 1 151 ? -42.391 -16.458 10.378  1.00   59.37 ? 145  SER A O     1 
ATOM   1158 C  CB    . SER A 1 151 ? -41.185 -17.805 7.341   1.00   61.64 ? 145  SER A CB    1 
ATOM   1159 O  OG    . SER A 1 151 ? -41.939 -18.997 7.168   1.00   63.53 ? 145  SER A OG    1 
ATOM   1160 N  N     . LYS A 1 152 ? -42.894 -18.475 9.466   1.00   60.44 ? 146  LYS A N     1 
ATOM   1161 C  CA    . LYS A 1 152 ? -43.377 -19.133 10.682  1.00   59.04 ? 146  LYS A CA    1 
ATOM   1162 C  C     . LYS A 1 152 ? -42.364 -19.270 11.808  1.00   58.58 ? 146  LYS A C     1 
ATOM   1163 O  O     . LYS A 1 152 ? -42.719 -19.133 12.979  1.00   58.51 ? 146  LYS A O     1 
ATOM   1164 C  CB    . LYS A 1 152 ? -43.923 -20.520 10.338  1.00   60.07 ? 146  LYS A CB    1 
ATOM   1165 C  CG    . LYS A 1 152 ? -45.132 -20.912 11.180  1.00   62.46 ? 146  LYS A CG    1 
ATOM   1166 C  CD    . LYS A 1 152 ? -45.561 -22.367 10.987  1.00   62.95 ? 146  LYS A CD    1 
ATOM   1167 C  CE    . LYS A 1 152 ? -44.623 -23.329 11.725  1.00   64.34 ? 146  LYS A CE    1 
ATOM   1168 N  NZ    . LYS A 1 152 ? -45.053 -24.771 11.725  1.00   63.46 ? 146  LYS A NZ    1 
ATOM   1169 N  N     . ASN A 1 153 ? -41.113 -19.573 11.470  1.00   58.39 ? 147  ASN A N     1 
ATOM   1170 C  CA    . ASN A 1 153 ? -40.079 -19.701 12.496  1.00   56.79 ? 147  ASN A CA    1 
ATOM   1171 C  C     . ASN A 1 153 ? -38.739 -19.077 12.103  1.00   55.02 ? 147  ASN A C     1 
ATOM   1172 O  O     . ASN A 1 153 ? -38.479 -18.797 10.929  1.00   54.46 ? 147  ASN A O     1 
ATOM   1173 C  CB    . ASN A 1 153 ? -39.891 -21.171 12.909  1.00   59.04 ? 147  ASN A CB    1 
ATOM   1174 C  CG    . ASN A 1 153 ? -39.552 -22.086 11.742  1.00   61.22 ? 147  ASN A CG    1 
ATOM   1175 O  OD1   . ASN A 1 153 ? -38.658 -21.798 10.948  1.00   65.17 ? 147  ASN A OD1   1 
ATOM   1176 N  ND2   . ASN A 1 153 ? -40.255 -23.209 11.650  1.00   60.79 ? 147  ASN A ND2   1 
ATOM   1177 N  N     . LYS A 1 154 ? -37.902 -18.849 13.109  1.00   52.92 ? 148  LYS A N     1 
ATOM   1178 C  CA    . LYS A 1 154 ? -36.603 -18.241 12.919  1.00   49.54 ? 148  LYS A CA    1 
ATOM   1179 C  C     . LYS A 1 154 ? -35.805 -18.853 11.796  1.00   48.95 ? 148  LYS A C     1 
ATOM   1180 O  O     . LYS A 1 154 ? -35.202 -18.144 10.996  1.00   50.96 ? 148  LYS A O     1 
ATOM   1181 C  CB    . LYS A 1 154 ? -35.805 -18.321 14.212  1.00   49.58 ? 148  LYS A CB    1 
ATOM   1182 C  CG    . LYS A 1 154 ? -36.458 -17.565 15.359  1.00   51.22 ? 148  LYS A CG    1 
ATOM   1183 C  CD    . LYS A 1 154 ? -35.489 -17.285 16.501  1.00   51.47 ? 148  LYS A CD    1 
ATOM   1184 C  CE    . LYS A 1 154 ? -35.001 -18.560 17.154  1.00   52.83 ? 148  LYS A CE    1 
ATOM   1185 N  NZ    . LYS A 1 154 ? -34.070 -18.271 18.283  1.00   54.79 ? 148  LYS A NZ    1 
ATOM   1186 N  N     . VAL A 1 155 ? -35.804 -20.171 11.716  1.00   47.39 ? 149  VAL A N     1 
ATOM   1187 C  CA    . VAL A 1 155 ? -35.032 -20.837 10.681  1.00   45.66 ? 149  VAL A CA    1 
ATOM   1188 C  C     . VAL A 1 155 ? -35.422 -20.508 9.241   1.00   46.17 ? 149  VAL A C     1 
ATOM   1189 O  O     . VAL A 1 155 ? -34.563 -20.402 8.379   1.00   46.76 ? 149  VAL A O     1 
ATOM   1190 C  CB    . VAL A 1 155 ? -35.057 -22.357 10.889  1.00   44.08 ? 149  VAL A CB    1 
ATOM   1191 C  CG1   . VAL A 1 155 ? -34.453 -23.059 9.704   1.00   43.80 ? 149  VAL A CG1   1 
ATOM   1192 C  CG2   . VAL A 1 155 ? -34.290 -22.701 12.147  1.00   43.03 ? 149  VAL A CG2   1 
ATOM   1193 N  N     . PHE A 1 156 ? -36.704 -20.338 8.962   1.00   45.98 ? 150  PHE A N     1 
ATOM   1194 C  CA    . PHE A 1 156 ? -37.100 -20.038 7.593   1.00   45.44 ? 150  PHE A CA    1 
ATOM   1195 C  C     . PHE A 1 156 ? -37.073 -18.557 7.245   1.00   46.08 ? 150  PHE A C     1 
ATOM   1196 O  O     . PHE A 1 156 ? -36.919 -18.187 6.076   1.00   44.26 ? 150  PHE A O     1 
ATOM   1197 C  CB    . PHE A 1 156 ? -38.479 -20.630 7.292   1.00   48.14 ? 150  PHE A CB    1 
ATOM   1198 C  CG    . PHE A 1 156 ? -38.415 -21.986 6.653   1.00   47.94 ? 150  PHE A CG    1 
ATOM   1199 C  CD1   . PHE A 1 156 ? -38.228 -23.126 7.416   1.00   49.63 ? 150  PHE A CD1   1 
ATOM   1200 C  CD2   . PHE A 1 156 ? -38.467 -22.111 5.281   1.00   47.97 ? 150  PHE A CD2   1 
ATOM   1201 C  CE1   . PHE A 1 156 ? -38.091 -24.364 6.815   1.00   48.16 ? 150  PHE A CE1   1 
ATOM   1202 C  CE2   . PHE A 1 156 ? -38.330 -23.337 4.676   1.00   48.84 ? 150  PHE A CE2   1 
ATOM   1203 C  CZ    . PHE A 1 156 ? -38.141 -24.467 5.444   1.00   49.23 ? 150  PHE A CZ    1 
ATOM   1204 N  N     . ALA A 1 157 ? -37.237 -17.706 8.253   1.00   46.25 ? 151  ALA A N     1 
ATOM   1205 C  CA    . ALA A 1 157 ? -37.171 -16.276 8.021   1.00   46.12 ? 151  ALA A CA    1 
ATOM   1206 C  C     . ALA A 1 157 ? -35.705 -16.060 7.629   1.00   47.38 ? 151  ALA A C     1 
ATOM   1207 O  O     . ALA A 1 157 ? -35.398 -15.359 6.662   1.00   49.73 ? 151  ALA A O     1 
ATOM   1208 C  CB    . ALA A 1 157 ? -37.499 -15.529 9.289   1.00   46.58 ? 151  ALA A CB    1 
ATOM   1209 N  N     . LYS A 1 158 ? -34.807 -16.707 8.370   1.00   45.83 ? 152  LYS A N     1 
ATOM   1210 C  CA    . LYS A 1 158 ? -33.376 -16.623 8.109   1.00   42.99 ? 152  LYS A CA    1 
ATOM   1211 C  C     . LYS A 1 158 ? -33.087 -17.078 6.683   1.00   42.34 ? 152  LYS A C     1 
ATOM   1212 O  O     . LYS A 1 158 ? -32.353 -16.420 5.959   1.00   43.10 ? 152  LYS A O     1 
ATOM   1213 C  CB    . LYS A 1 158 ? -32.630 -17.492 9.124   1.00   41.05 ? 152  LYS A CB    1 
ATOM   1214 C  CG    . LYS A 1 158 ? -31.191 -17.798 8.795   1.00   39.21 ? 152  LYS A CG    1 
ATOM   1215 C  CD    . LYS A 1 158 ? -30.171 -16.793 9.334   1.00   37.45 ? 152  LYS A CD    1 
ATOM   1216 C  CE    . LYS A 1 158 ? -28.755 -17.358 9.175   1.00   33.66 ? 152  LYS A CE    1 
ATOM   1217 N  NZ    . LYS A 1 158 ? -27.703 -16.540 9.845   1.00   34.59 ? 152  LYS A NZ    1 
ATOM   1218 N  N     . ILE A 1 159 ? -33.678 -18.197 6.275   1.00   43.13 ? 153  ILE A N     1 
ATOM   1219 C  CA    . ILE A 1 159 ? -33.485 -18.742 4.925   1.00   42.73 ? 153  ILE A CA    1 
ATOM   1220 C  C     . ILE A 1 159 ? -34.015 -17.789 3.860   1.00   44.52 ? 153  ILE A C     1 
ATOM   1221 O  O     . ILE A 1 159 ? -33.444 -17.666 2.777   1.00   43.26 ? 153  ILE A O     1 
ATOM   1222 C  CB    . ILE A 1 159 ? -34.202 -20.085 4.770   1.00   40.73 ? 153  ILE A CB    1 
ATOM   1223 C  CG1   . ILE A 1 159 ? -33.577 -21.099 5.726   1.00   42.58 ? 153  ILE A CG1   1 
ATOM   1224 C  CG2   . ILE A 1 159 ? -34.131 -20.559 3.332   1.00   37.61 ? 153  ILE A CG2   1 
ATOM   1225 C  CD1   . ILE A 1 159 ? -34.239 -22.469 5.712   1.00   44.92 ? 153  ILE A CD1   1 
ATOM   1226 N  N     . ALA A 1 160 ? -35.111 -17.113 4.193   1.00   46.32 ? 154  ALA A N     1 
ATOM   1227 C  CA    . ALA A 1 160 ? -35.756 -16.158 3.300   1.00   46.58 ? 154  ALA A CA    1 
ATOM   1228 C  C     . ALA A 1 160 ? -34.801 -15.039 2.918   1.00   46.77 ? 154  ALA A C     1 
ATOM   1229 O  O     . ALA A 1 160 ? -34.671 -14.686 1.746   1.00   44.91 ? 154  ALA A O     1 
ATOM   1230 C  CB    . ALA A 1 160 ? -37.000 -15.575 3.984   1.00   46.85 ? 154  ALA A CB    1 
ATOM   1231 N  N     . ALA A 1 161 ? -34.149 -14.474 3.928   1.00   48.15 ? 155  ALA A N     1 
ATOM   1232 C  CA    . ALA A 1 161 ? -33.195 -13.400 3.710   1.00   49.60 ? 155  ALA A CA    1 
ATOM   1233 C  C     . ALA A 1 161 ? -32.004 -13.875 2.878   1.00   50.64 ? 155  ALA A C     1 
ATOM   1234 O  O     . ALA A 1 161 ? -31.664 -13.237 1.887   1.00   53.11 ? 155  ALA A O     1 
ATOM   1235 C  CB    . ALA A 1 161 ? -32.726 -12.835 5.048   1.00   49.26 ? 155  ALA A CB    1 
ATOM   1236 N  N     . ASP A 1 162 ? -31.380 -14.994 3.251   1.00   50.81 ? 156  ASP A N     1 
ATOM   1237 C  CA    . ASP A 1 162 ? -30.227 -15.503 2.484   1.00   50.54 ? 156  ASP A CA    1 
ATOM   1238 C  C     . ASP A 1 162 ? -30.579 -15.649 1.019   1.00   52.49 ? 156  ASP A C     1 
ATOM   1239 O  O     . ASP A 1 162 ? -29.700 -15.660 0.148   1.00   54.08 ? 156  ASP A O     1 
ATOM   1240 C  CB    . ASP A 1 162 ? -29.752 -16.870 2.994   1.00   47.73 ? 156  ASP A CB    1 
ATOM   1241 C  CG    . ASP A 1 162 ? -29.307 -16.831 4.435   1.00   47.25 ? 156  ASP A CG    1 
ATOM   1242 O  OD1   . ASP A 1 162 ? -28.899 -15.740 4.886   1.00   46.58 ? 156  ASP A OD1   1 
ATOM   1243 O  OD2   . ASP A 1 162 ? -29.362 -17.880 5.116   1.00   45.45 ? 156  ASP A OD2   1 
ATOM   1244 N  N     . MET A 1 163 ? -31.870 -15.764 0.739   1.00   53.68 ? 157  MET A N     1 
ATOM   1245 C  CA    . MET A 1 163 ? -32.313 -15.928 -0.628  1.00   54.35 ? 157  MET A CA    1 
ATOM   1246 C  C     . MET A 1 163 ? -32.585 -14.624 -1.360  1.00   54.34 ? 157  MET A C     1 
ATOM   1247 O  O     . MET A 1 163 ? -32.520 -14.569 -2.584  1.00   55.07 ? 157  MET A O     1 
ATOM   1248 C  CB    . MET A 1 163 ? -33.585 -16.774 -0.656  1.00   55.78 ? 157  MET A CB    1 
ATOM   1249 C  CG    . MET A 1 163 ? -33.428 -18.205 -0.188  1.00   58.77 ? 157  MET A CG    1 
ATOM   1250 S  SD    . MET A 1 163 ? -34.677 -19.298 -0.976  1.00   64.09 ? 157  MET A SD    1 
ATOM   1251 C  CE    . MET A 1 163 ? -36.133 -18.884 -0.020  1.00   62.66 ? 157  MET A CE    1 
ATOM   1252 N  N     . ALA A 1 164 ? -32.884 -13.580 -0.610  1.00   54.35 ? 158  ALA A N     1 
ATOM   1253 C  CA    . ALA A 1 164 ? -33.246 -12.303 -1.202  1.00   54.25 ? 158  ALA A CA    1 
ATOM   1254 C  C     . ALA A 1 164 ? -32.134 -11.329 -1.276  1.00   54.98 ? 158  ALA A C     1 
ATOM   1255 O  O     . ALA A 1 164 ? -32.190 -10.329 -1.997  1.00   55.77 ? 158  ALA A O     1 
ATOM   1256 C  CB    . ALA A 1 164 ? -34.300 -11.634 -0.410  1.00   54.34 ? 158  ALA A CB    1 
ATOM   1257 N  N     . LYS A 1 165 ? -31.072 -11.553 -0.528  1.00   55.34 ? 159  LYS A N     1 
ATOM   1258 C  CA    . LYS A 1 165 ? -29.921 -10.561 -0.486  1.00   56.27 ? 159  LYS A CA    1 
ATOM   1259 C  C     . LYS A 1 165 ? -29.156 -10.202 -1.749  1.00   56.38 ? 159  LYS A C     1 
ATOM   1260 O  O     . LYS A 1 165 ? -29.033 -11.022 -2.622  1.00   57.27 ? 159  LYS A O     1 
ATOM   1261 C  CB    . LYS A 1 165 ? -28.930 -11.001 0.675   1.00   56.84 ? 159  LYS A CB    1 
ATOM   1262 C  CG    . LYS A 1 165 ? -28.260 -12.230 0.328   1.00   56.98 ? 159  LYS A CG    1 
ATOM   1263 C  CD    . LYS A 1 165 ? -27.049 -12.341 1.185   1.00   55.99 ? 159  LYS A CD    1 
ATOM   1264 C  CE    . LYS A 1 165 ? -26.241 -13.558 0.795   1.00   54.52 ? 159  LYS A CE    1 
ATOM   1265 N  NZ    . LYS A 1 165 ? -24.873 -13.568 1.365   1.00   52.94 ? 159  LYS A NZ    1 
ATOM   1266 N  N     . PRO A 1 166 ? -28.614 -9.027  -1.832  1.00   54.94 ? 160  PRO A N     1 
ATOM   1267 C  CA    . PRO A 1 166 ? -28.681 -8.027  -0.810  1.00   54.58 ? 160  PRO A CA    1 
ATOM   1268 C  C     . PRO A 1 166 ? -29.835 -6.991  -0.884  1.00   53.81 ? 160  PRO A C     1 
ATOM   1269 O  O     . PRO A 1 166 ? -30.639 -7.058  -1.789  1.00   52.73 ? 160  PRO A O     1 
ATOM   1270 C  CB    . PRO A 1 166 ? -27.351 -7.425  -0.938  1.00   53.67 ? 160  PRO A CB    1 
ATOM   1271 C  CG    . PRO A 1 166 ? -27.182 -7.316  -2.431  1.00   53.42 ? 160  PRO A CG    1 
ATOM   1272 C  CD    . PRO A 1 166 ? -27.599 -8.680  -2.845  1.00   54.51 ? 160  PRO A CD    1 
ATOM   1273 N  N     . ASN A 1 167 ? -29.905 -6.061  0.048   1.00   52.69 ? 161  ASN A N     1 
ATOM   1274 C  CA    . ASN A 1 167 ? -30.947 -4.998  0.016   1.00   54.07 ? 161  ASN A CA    1 
ATOM   1275 C  C     . ASN A 1 167 ? -32.292 -5.467  -0.578  1.00   55.70 ? 161  ASN A C     1 
ATOM   1276 O  O     . ASN A 1 167 ? -32.922 -4.777  -1.389  1.00   56.76 ? 161  ASN A O     1 
ATOM   1277 C  CB    . ASN A 1 167 ? -30.428 -3.780  -0.807  1.00   54.09 ? 161  ASN A CB    1 
ATOM   1278 C  CG    . ASN A 1 167 ? -31.428 -2.619  -0.920  1.00   52.14 ? 161  ASN A CG    1 
ATOM   1279 O  OD1   . ASN A 1 167 ? -32.035 -2.191  0.060   1.00   52.67 ? 161  ASN A OD1   1 
ATOM   1280 N  ND2   . ASN A 1 167 ? -31.562 -2.083  -2.129  1.00   52.25 ? 161  ASN A ND2   1 
ATOM   1281 N  N     . GLY A 1 168 ? -32.716 -6.655  -0.168  1.00   56.48 ? 162  GLY A N     1 
ATOM   1282 C  CA    . GLY A 1 168 ? -33.961 -7.216  -0.653  1.00   57.22 ? 162  GLY A CA    1 
ATOM   1283 C  C     . GLY A 1 168 ? -34.961 -7.606  0.427   1.00   58.19 ? 162  GLY A C     1 
ATOM   1284 O  O     . GLY A 1 168 ? -34.854 -7.218  1.593   1.00   57.61 ? 162  GLY A O     1 
ATOM   1285 N  N     . ILE A 1 169 ? -35.958 -8.378  0.020   1.00   58.60 ? 163  ILE A N     1 
ATOM   1286 C  CA    . ILE A 1 169 ? -36.987 -8.845  0.934   1.00   59.65 ? 163  ILE A CA    1 
ATOM   1287 C  C     . ILE A 1 169 ? -37.715 -10.048 0.324   1.00   59.98 ? 163  ILE A C     1 
ATOM   1288 O  O     . ILE A 1 169 ? -37.888 -10.144 -0.899  1.00   59.28 ? 163  ILE A O     1 
ATOM   1289 C  CB    . ILE A 1 169 ? -38.002 -7.723  1.242   1.00   59.65 ? 163  ILE A CB    1 
ATOM   1290 C  CG1   . ILE A 1 169 ? -39.025 -8.209  2.271   1.00   60.17 ? 163  ILE A CG1   1 
ATOM   1291 C  CG2   . ILE A 1 169 ? -38.696 -7.289  -0.046  1.00   60.32 ? 163  ILE A CG2   1 
ATOM   1292 C  CD1   . ILE A 1 169 ? -39.911 -7.109  2.846   1.00   60.07 ? 163  ILE A CD1   1 
ATOM   1293 N  N     . LYS A 1 170 ? -38.114 -10.980 1.182   1.00   60.40 ? 164  LYS A N     1 
ATOM   1294 C  CA    . LYS A 1 170 ? -38.824 -12.169 0.736   1.00   59.81 ? 164  LYS A CA    1 
ATOM   1295 C  C     . LYS A 1 170 ? -39.613 -12.760 1.872   1.00   59.82 ? 164  LYS A C     1 
ATOM   1296 O  O     . LYS A 1 170 ? -39.228 -12.679 3.036   1.00   58.72 ? 164  LYS A O     1 
ATOM   1297 C  CB    . LYS A 1 170 ? -37.859 -13.225 0.197   1.00   58.92 ? 164  LYS A CB    1 
ATOM   1298 C  CG    . LYS A 1 170 ? -38.544 -14.507 -0.231  1.00   58.56 ? 164  LYS A CG    1 
ATOM   1299 C  CD    . LYS A 1 170 ? -37.555 -15.535 -0.754  1.00   58.18 ? 164  LYS A CD    1 
ATOM   1300 C  CE    . LYS A 1 170 ? -38.240 -16.842 -1.161  0.50   58.75 ? 164  LYS A CE    1 
ATOM   1301 N  NZ    . LYS A 1 170 ? -39.168 -16.721 -2.326  0.50   59.56 ? 164  LYS A NZ    1 
ATOM   1302 N  N     . VAL A 1 171 ? -40.737 -13.358 1.517   1.00   62.42 ? 165  VAL A N     1 
ATOM   1303 C  CA    . VAL A 1 171 ? -41.604 -13.976 2.496   1.00   63.44 ? 165  VAL A CA    1 
ATOM   1304 C  C     . VAL A 1 171 ? -41.785 -15.443 2.118   1.00   64.21 ? 165  VAL A C     1 
ATOM   1305 O  O     . VAL A 1 171 ? -42.076 -15.770 0.961   1.00   63.01 ? 165  VAL A O     1 
ATOM   1306 C  CB    . VAL A 1 171 ? -42.970 -13.259 2.535   1.00   62.99 ? 165  VAL A CB    1 
ATOM   1307 C  CG1   . VAL A 1 171 ? -43.749 -13.538 1.253   1.00   63.26 ? 165  VAL A CG1   1 
ATOM   1308 C  CG2   . VAL A 1 171 ? -43.740 -13.682 3.764   1.00   63.56 ? 165  VAL A CG2   1 
ATOM   1309 N  N     . ILE A 1 172 ? -41.568 -16.318 3.096   1.00   66.42 ? 166  ILE A N     1 
ATOM   1310 C  CA    . ILE A 1 172 ? -41.710 -17.760 2.902   1.00   68.79 ? 166  ILE A CA    1 
ATOM   1311 C  C     . ILE A 1 172 ? -42.931 -18.260 3.670   1.00   69.83 ? 166  ILE A C     1 
ATOM   1312 O  O     . ILE A 1 172 ? -42.820 -18.666 4.825   1.00   69.02 ? 166  ILE A O     1 
ATOM   1313 C  CB    . ILE A 1 172 ? -40.476 -18.527 3.411   1.00   69.19 ? 166  ILE A CB    1 
ATOM   1314 C  CG1   . ILE A 1 172 ? -39.213 -17.989 2.738   1.00   69.63 ? 166  ILE A CG1   1 
ATOM   1315 C  CG2   . ILE A 1 172 ? -40.638 -20.008 3.120   1.00   67.91 ? 166  ILE A CG2   1 
ATOM   1316 C  CD1   . ILE A 1 172 ? -37.943 -18.701 3.159   1.00   70.85 ? 166  ILE A CD1   1 
ATOM   1317 N  N     . ASP A 1 173 ? -44.088 -18.232 3.008   1.00   71.92 ? 167  ASP A N     1 
ATOM   1318 C  CA    . ASP A 1 173 ? -45.360 -18.649 3.603   1.00   73.20 ? 167  ASP A CA    1 
ATOM   1319 C  C     . ASP A 1 173 ? -45.385 -20.101 4.072   1.00   73.18 ? 167  ASP A C     1 
ATOM   1320 O  O     . ASP A 1 173 ? -44.360 -20.776 4.083   1.00   73.72 ? 167  ASP A O     1 
ATOM   1321 C  CB    . ASP A 1 173 ? -46.515 -18.390 2.613   1.00   74.10 ? 167  ASP A CB    1 
ATOM   1322 C  CG    . ASP A 1 173 ? -46.347 -19.136 1.301   1.00   75.07 ? 167  ASP A CG    1 
ATOM   1323 O  OD1   . ASP A 1 173 ? -46.391 -20.383 1.311   1.00   76.73 ? 167  ASP A OD1   1 
ATOM   1324 O  OD2   . ASP A 1 173 ? -46.169 -18.477 0.255   1.00   75.60 ? 167  ASP A OD2   1 
ATOM   1325 N  N     . ASP A 1 174 ? -46.565 -20.575 4.459   1.00   72.95 ? 168  ASP A N     1 
ATOM   1326 C  CA    . ASP A 1 174 ? -46.715 -21.940 4.938   1.00   72.60 ? 168  ASP A CA    1 
ATOM   1327 C  C     . ASP A 1 174 ? -46.658 -23.009 3.854   1.00   71.66 ? 168  ASP A C     1 
ATOM   1328 O  O     . ASP A 1 174 ? -46.446 -24.180 4.170   1.00   71.87 ? 168  ASP A O     1 
ATOM   1329 C  CB    . ASP A 1 174 ? -48.014 -22.073 5.728   1.00   74.08 ? 168  ASP A CB    1 
ATOM   1330 C  CG    . ASP A 1 174 ? -48.045 -21.160 6.939   1.00   76.01 ? 168  ASP A CG    1 
ATOM   1331 O  OD1   . ASP A 1 174 ? -48.019 -19.925 6.754   1.00   78.44 ? 168  ASP A OD1   1 
ATOM   1332 O  OD2   . ASP A 1 174 ? -48.083 -21.671 8.078   1.00   76.65 ? 168  ASP A OD2   1 
ATOM   1333 N  N     . GLU A 1 175 ? -46.845 -22.617 2.592   1.00   69.95 ? 169  GLU A N     1 
ATOM   1334 C  CA    . GLU A 1 175 ? -46.795 -23.563 1.475   1.00   68.44 ? 169  GLU A CA    1 
ATOM   1335 C  C     . GLU A 1 175 ? -45.360 -23.733 1.017   1.00   68.40 ? 169  GLU A C     1 
ATOM   1336 O  O     . GLU A 1 175 ? -44.902 -24.852 0.784   1.00   68.89 ? 169  GLU A O     1 
ATOM   1337 C  CB    . GLU A 1 175 ? -47.613 -23.067 0.285   0.50   67.61 ? 169  GLU A CB    1 
ATOM   1338 C  CG    . GLU A 1 175 ? -47.614 -24.020 -0.921  0.50   67.37 ? 169  GLU A CG    1 
ATOM   1339 C  CD    . GLU A 1 175 ? -46.240 -24.223 -1.556  0.50   67.08 ? 169  GLU A CD    1 
ATOM   1340 O  OE1   . GLU A 1 175 ? -45.655 -23.238 -2.055  0.50   67.05 ? 169  GLU A OE1   1 
ATOM   1341 O  OE2   . GLU A 1 175 ? -45.746 -25.373 -1.558  0.50   66.57 ? 169  GLU A OE2   1 
ATOM   1342 N  N     . GLU A 1 176 ? -44.661 -22.611 0.870   1.00   67.32 ? 170  GLU A N     1 
ATOM   1343 C  CA    . GLU A 1 176 ? -43.279 -22.637 0.419   1.00   66.05 ? 170  GLU A CA    1 
ATOM   1344 C  C     . GLU A 1 176 ? -42.452 -23.449 1.384   1.00   65.17 ? 170  GLU A C     1 
ATOM   1345 O  O     . GLU A 1 176 ? -41.639 -24.268 0.974   1.00   65.79 ? 170  GLU A O     1 
ATOM   1346 C  CB    . GLU A 1 176 ? -42.716 -21.221 0.312   0.50   64.97 ? 170  GLU A CB    1 
ATOM   1347 C  CG    . GLU A 1 176 ? -41.270 -21.187 -0.126  0.50   63.37 ? 170  GLU A CG    1 
ATOM   1348 C  CD    . GLU A 1 176 ? -40.806 -19.796 -0.455  0.50   62.92 ? 170  GLU A CD    1 
ATOM   1349 O  OE1   . GLU A 1 176 ? -40.933 -18.908 0.413   0.50   63.37 ? 170  GLU A OE1   1 
ATOM   1350 O  OE2   . GLU A 1 176 ? -40.315 -19.590 -1.584  0.50   62.25 ? 170  GLU A OE2   1 
ATOM   1351 N  N     . VAL A 1 177 ? -42.669 -23.228 2.671   1.00   64.61 ? 171  VAL A N     1 
ATOM   1352 C  CA    . VAL A 1 177 ? -41.932 -23.970 3.664   1.00   65.09 ? 171  VAL A CA    1 
ATOM   1353 C  C     . VAL A 1 177 ? -41.968 -25.433 3.256   1.00   65.86 ? 171  VAL A C     1 
ATOM   1354 O  O     . VAL A 1 177 ? -40.959 -26.137 3.324   1.00   65.89 ? 171  VAL A O     1 
ATOM   1355 C  CB    . VAL A 1 177 ? -42.560 -23.821 5.064   1.00   66.08 ? 171  VAL A CB    1 
ATOM   1356 C  CG1   . VAL A 1 177 ? -41.812 -24.709 6.051   1.00   67.02 ? 171  VAL A CG1   1 
ATOM   1357 C  CG2   . VAL A 1 177 ? -42.494 -22.371 5.527   1.00   64.63 ? 171  VAL A CG2   1 
ATOM   1358 N  N     . LYS A 1 178 ? -43.138 -25.874 2.804   1.00   66.79 ? 172  LYS A N     1 
ATOM   1359 C  CA    . LYS A 1 178 ? -43.325 -27.255 2.383   1.00   67.15 ? 172  LYS A CA    1 
ATOM   1360 C  C     . LYS A 1 178 ? -42.518 -27.598 1.132   1.00   67.70 ? 172  LYS A C     1 
ATOM   1361 O  O     . LYS A 1 178 ? -41.967 -28.692 1.023   1.00   68.03 ? 172  LYS A O     1 
ATOM   1362 C  CB    . LYS A 1 178 ? -44.812 -27.541 2.126   1.00   68.11 ? 172  LYS A CB    1 
ATOM   1363 C  CG    . LYS A 1 178 ? -45.723 -27.495 3.364   1.00   68.91 ? 172  LYS A CG    1 
ATOM   1364 C  CD    . LYS A 1 178 ? -47.129 -28.045 3.050   1.00   67.23 ? 172  LYS A CD    1 
ATOM   1365 C  CE    . LYS A 1 178 ? -47.993 -28.139 4.309   1.00   67.94 ? 172  LYS A CE    1 
ATOM   1366 N  NZ    . LYS A 1 178 ? -49.320 -28.793 4.085   1.00   65.50 ? 172  LYS A NZ    1 
ATOM   1367 N  N     . ARG A 1 179 ? -42.454 -26.669 0.184   1.00   68.52 ? 173  ARG A N     1 
ATOM   1368 C  CA    . ARG A 1 179 ? -41.712 -26.902 -1.053  1.00   69.27 ? 173  ARG A CA    1 
ATOM   1369 C  C     . ARG A 1 179 ? -40.216 -27.006 -0.764  1.00   70.24 ? 173  ARG A C     1 
ATOM   1370 O  O     . ARG A 1 179 ? -39.515 -27.830 -1.358  1.00   69.48 ? 173  ARG A O     1 
ATOM   1371 C  CB    . ARG A 1 179 ? -41.964 -25.769 -2.058  1.00   69.41 ? 173  ARG A CB    1 
ATOM   1372 C  CG    . ARG A 1 179 ? -41.160 -25.908 -3.339  0.50   69.70 ? 173  ARG A CG    1 
ATOM   1373 C  CD    . ARG A 1 179 ? -41.747 -25.099 -4.488  0.50   70.03 ? 173  ARG A CD    1 
ATOM   1374 N  NE    . ARG A 1 179 ? -41.754 -23.662 -4.227  0.50   70.33 ? 173  ARG A NE    1 
ATOM   1375 C  CZ    . ARG A 1 179 ? -42.833 -22.964 -3.887  0.50   70.30 ? 173  ARG A CZ    1 
ATOM   1376 N  NH1   . ARG A 1 179 ? -44.005 -23.570 -3.763  0.50   70.03 ? 173  ARG A NH1   1 
ATOM   1377 N  NH2   . ARG A 1 179 ? -42.735 -21.660 -3.673  0.50   69.89 ? 173  ARG A NH2   1 
ATOM   1378 N  N     . LEU A 1 180 ? -39.738 -26.166 0.154   1.00   70.72 ? 174  LEU A N     1 
ATOM   1379 C  CA    . LEU A 1 180 ? -38.331 -26.151 0.525   1.00   70.72 ? 174  LEU A CA    1 
ATOM   1380 C  C     . LEU A 1 180 ? -37.891 -27.414 1.232   1.00   70.51 ? 174  LEU A C     1 
ATOM   1381 O  O     . LEU A 1 180 ? -36.922 -28.046 0.831   1.00   70.08 ? 174  LEU A O     1 
ATOM   1382 C  CB    . LEU A 1 180 ? -38.023 -24.952 1.418   1.00   71.62 ? 174  LEU A CB    1 
ATOM   1383 C  CG    . LEU A 1 180 ? -37.627 -23.665 0.700   1.00   72.27 ? 174  LEU A CG    1 
ATOM   1384 C  CD1   . LEU A 1 180 ? -37.131 -22.657 1.717   1.00   72.40 ? 174  LEU A CD1   1 
ATOM   1385 C  CD2   . LEU A 1 180 ? -36.534 -23.959 -0.311  1.00   71.60 ? 174  LEU A CD2   1 
ATOM   1386 N  N     . ILE A 1 181 ? -38.596 -27.776 2.295   1.00   70.34 ? 175  ILE A N     1 
ATOM   1387 C  CA    . ILE A 1 181 ? -38.237 -28.967 3.040   1.00   70.62 ? 175  ILE A CA    1 
ATOM   1388 C  C     . ILE A 1 181 ? -37.951 -30.144 2.115   1.00   71.16 ? 175  ILE A C     1 
ATOM   1389 O  O     . ILE A 1 181 ? -37.167 -31.031 2.453   1.00   71.44 ? 175  ILE A O     1 
ATOM   1390 C  CB    . ILE A 1 181 ? -39.342 -29.359 4.032   1.00   70.07 ? 175  ILE A CB    1 
ATOM   1391 C  CG1   . ILE A 1 181 ? -39.472 -28.278 5.110   1.00   69.22 ? 175  ILE A CG1   1 
ATOM   1392 C  CG2   . ILE A 1 181 ? -39.025 -30.715 4.653   1.00   70.72 ? 175  ILE A CG2   1 
ATOM   1393 C  CD1   . ILE A 1 181 ? -40.434 -28.613 6.217   1.00   68.04 ? 175  ILE A CD1   1 
ATOM   1394 N  N     . ARG A 1 182 ? -38.566 -30.146 0.938   1.00   71.68 ? 176  ARG A N     1 
ATOM   1395 C  CA    . ARG A 1 182 ? -38.348 -31.235 -0.006  1.00   72.88 ? 176  ARG A CA    1 
ATOM   1396 C  C     . ARG A 1 182 ? -37.327 -30.892 -1.099  1.00   73.04 ? 176  ARG A C     1 
ATOM   1397 O  O     . ARG A 1 182 ? -36.832 -31.778 -1.797  1.00   72.99 ? 176  ARG A O     1 
ATOM   1398 C  CB    . ARG A 1 182 ? -39.679 -31.652 -0.656  1.00   74.27 ? 176  ARG A CB    1 
ATOM   1399 C  CG    . ARG A 1 182 ? -39.870 -31.191 -2.101  1.00   75.97 ? 176  ARG A CG    1 
ATOM   1400 C  CD    . ARG A 1 182 ? -40.414 -32.322 -2.983  1.00   77.56 ? 176  ARG A CD    1 
ATOM   1401 N  NE    . ARG A 1 182 ? -41.865 -32.281 -3.186  1.00   79.30 ? 176  ARG A NE    1 
ATOM   1402 C  CZ    . ARG A 1 182 ? -42.548 -33.182 -3.897  1.00   80.36 ? 176  ARG A CZ    1 
ATOM   1403 N  NH1   . ARG A 1 182 ? -41.914 -34.198 -4.471  1.00   80.88 ? 176  ARG A NH1   1 
ATOM   1404 N  NH2   . ARG A 1 182 ? -43.865 -33.071 -4.044  1.00   80.48 ? 176  ARG A NH2   1 
ATOM   1405 N  N     . GLU A 1 183 ? -37.002 -29.610 -1.236  1.00   73.02 ? 177  GLU A N     1 
ATOM   1406 C  CA    . GLU A 1 183 ? -36.071 -29.175 -2.273  1.00   72.15 ? 177  GLU A CA    1 
ATOM   1407 C  C     . GLU A 1 183 ? -34.849 -28.404 -1.775  1.00   71.82 ? 177  GLU A C     1 
ATOM   1408 O  O     . GLU A 1 183 ? -33.809 -28.400 -2.442  1.00   71.87 ? 177  GLU A O     1 
ATOM   1409 C  CB    . GLU A 1 183 ? -36.815 -28.317 -3.304  1.00   71.92 ? 177  GLU A CB    1 
ATOM   1410 C  CG    . GLU A 1 183 ? -37.857 -29.058 -4.118  0.50   70.49 ? 177  GLU A CG    1 
ATOM   1411 C  CD    . GLU A 1 183 ? -37.352 -29.443 -5.489  0.50   69.96 ? 177  GLU A CD    1 
ATOM   1412 O  OE1   . GLU A 1 183 ? -36.938 -28.533 -6.237  0.50   70.07 ? 177  GLU A OE1   1 
ATOM   1413 O  OE2   . GLU A 1 183 ? -37.376 -30.647 -5.814  0.50   69.30 ? 177  GLU A OE2   1 
ATOM   1414 N  N     . LEU A 1 184 ? -34.963 -27.743 -0.624  1.00   70.63 ? 178  LEU A N     1 
ATOM   1415 C  CA    . LEU A 1 184 ? -33.840 -26.972 -0.095  1.00   68.47 ? 178  LEU A CA    1 
ATOM   1416 C  C     . LEU A 1 184 ? -32.630 -27.864 0.146   1.00   66.38 ? 178  LEU A C     1 
ATOM   1417 O  O     . LEU A 1 184 ? -32.742 -28.939 0.735   1.00   65.05 ? 178  LEU A O     1 
ATOM   1418 C  CB    . LEU A 1 184 ? -34.220 -26.275 1.216   1.00   69.64 ? 178  LEU A CB    1 
ATOM   1419 C  CG    . LEU A 1 184 ? -33.083 -25.422 1.791   1.00   70.06 ? 178  LEU A CG    1 
ATOM   1420 C  CD1   . LEU A 1 184 ? -32.829 -24.267 0.835   1.00   69.88 ? 178  LEU A CD1   1 
ATOM   1421 C  CD2   . LEU A 1 184 ? -33.420 -24.912 3.188   1.00   69.66 ? 178  LEU A CD2   1 
ATOM   1422 N  N     . ASP A 1 185 ? -31.474 -27.408 -0.324  1.00   64.71 ? 179  ASP A N     1 
ATOM   1423 C  CA    . ASP A 1 185 ? -30.227 -28.143 -0.155  1.00   62.40 ? 179  ASP A CA    1 
ATOM   1424 C  C     . ASP A 1 185 ? -29.893 -28.137 1.333   1.00   59.69 ? 179  ASP A C     1 
ATOM   1425 O  O     . ASP A 1 185 ? -29.743 -27.078 1.928   1.00   59.61 ? 179  ASP A O     1 
ATOM   1426 C  CB    . ASP A 1 185 ? -29.110 -27.446 -0.930  1.00   64.33 ? 179  ASP A CB    1 
ATOM   1427 C  CG    . ASP A 1 185 ? -27.839 -28.271 -1.010  1.00   66.85 ? 179  ASP A CG    1 
ATOM   1428 O  OD1   . ASP A 1 185 ? -27.432 -28.885 0.002   1.00   69.12 ? 179  ASP A OD1   1 
ATOM   1429 O  OD2   . ASP A 1 185 ? -27.229 -28.292 -2.096  1.00   69.37 ? 179  ASP A OD2   1 
ATOM   1430 N  N     . ILE A 1 186 ? -29.786 -29.318 1.930   1.00   57.09 ? 180  ILE A N     1 
ATOM   1431 C  CA    . ILE A 1 186 ? -29.469 -29.441 3.348   1.00   54.23 ? 180  ILE A CA    1 
ATOM   1432 C  C     . ILE A 1 186 ? -28.334 -28.480 3.697   1.00   52.77 ? 180  ILE A C     1 
ATOM   1433 O  O     . ILE A 1 186 ? -28.321 -27.857 4.756   1.00   52.71 ? 180  ILE A O     1 
ATOM   1434 C  CB    . ILE A 1 186 ? -29.044 -30.900 3.685   1.00   54.05 ? 180  ILE A CB    1 
ATOM   1435 C  CG1   . ILE A 1 186 ? -29.230 -31.172 5.174   1.00   53.47 ? 180  ILE A CG1   1 
ATOM   1436 C  CG2   . ILE A 1 186 ? -27.588 -31.142 3.287   1.00   55.09 ? 180  ILE A CG2   1 
ATOM   1437 C  CD1   . ILE A 1 186 ? -30.666 -31.206 5.603   1.00   52.52 ? 180  ILE A CD1   1 
ATOM   1438 N  N     . ALA A 1 187 ? -27.392 -28.343 2.776   1.00   51.05 ? 181  ALA A N     1 
ATOM   1439 C  CA    . ALA A 1 187 ? -26.250 -27.476 2.984   1.00   50.23 ? 181  ALA A CA    1 
ATOM   1440 C  C     . ALA A 1 187 ? -26.641 -26.018 3.172   1.00   49.23 ? 181  ALA A C     1 
ATOM   1441 O  O     . ALA A 1 187 ? -25.855 -25.221 3.645   1.00   49.36 ? 181  ALA A O     1 
ATOM   1442 C  CB    . ALA A 1 187 ? -25.299 -27.613 1.823   1.00   50.40 ? 181  ALA A CB    1 
ATOM   1443 N  N     . ASP A 1 188 ? -27.861 -25.658 2.808   1.00   47.81 ? 182  ASP A N     1 
ATOM   1444 C  CA    . ASP A 1 188 ? -28.287 -24.279 2.965   1.00   44.72 ? 182  ASP A CA    1 
ATOM   1445 C  C     . ASP A 1 188 ? -29.085 -24.027 4.251   1.00   42.68 ? 182  ASP A C     1 
ATOM   1446 O  O     . ASP A 1 188 ? -29.677 -22.975 4.445   1.00   42.46 ? 182  ASP A O     1 
ATOM   1447 C  CB    . ASP A 1 188 ? -29.093 -23.851 1.738   1.00   47.66 ? 182  ASP A CB    1 
ATOM   1448 C  CG    . ASP A 1 188 ? -28.216 -23.600 0.522   1.00   47.94 ? 182  ASP A CG    1 
ATOM   1449 O  OD1   . ASP A 1 188 ? -27.195 -22.895 0.669   1.00   48.15 ? 182  ASP A OD1   1 
ATOM   1450 O  OD2   . ASP A 1 188 ? -28.560 -24.090 -0.576  1.00   49.70 ? 182  ASP A OD2   1 
ATOM   1451 N  N     . VAL A 1 189 ? -29.092 -24.985 5.155   1.00   40.78 ? 183  VAL A N     1 
ATOM   1452 C  CA    . VAL A 1 189 ? -29.827 -24.774 6.380   1.00   38.48 ? 183  VAL A CA    1 
ATOM   1453 C  C     . VAL A 1 189 ? -29.008 -24.078 7.468   1.00   37.30 ? 183  VAL A C     1 
ATOM   1454 O  O     . VAL A 1 189 ? -27.902 -24.487 7.793   1.00   37.59 ? 183  VAL A O     1 
ATOM   1455 C  CB    . VAL A 1 189 ? -30.381 -26.107 6.929   1.00   37.73 ? 183  VAL A CB    1 
ATOM   1456 C  CG1   . VAL A 1 189 ? -30.965 -25.891 8.322   1.00   37.33 ? 183  VAL A CG1   1 
ATOM   1457 C  CG2   . VAL A 1 189 ? -31.431 -26.653 5.987   1.00   36.52 ? 183  VAL A CG2   1 
ATOM   1458 N  N     . PRO A 1 190 ? -29.563 -23.012 8.054   1.00   37.10 ? 184  PRO A N     1 
ATOM   1459 C  CA    . PRO A 1 190 ? -28.922 -22.242 9.112   1.00   35.99 ? 184  PRO A CA    1 
ATOM   1460 C  C     . PRO A 1 190 ? -28.247 -23.126 10.128  1.00   37.32 ? 184  PRO A C     1 
ATOM   1461 O  O     . PRO A 1 190 ? -28.868 -24.040 10.668  1.00   37.97 ? 184  PRO A O     1 
ATOM   1462 C  CB    . PRO A 1 190 ? -30.089 -21.491 9.722   1.00   34.75 ? 184  PRO A CB    1 
ATOM   1463 C  CG    . PRO A 1 190 ? -30.868 -21.130 8.519   1.00   33.02 ? 184  PRO A CG    1 
ATOM   1464 C  CD    . PRO A 1 190 ? -30.870 -22.417 7.717   1.00   37.36 ? 184  PRO A CD    1 
ATOM   1465 N  N     . GLY A 1 191 ? -26.970 -22.860 10.383  1.00   38.65 ? 185  GLY A N     1 
ATOM   1466 C  CA    . GLY A 1 191 ? -26.257 -23.631 11.387  1.00   36.57 ? 185  GLY A CA    1 
ATOM   1467 C  C     . GLY A 1 191 ? -25.747 -24.946 10.876  1.00   36.45 ? 185  GLY A C     1 
ATOM   1468 O  O     . GLY A 1 191 ? -25.403 -25.816 11.661  1.00   37.81 ? 185  GLY A O     1 
ATOM   1469 N  N     . ILE A 1 192 ? -25.733 -25.116 9.562   1.00   35.64 ? 186  ILE A N     1 
ATOM   1470 C  CA    . ILE A 1 192 ? -25.199 -26.329 8.984   1.00   36.45 ? 186  ILE A CA    1 
ATOM   1471 C  C     . ILE A 1 192 ? -23.966 -25.851 8.228   1.00   38.54 ? 186  ILE A C     1 
ATOM   1472 O  O     . ILE A 1 192 ? -24.090 -25.203 7.218   1.00   39.41 ? 186  ILE A O     1 
ATOM   1473 C  CB    . ILE A 1 192 ? -26.191 -26.976 8.000   1.00   37.24 ? 186  ILE A CB    1 
ATOM   1474 C  CG1   . ILE A 1 192 ? -27.419 -27.432 8.766   1.00   35.00 ? 186  ILE A CG1   1 
ATOM   1475 C  CG2   . ILE A 1 192 ? -25.538 -28.158 7.271   1.00   33.95 ? 186  ILE A CG2   1 
ATOM   1476 C  CD1   . ILE A 1 192 ? -27.068 -28.303 9.928   1.00   38.74 ? 186  ILE A CD1   1 
ATOM   1477 N  N     . GLY A 1 193 ? -22.778 -26.159 8.739   1.00   40.78 ? 187  GLY A N     1 
ATOM   1478 C  CA    . GLY A 1 193 ? -21.547 -25.724 8.104   1.00   40.72 ? 187  GLY A CA    1 
ATOM   1479 C  C     . GLY A 1 193 ? -21.105 -26.706 7.055   1.00   41.61 ? 187  GLY A C     1 
ATOM   1480 O  O     . GLY A 1 193 ? -21.829 -27.657 6.752   1.00   40.60 ? 187  GLY A O     1 
ATOM   1481 N  N     . ASN A 1 194 ? -19.914 -26.476 6.512   1.00   40.95 ? 188  ASN A N     1 
ATOM   1482 C  CA    . ASN A 1 194 ? -19.359 -27.337 5.483   1.00   40.59 ? 188  ASN A CA    1 
ATOM   1483 C  C     . ASN A 1 194 ? -19.182 -28.739 6.014   1.00   40.84 ? 188  ASN A C     1 
ATOM   1484 O  O     . ASN A 1 194 ? -19.557 -29.722 5.368   1.00   42.15 ? 188  ASN A O     1 
ATOM   1485 C  CB    . ASN A 1 194 ? -18.012 -26.787 5.032   1.00   39.45 ? 188  ASN A CB    1 
ATOM   1486 C  CG    . ASN A 1 194 ? -18.066 -25.301 4.780   0.50   39.21 ? 188  ASN A CG    1 
ATOM   1487 O  OD1   . ASN A 1 194 ? -18.833 -24.841 3.932   0.50   38.93 ? 188  ASN A OD1   1 
ATOM   1488 N  ND2   . ASN A 1 194 ? -17.272 -24.536 5.528   0.50   36.49 ? 188  ASN A ND2   1 
ATOM   1489 N  N     . ILE A 1 195 ? -18.610 -28.830 7.202   1.00   40.21 ? 189  ILE A N     1 
ATOM   1490 C  CA    . ILE A 1 195 ? -18.361 -30.119 7.801   1.00   40.70 ? 189  ILE A CA    1 
ATOM   1491 C  C     . ILE A 1 195 ? -19.646 -30.902 7.961   1.00   42.37 ? 189  ILE A C     1 
ATOM   1492 O  O     . ILE A 1 195 ? -19.717 -32.078 7.596   1.00   44.05 ? 189  ILE A O     1 
ATOM   1493 C  CB    . ILE A 1 195 ? -17.722 -29.981 9.174   1.00   38.49 ? 189  ILE A CB    1 
ATOM   1494 C  CG1   . ILE A 1 195 ? -16.512 -29.036 9.104   1.00   39.46 ? 189  ILE A CG1   1 
ATOM   1495 C  CG2   . ILE A 1 195 ? -17.333 -31.346 9.682   1.00   38.08 ? 189  ILE A CG2   1 
ATOM   1496 C  CD1   . ILE A 1 195 ? -15.214 -29.638 8.580   1.00   38.94 ? 189  ILE A CD1   1 
ATOM   1497 N  N     . THR A 1 196 ? -20.668 -30.259 8.511   1.00   42.51 ? 190  THR A N     1 
ATOM   1498 C  CA    . THR A 1 196 ? -21.940 -30.946 8.725   1.00   42.29 ? 190  THR A CA    1 
ATOM   1499 C  C     . THR A 1 196 ? -22.670 -31.300 7.431   1.00   41.76 ? 190  THR A C     1 
ATOM   1500 O  O     . THR A 1 196 ? -23.326 -32.328 7.343   1.00   40.28 ? 190  THR A O     1 
ATOM   1501 C  CB    . THR A 1 196 ? -22.871 -30.116 9.632   1.00   43.51 ? 190  THR A CB    1 
ATOM   1502 O  OG1   . THR A 1 196 ? -22.168 -29.779 10.839  1.00   44.94 ? 190  THR A OG1   1 
ATOM   1503 C  CG2   . THR A 1 196 ? -24.134 -30.928 9.997   1.00   41.69 ? 190  THR A CG2   1 
ATOM   1504 N  N     . ALA A 1 197 ? -22.562 -30.437 6.430   1.00   42.76 ? 191  ALA A N     1 
ATOM   1505 C  CA    . ALA A 1 197 ? -23.187 -30.698 5.143   1.00   44.17 ? 191  ALA A CA    1 
ATOM   1506 C  C     . ALA A 1 197 ? -22.561 -31.977 4.578   1.00   46.02 ? 191  ALA A C     1 
ATOM   1507 O  O     . ALA A 1 197 ? -23.275 -32.931 4.271   1.00   47.32 ? 191  ALA A O     1 
ATOM   1508 C  CB    . ALA A 1 197 ? -22.958 -29.520 4.183   1.00   42.28 ? 191  ALA A CB    1 
ATOM   1509 N  N     . GLU A 1 198 ? -21.231 -31.995 4.466   1.00   48.25 ? 192  GLU A N     1 
ATOM   1510 C  CA    . GLU A 1 198 ? -20.507 -33.147 3.940   1.00   49.68 ? 192  GLU A CA    1 
ATOM   1511 C  C     . GLU A 1 198 ? -20.964 -34.419 4.593   1.00   51.54 ? 192  GLU A C     1 
ATOM   1512 O  O     . GLU A 1 198 ? -21.406 -35.335 3.919   1.00   54.49 ? 192  GLU A O     1 
ATOM   1513 C  CB    . GLU A 1 198 ? -19.003 -33.009 4.179   1.00   49.06 ? 192  GLU A CB    1 
ATOM   1514 C  CG    . GLU A 1 198 ? -18.419 -31.716 3.695   0.50   47.29 ? 192  GLU A CG    1 
ATOM   1515 C  CD    . GLU A 1 198 ? -18.751 -31.423 2.251   0.50   46.68 ? 192  GLU A CD    1 
ATOM   1516 O  OE1   . GLU A 1 198 ? -18.526 -32.307 1.397   0.50   44.57 ? 192  GLU A OE1   1 
ATOM   1517 O  OE2   . GLU A 1 198 ? -19.229 -30.302 1.971   0.50   45.65 ? 192  GLU A OE2   1 
ATOM   1518 N  N     . LYS A 1 199 ? -20.834 -34.488 5.911   1.00   54.23 ? 193  LYS A N     1 
ATOM   1519 C  CA    . LYS A 1 199 ? -21.247 -35.682 6.641   1.00   56.34 ? 193  LYS A CA    1 
ATOM   1520 C  C     . LYS A 1 199 ? -22.634 -36.159 6.187   1.00   58.89 ? 193  LYS A C     1 
ATOM   1521 O  O     . LYS A 1 199 ? -22.919 -37.361 6.205   1.00   60.35 ? 193  LYS A O     1 
ATOM   1522 C  CB    . LYS A 1 199 ? -21.278 -35.415 8.153   1.00   55.75 ? 193  LYS A CB    1 
ATOM   1523 C  CG    . LYS A 1 199 ? -19.932 -35.175 8.839   1.00   54.32 ? 193  LYS A CG    1 
ATOM   1524 C  CD    . LYS A 1 199 ? -20.152 -34.984 10.339  1.00   52.60 ? 193  LYS A CD    1 
ATOM   1525 C  CE    . LYS A 1 199 ? -18.861 -34.747 11.094  1.00   54.24 ? 193  LYS A CE    1 
ATOM   1526 N  NZ    . LYS A 1 199 ? -19.080 -34.570 12.564  1.00   54.15 ? 193  LYS A NZ    1 
ATOM   1527 N  N     . LEU A 1 200 ? -23.490 -35.221 5.778   1.00   60.43 ? 194  LEU A N     1 
ATOM   1528 C  CA    . LEU A 1 200 ? -24.843 -35.561 5.345   1.00   62.31 ? 194  LEU A CA    1 
ATOM   1529 C  C     . LEU A 1 200 ? -24.875 -36.204 3.964   1.00   63.58 ? 194  LEU A C     1 
ATOM   1530 O  O     . LEU A 1 200 ? -25.796 -36.947 3.640   1.00   64.05 ? 194  LEU A O     1 
ATOM   1531 C  CB    . LEU A 1 200 ? -25.731 -34.314 5.388   1.00   62.67 ? 194  LEU A CB    1 
ATOM   1532 C  CG    . LEU A 1 200 ? -25.867 -33.735 6.804   1.00   63.14 ? 194  LEU A CG    1 
ATOM   1533 C  CD1   . LEU A 1 200 ? -26.655 -32.439 6.786   1.00   62.56 ? 194  LEU A CD1   1 
ATOM   1534 C  CD2   . LEU A 1 200 ? -26.536 -34.761 7.707   1.00   63.66 ? 194  LEU A CD2   1 
ATOM   1535 N  N     . LYS A 1 201 ? -23.868 -35.911 3.151   1.00   65.05 ? 195  LYS A N     1 
ATOM   1536 C  CA    . LYS A 1 201 ? -23.770 -36.504 1.825   1.00   66.32 ? 195  LYS A CA    1 
ATOM   1537 C  C     . LYS A 1 201 ? -23.648 -38.005 2.035   1.00   67.32 ? 195  LYS A C     1 
ATOM   1538 O  O     . LYS A 1 201 ? -24.353 -38.796 1.402   1.00   66.84 ? 195  LYS A O     1 
ATOM   1539 C  CB    . LYS A 1 201 ? -22.522 -35.993 1.102   1.00   66.96 ? 195  LYS A CB    1 
ATOM   1540 C  CG    . LYS A 1 201 ? -22.793 -34.929 0.058   1.00   68.01 ? 195  LYS A CG    1 
ATOM   1541 C  CD    . LYS A 1 201 ? -23.545 -33.756 0.647   1.00   68.79 ? 195  LYS A CD    1 
ATOM   1542 C  CE    . LYS A 1 201 ? -23.984 -32.806 -0.445  1.00   68.94 ? 195  LYS A CE    1 
ATOM   1543 N  NZ    . LYS A 1 201 ? -24.782 -31.671 0.104   1.00   70.71 ? 195  LYS A NZ    1 
ATOM   1544 N  N     . LYS A 1 202 ? -22.746 -38.384 2.939   1.00   67.75 ? 196  LYS A N     1 
ATOM   1545 C  CA    . LYS A 1 202 ? -22.519 -39.785 3.250   1.00   67.27 ? 196  LYS A CA    1 
ATOM   1546 C  C     . LYS A 1 202 ? -23.837 -40.455 3.574   1.00   67.76 ? 196  LYS A C     1 
ATOM   1547 O  O     . LYS A 1 202 ? -24.383 -41.186 2.752   1.00   68.61 ? 196  LYS A O     1 
ATOM   1548 C  CB    . LYS A 1 202 ? -21.562 -39.934 4.436   0.50   66.69 ? 196  LYS A CB    1 
ATOM   1549 C  CG    . LYS A 1 202 ? -20.198 -39.321 4.203   0.50   65.79 ? 196  LYS A CG    1 
ATOM   1550 C  CD    . LYS A 1 202 ? -19.170 -39.877 5.167   0.50   65.52 ? 196  LYS A CD    1 
ATOM   1551 C  CE    . LYS A 1 202 ? -17.788 -39.316 4.868   0.50   66.13 ? 196  LYS A CE    1 
ATOM   1552 N  NZ    . LYS A 1 202 ? -16.710 -40.102 5.534   0.50   66.11 ? 196  LYS A NZ    1 
ATOM   1553 N  N     . LEU A 1 203 ? -24.354 -40.186 4.766   1.00   68.04 ? 197  LEU A N     1 
ATOM   1554 C  CA    . LEU A 1 203 ? -25.613 -40.782 5.210   1.00   68.52 ? 197  LEU A CA    1 
ATOM   1555 C  C     . LEU A 1 203 ? -26.721 -40.768 4.153   1.00   68.97 ? 197  LEU A C     1 
ATOM   1556 O  O     . LEU A 1 203 ? -27.758 -41.411 4.331   1.00   69.26 ? 197  LEU A O     1 
ATOM   1557 C  CB    . LEU A 1 203 ? -26.128 -40.084 6.475   1.00   68.14 ? 197  LEU A CB    1 
ATOM   1558 C  CG    . LEU A 1 203 ? -25.328 -40.238 7.767   1.00   66.50 ? 197  LEU A CG    1 
ATOM   1559 C  CD1   . LEU A 1 203 ? -26.087 -39.575 8.895   1.00   65.74 ? 197  LEU A CD1   1 
ATOM   1560 C  CD2   . LEU A 1 203 ? -25.085 -41.705 8.064   1.00   66.88 ? 197  LEU A CD2   1 
ATOM   1561 N  N     . GLY A 1 204 ? -26.510 -40.032 3.065   1.00   68.23 ? 198  GLY A N     1 
ATOM   1562 C  CA    . GLY A 1 204 ? -27.505 -39.973 2.008   1.00   67.21 ? 198  GLY A CA    1 
ATOM   1563 C  C     . GLY A 1 204 ? -28.499 -38.843 2.160   1.00   66.56 ? 198  GLY A C     1 
ATOM   1564 O  O     . GLY A 1 204 ? -29.677 -38.983 1.835   1.00   66.81 ? 198  GLY A O     1 
ATOM   1565 N  N     . ILE A 1 205 ? -28.022 -37.708 2.644   1.00   65.95 ? 199  ILE A N     1 
ATOM   1566 C  CA    . ILE A 1 205 ? -28.898 -36.568 2.831   1.00   65.58 ? 199  ILE A CA    1 
ATOM   1567 C  C     . ILE A 1 205 ? -28.429 -35.365 2.029   1.00   64.02 ? 199  ILE A C     1 
ATOM   1568 O  O     . ILE A 1 205 ? -27.251 -35.016 2.041   1.00   64.32 ? 199  ILE A O     1 
ATOM   1569 C  CB    . ILE A 1 205 ? -28.987 -36.186 4.314   1.00   66.45 ? 199  ILE A CB    1 
ATOM   1570 C  CG1   . ILE A 1 205 ? -29.366 -37.418 5.140   1.00   67.16 ? 199  ILE A CG1   1 
ATOM   1571 C  CG2   . ILE A 1 205 ? -30.026 -35.097 4.499   1.00   66.48 ? 199  ILE A CG2   1 
ATOM   1572 C  CD1   . ILE A 1 205 ? -29.513 -37.153 6.625   1.00   68.16 ? 199  ILE A CD1   1 
ATOM   1573 N  N     . ASN A 1 206 ? -29.366 -34.743 1.324   1.00   62.95 ? 200  ASN A N     1 
ATOM   1574 C  CA    . ASN A 1 206 ? -29.072 -33.570 0.513   1.00   62.81 ? 200  ASN A CA    1 
ATOM   1575 C  C     . ASN A 1 206 ? -30.226 -32.576 0.574   1.00   61.36 ? 200  ASN A C     1 
ATOM   1576 O  O     . ASN A 1 206 ? -30.094 -31.434 0.140   1.00   60.55 ? 200  ASN A O     1 
ATOM   1577 C  CB    . ASN A 1 206 ? -28.804 -33.998 -0.924  1.00   63.59 ? 200  ASN A CB    1 
ATOM   1578 C  CG    . ASN A 1 206 ? -27.656 -34.974 -1.019  1.00   65.76 ? 200  ASN A CG    1 
ATOM   1579 O  OD1   . ASN A 1 206 ? -26.511 -34.625 -0.739  1.00   67.74 ? 200  ASN A OD1   1 
ATOM   1580 N  ND2   . ASN A 1 206 ? -27.955 -36.211 -1.397  1.00   67.13 ? 200  ASN A ND2   1 
ATOM   1581 N  N     . LYS A 1 207 ? -31.352 -33.030 1.123   1.00   60.08 ? 201  LYS A N     1 
ATOM   1582 C  CA    . LYS A 1 207 ? -32.551 -32.211 1.284   1.00   59.33 ? 201  LYS A CA    1 
ATOM   1583 C  C     . LYS A 1 207 ? -33.031 -32.325 2.709   1.00   58.50 ? 201  LYS A C     1 
ATOM   1584 O  O     . LYS A 1 207 ? -32.863 -33.356 3.346   1.00   57.63 ? 201  LYS A O     1 
ATOM   1585 C  CB    . LYS A 1 207 ? -33.682 -32.676 0.363   1.00   59.44 ? 201  LYS A CB    1 
ATOM   1586 C  CG    . LYS A 1 207 ? -33.347 -32.634 -1.118  1.00   59.65 ? 201  LYS A CG    1 
ATOM   1587 C  CD    . LYS A 1 207 ? -33.082 -31.227 -1.592  1.00   59.34 ? 201  LYS A CD    1 
ATOM   1588 C  CE    . LYS A 1 207 ? -32.594 -31.225 -3.032  1.00   59.53 ? 201  LYS A CE    1 
ATOM   1589 N  NZ    . LYS A 1 207 ? -32.169 -29.854 -3.450  1.00   60.82 ? 201  LYS A NZ    1 
ATOM   1590 N  N     . LEU A 1 208 ? -33.630 -31.256 3.209   1.00   58.56 ? 202  LEU A N     1 
ATOM   1591 C  CA    . LEU A 1 208 ? -34.141 -31.269 4.563   1.00   59.25 ? 202  LEU A CA    1 
ATOM   1592 C  C     . LEU A 1 208 ? -35.065 -32.477 4.756   1.00   60.01 ? 202  LEU A C     1 
ATOM   1593 O  O     . LEU A 1 208 ? -35.131 -33.056 5.839   1.00   60.57 ? 202  LEU A O     1 
ATOM   1594 C  CB    . LEU A 1 208 ? -34.917 -29.983 4.837   1.00   58.47 ? 202  LEU A CB    1 
ATOM   1595 C  CG    . LEU A 1 208 ? -34.551 -29.194 6.092   1.00   58.77 ? 202  LEU A CG    1 
ATOM   1596 C  CD1   . LEU A 1 208 ? -35.541 -28.051 6.253   1.00   59.03 ? 202  LEU A CD1   1 
ATOM   1597 C  CD2   . LEU A 1 208 ? -34.567 -30.091 7.320   1.00   58.44 ? 202  LEU A CD2   1 
ATOM   1598 N  N     . VAL A 1 209 ? -35.767 -32.866 3.698   1.00   60.84 ? 203  VAL A N     1 
ATOM   1599 C  CA    . VAL A 1 209 ? -36.704 -33.977 3.779   1.00   61.02 ? 203  VAL A CA    1 
ATOM   1600 C  C     . VAL A 1 209 ? -36.063 -35.327 4.032   1.00   61.52 ? 203  VAL A C     1 
ATOM   1601 O  O     . VAL A 1 209 ? -36.584 -36.116 4.818   1.00   62.19 ? 203  VAL A O     1 
ATOM   1602 C  CB    . VAL A 1 209 ? -37.540 -34.090 2.502   1.00   61.92 ? 203  VAL A CB    1 
ATOM   1603 C  CG1   . VAL A 1 209 ? -36.654 -34.513 1.326   1.00   62.58 ? 203  VAL A CG1   1 
ATOM   1604 C  CG2   . VAL A 1 209 ? -38.660 -35.068 2.721   1.00   60.91 ? 203  VAL A CG2   1 
ATOM   1605 N  N     . ASP A 1 210 ? -34.947 -35.599 3.359   1.00   61.72 ? 204  ASP A N     1 
ATOM   1606 C  CA    . ASP A 1 210 ? -34.245 -36.875 3.512   1.00   61.91 ? 204  ASP A CA    1 
ATOM   1607 C  C     . ASP A 1 210 ? -34.051 -37.297 4.972   1.00   61.27 ? 204  ASP A C     1 
ATOM   1608 O  O     . ASP A 1 210 ? -34.023 -38.486 5.283   1.00   61.30 ? 204  ASP A O     1 
ATOM   1609 C  CB    . ASP A 1 210 ? -32.878 -36.821 2.821   1.00   63.59 ? 204  ASP A CB    1 
ATOM   1610 C  CG    . ASP A 1 210 ? -32.977 -36.429 1.368   1.00   65.66 ? 204  ASP A CG    1 
ATOM   1611 O  OD1   . ASP A 1 210 ? -33.762 -37.071 0.641   1.00   68.00 ? 204  ASP A OD1   1 
ATOM   1612 O  OD2   . ASP A 1 210 ? -32.266 -35.489 0.948   1.00   66.25 ? 204  ASP A OD2   1 
ATOM   1613 N  N     . THR A 1 211 ? -33.914 -36.327 5.868   1.00   60.68 ? 205  THR A N     1 
ATOM   1614 C  CA    . THR A 1 211 ? -33.721 -36.634 7.280   1.00   60.12 ? 205  THR A CA    1 
ATOM   1615 C  C     . THR A 1 211 ? -34.874 -37.454 7.837   1.00   60.40 ? 205  THR A C     1 
ATOM   1616 O  O     . THR A 1 211 ? -34.840 -37.875 8.986   1.00   61.88 ? 205  THR A O     1 
ATOM   1617 C  CB    . THR A 1 211 ? -33.585 -35.349 8.132   1.00   58.32 ? 205  THR A CB    1 
ATOM   1618 O  OG1   . THR A 1 211 ? -34.703 -34.493 7.885   1.00   58.59 ? 205  THR A OG1   1 
ATOM   1619 C  CG2   . THR A 1 211 ? -32.302 -34.607 7.797   1.00   55.89 ? 205  THR A CG2   1 
ATOM   1620 N  N     . LEU A 1 212 ? -35.903 -37.675 7.028   1.00   60.84 ? 206  LEU A N     1 
ATOM   1621 C  CA    . LEU A 1 212 ? -37.050 -38.453 7.481   1.00   61.71 ? 206  LEU A CA    1 
ATOM   1622 C  C     . LEU A 1 212 ? -36.932 -39.930 7.117   1.00   61.64 ? 206  LEU A C     1 
ATOM   1623 O  O     . LEU A 1 212 ? -37.583 -40.770 7.728   1.00   60.74 ? 206  LEU A O     1 
ATOM   1624 C  CB    . LEU A 1 212 ? -38.355 -37.878 6.912   1.00   62.52 ? 206  LEU A CB    1 
ATOM   1625 C  CG    . LEU A 1 212 ? -38.916 -36.590 7.534   1.00   62.92 ? 206  LEU A CG    1 
ATOM   1626 C  CD1   . LEU A 1 212 ? -40.244 -36.241 6.864   1.00   62.12 ? 206  LEU A CD1   1 
ATOM   1627 C  CD2   . LEU A 1 212 ? -39.108 -36.776 9.041   1.00   60.75 ? 206  LEU A CD2   1 
ATOM   1628 N  N     . SER A 1 213 ? -36.104 -40.236 6.121   1.00   62.71 ? 207  SER A N     1 
ATOM   1629 C  CA    . SER A 1 213 ? -35.886 -41.616 5.691   1.00   64.90 ? 207  SER A CA    1 
ATOM   1630 C  C     . SER A 1 213 ? -34.955 -42.342 6.671   1.00   66.29 ? 207  SER A C     1 
ATOM   1631 O  O     . SER A 1 213 ? -35.326 -43.365 7.252   1.00   67.28 ? 207  SER A O     1 
ATOM   1632 C  CB    . SER A 1 213 ? -35.273 -41.650 4.285   1.00   65.33 ? 207  SER A CB    1 
ATOM   1633 O  OG    . SER A 1 213 ? -36.154 -41.117 3.308   1.00   64.59 ? 207  SER A OG    1 
ATOM   1634 N  N     . ILE A 1 214 ? -33.753 -41.801 6.855   1.00   66.67 ? 208  ILE A N     1 
ATOM   1635 C  CA    . ILE A 1 214 ? -32.762 -42.378 7.758   1.00   66.95 ? 208  ILE A CA    1 
ATOM   1636 C  C     . ILE A 1 214 ? -33.237 -42.596 9.190   1.00   67.97 ? 208  ILE A C     1 
ATOM   1637 O  O     . ILE A 1 214 ? -34.105 -41.884 9.682   1.00   68.21 ? 208  ILE A O     1 
ATOM   1638 C  CB    . ILE A 1 214 ? -31.505 -41.502 7.792   1.00   66.11 ? 208  ILE A CB    1 
ATOM   1639 C  CG1   . ILE A 1 214 ? -30.867 -41.501 6.405   1.00   66.01 ? 208  ILE A CG1   1 
ATOM   1640 C  CG2   . ILE A 1 214 ? -30.550 -41.981 8.864   1.00   64.43 ? 208  ILE A CG2   1 
ATOM   1641 C  CD1   . ILE A 1 214 ? -30.786 -42.881 5.776   1.00   66.47 ? 208  ILE A CD1   1 
ATOM   1642 N  N     . GLU A 1 215 ? -32.649 -43.592 9.847   1.00   69.02 ? 209  GLU A N     1 
ATOM   1643 C  CA    . GLU A 1 215 ? -32.973 -43.935 11.230  1.00   70.02 ? 209  GLU A CA    1 
ATOM   1644 C  C     . GLU A 1 215 ? -32.323 -42.957 12.199  1.00   71.16 ? 209  GLU A C     1 
ATOM   1645 O  O     . GLU A 1 215 ? -31.097 -42.838 12.226  1.00   71.77 ? 209  GLU A O     1 
ATOM   1646 C  CB    . GLU A 1 215 ? -32.474 -45.346 11.558  0.50   69.89 ? 209  GLU A CB    1 
ATOM   1647 C  CG    . GLU A 1 215 ? -33.236 -46.473 10.886  0.50   69.94 ? 209  GLU A CG    1 
ATOM   1648 C  CD    . GLU A 1 215 ? -34.624 -46.663 11.464  0.50   69.93 ? 209  GLU A CD    1 
ATOM   1649 O  OE1   . GLU A 1 215 ? -34.734 -46.851 12.694  0.50   70.21 ? 209  GLU A OE1   1 
ATOM   1650 O  OE2   . GLU A 1 215 ? -35.603 -46.630 10.691  0.50   70.16 ? 209  GLU A OE2   1 
ATOM   1651 N  N     . PHE A 1 216 ? -33.140 -42.273 12.999  1.00   72.05 ? 210  PHE A N     1 
ATOM   1652 C  CA    . PHE A 1 216 ? -32.643 -41.307 13.981  1.00   72.48 ? 210  PHE A CA    1 
ATOM   1653 C  C     . PHE A 1 216 ? -31.300 -41.745 14.550  1.00   72.52 ? 210  PHE A C     1 
ATOM   1654 O  O     . PHE A 1 216 ? -30.372 -40.944 14.632  1.00   73.31 ? 210  PHE A O     1 
ATOM   1655 C  CB    . PHE A 1 216 ? -33.657 -41.130 15.125  1.00   72.27 ? 210  PHE A CB    1 
ATOM   1656 C  CG    . PHE A 1 216 ? -33.235 -40.127 16.184  1.00   72.31 ? 210  PHE A CG    1 
ATOM   1657 C  CD1   . PHE A 1 216 ? -34.060 -39.054 16.509  1.00   72.72 ? 210  PHE A CD1   1 
ATOM   1658 C  CD2   . PHE A 1 216 ? -32.035 -40.272 16.878  1.00   71.83 ? 210  PHE A CD2   1 
ATOM   1659 C  CE1   . PHE A 1 216 ? -33.696 -38.146 17.509  1.00   72.51 ? 210  PHE A CE1   1 
ATOM   1660 C  CE2   . PHE A 1 216 ? -31.662 -39.372 17.878  1.00   71.83 ? 210  PHE A CE2   1 
ATOM   1661 C  CZ    . PHE A 1 216 ? -32.490 -38.310 18.195  1.00   71.98 ? 210  PHE A CZ    1 
ATOM   1662 N  N     . ASP A 1 217 ? -31.196 -43.014 14.940  1.00   72.24 ? 211  ASP A N     1 
ATOM   1663 C  CA    . ASP A 1 217 ? -29.952 -43.526 15.504  1.00   72.10 ? 211  ASP A CA    1 
ATOM   1664 C  C     . ASP A 1 217 ? -28.738 -43.305 14.612  1.00   71.17 ? 211  ASP A C     1 
ATOM   1665 O  O     . ASP A 1 217 ? -27.689 -42.881 15.090  1.00   71.30 ? 211  ASP A O     1 
ATOM   1666 C  CB    . ASP A 1 217 ? -30.085 -45.014 15.847  1.00   73.17 ? 211  ASP A CB    1 
ATOM   1667 C  CG    . ASP A 1 217 ? -30.637 -45.239 17.244  1.00   74.28 ? 211  ASP A CG    1 
ATOM   1668 O  OD1   . ASP A 1 217 ? -31.782 -44.799 17.506  1.00   74.86 ? 211  ASP A OD1   1 
ATOM   1669 O  OD2   . ASP A 1 217 ? -29.920 -45.847 18.072  1.00   73.77 ? 211  ASP A OD2   1 
ATOM   1670 N  N     . LYS A 1 218 ? -28.862 -43.592 13.322  1.00   70.10 ? 212  LYS A N     1 
ATOM   1671 C  CA    . LYS A 1 218 ? -27.730 -43.391 12.430  1.00   69.65 ? 212  LYS A CA    1 
ATOM   1672 C  C     . LYS A 1 218 ? -27.287 -41.932 12.530  1.00   69.71 ? 212  LYS A C     1 
ATOM   1673 O  O     . LYS A 1 218 ? -26.120 -41.654 12.812  1.00   69.38 ? 212  LYS A O     1 
ATOM   1674 C  CB    . LYS A 1 218 ? -28.112 -43.718 10.990  1.00   69.05 ? 212  LYS A CB    1 
ATOM   1675 C  CG    . LYS A 1 218 ? -26.966 -43.581 10.011  0.50   68.95 ? 212  LYS A CG    1 
ATOM   1676 C  CD    . LYS A 1 218 ? -26.338 -44.923 9.690   0.50   68.66 ? 212  LYS A CD    1 
ATOM   1677 C  CE    . LYS A 1 218 ? -27.202 -45.696 8.717   0.50   68.38 ? 212  LYS A CE    1 
ATOM   1678 N  NZ    . LYS A 1 218 ? -27.345 -44.940 7.448   0.50   67.59 ? 212  LYS A NZ    1 
ATOM   1679 N  N     . LEU A 1 219 ? -28.232 -41.013 12.316  1.00   69.35 ? 213  LEU A N     1 
ATOM   1680 C  CA    . LEU A 1 219 ? -27.967 -39.574 12.376  1.00   68.14 ? 213  LEU A CA    1 
ATOM   1681 C  C     . LEU A 1 219 ? -27.227 -39.202 13.642  1.00   67.73 ? 213  LEU A C     1 
ATOM   1682 O  O     . LEU A 1 219 ? -26.088 -38.753 13.601  1.00   68.17 ? 213  LEU A O     1 
ATOM   1683 C  CB    . LEU A 1 219 ? -29.273 -38.783 12.340  1.00   67.70 ? 213  LEU A CB    1 
ATOM   1684 C  CG    . LEU A 1 219 ? -30.060 -38.627 11.043  1.00   68.22 ? 213  LEU A CG    1 
ATOM   1685 C  CD1   . LEU A 1 219 ? -31.280 -37.769 11.323  1.00   68.44 ? 213  LEU A CD1   1 
ATOM   1686 C  CD2   . LEU A 1 219 ? -29.202 -37.971 9.977   1.00   68.13 ? 213  LEU A CD2   1 
ATOM   1687 N  N     . LYS A 1 220 ? -27.908 -39.387 14.765  1.00   67.32 ? 214  LYS A N     1 
ATOM   1688 C  CA    . LYS A 1 220 ? -27.381 -39.087 16.089  1.00   67.05 ? 214  LYS A CA    1 
ATOM   1689 C  C     . LYS A 1 220 ? -25.915 -39.463 16.242  1.00   67.45 ? 214  LYS A C     1 
ATOM   1690 O  O     . LYS A 1 220 ? -25.207 -38.916 17.089  1.00   66.99 ? 214  LYS A O     1 
ATOM   1691 C  CB    . LYS A 1 220 ? -28.220 -39.821 17.140  0.50   66.51 ? 214  LYS A CB    1 
ATOM   1692 C  CG    . LYS A 1 220 ? -27.663 -39.779 18.544  0.50   66.09 ? 214  LYS A CG    1 
ATOM   1693 C  CD    . LYS A 1 220 ? -28.456 -40.700 19.448  0.50   65.89 ? 214  LYS A CD    1 
ATOM   1694 C  CE    . LYS A 1 220 ? -27.861 -40.739 20.841  0.50   65.77 ? 214  LYS A CE    1 
ATOM   1695 N  NZ    . LYS A 1 220 ? -26.446 -41.195 20.822  0.50   65.56 ? 214  LYS A NZ    1 
ATOM   1696 N  N     . GLY A 1 221 ? -25.457 -40.391 15.412  1.00   68.49 ? 215  GLY A N     1 
ATOM   1697 C  CA    . GLY A 1 221 ? -24.079 -40.831 15.505  1.00   69.86 ? 215  GLY A CA    1 
ATOM   1698 C  C     . GLY A 1 221 ? -23.096 -40.069 14.645  1.00   69.91 ? 215  GLY A C     1 
ATOM   1699 O  O     . GLY A 1 221 ? -21.922 -39.934 15.000  1.00   71.54 ? 215  GLY A O     1 
ATOM   1700 N  N     . MET A 1 222 ? -23.567 -39.562 13.515  1.00   68.73 ? 216  MET A N     1 
ATOM   1701 C  CA    . MET A 1 222 ? -22.697 -38.828 12.620  1.00   68.09 ? 216  MET A CA    1 
ATOM   1702 C  C     . MET A 1 222 ? -22.721 -37.315 12.844  1.00   67.06 ? 216  MET A C     1 
ATOM   1703 O  O     . MET A 1 222 ? -21.700 -36.653 12.652  1.00   68.81 ? 216  MET A O     1 
ATOM   1704 C  CB    . MET A 1 222 ? -23.063 -39.157 11.179  1.00   68.46 ? 216  MET A CB    1 
ATOM   1705 C  CG    . MET A 1 222 ? -21.877 -39.264 10.265  1.00   69.93 ? 216  MET A CG    1 
ATOM   1706 S  SD    . MET A 1 222 ? -22.389 -39.791 8.627   1.00   72.44 ? 216  MET A SD    1 
ATOM   1707 C  CE    . MET A 1 222 ? -21.899 -41.519 8.653   1.00   72.67 ? 216  MET A CE    1 
ATOM   1708 N  N     . ILE A 1 223 ? -23.870 -36.772 13.260  1.00   64.69 ? 217  ILE A N     1 
ATOM   1709 C  CA    . ILE A 1 223 ? -23.992 -35.332 13.494  1.00   61.28 ? 217  ILE A CA    1 
ATOM   1710 C  C     . ILE A 1 223 ? -24.512 -34.901 14.878  1.00   61.29 ? 217  ILE A C     1 
ATOM   1711 O  O     . ILE A 1 223 ? -24.695 -33.710 15.138  1.00   62.82 ? 217  ILE A O     1 
ATOM   1712 C  CB    . ILE A 1 223 ? -24.877 -34.672 12.417  1.00   60.28 ? 217  ILE A CB    1 
ATOM   1713 C  CG1   . ILE A 1 223 ? -26.330 -35.139 12.552  1.00   60.15 ? 217  ILE A CG1   1 
ATOM   1714 C  CG2   . ILE A 1 223 ? -24.343 -35.017 11.033  1.00   59.98 ? 217  ILE A CG2   1 
ATOM   1715 C  CD1   . ILE A 1 223 ? -27.292 -34.501 11.538  1.00   55.75 ? 217  ILE A CD1   1 
ATOM   1716 N  N     . GLY A 1 224 ? -24.748 -35.850 15.773  1.00   60.02 ? 218  GLY A N     1 
ATOM   1717 C  CA    . GLY A 1 224 ? -25.217 -35.485 17.101  1.00   59.39 ? 218  GLY A CA    1 
ATOM   1718 C  C     . GLY A 1 224 ? -26.723 -35.422 17.284  1.00   58.91 ? 218  GLY A C     1 
ATOM   1719 O  O     . GLY A 1 224 ? -27.463 -35.106 16.351  1.00   58.38 ? 218  GLY A O     1 
ATOM   1720 N  N     . GLU A 1 225 ? -27.181 -35.717 18.495  1.00   57.91 ? 219  GLU A N     1 
ATOM   1721 C  CA    . GLU A 1 225 ? -28.607 -35.708 18.785  1.00   58.08 ? 219  GLU A CA    1 
ATOM   1722 C  C     . GLU A 1 225 ? -29.241 -34.377 18.448  1.00   57.91 ? 219  GLU A C     1 
ATOM   1723 O  O     . GLU A 1 225 ? -30.169 -34.315 17.639  1.00   57.83 ? 219  GLU A O     1 
ATOM   1724 C  CB    . GLU A 1 225 ? -28.863 -36.001 20.261  1.00   59.60 ? 219  GLU A CB    1 
ATOM   1725 C  CG    . GLU A 1 225 ? -28.293 -37.309 20.755  1.00   60.27 ? 219  GLU A CG    1 
ATOM   1726 C  CD    . GLU A 1 225 ? -28.785 -37.642 22.145  0.50   60.59 ? 219  GLU A CD    1 
ATOM   1727 O  OE1   . GLU A 1 225 ? -28.671 -36.773 23.033  0.50   60.75 ? 219  GLU A OE1   1 
ATOM   1728 O  OE2   . GLU A 1 225 ? -29.284 -38.769 22.350  0.50   61.60 ? 219  GLU A OE2   1 
ATOM   1729 N  N     . ALA A 1 226 ? -28.734 -33.325 19.096  1.00   57.21 ? 220  ALA A N     1 
ATOM   1730 C  CA    . ALA A 1 226 ? -29.214 -31.950 18.934  1.00   55.90 ? 220  ALA A CA    1 
ATOM   1731 C  C     . ALA A 1 226 ? -29.323 -31.570 17.470  1.00   54.75 ? 220  ALA A C     1 
ATOM   1732 O  O     . ALA A 1 226 ? -30.405 -31.284 16.972  1.00   55.19 ? 220  ALA A O     1 
ATOM   1733 C  CB    . ALA A 1 226 ? -28.275 -30.986 19.661  1.00   54.54 ? 220  ALA A CB    1 
ATOM   1734 N  N     . LYS A 1 227 ? -28.192 -31.584 16.783  1.00   53.21 ? 221  LYS A N     1 
ATOM   1735 C  CA    . LYS A 1 227 ? -28.160 -31.252 15.371  1.00   52.33 ? 221  LYS A CA    1 
ATOM   1736 C  C     . LYS A 1 227 ? -29.143 -32.159 14.633  1.00   52.15 ? 221  LYS A C     1 
ATOM   1737 O  O     . LYS A 1 227 ? -29.726 -31.783 13.619  1.00   51.05 ? 221  LYS A O     1 
ATOM   1738 C  CB    . LYS A 1 227 ? -26.744 -31.467 14.829  1.00   51.10 ? 221  LYS A CB    1 
ATOM   1739 C  CG    . LYS A 1 227 ? -26.448 -30.732 13.552  1.00   47.39 ? 221  LYS A CG    1 
ATOM   1740 C  CD    . LYS A 1 227 ? -25.818 -29.375 13.824  1.00   48.83 ? 221  LYS A CD    1 
ATOM   1741 C  CE    . LYS A 1 227 ? -24.359 -29.508 14.267  1.00   48.29 ? 221  LYS A CE    1 
ATOM   1742 N  NZ    . LYS A 1 227 ? -23.685 -28.188 14.452  1.00   49.14 ? 221  LYS A NZ    1 
ATOM   1743 N  N     . ALA A 1 228 ? -29.318 -33.361 15.165  1.00   53.21 ? 222  ALA A N     1 
ATOM   1744 C  CA    . ALA A 1 228 ? -30.205 -34.363 14.580  1.00   53.93 ? 222  ALA A CA    1 
ATOM   1745 C  C     . ALA A 1 228 ? -31.661 -33.987 14.771  1.00   53.76 ? 222  ALA A C     1 
ATOM   1746 O  O     . ALA A 1 228 ? -32.446 -33.976 13.826  1.00   54.28 ? 222  ALA A O     1 
ATOM   1747 C  CB    . ALA A 1 228 ? -29.942 -35.735 15.220  1.00   54.80 ? 222  ALA A CB    1 
ATOM   1748 N  N     . LYS A 1 229 ? -32.023 -33.715 16.015  1.00   53.21 ? 223  LYS A N     1 
ATOM   1749 C  CA    . LYS A 1 229 ? -33.386 -33.332 16.346  1.00   52.13 ? 223  LYS A CA    1 
ATOM   1750 C  C     . LYS A 1 229 ? -33.748 -32.071 15.570  1.00   49.70 ? 223  LYS A C     1 
ATOM   1751 O  O     . LYS A 1 229 ? -34.834 -31.955 15.013  1.00   50.34 ? 223  LYS A O     1 
ATOM   1752 C  CB    . LYS A 1 229 ? -33.491 -33.079 17.856  1.00   54.49 ? 223  LYS A CB    1 
ATOM   1753 C  CG    . LYS A 1 229 ? -33.132 -34.285 18.741  1.00   54.91 ? 223  LYS A CG    1 
ATOM   1754 C  CD    . LYS A 1 229 ? -33.018 -33.868 20.210  1.00   58.08 ? 223  LYS A CD    1 
ATOM   1755 C  CE    . LYS A 1 229 ? -33.253 -35.032 21.176  1.00   59.05 ? 223  LYS A CE    1 
ATOM   1756 N  NZ    . LYS A 1 229 ? -34.687 -35.478 21.180  1.00   59.01 ? 223  LYS A NZ    1 
ATOM   1757 N  N     . TYR A 1 230 ? -32.818 -31.130 15.533  1.00   47.61 ? 224  TYR A N     1 
ATOM   1758 C  CA    . TYR A 1 230 ? -33.025 -29.879 14.832  1.00   47.04 ? 224  TYR A CA    1 
ATOM   1759 C  C     . TYR A 1 230 ? -33.571 -30.093 13.427  1.00   46.48 ? 224  TYR A C     1 
ATOM   1760 O  O     . TYR A 1 230 ? -34.657 -29.617 13.109  1.00   46.95 ? 224  TYR A O     1 
ATOM   1761 C  CB    . TYR A 1 230 ? -31.708 -29.106 14.781  1.00   45.13 ? 224  TYR A CB    1 
ATOM   1762 C  CG    . TYR A 1 230 ? -31.700 -27.888 13.881  1.00   44.24 ? 224  TYR A CG    1 
ATOM   1763 C  CD1   . TYR A 1 230 ? -32.480 -26.766 14.166  1.00   43.18 ? 224  TYR A CD1   1 
ATOM   1764 C  CD2   . TYR A 1 230 ? -30.873 -27.846 12.758  1.00   43.55 ? 224  TYR A CD2   1 
ATOM   1765 C  CE1   . TYR A 1 230 ? -32.424 -25.620 13.347  1.00   43.65 ? 224  TYR A CE1   1 
ATOM   1766 C  CE2   . TYR A 1 230 ? -30.817 -26.716 11.935  1.00   44.21 ? 224  TYR A CE2   1 
ATOM   1767 C  CZ    . TYR A 1 230 ? -31.590 -25.606 12.236  1.00   42.36 ? 224  TYR A CZ    1 
ATOM   1768 O  OH    . TYR A 1 230 ? -31.515 -24.489 11.431  1.00   41.63 ? 224  TYR A OH    1 
ATOM   1769 N  N     . LEU A 1 231 ? -32.820 -30.821 12.601  1.00   46.69 ? 225  LEU A N     1 
ATOM   1770 C  CA    . LEU A 1 231 ? -33.209 -31.098 11.212  1.00   46.45 ? 225  LEU A CA    1 
ATOM   1771 C  C     . LEU A 1 231 ? -34.549 -31.827 11.078  1.00   45.99 ? 225  LEU A C     1 
ATOM   1772 O  O     . LEU A 1 231 ? -35.441 -31.361 10.384  1.00   46.82 ? 225  LEU A O     1 
ATOM   1773 C  CB    . LEU A 1 231 ? -32.100 -31.893 10.498  1.00   44.44 ? 225  LEU A CB    1 
ATOM   1774 C  CG    . LEU A 1 231 ? -30.758 -31.201 10.215  1.00   42.73 ? 225  LEU A CG    1 
ATOM   1775 C  CD1   . LEU A 1 231 ? -29.832 -32.160 9.549   1.00   39.53 ? 225  LEU A CD1   1 
ATOM   1776 C  CD2   . LEU A 1 231 ? -30.954 -29.988 9.333   1.00   42.96 ? 225  LEU A CD2   1 
ATOM   1777 N  N     . ILE A 1 232 ? -34.685 -32.968 11.739  1.00   46.76 ? 226  ILE A N     1 
ATOM   1778 C  CA    . ILE A 1 232 ? -35.922 -33.742 11.707  1.00   46.94 ? 226  ILE A CA    1 
ATOM   1779 C  C     . ILE A 1 232 ? -37.089 -32.829 12.026  1.00   47.93 ? 226  ILE A C     1 
ATOM   1780 O  O     . ILE A 1 232 ? -38.145 -32.890 11.398  1.00   46.69 ? 226  ILE A O     1 
ATOM   1781 C  CB    . ILE A 1 232 ? -35.899 -34.856 12.776  1.00   46.33 ? 226  ILE A CB    1 
ATOM   1782 C  CG1   . ILE A 1 232 ? -34.931 -35.960 12.367  1.00   44.19 ? 226  ILE A CG1   1 
ATOM   1783 C  CG2   . ILE A 1 232 ? -37.297 -35.403 12.983  1.00   47.32 ? 226  ILE A CG2   1 
ATOM   1784 C  CD1   . ILE A 1 232 ? -34.714 -36.971 13.458  1.00   42.56 ? 226  ILE A CD1   1 
ATOM   1785 N  N     . SER A 1 233 ? -36.878 -31.992 13.036  1.00   50.58 ? 227  SER A N     1 
ATOM   1786 C  CA    . SER A 1 233 ? -37.885 -31.049 13.494  1.00   51.89 ? 227  SER A CA    1 
ATOM   1787 C  C     . SER A 1 233 ? -38.295 -30.137 12.363  1.00   52.04 ? 227  SER A C     1 
ATOM   1788 O  O     . SER A 1 233 ? -39.468 -29.794 12.226  1.00   52.73 ? 227  SER A O     1 
ATOM   1789 C  CB    . SER A 1 233 ? -37.340 -30.217 14.648  1.00   54.09 ? 227  SER A CB    1 
ATOM   1790 O  OG    . SER A 1 233 ? -38.315 -29.293 15.101  1.00   57.33 ? 227  SER A OG    1 
ATOM   1791 N  N     . LEU A 1 234 ? -37.319 -29.749 11.553  1.00   51.30 ? 228  LEU A N     1 
ATOM   1792 C  CA    . LEU A 1 234 ? -37.580 -28.880 10.416  1.00   50.57 ? 228  LEU A CA    1 
ATOM   1793 C  C     . LEU A 1 234 ? -38.357 -29.577 9.311   1.00   50.03 ? 228  LEU A C     1 
ATOM   1794 O  O     . LEU A 1 234 ? -39.383 -29.081 8.861   1.00   50.56 ? 228  LEU A O     1 
ATOM   1795 C  CB    . LEU A 1 234 ? -36.266 -28.338 9.851   1.00   50.13 ? 228  LEU A CB    1 
ATOM   1796 C  CG    . LEU A 1 234 ? -35.635 -27.196 10.640  1.00   50.28 ? 228  LEU A CG    1 
ATOM   1797 C  CD1   . LEU A 1 234 ? -34.266 -26.872 10.083  1.00   49.05 ? 228  LEU A CD1   1 
ATOM   1798 C  CD2   . LEU A 1 234 ? -36.554 -25.988 10.571  1.00   50.48 ? 228  LEU A CD2   1 
ATOM   1799 N  N     . ALA A 1 235 ? -37.870 -30.727 8.871   1.00   50.43 ? 229  ALA A N     1 
ATOM   1800 C  CA    . ALA A 1 235 ? -38.534 -31.465 7.803   1.00   52.43 ? 229  ALA A CA    1 
ATOM   1801 C  C     . ALA A 1 235 ? -39.999 -31.762 8.142   1.00   54.25 ? 229  ALA A C     1 
ATOM   1802 O  O     . ALA A 1 235 ? -40.813 -32.063 7.265   1.00   53.19 ? 229  ALA A O     1 
ATOM   1803 C  CB    . ALA A 1 235 ? -37.782 -32.757 7.532   1.00   51.89 ? 229  ALA A CB    1 
ATOM   1804 N  N     . ARG A 1 236 ? -40.325 -31.667 9.428   1.00   57.76 ? 230  ARG A N     1 
ATOM   1805 C  CA    . ARG A 1 236 ? -41.681 -31.919 9.902   1.00   59.80 ? 230  ARG A CA    1 
ATOM   1806 C  C     . ARG A 1 236 ? -42.481 -30.630 10.057  1.00   60.74 ? 230  ARG A C     1 
ATOM   1807 O  O     . ARG A 1 236 ? -43.595 -30.656 10.564  1.00   61.59 ? 230  ARG A O     1 
ATOM   1808 C  CB    . ARG A 1 236 ? -41.639 -32.623 11.253  1.00   60.10 ? 230  ARG A CB    1 
ATOM   1809 C  CG    . ARG A 1 236 ? -40.913 -33.944 11.270  1.00   61.02 ? 230  ARG A CG    1 
ATOM   1810 C  CD    . ARG A 1 236 ? -40.956 -34.502 12.671  1.00   63.09 ? 230  ARG A CD    1 
ATOM   1811 N  NE    . ARG A 1 236 ? -40.337 -35.817 12.791  1.00   65.30 ? 230  ARG A NE    1 
ATOM   1812 C  CZ    . ARG A 1 236 ? -40.127 -36.433 13.952  1.00   64.71 ? 230  ARG A CZ    1 
ATOM   1813 N  NH1   . ARG A 1 236 ? -40.487 -35.849 15.085  1.00   63.50 ? 230  ARG A NH1   1 
ATOM   1814 N  NH2   . ARG A 1 236 ? -39.557 -37.629 13.980  1.00   65.03 ? 230  ARG A NH2   1 
ATOM   1815 N  N     . ASP A 1 237 ? -41.915 -29.505 9.629   1.00   61.93 ? 231  ASP A N     1 
ATOM   1816 C  CA    . ASP A 1 237 ? -42.596 -28.220 9.767   1.00   63.67 ? 231  ASP A CA    1 
ATOM   1817 C  C     . ASP A 1 237 ? -43.028 -28.129 11.234  1.00   64.73 ? 231  ASP A C     1 
ATOM   1818 O  O     . ASP A 1 237 ? -43.865 -27.314 11.620  1.00   66.97 ? 231  ASP A O     1 
ATOM   1819 C  CB    . ASP A 1 237 ? -43.817 -28.172 8.841   1.00   64.00 ? 231  ASP A CB    1 
ATOM   1820 C  CG    . ASP A 1 237 ? -44.523 -26.829 8.872   0.50   64.05 ? 231  ASP A CG    1 
ATOM   1821 O  OD1   . ASP A 1 237 ? -43.871 -25.810 8.563   0.50   63.39 ? 231  ASP A OD1   1 
ATOM   1822 O  OD2   . ASP A 1 237 ? -45.732 -26.795 9.199   0.50   64.99 ? 231  ASP A OD2   1 
ATOM   1823 N  N     . GLU A 1 238 ? -42.423 -28.985 12.043  1.00   64.45 ? 232  GLU A N     1 
ATOM   1824 C  CA    . GLU A 1 238 ? -42.700 -29.089 13.463  1.00   64.34 ? 232  GLU A CA    1 
ATOM   1825 C  C     . GLU A 1 238 ? -41.537 -28.463 14.257  1.00   64.87 ? 232  GLU A C     1 
ATOM   1826 O  O     . GLU A 1 238 ? -41.166 -28.952 15.330  1.00   64.51 ? 232  GLU A O     1 
ATOM   1827 C  CB    . GLU A 1 238 ? -42.854 -30.579 13.791  1.00   63.89 ? 232  GLU A CB    1 
ATOM   1828 C  CG    . GLU A 1 238 ? -43.078 -30.920 15.239  1.00   64.39 ? 232  GLU A CG    1 
ATOM   1829 C  CD    . GLU A 1 238 ? -42.799 -32.384 15.538  1.00   65.32 ? 232  GLU A CD    1 
ATOM   1830 O  OE1   . GLU A 1 238 ? -43.586 -33.259 15.110  1.00   64.52 ? 232  GLU A OE1   1 
ATOM   1831 O  OE2   . GLU A 1 238 ? -41.778 -32.659 16.202  1.00   65.62 ? 232  GLU A OE2   1 
ATOM   1832 N  N     . TYR A 1 239 ? -40.973 -27.374 13.728  1.00   65.09 ? 233  TYR A N     1 
ATOM   1833 C  CA    . TYR A 1 239 ? -39.836 -26.697 14.366  1.00   64.37 ? 233  TYR A CA    1 
ATOM   1834 C  C     . TYR A 1 239 ? -40.228 -25.767 15.520  1.00   65.66 ? 233  TYR A C     1 
ATOM   1835 O  O     . TYR A 1 239 ? -40.158 -26.150 16.695  1.00   66.69 ? 233  TYR A O     1 
ATOM   1836 C  CB    . TYR A 1 239 ? -39.037 -25.911 13.313  1.00   61.32 ? 233  TYR A CB    1 
ATOM   1837 C  CG    . TYR A 1 239 ? -37.921 -25.047 13.888  1.00   60.46 ? 233  TYR A CG    1 
ATOM   1838 C  CD1   . TYR A 1 239 ? -36.672 -25.583 14.205  1.00   57.42 ? 233  TYR A CD1   1 
ATOM   1839 C  CD2   . TYR A 1 239 ? -38.140 -23.694 14.166  1.00   59.24 ? 233  TYR A CD2   1 
ATOM   1840 C  CE1   . TYR A 1 239 ? -35.682 -24.787 14.787  1.00   56.07 ? 233  TYR A CE1   1 
ATOM   1841 C  CE2   . TYR A 1 239 ? -37.165 -22.904 14.747  1.00   55.34 ? 233  TYR A CE2   1 
ATOM   1842 C  CZ    . TYR A 1 239 ? -35.944 -23.450 15.059  1.00   54.95 ? 233  TYR A CZ    1 
ATOM   1843 O  OH    . TYR A 1 239 ? -34.999 -22.663 15.680  1.00   52.63 ? 233  TYR A OH    1 
ATOM   1844 N  N     . ASN A 1 240 ? -40.622 -24.543 15.173  1.00   66.03 ? 234  ASN A N     1 
ATOM   1845 C  CA    . ASN A 1 240 ? -41.031 -23.517 16.131  1.00   66.77 ? 234  ASN A CA    1 
ATOM   1846 C  C     . ASN A 1 240 ? -40.233 -23.403 17.441  1.00   67.30 ? 234  ASN A C     1 
ATOM   1847 O  O     . ASN A 1 240 ? -40.352 -24.237 18.344  1.00   68.00 ? 234  ASN A O     1 
ATOM   1848 C  CB    . ASN A 1 240 ? -42.523 -23.680 16.455  0.50   66.49 ? 234  ASN A CB    1 
ATOM   1849 C  CG    . ASN A 1 240 ? -43.084 -22.516 17.258  0.50   65.50 ? 234  ASN A CG    1 
ATOM   1850 O  OD1   . ASN A 1 240 ? -42.669 -22.263 18.390  0.50   64.87 ? 234  ASN A OD1   1 
ATOM   1851 N  ND2   . ASN A 1 240 ? -44.035 -21.806 16.672  0.50   64.80 ? 234  ASN A ND2   1 
ATOM   1852 N  N     . GLU A 1 241 ? -39.417 -22.357 17.520  1.00   67.21 ? 235  GLU A N     1 
ATOM   1853 C  CA    . GLU A 1 241 ? -38.623 -22.062 18.707  1.00   67.60 ? 235  GLU A CA    1 
ATOM   1854 C  C     . GLU A 1 241 ? -38.778 -20.554 18.883  1.00   67.32 ? 235  GLU A C     1 
ATOM   1855 O  O     . GLU A 1 241 ? -38.452 -19.775 17.985  1.00   66.04 ? 235  GLU A O     1 
ATOM   1856 C  CB    . GLU A 1 241 ? -37.150 -22.407 18.511  1.00   68.40 ? 235  GLU A CB    1 
ATOM   1857 C  CG    . GLU A 1 241 ? -36.363 -22.319 19.799  1.00   70.04 ? 235  GLU A CG    1 
ATOM   1858 C  CD    . GLU A 1 241 ? -34.934 -21.892 19.580  1.00   71.38 ? 235  GLU A CD    1 
ATOM   1859 O  OE1   . GLU A 1 241 ? -34.321 -22.398 18.622  1.00   73.22 ? 235  GLU A OE1   1 
ATOM   1860 O  OE2   . GLU A 1 241 ? -34.419 -21.062 20.364  1.00   73.38 ? 235  GLU A OE2   1 
ATOM   1861 N  N     . PRO A 1 242 ? -39.261 -20.123 20.054  1.00   67.45 ? 236  PRO A N     1 
ATOM   1862 C  CA    . PRO A 1 242 ? -39.475 -18.705 20.341  1.00   67.54 ? 236  PRO A CA    1 
ATOM   1863 C  C     . PRO A 1 242 ? -38.322 -17.745 20.105  1.00   66.55 ? 236  PRO A C     1 
ATOM   1864 O  O     . PRO A 1 242 ? -37.149 -18.117 20.124  1.00   67.14 ? 236  PRO A O     1 
ATOM   1865 C  CB    . PRO A 1 242 ? -39.904 -18.721 21.802  1.00   68.23 ? 236  PRO A CB    1 
ATOM   1866 C  CG    . PRO A 1 242 ? -39.063 -19.821 22.354  1.00   67.73 ? 236  PRO A CG    1 
ATOM   1867 C  CD    . PRO A 1 242 ? -39.268 -20.899 21.307  1.00   67.40 ? 236  PRO A CD    1 
ATOM   1868 N  N     . ILE A 1 243 ? -38.696 -16.494 19.891  1.00   64.68 ? 237  ILE A N     1 
ATOM   1869 C  CA    . ILE A 1 243 ? -37.750 -15.421 19.694  1.00   64.80 ? 237  ILE A CA    1 
ATOM   1870 C  C     . ILE A 1 243 ? -37.468 -14.933 21.109  1.00   65.19 ? 237  ILE A C     1 
ATOM   1871 O  O     . ILE A 1 243 ? -38.333 -14.310 21.725  1.00   66.78 ? 237  ILE A O     1 
ATOM   1872 C  CB    . ILE A 1 243 ? -38.386 -14.272 18.886  1.00   64.44 ? 237  ILE A CB    1 
ATOM   1873 C  CG1   . ILE A 1 243 ? -38.503 -14.669 17.417  1.00   64.22 ? 237  ILE A CG1   1 
ATOM   1874 C  CG2   . ILE A 1 243 ? -37.564 -13.015 19.032  1.00   64.79 ? 237  ILE A CG2   1 
ATOM   1875 C  CD1   . ILE A 1 243 ? -39.276 -15.948 17.190  1.00   66.10 ? 237  ILE A CD1   1 
ATOM   1876 N  N     . ARG A 1 244 ? -36.277 -15.212 21.633  1.00   63.76 ? 238  ARG A N     1 
ATOM   1877 C  CA    . ARG A 1 244 ? -35.958 -14.783 22.983  1.00   62.06 ? 238  ARG A CA    1 
ATOM   1878 C  C     . ARG A 1 244 ? -34.661 -14.009 23.100  1.00   61.68 ? 238  ARG A C     1 
ATOM   1879 O  O     . ARG A 1 244 ? -33.698 -14.280 22.400  1.00   61.77 ? 238  ARG A O     1 
ATOM   1880 C  CB    . ARG A 1 244 ? -35.922 -15.984 23.916  1.00   63.15 ? 238  ARG A CB    1 
ATOM   1881 C  CG    . ARG A 1 244 ? -35.040 -17.114 23.439  1.00   63.39 ? 238  ARG A CG    1 
ATOM   1882 C  CD    . ARG A 1 244 ? -34.685 -18.017 24.605  1.00   64.84 ? 238  ARG A CD    1 
ATOM   1883 N  NE    . ARG A 1 244 ? -34.137 -19.297 24.173  0.50   64.98 ? 238  ARG A NE    1 
ATOM   1884 C  CZ    . ARG A 1 244 ? -34.812 -20.189 23.452  0.50   65.50 ? 238  ARG A CZ    1 
ATOM   1885 N  NH1   . ARG A 1 244 ? -36.062 -19.940 23.078  0.50   65.27 ? 238  ARG A NH1   1 
ATOM   1886 N  NH2   . ARG A 1 244 ? -34.243 -21.338 23.113  0.50   65.10 ? 238  ARG A NH2   1 
ATOM   1887 N  N     . THR A 1 245 ? -34.661 -13.058 24.025  1.00   62.18 ? 239  THR A N     1 
ATOM   1888 C  CA    . THR A 1 245 ? -33.543 -12.160 24.299  1.00   63.21 ? 239  THR A CA    1 
ATOM   1889 C  C     . THR A 1 245 ? -32.149 -12.576 23.867  1.00   62.67 ? 239  THR A C     1 
ATOM   1890 O  O     . THR A 1 245 ? -31.525 -11.882 23.055  1.00   63.31 ? 239  THR A O     1 
ATOM   1891 C  CB    . THR A 1 245 ? -33.482 -11.826 25.785  1.00   64.42 ? 239  THR A CB    1 
ATOM   1892 O  OG1   . THR A 1 245 ? -33.595 -13.037 26.532  1.00   66.24 ? 239  THR A OG1   1 
ATOM   1893 C  CG2   . THR A 1 245 ? -34.615 -10.892 26.173  1.00   64.11 ? 239  THR A CG2   1 
ATOM   1894 N  N     . ARG A 1 246 ? -31.650 -13.682 24.414  1.00   62.25 ? 240  ARG A N     1 
ATOM   1895 C  CA    . ARG A 1 246 ? -30.304 -14.176 24.081  1.00   62.67 ? 240  ARG A CA    1 
ATOM   1896 C  C     . ARG A 1 246 ? -29.218 -13.145 24.427  1.00   61.91 ? 240  ARG A C     1 
ATOM   1897 O  O     . ARG A 1 246 ? -29.295 -11.975 24.046  1.00   62.59 ? 240  ARG A O     1 
ATOM   1898 C  CB    . ARG A 1 246 ? -30.206 -14.548 22.590  1.00   62.25 ? 240  ARG A CB    1 
ATOM   1899 C  CG    . ARG A 1 246 ? -30.076 -16.042 22.325  1.00   62.89 ? 240  ARG A CG    1 
ATOM   1900 C  CD    . ARG A 1 246 ? -29.837 -16.310 20.840  0.50   62.79 ? 240  ARG A CD    1 
ATOM   1901 N  NE    . ARG A 1 246 ? -29.334 -17.659 20.577  0.50   62.51 ? 240  ARG A NE    1 
ATOM   1902 C  CZ    . ARG A 1 246 ? -30.061 -18.770 20.649  0.50   62.36 ? 240  ARG A CZ    1 
ATOM   1903 N  NH1   . ARG A 1 246 ? -31.343 -18.713 20.977  0.50   63.16 ? 240  ARG A NH1   1 
ATOM   1904 N  NH2   . ARG A 1 246 ? -29.503 -19.942 20.386  0.50   62.32 ? 240  ARG A NH2   1 
ATOM   1905 N  N     . VAL A 1 247 ? -28.195 -13.590 25.143  1.00   60.55 ? 241  VAL A N     1 
ATOM   1906 C  CA    . VAL A 1 247 ? -27.111 -12.699 25.554  1.00   59.22 ? 241  VAL A CA    1 
ATOM   1907 C  C     . VAL A 1 247 ? -25.750 -13.299 25.213  1.00   56.74 ? 241  VAL A C     1 
ATOM   1908 O  O     . VAL A 1 247 ? -25.559 -14.507 25.326  1.00   58.08 ? 241  VAL A O     1 
ATOM   1909 C  CB    . VAL A 1 247 ? -27.158 -12.450 27.094  1.00   60.03 ? 241  VAL A CB    1 
ATOM   1910 C  CG1   . VAL A 1 247 ? -26.119 -11.416 27.490  1.00   58.57 ? 241  VAL A CG1   1 
ATOM   1911 C  CG2   . VAL A 1 247 ? -28.560 -12.008 27.515  1.00   60.00 ? 241  VAL A CG2   1 
ATOM   1912 N  N     . ARG A 1 248 ? -24.805 -12.463 24.798  1.00   53.55 ? 242  ARG A N     1 
ATOM   1913 C  CA    . ARG A 1 248 ? -23.461 -12.951 24.490  1.00   51.00 ? 242  ARG A CA    1 
ATOM   1914 C  C     . ARG A 1 248 ? -23.077 -13.750 25.735  1.00   50.34 ? 242  ARG A C     1 
ATOM   1915 O  O     . ARG A 1 248 ? -23.094 -13.216 26.844  1.00   50.09 ? 242  ARG A O     1 
ATOM   1916 C  CB    . ARG A 1 248 ? -22.499 -11.775 24.322  1.00   49.93 ? 242  ARG A CB    1 
ATOM   1917 C  CG    . ARG A 1 248 ? -21.345 -11.983 23.347  0.50   48.65 ? 242  ARG A CG    1 
ATOM   1918 C  CD    . ARG A 1 248 ? -21.537 -11.114 22.107  0.50   46.94 ? 242  ARG A CD    1 
ATOM   1919 N  NE    . ARG A 1 248 ? -20.267 -10.731 21.501  0.50   46.21 ? 242  ARG A NE    1 
ATOM   1920 C  CZ    . ARG A 1 248 ? -20.138 -9.806  20.554  0.50   46.58 ? 242  ARG A CZ    1 
ATOM   1921 N  NH1   . ARG A 1 248 ? -21.204 -9.163  20.095  0.50   46.07 ? 242  ARG A NH1   1 
ATOM   1922 N  NH2   . ARG A 1 248 ? -18.937 -9.513  20.072  0.50   46.09 ? 242  ARG A NH2   1 
ATOM   1923 N  N     . LYS A 1 249 ? -22.739 -15.023 25.566  1.00   50.18 ? 243  LYS A N     1 
ATOM   1924 C  CA    . LYS A 1 249 ? -22.391 -15.845 26.715  1.00   48.07 ? 243  LYS A CA    1 
ATOM   1925 C  C     . LYS A 1 249 ? -20.902 -16.066 26.946  1.00   46.09 ? 243  LYS A C     1 
ATOM   1926 O  O     . LYS A 1 249 ? -20.516 -16.919 27.723  1.00   46.49 ? 243  LYS A O     1 
ATOM   1927 C  CB    . LYS A 1 249 ? -23.151 -17.167 26.630  1.00   48.89 ? 243  LYS A CB    1 
ATOM   1928 C  CG    . LYS A 1 249 ? -24.666 -16.950 26.761  1.00   53.46 ? 243  LYS A CG    1 
ATOM   1929 C  CD    . LYS A 1 249 ? -25.473 -18.215 26.532  1.00   58.10 ? 243  LYS A CD    1 
ATOM   1930 C  CE    . LYS A 1 249 ? -26.949 -18.000 26.897  1.00   61.93 ? 243  LYS A CE    1 
ATOM   1931 N  NZ    . LYS A 1 249 ? -27.682 -17.026 26.011  1.00   63.59 ? 243  LYS A NZ    1 
ATOM   1932 N  N     . SER A 1 250 ? -20.069 -15.268 26.292  1.00   44.92 ? 244  SER A N     1 
ATOM   1933 C  CA    . SER A 1 250 ? -18.615 -15.356 26.459  1.00   45.33 ? 244  SER A CA    1 
ATOM   1934 C  C     . SER A 1 250 ? -17.971 -14.194 25.707  1.00   45.53 ? 244  SER A C     1 
ATOM   1935 O  O     . SER A 1 250 ? -18.566 -13.650 24.777  1.00   48.66 ? 244  SER A O     1 
ATOM   1936 C  CB    . SER A 1 250 ? -18.063 -16.690 25.926  1.00   44.78 ? 244  SER A CB    1 
ATOM   1937 O  OG    . SER A 1 250 ? -17.866 -16.668 24.521  1.00   45.44 ? 244  SER A OG    1 
ATOM   1938 N  N     . ILE A 1 251 ? -16.766 -13.811 26.121  1.00   43.31 ? 245  ILE A N     1 
ATOM   1939 C  CA    . ILE A 1 251 ? -16.027 -12.715 25.503  1.00   41.07 ? 245  ILE A CA    1 
ATOM   1940 C  C     . ILE A 1 251 ? -14.577 -13.105 25.609  1.00   40.40 ? 245  ILE A C     1 
ATOM   1941 O  O     . ILE A 1 251 ? -14.156 -13.591 26.647  1.00   40.62 ? 245  ILE A O     1 
ATOM   1942 C  CB    . ILE A 1 251 ? -16.228 -11.382 26.278  1.00   41.52 ? 245  ILE A CB    1 
ATOM   1943 C  CG1   . ILE A 1 251 ? -17.594 -10.787 25.954  1.00   41.24 ? 245  ILE A CG1   1 
ATOM   1944 C  CG2   . ILE A 1 251 ? -15.144 -10.386 25.926  1.00   37.96 ? 245  ILE A CG2   1 
ATOM   1945 C  CD1   . ILE A 1 251 ? -17.736 -10.361 24.509  1.00   45.93 ? 245  ILE A CD1   1 
ATOM   1946 N  N     . GLY A 1 252 ? -13.803 -12.894 24.552  1.00   40.79 ? 246  GLY A N     1 
ATOM   1947 C  CA    . GLY A 1 252 ? -12.401 -13.258 24.621  1.00   39.59 ? 246  GLY A CA    1 
ATOM   1948 C  C     . GLY A 1 252 ? -11.514 -12.602 23.587  1.00   40.50 ? 246  GLY A C     1 
ATOM   1949 O  O     . GLY A 1 252 ? -11.934 -11.699 22.856  1.00   38.77 ? 246  GLY A O     1 
ATOM   1950 N  N     . ARG A 1 253 ? -10.268 -13.060 23.536  1.00   41.79 ? 247  ARG A N     1 
ATOM   1951 C  CA    . ARG A 1 253 ? -9.301  -12.532 22.598  1.00   42.26 ? 247  ARG A CA    1 
ATOM   1952 C  C     . ARG A 1 253 ? -8.147  -13.507 22.390  1.00   42.16 ? 247  ARG A C     1 
ATOM   1953 O  O     . ARG A 1 253 ? -7.458  -13.879 23.336  1.00   41.16 ? 247  ARG A O     1 
ATOM   1954 C  CB    . ARG A 1 253 ? -8.773  -11.187 23.103  1.00   42.69 ? 247  ARG A CB    1 
ATOM   1955 C  CG    . ARG A 1 253 ? -7.677  -10.577 22.218  1.00   46.42 ? 247  ARG A CG    1 
ATOM   1956 C  CD    . ARG A 1 253 ? -8.205  -9.444  21.327  1.00   51.05 ? 247  ARG A CD    1 
ATOM   1957 N  NE    . ARG A 1 253 ? -7.202  -8.903  20.404  1.00   50.01 ? 247  ARG A NE    1 
ATOM   1958 C  CZ    . ARG A 1 253 ? -6.661  -9.598  19.406  1.00   52.81 ? 247  ARG A CZ    1 
ATOM   1959 N  NH1   . ARG A 1 253 ? -7.021  -10.863 19.201  1.00   54.39 ? 247  ARG A NH1   1 
ATOM   1960 N  NH2   . ARG A 1 253 ? -5.768  -9.034  18.597  1.00   55.69 ? 247  ARG A NH2   1 
ATOM   1961 N  N     . ILE A 1 254 ? -7.962  -13.936 21.145  1.00   41.31 ? 248  ILE A N     1 
ATOM   1962 C  CA    . ILE A 1 254 ? -6.870  -14.833 20.798  1.00   42.84 ? 248  ILE A CA    1 
ATOM   1963 C  C     . ILE A 1 254 ? -5.989  -14.001 19.861  1.00   44.12 ? 248  ILE A C     1 
ATOM   1964 O  O     . ILE A 1 254 ? -6.502  -13.309 18.976  1.00   44.49 ? 248  ILE A O     1 
ATOM   1965 C  CB    . ILE A 1 254 ? -7.380  -16.106 20.043  1.00   43.20 ? 248  ILE A CB    1 
ATOM   1966 C  CG1   . ILE A 1 254 ? -8.609  -16.669 20.756  1.00   45.80 ? 248  ILE A CG1   1 
ATOM   1967 C  CG2   . ILE A 1 254 ? -6.322  -17.223 20.066  1.00   40.86 ? 248  ILE A CG2   1 
ATOM   1968 C  CD1   . ILE A 1 254 ? -9.201  -17.979 20.169  1.00   44.88 ? 248  ILE A CD1   1 
ATOM   1969 N  N     . VAL A 1 255 ? -4.675  -14.059 20.059  1.00   44.17 ? 249  VAL A N     1 
ATOM   1970 C  CA    . VAL A 1 255 ? -3.739  -13.307 19.227  1.00   43.47 ? 249  VAL A CA    1 
ATOM   1971 C  C     . VAL A 1 255 ? -2.620  -14.215 18.725  1.00   43.29 ? 249  VAL A C     1 
ATOM   1972 O  O     . VAL A 1 255 ? -2.228  -15.145 19.415  1.00   42.44 ? 249  VAL A O     1 
ATOM   1973 C  CB    . VAL A 1 255 ? -3.095  -12.150 20.015  1.00   44.10 ? 249  VAL A CB    1 
ATOM   1974 C  CG1   . VAL A 1 255 ? -4.145  -11.158 20.462  1.00   44.02 ? 249  VAL A CG1   1 
ATOM   1975 C  CG2   . VAL A 1 255 ? -2.358  -12.694 21.221  1.00   42.79 ? 249  VAL A CG2   1 
ATOM   1976 N  N     . THR A 1 256 ? -2.121  -13.942 17.521  1.00   44.10 ? 250  THR A N     1 
ATOM   1977 C  CA    . THR A 1 256 ? -1.041  -14.722 16.922  1.00   44.75 ? 250  THR A CA    1 
ATOM   1978 C  C     . THR A 1 256 ? 0.299   -14.184 17.402  1.00   46.08 ? 250  THR A C     1 
ATOM   1979 O  O     . THR A 1 256 ? 0.627   -13.031 17.167  1.00   46.59 ? 250  THR A O     1 
ATOM   1980 C  CB    . THR A 1 256 ? -1.069  -14.623 15.379  1.00   44.38 ? 250  THR A CB    1 
ATOM   1981 O  OG1   . THR A 1 256 ? -2.361  -15.009 14.899  1.00   44.81 ? 250  THR A OG1   1 
ATOM   1982 C  CG2   . THR A 1 256 ? -0.009  -15.529 14.752  1.00   41.90 ? 250  THR A CG2   1 
ATOM   1983 N  N     . MET A 1 257 ? 1.067   -15.019 18.085  1.00   49.09 ? 251  MET A N     1 
ATOM   1984 C  CA    . MET A 1 257 ? 2.377   -14.609 18.576  1.00   52.79 ? 251  MET A CA    1 
ATOM   1985 C  C     . MET A 1 257 ? 3.263   -14.370 17.372  1.00   53.77 ? 251  MET A C     1 
ATOM   1986 O  O     . MET A 1 257 ? 3.110   -15.038 16.357  1.00   52.81 ? 251  MET A O     1 
ATOM   1987 C  CB    . MET A 1 257 ? 3.000   -15.705 19.448  1.00   53.90 ? 251  MET A CB    1 
ATOM   1988 C  CG    . MET A 1 257 ? 2.156   -16.108 20.640  1.00   54.49 ? 251  MET A CG    1 
ATOM   1989 S  SD    . MET A 1 257 ? 3.051   -17.194 21.720  1.00   56.52 ? 251  MET A SD    1 
ATOM   1990 C  CE    . MET A 1 257 ? 2.851   -18.765 20.905  1.00   54.98 ? 251  MET A CE    1 
ATOM   1991 N  N     . LYS A 1 258 ? 4.184   -13.419 17.483  1.00   56.39 ? 252  LYS A N     1 
ATOM   1992 C  CA    . LYS A 1 258 ? 5.089   -13.119 16.379  1.00   59.75 ? 252  LYS A CA    1 
ATOM   1993 C  C     . LYS A 1 258 ? 5.715   -14.396 15.805  1.00   60.85 ? 252  LYS A C     1 
ATOM   1994 O  O     . LYS A 1 258 ? 5.774   -14.579 14.588  1.00   61.53 ? 252  LYS A O     1 
ATOM   1995 C  CB    . LYS A 1 258 ? 6.166   -12.139 16.846  1.00   60.77 ? 252  LYS A CB    1 
ATOM   1996 C  CG    . LYS A 1 258 ? 5.725   -10.671 16.741  1.00   63.86 ? 252  LYS A CG    1 
ATOM   1997 C  CD    . LYS A 1 258 ? 6.117   -9.854  17.971  1.00   66.10 ? 252  LYS A CD    1 
ATOM   1998 C  CE    . LYS A 1 258 ? 5.308   -10.297 19.200  1.00   67.09 ? 252  LYS A CE    1 
ATOM   1999 N  NZ    . LYS A 1 258 ? 5.660   -9.613  20.490  1.00   68.76 ? 252  LYS A NZ    1 
ATOM   2000 N  N     . ARG A 1 259 ? 6.164   -15.285 16.684  1.00   61.95 ? 253  ARG A N     1 
ATOM   2001 C  CA    . ARG A 1 259 ? 6.756   -16.545 16.260  1.00   62.27 ? 253  ARG A CA    1 
ATOM   2002 C  C     . ARG A 1 259 ? 6.111   -17.620 17.098  1.00   62.85 ? 253  ARG A C     1 
ATOM   2003 O  O     . ARG A 1 259 ? 5.506   -17.323 18.123  1.00   63.16 ? 253  ARG A O     1 
ATOM   2004 C  CB    . ARG A 1 259 ? 8.270   -16.554 16.500  0.50   63.01 ? 253  ARG A CB    1 
ATOM   2005 C  CG    . ARG A 1 259 ? 8.688   -16.258 17.937  0.50   63.56 ? 253  ARG A CG    1 
ATOM   2006 C  CD    . ARG A 1 259 ? 9.991   -16.965 18.280  0.50   63.98 ? 253  ARG A CD    1 
ATOM   2007 N  NE    . ARG A 1 259 ? 11.041  -16.662 17.316  0.50   64.19 ? 253  ARG A NE    1 
ATOM   2008 C  CZ    . ARG A 1 259 ? 12.170  -17.353 17.197  0.50   64.45 ? 253  ARG A CZ    1 
ATOM   2009 N  NH1   . ARG A 1 259 ? 12.404  -18.396 17.985  0.50   64.18 ? 253  ARG A NH1   1 
ATOM   2010 N  NH2   . ARG A 1 259 ? 13.062  -17.004 16.282  0.50   64.33 ? 253  ARG A NH2   1 
ATOM   2011 N  N     . ASN A 1 260 ? 6.236   -18.864 16.662  1.00   63.38 ? 254  ASN A N     1 
ATOM   2012 C  CA    . ASN A 1 260 ? 5.664   -19.976 17.395  1.00   64.31 ? 254  ASN A CA    1 
ATOM   2013 C  C     . ASN A 1 260 ? 6.491   -20.208 18.635  1.00   65.08 ? 254  ASN A C     1 
ATOM   2014 O  O     . ASN A 1 260 ? 7.503   -19.537 18.832  1.00   66.24 ? 254  ASN A O     1 
ATOM   2015 C  CB    . ASN A 1 260 ? 5.672   -21.218 16.528  1.00   65.24 ? 254  ASN A CB    1 
ATOM   2016 C  CG    . ASN A 1 260 ? 4.751   -21.084 15.352  1.00   66.56 ? 254  ASN A CG    1 
ATOM   2017 O  OD1   . ASN A 1 260 ? 3.559   -21.372 15.452  1.00   67.25 ? 254  ASN A OD1   1 
ATOM   2018 N  ND2   . ASN A 1 260 ? 5.289   -20.615 14.228  1.00   67.15 ? 254  ASN A ND2   1 
ATOM   2019 N  N     . SER A 1 261 ? 6.061   -21.146 19.475  1.00   64.44 ? 255  SER A N     1 
ATOM   2020 C  CA    . SER A 1 261 ? 6.796   -21.444 20.693  1.00   64.17 ? 255  SER A CA    1 
ATOM   2021 C  C     . SER A 1 261 ? 6.124   -22.449 21.605  1.00   64.70 ? 255  SER A C     1 
ATOM   2022 O  O     . SER A 1 261 ? 5.000   -22.896 21.380  1.00   64.37 ? 255  SER A O     1 
ATOM   2023 C  CB    . SER A 1 261 ? 7.045   -20.169 21.503  1.00   63.59 ? 255  SER A CB    1 
ATOM   2024 O  OG    . SER A 1 261 ? 5.936   -19.845 22.325  1.00   62.55 ? 255  SER A OG    1 
ATOM   2025 N  N     . ARG A 1 262 ? 6.855   -22.785 22.656  1.00   65.26 ? 256  ARG A N     1 
ATOM   2026 C  CA    . ARG A 1 262 ? 6.404   -23.714 23.666  1.00   65.21 ? 256  ARG A CA    1 
ATOM   2027 C  C     . ARG A 1 262 ? 7.085   -23.230 24.943  1.00   64.80 ? 256  ARG A C     1 
ATOM   2028 O  O     . ARG A 1 262 ? 7.163   -23.943 25.938  1.00   65.25 ? 256  ARG A O     1 
ATOM   2029 C  CB    . ARG A 1 262 ? 6.846   -25.132 23.303  1.00   65.18 ? 256  ARG A CB    1 
ATOM   2030 C  CG    . ARG A 1 262 ? 5.911   -26.195 23.837  1.00   65.66 ? 256  ARG A CG    1 
ATOM   2031 C  CD    . ARG A 1 262 ? 6.267   -27.562 23.323  1.00   64.52 ? 256  ARG A CD    1 
ATOM   2032 N  NE    . ARG A 1 262 ? 5.200   -28.512 23.604  1.00   64.65 ? 256  ARG A NE    1 
ATOM   2033 C  CZ    . ARG A 1 262 ? 4.754   -28.790 24.822  1.00   64.85 ? 256  ARG A CZ    1 
ATOM   2034 N  NH1   . ARG A 1 262 ? 5.287   -28.190 25.877  1.00   65.96 ? 256  ARG A NH1   1 
ATOM   2035 N  NH2   . ARG A 1 262 ? 3.776   -29.665 24.984  1.00   65.30 ? 256  ARG A NH2   1 
ATOM   2036 N  N     . ASN A 1 263 ? 7.559   -21.986 24.878  1.00   64.63 ? 257  ASN A N     1 
ATOM   2037 C  CA    . ASN A 1 263 ? 8.256   -21.297 25.965  1.00   64.45 ? 257  ASN A CA    1 
ATOM   2038 C  C     . ASN A 1 263 ? 7.280   -20.456 26.789  1.00   64.66 ? 257  ASN A C     1 
ATOM   2039 O  O     . ASN A 1 263 ? 6.879   -19.371 26.375  1.00   65.24 ? 257  ASN A O     1 
ATOM   2040 C  CB    . ASN A 1 263 ? 9.344   -20.391 25.370  1.00   63.70 ? 257  ASN A CB    1 
ATOM   2041 C  CG    . ASN A 1 263 ? 10.139  -19.658 26.423  1.00   63.90 ? 257  ASN A CG    1 
ATOM   2042 O  OD1   . ASN A 1 263 ? 9.602   -18.851 27.181  1.00   64.23 ? 257  ASN A OD1   1 
ATOM   2043 N  ND2   . ASN A 1 263 ? 11.435  -19.932 26.475  1.00   65.33 ? 257  ASN A ND2   1 
ATOM   2044 N  N     . LEU A 1 264 ? 6.916   -20.951 27.963  1.00   64.71 ? 258  LEU A N     1 
ATOM   2045 C  CA    . LEU A 1 264 ? 5.974   -20.252 28.831  1.00   65.42 ? 258  LEU A CA    1 
ATOM   2046 C  C     . LEU A 1 264 ? 6.233   -18.756 29.002  1.00   65.28 ? 258  LEU A C     1 
ATOM   2047 O  O     . LEU A 1 264 ? 5.304   -17.945 29.021  1.00   64.05 ? 258  LEU A O     1 
ATOM   2048 C  CB    . LEU A 1 264 ? 5.947   -20.921 30.210  1.00   66.29 ? 258  LEU A CB    1 
ATOM   2049 C  CG    . LEU A 1 264 ? 4.955   -20.350 31.224  1.00   65.98 ? 258  LEU A CG    1 
ATOM   2050 C  CD1   . LEU A 1 264 ? 3.540   -20.436 30.679  1.00   66.77 ? 258  LEU A CD1   1 
ATOM   2051 C  CD2   . LEU A 1 264 ? 5.059   -21.131 32.508  1.00   66.82 ? 258  LEU A CD2   1 
ATOM   2052 N  N     . GLU A 1 265 ? 7.500   -18.394 29.141  1.00   66.38 ? 259  GLU A N     1 
ATOM   2053 C  CA    . GLU A 1 265 ? 7.857   -16.993 29.325  1.00   67.63 ? 259  GLU A CA    1 
ATOM   2054 C  C     . GLU A 1 265 ? 7.785   -16.148 28.052  1.00   67.00 ? 259  GLU A C     1 
ATOM   2055 O  O     . GLU A 1 265 ? 7.665   -14.926 28.117  1.00   68.07 ? 259  GLU A O     1 
ATOM   2056 C  CB    . GLU A 1 265 ? 9.256   -16.876 29.944  1.00   69.00 ? 259  GLU A CB    1 
ATOM   2057 C  CG    . GLU A 1 265 ? 9.278   -17.040 31.462  1.00   70.79 ? 259  GLU A CG    1 
ATOM   2058 C  CD    . GLU A 1 265 ? 8.448   -15.984 32.175  1.00   71.58 ? 259  GLU A CD    1 
ATOM   2059 O  OE1   . GLU A 1 265 ? 8.693   -14.782 31.946  1.00   71.86 ? 259  GLU A OE1   1 
ATOM   2060 O  OE2   . GLU A 1 265 ? 7.554   -16.351 32.967  1.00   72.89 ? 259  GLU A OE2   1 
ATOM   2061 N  N     . GLU A 1 266 ? 7.860   -16.785 26.893  1.00   64.96 ? 260  GLU A N     1 
ATOM   2062 C  CA    . GLU A 1 266 ? 7.789   -16.045 25.645  1.00   62.62 ? 260  GLU A CA    1 
ATOM   2063 C  C     . GLU A 1 266 ? 6.316   -15.748 25.354  1.00   61.41 ? 260  GLU A C     1 
ATOM   2064 O  O     . GLU A 1 266 ? 5.973   -14.731 24.748  1.00   61.26 ? 260  GLU A O     1 
ATOM   2065 C  CB    . GLU A 1 266 ? 8.414   -16.888 24.530  1.00   64.53 ? 260  GLU A CB    1 
ATOM   2066 C  CG    . GLU A 1 266 ? 8.347   -16.293 23.133  1.00   66.36 ? 260  GLU A CG    1 
ATOM   2067 C  CD    . GLU A 1 266 ? 9.123   -17.115 22.110  1.00   68.28 ? 260  GLU A CD    1 
ATOM   2068 O  OE1   . GLU A 1 266 ? 9.032   -18.361 22.161  1.00   68.91 ? 260  GLU A OE1   1 
ATOM   2069 O  OE2   . GLU A 1 266 ? 9.815   -16.521 21.249  1.00   69.36 ? 260  GLU A OE2   1 
ATOM   2070 N  N     . ILE A 1 267 ? 5.449   -16.636 25.824  1.00   59.20 ? 261  ILE A N     1 
ATOM   2071 C  CA    . ILE A 1 267 ? 4.017   -16.511 25.612  1.00   57.23 ? 261  ILE A CA    1 
ATOM   2072 C  C     . ILE A 1 267 ? 3.344   -15.509 26.533  1.00   56.62 ? 261  ILE A C     1 
ATOM   2073 O  O     . ILE A 1 267 ? 2.587   -14.649 26.081  1.00   56.22 ? 261  ILE A O     1 
ATOM   2074 C  CB    . ILE A 1 267 ? 3.325   -17.855 25.819  1.00   58.20 ? 261  ILE A CB    1 
ATOM   2075 C  CG1   . ILE A 1 267 ? 3.818   -18.857 24.772  1.00   58.25 ? 261  ILE A CG1   1 
ATOM   2076 C  CG2   . ILE A 1 267 ? 1.812   -17.674 25.751  1.00   57.93 ? 261  ILE A CG2   1 
ATOM   2077 C  CD1   . ILE A 1 267 ? 3.222   -20.247 24.907  1.00   57.71 ? 261  ILE A CD1   1 
ATOM   2078 N  N     . LYS A 1 268 ? 3.611   -15.637 27.827  1.00   55.54 ? 262  LYS A N     1 
ATOM   2079 C  CA    . LYS A 1 268 ? 3.021   -14.758 28.818  1.00   55.24 ? 262  LYS A CA    1 
ATOM   2080 C  C     . LYS A 1 268 ? 2.538   -13.398 28.311  1.00   55.28 ? 262  LYS A C     1 
ATOM   2081 O  O     . LYS A 1 268 ? 1.348   -13.081 28.404  1.00   56.12 ? 262  LYS A O     1 
ATOM   2082 C  CB    . LYS A 1 268 ? 3.995   -14.538 29.969  1.00   55.46 ? 262  LYS A CB    1 
ATOM   2083 C  CG    . LYS A 1 268 ? 3.891   -15.538 31.098  1.00   57.88 ? 262  LYS A CG    1 
ATOM   2084 C  CD    . LYS A 1 268 ? 4.589   -14.985 32.330  1.00   59.15 ? 262  LYS A CD    1 
ATOM   2085 C  CE    . LYS A 1 268 ? 4.571   -15.952 33.492  1.00   60.23 ? 262  LYS A CE    1 
ATOM   2086 N  NZ    . LYS A 1 268 ? 5.324   -15.369 34.645  1.00   60.65 ? 262  LYS A NZ    1 
ATOM   2087 N  N     . PRO A 1 269 ? 3.449   -12.573 27.768  1.00   55.01 ? 263  PRO A N     1 
ATOM   2088 C  CA    . PRO A 1 269 ? 3.040   -11.251 27.275  1.00   53.64 ? 263  PRO A CA    1 
ATOM   2089 C  C     . PRO A 1 269 ? 1.818   -11.240 26.356  1.00   52.86 ? 263  PRO A C     1 
ATOM   2090 O  O     . PRO A 1 269 ? 0.939   -10.386 26.492  1.00   52.63 ? 263  PRO A O     1 
ATOM   2091 C  CB    . PRO A 1 269 ? 4.306   -10.726 26.602  1.00   53.27 ? 263  PRO A CB    1 
ATOM   2092 C  CG    . PRO A 1 269 ? 5.003   -11.976 26.170  1.00   55.27 ? 263  PRO A CG    1 
ATOM   2093 C  CD    . PRO A 1 269 ? 4.837   -12.866 27.370  1.00   54.89 ? 263  PRO A CD    1 
ATOM   2094 N  N     . TYR A 1 270 ? 1.752   -12.178 25.421  1.00   52.68 ? 264  TYR A N     1 
ATOM   2095 C  CA    . TYR A 1 270 ? 0.604   -12.234 24.525  1.00   52.60 ? 264  TYR A CA    1 
ATOM   2096 C  C     . TYR A 1 270 ? -0.607  -12.570 25.374  1.00   51.66 ? 264  TYR A C     1 
ATOM   2097 O  O     . TYR A 1 270 ? -1.590  -11.829 25.395  1.00   50.42 ? 264  TYR A O     1 
ATOM   2098 C  CB    . TYR A 1 270 ? 0.807   -13.318 23.490  1.00   54.00 ? 264  TYR A CB    1 
ATOM   2099 C  CG    . TYR A 1 270 ? 2.071   -13.141 22.711  1.00   56.69 ? 264  TYR A CG    1 
ATOM   2100 C  CD1   . TYR A 1 270 ? 2.136   -12.232 21.657  1.00   56.21 ? 264  TYR A CD1   1 
ATOM   2101 C  CD2   . TYR A 1 270 ? 3.210   -13.886 23.019  1.00   57.42 ? 264  TYR A CD2   1 
ATOM   2102 C  CE1   . TYR A 1 270 ? 3.301   -12.075 20.926  1.00   57.60 ? 264  TYR A CE1   1 
ATOM   2103 C  CE2   . TYR A 1 270 ? 4.381   -13.732 22.291  1.00   58.45 ? 264  TYR A CE2   1 
ATOM   2104 C  CZ    . TYR A 1 270 ? 4.415   -12.827 21.250  1.00   57.86 ? 264  TYR A CZ    1 
ATOM   2105 O  OH    . TYR A 1 270 ? 5.569   -12.667 20.536  1.00   60.86 ? 264  TYR A OH    1 
ATOM   2106 N  N     . LEU A 1 271 ? -0.511  -13.691 26.085  1.00   50.85 ? 265  LEU A N     1 
ATOM   2107 C  CA    . LEU A 1 271 ? -1.574  -14.150 26.964  1.00   50.81 ? 265  LEU A CA    1 
ATOM   2108 C  C     . LEU A 1 271 ? -2.033  -13.030 27.882  1.00   50.26 ? 265  LEU A C     1 
ATOM   2109 O  O     . LEU A 1 271 ? -3.229  -12.802 28.037  1.00   50.71 ? 265  LEU A O     1 
ATOM   2110 C  CB    . LEU A 1 271 ? -1.094  -15.342 27.794  1.00   50.89 ? 265  LEU A CB    1 
ATOM   2111 C  CG    . LEU A 1 271 ? -2.074  -15.893 28.840  1.00   51.55 ? 265  LEU A CG    1 
ATOM   2112 C  CD1   . LEU A 1 271 ? -3.381  -16.344 28.192  1.00   49.65 ? 265  LEU A CD1   1 
ATOM   2113 C  CD2   . LEU A 1 271 ? -1.419  -17.050 29.556  1.00   50.81 ? 265  LEU A CD2   1 
ATOM   2114 N  N     . PHE A 1 272 ? -1.084  -12.325 28.484  1.00   50.62 ? 266  PHE A N     1 
ATOM   2115 C  CA    . PHE A 1 272 ? -1.429  -11.227 29.377  1.00   51.25 ? 266  PHE A CA    1 
ATOM   2116 C  C     . PHE A 1 272 ? -2.056  -10.064 28.625  1.00   51.10 ? 266  PHE A C     1 
ATOM   2117 O  O     . PHE A 1 272 ? -2.765  -9.245  29.218  1.00   51.14 ? 266  PHE A O     1 
ATOM   2118 C  CB    . PHE A 1 272 ? -0.199  -10.730 30.140  1.00   53.03 ? 266  PHE A CB    1 
ATOM   2119 C  CG    . PHE A 1 272 ? 0.388   -11.748 31.078  1.00   54.92 ? 266  PHE A CG    1 
ATOM   2120 C  CD1   . PHE A 1 272 ? -0.436  -12.593 31.815  1.00   54.68 ? 266  PHE A CD1   1 
ATOM   2121 C  CD2   . PHE A 1 272 ? 1.770   -11.850 31.239  1.00   56.00 ? 266  PHE A CD2   1 
ATOM   2122 C  CE1   . PHE A 1 272 ? 0.106   -13.519 32.688  1.00   55.04 ? 266  PHE A CE1   1 
ATOM   2123 C  CE2   . PHE A 1 272 ? 2.322   -12.775 32.112  1.00   55.29 ? 266  PHE A CE2   1 
ATOM   2124 C  CZ    . PHE A 1 272 ? 1.493   -13.611 32.837  1.00   56.02 ? 266  PHE A CZ    1 
ATOM   2125 N  N     . ARG A 1 273 ? -1.776  -9.969  27.326  1.00   50.19 ? 267  ARG A N     1 
ATOM   2126 C  CA    . ARG A 1 273 ? -2.359  -8.905  26.517  1.00   49.48 ? 267  ARG A CA    1 
ATOM   2127 C  C     . ARG A 1 273 ? -3.772  -9.320  26.164  1.00   46.89 ? 267  ARG A C     1 
ATOM   2128 O  O     . ARG A 1 273 ? -4.677  -8.506  26.103  1.00   46.32 ? 267  ARG A O     1 
ATOM   2129 C  CB    . ARG A 1 273 ? -1.553  -8.684  25.243  0.50   52.24 ? 267  ARG A CB    1 
ATOM   2130 C  CG    . ARG A 1 273 ? -0.216  -8.035  25.484  0.50   56.06 ? 267  ARG A CG    1 
ATOM   2131 C  CD    . ARG A 1 273 ? 0.630   -8.092  24.238  0.50   58.36 ? 267  ARG A CD    1 
ATOM   2132 N  NE    . ARG A 1 273 ? 1.985   -7.636  24.502  1.00   60.19 ? 267  ARG A NE    1 
ATOM   2133 C  CZ    . ARG A 1 273 ? 3.038   -8.019  23.796  1.00   62.99 ? 267  ARG A CZ    1 
ATOM   2134 N  NH1   . ARG A 1 273 ? 2.887   -8.868  22.784  1.00   62.07 ? 267  ARG A NH1   1 
ATOM   2135 N  NH2   . ARG A 1 273 ? 4.242   -7.550  24.102  1.00   66.42 ? 267  ARG A NH2   1 
ATOM   2136 N  N     . ALA A 1 274 ? -3.955  -10.609 25.941  1.00   44.90 ? 268  ALA A N     1 
ATOM   2137 C  CA    . ALA A 1 274 ? -5.268  -11.124 25.616  1.00   44.19 ? 268  ALA A CA    1 
ATOM   2138 C  C     . ALA A 1 274 ? -6.231  -10.821 26.759  1.00   43.02 ? 268  ALA A C     1 
ATOM   2139 O  O     . ALA A 1 274 ? -7.304  -10.286 26.529  1.00   41.37 ? 268  ALA A O     1 
ATOM   2140 C  CB    . ALA A 1 274 ? -5.185  -12.620 25.364  1.00   43.41 ? 268  ALA A CB    1 
ATOM   2141 N  N     . ILE A 1 275 ? -5.825  -11.145 27.989  1.00   44.59 ? 269  ILE A N     1 
ATOM   2142 C  CA    . ILE A 1 275 ? -6.644  -10.904 29.190  1.00   45.17 ? 269  ILE A CA    1 
ATOM   2143 C  C     . ILE A 1 275 ? -6.993  -9.433  29.393  1.00   47.51 ? 269  ILE A C     1 
ATOM   2144 O  O     . ILE A 1 275 ? -8.169  -9.041  29.464  1.00   48.14 ? 269  ILE A O     1 
ATOM   2145 C  CB    . ILE A 1 275 ? -5.930  -11.333 30.495  1.00   43.82 ? 269  ILE A CB    1 
ATOM   2146 C  CG1   . ILE A 1 275 ? -5.403  -12.765 30.390  1.00   42.47 ? 269  ILE A CG1   1 
ATOM   2147 C  CG2   . ILE A 1 275 ? -6.911  -11.230 31.667  1.00   41.95 ? 269  ILE A CG2   1 
ATOM   2148 C  CD1   . ILE A 1 275 ? -4.664  -13.207 31.627  1.00   37.20 ? 269  ILE A CD1   1 
ATOM   2149 N  N     . GLU A 1 276 ? -5.955  -8.620  29.517  1.00   49.20 ? 270  GLU A N     1 
ATOM   2150 C  CA    . GLU A 1 276 ? -6.151  -7.199  29.717  1.00   50.71 ? 270  GLU A CA    1 
ATOM   2151 C  C     . GLU A 1 276 ? -7.100  -6.660  28.658  1.00   49.27 ? 270  GLU A C     1 
ATOM   2152 O  O     . GLU A 1 276 ? -7.994  -5.883  28.946  1.00   49.41 ? 270  GLU A O     1 
ATOM   2153 C  CB    . GLU A 1 276 ? -4.808  -6.478  29.644  1.00   53.66 ? 270  GLU A CB    1 
ATOM   2154 C  CG    . GLU A 1 276 ? -4.868  -5.033  30.109  1.00   59.06 ? 270  GLU A CG    1 
ATOM   2155 C  CD    . GLU A 1 276 ? -5.264  -4.904  31.571  1.00   61.33 ? 270  GLU A CD    1 
ATOM   2156 O  OE1   . GLU A 1 276 ? -4.526  -5.442  32.432  1.00   61.92 ? 270  GLU A OE1   1 
ATOM   2157 O  OE2   . GLU A 1 276 ? -6.310  -4.264  31.847  1.00   62.37 ? 270  GLU A OE2   1 
ATOM   2158 N  N     . GLU A 1 277 ? -6.919  -7.101  27.427  1.00   49.39 ? 271  GLU A N     1 
ATOM   2159 C  CA    . GLU A 1 277 ? -7.763  -6.631  26.354  1.00   50.15 ? 271  GLU A CA    1 
ATOM   2160 C  C     . GLU A 1 277 ? -9.128  -7.282  26.430  1.00   49.50 ? 271  GLU A C     1 
ATOM   2161 O  O     . GLU A 1 277 ? -10.078 -6.802  25.820  1.00   49.61 ? 271  GLU A O     1 
ATOM   2162 C  CB    . GLU A 1 277 ? -7.103  -6.925  25.014  1.00   53.22 ? 271  GLU A CB    1 
ATOM   2163 C  CG    . GLU A 1 277 ? -7.638  -6.116  23.860  1.00   57.53 ? 271  GLU A CG    1 
ATOM   2164 C  CD    . GLU A 1 277 ? -6.706  -6.173  22.665  1.00   61.08 ? 271  GLU A CD    1 
ATOM   2165 O  OE1   . GLU A 1 277 ? -7.169  -6.584  21.571  1.00   62.35 ? 271  GLU A OE1   1 
ATOM   2166 O  OE2   . GLU A 1 277 ? -5.513  -5.805  22.832  1.00   60.37 ? 271  GLU A OE2   1 
ATOM   2167 N  N     . SER A 1 278 ? -9.225  -8.380  27.176  1.00   48.45 ? 272  SER A N     1 
ATOM   2168 C  CA    . SER A 1 278 ? -10.497 -9.075  27.343  1.00   46.05 ? 272  SER A CA    1 
ATOM   2169 C  C     . SER A 1 278 ? -11.311 -8.436  28.453  1.00   47.05 ? 272  SER A C     1 
ATOM   2170 O  O     . SER A 1 278 ? -12.541 -8.447  28.415  1.00   47.34 ? 272  SER A O     1 
ATOM   2171 C  CB    . SER A 1 278 ? -10.272 -10.541 27.670  1.00   43.27 ? 272  SER A CB    1 
ATOM   2172 O  OG    . SER A 1 278 ? -9.785  -11.218 26.542  1.00   35.86 ? 272  SER A OG    1 
ATOM   2173 N  N     . TYR A 1 279 ? -10.632 -7.885  29.451  1.00   48.47 ? 273  TYR A N     1 
ATOM   2174 C  CA    . TYR A 1 279 ? -11.342 -7.224  30.541  1.00   49.91 ? 273  TYR A CA    1 
ATOM   2175 C  C     . TYR A 1 279 ? -11.971 -5.926  30.072  1.00   50.19 ? 273  TYR A C     1 
ATOM   2176 O  O     . TYR A 1 279 ? -13.085 -5.573  30.474  1.00   49.84 ? 273  TYR A O     1 
ATOM   2177 C  CB    . TYR A 1 279 ? -10.414 -6.944  31.709  1.00   52.01 ? 273  TYR A CB    1 
ATOM   2178 C  CG    . TYR A 1 279 ? -10.543 -7.983  32.790  1.00   54.78 ? 273  TYR A CG    1 
ATOM   2179 C  CD1   . TYR A 1 279 ? -9.876  -9.195  32.692  1.00   55.82 ? 273  TYR A CD1   1 
ATOM   2180 C  CD2   . TYR A 1 279 ? -11.409 -7.789  33.871  1.00   55.96 ? 273  TYR A CD2   1 
ATOM   2181 C  CE1   . TYR A 1 279 ? -10.072 -10.193 33.633  1.00   57.40 ? 273  TYR A CE1   1 
ATOM   2182 C  CE2   . TYR A 1 279 ? -11.611 -8.788  34.820  1.00   57.00 ? 273  TYR A CE2   1 
ATOM   2183 C  CZ    . TYR A 1 279 ? -10.938 -9.985  34.685  1.00   56.81 ? 273  TYR A CZ    1 
ATOM   2184 O  OH    . TYR A 1 279 ? -11.132 -10.998 35.578  1.00   59.29 ? 273  TYR A OH    1 
ATOM   2185 N  N     . TYR A 1 280 ? -11.252 -5.205  29.225  1.00   49.64 ? 274  TYR A N     1 
ATOM   2186 C  CA    . TYR A 1 280 ? -11.796 -3.975  28.691  1.00   50.30 ? 274  TYR A CA    1 
ATOM   2187 C  C     . TYR A 1 280 ? -13.141 -4.301  28.029  1.00   52.08 ? 274  TYR A C     1 
ATOM   2188 O  O     . TYR A 1 280 ? -14.140 -3.633  28.281  1.00   53.91 ? 274  TYR A O     1 
ATOM   2189 C  CB    . TYR A 1 280 ? -10.843 -3.370  27.657  1.00   46.87 ? 274  TYR A CB    1 
ATOM   2190 C  CG    . TYR A 1 280 ? -11.280 -2.020  27.148  0.50   46.21 ? 274  TYR A CG    1 
ATOM   2191 C  CD1   . TYR A 1 280 ? -11.398 -0.942  28.013  0.50   46.20 ? 274  TYR A CD1   1 
ATOM   2192 C  CD2   . TYR A 1 280 ? -11.567 -1.818  25.799  0.50   45.46 ? 274  TYR A CD2   1 
ATOM   2193 C  CE1   . TYR A 1 280 ? -11.787 0.304   27.556  0.50   46.90 ? 274  TYR A CE1   1 
ATOM   2194 C  CE2   . TYR A 1 280 ? -11.958 -0.575  25.328  0.50   45.64 ? 274  TYR A CE2   1 
ATOM   2195 C  CZ    . TYR A 1 280 ? -12.064 0.483   26.214  0.50   46.63 ? 274  TYR A CZ    1 
ATOM   2196 O  OH    . TYR A 1 280 ? -12.426 1.736   25.778  0.50   46.40 ? 274  TYR A OH    1 
ATOM   2197 N  N     . LYS A 1 281 ? -13.165 -5.338  27.197  1.00   53.13 ? 275  LYS A N     1 
ATOM   2198 C  CA    . LYS A 1 281 ? -14.382 -5.725  26.502  1.00   53.65 ? 275  LYS A CA    1 
ATOM   2199 C  C     . LYS A 1 281 ? -15.422 -6.317  27.444  1.00   54.24 ? 275  LYS A C     1 
ATOM   2200 O  O     . LYS A 1 281 ? -16.594 -6.334  27.119  1.00   53.62 ? 275  LYS A O     1 
ATOM   2201 C  CB    . LYS A 1 281 ? -14.058 -6.710  25.373  1.00   54.39 ? 275  LYS A CB    1 
ATOM   2202 C  CG    . LYS A 1 281 ? -13.320 -6.090  24.179  1.00   54.15 ? 275  LYS A CG    1 
ATOM   2203 C  CD    . LYS A 1 281 ? -12.566 -7.144  23.341  1.00   56.76 ? 275  LYS A CD    1 
ATOM   2204 C  CE    . LYS A 1 281 ? -13.457 -8.316  22.912  1.00   57.31 ? 275  LYS A CE    1 
ATOM   2205 N  NZ    . LYS A 1 281 ? -12.767 -9.289  22.007  1.00   57.62 ? 275  LYS A NZ    1 
ATOM   2206 N  N     . LEU A 1 282 ? -15.006 -6.804  28.608  1.00   56.34 ? 276  LEU A N     1 
ATOM   2207 C  CA    . LEU A 1 282 ? -15.963 -7.350  29.574  1.00   58.34 ? 276  LEU A CA    1 
ATOM   2208 C  C     . LEU A 1 282 ? -16.813 -6.207  30.094  1.00   60.32 ? 276  LEU A C     1 
ATOM   2209 O  O     . LEU A 1 282 ? -18.041 -6.241  30.042  1.00   59.67 ? 276  LEU A O     1 
ATOM   2210 C  CB    . LEU A 1 282 ? -15.243 -7.983  30.760  1.00   57.91 ? 276  LEU A CB    1 
ATOM   2211 C  CG    . LEU A 1 282 ? -14.957 -9.478  30.686  1.00   58.89 ? 276  LEU A CG    1 
ATOM   2212 C  CD1   . LEU A 1 282 ? -14.313 -9.947  31.982  1.00   58.80 ? 276  LEU A CD1   1 
ATOM   2213 C  CD2   . LEU A 1 282 ? -16.256 -10.225 30.454  1.00   58.48 ? 276  LEU A CD2   1 
ATOM   2214 N  N     . ASP A 1 283 ? -16.117 -5.203  30.613  1.00   63.45 ? 277  ASP A N     1 
ATOM   2215 C  CA    . ASP A 1 283 ? -16.719 -4.005  31.163  1.00   66.95 ? 277  ASP A CA    1 
ATOM   2216 C  C     . ASP A 1 283 ? -17.730 -4.270  32.270  1.00   68.42 ? 277  ASP A C     1 
ATOM   2217 O  O     . ASP A 1 283 ? -18.932 -4.406  32.010  1.00   70.12 ? 277  ASP A O     1 
ATOM   2218 C  CB    . ASP A 1 283 ? -17.388 -3.191  30.061  1.00   69.29 ? 277  ASP A CB    1 
ATOM   2219 C  CG    . ASP A 1 283 ? -17.718 -1.779  30.513  1.00   73.65 ? 277  ASP A CG    1 
ATOM   2220 O  OD1   . ASP A 1 283 ? -16.768 -1.025  30.833  1.00   75.10 ? 277  ASP A OD1   1 
ATOM   2221 O  OD2   . ASP A 1 283 ? -18.919 -1.423  30.561  1.00   75.94 ? 277  ASP A OD2   1 
ATOM   2222 N  N     . LYS A 1 284 ? -17.233 -4.334  33.503  1.00   68.95 ? 278  LYS A N     1 
ATOM   2223 C  CA    . LYS A 1 284 ? -18.062 -4.548  34.688  1.00   69.24 ? 278  LYS A CA    1 
ATOM   2224 C  C     . LYS A 1 284 ? -18.606 -5.968  34.843  1.00   68.72 ? 278  LYS A C     1 
ATOM   2225 O  O     . LYS A 1 284 ? -18.598 -6.504  35.951  1.00   69.39 ? 278  LYS A O     1 
ATOM   2226 C  CB    . LYS A 1 284 ? -19.214 -3.529  34.725  1.00   71.02 ? 278  LYS A CB    1 
ATOM   2227 C  CG    . LYS A 1 284 ? -18.764 -2.058  34.804  1.00   72.16 ? 278  LYS A CG    1 
ATOM   2228 C  CD    . LYS A 1 284 ? -17.765 -1.820  35.948  1.00   74.54 ? 278  LYS A CD    1 
ATOM   2229 C  CE    . LYS A 1 284 ? -17.511 -0.330  36.207  1.00   75.80 ? 278  LYS A CE    1 
ATOM   2230 N  NZ    . LYS A 1 284 ? -17.072 0.420   34.992  1.00   76.93 ? 278  LYS A NZ    1 
ATOM   2231 N  N     . ARG A 1 285 ? -19.086 -6.573  33.755  1.00   67.32 ? 279  ARG A N     1 
ATOM   2232 C  CA    . ARG A 1 285 ? -19.594 -7.949  33.818  1.00   64.57 ? 279  ARG A CA    1 
ATOM   2233 C  C     . ARG A 1 285 ? -18.593 -8.821  34.546  1.00   62.53 ? 279  ARG A C     1 
ATOM   2234 O  O     . ARG A 1 285 ? -17.383 -8.684  34.355  1.00   62.13 ? 279  ARG A O     1 
ATOM   2235 C  CB    . ARG A 1 285 ? -19.810 -8.526  32.427  1.00   64.27 ? 279  ARG A CB    1 
ATOM   2236 C  CG    . ARG A 1 285 ? -21.207 -8.358  31.911  1.00   65.09 ? 279  ARG A CG    1 
ATOM   2237 C  CD    . ARG A 1 285 ? -21.312 -9.000  30.557  1.00   65.55 ? 279  ARG A CD    1 
ATOM   2238 N  NE    . ARG A 1 285 ? -20.214 -8.562  29.711  1.00   66.33 ? 279  ARG A NE    1 
ATOM   2239 C  CZ    . ARG A 1 285 ? -20.122 -8.820  28.412  1.00   67.68 ? 279  ARG A CZ    1 
ATOM   2240 N  NH1   . ARG A 1 285 ? -21.065 -9.523  27.791  1.00   68.46 ? 279  ARG A NH1   1 
ATOM   2241 N  NH2   . ARG A 1 285 ? -19.084 -8.365  27.728  1.00   68.88 ? 279  ARG A NH2   1 
ATOM   2242 N  N     . ILE A 1 286 ? -19.090 -9.728  35.375  1.00   60.26 ? 280  ILE A N     1 
ATOM   2243 C  CA    . ILE A 1 286 ? -18.189 -10.585 36.133  1.00   57.80 ? 280  ILE A CA    1 
ATOM   2244 C  C     . ILE A 1 286 ? -18.234 -12.020 35.654  1.00   56.02 ? 280  ILE A C     1 
ATOM   2245 O  O     . ILE A 1 286 ? -19.300 -12.629 35.626  1.00   58.27 ? 280  ILE A O     1 
ATOM   2246 C  CB    . ILE A 1 286 ? -18.512 -10.534 37.655  1.00   56.62 ? 280  ILE A CB    1 
ATOM   2247 C  CG1   . ILE A 1 286 ? -18.359 -9.107  38.157  1.00   56.27 ? 280  ILE A CG1   1 
ATOM   2248 C  CG2   . ILE A 1 286 ? -17.532 -11.387 38.450  1.00   55.18 ? 280  ILE A CG2   1 
ATOM   2249 C  CD1   . ILE A 1 286 ? -16.963 -8.579  37.974  1.00   55.81 ? 280  ILE A CD1   1 
ATOM   2250 N  N     . PRO A 1 287 ? -17.076 -12.569 35.244  1.00   53.61 ? 281  PRO A N     1 
ATOM   2251 C  CA    . PRO A 1 287 ? -16.973 -13.950 34.759  1.00   51.97 ? 281  PRO A CA    1 
ATOM   2252 C  C     . PRO A 1 287 ? -16.550 -14.913 35.882  1.00   50.99 ? 281  PRO A C     1 
ATOM   2253 O  O     . PRO A 1 287 ? -15.756 -14.542 36.744  1.00   52.07 ? 281  PRO A O     1 
ATOM   2254 C  CB    . PRO A 1 287 ? -15.934 -13.830 33.656  1.00   50.96 ? 281  PRO A CB    1 
ATOM   2255 C  CG    . PRO A 1 287 ? -14.991 -12.843 34.242  1.00   52.18 ? 281  PRO A CG    1 
ATOM   2256 C  CD    . PRO A 1 287 ? -15.900 -11.787 34.821  1.00   52.24 ? 281  PRO A CD    1 
ATOM   2257 N  N     . LYS A 1 288 ? -17.093 -16.133 35.877  1.00   48.72 ? 282  LYS A N     1 
ATOM   2258 C  CA    . LYS A 1 288 ? -16.773 -17.142 36.894  1.00   47.73 ? 282  LYS A CA    1 
ATOM   2259 C  C     . LYS A 1 288 ? -16.007 -18.295 36.272  1.00   46.04 ? 282  LYS A C     1 
ATOM   2260 O  O     . LYS A 1 288 ? -15.560 -19.202 36.965  1.00   46.76 ? 282  LYS A O     1 
ATOM   2261 C  CB    . LYS A 1 288 ? -18.049 -17.708 37.551  1.00   48.72 ? 282  LYS A CB    1 
ATOM   2262 C  CG    . LYS A 1 288 ? -18.945 -16.662 38.214  1.00   50.19 ? 282  LYS A CG    1 
ATOM   2263 C  CD    . LYS A 1 288 ? -20.014 -17.276 39.107  1.00   50.79 ? 282  LYS A CD    1 
ATOM   2264 C  CE    . LYS A 1 288 ? -20.966 -18.155 38.328  1.00   51.91 ? 282  LYS A CE    1 
ATOM   2265 N  NZ    . LYS A 1 288 ? -22.226 -18.408 39.096  1.00   53.67 ? 282  LYS A NZ    1 
ATOM   2266 N  N     . ALA A 1 289 ? -15.879 -18.269 34.954  1.00   44.46 ? 283  ALA A N     1 
ATOM   2267 C  CA    . ALA A 1 289 ? -15.172 -19.316 34.234  1.00   41.64 ? 283  ALA A CA    1 
ATOM   2268 C  C     . ALA A 1 289 ? -14.178 -18.657 33.284  1.00   41.10 ? 283  ALA A C     1 
ATOM   2269 O  O     . ALA A 1 289 ? -14.463 -17.602 32.708  1.00   38.55 ? 283  ALA A O     1 
ATOM   2270 C  CB    . ALA A 1 289 ? -16.156 -20.171 33.454  1.00   38.82 ? 283  ALA A CB    1 
ATOM   2271 N  N     . ILE A 1 290 ? -13.018 -19.293 33.134  1.00   40.53 ? 284  ILE A N     1 
ATOM   2272 C  CA    . ILE A 1 290 ? -11.949 -18.807 32.276  1.00   39.69 ? 284  ILE A CA    1 
ATOM   2273 C  C     . ILE A 1 290 ? -11.353 -19.941 31.472  1.00   39.65 ? 284  ILE A C     1 
ATOM   2274 O  O     . ILE A 1 290 ? -11.081 -21.019 31.989  1.00   38.64 ? 284  ILE A O     1 
ATOM   2275 C  CB    . ILE A 1 290 ? -10.803 -18.182 33.090  1.00   40.93 ? 284  ILE A CB    1 
ATOM   2276 C  CG1   . ILE A 1 290 ? -9.559  -18.017 32.210  1.00   41.33 ? 284  ILE A CG1   1 
ATOM   2277 C  CG2   . ILE A 1 290 ? -10.450 -19.081 34.269  1.00   40.29 ? 284  ILE A CG2   1 
ATOM   2278 C  CD1   . ILE A 1 290 ? -8.404  -17.313 32.901  1.00   41.12 ? 284  ILE A CD1   1 
ATOM   2279 N  N     . HIS A 1 291 ? -11.156 -19.686 30.192  1.00   39.27 ? 285  HIS A N     1 
ATOM   2280 C  CA    . HIS A 1 291 ? -10.557 -20.659 29.320  1.00   40.13 ? 285  HIS A CA    1 
ATOM   2281 C  C     . HIS A 1 291 ? -9.300  -20.054 28.688  1.00   41.09 ? 285  HIS A C     1 
ATOM   2282 O  O     . HIS A 1 291 ? -9.351  -18.985 28.068  1.00   41.77 ? 285  HIS A O     1 
ATOM   2283 C  CB    . HIS A 1 291 ? -11.528 -21.041 28.206  1.00   41.72 ? 285  HIS A CB    1 
ATOM   2284 C  CG    . HIS A 1 291 ? -12.415 -22.193 28.538  1.00   42.77 ? 285  HIS A CG    1 
ATOM   2285 N  ND1   . HIS A 1 291 ? -13.398 -22.128 29.499  1.00   42.40 ? 285  HIS A ND1   1 
ATOM   2286 C  CD2   . HIS A 1 291 ? -12.461 -23.447 28.034  1.00   43.35 ? 285  HIS A CD2   1 
ATOM   2287 C  CE1   . HIS A 1 291 ? -14.011 -23.295 29.572  1.00   43.69 ? 285  HIS A CE1   1 
ATOM   2288 N  NE2   . HIS A 1 291 ? -13.461 -24.113 28.695  1.00   43.35 ? 285  HIS A NE2   1 
ATOM   2289 N  N     . VAL A 1 292 ? -8.161  -20.700 28.875  1.00   40.04 ? 286  VAL A N     1 
ATOM   2290 C  CA    . VAL A 1 292 ? -6.977  -20.207 28.206  1.00   40.19 ? 286  VAL A CA    1 
ATOM   2291 C  C     . VAL A 1 292 ? -7.003  -21.042 26.932  1.00   41.44 ? 286  VAL A C     1 
ATOM   2292 O  O     . VAL A 1 292 ? -7.044  -22.265 26.983  1.00   41.23 ? 286  VAL A O     1 
ATOM   2293 C  CB    . VAL A 1 292 ? -5.674  -20.474 28.987  1.00   40.26 ? 286  VAL A CB    1 
ATOM   2294 C  CG1   . VAL A 1 292 ? -4.481  -20.387 28.038  1.00   40.77 ? 286  VAL A CG1   1 
ATOM   2295 C  CG2   . VAL A 1 292 ? -5.498  -19.438 30.083  1.00   37.34 ? 286  VAL A CG2   1 
ATOM   2296 N  N     . VAL A 1 293 ? -7.016  -20.363 25.793  1.00   42.75 ? 287  VAL A N     1 
ATOM   2297 C  CA    . VAL A 1 293 ? -7.067  -21.009 24.504  1.00   42.78 ? 287  VAL A CA    1 
ATOM   2298 C  C     . VAL A 1 293 ? -5.759  -20.867 23.743  1.00   45.30 ? 287  VAL A C     1 
ATOM   2299 O  O     . VAL A 1 293 ? -5.063  -19.858 23.843  1.00   46.61 ? 287  VAL A O     1 
ATOM   2300 C  CB    . VAL A 1 293 ? -8.171  -20.408 23.662  1.00   40.85 ? 287  VAL A CB    1 
ATOM   2301 C  CG1   . VAL A 1 293 ? -8.251  -21.135 22.350  1.00   40.10 ? 287  VAL A CG1   1 
ATOM   2302 C  CG2   . VAL A 1 293 ? -9.481  -20.471 24.412  1.00   39.16 ? 287  VAL A CG2   1 
ATOM   2303 N  N     . ALA A 1 294 ? -5.435  -21.885 22.965  1.00   47.53 ? 288  ALA A N     1 
ATOM   2304 C  CA    . ALA A 1 294 ? -4.209  -21.852 22.201  1.00   50.41 ? 288  ALA A CA    1 
ATOM   2305 C  C     . ALA A 1 294 ? -4.341  -22.638 20.911  1.00   51.89 ? 288  ALA A C     1 
ATOM   2306 O  O     . ALA A 1 294 ? -4.732  -23.808 20.921  1.00   52.30 ? 288  ALA A O     1 
ATOM   2307 C  CB    . ALA A 1 294 ? -3.066  -22.411 23.036  1.00   51.42 ? 288  ALA A CB    1 
ATOM   2308 N  N     . VAL A 1 295 ? -4.024  -21.982 19.799  1.00   53.38 ? 289  VAL A N     1 
ATOM   2309 C  CA    . VAL A 1 295 ? -4.067  -22.620 18.496  1.00   53.48 ? 289  VAL A CA    1 
ATOM   2310 C  C     . VAL A 1 295 ? -2.705  -23.261 18.301  1.00   54.89 ? 289  VAL A C     1 
ATOM   2311 O  O     . VAL A 1 295 ? -1.683  -22.618 18.523  1.00   56.01 ? 289  VAL A O     1 
ATOM   2312 C  CB    . VAL A 1 295 ? -4.302  -21.590 17.391  1.00   52.60 ? 289  VAL A CB    1 
ATOM   2313 C  CG1   . VAL A 1 295 ? -4.128  -22.241 16.025  1.00   53.54 ? 289  VAL A CG1   1 
ATOM   2314 C  CG2   . VAL A 1 295 ? -5.685  -21.011 17.526  1.00   50.86 ? 289  VAL A CG2   1 
ATOM   2315 N  N     . THR A 1 296 ? -2.680  -24.525 17.894  1.00   56.95 ? 290  THR A N     1 
ATOM   2316 C  CA    . THR A 1 296 ? -1.412  -25.229 17.696  1.00   59.47 ? 290  THR A CA    1 
ATOM   2317 C  C     . THR A 1 296 ? -0.676  -24.842 16.406  1.00   60.61 ? 290  THR A C     1 
ATOM   2318 O  O     . THR A 1 296 ? -1.208  -24.111 15.569  1.00   60.50 ? 290  THR A O     1 
ATOM   2319 C  CB    . THR A 1 296 ? -1.635  -26.735 17.668  1.00   59.70 ? 290  THR A CB    1 
ATOM   2320 O  OG1   . THR A 1 296 ? -2.457  -27.065 16.543  1.00   61.93 ? 290  THR A OG1   1 
ATOM   2321 C  CG2   . THR A 1 296 ? -2.327  -27.193 18.937  1.00   60.59 ? 290  THR A CG2   1 
ATOM   2322 N  N     . GLU A 1 297 ? 0.550   -25.345 16.258  1.00   61.61 ? 291  GLU A N     1 
ATOM   2323 C  CA    . GLU A 1 297 ? 1.380   -25.086 15.079  1.00   62.16 ? 291  GLU A CA    1 
ATOM   2324 C  C     . GLU A 1 297 ? 0.745   -25.699 13.826  1.00   62.15 ? 291  GLU A C     1 
ATOM   2325 O  O     . GLU A 1 297 ? 1.126   -25.367 12.703  1.00   62.28 ? 291  GLU A O     1 
ATOM   2326 C  CB    . GLU A 1 297 ? 2.779   -25.682 15.288  1.00   62.37 ? 291  GLU A CB    1 
ATOM   2327 C  CG    . GLU A 1 297 ? 3.652   -25.709 14.034  0.50   62.90 ? 291  GLU A CG    1 
ATOM   2328 C  CD    . GLU A 1 297 ? 4.072   -24.330 13.574  0.50   63.12 ? 291  GLU A CD    1 
ATOM   2329 O  OE1   . GLU A 1 297 ? 4.883   -23.697 14.281  0.50   63.67 ? 291  GLU A OE1   1 
ATOM   2330 O  OE2   . GLU A 1 297 ? 3.591   -23.882 12.509  0.50   63.25 ? 291  GLU A OE2   1 
ATOM   2331 N  N     . ASP A 1 298 ? -0.213  -26.602 14.034  1.00   62.27 ? 292  ASP A N     1 
ATOM   2332 C  CA    . ASP A 1 298 ? -0.917  -27.266 12.938  1.00   62.14 ? 292  ASP A CA    1 
ATOM   2333 C  C     . ASP A 1 298 ? -2.401  -26.893 12.919  1.00   63.46 ? 292  ASP A C     1 
ATOM   2334 O  O     . ASP A 1 298 ? -3.243  -27.658 12.447  1.00   63.88 ? 292  ASP A O     1 
ATOM   2335 C  CB    . ASP A 1 298 ? -0.760  -28.788 13.041  1.00   60.87 ? 292  ASP A CB    1 
ATOM   2336 C  CG    . ASP A 1 298 ? -1.453  -29.372 14.253  1.00   60.30 ? 292  ASP A CG    1 
ATOM   2337 O  OD1   . ASP A 1 298 ? -1.361  -28.777 15.342  1.00   60.86 ? 292  ASP A OD1   1 
ATOM   2338 O  OD2   . ASP A 1 298 ? -2.076  -30.444 14.122  1.00   59.85 ? 292  ASP A OD2   1 
ATOM   2339 N  N     . LEU A 1 299 ? -2.710  -25.719 13.459  1.00   63.51 ? 293  LEU A N     1 
ATOM   2340 C  CA    . LEU A 1 299 ? -4.069  -25.184 13.489  1.00   63.71 ? 293  LEU A CA    1 
ATOM   2341 C  C     . LEU A 1 299 ? -5.151  -25.955 14.258  1.00   63.43 ? 293  LEU A C     1 
ATOM   2342 O  O     . LEU A 1 299 ? -6.332  -25.878 13.908  1.00   64.44 ? 293  LEU A O     1 
ATOM   2343 C  CB    . LEU A 1 299 ? -4.540  -24.917 12.050  1.00   63.70 ? 293  LEU A CB    1 
ATOM   2344 C  CG    . LEU A 1 299 ? -3.873  -23.764 11.280  1.00   63.28 ? 293  LEU A CG    1 
ATOM   2345 C  CD1   . LEU A 1 299 ? -4.465  -22.439 11.702  1.00   62.24 ? 293  LEU A CD1   1 
ATOM   2346 C  CD2   . LEU A 1 299 ? -2.375  -23.774 11.516  1.00   64.07 ? 293  LEU A CD2   1 
ATOM   2347 N  N     . ASP A 1 300 ? -4.764  -26.685 15.304  1.00   62.99 ? 294  ASP A N     1 
ATOM   2348 C  CA    . ASP A 1 300 ? -5.740  -27.414 16.122  1.00   61.66 ? 294  ASP A CA    1 
ATOM   2349 C  C     . ASP A 1 300 ? -5.992  -26.595 17.388  1.00   61.91 ? 294  ASP A C     1 
ATOM   2350 O  O     . ASP A 1 300 ? -5.049  -26.210 18.083  1.00   60.49 ? 294  ASP A O     1 
ATOM   2351 C  CB    . ASP A 1 300 ? -5.228  -28.816 16.497  1.00   60.29 ? 294  ASP A CB    1 
ATOM   2352 C  CG    . ASP A 1 300 ? -6.350  -29.747 16.993  1.00   60.81 ? 294  ASP A CG    1 
ATOM   2353 O  OD1   . ASP A 1 300 ? -7.537  -29.478 16.697  1.00   57.97 ? 294  ASP A OD1   1 
ATOM   2354 O  OD2   . ASP A 1 300 ? -6.046  -30.760 17.670  1.00   61.52 ? 294  ASP A OD2   1 
ATOM   2355 N  N     . ILE A 1 301 ? -7.268  -26.323 17.662  1.00   61.05 ? 295  ILE A N     1 
ATOM   2356 C  CA    . ILE A 1 301 ? -7.679  -25.552 18.826  1.00   60.18 ? 295  ILE A CA    1 
ATOM   2357 C  C     . ILE A 1 301 ? -7.690  -26.372 20.125  1.00   60.60 ? 295  ILE A C     1 
ATOM   2358 O  O     . ILE A 1 301 ? -8.607  -27.176 20.359  1.00   59.96 ? 295  ILE A O     1 
ATOM   2359 C  CB    . ILE A 1 301 ? -9.091  -24.953 18.593  1.00   60.51 ? 295  ILE A CB    1 
ATOM   2360 C  CG1   . ILE A 1 301 ? -9.602  -24.264 19.857  1.00   60.24 ? 295  ILE A CG1   1 
ATOM   2361 C  CG2   . ILE A 1 301 ? -10.063 -26.055 18.173  1.00   61.37 ? 295  ILE A CG2   1 
ATOM   2362 C  CD1   . ILE A 1 301 ? -11.095 -23.942 19.812  1.00   58.24 ? 295  ILE A CD1   1 
ATOM   2363 N  N     . VAL A 1 302 ? -6.664  -26.178 20.958  1.00   59.91 ? 296  VAL A N     1 
ATOM   2364 C  CA    . VAL A 1 302 ? -6.585  -26.860 22.257  1.00   58.57 ? 296  VAL A CA    1 
ATOM   2365 C  C     . VAL A 1 302 ? -6.804  -25.813 23.344  1.00   57.18 ? 296  VAL A C     1 
ATOM   2366 O  O     . VAL A 1 302 ? -6.206  -24.740 23.309  1.00   57.18 ? 296  VAL A O     1 
ATOM   2367 C  CB    . VAL A 1 302 ? -5.203  -27.518 22.508  1.00   59.10 ? 296  VAL A CB    1 
ATOM   2368 C  CG1   . VAL A 1 302 ? -4.128  -26.457 22.589  1.00   59.94 ? 296  VAL A CG1   1 
ATOM   2369 C  CG2   . VAL A 1 302 ? -5.227  -28.306 23.803  1.00   57.11 ? 296  VAL A CG2   1 
ATOM   2370 N  N     . SER A 1 303 ? -7.675  -26.103 24.299  1.00   56.23 ? 297  SER A N     1 
ATOM   2371 C  CA    . SER A 1 303 ? -7.917  -25.149 25.372  1.00   56.22 ? 297  SER A CA    1 
ATOM   2372 C  C     . SER A 1 303 ? -8.221  -25.852 26.683  1.00   55.99 ? 297  SER A C     1 
ATOM   2373 O  O     . SER A 1 303 ? -8.710  -26.979 26.701  1.00   55.51 ? 297  SER A O     1 
ATOM   2374 C  CB    . SER A 1 303 ? -9.057  -24.202 25.006  1.00   56.14 ? 297  SER A CB    1 
ATOM   2375 O  OG    . SER A 1 303 ? -10.243 -24.917 24.739  1.00   60.01 ? 297  SER A OG    1 
ATOM   2376 N  N     . ARG A 1 304 ? -7.902  -25.176 27.781  1.00   56.00 ? 298  ARG A N     1 
ATOM   2377 C  CA    . ARG A 1 304 ? -8.109  -25.704 29.122  1.00   55.94 ? 298  ARG A CA    1 
ATOM   2378 C  C     . ARG A 1 304 ? -8.677  -24.585 29.950  1.00   55.62 ? 298  ARG A C     1 
ATOM   2379 O  O     . ARG A 1 304 ? -8.112  -23.502 29.999  1.00   56.31 ? 298  ARG A O     1 
ATOM   2380 C  CB    . ARG A 1 304 ? -6.784  -26.142 29.739  1.00   57.81 ? 298  ARG A CB    1 
ATOM   2381 C  CG    . ARG A 1 304 ? -6.167  -27.394 29.122  1.00   61.64 ? 298  ARG A CG    1 
ATOM   2382 C  CD    . ARG A 1 304 ? -6.827  -28.661 29.652  1.00   64.20 ? 298  ARG A CD    1 
ATOM   2383 N  NE    . ARG A 1 304 ? -6.311  -29.849 28.976  1.00   67.31 ? 298  ARG A NE    1 
ATOM   2384 C  CZ    . ARG A 1 304 ? -6.618  -30.193 27.728  1.00   68.43 ? 298  ARG A CZ    1 
ATOM   2385 N  NH1   . ARG A 1 304 ? -7.452  -29.441 27.015  1.00   69.78 ? 298  ARG A NH1   1 
ATOM   2386 N  NH2   . ARG A 1 304 ? -6.077  -31.280 27.187  1.00   69.13 ? 298  ARG A NH2   1 
ATOM   2387 N  N     . GLY A 1 305 ? -9.802  -24.842 30.600  1.00   55.58 ? 299  GLY A N     1 
ATOM   2388 C  CA    . GLY A 1 305 ? -10.414 -23.809 31.412  1.00   55.04 ? 299  GLY A CA    1 
ATOM   2389 C  C     . GLY A 1 305 ? -10.648 -24.220 32.846  1.00   53.68 ? 299  GLY A C     1 
ATOM   2390 O  O     . GLY A 1 305 ? -10.257 -25.299 33.271  1.00   53.66 ? 299  GLY A O     1 
ATOM   2391 N  N     . ARG A 1 306 ? -11.286 -23.336 33.596  1.00   52.87 ? 300  ARG A N     1 
ATOM   2392 C  CA    . ARG A 1 306 ? -11.606 -23.597 34.985  1.00   52.74 ? 300  ARG A CA    1 
ATOM   2393 C  C     . ARG A 1 306 ? -12.764 -22.724 35.418  1.00   50.86 ? 300  ARG A C     1 
ATOM   2394 O  O     . ARG A 1 306 ? -12.796 -21.542 35.101  1.00   50.85 ? 300  ARG A O     1 
ATOM   2395 C  CB    . ARG A 1 306 ? -10.400 -23.322 35.885  1.00   55.45 ? 300  ARG A CB    1 
ATOM   2396 C  CG    . ARG A 1 306 ? -10.732 -23.399 37.369  1.00   59.74 ? 300  ARG A CG    1 
ATOM   2397 C  CD    . ARG A 1 306 ? -9.477  -23.396 38.223  1.00   65.29 ? 300  ARG A CD    1 
ATOM   2398 N  NE    . ARG A 1 306 ? -9.777  -23.436 39.655  1.00   68.53 ? 300  ARG A NE    1 
ATOM   2399 C  CZ    . ARG A 1 306 ? -8.863  -23.633 40.602  1.00   70.33 ? 300  ARG A CZ    1 
ATOM   2400 N  NH1   . ARG A 1 306 ? -7.586  -23.811 40.273  1.00   71.88 ? 300  ARG A NH1   1 
ATOM   2401 N  NH2   . ARG A 1 306 ? -9.225  -23.647 41.880  1.00   71.35 ? 300  ARG A NH2   1 
ATOM   2402 N  N     . THR A 1 307 ? -13.712 -23.311 36.140  1.00   48.43 ? 301  THR A N     1 
ATOM   2403 C  CA    . THR A 1 307 ? -14.861 -22.578 36.641  1.00   46.89 ? 301  THR A CA    1 
ATOM   2404 C  C     . THR A 1 307 ? -14.764 -22.415 38.159  1.00   47.83 ? 301  THR A C     1 
ATOM   2405 O  O     . THR A 1 307 ? -14.500 -23.376 38.874  1.00   48.41 ? 301  THR A O     1 
ATOM   2406 C  CB    . THR A 1 307 ? -16.148 -23.319 36.315  1.00   45.15 ? 301  THR A CB    1 
ATOM   2407 O  OG1   . THR A 1 307 ? -16.316 -23.354 34.895  1.00   45.70 ? 301  THR A OG1   1 
ATOM   2408 C  CG2   . THR A 1 307 ? -17.339 -22.646 36.971  1.00   42.35 ? 301  THR A CG2   1 
ATOM   2409 N  N     . PHE A 1 308 ? -14.986 -21.199 38.647  1.00   47.26 ? 302  PHE A N     1 
ATOM   2410 C  CA    . PHE A 1 308 ? -14.919 -20.925 40.074  1.00   48.07 ? 302  PHE A CA    1 
ATOM   2411 C  C     . PHE A 1 308 ? -16.330 -20.690 40.570  1.00   49.15 ? 302  PHE A C     1 
ATOM   2412 O  O     . PHE A 1 308 ? -17.246 -20.484 39.770  1.00   48.60 ? 302  PHE A O     1 
ATOM   2413 C  CB    . PHE A 1 308 ? -14.086 -19.663 40.361  1.00   49.07 ? 302  PHE A CB    1 
ATOM   2414 C  CG    . PHE A 1 308 ? -12.634 -19.761 39.941  1.00   49.53 ? 302  PHE A CG    1 
ATOM   2415 C  CD1   . PHE A 1 308 ? -12.281 -20.164 38.664  1.00   49.57 ? 302  PHE A CD1   1 
ATOM   2416 C  CD2   . PHE A 1 308 ? -11.623 -19.400 40.817  1.00   48.95 ? 302  PHE A CD2   1 
ATOM   2417 C  CE1   . PHE A 1 308 ? -10.958 -20.203 38.273  1.00   49.13 ? 302  PHE A CE1   1 
ATOM   2418 C  CE2   . PHE A 1 308 ? -10.301 -19.436 40.428  1.00   47.97 ? 302  PHE A CE2   1 
ATOM   2419 C  CZ    . PHE A 1 308 ? -9.969  -19.840 39.152  1.00   48.77 ? 302  PHE A CZ    1 
ATOM   2420 N  N     . PRO A 1 309 ? -16.525 -20.746 41.901  1.00   49.28 ? 303  PRO A N     1 
ATOM   2421 C  CA    . PRO A 1 309 ? -17.818 -20.535 42.560  1.00   49.34 ? 303  PRO A CA    1 
ATOM   2422 C  C     . PRO A 1 309 ? -18.067 -19.057 42.783  1.00   49.99 ? 303  PRO A C     1 
ATOM   2423 O  O     . PRO A 1 309 ? -18.992 -18.678 43.510  1.00   51.12 ? 303  PRO A O     1 
ATOM   2424 C  CB    . PRO A 1 309 ? -17.651 -21.257 43.877  1.00   48.86 ? 303  PRO A CB    1 
ATOM   2425 C  CG    . PRO A 1 309 ? -16.212 -21.000 44.175  1.00   49.61 ? 303  PRO A CG    1 
ATOM   2426 C  CD    . PRO A 1 309 ? -15.559 -21.320 42.855  1.00   47.67 ? 303  PRO A CD    1 
ATOM   2427 N  N     . HIS A 1 310 ? -17.224 -18.231 42.165  1.00   49.11 ? 304  HIS A N     1 
ATOM   2428 C  CA    . HIS A 1 310 ? -17.331 -16.778 42.278  1.00   47.77 ? 304  HIS A CA    1 
ATOM   2429 C  C     . HIS A 1 310 ? -16.765 -16.094 41.030  1.00   47.56 ? 304  HIS A C     1 
ATOM   2430 O  O     . HIS A 1 310 ? -16.248 -16.752 40.117  1.00   48.02 ? 304  HIS A O     1 
ATOM   2431 C  CB    . HIS A 1 310 ? -16.559 -16.298 43.502  1.00   45.14 ? 304  HIS A CB    1 
ATOM   2432 C  CG    . HIS A 1 310 ? -15.174 -16.848 43.569  1.00   44.38 ? 304  HIS A CG    1 
ATOM   2433 N  ND1   . HIS A 1 310 ? -14.216 -16.562 42.621  1.00   45.30 ? 304  HIS A ND1   1 
ATOM   2434 C  CD2   . HIS A 1 310 ? -14.605 -17.726 44.427  1.00   44.40 ? 304  HIS A CD2   1 
ATOM   2435 C  CE1   . HIS A 1 310 ? -13.115 -17.242 42.893  1.00   44.09 ? 304  HIS A CE1   1 
ATOM   2436 N  NE2   . HIS A 1 310 ? -13.324 -17.957 43.983  1.00   43.62 ? 304  HIS A NE2   1 
ATOM   2437 N  N     . GLY A 1 311 ? -16.884 -14.770 41.001  1.00   46.77 ? 305  GLY A N     1 
ATOM   2438 C  CA    . GLY A 1 311 ? -16.368 -13.999 39.891  1.00   45.89 ? 305  GLY A CA    1 
ATOM   2439 C  C     . GLY A 1 311 ? -14.850 -14.029 39.919  1.00   46.51 ? 305  GLY A C     1 
ATOM   2440 O  O     . GLY A 1 311 ? -14.226 -14.219 40.975  1.00   42.62 ? 305  GLY A O     1 
ATOM   2441 N  N     . ILE A 1 312 ? -14.255 -13.840 38.744  1.00   46.87 ? 306  ILE A N     1 
ATOM   2442 C  CA    . ILE A 1 312 ? -12.807 -13.858 38.590  1.00   46.52 ? 306  ILE A CA    1 
ATOM   2443 C  C     . ILE A 1 312 ? -12.205 -12.456 38.494  1.00   46.60 ? 306  ILE A C     1 
ATOM   2444 O  O     . ILE A 1 312 ? -12.389 -11.775 37.509  1.00   47.40 ? 306  ILE A O     1 
ATOM   2445 C  CB    . ILE A 1 312 ? -12.437 -14.632 37.331  1.00   46.13 ? 306  ILE A CB    1 
ATOM   2446 C  CG1   . ILE A 1 312 ? -13.077 -16.012 37.389  1.00   43.80 ? 306  ILE A CG1   1 
ATOM   2447 C  CG2   . ILE A 1 312 ? -10.926 -14.704 37.189  1.00   47.55 ? 306  ILE A CG2   1 
ATOM   2448 C  CD1   . ILE A 1 312 ? -13.191 -16.684 36.071  1.00   45.70 ? 306  ILE A CD1   1 
ATOM   2449 N  N     . SER A 1 313 ? -11.504 -12.021 39.531  1.00   46.86 ? 307  SER A N     1 
ATOM   2450 C  CA    . SER A 1 313 ? -10.868 -10.715 39.511  1.00   46.00 ? 307  SER A CA    1 
ATOM   2451 C  C     . SER A 1 313 ? -9.759  -10.827 38.470  1.00   46.41 ? 307  SER A C     1 
ATOM   2452 O  O     . SER A 1 313 ? -9.172  -11.897 38.289  1.00   48.33 ? 307  SER A O     1 
ATOM   2453 C  CB    . SER A 1 313 ? -10.227 -10.430 40.853  1.00   45.49 ? 307  SER A CB    1 
ATOM   2454 O  OG    . SER A 1 313 ? -9.096  -11.267 40.993  1.00   45.68 ? 307  SER A OG    1 
ATOM   2455 N  N     . LYS A 1 314 ? -9.464  -9.727  37.795  1.00   45.66 ? 308  LYS A N     1 
ATOM   2456 C  CA    . LYS A 1 314 ? -8.426  -9.729  36.768  1.00   43.70 ? 308  LYS A CA    1 
ATOM   2457 C  C     . LYS A 1 314 ? -7.112  -10.223 37.349  1.00   41.74 ? 308  LYS A C     1 
ATOM   2458 O  O     . LYS A 1 314 ? -6.382  -10.980 36.726  1.00   41.01 ? 308  LYS A O     1 
ATOM   2459 C  CB    . LYS A 1 314 ? -8.252  -8.316  36.210  1.00   44.09 ? 308  LYS A CB    1 
ATOM   2460 C  CG    . LYS A 1 314 ? -7.189  -8.185  35.151  1.00   43.94 ? 308  LYS A CG    1 
ATOM   2461 C  CD    . LYS A 1 314 ? -6.889  -6.715  34.874  1.00   45.16 ? 308  LYS A CD    1 
ATOM   2462 C  CE    . LYS A 1 314 ? -8.060  -5.990  34.238  1.00   45.45 ? 308  LYS A CE    1 
ATOM   2463 N  NZ    . LYS A 1 314 ? -7.756  -4.528  34.122  1.00   48.01 ? 308  LYS A NZ    1 
ATOM   2464 N  N     A GLU A 1 315 ? -6.810  -9.786  38.562  0.50   41.32 ? 309  GLU A N     1 
ATOM   2465 N  N     B GLU A 1 315 ? -6.816  -9.780  38.560  0.25   40.93 ? 309  GLU A N     1 
ATOM   2466 C  CA    A GLU A 1 315 ? -5.573  -10.200 39.194  0.50   40.30 ? 309  GLU A CA    1 
ATOM   2467 C  CA    B GLU A 1 315 ? -5.588  -10.185 39.212  0.25   39.74 ? 309  GLU A CA    1 
ATOM   2468 C  C     A GLU A 1 315 ? -5.512  -11.718 39.215  0.50   39.84 ? 309  GLU A C     1 
ATOM   2469 C  C     B GLU A 1 315 ? -5.513  -11.707 39.276  0.25   39.68 ? 309  GLU A C     1 
ATOM   2470 O  O     A GLU A 1 315 ? -4.441  -12.308 39.043  0.50   38.63 ? 309  GLU A O     1 
ATOM   2471 O  O     B GLU A 1 315 ? -4.431  -12.290 39.193  0.25   39.14 ? 309  GLU A O     1 
ATOM   2472 C  CB    A GLU A 1 315 ? -5.494  -9.661  40.623  0.50   39.90 ? 309  GLU A CB    1 
ATOM   2473 C  CB    B GLU A 1 315 ? -5.516  -9.573  40.618  0.25   38.40 ? 309  GLU A CB    1 
ATOM   2474 C  CG    A GLU A 1 315 ? -5.467  -8.146  40.739  0.50   38.93 ? 309  GLU A CG    1 
ATOM   2475 C  CG    B GLU A 1 315 ? -4.349  -10.071 41.427  0.25   36.53 ? 309  GLU A CG    1 
ATOM   2476 C  CD    A GLU A 1 315 ? -6.765  -7.486  40.313  0.50   40.45 ? 309  GLU A CD    1 
ATOM   2477 C  CD    B GLU A 1 315 ? -3.097  -10.072 40.608  0.25   35.15 ? 309  GLU A CD    1 
ATOM   2478 O  OE1   A GLU A 1 315 ? -7.841  -8.102  40.468  0.50   40.19 ? 309  GLU A OE1   1 
ATOM   2479 O  OE1   B GLU A 1 315 ? -2.641  -8.968  40.300  0.25   34.31 ? 309  GLU A OE1   1 
ATOM   2480 O  OE2   A GLU A 1 315 ? -6.714  -6.335  39.835  0.50   41.63 ? 309  GLU A OE2   1 
ATOM   2481 O  OE2   B GLU A 1 315 ? -2.568  -11.148 40.249  0.25   33.87 ? 309  GLU A OE2   1 
ATOM   2482 N  N     . THR A 1 316 ? -6.674  -12.341 39.410  1.00   39.52 ? 310  THR A N     1 
ATOM   2483 C  CA    . THR A 1 316 ? -6.769  -13.796 39.477  1.00   40.24 ? 310  THR A CA    1 
ATOM   2484 C  C     . THR A 1 316 ? -6.619  -14.410 38.093  1.00   40.12 ? 310  THR A C     1 
ATOM   2485 O  O     . THR A 1 316 ? -6.059  -15.503 37.939  1.00   40.83 ? 310  THR A O     1 
ATOM   2486 C  CB    . THR A 1 316 ? -8.116  -14.234 40.076  1.00   40.75 ? 310  THR A CB    1 
ATOM   2487 O  OG1   . THR A 1 316 ? -8.199  -13.793 41.436  1.00   40.89 ? 310  THR A OG1   1 
ATOM   2488 C  CG2   . THR A 1 316 ? -8.255  -15.751 40.044  1.00   40.51 ? 310  THR A CG2   1 
ATOM   2489 N  N     . ALA A 1 317 ? -7.116  -13.696 37.087  1.00   38.76 ? 311  ALA A N     1 
ATOM   2490 C  CA    . ALA A 1 317 ? -7.017  -14.155 35.707  1.00   37.21 ? 311  ALA A CA    1 
ATOM   2491 C  C     . ALA A 1 317 ? -5.550  -14.367 35.398  1.00   38.12 ? 311  ALA A C     1 
ATOM   2492 O  O     . ALA A 1 317 ? -5.137  -15.441 35.002  1.00   37.44 ? 311  ALA A O     1 
ATOM   2493 C  CB    . ALA A 1 317 ? -7.597  -13.123 34.769  1.00   34.97 ? 311  ALA A CB    1 
ATOM   2494 N  N     . TYR A 1 318 ? -4.755  -13.332 35.595  1.00   40.70 ? 312  TYR A N     1 
ATOM   2495 C  CA    . TYR A 1 318 ? -3.338  -13.448 35.331  1.00   44.05 ? 312  TYR A CA    1 
ATOM   2496 C  C     . TYR A 1 318 ? -2.811  -14.709 35.974  1.00   44.79 ? 312  TYR A C     1 
ATOM   2497 O  O     . TYR A 1 318 ? -2.180  -15.533 35.323  1.00   44.53 ? 312  TYR A O     1 
ATOM   2498 C  CB    . TYR A 1 318 ? -2.604  -12.234 35.890  1.00   46.94 ? 312  TYR A CB    1 
ATOM   2499 C  CG    . TYR A 1 318 ? -2.609  -11.046 34.966  1.00   47.99 ? 312  TYR A CG    1 
ATOM   2500 C  CD1   . TYR A 1 318 ? -1.481  -10.714 34.231  1.00   49.53 ? 312  TYR A CD1   1 
ATOM   2501 C  CD2   . TYR A 1 318 ? -3.735  -10.249 34.836  1.00   50.35 ? 312  TYR A CD2   1 
ATOM   2502 C  CE1   . TYR A 1 318 ? -1.464  -9.605  33.391  1.00   50.33 ? 312  TYR A CE1   1 
ATOM   2503 C  CE2   . TYR A 1 318 ? -3.740  -9.137  33.993  1.00   51.13 ? 312  TYR A CE2   1 
ATOM   2504 C  CZ    . TYR A 1 318 ? -2.597  -8.818  33.280  1.00   51.62 ? 312  TYR A CZ    1 
ATOM   2505 O  OH    . TYR A 1 318 ? -2.575  -7.691  32.494  1.00   53.43 ? 312  TYR A OH    1 
ATOM   2506 N  N     . SER A 1 319 ? -3.112  -14.860 37.258  1.00   47.38 ? 313  SER A N     1 
ATOM   2507 C  CA    . SER A 1 319 ? -2.672  -16.000 38.056  1.00   48.36 ? 313  SER A CA    1 
ATOM   2508 C  C     . SER A 1 319 ? -3.091  -17.373 37.528  1.00   48.64 ? 313  SER A C     1 
ATOM   2509 O  O     . SER A 1 319 ? -2.251  -18.269 37.363  1.00   48.85 ? 313  SER A O     1 
ATOM   2510 C  CB    . SER A 1 319 ? -3.175  -15.822 39.488  1.00   48.94 ? 313  SER A CB    1 
ATOM   2511 O  OG    . SER A 1 319 ? -2.766  -16.892 40.317  1.00   53.05 ? 313  SER A OG    1 
ATOM   2512 N  N     . GLU A 1 320 ? -4.384  -17.536 37.265  1.00   48.35 ? 314  GLU A N     1 
ATOM   2513 C  CA    . GLU A 1 320 ? -4.922  -18.800 36.769  1.00   49.89 ? 314  GLU A CA    1 
ATOM   2514 C  C     . GLU A 1 320 ? -4.599  -19.075 35.288  1.00   50.81 ? 314  GLU A C     1 
ATOM   2515 O  O     . GLU A 1 320 ? -4.313  -20.207 34.899  1.00   50.71 ? 314  GLU A O     1 
ATOM   2516 C  CB    . GLU A 1 320 ? -6.431  -18.803 36.982  1.00   51.44 ? 314  GLU A CB    1 
ATOM   2517 C  CG    . GLU A 1 320 ? -7.106  -20.154 36.855  1.00   54.49 ? 314  GLU A CG    1 
ATOM   2518 C  CD    . GLU A 1 320 ? -6.508  -21.219 37.766  1.00   57.88 ? 314  GLU A CD    1 
ATOM   2519 O  OE1   . GLU A 1 320 ? -6.026  -20.886 38.876  1.00   58.22 ? 314  GLU A OE1   1 
ATOM   2520 O  OE2   . GLU A 1 320 ? -6.535  -22.404 37.370  1.00   60.53 ? 314  GLU A OE2   1 
ATOM   2521 N  N     . SER A 1 321 ? -4.649  -18.037 34.462  1.00   51.21 ? 315  SER A N     1 
ATOM   2522 C  CA    . SER A 1 321 ? -4.365  -18.167 33.038  1.00   51.47 ? 315  SER A CA    1 
ATOM   2523 C  C     . SER A 1 321 ? -3.048  -18.839 32.819  1.00   51.70 ? 315  SER A C     1 
ATOM   2524 O  O     . SER A 1 321 ? -2.839  -19.517 31.822  1.00   52.54 ? 315  SER A O     1 
ATOM   2525 C  CB    . SER A 1 321 ? -4.300  -16.798 32.386  1.00   52.22 ? 315  SER A CB    1 
ATOM   2526 O  OG    . SER A 1 321 ? -5.473  -16.070 32.681  1.00   56.58 ? 315  SER A OG    1 
ATOM   2527 N  N     . VAL A 1 322 ? -2.138  -18.631 33.751  1.00   52.75 ? 316  VAL A N     1 
ATOM   2528 C  CA    . VAL A 1 322 ? -0.826  -19.222 33.612  1.00   53.35 ? 316  VAL A CA    1 
ATOM   2529 C  C     . VAL A 1 322 ? -0.920  -20.709 33.872  1.00   53.45 ? 316  VAL A C     1 
ATOM   2530 O  O     . VAL A 1 322 ? -0.444  -21.514 33.077  1.00   54.62 ? 316  VAL A O     1 
ATOM   2531 C  CB    . VAL A 1 322 ? 0.183   -18.592 34.597  1.00   53.52 ? 316  VAL A CB    1 
ATOM   2532 C  CG1   . VAL A 1 322 ? 1.561   -19.205 34.402  1.00   51.23 ? 316  VAL A CG1   1 
ATOM   2533 C  CG2   . VAL A 1 322 ? 0.227   -17.089 34.393  1.00   53.02 ? 316  VAL A CG2   1 
ATOM   2534 N  N     . LYS A 1 323 ? -1.535  -21.073 34.989  1.00   52.97 ? 317  LYS A N     1 
ATOM   2535 C  CA    . LYS A 1 323 ? -1.679  -22.473 35.340  1.00   52.58 ? 317  LYS A CA    1 
ATOM   2536 C  C     . LYS A 1 323 ? -2.303  -23.245 34.172  1.00   53.82 ? 317  LYS A C     1 
ATOM   2537 O  O     . LYS A 1 323 ? -1.757  -24.260 33.717  1.00   53.74 ? 317  LYS A O     1 
ATOM   2538 C  CB    . LYS A 1 323 ? -2.554  -22.605 36.579  1.00   53.27 ? 317  LYS A CB    1 
ATOM   2539 C  CG    . LYS A 1 323 ? -2.160  -21.693 37.735  1.00   53.73 ? 317  LYS A CG    1 
ATOM   2540 C  CD    . LYS A 1 323 ? -2.934  -22.067 38.989  1.00   54.59 ? 317  LYS A CD    1 
ATOM   2541 C  CE    . LYS A 1 323 ? -2.544  -21.204 40.178  1.00   56.75 ? 317  LYS A CE    1 
ATOM   2542 N  NZ    . LYS A 1 323 ? -3.111  -21.745 41.449  1.00   58.72 ? 317  LYS A NZ    1 
ATOM   2543 N  N     . LEU A 1 324 ? -3.436  -22.755 33.676  1.00   53.46 ? 318  LEU A N     1 
ATOM   2544 C  CA    . LEU A 1 324 ? -4.115  -23.416 32.576  1.00   53.08 ? 318  LEU A CA    1 
ATOM   2545 C  C     . LEU A 1 324 ? -3.178  -23.552 31.392  1.00   54.35 ? 318  LEU A C     1 
ATOM   2546 O  O     . LEU A 1 324 ? -3.208  -24.546 30.675  1.00   53.91 ? 318  LEU A O     1 
ATOM   2547 C  CB    . LEU A 1 324 ? -5.362  -22.629 32.179  1.00   52.44 ? 318  LEU A CB    1 
ATOM   2548 C  CG    . LEU A 1 324 ? -6.474  -22.529 33.229  1.00   52.68 ? 318  LEU A CG    1 
ATOM   2549 C  CD1   . LEU A 1 324 ? -7.700  -21.868 32.611  1.00   51.87 ? 318  LEU A CD1   1 
ATOM   2550 C  CD2   . LEU A 1 324 ? -6.829  -23.917 33.740  1.00   53.64 ? 318  LEU A CD2   1 
ATOM   2551 N  N     . LEU A 1 325 ? -2.340  -22.547 31.185  1.00   55.93 ? 319  LEU A N     1 
ATOM   2552 C  CA    . LEU A 1 325 ? -1.395  -22.599 30.080  1.00   58.48 ? 319  LEU A CA    1 
ATOM   2553 C  C     . LEU A 1 325 ? -0.366  -23.690 30.343  1.00   59.82 ? 319  LEU A C     1 
ATOM   2554 O  O     . LEU A 1 325 ? -0.055  -24.487 29.458  1.00   60.67 ? 319  LEU A O     1 
ATOM   2555 C  CB    . LEU A 1 325 ? -0.689  -21.248 29.894  1.00   58.35 ? 319  LEU A CB    1 
ATOM   2556 C  CG    . LEU A 1 325 ? 0.359   -21.165 28.772  1.00   56.74 ? 319  LEU A CG    1 
ATOM   2557 C  CD1   . LEU A 1 325 ? -0.239  -21.612 27.454  1.00   55.54 ? 319  LEU A CD1   1 
ATOM   2558 C  CD2   . LEU A 1 325 ? 0.869   -19.742 28.668  1.00   55.90 ? 319  LEU A CD2   1 
ATOM   2559 N  N     . GLN A 1 326 ? 0.166   -23.719 31.563  1.00   62.13 ? 320  GLN A N     1 
ATOM   2560 C  CA    . GLN A 1 326 ? 1.152   -24.725 31.935  1.00   62.81 ? 320  GLN A CA    1 
ATOM   2561 C  C     . GLN A 1 326 ? 0.536   -26.110 31.816  1.00   63.06 ? 320  GLN A C     1 
ATOM   2562 O  O     . GLN A 1 326 ? 1.231   -27.079 31.500  1.00   62.77 ? 320  GLN A O     1 
ATOM   2563 C  CB    . GLN A 1 326 ? 1.643   -24.476 33.355  1.00   63.17 ? 320  GLN A CB    1 
ATOM   2564 C  CG    . GLN A 1 326 ? 2.695   -23.387 33.425  1.00   65.75 ? 320  GLN A CG    1 
ATOM   2565 C  CD    . GLN A 1 326 ? 3.084   -23.042 34.845  1.00   67.50 ? 320  GLN A CD    1 
ATOM   2566 O  OE1   . GLN A 1 326 ? 2.377   -22.299 35.533  1.00   68.91 ? 320  GLN A OE1   1 
ATOM   2567 N  NE2   . GLN A 1 326 ? 4.207   -23.588 35.300  1.00   67.44 ? 320  GLN A NE2   1 
ATOM   2568 N  N     . LYS A 1 327 ? -0.777  -26.187 32.047  1.00   63.52 ? 321  LYS A N     1 
ATOM   2569 C  CA    . LYS A 1 327 ? -1.518  -27.445 31.957  1.00   63.43 ? 321  LYS A CA    1 
ATOM   2570 C  C     . LYS A 1 327 ? -1.496  -27.920 30.512  1.00   64.52 ? 321  LYS A C     1 
ATOM   2571 O  O     . LYS A 1 327 ? -1.147  -29.062 30.233  1.00   65.26 ? 321  LYS A O     1 
ATOM   2572 C  CB    . LYS A 1 327 ? -2.958  -27.239 32.422  1.00   62.27 ? 321  LYS A CB    1 
ATOM   2573 C  CG    . LYS A 1 327 ? -3.708  -28.505 32.807  1.00   61.20 ? 321  LYS A CG    1 
ATOM   2574 C  CD    . LYS A 1 327 ? -4.995  -28.158 33.552  1.00   61.23 ? 321  LYS A CD    1 
ATOM   2575 C  CE    . LYS A 1 327 ? -5.708  -29.382 34.119  1.00   62.68 ? 321  LYS A CE    1 
ATOM   2576 N  NZ    . LYS A 1 327 ? -6.295  -30.258 33.058  1.00   63.13 ? 321  LYS A NZ    1 
ATOM   2577 N  N     . ILE A 1 328 ? -1.854  -27.031 29.593  1.00   65.41 ? 322  ILE A N     1 
ATOM   2578 C  CA    . ILE A 1 328 ? -1.852  -27.352 28.172  1.00   65.61 ? 322  ILE A CA    1 
ATOM   2579 C  C     . ILE A 1 328 ? -0.511  -27.919 27.727  1.00   66.43 ? 322  ILE A C     1 
ATOM   2580 O  O     . ILE A 1 328 ? -0.431  -29.041 27.245  1.00   67.18 ? 322  ILE A O     1 
ATOM   2581 C  CB    . ILE A 1 328 ? -2.169  -26.099 27.334  1.00   66.09 ? 322  ILE A CB    1 
ATOM   2582 C  CG1   . ILE A 1 328 ? -3.660  -25.767 27.451  1.00   66.99 ? 322  ILE A CG1   1 
ATOM   2583 C  CG2   . ILE A 1 328 ? -1.784  -26.315 25.879  1.00   66.24 ? 322  ILE A CG2   1 
ATOM   2584 C  CD1   . ILE A 1 328 ? -4.077  -24.518 26.697  1.00   66.54 ? 322  ILE A CD1   1 
ATOM   2585 N  N     . LEU A 1 329 ? 0.547   -27.140 27.892  1.00   67.92 ? 323  LEU A N     1 
ATOM   2586 C  CA    . LEU A 1 329 ? 1.879   -27.583 27.501  1.00   68.80 ? 323  LEU A CA    1 
ATOM   2587 C  C     . LEU A 1 329 ? 2.161   -29.001 27.981  1.00   69.98 ? 323  LEU A C     1 
ATOM   2588 O  O     . LEU A 1 329 ? 2.955   -29.723 27.377  1.00   70.90 ? 323  LEU A O     1 
ATOM   2589 C  CB    . LEU A 1 329 ? 2.937   -26.620 28.051  1.00   68.03 ? 323  LEU A CB    1 
ATOM   2590 C  CG    . LEU A 1 329 ? 2.898   -25.195 27.478  1.00   67.33 ? 323  LEU A CG    1 
ATOM   2591 C  CD1   . LEU A 1 329 ? 3.822   -24.272 28.267  1.00   66.32 ? 323  LEU A CD1   1 
ATOM   2592 C  CD2   . LEU A 1 329 ? 3.302   -25.235 26.012  1.00   66.82 ? 323  LEU A CD2   1 
ATOM   2593 N  N     . GLU A 1 330 ? 1.494   -29.401 29.059  1.00   70.87 ? 324  GLU A N     1 
ATOM   2594 C  CA    . GLU A 1 330 ? 1.674   -30.735 29.619  1.00   71.55 ? 324  GLU A CA    1 
ATOM   2595 C  C     . GLU A 1 330 ? 0.988   -31.835 28.811  1.00   72.48 ? 324  GLU A C     1 
ATOM   2596 O  O     . GLU A 1 330 ? 1.566   -32.890 28.579  1.00   74.03 ? 324  GLU A O     1 
ATOM   2597 C  CB    . GLU A 1 330 ? 1.145   -30.786 31.055  1.00   70.97 ? 324  GLU A CB    1 
ATOM   2598 C  CG    . GLU A 1 330 ? 1.996   -30.091 32.100  0.50   69.74 ? 324  GLU A CG    1 
ATOM   2599 C  CD    . GLU A 1 330 ? 1.256   -29.941 33.415  0.50   69.38 ? 324  GLU A CD    1 
ATOM   2600 O  OE1   . GLU A 1 330 ? 0.369   -30.776 33.700  0.50   68.78 ? 324  GLU A OE1   1 
ATOM   2601 O  OE2   . GLU A 1 330 ? 1.562   -28.997 34.171  0.50   69.51 ? 324  GLU A OE2   1 
ATOM   2602 N  N     . GLU A 1 331 ? -0.241  -31.590 28.376  1.00   73.28 ? 325  GLU A N     1 
ATOM   2603 C  CA    . GLU A 1 331 ? -0.992  -32.601 27.636  1.00   74.53 ? 325  GLU A CA    1 
ATOM   2604 C  C     . GLU A 1 331 ? -0.891  -32.530 26.117  1.00   75.30 ? 325  GLU A C     1 
ATOM   2605 O  O     . GLU A 1 331 ? -1.663  -33.182 25.416  1.00   75.88 ? 325  GLU A O     1 
ATOM   2606 C  CB    . GLU A 1 331 ? -2.464  -32.537 28.045  1.00   74.30 ? 325  GLU A CB    1 
ATOM   2607 C  CG    . GLU A 1 331 ? -2.659  -32.385 29.547  1.00   74.77 ? 325  GLU A CG    1 
ATOM   2608 C  CD    . GLU A 1 331 ? -4.119  -32.275 29.956  1.00   75.19 ? 325  GLU A CD    1 
ATOM   2609 O  OE1   . GLU A 1 331 ? -4.377  -31.966 31.141  1.00   74.81 ? 325  GLU A OE1   1 
ATOM   2610 O  OE2   . GLU A 1 331 ? -5.003  -32.504 29.101  1.00   75.69 ? 325  GLU A OE2   1 
ATOM   2611 N  N     . ASP A 1 332 ? 0.049   -31.748 25.602  1.00   76.29 ? 326  ASP A N     1 
ATOM   2612 C  CA    . ASP A 1 332 ? 0.196   -31.640 24.157  1.00   77.06 ? 326  ASP A CA    1 
ATOM   2613 C  C     . ASP A 1 332 ? 1.668   -31.638 23.747  1.00   77.96 ? 326  ASP A C     1 
ATOM   2614 O  O     . ASP A 1 332 ? 2.555   -31.787 24.590  1.00   79.56 ? 326  ASP A O     1 
ATOM   2615 C  CB    . ASP A 1 332 ? -0.472  -30.366 23.648  1.00   76.36 ? 326  ASP A CB    1 
ATOM   2616 C  CG    . ASP A 1 332 ? -0.854  -30.465 22.192  1.00   76.74 ? 326  ASP A CG    1 
ATOM   2617 O  OD1   . ASP A 1 332 ? -1.943  -31.004 21.899  1.00   76.00 ? 326  ASP A OD1   1 
ATOM   2618 O  OD2   . ASP A 1 332 ? -0.058  -30.025 21.338  1.00   77.41 ? 326  ASP A OD2   1 
ATOM   2619 N  N     . GLU A 1 333 ? 1.921   -31.477 22.451  1.00   77.15 ? 327  GLU A N     1 
ATOM   2620 C  CA    . GLU A 1 333 ? 3.280   -31.451 21.939  0.50   75.74 ? 327  GLU A CA    1 
ATOM   2621 C  C     . GLU A 1 333 ? 3.436   -30.212 21.078  1.00   75.21 ? 327  GLU A C     1 
ATOM   2622 O  O     . GLU A 1 333 ? 4.264   -29.348 21.359  1.00   74.84 ? 327  GLU A O     1 
ATOM   2623 C  CB    . GLU A 1 333 ? 3.549   -32.687 21.082  0.50   75.34 ? 327  GLU A CB    1 
ATOM   2624 C  CG    . GLU A 1 333 ? 3.149   -33.996 21.726  0.50   75.11 ? 327  GLU A CG    1 
ATOM   2625 C  CD    . GLU A 1 333 ? 3.223   -35.157 20.756  0.50   75.09 ? 327  GLU A CD    1 
ATOM   2626 O  OE1   . GLU A 1 333 ? 2.594   -35.068 19.679  0.50   74.77 ? 327  GLU A OE1   1 
ATOM   2627 O  OE2   . GLU A 1 333 ? 3.904   -36.156 21.069  0.50   74.66 ? 327  GLU A OE2   1 
ATOM   2628 N  N     . ARG A 1 334 ? 2.620   -30.144 20.027  1.00   74.97 ? 328  ARG A N     1 
ATOM   2629 C  CA    . ARG A 1 334 ? 2.641   -29.041 19.066  1.00   74.33 ? 328  ARG A CA    1 
ATOM   2630 C  C     . ARG A 1 334 ? 3.093   -27.719 19.676  1.00   74.33 ? 328  ARG A C     1 
ATOM   2631 O  O     . ARG A 1 334 ? 2.894   -27.468 20.864  1.00   74.67 ? 328  ARG A O     1 
ATOM   2632 C  CB    . ARG A 1 334 ? 1.255   -28.851 18.425  1.00   73.68 ? 328  ARG A CB    1 
ATOM   2633 C  CG    . ARG A 1 334 ? 0.755   -30.027 17.590  1.00   72.47 ? 328  ARG A CG    1 
ATOM   2634 C  CD    . ARG A 1 334 ? 0.164   -31.131 18.453  1.00   72.45 ? 328  ARG A CD    1 
ATOM   2635 N  NE    . ARG A 1 334 ? -1.233  -30.891 18.819  1.00   72.08 ? 328  ARG A NE    1 
ATOM   2636 C  CZ    . ARG A 1 334 ? -2.267  -31.052 17.996  1.00   71.58 ? 328  ARG A CZ    1 
ATOM   2637 N  NH1   . ARG A 1 334 ? -2.070  -31.452 16.750  1.00   71.42 ? 328  ARG A NH1   1 
ATOM   2638 N  NH2   . ARG A 1 334 ? -3.503  -30.830 18.424  1.00   70.88 ? 328  ARG A NH2   1 
ATOM   2639 N  N     . LYS A 1 335 ? 3.712   -26.875 18.859  1.00   73.88 ? 329  LYS A N     1 
ATOM   2640 C  CA    . LYS A 1 335 ? 4.161   -25.581 19.339  1.00   73.37 ? 329  LYS A CA    1 
ATOM   2641 C  C     . LYS A 1 335 ? 2.946   -24.687 19.215  1.00   72.04 ? 329  LYS A C     1 
ATOM   2642 O  O     . LYS A 1 335 ? 2.116   -24.879 18.328  1.00   72.39 ? 329  LYS A O     1 
ATOM   2643 C  CB    . LYS A 1 335 ? 5.300   -25.015 18.476  1.00   75.02 ? 329  LYS A CB    1 
ATOM   2644 C  CG    . LYS A 1 335 ? 6.209   -26.035 17.796  1.00   77.03 ? 329  LYS A CG    1 
ATOM   2645 C  CD    . LYS A 1 335 ? 5.481   -26.727 16.648  1.00   78.89 ? 329  LYS A CD    1 
ATOM   2646 C  CE    . LYS A 1 335 ? 6.440   -27.224 15.591  1.00   79.47 ? 329  LYS A CE    1 
ATOM   2647 N  NZ    . LYS A 1 335 ? 5.695   -27.903 14.496  1.00   82.43 ? 329  LYS A NZ    1 
ATOM   2648 N  N     . ILE A 1 336 ? 2.836   -23.712 20.102  1.00   70.09 ? 330  ILE A N     1 
ATOM   2649 C  CA    . ILE A 1 336 ? 1.704   -22.808 20.062  1.00   68.54 ? 330  ILE A CA    1 
ATOM   2650 C  C     . ILE A 1 336 ? 1.949   -21.652 19.087  1.00   67.61 ? 330  ILE A C     1 
ATOM   2651 O  O     . ILE A 1 336 ? 3.039   -21.069 19.051  1.00   67.95 ? 330  ILE A O     1 
ATOM   2652 C  CB    . ILE A 1 336 ? 1.418   -22.253 21.463  1.00   68.65 ? 330  ILE A CB    1 
ATOM   2653 C  CG1   . ILE A 1 336 ? 1.187   -23.417 22.428  1.00   67.49 ? 330  ILE A CG1   1 
ATOM   2654 C  CG2   . ILE A 1 336 ? 0.213   -21.320 21.420  1.00   68.56 ? 330  ILE A CG2   1 
ATOM   2655 C  CD1   . ILE A 1 336 ? 1.048   -22.990 23.872  1.00   68.75 ? 330  ILE A CD1   1 
ATOM   2656 N  N     . ARG A 1 337 ? 0.925   -21.332 18.299  1.00   64.80 ? 331  ARG A N     1 
ATOM   2657 C  CA    . ARG A 1 337 ? 0.997   -20.258 17.316  1.00   61.48 ? 331  ARG A CA    1 
ATOM   2658 C  C     . ARG A 1 337 ? 0.194   -19.065 17.846  1.00   58.97 ? 331  ARG A C     1 
ATOM   2659 O  O     . ARG A 1 337 ? 0.733   -17.981 18.060  1.00   58.54 ? 331  ARG A O     1 
ATOM   2660 C  CB    . ARG A 1 337 ? 0.420   -20.763 15.989  1.00   62.43 ? 331  ARG A CB    1 
ATOM   2661 C  CG    . ARG A 1 337 ? 0.889   -20.034 14.724  1.00   64.45 ? 331  ARG A CG    1 
ATOM   2662 C  CD    . ARG A 1 337 ? 0.404   -20.786 13.465  1.00   64.73 ? 331  ARG A CD    1 
ATOM   2663 N  NE    . ARG A 1 337 ? 1.131   -20.416 12.250  1.00   64.24 ? 331  ARG A NE    1 
ATOM   2664 C  CZ    . ARG A 1 337 ? 0.835   -19.376 11.481  1.00   64.38 ? 331  ARG A CZ    1 
ATOM   2665 N  NH1   . ARG A 1 337 ? -0.185  -18.590 11.789  1.00   64.29 ? 331  ARG A NH1   1 
ATOM   2666 N  NH2   . ARG A 1 337 ? 1.562   -19.120 10.402  1.00   66.49 ? 331  ARG A NH2   1 
ATOM   2667 N  N     . ARG A 1 338 ? -1.100  -19.280 18.055  1.00   56.56 ? 332  ARG A N     1 
ATOM   2668 C  CA    . ARG A 1 338 ? -1.996  -18.254 18.577  1.00   53.52 ? 332  ARG A CA    1 
ATOM   2669 C  C     . ARG A 1 338 ? -2.361  -18.616 20.008  1.00   50.52 ? 332  ARG A C     1 
ATOM   2670 O  O     . ARG A 1 338 ? -2.586  -19.782 20.337  1.00   49.00 ? 332  ARG A O     1 
ATOM   2671 C  CB    . ARG A 1 338 ? -3.275  -18.160 17.739  1.00   55.46 ? 332  ARG A CB    1 
ATOM   2672 C  CG    . ARG A 1 338 ? -3.056  -17.749 16.299  1.00   59.32 ? 332  ARG A CG    1 
ATOM   2673 C  CD    . ARG A 1 338 ? -4.339  -17.164 15.694  1.00   61.80 ? 332  ARG A CD    1 
ATOM   2674 N  NE    . ARG A 1 338 ? -5.338  -18.180 15.382  1.00   62.36 ? 332  ARG A NE    1 
ATOM   2675 C  CZ    . ARG A 1 338 ? -5.402  -18.830 14.225  1.00   63.04 ? 332  ARG A CZ    1 
ATOM   2676 N  NH1   . ARG A 1 338 ? -4.522  -18.562 13.270  1.00   61.54 ? 332  ARG A NH1   1 
ATOM   2677 N  NH2   . ARG A 1 338 ? -6.344  -19.746 14.024  1.00   63.50 ? 332  ARG A NH2   1 
ATOM   2678 N  N     . ILE A 1 339 ? -2.438  -17.598 20.852  1.00   47.63 ? 333  ILE A N     1 
ATOM   2679 C  CA    . ILE A 1 339 ? -2.745  -17.780 22.255  1.00   44.50 ? 333  ILE A CA    1 
ATOM   2680 C  C     . ILE A 1 339 ? -3.737  -16.725 22.679  1.00   43.61 ? 333  ILE A C     1 
ATOM   2681 O  O     . ILE A 1 339 ? -3.625  -15.559 22.296  1.00   42.23 ? 333  ILE A O     1 
ATOM   2682 C  CB    . ILE A 1 339 ? -1.475  -17.622 23.116  1.00   44.65 ? 333  ILE A CB    1 
ATOM   2683 C  CG1   . ILE A 1 339 ? -1.758  -18.000 24.574  1.00   45.24 ? 333  ILE A CG1   1 
ATOM   2684 C  CG2   . ILE A 1 339 ? -0.985  -16.190 23.040  1.00   43.47 ? 333  ILE A CG2   1 
ATOM   2685 C  CD1   . ILE A 1 339 ? -2.170  -19.435 24.767  1.00   44.90 ? 333  ILE A CD1   1 
ATOM   2686 N  N     . GLY A 1 340 ? -4.705  -17.127 23.487  1.00   42.31 ? 334  GLY A N     1 
ATOM   2687 C  CA    . GLY A 1 340 ? -5.684  -16.163 23.927  1.00   43.04 ? 334  GLY A CA    1 
ATOM   2688 C  C     . GLY A 1 340 ? -6.420  -16.663 25.137  1.00   42.61 ? 334  GLY A C     1 
ATOM   2689 O  O     . GLY A 1 340 ? -6.106  -17.741 25.637  1.00   41.59 ? 334  GLY A O     1 
ATOM   2690 N  N     . VAL A 1 341 ? -7.396  -15.881 25.594  1.00   41.58 ? 335  VAL A N     1 
ATOM   2691 C  CA    . VAL A 1 341 ? -8.200  -16.241 26.747  1.00   43.16 ? 335  VAL A CA    1 
ATOM   2692 C  C     . VAL A 1 341 ? -9.662  -16.079 26.415  1.00   43.34 ? 335  VAL A C     1 
ATOM   2693 O  O     . VAL A 1 341 ? -10.002 -15.412 25.449  1.00   45.27 ? 335  VAL A O     1 
ATOM   2694 C  CB    . VAL A 1 341 ? -7.903  -15.338 27.956  1.00   42.83 ? 335  VAL A CB    1 
ATOM   2695 C  CG1   . VAL A 1 341 ? -6.519  -15.607 28.472  1.00   42.26 ? 335  VAL A CG1   1 
ATOM   2696 C  CG2   . VAL A 1 341 ? -8.049  -13.885 27.563  1.00   42.32 ? 335  VAL A CG2   1 
ATOM   2697 N  N     . ARG A 1 342 ? -10.507 -16.685 27.242  1.00   43.42 ? 336  ARG A N     1 
ATOM   2698 C  CA    . ARG A 1 342 ? -11.957 -16.649 27.109  1.00   41.76 ? 336  ARG A CA    1 
ATOM   2699 C  C     . ARG A 1 342 ? -12.559 -16.618 28.508  1.00   42.38 ? 336  ARG A C     1 
ATOM   2700 O  O     . ARG A 1 342 ? -12.217 -17.424 29.370  1.00   41.31 ? 336  ARG A O     1 
ATOM   2701 C  CB    . ARG A 1 342 ? -12.481 -17.911 26.423  1.00   42.85 ? 336  ARG A CB    1 
ATOM   2702 C  CG    . ARG A 1 342 ? -12.387 -17.947 24.933  1.00   42.04 ? 336  ARG A CG    1 
ATOM   2703 C  CD    . ARG A 1 342 ? -13.720 -17.593 24.305  1.00   43.62 ? 336  ARG A CD    1 
ATOM   2704 N  NE    . ARG A 1 342 ? -13.504 -16.755 23.136  1.00   39.89 ? 336  ARG A NE    1 
ATOM   2705 C  CZ    . ARG A 1 342 ? -14.259 -15.717 22.829  1.00   38.27 ? 336  ARG A CZ    1 
ATOM   2706 N  NH1   . ARG A 1 342 ? -15.289 -15.400 23.596  1.00   38.84 ? 336  ARG A NH1   1 
ATOM   2707 N  NH2   . ARG A 1 342 ? -13.941 -14.960 21.794  1.00   37.87 ? 336  ARG A NH2   1 
ATOM   2708 N  N     . PHE A 1 343 ? -13.472 -15.689 28.723  1.00   41.81 ? 337  PHE A N     1 
ATOM   2709 C  CA    . PHE A 1 343 ? -14.139 -15.581 29.991  1.00   40.91 ? 337  PHE A CA    1 
ATOM   2710 C  C     . PHE A 1 343 ? -15.608 -15.910 29.765  1.00   39.79 ? 337  PHE A C     1 
ATOM   2711 O  O     . PHE A 1 343 ? -16.193 -15.467 28.787  1.00   38.34 ? 337  PHE A O     1 
ATOM   2712 C  CB    . PHE A 1 343 ? -13.987 -14.164 30.524  1.00   42.57 ? 337  PHE A CB    1 
ATOM   2713 C  CG    . PHE A 1 343 ? -12.590 -13.829 30.938  1.00   42.28 ? 337  PHE A CG    1 
ATOM   2714 C  CD1   . PHE A 1 343 ? -11.905 -14.646 31.828  1.00   43.34 ? 337  PHE A CD1   1 
ATOM   2715 C  CD2   . PHE A 1 343 ? -11.955 -12.712 30.436  1.00   44.15 ? 337  PHE A CD2   1 
ATOM   2716 C  CE1   . PHE A 1 343 ? -10.605 -14.367 32.214  1.00   42.87 ? 337  PHE A CE1   1 
ATOM   2717 C  CE2   . PHE A 1 343 ? -10.651 -12.416 30.815  1.00   44.78 ? 337  PHE A CE2   1 
ATOM   2718 C  CZ    . PHE A 1 343 ? -9.971  -13.245 31.705  1.00   43.70 ? 337  PHE A CZ    1 
ATOM   2719 N  N     . SER A 1 344 ? -16.203 -16.688 30.666  1.00   38.90 ? 338  SER A N     1 
ATOM   2720 C  CA    . SER A 1 344 ? -17.612 -17.057 30.539  1.00   37.76 ? 338  SER A CA    1 
ATOM   2721 C  C     . SER A 1 344 ? -18.319 -17.245 31.880  1.00   37.70 ? 338  SER A C     1 
ATOM   2722 O  O     . SER A 1 344 ? -17.756 -16.980 32.938  1.00   36.25 ? 338  SER A O     1 
ATOM   2723 C  CB    . SER A 1 344 ? -17.758 -18.330 29.676  1.00   38.56 ? 338  SER A CB    1 
ATOM   2724 O  OG    . SER A 1 344 ? -16.974 -19.422 30.140  1.00   38.07 ? 338  SER A OG    1 
ATOM   2725 N  N     . LYS A 1 345 ? -19.561 -17.713 31.823  1.00   38.30 ? 339  LYS A N     1 
ATOM   2726 C  CA    . LYS A 1 345 ? -20.354 -17.933 33.018  1.00   37.46 ? 339  LYS A CA    1 
ATOM   2727 C  C     . LYS A 1 345 ? -20.373 -16.692 33.882  1.00   38.10 ? 339  LYS A C     1 
ATOM   2728 O  O     . LYS A 1 345 ? -19.998 -16.702 35.055  1.00   37.99 ? 339  LYS A O     1 
ATOM   2729 C  CB    . LYS A 1 345 ? -19.814 -19.134 33.779  1.00   36.90 ? 339  LYS A CB    1 
ATOM   2730 C  CG    . LYS A 1 345 ? -19.914 -20.405 32.964  1.00   34.35 ? 339  LYS A CG    1 
ATOM   2731 C  CD    . LYS A 1 345 ? -19.421 -21.587 33.746  1.00   35.47 ? 339  LYS A CD    1 
ATOM   2732 C  CE    . LYS A 1 345 ? -19.496 -22.846 32.947  1.00   36.35 ? 339  LYS A CE    1 
ATOM   2733 N  NZ    . LYS A 1 345 ? -18.982 -23.976 33.755  1.00   40.53 ? 339  LYS A NZ    1 
ATOM   2734 N  N     . PHE A 1 346 ? -20.842 -15.616 33.275  1.00   39.99 ? 340  PHE A N     1 
ATOM   2735 C  CA    . PHE A 1 346 ? -20.930 -14.338 33.941  1.00   42.09 ? 340  PHE A CA    1 
ATOM   2736 C  C     . PHE A 1 346 ? -21.860 -14.372 35.144  1.00   45.60 ? 340  PHE A C     1 
ATOM   2737 O  O     . PHE A 1 346 ? -22.740 -15.230 35.239  1.00   47.00 ? 340  PHE A O     1 
ATOM   2738 C  CB    . PHE A 1 346 ? -21.408 -13.299 32.950  1.00   38.91 ? 340  PHE A CB    1 
ATOM   2739 C  CG    . PHE A 1 346 ? -20.549 -13.203 31.729  1.00   36.11 ? 340  PHE A CG    1 
ATOM   2740 C  CD1   . PHE A 1 346 ? -19.201 -12.889 31.831  1.00   35.43 ? 340  PHE A CD1   1 
ATOM   2741 C  CD2   . PHE A 1 346 ? -21.089 -13.395 30.472  1.00   35.11 ? 340  PHE A CD2   1 
ATOM   2742 C  CE1   . PHE A 1 346 ? -18.404 -12.765 30.683  1.00   33.57 ? 340  PHE A CE1   1 
ATOM   2743 C  CE2   . PHE A 1 346 ? -20.303 -13.270 29.334  1.00   33.51 ? 340  PHE A CE2   1 
ATOM   2744 C  CZ    . PHE A 1 346 ? -18.957 -12.953 29.445  1.00   32.33 ? 340  PHE A CZ    1 
ATOM   2745 N  N     . ILE A 1 347 ? -21.660 -13.433 36.063  1.00   47.35 ? 341  ILE A N     1 
ATOM   2746 C  CA    . ILE A 1 347 ? -22.484 -13.372 37.253  1.00   50.21 ? 341  ILE A CA    1 
ATOM   2747 C  C     . ILE A 1 347 ? -23.653 -12.433 37.004  1.00   52.07 ? 341  ILE A C     1 
ATOM   2748 O  O     . ILE A 1 347 ? -23.487 -11.213 37.220  1.00   54.52 ? 341  ILE A O     1 
ATOM   2749 C  CB    . ILE A 1 347 ? -21.656 -12.911 38.475  1.00   49.90 ? 341  ILE A CB    1 
ATOM   2750 C  CG1   . ILE A 1 347 ? -20.663 -14.006 38.857  1.00   48.02 ? 341  ILE A CG1   1 
ATOM   2751 C  CG2   . ILE A 1 347 ? -22.569 -12.618 39.651  1.00   49.79 ? 341  ILE A CG2   1 
ATOM   2752 C  CD1   . ILE A 1 347 ? -19.749 -13.636 39.970  1.00   49.28 ? 341  ILE A CD1   1 
ATOM   2753 N  N     . GLU A 1 348 ? -24.709 -12.936 36.557  1.00   53.28 ? 342  GLU A N     1 
ATOM   2754 O  "O5'" . DG  B 2 1   ? -32.358 -47.803 32.442  1.00   51.62 ? 1    DG  P "O5'" 1 
ATOM   2755 C  "C5'" . DG  B 2 1   ? -31.579 -47.505 33.609  1.00   50.12 ? 1    DG  P "C5'" 1 
ATOM   2756 C  "C4'" . DG  B 2 1   ? -32.013 -46.157 34.184  1.00   49.95 ? 1    DG  P "C4'" 1 
ATOM   2757 O  "O4'" . DG  B 2 1   ? -31.273 -45.862 35.399  1.00   50.72 ? 1    DG  P "O4'" 1 
ATOM   2758 C  "C3'" . DG  B 2 1   ? -31.775 -44.983 33.240  1.00   50.77 ? 1    DG  P "C3'" 1 
ATOM   2759 O  "O3'" . DG  B 2 1   ? -32.896 -44.098 33.303  1.00   53.10 ? 1    DG  P "O3'" 1 
ATOM   2760 C  "C2'" . DG  B 2 1   ? -30.508 -44.336 33.782  1.00   50.62 ? 1    DG  P "C2'" 1 
ATOM   2761 C  "C1'" . DG  B 2 1   ? -30.597 -44.616 35.281  1.00   48.56 ? 1    DG  P "C1'" 1 
ATOM   2762 N  N9    . DG  B 2 1   ? -29.318 -44.726 35.984  1.00   43.65 ? 1    DG  P N9    1 
ATOM   2763 C  C8    . DG  B 2 1   ? -28.221 -45.456 35.604  1.00   42.82 ? 1    DG  P C8    1 
ATOM   2764 N  N7    . DG  B 2 1   ? -27.233 -45.387 36.462  1.00   41.99 ? 1    DG  P N7    1 
ATOM   2765 C  C5    . DG  B 2 1   ? -27.712 -44.562 37.470  1.00   43.35 ? 1    DG  P C5    1 
ATOM   2766 C  C6    . DG  B 2 1   ? -27.109 -44.143 38.702  1.00   43.94 ? 1    DG  P C6    1 
ATOM   2767 O  O6    . DG  B 2 1   ? -26.017 -44.484 39.200  1.00   39.22 ? 1    DG  P O6    1 
ATOM   2768 N  N1    . DG  B 2 1   ? -27.937 -43.262 39.395  1.00   42.97 ? 1    DG  P N1    1 
ATOM   2769 C  C2    . DG  B 2 1   ? -29.182 -42.876 38.996  1.00   42.34 ? 1    DG  P C2    1 
ATOM   2770 N  N2    . DG  B 2 1   ? -29.808 -42.011 39.816  1.00   44.82 ? 1    DG  P N2    1 
ATOM   2771 N  N3    . DG  B 2 1   ? -29.773 -43.296 37.889  1.00   41.79 ? 1    DG  P N3    1 
ATOM   2772 C  C4    . DG  B 2 1   ? -28.987 -44.124 37.177  1.00   42.53 ? 1    DG  P C4    1 
ATOM   2773 P  P     . DG  B 2 2   ? -33.033 -42.906 32.237  1.00   57.33 ? 2    DG  P P     1 
ATOM   2774 O  OP1   . DG  B 2 2   ? -34.472 -42.723 31.933  1.00   55.58 ? 2    DG  P OP1   1 
ATOM   2775 O  OP2   . DG  B 2 2   ? -32.069 -43.116 31.133  1.00   55.25 ? 2    DG  P OP2   1 
ATOM   2776 O  "O5'" . DG  B 2 2   ? -32.529 -41.639 33.088  1.00   53.51 ? 2    DG  P "O5'" 1 
ATOM   2777 C  "C5'" . DG  B 2 2   ? -33.112 -41.348 34.359  1.00   52.55 ? 2    DG  P "C5'" 1 
ATOM   2778 C  "C4'" . DG  B 2 2   ? -32.332 -40.215 35.023  1.00   52.55 ? 2    DG  P "C4'" 1 
ATOM   2779 O  "O4'" . DG  B 2 2   ? -31.120 -40.729 35.623  1.00   51.72 ? 2    DG  P "O4'" 1 
ATOM   2780 C  "C3'" . DG  B 2 2   ? -31.889 -39.134 34.031  1.00   53.33 ? 2    DG  P "C3'" 1 
ATOM   2781 O  "O3'" . DG  B 2 2   ? -31.983 -37.856 34.664  1.00   57.55 ? 2    DG  P "O3'" 1 
ATOM   2782 C  "C2'" . DG  B 2 2   ? -30.417 -39.442 33.828  1.00   52.42 ? 2    DG  P "C2'" 1 
ATOM   2783 C  "C1'" . DG  B 2 2   ? -30.056 -39.889 35.228  1.00   50.18 ? 2    DG  P "C1'" 1 
ATOM   2784 N  N9    . DG  B 2 2   ? -28.801 -40.615 35.381  1.00   45.64 ? 2    DG  P N9    1 
ATOM   2785 C  C8    . DG  B 2 2   ? -28.210 -41.481 34.494  1.00   44.65 ? 2    DG  P C8    1 
ATOM   2786 N  N7    . DG  B 2 2   ? -27.042 -41.908 34.897  1.00   42.93 ? 2    DG  P N7    1 
ATOM   2787 C  C5    . DG  B 2 2   ? -26.867 -41.305 36.137  1.00   45.28 ? 2    DG  P C5    1 
ATOM   2788 C  C6    . DG  B 2 2   ? -25.785 -41.386 37.066  1.00   44.45 ? 2    DG  P C6    1 
ATOM   2789 O  O6    . DG  B 2 2   ? -24.742 -42.033 36.981  1.00   49.11 ? 2    DG  P O6    1 
ATOM   2790 N  N1    . DG  B 2 2   ? -26.017 -40.607 38.191  1.00   42.63 ? 2    DG  P N1    1 
ATOM   2791 C  C2    . DG  B 2 2   ? -27.148 -39.855 38.415  1.00   42.96 ? 2    DG  P C2    1 
ATOM   2792 N  N2    . DG  B 2 2   ? -27.182 -39.168 39.578  1.00   40.64 ? 2    DG  P N2    1 
ATOM   2793 N  N3    . DG  B 2 2   ? -28.166 -39.779 37.567  1.00   42.19 ? 2    DG  P N3    1 
ATOM   2794 C  C4    . DG  B 2 2   ? -27.955 -40.519 36.456  1.00   44.79 ? 2    DG  P C4    1 
ATOM   2795 P  P     . DG  B 2 3   ? -32.649 -36.621 33.890  1.00   60.04 ? 3    DG  P P     1 
ATOM   2796 O  OP1   . DG  B 2 3   ? -34.112 -36.851 33.890  1.00   58.99 ? 3    DG  P OP1   1 
ATOM   2797 O  OP2   . DG  B 2 3   ? -31.935 -36.348 32.622  1.00   57.90 ? 3    DG  P OP2   1 
ATOM   2798 O  "O5'" . DG  B 2 3   ? -32.380 -35.422 34.926  1.00   58.37 ? 3    DG  P "O5'" 1 
ATOM   2799 C  "C5'" . DG  B 2 3   ? -32.834 -35.556 36.274  1.00   59.51 ? 3    DG  P "C5'" 1 
ATOM   2800 C  "C4'" . DG  B 2 3   ? -31.874 -34.850 37.232  1.00   58.61 ? 3    DG  P "C4'" 1 
ATOM   2801 O  "O4'" . DG  B 2 3   ? -30.654 -35.607 37.446  1.00   56.74 ? 3    DG  P "O4'" 1 
ATOM   2802 C  "C3'" . DG  B 2 3   ? -31.452 -33.473 36.743  1.00   58.38 ? 3    DG  P "C3'" 1 
ATOM   2803 O  "O3'" . DG  B 2 3   ? -31.549 -32.562 37.839  1.00   61.13 ? 3    DG  P "O3'" 1 
ATOM   2804 C  "C2'" . DG  B 2 3   ? -30.015 -33.677 36.291  1.00   56.29 ? 3    DG  P "C2'" 1 
ATOM   2805 C  "C1'" . DG  B 2 3   ? -29.524 -34.788 37.205  1.00   54.35 ? 3    DG  P "C1'" 1 
ATOM   2806 N  N9    . DG  B 2 3   ? -28.480 -35.642 36.642  1.00   51.84 ? 3    DG  P N9    1 
ATOM   2807 C  C8    . DG  B 2 3   ? -28.524 -36.317 35.444  1.00   49.62 ? 3    DG  P C8    1 
ATOM   2808 N  N7    . DG  B 2 3   ? -27.459 -37.045 35.225  1.00   48.65 ? 3    DG  P N7    1 
ATOM   2809 C  C5    . DG  B 2 3   ? -26.657 -36.835 36.342  1.00   46.93 ? 3    DG  P C5    1 
ATOM   2810 C  C6    . DG  B 2 3   ? -25.382 -37.378 36.681  1.00   45.56 ? 3    DG  P C6    1 
ATOM   2811 O  O6    . DG  B 2 3   ? -24.694 -38.178 36.040  1.00   44.77 ? 3    DG  P O6    1 
ATOM   2812 N  N1    . DG  B 2 3   ? -24.925 -36.896 37.907  1.00   42.70 ? 3    DG  P N1    1 
ATOM   2813 C  C2    . DG  B 2 3   ? -25.597 -36.004 38.702  1.00   42.48 ? 3    DG  P C2    1 
ATOM   2814 N  N2    . DG  B 2 3   ? -24.975 -35.640 39.826  1.00   42.22 ? 3    DG  P N2    1 
ATOM   2815 N  N3    . DG  B 2 3   ? -26.791 -35.500 38.409  1.00   44.93 ? 3    DG  P N3    1 
ATOM   2816 C  C4    . DG  B 2 3   ? -27.260 -35.958 37.221  1.00   48.19 ? 3    DG  P C4    1 
ATOM   2817 P  P     . DG  B 2 4   ? -31.733 -31.001 37.554  1.00   62.38 ? 4    DG  P P     1 
ATOM   2818 O  OP1   . DG  B 2 4   ? -32.630 -30.466 38.603  1.00   62.75 ? 4    DG  P OP1   1 
ATOM   2819 O  OP2   . DG  B 2 4   ? -32.049 -30.795 36.123  1.00   61.28 ? 4    DG  P OP2   1 
ATOM   2820 O  "O5'" . DG  B 2 4   ? -30.249 -30.448 37.825  1.00   63.65 ? 4    DG  P "O5'" 1 
ATOM   2821 C  "C5'" . DG  B 2 4   ? -29.583 -30.757 39.051  1.00   63.93 ? 4    DG  P "C5'" 1 
ATOM   2822 C  "C4'" . DG  B 2 4   ? -28.124 -30.316 38.952  1.00   64.31 ? 4    DG  P "C4'" 1 
ATOM   2823 O  "O4'" . DG  B 2 4   ? -27.302 -31.367 38.375  1.00   63.13 ? 4    DG  P "O4'" 1 
ATOM   2824 C  "C3'" . DG  B 2 4   ? -27.971 -29.087 38.053  1.00   65.20 ? 4    DG  P "C3'" 1 
ATOM   2825 O  "O3'" . DG  B 2 4   ? -27.161 -28.101 38.700  1.00   65.57 ? 4    DG  P "O3'" 1 
ATOM   2826 C  "C2'" . DG  B 2 4   ? -27.371 -29.658 36.772  1.00   63.53 ? 4    DG  P "C2'" 1 
ATOM   2827 C  "C1'" . DG  B 2 4   ? -26.574 -30.862 37.269  1.00   61.13 ? 4    DG  P "C1'" 1 
ATOM   2828 N  N9    . DG  B 2 4   ? -26.412 -31.946 36.299  1.00   58.77 ? 4    DG  P N9    1 
ATOM   2829 C  C8    . DG  B 2 4   ? -27.266 -32.280 35.271  1.00   57.89 ? 4    DG  P C8    1 
ATOM   2830 N  N7    . DG  B 2 4   ? -26.840 -33.288 34.555  1.00   55.14 ? 4    DG  P N7    1 
ATOM   2831 C  C5    . DG  B 2 4   ? -25.635 -33.648 35.144  1.00   54.61 ? 4    DG  P C5    1 
ATOM   2832 C  C6    . DG  B 2 4   ? -24.713 -34.671 34.799  1.00   53.58 ? 4    DG  P C6    1 
ATOM   2833 O  O6    . DG  B 2 4   ? -24.786 -35.501 33.884  1.00   54.76 ? 4    DG  P O6    1 
ATOM   2834 N  N1    . DG  B 2 4   ? -23.614 -34.676 35.647  1.00   52.73 ? 4    DG  P N1    1 
ATOM   2835 C  C2    . DG  B 2 4   ? -23.426 -33.815 36.702  1.00   53.67 ? 4    DG  P C2    1 
ATOM   2836 N  N2    . DG  B 2 4   ? -22.289 -33.967 37.403  1.00   52.94 ? 4    DG  P N2    1 
ATOM   2837 N  N3    . DG  B 2 4   ? -24.283 -32.868 37.045  1.00   54.59 ? 4    DG  P N3    1 
ATOM   2838 C  C4    . DG  B 2 4   ? -25.356 -32.836 36.225  1.00   56.32 ? 4    DG  P C4    1 
ATOM   2839 P  P     . DG  B 2 5   ? -26.741 -26.769 37.913  1.00   64.96 ? 5    DG  P P     1 
ATOM   2840 O  OP1   . DG  B 2 5   ? -26.944 -25.586 38.779  1.00   65.16 ? 5    DG  P OP1   1 
ATOM   2841 O  OP2   . DG  B 2 5   ? -27.359 -26.816 36.569  1.00   63.56 ? 5    DG  P OP2   1 
ATOM   2842 O  "O5'" . DG  B 2 5   ? -25.164 -27.005 37.720  1.00   63.50 ? 5    DG  P "O5'" 1 
ATOM   2843 C  "C5'" . DG  B 2 5   ? -24.672 -28.325 37.486  1.00   64.04 ? 5    DG  P "C5'" 1 
ATOM   2844 C  "C4'" . DG  B 2 5   ? -23.152 -28.327 37.610  1.00   63.54 ? 5    DG  P "C4'" 1 
ATOM   2845 O  "O4'" . DG  B 2 5   ? -22.655 -29.555 37.044  1.00   63.64 ? 5    DG  P "O4'" 1 
ATOM   2846 C  "C3'" . DG  B 2 5   ? -22.549 -27.211 36.775  1.00   62.83 ? 5    DG  P "C3'" 1 
ATOM   2847 O  "O3'" . DG  B 2 5   ? -21.353 -26.759 37.409  1.00   62.88 ? 5    DG  P "O3'" 1 
ATOM   2848 C  "C2'" . DG  B 2 5   ? -22.302 -27.865 35.433  1.00   62.64 ? 5    DG  P "C2'" 1 
ATOM   2849 C  "C1'" . DG  B 2 5   ? -22.057 -29.322 35.783  1.00   61.67 ? 5    DG  P "C1'" 1 
ATOM   2850 N  N9    . DG  B 2 5   ? -22.691 -30.231 34.843  1.00   59.61 ? 5    DG  P N9    1 
ATOM   2851 C  C8    . DG  B 2 5   ? -23.952 -30.124 34.314  1.00   59.35 ? 5    DG  P C8    1 
ATOM   2852 N  N7    . DG  B 2 5   ? -24.236 -31.084 33.477  1.00   59.54 ? 5    DG  P N7    1 
ATOM   2853 C  C5    . DG  B 2 5   ? -23.092 -31.871 33.461  1.00   59.14 ? 5    DG  P C5    1 
ATOM   2854 C  C6    . DG  B 2 5   ? -22.798 -33.053 32.735  1.00   59.03 ? 5    DG  P C6    1 
ATOM   2855 O  O6    . DG  B 2 5   ? -23.515 -33.668 31.932  1.00   60.65 ? 5    DG  P O6    1 
ATOM   2856 N  N1    . DG  B 2 5   ? -21.519 -33.518 33.018  1.00   57.57 ? 5    DG  P N1    1 
ATOM   2857 C  C2    . DG  B 2 5   ? -20.642 -32.926 33.889  1.00   58.44 ? 5    DG  P C2    1 
ATOM   2858 N  N2    . DG  B 2 5   ? -19.457 -33.518 34.027  1.00   58.59 ? 5    DG  P N2    1 
ATOM   2859 N  N3    . DG  B 2 5   ? -20.906 -31.830 34.573  1.00   58.71 ? 5    DG  P N3    1 
ATOM   2860 C  C4    . DG  B 2 5   ? -22.137 -31.358 34.308  1.00   59.07 ? 5    DG  P C4    1 
ATOM   2861 P  P     . DA  B 2 6   ? -20.525 -25.565 36.758  1.00   63.96 ? 6    DA  P P     1 
ATOM   2862 O  OP1   . DA  B 2 6   ? -20.297 -24.554 37.814  1.00   62.29 ? 6    DA  P OP1   1 
ATOM   2863 O  OP2   . DA  B 2 6   ? -21.188 -25.182 35.491  1.00   63.86 ? 6    DA  P OP2   1 
ATOM   2864 O  "O5'" . DA  B 2 6   ? -19.129 -26.283 36.408  1.00   61.29 ? 6    DA  P "O5'" 1 
ATOM   2865 C  "C5'" . DA  B 2 6   ? -18.511 -27.145 37.365  1.00   57.65 ? 6    DA  P "C5'" 1 
ATOM   2866 C  "C4'" . DA  B 2 6   ? -17.408 -27.963 36.694  1.00   56.53 ? 6    DA  P "C4'" 1 
ATOM   2867 O  "O4'" . DA  B 2 6   ? -17.978 -28.975 35.833  1.00   56.67 ? 6    DA  P "O4'" 1 
ATOM   2868 C  "C3'" . DA  B 2 6   ? -16.477 -27.139 35.818  1.00   55.33 ? 6    DA  P "C3'" 1 
ATOM   2869 O  "O3'" . DA  B 2 6   ? -15.140 -27.609 36.000  1.00   56.66 ? 6    DA  P "O3'" 1 
ATOM   2870 C  "C2'" . DA  B 2 6   ? -16.969 -27.428 34.411  1.00   55.71 ? 6    DA  P "C2'" 1 
ATOM   2871 C  "C1'" . DA  B 2 6   ? -17.458 -28.857 34.522  1.00   55.69 ? 6    DA  P "C1'" 1 
ATOM   2872 N  N9    . DA  B 2 6   ? -18.538 -29.202 33.604  1.00   55.23 ? 6    DA  P N9    1 
ATOM   2873 C  C8    . DA  B 2 6   ? -19.763 -28.599 33.523  1.00   55.36 ? 6    DA  P C8    1 
ATOM   2874 N  N7    . DA  B 2 6   ? -20.561 -29.135 32.636  1.00   55.14 ? 6    DA  P N7    1 
ATOM   2875 C  C5    . DA  B 2 6   ? -19.803 -30.157 32.084  1.00   54.92 ? 6    DA  P C5    1 
ATOM   2876 C  C6    . DA  B 2 6   ? -20.079 -31.095 31.081  1.00   55.05 ? 6    DA  P C6    1 
ATOM   2877 N  N6    . DA  B 2 6   ? -21.247 -31.169 30.438  1.00   54.38 ? 6    DA  P N6    1 
ATOM   2878 N  N1    . DA  B 2 6   ? -19.104 -31.968 30.756  1.00   56.46 ? 6    DA  P N1    1 
ATOM   2879 C  C2    . DA  B 2 6   ? -17.937 -31.901 31.413  1.00   56.56 ? 6    DA  P C2    1 
ATOM   2880 N  N3    . DA  B 2 6   ? -17.560 -31.066 32.378  1.00   55.61 ? 6    DA  P N3    1 
ATOM   2881 C  C4    . DA  B 2 6   ? -18.551 -30.207 32.669  1.00   55.28 ? 6    DA  P C4    1 
ATOM   2882 P  P     . DA  B 2 7   ? -13.951 -26.931 35.177  1.00   56.17 ? 7    DA  P P     1 
ATOM   2883 O  OP1   . DA  B 2 7   ? -12.751 -26.861 36.040  1.00   56.57 ? 7    DA  P OP1   1 
ATOM   2884 O  OP2   . DA  B 2 7   ? -14.497 -25.698 34.568  1.00   56.04 ? 7    DA  P OP2   1 
ATOM   2885 O  "O5'" . DA  B 2 7   ? -13.674 -27.997 34.006  1.00   57.21 ? 7    DA  P "O5'" 1 
ATOM   2886 C  "C5'" . DA  B 2 7   ? -13.475 -29.380 34.305  1.00   58.67 ? 7    DA  P "C5'" 1 
ATOM   2887 C  "C4'" . DA  B 2 7   ? -13.146 -30.131 33.016  1.00   60.21 ? 7    DA  P "C4'" 1 
ATOM   2888 O  "O4'" . DA  B 2 7   ? -14.354 -30.379 32.265  1.00   60.52 ? 7    DA  P "O4'" 1 
ATOM   2889 C  "C3'" . DA  B 2 7   ? -12.231 -29.321 32.097  1.00   60.90 ? 7    DA  P "C3'" 1 
ATOM   2890 O  "O3'" . DA  B 2 7   ? -11.269 -30.185 31.491  1.00   61.21 ? 7    DA  P "O3'" 1 
ATOM   2891 C  "C2'" . DA  B 2 7   ? -13.171 -28.756 31.047  1.00   60.88 ? 7    DA  P "C2'" 1 
ATOM   2892 C  "C1'" . DA  B 2 7   ? -14.230 -29.840 30.956  1.00   62.56 ? 7    DA  P "C1'" 1 
ATOM   2893 N  N9    . DA  B 2 7   ? -15.550 -29.364 30.546  1.00   63.75 ? 7    DA  P N9    1 
ATOM   2894 C  C8    . DA  B 2 7   ? -16.263 -28.291 31.031  1.00   63.54 ? 7    DA  P C8    1 
ATOM   2895 N  N7    . DA  B 2 7   ? -17.436 -28.134 30.463  1.00   63.35 ? 7    DA  P N7    1 
ATOM   2896 C  C5    . DA  B 2 7   ? -17.498 -29.172 29.539  1.00   63.01 ? 7    DA  P C5    1 
ATOM   2897 C  C6    . DA  B 2 7   ? -18.484 -29.563 28.616  1.00   61.48 ? 7    DA  P C6    1 
ATOM   2898 N  N6    . DA  B 2 7   ? -19.644 -28.934 28.468  1.00   60.80 ? 7    DA  P N6    1 
ATOM   2899 N  N1    . DA  B 2 7   ? -18.232 -30.641 27.842  1.00   61.76 ? 7    DA  P N1    1 
ATOM   2900 C  C2    . DA  B 2 7   ? -17.067 -31.282 27.996  1.00   62.61 ? 7    DA  P C2    1 
ATOM   2901 N  N3    . DA  B 2 7   ? -16.060 -31.014 28.827  1.00   63.78 ? 7    DA  P N3    1 
ATOM   2902 C  C4    . DA  B 2 7   ? -16.342 -29.934 29.578  1.00   64.19 ? 7    DA  P C4    1 
ATOM   2903 P  P     . DG  B 2 8   ? -9.968  -29.557 30.815  1.00   61.24 ? 8    DG  P P     1 
ATOM   2904 O  OP1   . DG  B 2 8   ? -8.823  -30.120 31.563  1.00   63.45 ? 8    DG  P OP1   1 
ATOM   2905 O  OP2   . DG  B 2 8   ? -10.134 -28.091 30.705  1.00   60.07 ? 8    DG  P OP2   1 
ATOM   2906 O  "O5'" . DG  B 2 8   ? -9.991  -30.216 29.347  1.00   62.63 ? 8    DG  P "O5'" 1 
ATOM   2907 C  "C5'" . DG  B 2 8   ? -10.397 -31.578 29.187  1.00   63.71 ? 8    DG  P "C5'" 1 
ATOM   2908 C  "C4'" . DG  B 2 8   ? -10.931 -31.809 27.772  1.00   63.96 ? 8    DG  P "C4'" 1 
ATOM   2909 O  "O4'" . DG  B 2 8   ? -12.336 -31.441 27.646  1.00   63.44 ? 8    DG  P "O4'" 1 
ATOM   2910 C  "C3'" . DG  B 2 8   ? -10.169 -31.009 26.719  1.00   65.29 ? 8    DG  P "C3'" 1 
ATOM   2911 O  "O3'" . DG  B 2 8   ? -9.822  -31.861 25.627  1.00   67.20 ? 8    DG  P "O3'" 1 
ATOM   2912 C  "C2'" . DG  B 2 8   ? -11.160 -29.934 26.296  1.00   63.79 ? 8    DG  P "C2'" 1 
ATOM   2913 C  "C1'" . DG  B 2 8   ? -12.505 -30.622 26.494  1.00   62.32 ? 8    DG  P "C1'" 1 
ATOM   2914 N  N9    . DG  B 2 8   ? -13.624 -29.701 26.720  1.00   59.62 ? 8    DG  P N9    1 
ATOM   2915 C  C8    . DG  B 2 8   ? -13.652 -28.644 27.595  1.00   59.00 ? 8    DG  P C8    1 
ATOM   2916 N  N7    . DG  B 2 8   ? -14.759 -27.953 27.532  1.00   57.31 ? 8    DG  P N7    1 
ATOM   2917 C  C5    . DG  B 2 8   ? -15.519 -28.597 26.564  1.00   54.97 ? 8    DG  P C5    1 
ATOM   2918 C  C6    . DG  B 2 8   ? -16.816 -28.293 26.053  1.00   52.47 ? 8    DG  P C6    1 
ATOM   2919 O  O6    . DG  B 2 8   ? -17.562 -27.358 26.349  1.00   51.51 ? 8    DG  P O6    1 
ATOM   2920 N  N1    . DG  B 2 8   ? -17.218 -29.209 25.095  1.00   50.50 ? 8    DG  P N1    1 
ATOM   2921 C  C2    . DG  B 2 8   ? -16.483 -30.277 24.674  1.00   52.71 ? 8    DG  P C2    1 
ATOM   2922 N  N2    . DG  B 2 8   ? -17.065 -31.047 23.747  1.00   51.65 ? 8    DG  P N2    1 
ATOM   2923 N  N3    . DG  B 2 8   ? -15.267 -30.571 25.127  1.00   55.23 ? 8    DG  P N3    1 
ATOM   2924 C  C4    . DG  B 2 8   ? -14.849 -29.691 26.065  1.00   56.76 ? 8    DG  P C4    1 
ATOM   2925 P  P     . DG  B 2 9   ? -9.013  -31.269 24.371  1.00   70.95 ? 9    DG  P P     1 
ATOM   2926 O  OP1   . DG  B 2 9   ? -7.672  -31.897 24.368  1.00   70.84 ? 9    DG  P OP1   1 
ATOM   2927 O  OP2   . DG  B 2 9   ? -9.140  -29.796 24.300  1.00   69.56 ? 9    DG  P OP2   1 
ATOM   2928 O  "O5'" . DG  B 2 9   ? -9.854  -31.873 23.140  1.00   69.30 ? 9    DG  P "O5'" 1 
ATOM   2929 C  "C5'" . DG  B 2 9   ? -10.760 -32.959 23.359  1.00   66.21 ? 9    DG  P "C5'" 1 
ATOM   2930 C  "C4'" . DG  B 2 9   ? -11.854 -32.938 22.292  1.00   62.08 ? 9    DG  P "C4'" 1 
ATOM   2931 O  "O4'" . DG  B 2 9   ? -12.922 -32.024 22.657  1.00   60.54 ? 9    DG  P "O4'" 1 
ATOM   2932 C  "C3'" . DG  B 2 9   ? -11.307 -32.451 20.953  1.00   60.50 ? 9    DG  P "C3'" 1 
ATOM   2933 O  "O3'" . DG  B 2 9   ? -11.839 -33.257 19.900  1.00   59.27 ? 9    DG  P "O3'" 1 
ATOM   2934 C  "C2'" . DG  B 2 9   ? -11.809 -31.023 20.865  1.00   60.47 ? 9    DG  P "C2'" 1 
ATOM   2935 C  "C1'" . DG  B 2 9   ? -13.140 -31.105 21.597  1.00   59.69 ? 9    DG  P "C1'" 1 
ATOM   2936 N  N9    . DG  B 2 9   ? -13.574 -29.833 22.173  1.00   56.94 ? 9    DG  P N9    1 
ATOM   2937 C  C8    . DG  B 2 9   ? -12.869 -29.061 23.066  1.00   56.59 ? 9    DG  P C8    1 
ATOM   2938 N  N7    . DG  B 2 9   ? -13.497 -27.968 23.406  1.00   55.86 ? 9    DG  P N7    1 
ATOM   2939 C  C5    . DG  B 2 9   ? -14.693 -28.017 22.698  1.00   53.81 ? 9    DG  P C5    1 
ATOM   2940 C  C6    . DG  B 2 9   ? -15.785 -27.105 22.674  1.00   51.01 ? 9    DG  P C6    1 
ATOM   2941 O  O6    . DG  B 2 9   ? -15.911 -26.044 23.283  1.00   50.18 ? 9    DG  P O6    1 
ATOM   2942 N  N1    . DG  B 2 9   ? -16.795 -27.537 21.828  1.00   49.68 ? 9    DG  P N1    1 
ATOM   2943 C  C2    . DG  B 2 9   ? -16.765 -28.687 21.088  1.00   50.44 ? 9    DG  P C2    1 
ATOM   2944 N  N2    . DG  B 2 9   ? -17.833 -28.897 20.305  1.00   49.10 ? 9    DG  P N2    1 
ATOM   2945 N  N3    . DG  B 2 9   ? -15.759 -29.559 21.104  1.00   52.15 ? 9    DG  P N3    1 
ATOM   2946 C  C4    . DG  B 2 9   ? -14.761 -29.161 21.929  1.00   54.57 ? 9    DG  P C4    1 
ATOM   2947 P  P     . DA  B 2 10  ? -11.582 -32.840 18.383  1.00   57.13 ? 10   DA  P P     1 
ATOM   2948 O  OP1   . DA  B 2 10  ? -11.580 -34.097 17.603  1.00   58.82 ? 10   DA  P OP1   1 
ATOM   2949 O  OP2   . DA  B 2 10  ? -10.419 -31.927 18.330  1.00   56.17 ? 10   DA  P OP2   1 
ATOM   2950 O  "O5'" . DA  B 2 10  ? -12.922 -32.026 18.022  1.00   55.68 ? 10   DA  P "O5'" 1 
ATOM   2951 C  "C5'" . DA  B 2 10  ? -14.193 -32.551 18.411  1.00   51.13 ? 10   DA  P "C5'" 1 
ATOM   2952 C  "C4'" . DA  B 2 10  ? -15.310 -31.820 17.668  1.00   48.98 ? 10   DA  P "C4'" 1 
ATOM   2953 O  "O4'" . DA  B 2 10  ? -15.608 -30.567 18.332  1.00   49.21 ? 10   DA  P "O4'" 1 
ATOM   2954 C  "C3'" . DA  B 2 10  ? -14.971 -31.484 16.215  1.00   46.57 ? 10   DA  P "C3'" 1 
ATOM   2955 O  "O3'" . DA  B 2 10  ? -16.117 -31.713 15.391  1.00   44.55 ? 10   DA  P "O3'" 1 
ATOM   2956 C  "C2'" . DA  B 2 10  ? -14.609 -30.010 16.277  1.00   47.46 ? 10   DA  P "C2'" 1 
ATOM   2957 C  "C1'" . DA  B 2 10  ? -15.501 -29.492 17.403  1.00   48.44 ? 10   DA  P "C1'" 1 
ATOM   2958 N  N9    . DA  B 2 10  ? -14.956 -28.336 18.118  1.00   46.40 ? 10   DA  P N9    1 
ATOM   2959 C  C8    . DA  B 2 10  ? -13.671 -28.191 18.567  1.00   45.90 ? 10   DA  P C8    1 
ATOM   2960 N  N7    . DA  B 2 10  ? -13.449 -27.059 19.188  1.00   46.23 ? 10   DA  P N7    1 
ATOM   2961 C  C5    . DA  B 2 10  ? -14.668 -26.407 19.143  1.00   44.91 ? 10   DA  P C5    1 
ATOM   2962 C  C6    . DA  B 2 10  ? -15.092 -25.156 19.644  1.00   43.82 ? 10   DA  P C6    1 
ATOM   2963 N  N6    . DA  B 2 10  ? -14.295 -24.324 20.313  1.00   39.87 ? 10   DA  P N6    1 
ATOM   2964 N  N1    . DA  B 2 10  ? -16.382 -24.798 19.435  1.00   41.84 ? 10   DA  P N1    1 
ATOM   2965 C  C2    . DA  B 2 10  ? -17.179 -25.654 18.776  1.00   43.00 ? 10   DA  P C2    1 
ATOM   2966 N  N3    . DA  B 2 10  ? -16.897 -26.859 18.266  1.00   44.28 ? 10   DA  P N3    1 
ATOM   2967 C  C4    . DA  B 2 10  ? -15.611 -27.180 18.483  1.00   45.59 ? 10   DA  P C4    1 
ATOM   2968 P  P     . DT  B 2 11  ? -16.041 -31.432 13.816  1.00   42.86 ? 11   DT  P P     1 
ATOM   2969 O  OP1   . DT  B 2 11  ? -16.671 -32.546 13.073  1.00   42.15 ? 11   DT  P OP1   1 
ATOM   2970 O  OP2   . DT  B 2 11  ? -14.665 -30.998 13.485  1.00   44.78 ? 11   DT  P OP2   1 
ATOM   2971 O  "O5'" . DT  B 2 11  ? -16.989 -30.148 13.640  1.00   41.29 ? 11   DT  P "O5'" 1 
ATOM   2972 C  "C5'" . DT  B 2 11  ? -18.187 -30.048 14.408  1.00   38.67 ? 11   DT  P "C5'" 1 
ATOM   2973 C  "C4'" . DT  B 2 11  ? -18.811 -28.670 14.203  1.00   36.56 ? 11   DT  P "C4'" 1 
ATOM   2974 O  "O4'" . DT  B 2 11  ? -18.188 -27.676 15.049  1.00   34.89 ? 11   DT  P "O4'" 1 
ATOM   2975 C  "C3'" . DT  B 2 11  ? -18.693 -28.168 12.766  1.00   37.40 ? 11   DT  P "C3'" 1 
ATOM   2976 O  "O3'" . DT  B 2 11  ? -19.984 -27.760 12.307  1.00   38.00 ? 11   DT  P "O3'" 1 
ATOM   2977 C  "C2'" . DT  B 2 11  ? -17.727 -26.996 12.876  1.00   36.69 ? 11   DT  P "C2'" 1 
ATOM   2978 C  "C1'" . DT  B 2 11  ? -17.937 -26.511 14.297  1.00   33.34 ? 11   DT  P "C1'" 1 
ATOM   2979 N  N1    . DT  B 2 11  ? -16.787 -25.806 14.904  1.00   31.37 ? 11   DT  P N1    1 
ATOM   2980 C  C2    . DT  B 2 11  ? -17.046 -24.617 15.534  1.00   31.58 ? 11   DT  P C2    1 
ATOM   2981 O  O2    . DT  B 2 11  ? -18.155 -24.139 15.604  1.00   34.73 ? 11   DT  P O2    1 
ATOM   2982 N  N3    . DT  B 2 11  ? -15.957 -24.000 16.073  1.00   30.84 ? 11   DT  P N3    1 
ATOM   2983 C  C4    . DT  B 2 11  ? -14.648 -24.445 16.044  1.00   32.16 ? 11   DT  P C4    1 
ATOM   2984 O  O4    . DT  B 2 11  ? -13.750 -23.772 16.557  1.00   30.76 ? 11   DT  P O4    1 
ATOM   2985 C  C5    . DT  B 2 11  ? -14.447 -25.698 15.387  1.00   31.85 ? 11   DT  P C5    1 
ATOM   2986 C  C7    . DT  B 2 11  ? -13.067 -26.263 15.349  1.00   31.64 ? 11   DT  P C7    1 
ATOM   2987 C  C6    . DT  B 2 11  ? -15.511 -26.314 14.844  1.00   31.33 ? 11   DT  P C6    1 
ATOM   2988 P  P     . DT  B 2 12  ? -20.143 -27.131 10.857  1.00   36.19 ? 12   DT  P P     1 
ATOM   2989 O  OP1   . DT  B 2 12  ? -21.219 -27.865 10.155  1.00   37.40 ? 12   DT  P OP1   1 
ATOM   2990 O  OP2   . DT  B 2 12  ? -18.813 -26.969 10.229  1.00   41.20 ? 12   DT  P OP2   1 
ATOM   2991 O  "O5'" . DT  B 2 12  ? -20.680 -25.654 11.191  1.00   38.82 ? 12   DT  P "O5'" 1 
ATOM   2992 C  "C5'" . DT  B 2 12  ? -21.781 -25.487 12.085  1.00   36.04 ? 12   DT  P "C5'" 1 
ATOM   2993 C  "C4'" . DT  B 2 12  ? -21.977 -24.003 12.382  1.00   31.57 ? 12   DT  P "C4'" 1 
ATOM   2994 O  "O4'" . DT  B 2 12  ? -20.828 -23.521 13.118  1.00   30.06 ? 12   DT  P "O4'" 1 
ATOM   2995 C  "C3'" . DT  B 2 12  ? -22.061 -23.166 11.112  1.00   32.47 ? 12   DT  P "C3'" 1 
ATOM   2996 O  "O3'" . DT  B 2 12  ? -23.197 -22.301 11.172  1.00   30.60 ? 12   DT  P "O3'" 1 
ATOM   2997 C  "C2'" . DT  B 2 12  ? -20.738 -22.408 11.069  1.00   26.64 ? 12   DT  P "C2'" 1 
ATOM   2998 C  "C1'" . DT  B 2 12  ? -20.319 -22.348 12.532  1.00   28.90 ? 12   DT  P "C1'" 1 
ATOM   2999 N  N1    . DT  B 2 12  ? -18.850 -22.318 12.767  1.00   29.19 ? 12   DT  P N1    1 
ATOM   3000 C  C2    . DT  B 2 12  ? -18.332 -21.333 13.584  1.00   27.94 ? 12   DT  P C2    1 
ATOM   3001 O  O2    . DT  B 2 12  ? -19.017 -20.517 14.150  1.00   32.06 ? 12   DT  P O2    1 
ATOM   3002 N  N3    . DT  B 2 12  ? -16.970 -21.334 13.706  1.00   29.76 ? 12   DT  P N3    1 
ATOM   3003 C  C4    . DT  B 2 12  ? -16.088 -22.203 13.107  1.00   30.64 ? 12   DT  P C4    1 
ATOM   3004 O  O4    . DT  B 2 12  ? -14.893 -22.081 13.298  1.00   30.82 ? 12   DT  P O4    1 
ATOM   3005 C  C5    . DT  B 2 12  ? -16.687 -23.219 12.272  1.00   31.14 ? 12   DT  P C5    1 
ATOM   3006 C  C7    . DT  B 2 12  ? -15.790 -24.188 11.569  1.00   28.99 ? 12   DT  P C7    1 
ATOM   3007 C  C6    . DT  B 2 12  ? -18.024 -23.237 12.156  1.00   30.08 ? 12   DT  P C6    1 
ATOM   3008 P  P     . DC  B 2 13  ? -23.482 -21.318 9.960   1.00   33.07 ? 13   DC  P P     1 
ATOM   3009 O  OP1   . DC  B 2 13  ? -24.905 -20.916 10.053  1.00   37.64 ? 13   DC  P OP1   1 
ATOM   3010 O  OP2   . DC  B 2 13  ? -22.971 -21.942 8.719   1.00   30.54 ? 13   DC  P OP2   1 
ATOM   3011 O  "O5'" . DC  B 2 13  ? -22.574 -20.047 10.339  1.00   32.23 ? 13   DC  P "O5'" 1 
ATOM   3012 C  "C5'" . DC  B 2 13  ? -22.688 -19.450 11.631  1.00   29.15 ? 13   DC  P "C5'" 1 
ATOM   3013 C  "C4'" . DC  B 2 13  ? -22.025 -18.075 11.606  1.00   31.86 ? 13   DC  P "C4'" 1 
ATOM   3014 O  "O4'" . DC  B 2 13  ? -20.614 -18.172 11.912  1.00   34.00 ? 13   DC  P "O4'" 1 
ATOM   3015 C  "C3'" . DC  B 2 13  ? -22.127 -17.422 10.231  1.00   31.70 ? 13   DC  P "C3'" 1 
ATOM   3016 O  "O3'" . DC  B 2 13  ? -22.467 -16.044 10.400  1.00   35.56 ? 13   DC  P "O3'" 1 
ATOM   3017 C  "C2'" . DC  B 2 13  ? -20.729 -17.582 9.663   1.00   32.12 ? 13   DC  P "C2'" 1 
ATOM   3018 C  "C1'" . DC  B 2 13  ? -19.874 -17.507 10.913  1.00   30.67 ? 13   DC  P "C1'" 1 
ATOM   3019 N  N1    . DC  B 2 13  ? -18.564 -18.166 10.826  1.00   29.99 ? 13   DC  P N1    1 
ATOM   3020 C  C2    . DC  B 2 13  ? -17.482 -17.592 11.512  1.00   29.25 ? 13   DC  P C2    1 
ATOM   3021 O  O2    . DC  B 2 13  ? -17.678 -16.553 12.168  1.00   30.25 ? 13   DC  P O2    1 
ATOM   3022 N  N3    . DC  B 2 13  ? -16.257 -18.184 11.448  1.00   25.71 ? 13   DC  P N3    1 
ATOM   3023 C  C4    . DC  B 2 13  ? -16.096 -19.307 10.747  1.00   25.04 ? 13   DC  P C4    1 
ATOM   3024 N  N4    . DC  B 2 13  ? -14.876 -19.853 10.731  1.00   21.92 ? 13   DC  P N4    1 
ATOM   3025 C  C5    . DC  B 2 13  ? -17.183 -19.920 10.035  1.00   23.56 ? 13   DC  P C5    1 
ATOM   3026 C  C6    . DC  B 2 13  ? -18.390 -19.315 10.101  1.00   28.64 ? 13   DC  P C6    1 
HETATM 3027 N  N1    . DOC B 2 14  ? -24.539 -20.090 15.015  1.00   56.55 ? 14   DOC P N1    1 
HETATM 3028 C  C2    . DOC B 2 14  ? -23.248 -20.145 15.578  1.00   58.40 ? 14   DOC P C2    1 
HETATM 3029 N  N3    . DOC B 2 14  ? -22.646 -21.344 15.746  1.00   58.59 ? 14   DOC P N3    1 
HETATM 3030 C  C4    . DOC B 2 14  ? -23.270 -22.461 15.373  1.00   59.27 ? 14   DOC P C4    1 
HETATM 3031 C  C5    . DOC B 2 14  ? -24.567 -22.439 14.772  1.00   58.72 ? 14   DOC P C5    1 
HETATM 3032 C  C6    . DOC B 2 14  ? -25.157 -21.241 14.609  1.00   58.04 ? 14   DOC P C6    1 
HETATM 3033 O  O2    . DOC B 2 14  ? -22.686 -19.093 15.908  1.00   60.18 ? 14   DOC P O2    1 
HETATM 3034 N  N4    . DOC B 2 14  ? -22.637 -23.625 15.584  1.00   59.58 ? 14   DOC P N4    1 
HETATM 3035 C  "C1'" . DOC B 2 14  ? -25.235 -18.784 14.903  1.00   54.33 ? 14   DOC P "C1'" 1 
HETATM 3036 C  "C2'" . DOC B 2 14  ? -24.688 -17.649 15.741  1.00   51.67 ? 14   DOC P "C2'" 1 
HETATM 3037 C  "C3'" . DOC B 2 14  ? -25.278 -16.443 15.042  1.00   50.10 ? 14   DOC P "C3'" 1 
HETATM 3038 C  "C4'" . DOC B 2 14  ? -25.374 -16.873 13.577  1.00   47.91 ? 14   DOC P "C4'" 1 
HETATM 3039 O  "O4'" . DOC B 2 14  ? -25.162 -18.315 13.563  1.00   52.02 ? 14   DOC P "O4'" 1 
HETATM 3040 C  "C5'" . DOC B 2 14  ? -24.372 -16.154 12.672  1.00   44.10 ? 14   DOC P "C5'" 1 
HETATM 3041 O  "O5'" . DOC B 2 14  ? -24.847 -16.172 11.324  1.00   38.49 ? 14   DOC P "O5'" 1 
HETATM 3042 P  P     . DOC B 2 14  ? -23.977 -15.563 10.117  1.00   35.80 ? 14   DOC P P     1 
HETATM 3043 O  OP1   . DOC B 2 14  ? -24.446 -16.268 8.906   1.00   33.43 ? 14   DOC P OP1   1 
HETATM 3044 O  OP2   . DOC B 2 14  ? -23.990 -14.085 10.171  1.00   33.11 ? 14   DOC P OP2   1 
ATOM   3045 O  "O5'" . DA  C 3 3   ? 3.019   -21.152 7.428   0.50   87.03 ? 3    DA  T "O5'" 1 
ATOM   3046 C  "C5'" . DA  C 3 3   ? 3.094   -22.530 7.049   0.50   87.23 ? 3    DA  T "C5'" 1 
ATOM   3047 C  "C4'" . DA  C 3 3   ? 1.731   -23.072 6.613   0.0000 87.62 ? 3    DA  T "C4'" 1 
ATOM   3048 O  "O4'" . DA  C 3 3   ? 1.884   -24.428 6.132   0.10   87.60 ? 3    DA  T "O4'" 1 
ATOM   3049 C  "C3'" . DA  C 3 3   ? 0.685   -23.136 7.724   1.00   87.93 ? 3    DA  T "C3'" 1 
ATOM   3050 O  "O3'" . DA  C 3 3   ? -0.608  -22.877 7.172   1.00   87.77 ? 3    DA  T "O3'" 1 
ATOM   3051 C  "C2'" . DA  C 3 3   ? 0.771   -24.576 8.194   0.50   87.66 ? 3    DA  T "C2'" 1 
ATOM   3052 C  "C1'" . DA  C 3 3   ? 1.087   -25.313 6.904   0.10   87.69 ? 3    DA  T "C1'" 1 
ATOM   3053 N  N9    . DA  C 3 3   ? 1.844   -26.550 7.080   0.10   87.72 ? 3    DA  T N9    1 
ATOM   3054 C  C8    . DA  C 3 3   ? 1.626   -27.760 6.469   0.10   87.69 ? 3    DA  T C8    1 
ATOM   3055 N  N7    . DA  C 3 3   ? 2.475   -28.693 6.826   0.10   87.73 ? 3    DA  T N7    1 
ATOM   3056 C  C5    . DA  C 3 3   ? 3.310   -28.054 7.732   0.10   87.72 ? 3    DA  T C5    1 
ATOM   3057 C  C6    . DA  C 3 3   ? 4.420   -28.497 8.469   0.10   87.68 ? 3    DA  T C6    1 
ATOM   3058 N  N6    . DA  C 3 3   ? 4.900   -29.741 8.410   0.10   87.73 ? 3    DA  T N6    1 
ATOM   3059 N  N1    . DA  C 3 3   ? 5.031   -27.606 9.280   0.10   87.70 ? 3    DA  T N1    1 
ATOM   3060 C  C2    . DA  C 3 3   ? 4.551   -26.358 9.337   0.10   87.69 ? 3    DA  T C2    1 
ATOM   3061 N  N3    . DA  C 3 3   ? 3.516   -25.824 8.696   0.10   87.76 ? 3    DA  T N3    1 
ATOM   3062 C  C4    . DA  C 3 3   ? 2.931   -26.735 7.900   0.10   87.72 ? 3    DA  T C4    1 
ATOM   3063 P  P     . DC  C 3 4   ? -1.623  -21.890 7.933   1.00   87.24 ? 4    DC  T P     1 
ATOM   3064 O  OP1   . DC  C 3 4   ? -1.256  -21.934 9.366   1.00   86.73 ? 4    DC  T OP1   1 
ATOM   3065 O  OP2   . DC  C 3 4   ? -3.004  -22.220 7.518   1.00   87.48 ? 4    DC  T OP2   1 
ATOM   3066 O  "O5'" . DC  C 3 4   ? -1.282  -20.426 7.353   1.00   84.27 ? 4    DC  T "O5'" 1 
ATOM   3067 C  "C5'" . DC  C 3 4   ? -0.296  -19.602 7.981   1.00   79.36 ? 4    DC  T "C5'" 1 
ATOM   3068 C  "C4'" . DC  C 3 4   ? -0.573  -18.123 7.703   1.00   74.88 ? 4    DC  T "C4'" 1 
ATOM   3069 O  "O4'" . DC  C 3 4   ? -0.327  -17.863 6.296   1.00   75.78 ? 4    DC  T "O4'" 1 
ATOM   3070 C  "C3'" . DC  C 3 4   ? -1.992  -17.636 8.004   1.00   71.18 ? 4    DC  T "C3'" 1 
ATOM   3071 O  "O3'" . DC  C 3 4   ? -1.967  -16.304 8.529   1.00   64.88 ? 4    DC  T "O3'" 1 
ATOM   3072 C  "C2'" . DC  C 3 4   ? -2.643  -17.686 6.628   1.00   71.73 ? 4    DC  T "C2'" 1 
ATOM   3073 C  "C1'" . DC  C 3 4   ? -1.487  -17.366 5.658   1.00   74.54 ? 4    DC  T "C1'" 1 
ATOM   3074 N  N1    . DC  C 3 4   ? -1.532  -17.967 4.292   1.00   74.78 ? 4    DC  T N1    1 
ATOM   3075 C  C2    . DC  C 3 4   ? -1.138  -17.191 3.171   1.00   74.60 ? 4    DC  T C2    1 
ATOM   3076 O  O2    . DC  C 3 4   ? -0.752  -16.022 3.348   1.00   73.85 ? 4    DC  T O2    1 
ATOM   3077 N  N3    . DC  C 3 4   ? -1.191  -17.748 1.930   1.00   74.45 ? 4    DC  T N3    1 
ATOM   3078 C  C4    . DC  C 3 4   ? -1.611  -19.012 1.780   1.00   74.41 ? 4    DC  T C4    1 
ATOM   3079 N  N4    . DC  C 3 4   ? -1.666  -19.516 0.539   1.00   73.81 ? 4    DC  T N4    1 
ATOM   3080 C  C5    . DC  C 3 4   ? -2.000  -19.815 2.894   1.00   73.96 ? 4    DC  T C5    1 
ATOM   3081 C  C6    . DC  C 3 4   ? -1.946  -19.259 4.115   1.00   74.40 ? 4    DC  T C6    1 
HETATM 3082 P  P     . 8OG C 3 5   ? -1.879  -16.055 10.122  1.00   61.57 ? 5    8OG T P     1 
HETATM 3083 O  OP1   . 8OG C 3 5   ? -0.512  -15.506 9.902   1.00   63.88 ? 5    8OG T OP1   1 
HETATM 3084 O  OP2   . 8OG C 3 5   ? -2.128  -17.497 10.381  1.00   62.35 ? 5    8OG T OP2   1 
HETATM 3085 O  "O5'" . 8OG C 3 5   ? -3.028  -14.926 10.151  1.00   58.22 ? 5    8OG T "O5'" 1 
HETATM 3086 C  "C5'" . 8OG C 3 5   ? -4.424  -15.190 9.983   1.00   53.00 ? 5    8OG T "C5'" 1 
HETATM 3087 C  "C4'" . 8OG C 3 5   ? -5.213  -14.160 10.793  1.00   49.02 ? 5    8OG T "C4'" 1 
HETATM 3088 O  "O4'" . 8OG C 3 5   ? -6.593  -14.297 10.414  1.00   48.75 ? 5    8OG T "O4'" 1 
HETATM 3089 C  "C3'" . 8OG C 3 5   ? -5.200  -14.443 12.286  1.00   48.62 ? 5    8OG T "C3'" 1 
HETATM 3090 O  "O3'" . 8OG C 3 5   ? -5.713  -13.305 12.983  1.00   48.29 ? 5    8OG T "O3'" 1 
HETATM 3091 C  "C2'" . 8OG C 3 5   ? -6.176  -15.617 12.345  1.00   45.57 ? 5    8OG T "C2'" 1 
HETATM 3092 C  "C1'" . 8OG C 3 5   ? -7.269  -15.027 11.451  1.00   44.38 ? 5    8OG T "C1'" 1 
HETATM 3093 N  N9    . 8OG C 3 5   ? -8.198  -15.999 10.832  1.00   40.58 ? 5    8OG T N9    1 
HETATM 3094 C  C8    . 8OG C 3 5   ? -7.896  -17.166 10.273  1.00   42.30 ? 5    8OG T C8    1 
HETATM 3095 N  N7    . 8OG C 3 5   ? -8.960  -17.689 9.661   1.00   38.23 ? 5    8OG T N7    1 
HETATM 3096 C  C5    . 8OG C 3 5   ? -9.964  -16.837 9.841   1.00   34.77 ? 5    8OG T C5    1 
HETATM 3097 C  C6    . 8OG C 3 5   ? -11.288 -16.836 9.429   1.00   33.66 ? 5    8OG T C6    1 
HETATM 3098 O  O6    . 8OG C 3 5   ? -11.741 -17.763 8.755   1.00   30.43 ? 5    8OG T O6    1 
HETATM 3099 N  N1    . 8OG C 3 5   ? -12.109 -15.758 9.785   1.00   32.90 ? 5    8OG T N1    1 
HETATM 3100 C  C2    . 8OG C 3 5   ? -11.579 -14.711 10.549  1.00   34.25 ? 5    8OG T C2    1 
HETATM 3101 N  N2    . 8OG C 3 5   ? -12.358 -13.696 10.906  1.00   33.02 ? 5    8OG T N2    1 
HETATM 3102 N  N3    . 8OG C 3 5   ? -10.287 -14.745 10.927  1.00   36.46 ? 5    8OG T N3    1 
HETATM 3103 C  C4    . 8OG C 3 5   ? -9.488  -15.762 10.593  1.00   37.41 ? 5    8OG T C4    1 
HETATM 3104 O  O8    . 8OG C 3 5   ? -6.799  -17.716 10.335  1.00   46.22 ? 5    8OG T O8    1 
ATOM   3105 P  P     . DG  C 3 6   ? -5.500  -13.147 14.555  1.00   47.04 ? 6    DG  T P     1 
ATOM   3106 O  OP1   . DG  C 3 6   ? -4.938  -11.810 14.853  1.00   45.65 ? 6    DG  T OP1   1 
ATOM   3107 O  OP2   . DG  C 3 6   ? -4.847  -14.371 15.070  1.00   47.79 ? 6    DG  T OP2   1 
ATOM   3108 O  "O5'" . DG  C 3 6   ? -7.023  -13.107 15.060  1.00   44.05 ? 6    DG  T "O5'" 1 
ATOM   3109 C  "C5'" . DG  C 3 6   ? -7.916  -12.143 14.501  1.00   40.33 ? 6    DG  T "C5'" 1 
ATOM   3110 C  "C4'" . DG  C 3 6   ? -9.349  -12.470 14.913  1.00   37.45 ? 6    DG  T "C4'" 1 
ATOM   3111 O  "O4'" . DG  C 3 6   ? -9.905  -13.552 14.134  1.00   36.77 ? 6    DG  T "O4'" 1 
ATOM   3112 C  "C3'" . DG  C 3 6   ? -9.430  -12.916 16.362  1.00   38.11 ? 6    DG  T "C3'" 1 
ATOM   3113 O  "O3'" . DG  C 3 6   ? -10.402 -12.100 17.010  1.00   39.38 ? 6    DG  T "O3'" 1 
ATOM   3114 C  "C2'" . DG  C 3 6   ? -9.914  -14.354 16.285  1.00   37.30 ? 6    DG  T "C2'" 1 
ATOM   3115 C  "C1'" . DG  C 3 6   ? -10.702 -14.325 14.999  1.00   35.53 ? 6    DG  T "C1'" 1 
ATOM   3116 N  N9    . DG  C 3 6   ? -10.977 -15.601 14.347  1.00   29.79 ? 6    DG  T N9    1 
ATOM   3117 C  C8    . DG  C 3 6   ? -10.117 -16.637 14.153  1.00   31.81 ? 6    DG  T C8    1 
ATOM   3118 N  N7    . DG  C 3 6   ? -10.650 -17.628 13.488  1.00   32.67 ? 6    DG  T N7    1 
ATOM   3119 C  C5    . DG  C 3 6   ? -11.942 -17.214 13.235  1.00   31.27 ? 6    DG  T C5    1 
ATOM   3120 C  C6    . DG  C 3 6   ? -12.994 -17.861 12.519  1.00   32.72 ? 6    DG  T C6    1 
ATOM   3121 O  O6    . DG  C 3 6   ? -12.984 -18.964 11.948  1.00   30.51 ? 6    DG  T O6    1 
ATOM   3122 N  N1    . DG  C 3 6   ? -14.145 -17.083 12.497  1.00   31.36 ? 6    DG  T N1    1 
ATOM   3123 C  C2    . DG  C 3 6   ? -14.272 -15.851 13.095  1.00   31.87 ? 6    DG  T C2    1 
ATOM   3124 N  N2    . DG  C 3 6   ? -15.473 -15.258 12.962  1.00   29.95 ? 6    DG  T N2    1 
ATOM   3125 N  N3    . DG  C 3 6   ? -13.297 -15.243 13.770  1.00   30.17 ? 6    DG  T N3    1 
ATOM   3126 C  C4    . DG  C 3 6   ? -12.167 -15.974 13.783  1.00   30.29 ? 6    DG  T C4    1 
ATOM   3127 P  P     . DA  C 3 7   ? -10.359 -11.973 18.574  1.00   42.30 ? 7    DA  T P     1 
ATOM   3128 O  OP1   . DA  C 3 7   ? -9.900  -10.610 18.923  1.00   43.46 ? 7    DA  T OP1   1 
ATOM   3129 O  OP2   . DA  C 3 7   ? -9.639  -13.157 19.090  1.00   47.05 ? 7    DA  T OP2   1 
ATOM   3130 O  "O5'" . DA  C 3 7   ? -11.922 -12.085 18.924  1.00   42.82 ? 7    DA  T "O5'" 1 
ATOM   3131 C  "C5'" . DA  C 3 7   ? -12.857 -11.411 18.080  1.00   38.34 ? 7    DA  T "C5'" 1 
ATOM   3132 C  "C4'" . DA  C 3 7   ? -14.174 -12.182 18.059  1.00   34.94 ? 7    DA  T "C4'" 1 
ATOM   3133 O  "O4'" . DA  C 3 7   ? -14.081 -13.352 17.204  1.00   32.16 ? 7    DA  T "O4'" 1 
ATOM   3134 C  "C3'" . DA  C 3 7   ? -14.516 -12.699 19.448  1.00   33.48 ? 7    DA  T "C3'" 1 
ATOM   3135 O  "O3'" . DA  C 3 7   ? -15.892 -12.428 19.717  1.00   33.74 ? 7    DA  T "O3'" 1 
ATOM   3136 C  "C2'" . DA  C 3 7   ? -14.269 -14.190 19.328  1.00   32.95 ? 7    DA  T "C2'" 1 
ATOM   3137 C  "C1'" . DA  C 3 7   ? -14.654 -14.435 17.883  1.00   28.28 ? 7    DA  T "C1'" 1 
ATOM   3138 N  N9    . DA  C 3 7   ? -14.138 -15.667 17.306  1.00   25.23 ? 7    DA  T N9    1 
ATOM   3139 C  C8    . DA  C 3 7   ? -12.860 -16.132 17.384  1.00   24.41 ? 7    DA  T C8    1 
ATOM   3140 N  N7    . DA  C 3 7   ? -12.678 -17.275 16.777  1.00   25.48 ? 7    DA  T N7    1 
ATOM   3141 C  C5    . DA  C 3 7   ? -13.920 -17.576 16.245  1.00   23.37 ? 7    DA  T C5    1 
ATOM   3142 C  C6    . DA  C 3 7   ? -14.374 -18.667 15.496  1.00   26.96 ? 7    DA  T C6    1 
ATOM   3143 N  N6    . DA  C 3 7   ? -13.554 -19.644 15.072  1.00   28.65 ? 7    DA  T N6    1 
ATOM   3144 N  N1    . DA  C 3 7   ? -15.700 -18.723 15.181  1.00   26.03 ? 7    DA  T N1    1 
ATOM   3145 C  C2    . DA  C 3 7   ? -16.482 -17.716 15.577  1.00   23.46 ? 7    DA  T C2    1 
ATOM   3146 N  N3    . DA  C 3 7   ? -16.155 -16.611 16.264  1.00   27.03 ? 7    DA  T N3    1 
ATOM   3147 C  C4    . DA  C 3 7   ? -14.839 -16.608 16.577  1.00   26.39 ? 7    DA  T C4    1 
ATOM   3148 P  P     . DA  C 3 8   ? -16.378 -12.364 21.227  1.00   33.85 ? 8    DA  T P     1 
ATOM   3149 O  OP1   . DA  C 3 8   ? -17.135 -11.120 21.490  1.00   38.71 ? 8    DA  T OP1   1 
ATOM   3150 O  OP2   . DA  C 3 8   ? -15.172 -12.675 22.026  1.00   39.07 ? 8    DA  T OP2   1 
ATOM   3151 O  "O5'" . DA  C 3 8   ? -17.392 -13.603 21.262  1.00   32.84 ? 8    DA  T "O5'" 1 
ATOM   3152 C  "C5'" . DA  C 3 8   ? -17.239 -14.617 20.270  1.00   35.27 ? 8    DA  T "C5'" 1 
ATOM   3153 C  "C4'" . DA  C 3 8   ? -18.580 -15.300 20.030  1.00   33.99 ? 8    DA  T "C4'" 1 
ATOM   3154 O  "O4'" . DA  C 3 8   ? -18.330 -16.343 19.075  1.00   34.36 ? 8    DA  T "O4'" 1 
ATOM   3155 C  "C3'" . DA  C 3 8   ? -19.110 -15.964 21.286  1.00   33.29 ? 8    DA  T "C3'" 1 
ATOM   3156 O  "O3'" . DA  C 3 8   ? -20.526 -15.795 21.364  1.00   37.10 ? 8    DA  T "O3'" 1 
ATOM   3157 C  "C2'" . DA  C 3 8   ? -18.654 -17.405 21.163  1.00   31.09 ? 8    DA  T "C2'" 1 
ATOM   3158 C  "C1'" . DA  C 3 8   ? -18.377 -17.618 19.680  1.00   31.01 ? 8    DA  T "C1'" 1 
ATOM   3159 N  N9    . DA  C 3 8   ? -17.087 -18.264 19.430  1.00   28.86 ? 8    DA  T N9    1 
ATOM   3160 C  C8    . DA  C 3 8   ? -15.882 -17.946 19.988  1.00   22.95 ? 8    DA  T C8    1 
ATOM   3161 N  N7    . DA  C 3 8   ? -14.917 -18.786 19.672  1.00   27.87 ? 8    DA  T N7    1 
ATOM   3162 C  C5    . DA  C 3 8   ? -15.528 -19.695 18.817  1.00   25.29 ? 8    DA  T C5    1 
ATOM   3163 C  C6    . DA  C 3 8   ? -15.070 -20.860 18.173  1.00   23.94 ? 8    DA  T C6    1 
ATOM   3164 N  N6    . DA  C 3 8   ? -13.824 -21.343 18.273  1.00   24.79 ? 8    DA  T N6    1 
ATOM   3165 N  N1    . DA  C 3 8   ? -15.952 -21.538 17.415  1.00   26.39 ? 8    DA  T N1    1 
ATOM   3166 C  C2    . DA  C 3 8   ? -17.196 -21.075 17.316  1.00   23.88 ? 8    DA  T C2    1 
ATOM   3167 N  N3    . DA  C 3 8   ? -17.743 -20.010 17.874  1.00   24.42 ? 8    DA  T N3    1 
ATOM   3168 C  C4    . DA  C 3 8   ? -16.854 -19.359 18.628  1.00   26.26 ? 8    DA  T C4    1 
ATOM   3169 P  P     . DT  C 3 9   ? -21.358 -16.547 22.512  1.00   40.52 ? 9    DT  T P     1 
ATOM   3170 O  OP1   . DT  C 3 9   ? -22.617 -15.800 22.727  1.00   43.33 ? 9    DT  T OP1   1 
ATOM   3171 O  OP2   . DT  C 3 9   ? -20.484 -16.862 23.663  1.00   39.47 ? 9    DT  T OP2   1 
ATOM   3172 O  "O5'" . DT  C 3 9   ? -21.760 -17.909 21.762  1.00   39.65 ? 9    DT  T "O5'" 1 
ATOM   3173 C  "C5'" . DT  C 3 9   ? -22.119 -17.846 20.382  1.00   37.49 ? 9    DT  T "C5'" 1 
ATOM   3174 C  "C4'" . DT  C 3 9   ? -22.272 -19.256 19.815  1.00   37.94 ? 9    DT  T "C4'" 1 
ATOM   3175 O  "O4'" . DT  C 3 9   ? -20.974 -19.856 19.625  1.00   37.22 ? 9    DT  T "O4'" 1 
ATOM   3176 C  "C3'" . DT  C 3 9   ? -23.063 -20.210 20.701  1.00   36.91 ? 9    DT  T "C3'" 1 
ATOM   3177 O  "O3'" . DT  C 3 9   ? -23.997 -20.923 19.889  1.00   37.84 ? 9    DT  T "O3'" 1 
ATOM   3178 C  "C2'" . DT  C 3 9   ? -22.006 -21.147 21.259  1.00   35.78 ? 9    DT  T "C2'" 1 
ATOM   3179 C  "C1'" . DT  C 3 9   ? -20.976 -21.168 20.150  1.00   36.40 ? 9    DT  T "C1'" 1 
ATOM   3180 N  N1    . DT  C 3 9   ? -19.599 -21.466 20.573  1.00   35.36 ? 9    DT  T N1    1 
ATOM   3181 C  C2    . DT  C 3 9   ? -18.956 -22.503 19.955  1.00   33.31 ? 9    DT  T C2    1 
ATOM   3182 O  O2    . DT  C 3 9   ? -19.489 -23.203 19.105  1.00   34.44 ? 9    DT  T O2    1 
ATOM   3183 N  N3    . DT  C 3 9   ? -17.661 -22.694 20.367  1.00   34.98 ? 9    DT  T N3    1 
ATOM   3184 C  C4    . DT  C 3 9   ? -16.969 -21.962 21.319  1.00   34.98 ? 9    DT  T C4    1 
ATOM   3185 O  O4    . DT  C 3 9   ? -15.807 -22.248 21.587  1.00   38.36 ? 9    DT  T O4    1 
ATOM   3186 C  C5    . DT  C 3 9   ? -17.708 -20.898 21.931  1.00   33.75 ? 9    DT  T C5    1 
ATOM   3187 C  C7    . DT  C 3 9   ? -17.038 -20.052 22.961  1.00   34.44 ? 9    DT  T C7    1 
ATOM   3188 C  C6    . DT  C 3 9   ? -18.973 -20.709 21.544  1.00   34.76 ? 9    DT  T C6    1 
ATOM   3189 P  P     . DC  C 3 10  ? -25.162 -21.757 20.587  1.00   40.75 ? 10   DC  T P     1 
ATOM   3190 O  OP1   . DC  C 3 10  ? -26.456 -21.269 20.058  1.00   42.27 ? 10   DC  T OP1   1 
ATOM   3191 O  OP2   . DC  C 3 10  ? -24.918 -21.755 22.047  1.00   42.87 ? 10   DC  T OP2   1 
ATOM   3192 O  "O5'" . DC  C 3 10  ? -24.888 -23.240 20.031  1.00   38.59 ? 10   DC  T "O5'" 1 
ATOM   3193 C  "C5'" . DC  C 3 10  ? -24.522 -23.401 18.661  1.00   38.77 ? 10   DC  T "C5'" 1 
ATOM   3194 C  "C4'" . DC  C 3 10  ? -23.747 -24.703 18.468  1.00   38.55 ? 10   DC  T "C4'" 1 
ATOM   3195 O  "O4'" . DC  C 3 10  ? -22.417 -24.620 19.033  1.00   39.04 ? 10   DC  T "O4'" 1 
ATOM   3196 C  "C3'" . DC  C 3 10  ? -24.405 -25.924 19.094  1.00   38.76 ? 10   DC  T "C3'" 1 
ATOM   3197 O  "O3'" . DC  C 3 10  ? -24.356 -26.996 18.151  1.00   42.59 ? 10   DC  T "O3'" 1 
ATOM   3198 C  "C2'" . DC  C 3 10  ? -23.521 -26.241 20.289  1.00   38.83 ? 10   DC  T "C2'" 1 
ATOM   3199 C  "C1'" . DC  C 3 10  ? -22.167 -25.804 19.785  1.00   38.99 ? 10   DC  T "C1'" 1 
ATOM   3200 N  N1    . DC  C 3 10  ? -21.162 -25.492 20.813  1.00   37.28 ? 10   DC  T N1    1 
ATOM   3201 C  C2    . DC  C 3 10  ? -19.936 -26.160 20.774  1.00   37.29 ? 10   DC  T C2    1 
ATOM   3202 O  O2    . DC  C 3 10  ? -19.761 -27.047 19.922  1.00   36.12 ? 10   DC  T O2    1 
ATOM   3203 N  N3    . DC  C 3 10  ? -18.971 -25.822 21.667  1.00   38.18 ? 10   DC  T N3    1 
ATOM   3204 C  C4    . DC  C 3 10  ? -19.202 -24.869 22.571  1.00   36.17 ? 10   DC  T C4    1 
ATOM   3205 N  N4    . DC  C 3 10  ? -18.204 -24.546 23.417  1.00   31.27 ? 10   DC  T N4    1 
ATOM   3206 C  C5    . DC  C 3 10  ? -20.461 -24.199 22.650  1.00   35.27 ? 10   DC  T C5    1 
ATOM   3207 C  C6    . DC  C 3 10  ? -21.403 -24.545 21.769  1.00   35.27 ? 10   DC  T C6    1 
ATOM   3208 P  P     . DC  C 3 11  ? -25.171 -28.331 18.446  1.00   45.07 ? 11   DC  T P     1 
ATOM   3209 O  OP1   . DC  C 3 11  ? -25.448 -28.975 17.143  1.00   45.45 ? 11   DC  T OP1   1 
ATOM   3210 O  OP2   . DC  C 3 11  ? -26.285 -27.951 19.343  1.00   44.72 ? 11   DC  T OP2   1 
ATOM   3211 O  "O5'" . DC  C 3 11  ? -24.113 -29.235 19.249  1.00   41.83 ? 11   DC  T "O5'" 1 
ATOM   3212 C  "C5'" . DC  C 3 11  ? -22.984 -29.794 18.574  1.00   42.84 ? 11   DC  T "C5'" 1 
ATOM   3213 C  "C4'" . DC  C 3 11  ? -22.234 -30.714 19.535  1.00   45.31 ? 11   DC  T "C4'" 1 
ATOM   3214 O  "O4'" . DC  C 3 11  ? -21.481 -29.924 20.490  1.00   45.08 ? 11   DC  T "O4'" 1 
ATOM   3215 C  "C3'" . DC  C 3 11  ? -23.181 -31.576 20.370  1.00   47.57 ? 11   DC  T "C3'" 1 
ATOM   3216 O  "O3'" . DC  C 3 11  ? -22.579 -32.855 20.579  1.00   53.63 ? 11   DC  T "O3'" 1 
ATOM   3217 C  "C2'" . DC  C 3 11  ? -23.227 -30.842 21.697  1.00   45.24 ? 11   DC  T "C2'" 1 
ATOM   3218 C  "C1'" . DC  C 3 11  ? -21.795 -30.365 21.794  1.00   41.63 ? 11   DC  T "C1'" 1 
ATOM   3219 N  N1    . DC  C 3 11  ? -21.527 -29.268 22.739  1.00   40.71 ? 11   DC  T N1    1 
ATOM   3220 C  C2    . DC  C 3 11  ? -20.264 -29.194 23.309  1.00   39.66 ? 11   DC  T C2    1 
ATOM   3221 O  O2    . DC  C 3 11  ? -19.411 -30.022 22.964  1.00   42.26 ? 11   DC  T O2    1 
ATOM   3222 N  N3    . DC  C 3 11  ? -19.994 -28.225 24.216  1.00   38.10 ? 11   DC  T N3    1 
ATOM   3223 C  C4    . DC  C 3 11  ? -20.928 -27.342 24.540  1.00   38.22 ? 11   DC  T C4    1 
ATOM   3224 N  N4    . DC  C 3 11  ? -20.603 -26.405 25.421  1.00   38.99 ? 11   DC  T N4    1 
ATOM   3225 C  C5    . DC  C 3 11  ? -22.236 -27.382 23.968  1.00   39.87 ? 11   DC  T C5    1 
ATOM   3226 C  C6    . DC  C 3 11  ? -22.488 -28.353 23.073  1.00   40.23 ? 11   DC  T C6    1 
ATOM   3227 P  P     . DT  C 3 12  ? -23.301 -34.172 20.037  1.00   57.05 ? 12   DT  T P     1 
ATOM   3228 O  OP1   . DT  C 3 12  ? -23.579 -33.963 18.599  1.00   57.76 ? 12   DT  T OP1   1 
ATOM   3229 O  OP2   . DT  C 3 12  ? -24.401 -34.516 20.965  1.00   60.06 ? 12   DT  T OP2   1 
ATOM   3230 O  "O5'" . DT  C 3 12  ? -22.158 -35.292 20.190  1.00   59.43 ? 12   DT  T "O5'" 1 
ATOM   3231 C  "C5'" . DT  C 3 12  ? -20.792 -34.988 19.892  1.00   60.86 ? 12   DT  T "C5'" 1 
ATOM   3232 C  "C4'" . DT  C 3 12  ? -19.910 -35.373 21.080  1.00   61.85 ? 12   DT  T "C4'" 1 
ATOM   3233 O  "O4'" . DT  C 3 12  ? -19.763 -34.264 22.008  1.00   60.54 ? 12   DT  T "O4'" 1 
ATOM   3234 C  "C3'" . DT  C 3 12  ? -20.493 -36.536 21.889  1.00   62.92 ? 12   DT  T "C3'" 1 
ATOM   3235 O  "O3'" . DT  C 3 12  ? -19.468 -37.465 22.251  1.00   65.87 ? 12   DT  T "O3'" 1 
ATOM   3236 C  "C2'" . DT  C 3 12  ? -21.042 -35.848 23.126  1.00   61.49 ? 12   DT  T "C2'" 1 
ATOM   3237 C  "C1'" . DT  C 3 12  ? -20.026 -34.734 23.319  1.00   58.58 ? 12   DT  T "C1'" 1 
ATOM   3238 N  N1    . DT  C 3 12  ? -20.484 -33.602 24.163  1.00   54.27 ? 12   DT  T N1    1 
ATOM   3239 C  C2    . DT  C 3 12  ? -19.586 -33.027 25.038  1.00   53.14 ? 12   DT  T C2    1 
ATOM   3240 O  O2    . DT  C 3 12  ? -18.425 -33.377 25.132  1.00   55.65 ? 12   DT  T O2    1 
ATOM   3241 N  N3    . DT  C 3 12  ? -20.102 -32.027 25.814  1.00   50.41 ? 12   DT  T N3    1 
ATOM   3242 C  C4    . DT  C 3 12  ? -21.395 -31.561 25.814  1.00   49.40 ? 12   DT  T C4    1 
ATOM   3243 O  O4    . DT  C 3 12  ? -21.717 -30.668 26.589  1.00   47.02 ? 12   DT  T O4    1 
ATOM   3244 C  C5    . DT  C 3 12  ? -22.282 -32.204 24.865  1.00   49.31 ? 12   DT  T C5    1 
ATOM   3245 C  C7    . DT  C 3 12  ? -23.714 -31.778 24.797  1.00   50.13 ? 12   DT  T C7    1 
ATOM   3246 C  C6    . DT  C 3 12  ? -21.783 -33.166 24.091  1.00   51.03 ? 12   DT  T C6    1 
ATOM   3247 P  P     . DT  C 3 13  ? -19.822 -38.728 23.198  1.00   68.08 ? 13   DT  T P     1 
ATOM   3248 O  OP1   . DT  C 3 13  ? -19.333 -39.928 22.482  1.00   68.90 ? 13   DT  T OP1   1 
ATOM   3249 O  OP2   . DT  C 3 13  ? -21.241 -38.653 23.616  1.00   65.36 ? 13   DT  T OP2   1 
ATOM   3250 O  "O5'" . DT  C 3 13  ? -18.873 -38.498 24.479  1.00   64.95 ? 13   DT  T "O5'" 1 
ATOM   3251 C  "C5'" . DT  C 3 13  ? -17.502 -38.138 24.286  1.00   61.21 ? 13   DT  T "C5'" 1 
ATOM   3252 C  "C4'" . DT  C 3 13  ? -16.815 -37.849 25.623  1.00   58.14 ? 13   DT  T "C4'" 1 
ATOM   3253 O  "O4'" . DT  C 3 13  ? -17.300 -36.615 26.202  1.00   55.88 ? 13   DT  T "O4'" 1 
ATOM   3254 C  "C3'" . DT  C 3 13  ? -16.959 -38.920 26.701  1.00   58.40 ? 13   DT  T "C3'" 1 
ATOM   3255 O  "O3'" . DT  C 3 13  ? -15.667 -39.147 27.270  1.00   60.66 ? 13   DT  T "O3'" 1 
ATOM   3256 C  "C2'" . DT  C 3 13  ? -17.948 -38.307 27.686  1.00   55.61 ? 13   DT  T "C2'" 1 
ATOM   3257 C  "C1'" . DT  C 3 13  ? -17.696 -36.811 27.549  1.00   52.32 ? 13   DT  T "C1'" 1 
ATOM   3258 N  N1    . DT  C 3 13  ? -18.861 -35.922 27.807  1.00   47.97 ? 13   DT  T N1    1 
ATOM   3259 C  C2    . DT  C 3 13  ? -18.699 -34.866 28.676  1.00   45.33 ? 13   DT  T C2    1 
ATOM   3260 O  O2    . DT  C 3 13  ? -17.666 -34.652 29.271  1.00   45.84 ? 13   DT  T O2    1 
ATOM   3261 N  N3    . DT  C 3 13  ? -19.803 -34.069 28.832  1.00   42.59 ? 13   DT  T N3    1 
ATOM   3262 C  C4    . DT  C 3 13  ? -21.044 -34.234 28.239  1.00   43.30 ? 13   DT  T C4    1 
ATOM   3263 O  O4    . DT  C 3 13  ? -21.960 -33.440 28.480  1.00   42.46 ? 13   DT  T O4    1 
ATOM   3264 C  C5    . DT  C 3 13  ? -21.155 -35.374 27.362  1.00   43.70 ? 13   DT  T C5    1 
ATOM   3265 C  C7    . DT  C 3 13  ? -22.473 -35.654 26.707  1.00   41.01 ? 13   DT  T C7    1 
ATOM   3266 C  C6    . DT  C 3 13  ? -20.068 -36.146 27.183  1.00   46.01 ? 13   DT  T C6    1 
ATOM   3267 P  P     . DC  C 3 14  ? -15.451 -40.302 28.368  1.00   63.40 ? 14   DC  T P     1 
ATOM   3268 O  OP1   . DC  C 3 14  ? -14.180 -40.993 28.050  1.00   62.75 ? 14   DC  T OP1   1 
ATOM   3269 O  OP2   . DC  C 3 14  ? -16.684 -41.094 28.574  1.00   62.58 ? 14   DC  T OP2   1 
ATOM   3270 O  "O5'" . DC  C 3 14  ? -15.225 -39.421 29.693  1.00   62.13 ? 14   DC  T "O5'" 1 
ATOM   3271 C  "C5'" . DC  C 3 14  ? -14.333 -38.306 29.645  1.00   62.67 ? 14   DC  T "C5'" 1 
ATOM   3272 C  "C4'" . DC  C 3 14  ? -14.352 -37.565 30.981  1.00   62.72 ? 14   DC  T "C4'" 1 
ATOM   3273 O  "O4'" . DC  C 3 14  ? -15.510 -36.705 31.079  1.00   60.58 ? 14   DC  T "O4'" 1 
ATOM   3274 C  "C3'" . DC  C 3 14  ? -14.408 -38.507 32.175  1.00   63.70 ? 14   DC  T "C3'" 1 
ATOM   3275 O  "O3'" . DC  C 3 14  ? -13.488 -38.048 33.167  1.00   65.24 ? 14   DC  T "O3'" 1 
ATOM   3276 C  "C2'" . DC  C 3 14  ? -15.855 -38.425 32.634  1.00   60.62 ? 14   DC  T "C2'" 1 
ATOM   3277 C  "C1'" . DC  C 3 14  ? -16.253 -37.011 32.241  1.00   58.69 ? 14   DC  T "C1'" 1 
ATOM   3278 N  N1    . DC  C 3 14  ? -17.680 -36.835 31.918  1.00   56.40 ? 14   DC  T N1    1 
ATOM   3279 C  C2    . DC  C 3 14  ? -18.359 -35.747 32.458  1.00   54.90 ? 14   DC  T C2    1 
ATOM   3280 O  O2    . DC  C 3 14  ? -17.739 -34.946 33.172  1.00   56.88 ? 14   DC  T O2    1 
ATOM   3281 N  N3    . DC  C 3 14  ? -19.671 -35.588 32.196  1.00   54.24 ? 14   DC  T N3    1 
ATOM   3282 C  C4    . DC  C 3 14  ? -20.307 -36.464 31.422  1.00   54.26 ? 14   DC  T C4    1 
ATOM   3283 N  N4    . DC  C 3 14  ? -21.610 -36.274 31.207  1.00   53.77 ? 14   DC  T N4    1 
ATOM   3284 C  C5    . DC  C 3 14  ? -19.638 -37.575 30.839  1.00   55.46 ? 14   DC  T C5    1 
ATOM   3285 C  C6    . DC  C 3 14  ? -18.334 -37.722 31.111  1.00   55.97 ? 14   DC  T C6    1 
ATOM   3286 P  P     . DC  C 3 15  ? -13.377 -38.831 34.548  1.00   68.91 ? 15   DC  T P     1 
ATOM   3287 O  OP1   . DC  C 3 15  ? -12.073 -38.484 35.156  1.00   67.90 ? 15   DC  T OP1   1 
ATOM   3288 O  OP2   . DC  C 3 15  ? -13.739 -40.247 34.312  1.00   67.63 ? 15   DC  T OP2   1 
ATOM   3289 O  "O5'" . DC  C 3 15  ? -14.540 -38.142 35.419  1.00   67.08 ? 15   DC  T "O5'" 1 
ATOM   3290 C  "C5'" . DC  C 3 15  ? -14.515 -36.729 35.628  1.00   64.41 ? 15   DC  T "C5'" 1 
ATOM   3291 C  "C4'" . DC  C 3 15  ? -15.532 -36.342 36.700  1.00   63.42 ? 15   DC  T "C4'" 1 
ATOM   3292 O  "O4'" . DC  C 3 15  ? -16.835 -36.100 36.128  1.00   62.14 ? 15   DC  T "O4'" 1 
ATOM   3293 C  "C3'" . DC  C 3 15  ? -15.724 -37.395 37.785  1.00   63.40 ? 15   DC  T "C3'" 1 
ATOM   3294 O  "O3'" . DC  C 3 15  ? -15.755 -36.729 39.047  1.00   64.86 ? 15   DC  T "O3'" 1 
ATOM   3295 C  "C2'" . DC  C 3 15  ? -17.103 -37.956 37.495  1.00   62.59 ? 15   DC  T "C2'" 1 
ATOM   3296 C  "C1'" . DC  C 3 15  ? -17.806 -36.738 36.926  1.00   61.12 ? 15   DC  T "C1'" 1 
ATOM   3297 N  N1    . DC  C 3 15  ? -18.967 -37.020 36.075  1.00   58.79 ? 15   DC  T N1    1 
ATOM   3298 C  C2    . DC  C 3 15  ? -20.147 -36.308 36.291  1.00   58.29 ? 15   DC  T C2    1 
ATOM   3299 O  O2    . DC  C 3 15  ? -20.168 -35.430 37.173  1.00   57.83 ? 15   DC  T O2    1 
ATOM   3300 N  N3    . DC  C 3 15  ? -21.233 -36.586 35.535  1.00   57.37 ? 15   DC  T N3    1 
ATOM   3301 C  C4    . DC  C 3 15  ? -21.160 -37.523 34.586  1.00   57.75 ? 15   DC  T C4    1 
ATOM   3302 N  N4    . DC  C 3 15  ? -22.254 -37.771 33.865  1.00   57.75 ? 15   DC  T N4    1 
ATOM   3303 C  C5    . DC  C 3 15  ? -19.962 -38.248 34.333  1.00   57.32 ? 15   DC  T C5    1 
ATOM   3304 C  C6    . DC  C 3 15  ? -18.901 -37.967 35.093  1.00   58.36 ? 15   DC  T C6    1 
ATOM   3305 P  P     . DC  C 3 16  ? -15.149 -37.454 40.329  1.00   67.36 ? 16   DC  T P     1 
ATOM   3306 O  OP1   . DC  C 3 16  ? -13.916 -36.735 40.722  1.00   67.71 ? 16   DC  T OP1   1 
ATOM   3307 O  OP2   . DC  C 3 16  ? -15.095 -38.906 40.049  1.00   66.98 ? 16   DC  T OP2   1 
ATOM   3308 O  "O5'" . DC  C 3 16  ? -16.272 -37.131 41.433  1.00   65.17 ? 16   DC  T "O5'" 1 
ATOM   3309 C  "C5'" . DC  C 3 16  ? -16.542 -35.774 41.790  1.00   64.13 ? 16   DC  T "C5'" 1 
ATOM   3310 C  "C4'" . DC  C 3 16  ? -17.909 -35.673 42.468  1.00   63.18 ? 16   DC  T "C4'" 1 
ATOM   3311 O  "O4'" . DC  C 3 16  ? -18.961 -35.725 41.472  1.00   61.55 ? 16   DC  T "O4'" 1 
ATOM   3312 C  "C3'" . DC  C 3 16  ? -18.170 -36.814 43.444  1.00   62.58 ? 16   DC  T "C3'" 1 
ATOM   3313 O  "O3'" . DC  C 3 16  ? -18.609 -36.311 44.708  1.00   63.64 ? 16   DC  T "O3'" 1 
ATOM   3314 C  "C2'" . DC  C 3 16  ? -19.226 -37.661 42.748  1.00   61.47 ? 16   DC  T "C2'" 1 
ATOM   3315 C  "C1'" . DC  C 3 16  ? -19.937 -36.673 41.840  1.00   59.37 ? 16   DC  T "C1'" 1 
ATOM   3316 N  N1    . DC  C 3 16  ? -20.467 -37.265 40.602  1.00   57.55 ? 16   DC  T N1    1 
ATOM   3317 C  C2    . DC  C 3 16  ? -21.765 -36.922 40.179  1.00   56.93 ? 16   DC  T C2    1 
ATOM   3318 O  O2    . DC  C 3 16  ? -22.419 -36.091 40.840  1.00   56.74 ? 16   DC  T O2    1 
ATOM   3319 N  N3    . DC  C 3 16  ? -22.268 -37.502 39.060  1.00   53.87 ? 16   DC  T N3    1 
ATOM   3320 C  C4    . DC  C 3 16  ? -21.532 -38.378 38.374  1.00   53.85 ? 16   DC  T C4    1 
ATOM   3321 N  N4    . DC  C 3 16  ? -22.064 -38.936 37.294  1.00   53.02 ? 16   DC  T N4    1 
ATOM   3322 C  C5    . DC  C 3 16  ? -20.213 -38.724 38.767  1.00   56.17 ? 16   DC  T C5    1 
ATOM   3323 C  C6    . DC  C 3 16  ? -19.721 -38.148 39.874  1.00   58.63 ? 16   DC  T C6    1 
ATOM   3324 P  P     . DC  C 3 17  ? -19.042 -37.339 45.852  1.00   65.27 ? 17   DC  T P     1 
ATOM   3325 O  OP1   . DC  C 3 17  ? -18.945 -36.667 47.167  1.00   64.60 ? 17   DC  T OP1   1 
ATOM   3326 O  OP2   . DC  C 3 17  ? -18.330 -38.616 45.623  1.00   65.13 ? 17   DC  T OP2   1 
ATOM   3327 O  "O5'" . DC  C 3 17  ? -20.595 -37.563 45.502  1.00   64.90 ? 17   DC  T "O5'" 1 
ATOM   3328 C  "C5'" . DC  C 3 17  ? -21.408 -36.451 45.118  1.00   63.50 ? 17   DC  T "C5'" 1 
ATOM   3329 C  "C4'" . DC  C 3 17  ? -22.836 -36.932 44.870  1.00   62.09 ? 17   DC  T "C4'" 1 
ATOM   3330 O  "O4'" . DC  C 3 17  ? -22.989 -37.433 43.518  1.00   60.08 ? 17   DC  T "O4'" 1 
ATOM   3331 C  "C3'" . DC  C 3 17  ? -23.210 -38.090 45.800  1.00   61.61 ? 17   DC  T "C3'" 1 
ATOM   3332 O  "O3'" . DC  C 3 17  ? -24.564 -37.929 46.225  1.00   63.21 ? 17   DC  T "O3'" 1 
ATOM   3333 C  "C2'" . DC  C 3 17  ? -23.123 -39.298 44.892  1.00   60.07 ? 17   DC  T "C2'" 1 
ATOM   3334 C  "C1'" . DC  C 3 17  ? -23.628 -38.690 43.599  1.00   59.17 ? 17   DC  T "C1'" 1 
ATOM   3335 N  N1    . DC  C 3 17  ? -23.349 -39.457 42.374  1.00   56.81 ? 17   DC  T N1    1 
ATOM   3336 C  C2    . DC  C 3 17  ? -24.301 -39.443 41.346  1.00   56.57 ? 17   DC  T C2    1 
ATOM   3337 O  O2    . DC  C 3 17  ? -25.321 -38.752 41.478  1.00   57.35 ? 17   DC  T O2    1 
ATOM   3338 N  N3    . DC  C 3 17  ? -24.093 -40.183 40.238  1.00   56.17 ? 17   DC  T N3    1 
ATOM   3339 C  C4    . DC  C 3 17  ? -22.990 -40.922 40.128  1.00   55.81 ? 17   DC  T C4    1 
ATOM   3340 N  N4    . DC  C 3 17  ? -22.845 -41.657 39.022  1.00   53.25 ? 17   DC  T N4    1 
ATOM   3341 C  C5    . DC  C 3 17  ? -21.990 -40.942 41.150  1.00   57.00 ? 17   DC  T C5    1 
ATOM   3342 C  C6    . DC  C 3 17  ? -22.206 -40.194 42.244  1.00   56.78 ? 17   DC  T C6    1 
ATOM   3343 P  P     . DC  C 3 18  ? -25.025 -38.490 47.653  1.00   64.11 ? 18   DC  T P     1 
ATOM   3344 O  OP1   . DC  C 3 18  ? -24.660 -37.480 48.672  1.00   62.88 ? 18   DC  T OP1   1 
ATOM   3345 O  OP2   . DC  C 3 18  ? -24.546 -39.883 47.793  1.00   63.47 ? 18   DC  T OP2   1 
ATOM   3346 O  "O5'" . DC  C 3 18  ? -26.625 -38.485 47.487  1.00   61.26 ? 18   DC  T "O5'" 1 
ATOM   3347 C  "C5'" . DC  C 3 18  ? -27.252 -37.353 46.881  1.00   57.26 ? 18   DC  T "C5'" 1 
ATOM   3348 C  "C4'" . DC  C 3 18  ? -28.409 -37.802 45.989  1.00   55.09 ? 18   DC  T "C4'" 1 
ATOM   3349 O  "O4'" . DC  C 3 18  ? -27.917 -38.392 44.761  1.00   53.77 ? 18   DC  T "O4'" 1 
ATOM   3350 C  "C3'" . DC  C 3 18  ? -29.311 -38.853 46.634  1.00   53.40 ? 18   DC  T "C3'" 1 
ATOM   3351 O  "O3'" . DC  C 3 18  ? -30.638 -38.628 46.146  1.00   53.77 ? 18   DC  T "O3'" 1 
ATOM   3352 C  "C2'" . DC  C 3 18  ? -28.834 -40.135 45.985  1.00   52.18 ? 18   DC  T "C2'" 1 
ATOM   3353 C  "C1'" . DC  C 3 18  ? -28.565 -39.636 44.581  1.00   51.14 ? 18   DC  T "C1'" 1 
ATOM   3354 N  N1    . DC  C 3 18  ? -27.708 -40.503 43.758  1.00   49.14 ? 18   DC  T N1    1 
ATOM   3355 C  C2    . DC  C 3 18  ? -28.268 -41.100 42.618  1.00   48.35 ? 18   DC  T C2    1 
ATOM   3356 O  O2    . DC  C 3 18  ? -29.441 -40.823 42.310  1.00   50.33 ? 18   DC  T O2    1 
ATOM   3357 N  N3    . DC  C 3 18  ? -27.522 -41.959 41.883  1.00   45.23 ? 18   DC  T N3    1 
ATOM   3358 C  C4    . DC  C 3 18  ? -26.263 -42.219 42.241  1.00   44.65 ? 18   DC  T C4    1 
ATOM   3359 N  N4    . DC  C 3 18  ? -25.579 -43.087 41.500  1.00   43.26 ? 18   DC  T N4    1 
ATOM   3360 C  C5    . DC  C 3 18  ? -25.656 -41.601 43.379  1.00   44.71 ? 18   DC  T C5    1 
ATOM   3361 C  C6    . DC  C 3 18  ? -26.407 -40.752 44.100  1.00   46.76 ? 18   DC  T C6    1 
HETATM 3362 N  N1    . DCT D 4 .   ? -17.018 -14.577 9.194   1.00   52.94 ? 1342 DCT A N1    1 
HETATM 3363 C  C2    . DCT D 4 .   ? -15.711 -14.702 9.675   1.00   51.60 ? 1342 DCT A C2    1 
HETATM 3364 N  N3    . DCT D 4 .   ? -14.885 -15.712 9.168   1.00   49.67 ? 1342 DCT A N3    1 
HETATM 3365 C  C4    . DCT D 4 .   ? -15.366 -16.589 8.186   1.00   49.59 ? 1342 DCT A C4    1 
HETATM 3366 C  C5    . DCT D 4 .   ? -16.666 -16.465 7.707   1.00   49.71 ? 1342 DCT A C5    1 
HETATM 3367 C  C6    . DCT D 4 .   ? -17.487 -15.464 8.211   1.00   50.90 ? 1342 DCT A C6    1 
HETATM 3368 O  O2    . DCT D 4 .   ? -15.272 -13.918 10.525  1.00   52.41 ? 1342 DCT A O2    1 
HETATM 3369 N  N4    . DCT D 4 .   ? -14.580 -17.552 7.712   1.00   49.40 ? 1342 DCT A N4    1 
HETATM 3370 C  "C1'" . DCT D 4 .   ? -17.880 -13.471 9.675   1.00   55.26 ? 1342 DCT A "C1'" 1 
HETATM 3371 C  "C2'" . DCT D 4 .   ? -18.118 -12.446 8.567   1.00   58.59 ? 1342 DCT A "C2'" 1 
HETATM 3372 C  "C3'" . DCT D 4 .   ? -19.184 -11.614 9.278   1.00   59.86 ? 1342 DCT A "C3'" 1 
HETATM 3373 C  "C4'" . DCT D 4 .   ? -20.025 -12.703 9.954   1.00   60.73 ? 1342 DCT A "C4'" 1 
HETATM 3374 O  "O4'" . DCT D 4 .   ? -19.221 -13.899 9.963   1.00   58.43 ? 1342 DCT A "O4'" 1 
HETATM 3375 C  "C5'" . DCT D 4 .   ? -21.358 -12.953 9.239   1.00   64.21 ? 1342 DCT A "C5'" 1 
HETATM 3376 O  "O5'" . DCT D 4 .   ? -21.184 -13.318 7.866   1.00   68.74 ? 1342 DCT A "O5'" 1 
HETATM 3377 P  PA    . DCT D 4 .   ? -22.445 -13.581 6.896   1.00   71.23 ? 1342 DCT A PA    1 
HETATM 3378 O  O1A   . DCT D 4 .   ? -23.644 -13.966 7.674   1.00   72.29 ? 1342 DCT A O1A   1 
HETATM 3379 O  O2A   . DCT D 4 .   ? -21.964 -14.509 5.848   1.00   70.40 ? 1342 DCT A O2A   1 
HETATM 3380 O  O3A   . DCT D 4 .   ? -22.776 -12.135 6.267   1.00   74.52 ? 1342 DCT A O3A   1 
HETATM 3381 P  PB    . DCT D 4 .   ? -21.616 -11.233 5.608   1.00   77.78 ? 1342 DCT A PB    1 
HETATM 3382 O  O1B   . DCT D 4 .   ? -20.591 -12.159 5.074   1.00   79.06 ? 1342 DCT A O1B   1 
HETATM 3383 O  O2B   . DCT D 4 .   ? -21.193 -10.195 6.577   1.00   73.82 ? 1342 DCT A O2B   1 
HETATM 3384 O  O3B   . DCT D 4 .   ? -22.317 -10.509 4.351   1.00   71.84 ? 1342 DCT A O3B   1 
HETATM 3385 P  PG    . DCT D 4 .   ? -23.826 -10.818 3.884   1.00   66.41 ? 1342 DCT A PG    1 
HETATM 3386 O  O1G   . DCT D 4 .   ? -23.876 -12.363 3.454   1.00   67.66 ? 1342 DCT A O1G   1 
HETATM 3387 O  O2G   . DCT D 4 .   ? -24.775 -10.769 5.180   1.00   65.68 ? 1342 DCT A O2G   1 
HETATM 3388 O  O3G   . DCT D 4 .   ? -24.287 -9.901  2.816   1.00   69.41 ? 1342 DCT A O3G   1 
HETATM 3389 CA CA    . CA  E 5 .   ? -25.519 -12.214 9.245   1.00   50.64 ? 1343 CA  A CA    1 
HETATM 3390 CA CA    . CA  F 5 .   ? -24.873 -9.985  7.174   1.00   41.76 ? 1344 CA  A CA    1 
HETATM 3391 CA CA    . CA  G 5 .   ? -23.810 -24.355 4.890   1.00   72.59 ? 1345 CA  A CA    1 
HETATM 3392 CA CA    . CA  H 5 .   ? -24.137 -16.789 6.478   1.00   64.97 ? 1346 CA  A CA    1 
HETATM 3393 O  O     . HOH I 6 .   ? -48.844 -18.832 12.518  1.00   38.31 ? 2001 HOH A O     1 
HETATM 3394 O  O     . HOH I 6 .   ? -21.725 -10.335 11.800  1.00   25.55 ? 2002 HOH A O     1 
HETATM 3395 O  O     . HOH I 6 .   ? -44.397 -34.956 10.758  1.00   61.29 ? 2003 HOH A O     1 
HETATM 3396 O  O     . HOH I 6 .   ? -55.258 -14.653 17.209  1.00   50.34 ? 2004 HOH A O     1 
HETATM 3397 O  O     . HOH I 6 .   ? -13.863 3.349   5.395   1.00   36.66 ? 2005 HOH A O     1 
HETATM 3398 O  O     . HOH I 6 .   ? -12.590 9.708   0.078   1.00   52.25 ? 2006 HOH A O     1 
HETATM 3399 O  O     . HOH I 6 .   ? -2.075  -13.744 3.959   1.00   46.19 ? 2007 HOH A O     1 
HETATM 3400 O  O     . HOH I 6 .   ? -0.141  -8.713  8.651   1.00   45.64 ? 2008 HOH A O     1 
HETATM 3401 O  O     . HOH I 6 .   ? -17.754 -12.223 2.875   1.00   37.85 ? 2009 HOH A O     1 
HETATM 3402 O  O     . HOH I 6 .   ? -21.766 -4.399  -10.736 1.00   43.56 ? 2010 HOH A O     1 
HETATM 3403 O  O     . HOH I 6 .   ? -17.975 -14.139 1.117   1.00   42.24 ? 2011 HOH A O     1 
HETATM 3404 O  O     . HOH I 6 .   ? -16.511 -17.858 3.296   1.00   37.05 ? 2012 HOH A O     1 
HETATM 3405 O  O     . HOH I 6 .   ? -8.608  -4.939  -8.596  1.00   39.54 ? 2013 HOH A O     1 
HETATM 3406 O  O     . HOH I 6 .   ? -1.184  -4.176  -8.822  1.00   48.94 ? 2014 HOH A O     1 
HETATM 3407 O  O     . HOH I 6 .   ? -10.838 -0.793  8.568   1.00   42.79 ? 2015 HOH A O     1 
HETATM 3408 O  O     . HOH I 6 .   ? -19.723 -11.784 17.004  1.00   46.48 ? 2016 HOH A O     1 
HETATM 3409 O  O     . HOH I 6 .   ? -12.407 -3.992  9.346   1.00   45.48 ? 2017 HOH A O     1 
HETATM 3410 O  O     . HOH I 6 .   ? -17.172 -5.009  19.938  1.00   37.73 ? 2018 HOH A O     1 
HETATM 3411 O  O     . HOH I 6 .   ? -23.888 1.992   20.541  1.00   63.79 ? 2019 HOH A O     1 
HETATM 3412 O  O     . HOH I 6 .   ? -25.301 -5.440  18.211  1.00   34.47 ? 2020 HOH A O     1 
HETATM 3413 O  O     . HOH I 6 .   ? -33.219 -10.109 21.992  1.00   41.69 ? 2021 HOH A O     1 
HETATM 3414 O  O     . HOH I 6 .   ? -21.952 -9.587  9.675   1.00   24.32 ? 2022 HOH A O     1 
HETATM 3415 O  O     . HOH I 6 .   ? -53.112 -17.754 15.107  1.00   53.92 ? 2023 HOH A O     1 
HETATM 3416 O  O     . HOH I 6 .   ? -51.679 -19.455 11.722  1.00   71.78 ? 2024 HOH A O     1 
HETATM 3417 O  O     . HOH I 6 .   ? -49.727 -4.245  0.222   1.00   68.86 ? 2025 HOH A O     1 
HETATM 3418 O  O     . HOH I 6 .   ? -32.359 -0.723  4.871   1.00   50.03 ? 2026 HOH A O     1 
HETATM 3419 O  O     . HOH I 6 .   ? -25.242 1.832   2.644   1.00   60.78 ? 2027 HOH A O     1 
HETATM 3420 O  O     . HOH I 6 .   ? -25.878 -1.475  -0.425  1.00   38.88 ? 2028 HOH A O     1 
HETATM 3421 O  O     . HOH I 6 .   ? -40.089 -24.192 9.193   1.00   55.57 ? 2029 HOH A O     1 
HETATM 3422 O  O     . HOH I 6 .   ? -27.866 -19.374 6.190   1.00   64.09 ? 2030 HOH A O     1 
HETATM 3423 O  O     . HOH I 6 .   ? -22.912 -15.542 1.102   1.00   39.74 ? 2031 HOH A O     1 
HETATM 3424 O  O     . HOH I 6 .   ? -33.480 -0.480  1.518   1.00   74.15 ? 2032 HOH A O     1 
HETATM 3425 O  O     . HOH I 6 .   ? -33.286 -6.088  -3.270  1.00   71.52 ? 2033 HOH A O     1 
HETATM 3426 O  O     . HOH I 6 .   ? -17.741 -22.679 4.019   1.00   51.96 ? 2034 HOH A O     1 
HETATM 3427 O  O     . HOH I 6 .   ? -16.265 -30.286 3.619   1.00   49.75 ? 2035 HOH A O     1 
HETATM 3428 O  O     . HOH I 6 .   ? -27.519 -43.320 5.617   1.00   49.48 ? 2036 HOH A O     1 
HETATM 3429 O  O     . HOH I 6 .   ? -30.421 -37.099 -1.563  1.00   46.22 ? 2037 HOH A O     1 
HETATM 3430 O  O     . HOH I 6 .   ? -21.514 -27.180 15.994  1.00   40.65 ? 2038 HOH A O     1 
HETATM 3431 O  O     . HOH I 6 .   ? -35.050 -27.479 17.363  1.00   45.99 ? 2039 HOH A O     1 
HETATM 3432 O  O     . HOH I 6 .   ? -38.882 -33.543 16.045  1.00   44.58 ? 2040 HOH A O     1 
HETATM 3433 O  O     . HOH I 6 .   ? -41.919 -25.580 11.199  1.00   75.52 ? 2041 HOH A O     1 
HETATM 3434 O  O     . HOH I 6 .   ? -45.314 -26.632 6.377   1.00   60.72 ? 2042 HOH A O     1 
HETATM 3435 O  O     . HOH I 6 .   ? -45.275 -32.297 13.559  1.00   44.85 ? 2043 HOH A O     1 
HETATM 3436 O  O     . HOH I 6 .   ? -42.409 -24.284 13.103  1.00   56.85 ? 2044 HOH A O     1 
HETATM 3437 O  O     . HOH I 6 .   ? -39.183 -20.083 15.621  1.00   58.50 ? 2045 HOH A O     1 
HETATM 3438 O  O     . HOH I 6 .   ? -33.458 -14.926 27.719  1.00   45.71 ? 2046 HOH A O     1 
HETATM 3439 O  O     . HOH I 6 .   ? -27.067 -16.578 20.515  1.00   39.11 ? 2047 HOH A O     1 
HETATM 3440 O  O     . HOH I 6 .   ? -28.363 -14.812 29.445  1.00   54.04 ? 2048 HOH A O     1 
HETATM 3441 O  O     . HOH I 6 .   ? -2.140  -17.026 13.615  1.00   47.41 ? 2049 HOH A O     1 
HETATM 3442 O  O     . HOH I 6 .   ? 7.088   -13.920 30.109  1.00   43.32 ? 2050 HOH A O     1 
HETATM 3443 O  O     . HOH I 6 .   ? -1.091  -8.495  20.731  1.00   48.47 ? 2051 HOH A O     1 
HETATM 3444 O  O     . HOH I 6 .   ? -6.366  -1.133  28.077  1.00   56.09 ? 2052 HOH A O     1 
HETATM 3445 O  O     . HOH I 6 .   ? -13.700 1.710   23.947  1.00   59.76 ? 2053 HOH A O     1 
HETATM 3446 O  O     . HOH I 6 .   ? -14.541 -19.848 29.289  1.00   44.82 ? 2054 HOH A O     1 
HETATM 3447 O  O     . HOH I 6 .   ? -11.153 -13.664 41.420  1.00   33.18 ? 2055 HOH A O     1 
HETATM 3448 O  O     . HOH I 6 .   ? -11.533 -7.108  38.548  1.00   61.54 ? 2056 HOH A O     1 
HETATM 3449 O  O     . HOH I 6 .   ? -0.836  -13.009 38.909  1.00   40.17 ? 2057 HOH A O     1 
HETATM 3450 O  O     . HOH I 6 .   ? -1.245  -7.604  40.260  1.00   61.93 ? 2058 HOH A O     1 
HETATM 3451 O  O     . HOH I 6 .   ? -5.467  -19.213 40.907  1.00   54.10 ? 2059 HOH A O     1 
HETATM 3452 O  O     . HOH I 6 .   ? -2.558  -32.905 33.424  1.00   43.18 ? 2060 HOH A O     1 
HETATM 3453 O  O     . HOH I 6 .   ? -7.534  -17.137 16.499  1.00   46.66 ? 2061 HOH A O     1 
HETATM 3454 O  O     . HOH I 6 .   ? -10.866 -16.152 21.642  1.00   47.31 ? 2062 HOH A O     1 
HETATM 3455 O  O     . HOH I 6 .   ? -18.311 -25.342 31.192  1.00   51.24 ? 2063 HOH A O     1 
HETATM 3456 O  O     . HOH I 6 .   ? -26.902 -11.855 36.203  1.00   54.87 ? 2064 HOH A O     1 
HETATM 3457 O  O     . HOH I 6 .   ? -19.558 -8.378  7.793   1.00   35.51 ? 2065 HOH A O     1 
HETATM 3458 O  O     . HOH I 6 .   ? -18.444 -12.073 5.818   1.00   42.23 ? 2066 HOH A O     1 
HETATM 3459 O  O     . HOH I 6 .   ? -24.928 -14.180 5.812   1.00   47.92 ? 2067 HOH A O     1 
HETATM 3460 O  O     . HOH J 6 .   ? -26.793 -38.993 31.497  1.00   59.79 ? 2001 HOH P O     1 
HETATM 3461 O  O     . HOH J 6 .   ? -26.701 -36.575 30.933  1.00   36.37 ? 2002 HOH P O     1 
HETATM 3462 O  O     . HOH J 6 .   ? -33.070 -40.256 38.873  1.00   58.74 ? 2003 HOH P O     1 
HETATM 3463 O  O     . HOH J 6 .   ? -20.234 -29.366 40.036  1.00   61.78 ? 2004 HOH P O     1 
HETATM 3464 O  O     . HOH J 6 .   ? -29.400 -42.653 31.081  1.00   47.27 ? 2005 HOH P O     1 
HETATM 3465 O  O     . HOH J 6 .   ? -30.681 -38.268 38.538  1.00   53.32 ? 2006 HOH P O     1 
HETATM 3466 O  O     . HOH J 6 .   ? -29.148 -36.427 30.760  1.00   30.10 ? 2007 HOH P O     1 
HETATM 3467 O  O     . HOH J 6 .   ? -26.837 -34.653 32.498  1.00   55.30 ? 2008 HOH P O     1 
HETATM 3468 O  O     . HOH J 6 .   ? -27.273 -27.055 34.369  1.00   42.55 ? 2009 HOH P O     1 
HETATM 3469 O  O     . HOH J 6 .   ? -20.451 -31.327 38.606  1.00   52.60 ? 2010 HOH P O     1 
HETATM 3470 O  O     . HOH J 6 .   ? -22.735 -24.114 33.758  1.00   45.91 ? 2011 HOH P O     1 
HETATM 3471 O  O     . HOH J 6 .   ? -11.803 -34.142 33.206  1.00   40.30 ? 2012 HOH P O     1 
HETATM 3472 O  O     . HOH J 6 .   ? -17.525 -24.933 27.614  1.00   33.32 ? 2013 HOH P O     1 
HETATM 3473 O  O     . HOH J 6 .   ? -13.522 -33.847 28.764  1.00   48.76 ? 2014 HOH P O     1 
HETATM 3474 O  O     . HOH J 6 .   ? -8.200  -31.669 18.313  1.00   46.88 ? 2015 HOH P O     1 
HETATM 3475 O  O     . HOH J 6 .   ? -20.158 -24.133 16.566  1.00   41.21 ? 2016 HOH P O     1 
HETATM 3476 O  O     . HOH J 6 .   ? -15.189 -26.553 9.013   1.00   47.94 ? 2017 HOH P O     1 
HETATM 3477 O  O     . HOH J 6 .   ? -25.897 -19.366 8.696   1.00   47.48 ? 2018 HOH P O     1 
HETATM 3478 O  O     . HOH J 6 .   ? -23.842 -21.791 6.673   1.00   62.30 ? 2019 HOH P O     1 
HETATM 3479 O  O     . HOH J 6 .   ? -20.787 -19.864 17.051  1.00   42.16 ? 2020 HOH P O     1 
HETATM 3480 O  O     . HOH K 6 .   ? -13.680 -21.793 25.155  1.00   40.23 ? 2001 HOH T O     1 
HETATM 3481 O  O     . HOH K 6 .   ? 1.645   -28.273 10.277  1.00   74.01 ? 2002 HOH T O     1 
HETATM 3482 O  O     . HOH K 6 .   ? -10.390 -20.344 7.480   1.00   55.61 ? 2003 HOH T O     1 
HETATM 3483 O  O     . HOH K 6 .   ? -9.602  -19.801 13.080  1.00   40.77 ? 2004 HOH T O     1 
HETATM 3484 O  O     . HOH K 6 .   ? -18.486 -15.407 16.040  1.00   41.61 ? 2005 HOH T O     1 
HETATM 3485 O  O     . HOH K 6 .   ? -10.366 -18.196 17.347  1.00   42.31 ? 2006 HOH T O     1 
HETATM 3486 O  O     . HOH K 6 .   ? -11.111 -14.525 20.142  1.00   29.96 ? 2007 HOH T O     1 
HETATM 3487 O  O     . HOH K 6 .   ? -10.673 -20.281 15.926  1.00   42.28 ? 2008 HOH T O     1 
HETATM 3488 O  O     . HOH K 6 .   ? -12.524 -19.085 20.621  1.00   39.42 ? 2009 HOH T O     1 
HETATM 3489 O  O     . HOH K 6 .   ? -13.235 -22.086 22.930  1.00   28.25 ? 2010 HOH T O     1 
HETATM 3490 O  O     . HOH K 6 .   ? -23.051 -12.949 20.772  1.00   40.92 ? 2011 HOH T O     1 
HETATM 3491 O  O     . HOH K 6 .   ? -19.382 -28.071 17.641  1.00   44.26 ? 2012 HOH T O     1 
HETATM 3492 O  O     . HOH K 6 .   ? -23.821 -24.052 23.789  1.00   61.15 ? 2013 HOH T O     1 
HETATM 3493 O  O     . HOH K 6 .   ? -18.411 -23.302 25.921  1.00   43.95 ? 2014 HOH T O     1 
HETATM 3494 O  O     . HOH K 6 .   ? -26.805 -20.471 17.828  1.00   45.09 ? 2015 HOH T O     1 
HETATM 3495 O  O     . HOH K 6 .   ? -27.894 -24.977 16.054  1.00   51.40 ? 2016 HOH T O     1 
HETATM 3496 O  O     . HOH K 6 .   ? -25.983 -33.208 19.755  1.00   40.17 ? 2017 HOH T O     1 
HETATM 3497 O  O     . HOH K 6 .   ? -14.778 -41.908 32.792  1.00   48.14 ? 2018 HOH T O     1 
HETATM 3498 O  O     . HOH K 6 .   ? -19.985 -34.479 47.227  1.00   65.75 ? 2019 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   -5  ?   ?   ?   A . n 
A 1 2   HIS 2   -4  ?   ?   ?   A . n 
A 1 3   HIS 3   -3  ?   ?   ?   A . n 
A 1 4   HIS 4   -2  ?   ?   ?   A . n 
A 1 5   HIS 5   -1  ?   ?   ?   A . n 
A 1 6   HIS 6   0   ?   ?   ?   A . n 
A 1 7   MET 7   1   1   MET MET A . n 
A 1 8   ILE 8   2   2   ILE ILE A . n 
A 1 9   VAL 9   3   3   VAL VAL A . n 
A 1 10  LEU 10  4   4   LEU LEU A . n 
A 1 11  PHE 11  5   5   PHE PHE A . n 
A 1 12  VAL 12  6   6   VAL VAL A . n 
A 1 13  ASP 13  7   7   ASP ASP A . n 
A 1 14  PHE 14  8   8   PHE PHE A . n 
A 1 15  ASP 15  9   9   ASP ASP A . n 
A 1 16  TYR 16  10  10  TYR TYR A . n 
A 1 17  PHE 17  11  11  PHE PHE A . n 
A 1 18  TYR 18  12  12  TYR TYR A . n 
A 1 19  ALA 19  13  13  ALA ALA A . n 
A 1 20  GLN 20  14  14  GLN GLN A . n 
A 1 21  VAL 21  15  15  VAL VAL A . n 
A 1 22  GLU 22  16  16  GLU GLU A . n 
A 1 23  GLU 23  17  17  GLU GLU A . n 
A 1 24  VAL 24  18  18  VAL VAL A . n 
A 1 25  LEU 25  19  19  LEU LEU A . n 
A 1 26  ASN 26  20  20  ASN ASN A . n 
A 1 27  PRO 27  21  21  PRO PRO A . n 
A 1 28  SER 28  22  22  SER SER A . n 
A 1 29  LEU 29  23  23  LEU LEU A . n 
A 1 30  LYS 30  24  24  LYS LYS A . n 
A 1 31  GLY 31  25  25  GLY GLY A . n 
A 1 32  LYS 32  26  26  LYS LYS A . n 
A 1 33  PRO 33  27  27  PRO PRO A . n 
A 1 34  VAL 34  28  28  VAL VAL A . n 
A 1 35  VAL 35  29  29  VAL VAL A . n 
A 1 36  VAL 36  30  30  VAL VAL A . n 
A 1 37  CYS 37  31  31  CYS CYS A . n 
A 1 38  VAL 38  32  32  VAL VAL A . n 
A 1 39  PHE 39  33  33  PHE PHE A . n 
A 1 40  SER 40  34  34  SER SER A . n 
A 1 41  GLY 41  35  35  GLY GLY A . n 
A 1 42  ARG 42  36  36  ARG ARG A . n 
A 1 43  PHE 43  37  37  PHE PHE A . n 
A 1 44  GLU 44  38  38  GLU GLU A . n 
A 1 45  ASP 45  39  39  ASP ASP A . n 
A 1 46  SER 46  40  40  SER SER A . n 
A 1 47  GLY 47  41  41  GLY GLY A . n 
A 1 48  ALA 48  42  42  ALA ALA A . n 
A 1 49  VAL 49  43  43  VAL VAL A . n 
A 1 50  ALA 50  44  44  ALA ALA A . n 
A 1 51  THR 51  45  45  THR THR A . n 
A 1 52  ALA 52  46  46  ALA ALA A . n 
A 1 53  ASN 53  47  47  ASN ASN A . n 
A 1 54  TYR 54  48  48  TYR TYR A . n 
A 1 55  GLU 55  49  49  GLU GLU A . n 
A 1 56  ALA 56  50  50  ALA ALA A . n 
A 1 57  ARG 57  51  51  ARG ARG A . n 
A 1 58  LYS 58  52  52  LYS LYS A . n 
A 1 59  PHE 59  53  53  PHE PHE A . n 
A 1 60  GLY 60  54  54  GLY GLY A . n 
A 1 61  VAL 61  55  55  VAL VAL A . n 
A 1 62  LYS 62  56  56  LYS LYS A . n 
A 1 63  ALA 63  57  57  ALA ALA A . n 
A 1 64  GLY 64  58  58  GLY GLY A . n 
A 1 65  ILE 65  59  59  ILE ILE A . n 
A 1 66  PRO 66  60  60  PRO PRO A . n 
A 1 67  ILE 67  61  61  ILE ILE A . n 
A 1 68  VAL 68  62  62  VAL VAL A . n 
A 1 69  GLU 69  63  63  GLU GLU A . n 
A 1 70  ALA 70  64  64  ALA ALA A . n 
A 1 71  LYS 71  65  65  LYS LYS A . n 
A 1 72  LYS 72  66  66  LYS LYS A . n 
A 1 73  ILE 73  67  67  ILE ILE A . n 
A 1 74  LEU 74  68  68  LEU LEU A . n 
A 1 75  PRO 75  69  69  PRO PRO A . n 
A 1 76  ASN 76  70  70  ASN ASN A . n 
A 1 77  ALA 77  71  71  ALA ALA A . n 
A 1 78  VAL 78  72  72  VAL VAL A . n 
A 1 79  TYR 79  73  73  TYR TYR A . n 
A 1 80  LEU 80  74  74  LEU LEU A . n 
A 1 81  PRO 81  75  75  PRO PRO A . n 
A 1 82  MET 82  76  76  MET MET A . n 
A 1 83  ARG 83  77  77  ARG ARG A . n 
A 1 84  LYS 84  78  78  LYS LYS A . n 
A 1 85  GLU 85  79  79  GLU GLU A . n 
A 1 86  VAL 86  80  80  VAL VAL A . n 
A 1 87  TYR 87  81  81  TYR TYR A . n 
A 1 88  GLN 88  82  82  GLN GLN A . n 
A 1 89  GLN 89  83  83  GLN GLN A . n 
A 1 90  VAL 90  84  84  VAL VAL A . n 
A 1 91  SER 91  85  85  SER SER A . n 
A 1 92  SER 92  86  86  SER SER A . n 
A 1 93  ARG 93  87  87  ARG ARG A . n 
A 1 94  ILE 94  88  88  ILE ILE A . n 
A 1 95  MET 95  89  89  MET MET A . n 
A 1 96  ASN 96  90  90  ASN ASN A . n 
A 1 97  LEU 97  91  91  LEU LEU A . n 
A 1 98  LEU 98  92  92  LEU LEU A . n 
A 1 99  ARG 99  93  93  ARG ARG A . n 
A 1 100 GLU 100 94  94  GLU GLU A . n 
A 1 101 TYR 101 95  95  TYR TYR A . n 
A 1 102 SER 102 96  96  SER SER A . n 
A 1 103 GLU 103 97  97  GLU GLU A . n 
A 1 104 LYS 104 98  98  LYS LYS A . n 
A 1 105 ILE 105 99  99  ILE ILE A . n 
A 1 106 GLU 106 100 100 GLU GLU A . n 
A 1 107 ILE 107 101 101 ILE ILE A . n 
A 1 108 ALA 108 102 102 ALA ALA A . n 
A 1 109 SER 109 103 103 SER SER A . n 
A 1 110 ILE 110 104 104 ILE ILE A . n 
A 1 111 ASP 111 105 105 ASP ASP A . n 
A 1 112 GLU 112 106 106 GLU GLU A . n 
A 1 113 ALA 113 107 107 ALA ALA A . n 
A 1 114 TYR 114 108 108 TYR TYR A . n 
A 1 115 LEU 115 109 109 LEU LEU A . n 
A 1 116 ASP 116 110 110 ASP ASP A . n 
A 1 117 ILE 117 111 111 ILE ILE A . n 
A 1 118 SER 118 112 112 SER SER A . n 
A 1 119 ASP 119 113 113 ASP ASP A . n 
A 1 120 LYS 120 114 114 LYS LYS A . n 
A 1 121 VAL 121 115 115 VAL VAL A . n 
A 1 122 ARG 122 116 116 ARG ARG A . n 
A 1 123 ASP 123 117 117 ASP ASP A . n 
A 1 124 TYR 124 118 118 TYR TYR A . n 
A 1 125 ARG 125 119 119 ARG ARG A . n 
A 1 126 GLU 126 120 120 GLU GLU A . n 
A 1 127 ALA 127 121 121 ALA ALA A . n 
A 1 128 TYR 128 122 122 TYR TYR A . n 
A 1 129 ASN 129 123 123 ASN ASN A . n 
A 1 130 LEU 130 124 124 LEU LEU A . n 
A 1 131 GLY 131 125 125 GLY GLY A . n 
A 1 132 LEU 132 126 126 LEU LEU A . n 
A 1 133 GLU 133 127 127 GLU GLU A . n 
A 1 134 ILE 134 128 128 ILE ILE A . n 
A 1 135 LYS 135 129 129 LYS LYS A . n 
A 1 136 ASN 136 130 130 ASN ASN A . n 
A 1 137 LYS 137 131 131 LYS LYS A . n 
A 1 138 ILE 138 132 132 ILE ILE A . n 
A 1 139 LEU 139 133 133 LEU LEU A . n 
A 1 140 GLU 140 134 134 GLU GLU A . n 
A 1 141 LYS 141 135 135 LYS LYS A . n 
A 1 142 GLU 142 136 136 GLU GLU A . n 
A 1 143 LYS 143 137 137 LYS LYS A . n 
A 1 144 ILE 144 138 138 ILE ILE A . n 
A 1 145 THR 145 139 139 THR THR A . n 
A 1 146 VAL 146 140 140 VAL VAL A . n 
A 1 147 THR 147 141 141 THR THR A . n 
A 1 148 VAL 148 142 142 VAL VAL A . n 
A 1 149 GLY 149 143 143 GLY GLY A . n 
A 1 150 ILE 150 144 144 ILE ILE A . n 
A 1 151 SER 151 145 145 SER SER A . n 
A 1 152 LYS 152 146 146 LYS LYS A . n 
A 1 153 ASN 153 147 147 ASN ASN A . n 
A 1 154 LYS 154 148 148 LYS LYS A . n 
A 1 155 VAL 155 149 149 VAL VAL A . n 
A 1 156 PHE 156 150 150 PHE PHE A . n 
A 1 157 ALA 157 151 151 ALA ALA A . n 
A 1 158 LYS 158 152 152 LYS LYS A . n 
A 1 159 ILE 159 153 153 ILE ILE A . n 
A 1 160 ALA 160 154 154 ALA ALA A . n 
A 1 161 ALA 161 155 155 ALA ALA A . n 
A 1 162 ASP 162 156 156 ASP ASP A . n 
A 1 163 MET 163 157 157 MET MET A . n 
A 1 164 ALA 164 158 158 ALA ALA A . n 
A 1 165 LYS 165 159 159 LYS LYS A . n 
A 1 166 PRO 166 160 160 PRO PRO A . n 
A 1 167 ASN 167 161 161 ASN ASN A . n 
A 1 168 GLY 168 162 162 GLY GLY A . n 
A 1 169 ILE 169 163 163 ILE ILE A . n 
A 1 170 LYS 170 164 164 LYS LYS A . n 
A 1 171 VAL 171 165 165 VAL VAL A . n 
A 1 172 ILE 172 166 166 ILE ILE A . n 
A 1 173 ASP 173 167 167 ASP ASP A . n 
A 1 174 ASP 174 168 168 ASP ASP A . n 
A 1 175 GLU 175 169 169 GLU GLU A . n 
A 1 176 GLU 176 170 170 GLU GLU A . n 
A 1 177 VAL 177 171 171 VAL VAL A . n 
A 1 178 LYS 178 172 172 LYS LYS A . n 
A 1 179 ARG 179 173 173 ARG ARG A . n 
A 1 180 LEU 180 174 174 LEU LEU A . n 
A 1 181 ILE 181 175 175 ILE ILE A . n 
A 1 182 ARG 182 176 176 ARG ARG A . n 
A 1 183 GLU 183 177 177 GLU GLU A . n 
A 1 184 LEU 184 178 178 LEU LEU A . n 
A 1 185 ASP 185 179 179 ASP ASP A . n 
A 1 186 ILE 186 180 180 ILE ILE A . n 
A 1 187 ALA 187 181 181 ALA ALA A . n 
A 1 188 ASP 188 182 182 ASP ASP A . n 
A 1 189 VAL 189 183 183 VAL VAL A . n 
A 1 190 PRO 190 184 184 PRO PRO A . n 
A 1 191 GLY 191 185 185 GLY GLY A . n 
A 1 192 ILE 192 186 186 ILE ILE A . n 
A 1 193 GLY 193 187 187 GLY GLY A . n 
A 1 194 ASN 194 188 188 ASN ASN A . n 
A 1 195 ILE 195 189 189 ILE ILE A . n 
A 1 196 THR 196 190 190 THR THR A . n 
A 1 197 ALA 197 191 191 ALA ALA A . n 
A 1 198 GLU 198 192 192 GLU GLU A . n 
A 1 199 LYS 199 193 193 LYS LYS A . n 
A 1 200 LEU 200 194 194 LEU LEU A . n 
A 1 201 LYS 201 195 195 LYS LYS A . n 
A 1 202 LYS 202 196 196 LYS LYS A . n 
A 1 203 LEU 203 197 197 LEU LEU A . n 
A 1 204 GLY 204 198 198 GLY GLY A . n 
A 1 205 ILE 205 199 199 ILE ILE A . n 
A 1 206 ASN 206 200 200 ASN ASN A . n 
A 1 207 LYS 207 201 201 LYS LYS A . n 
A 1 208 LEU 208 202 202 LEU LEU A . n 
A 1 209 VAL 209 203 203 VAL VAL A . n 
A 1 210 ASP 210 204 204 ASP ASP A . n 
A 1 211 THR 211 205 205 THR THR A . n 
A 1 212 LEU 212 206 206 LEU LEU A . n 
A 1 213 SER 213 207 207 SER SER A . n 
A 1 214 ILE 214 208 208 ILE ILE A . n 
A 1 215 GLU 215 209 209 GLU GLU A . n 
A 1 216 PHE 216 210 210 PHE PHE A . n 
A 1 217 ASP 217 211 211 ASP ASP A . n 
A 1 218 LYS 218 212 212 LYS LYS A . n 
A 1 219 LEU 219 213 213 LEU LEU A . n 
A 1 220 LYS 220 214 214 LYS LYS A . n 
A 1 221 GLY 221 215 215 GLY GLY A . n 
A 1 222 MET 222 216 216 MET MET A . n 
A 1 223 ILE 223 217 217 ILE ILE A . n 
A 1 224 GLY 224 218 218 GLY GLY A . n 
A 1 225 GLU 225 219 219 GLU GLU A . n 
A 1 226 ALA 226 220 220 ALA ALA A . n 
A 1 227 LYS 227 221 221 LYS LYS A . n 
A 1 228 ALA 228 222 222 ALA ALA A . n 
A 1 229 LYS 229 223 223 LYS LYS A . n 
A 1 230 TYR 230 224 224 TYR TYR A . n 
A 1 231 LEU 231 225 225 LEU LEU A . n 
A 1 232 ILE 232 226 226 ILE ILE A . n 
A 1 233 SER 233 227 227 SER SER A . n 
A 1 234 LEU 234 228 228 LEU LEU A . n 
A 1 235 ALA 235 229 229 ALA ALA A . n 
A 1 236 ARG 236 230 230 ARG ARG A . n 
A 1 237 ASP 237 231 231 ASP ASP A . n 
A 1 238 GLU 238 232 232 GLU GLU A . n 
A 1 239 TYR 239 233 233 TYR TYR A . n 
A 1 240 ASN 240 234 234 ASN ASN A . n 
A 1 241 GLU 241 235 235 GLU GLU A . n 
A 1 242 PRO 242 236 236 PRO PRO A . n 
A 1 243 ILE 243 237 237 ILE ILE A . n 
A 1 244 ARG 244 238 238 ARG ARG A . n 
A 1 245 THR 245 239 239 THR THR A . n 
A 1 246 ARG 246 240 240 ARG ARG A . n 
A 1 247 VAL 247 241 241 VAL VAL A . n 
A 1 248 ARG 248 242 242 ARG ARG A . n 
A 1 249 LYS 249 243 243 LYS LYS A . n 
A 1 250 SER 250 244 244 SER SER A . n 
A 1 251 ILE 251 245 245 ILE ILE A . n 
A 1 252 GLY 252 246 246 GLY GLY A . n 
A 1 253 ARG 253 247 247 ARG ARG A . n 
A 1 254 ILE 254 248 248 ILE ILE A . n 
A 1 255 VAL 255 249 249 VAL VAL A . n 
A 1 256 THR 256 250 250 THR THR A . n 
A 1 257 MET 257 251 251 MET MET A . n 
A 1 258 LYS 258 252 252 LYS LYS A . n 
A 1 259 ARG 259 253 253 ARG ARG A . n 
A 1 260 ASN 260 254 254 ASN ASN A . n 
A 1 261 SER 261 255 255 SER SER A . n 
A 1 262 ARG 262 256 256 ARG ARG A . n 
A 1 263 ASN 263 257 257 ASN ASN A . n 
A 1 264 LEU 264 258 258 LEU LEU A . n 
A 1 265 GLU 265 259 259 GLU GLU A . n 
A 1 266 GLU 266 260 260 GLU GLU A . n 
A 1 267 ILE 267 261 261 ILE ILE A . n 
A 1 268 LYS 268 262 262 LYS LYS A . n 
A 1 269 PRO 269 263 263 PRO PRO A . n 
A 1 270 TYR 270 264 264 TYR TYR A . n 
A 1 271 LEU 271 265 265 LEU LEU A . n 
A 1 272 PHE 272 266 266 PHE PHE A . n 
A 1 273 ARG 273 267 267 ARG ARG A . n 
A 1 274 ALA 274 268 268 ALA ALA A . n 
A 1 275 ILE 275 269 269 ILE ILE A . n 
A 1 276 GLU 276 270 270 GLU GLU A . n 
A 1 277 GLU 277 271 271 GLU GLU A . n 
A 1 278 SER 278 272 272 SER SER A . n 
A 1 279 TYR 279 273 273 TYR TYR A . n 
A 1 280 TYR 280 274 274 TYR TYR A . n 
A 1 281 LYS 281 275 275 LYS LYS A . n 
A 1 282 LEU 282 276 276 LEU LEU A . n 
A 1 283 ASP 283 277 277 ASP ASP A . n 
A 1 284 LYS 284 278 278 LYS LYS A . n 
A 1 285 ARG 285 279 279 ARG ARG A . n 
A 1 286 ILE 286 280 280 ILE ILE A . n 
A 1 287 PRO 287 281 281 PRO PRO A . n 
A 1 288 LYS 288 282 282 LYS LYS A . n 
A 1 289 ALA 289 283 283 ALA ALA A . n 
A 1 290 ILE 290 284 284 ILE ILE A . n 
A 1 291 HIS 291 285 285 HIS HIS A . n 
A 1 292 VAL 292 286 286 VAL VAL A . n 
A 1 293 VAL 293 287 287 VAL VAL A . n 
A 1 294 ALA 294 288 288 ALA ALA A . n 
A 1 295 VAL 295 289 289 VAL VAL A . n 
A 1 296 THR 296 290 290 THR THR A . n 
A 1 297 GLU 297 291 291 GLU GLU A . n 
A 1 298 ASP 298 292 292 ASP ASP A . n 
A 1 299 LEU 299 293 293 LEU LEU A . n 
A 1 300 ASP 300 294 294 ASP ASP A . n 
A 1 301 ILE 301 295 295 ILE ILE A . n 
A 1 302 VAL 302 296 296 VAL VAL A . n 
A 1 303 SER 303 297 297 SER SER A . n 
A 1 304 ARG 304 298 298 ARG ARG A . n 
A 1 305 GLY 305 299 299 GLY GLY A . n 
A 1 306 ARG 306 300 300 ARG ARG A . n 
A 1 307 THR 307 301 301 THR THR A . n 
A 1 308 PHE 308 302 302 PHE PHE A . n 
A 1 309 PRO 309 303 303 PRO PRO A . n 
A 1 310 HIS 310 304 304 HIS HIS A . n 
A 1 311 GLY 311 305 305 GLY GLY A . n 
A 1 312 ILE 312 306 306 ILE ILE A . n 
A 1 313 SER 313 307 307 SER SER A . n 
A 1 314 LYS 314 308 308 LYS LYS A . n 
A 1 315 GLU 315 309 309 GLU GLU A . n 
A 1 316 THR 316 310 310 THR THR A . n 
A 1 317 ALA 317 311 311 ALA ALA A . n 
A 1 318 TYR 318 312 312 TYR TYR A . n 
A 1 319 SER 319 313 313 SER SER A . n 
A 1 320 GLU 320 314 314 GLU GLU A . n 
A 1 321 SER 321 315 315 SER SER A . n 
A 1 322 VAL 322 316 316 VAL VAL A . n 
A 1 323 LYS 323 317 317 LYS LYS A . n 
A 1 324 LEU 324 318 318 LEU LEU A . n 
A 1 325 LEU 325 319 319 LEU LEU A . n 
A 1 326 GLN 326 320 320 GLN GLN A . n 
A 1 327 LYS 327 321 321 LYS LYS A . n 
A 1 328 ILE 328 322 322 ILE ILE A . n 
A 1 329 LEU 329 323 323 LEU LEU A . n 
A 1 330 GLU 330 324 324 GLU GLU A . n 
A 1 331 GLU 331 325 325 GLU GLU A . n 
A 1 332 ASP 332 326 326 ASP ASP A . n 
A 1 333 GLU 333 327 327 GLU GLU A . n 
A 1 334 ARG 334 328 328 ARG ARG A . n 
A 1 335 LYS 335 329 329 LYS LYS A . n 
A 1 336 ILE 336 330 330 ILE ILE A . n 
A 1 337 ARG 337 331 331 ARG ARG A . n 
A 1 338 ARG 338 332 332 ARG ARG A . n 
A 1 339 ILE 339 333 333 ILE ILE A . n 
A 1 340 GLY 340 334 334 GLY GLY A . n 
A 1 341 VAL 341 335 335 VAL VAL A . n 
A 1 342 ARG 342 336 336 ARG ARG A . n 
A 1 343 PHE 343 337 337 PHE PHE A . n 
A 1 344 SER 344 338 338 SER SER A . n 
A 1 345 LYS 345 339 339 LYS LYS A . n 
A 1 346 PHE 346 340 340 PHE PHE A . n 
A 1 347 ILE 347 341 341 ILE ILE A . n 
A 1 348 GLU 348 342 342 GLU GLU A . n 
A 1 349 ALA 349 343 ?   ?   ?   A . n 
A 1 350 ILE 350 344 ?   ?   ?   A . n 
A 1 351 GLY 351 345 ?   ?   ?   A . n 
A 1 352 LEU 352 346 ?   ?   ?   A . n 
A 1 353 ASP 353 347 ?   ?   ?   A . n 
A 1 354 LYS 354 348 ?   ?   ?   A . n 
A 1 355 PHE 355 349 ?   ?   ?   A . n 
A 1 356 PHE 356 350 ?   ?   ?   A . n 
A 1 357 ASP 357 351 ?   ?   ?   A . n 
A 1 358 THR 358 352 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  P . n 
B 2 2   DG  2   2   2   DG  DG  P . n 
B 2 3   DG  3   3   3   DG  DG  P . n 
B 2 4   DG  4   4   4   DG  DG  P . n 
B 2 5   DG  5   5   5   DG  DG  P . n 
B 2 6   DA  6   6   6   DA  DA  P . n 
B 2 7   DA  7   7   7   DA  DA  P . n 
B 2 8   DG  8   8   8   DG  DG  P . n 
B 2 9   DG  9   9   9   DG  DG  P . n 
B 2 10  DA  10  10  10  DA  DA  P . n 
B 2 11  DT  11  11  11  DT  DT  P . n 
B 2 12  DT  12  12  12  DT  DT  P . n 
B 2 13  DC  13  13  13  DC  DC  P . n 
B 2 14  DOC 14  14  14  DOC DOC P . n 
C 3 1   DT  1   1   ?   ?   ?   T . n 
C 3 2   DC  2   2   ?   ?   ?   T . n 
C 3 3   DA  3   3   3   DA  DA  T . n 
C 3 4   DC  4   4   4   DC  DC  T . n 
C 3 5   8OG 5   5   5   8OG 8OG T . n 
C 3 6   DG  6   6   6   DG  DG  T . n 
C 3 7   DA  7   7   7   DA  DA  T . n 
C 3 8   DA  8   8   8   DA  DA  T . n 
C 3 9   DT  9   9   9   DT  DT  T . n 
C 3 10  DC  10  10  10  DC  DC  T . n 
C 3 11  DC  11  11  11  DC  DC  T . n 
C 3 12  DT  12  12  12  DT  DT  T . n 
C 3 13  DT  13  13  13  DT  DT  T . n 
C 3 14  DC  14  14  14  DC  DC  T . n 
C 3 15  DC  15  15  15  DC  DC  T . n 
C 3 16  DC  16  16  16  DC  DC  T . n 
C 3 17  DC  17  17  17  DC  DC  T . n 
C 3 18  DC  18  18  18  DC  DC  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DCT 1  1342 1342 DCT DCT A . 
E 5 CA  1  1343 1343 CA  CA  A . 
F 5 CA  1  1344 1344 CA  CA  A . 
G 5 CA  1  1345 1345 CA  CA  A . 
H 5 CA  1  1346 1346 CA  CA  A . 
I 6 HOH 1  2001 2001 HOH HOH A . 
I 6 HOH 2  2002 2002 HOH HOH A . 
I 6 HOH 3  2003 2003 HOH HOH A . 
I 6 HOH 4  2004 2004 HOH HOH A . 
I 6 HOH 5  2005 2005 HOH HOH A . 
I 6 HOH 6  2006 2006 HOH HOH A . 
I 6 HOH 7  2007 2007 HOH HOH A . 
I 6 HOH 8  2008 2008 HOH HOH A . 
I 6 HOH 9  2009 2009 HOH HOH A . 
I 6 HOH 10 2010 2010 HOH HOH A . 
I 6 HOH 11 2011 2011 HOH HOH A . 
I 6 HOH 12 2012 2012 HOH HOH A . 
I 6 HOH 13 2013 2013 HOH HOH A . 
I 6 HOH 14 2014 2014 HOH HOH A . 
I 6 HOH 15 2015 2015 HOH HOH A . 
I 6 HOH 16 2016 2016 HOH HOH A . 
I 6 HOH 17 2017 2017 HOH HOH A . 
I 6 HOH 18 2018 2018 HOH HOH A . 
I 6 HOH 19 2019 2019 HOH HOH A . 
I 6 HOH 20 2020 2020 HOH HOH A . 
I 6 HOH 21 2021 2021 HOH HOH A . 
I 6 HOH 22 2022 2022 HOH HOH A . 
I 6 HOH 23 2023 2023 HOH HOH A . 
I 6 HOH 24 2024 2024 HOH HOH A . 
I 6 HOH 25 2025 2025 HOH HOH A . 
I 6 HOH 26 2026 2026 HOH HOH A . 
I 6 HOH 27 2027 2027 HOH HOH A . 
I 6 HOH 28 2028 2028 HOH HOH A . 
I 6 HOH 29 2029 2029 HOH HOH A . 
I 6 HOH 30 2030 2030 HOH HOH A . 
I 6 HOH 31 2031 2031 HOH HOH A . 
I 6 HOH 32 2032 2032 HOH HOH A . 
I 6 HOH 33 2033 2033 HOH HOH A . 
I 6 HOH 34 2034 2034 HOH HOH A . 
I 6 HOH 35 2035 2035 HOH HOH A . 
I 6 HOH 36 2036 2036 HOH HOH A . 
I 6 HOH 37 2037 2037 HOH HOH A . 
I 6 HOH 38 2038 2038 HOH HOH A . 
I 6 HOH 39 2039 2039 HOH HOH A . 
I 6 HOH 40 2040 2040 HOH HOH A . 
I 6 HOH 41 2041 2041 HOH HOH A . 
I 6 HOH 42 2042 2042 HOH HOH A . 
I 6 HOH 43 2043 2043 HOH HOH A . 
I 6 HOH 44 2044 2044 HOH HOH A . 
I 6 HOH 45 2045 2045 HOH HOH A . 
I 6 HOH 46 2046 2046 HOH HOH A . 
I 6 HOH 47 2047 2047 HOH HOH A . 
I 6 HOH 48 2048 2048 HOH HOH A . 
I 6 HOH 49 2049 2049 HOH HOH A . 
I 6 HOH 50 2050 2050 HOH HOH A . 
I 6 HOH 51 2051 2051 HOH HOH A . 
I 6 HOH 52 2052 2052 HOH HOH A . 
I 6 HOH 53 2053 2053 HOH HOH A . 
I 6 HOH 54 2054 2054 HOH HOH A . 
I 6 HOH 55 2055 2055 HOH HOH A . 
I 6 HOH 56 2056 2056 HOH HOH A . 
I 6 HOH 57 2057 2057 HOH HOH A . 
I 6 HOH 58 2058 2058 HOH HOH A . 
I 6 HOH 59 2059 2059 HOH HOH A . 
I 6 HOH 60 2060 2060 HOH HOH A . 
I 6 HOH 61 2061 2061 HOH HOH A . 
I 6 HOH 62 2062 2062 HOH HOH A . 
I 6 HOH 63 2063 2063 HOH HOH A . 
I 6 HOH 64 2064 2064 HOH HOH A . 
I 6 HOH 65 2065 2065 HOH HOH A . 
I 6 HOH 66 2066 2066 HOH HOH A . 
I 6 HOH 67 2067 2067 HOH HOH A . 
J 6 HOH 1  2001 2001 HOH HOH P . 
J 6 HOH 2  2002 2002 HOH HOH P . 
J 6 HOH 3  2003 2003 HOH HOH P . 
J 6 HOH 4  2004 2004 HOH HOH P . 
J 6 HOH 5  2005 2005 HOH HOH P . 
J 6 HOH 6  2006 2006 HOH HOH P . 
J 6 HOH 7  2007 2007 HOH HOH P . 
J 6 HOH 8  2008 2008 HOH HOH P . 
J 6 HOH 9  2009 2009 HOH HOH P . 
J 6 HOH 10 2010 2010 HOH HOH P . 
J 6 HOH 11 2011 2011 HOH HOH P . 
J 6 HOH 12 2012 2012 HOH HOH P . 
J 6 HOH 13 2013 2013 HOH HOH P . 
J 6 HOH 14 2014 2014 HOH HOH P . 
J 6 HOH 15 2015 2015 HOH HOH P . 
J 6 HOH 16 2016 2016 HOH HOH P . 
J 6 HOH 17 2017 2017 HOH HOH P . 
J 6 HOH 18 2018 2018 HOH HOH P . 
J 6 HOH 19 2019 2019 HOH HOH P . 
J 6 HOH 20 2020 2020 HOH HOH P . 
K 6 HOH 1  2001 2001 HOH HOH T . 
K 6 HOH 2  2002 2002 HOH HOH T . 
K 6 HOH 3  2003 2003 HOH HOH T . 
K 6 HOH 4  2004 2004 HOH HOH T . 
K 6 HOH 5  2005 2005 HOH HOH T . 
K 6 HOH 6  2006 2006 HOH HOH T . 
K 6 HOH 7  2007 2007 HOH HOH T . 
K 6 HOH 8  2008 2008 HOH HOH T . 
K 6 HOH 9  2009 2009 HOH HOH T . 
K 6 HOH 10 2010 2010 HOH HOH T . 
K 6 HOH 11 2011 2011 HOH HOH T . 
K 6 HOH 12 2012 2012 HOH HOH T . 
K 6 HOH 13 2013 2013 HOH HOH T . 
K 6 HOH 14 2014 2014 HOH HOH T . 
K 6 HOH 15 2015 2015 HOH HOH T . 
K 6 HOH 16 2016 2016 HOH HOH T . 
K 6 HOH 17 2017 2017 HOH HOH T . 
K 6 HOH 18 2018 2018 HOH HOH T . 
K 6 HOH 19 2019 2019 HOH HOH T . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B DOC 14 P DOC 14 ? DC "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" 
2 C 8OG 5  T 8OG 5  ? DG ?                                        
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 CA  ? F CA  .   ? A CA  1344 ? 1_555 66.6  ? 
2  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 O1A ? D DCT .   ? A DCT 1342 ? 1_555 105.0 ? 
3  CA  ? F CA  .   ? A CA  1344 ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 O1A ? D DCT .   ? A DCT 1342 ? 1_555 86.6  ? 
4  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OP2 ? B DOC 14  ? P DOC 14   ? 1_555 144.2 ? 
5  CA  ? F CA  .   ? A CA  1344 ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OP2 ? B DOC 14  ? P DOC 14   ? 1_555 129.3 ? 
6  O1A ? D DCT .   ? A DCT 1342 ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OP2 ? B DOC 14  ? P DOC 14   ? 1_555 53.0  ? 
7  OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 122.9 ? 
8  CA  ? F CA  .   ? A CA  1344 ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 93.4  ? 
9  O1A ? D DCT .   ? A DCT 1342 ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 127.6 ? 
10 OP2 ? B DOC 14  ? P DOC 14   ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 90.6  ? 
11 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 97.3  ? 
12 CA  ? F CA  .   ? A CA  1344 ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 46.3  ? 
13 O1A ? D DCT .   ? A DCT 1342 ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 111.7 ? 
14 OP2 ? B DOC 14  ? P DOC 14   ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 116.4 ? 
15 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 47.1  ? 
16 OD2 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OE2 ? A GLU 112 ? A GLU 106  ? 1_555 80.5  ? 
17 CA  ? F CA  .   ? A CA  1344 ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OE2 ? A GLU 112 ? A GLU 106  ? 1_555 146.7 ? 
18 O1A ? D DCT .   ? A DCT 1342 ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OE2 ? A GLU 112 ? A GLU 106  ? 1_555 97.8  ? 
19 OP2 ? B DOC 14  ? P DOC 14   ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OE2 ? A GLU 112 ? A GLU 106  ? 1_555 76.2  ? 
20 OD1 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OE2 ? A GLU 112 ? A GLU 106  ? 1_555 109.2 ? 
21 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? E CA . ? A CA 1343 ? 1_555 OE2 ? A GLU 112 ? A GLU 106  ? 1_555 149.7 ? 
22 O   ? A PHE 14  ? A PHE 8    ? 1_555 CA ? F CA . ? A CA 1344 ? 1_555 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 100.9 ? 
23 O   ? A PHE 14  ? A PHE 8    ? 1_555 CA ? F CA . ? A CA 1344 ? 1_555 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 62.7  ? 
24 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? F CA . ? A CA 1344 ? 1_555 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 116.2 ? 
25 O   ? A PHE 14  ? A PHE 8    ? 1_555 CA ? F CA . ? A CA 1344 ? 1_555 O3A ? D DCT .   ? A DCT 1342 ? 1_555 144.1 ? 
26 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? F CA . ? A CA 1344 ? 1_555 O3A ? D DCT .   ? A DCT 1342 ? 1_555 106.3 ? 
27 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? F CA . ? A CA 1344 ? 1_555 O3A ? D DCT .   ? A DCT 1342 ? 1_555 121.7 ? 
28 O   ? A PHE 14  ? A PHE 8    ? 1_555 CA ? F CA . ? A CA 1344 ? 1_555 O2G ? D DCT .   ? A DCT 1342 ? 1_555 96.9  ? 
29 OD2 ? A ASP 111 ? A ASP 105  ? 1_555 CA ? F CA . ? A CA 1344 ? 1_555 O2G ? D DCT .   ? A DCT 1342 ? 1_555 162.1 ? 
30 OD1 ? A ASP 13  ? A ASP 7    ? 1_555 CA ? F CA . ? A CA 1344 ? 1_555 O2G ? D DCT .   ? A DCT 1342 ? 1_555 74.1  ? 
31 O3A ? D DCT .   ? A DCT 1342 ? 1_555 CA ? F CA . ? A CA 1344 ? 1_555 O2G ? D DCT .   ? A DCT 1342 ? 1_555 56.6  ? 
32 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O   ? A ILE 192 ? A ILE 186  ? 1_555 104.5 ? 
33 O   ? A ALA 187 ? A ALA 181  ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O   ? J HOH .   ? P HOH 2019 ? 1_555 123.4 ? 
34 O   ? A ILE 192 ? A ILE 186  ? 1_555 CA ? G CA . ? A CA 1345 ? 1_555 O   ? J HOH .   ? P HOH 2019 ? 1_555 75.2  ? 
35 O   ? I HOH .   ? A HOH 2067 ? 1_555 CA ? H CA . ? A CA 1346 ? 1_555 O1A ? D DCT .   ? A DCT 1342 ? 1_555 44.8  ? 
36 O   ? I HOH .   ? A HOH 2067 ? 1_555 CA ? H CA . ? A CA 1346 ? 1_555 OP1 ? B DOC 14  ? P DOC 14   ? 1_555 90.1  ? 
37 O1A ? D DCT .   ? A DCT 1342 ? 1_555 CA ? H CA . ? A CA 1346 ? 1_555 OP1 ? B DOC 14  ? P DOC 14   ? 1_555 57.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-11-29 
2 'Structure model' 1 1 2011-05-07 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
XDS    'data reduction' .   ? 2 
XDS    'data scaling'   .   ? 3 
PHASER phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id             2C2R 
_pdbx_entry_details.compound_details     'INVOLVEMENT IN UNTARGETED MUTAGENESIS.' 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     'THE 14TH NUCLEOTIDE WAS ADDED BY POLYMERASE' 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    309 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   B 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    2058 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.95 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O3'" T DC 4 ? ? P T 8OG 5 ? ? OP2 T 8OG 5 ? ? 90.75 105.20 -14.45 2.20 Y 
2 1 "O3'" T DC 4 ? ? P T 8OG 5 ? ? OP1 T 8OG 5 ? ? 87.77 105.20 -17.43 2.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 10  ? ? 17.29   48.85   
2  1 PHE A 11  ? ? -32.87  -70.27  
3  1 PRO A 21  ? ? -59.17  1.53    
4  1 PHE A 37  ? ? 169.93  144.98  
5  1 LEU A 68  ? ? -113.02 73.39   
6  1 ARG A 93  ? ? -50.60  -5.98   
7  1 SER A 96  ? ? 160.09  99.49   
8  1 GLU A 97  ? ? -74.56  29.92   
9  1 ASP A 105 ? ? -143.26 14.72   
10 1 ASP A 113 ? ? -61.05  -85.73  
11 1 LYS A 114 ? ? -23.47  -32.14  
12 1 ASP A 117 ? ? 109.70  144.47  
13 1 SER A 145 ? ? -173.04 -168.43 
14 1 ASN A 161 ? ? 33.34   43.86   
15 1 ASP A 167 ? ? -60.00  -171.63 
16 1 LYS A 196 ? ? -51.82  -75.41  
17 1 LEU A 197 ? ? -44.68  -11.25  
18 1 ASN A 200 ? ? -142.87 -11.59  
19 1 THR A 205 ? ? -58.74  -5.12   
20 1 LYS A 214 ? ? -39.47  -22.99  
21 1 ASP A 231 ? ? 50.96   16.32   
22 1 TYR A 233 ? ? -80.46  -83.20  
23 1 ASN A 234 ? ? 39.65   106.01  
24 1 THR A 239 ? ? -21.24  -62.03  
25 1 ARG A 240 ? ? 59.88   129.73  
26 1 SER A 255 ? ? 175.03  175.04  
27 1 ARG A 256 ? ? -149.22 16.82   
28 1 LYS A 262 ? ? -22.72  -60.99  
29 1 ASP A 277 ? ? 56.19   88.58   
30 1 LYS A 278 ? ? 72.89   -43.05  
31 1 GLU A 327 ? ? -128.91 -60.24  
32 1 ARG A 328 ? ? -29.41  150.25  
33 1 ARG A 331 ? ? -105.68 -61.16  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DA 
_pdbx_validate_planes.auth_asym_id    T 
_pdbx_validate_planes.auth_seq_id     8 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.057 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2004 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.86 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 342 ? CA    ? A GLU 348 CA    
2  1 Y 1 A GLU 342 ? C     ? A GLU 348 C     
3  1 Y 1 A GLU 342 ? O     ? A GLU 348 O     
4  1 Y 1 A GLU 342 ? CB    ? A GLU 348 CB    
5  1 Y 1 A GLU 342 ? CG    ? A GLU 348 CG    
6  1 Y 1 A GLU 342 ? CD    ? A GLU 348 CD    
7  1 Y 1 A GLU 342 ? OE1   ? A GLU 348 OE1   
8  1 Y 1 A GLU 342 ? OE2   ? A GLU 348 OE2   
9  1 Y 1 T DA  3   ? P     ? C DA  3   P     
10 1 Y 1 T DA  3   ? OP1   ? C DA  3   OP1   
11 1 Y 1 T DA  3   ? OP2   ? C DA  3   OP2   
12 1 Y 0 T DA  3   ? "C4'" ? C DA  3   "C4'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A HIS -5  ? A HIS 1   
2  1 Y 1 A HIS -4  ? A HIS 2   
3  1 Y 1 A HIS -3  ? A HIS 3   
4  1 Y 1 A HIS -2  ? A HIS 4   
5  1 Y 1 A HIS -1  ? A HIS 5   
6  1 Y 1 A HIS 0   ? A HIS 6   
7  1 Y 1 A ALA 343 ? A ALA 349 
8  1 Y 1 A ILE 344 ? A ILE 350 
9  1 Y 1 A GLY 345 ? A GLY 351 
10 1 Y 1 A LEU 346 ? A LEU 352 
11 1 Y 1 A ASP 347 ? A ASP 353 
12 1 Y 1 A LYS 348 ? A LYS 354 
13 1 Y 1 A PHE 349 ? A PHE 355 
14 1 Y 1 A PHE 350 ? A PHE 356 
15 1 Y 1 A ASP 351 ? A ASP 357 
16 1 Y 1 A THR 352 ? A THR 358 
17 1 Y 1 T DT  1   ? C DT  1   
18 1 Y 1 T DC  2   ? C DC  2   
# 
_ndb_struct_conf_na.entry_id   2C2R 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 18 1_555 0.613  -0.170 0.214  5.829   3.119   -2.167 1  P_DG1:DC18_T P 1  ? T 18 ? 19 1 
1 B DG 2  1_555 C DC 17 1_555 0.206  -0.158 -0.321 -1.278  -0.955  0.025  2  P_DG2:DC17_T P 2  ? T 17 ? 19 1 
1 B DG 3  1_555 C DC 16 1_555 0.212  -0.008 0.102  5.510   -3.400  0.678  3  P_DG3:DC16_T P 3  ? T 16 ? 19 1 
1 B DG 4  1_555 C DC 15 1_555 0.006  0.146  0.499  10.974  -4.850  7.967  4  P_DG4:DC15_T P 4  ? T 15 ? 19 1 
1 B DG 5  1_555 C DC 14 1_555 0.609  -0.018 0.087  3.113   -7.997  10.989 5  P_DG5:DC14_T P 5  ? T 14 ? 19 1 
1 B DA 6  1_555 C DT 13 1_555 -0.370 -0.080 0.030  -5.610  -3.487  1.551  6  P_DA6:DT13_T P 6  ? T 13 ? 20 1 
1 B DA 7  1_555 C DT 12 1_555 0.184  0.165  0.140  -3.101  -10.055 2.205  7  P_DA7:DT12_T P 7  ? T 12 ? 20 1 
1 B DG 8  1_555 C DC 11 1_555 -1.104 -0.135 -0.295 -5.597  -2.355  7.160  8  P_DG8:DC11_T P 8  ? T 11 ? 19 1 
1 B DG 9  1_555 C DC 10 1_555 -0.233 -0.267 -0.309 -8.864  -12.059 -0.488 9  P_DG9:DC10_T P 9  ? T 10 ? 19 1 
1 B DA 10 1_555 C DT 9  1_555 0.161  -0.268 -0.077 -10.146 -11.206 2.618  10 P_DA10:DT9_T P 10 ? T 9  ? 20 1 
1 B DT 11 1_555 C DA 8  1_555 -0.585 -0.131 -0.059 -5.499  -6.527  2.926  11 P_DT11:DA8_T P 11 ? T 8  ? 20 1 
1 B DT 12 1_555 C DA 7  1_555 0.058  0.260  -0.367 2.328   -10.814 -1.744 12 P_DT12:DA7_T P 12 ? T 7  ? 20 1 
1 B DC 13 1_555 C DG 6  1_555 -0.030 -0.437 -0.124 -0.864  -8.013  -3.835 13 P_DC13:DG6_T P 13 ? T 6  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 18 1_555 B DG 2  1_555 C DC 17 1_555 0.824  -0.368 3.651 7.128  3.448  29.484 -1.482 0.052  3.679 6.625   
-13.698 30.506 1  PP_DG1DG2:DC17DC18_TT P 1  ? T 18 ? P 2  ? T 17 ? 
1 B DG 2  1_555 C DC 17 1_555 B DG 3  1_555 C DC 16 1_555 -1.365 -0.228 3.271 -4.704 1.991  31.055 -0.804 1.612  3.415 3.688   
8.712   31.462 2  PP_DG2DG3:DC16DC17_TT P 2  ? T 17 ? P 3  ? T 16 ? 
1 B DG 3  1_555 C DC 16 1_555 B DG 4  1_555 C DC 15 1_555 0.858  0.363  3.079 -0.350 8.959  33.922 -0.682 -1.475 3.065 15.031  
0.588   35.053 3  PP_DG3DG4:DC15DC16_TT P 3  ? T 16 ? P 4  ? T 15 ? 
1 B DG 4  1_555 C DC 15 1_555 B DG 5  1_555 C DC 14 1_555 -0.015 -0.915 3.427 2.856  11.353 29.874 -3.705 0.543  2.882 21.033  
-5.292  32.037 4  PP_DG4DG5:DC14DC15_TT P 4  ? T 15 ? P 5  ? T 14 ? 
1 B DG 5  1_555 C DC 14 1_555 B DA 6  1_555 C DT 13 1_555 -0.659 -0.086 3.443 -3.601 -2.357 33.796 0.253  0.515  3.491 -4.034  
6.163   34.061 5  PP_DG5DA6:DT13DC14_TT P 5  ? T 14 ? P 6  ? T 13 ? 
1 B DA 6  1_555 C DT 13 1_555 B DA 7  1_555 C DT 12 1_555 -0.023 -0.569 3.188 -2.743 0.013  37.390 -0.887 -0.315 3.182 0.020   
4.272   37.487 6  PP_DA6DA7:DT12DT13_TT P 6  ? T 13 ? P 7  ? T 12 ? 
1 B DA 7  1_555 C DT 12 1_555 B DG 8  1_555 C DC 11 1_555 0.471  0.072  3.410 0.955  -3.402 31.028 0.807  -0.687 3.396 -6.334  
-1.778  31.224 7  PP_DA7DG8:DC11DT12_TT P 7  ? T 12 ? P 8  ? T 11 ? 
1 B DG 8  1_555 C DC 11 1_555 B DG 9  1_555 C DC 10 1_555 -0.879 -0.302 3.577 -2.125 1.317  36.488 -0.681 1.080  3.608 2.100   
3.388   36.571 8  PP_DG8DG9:DC10DC11_TT P 8  ? T 11 ? P 9  ? T 10 ? 
1 B DG 9  1_555 C DC 10 1_555 B DA 10 1_555 C DT 9  1_555 0.183  -0.510 3.441 1.286  -8.607 39.356 0.301  -0.110 3.476 -12.593 
-1.881  40.269 9  PP_DG9DA10:DT9DC10_TT P 9  ? T 10 ? P 10 ? T 9  ? 
1 B DA 10 1_555 C DT 9  1_555 B DT 11 1_555 C DA 8  1_555 -0.078 -0.649 3.337 0.544  -5.279 27.530 -0.045 0.295  3.398 -10.963 
-1.130  28.028 10 PP_DA10DT11:DA8DT9_TT P 10 ? T 9  ? P 11 ? T 8  ? 
1 B DT 11 1_555 C DA 8  1_555 B DT 12 1_555 C DA 7  1_555 -0.634 -0.497 3.218 0.511  -3.802 36.515 -0.275 1.076  3.243 -6.047  
-0.813  36.709 11 PP_DT11DT12:DA7DA8_TT P 11 ? T 8  ? P 12 ? T 7  ? 
1 B DT 12 1_555 C DA 7  1_555 B DC 13 1_555 C DG 6  1_555 0.288  -0.454 3.455 2.822  7.358  31.499 -2.163 0.004  3.281 13.294  
-5.100  32.446 12 PP_DT12DC13:DG6DA7_TT P 12 ? T 7  ? P 13 ? T 6  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 
;2',3'-DIDEOXYCYTIDINE 5'-TRIPHOSPHATE
;
DCT 
5 'CALCIUM ION'                           CA  
6 water                                   HOH 
#