data_2C5F
# 
_entry.id   2C5F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2C5F         
PDBE  EBI-26189    
WWPDB D_1290026189 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7 ) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN- II' 
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7- HEPTYLENE-BIS-N,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3- PROPYLENE-BIS-N,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1ODC unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9 "-(1",2",3",4"-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-9-(1',2',3',4 '-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS- ACTING GALANTHAMINE DERIVATIVE' 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 2C5G unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM THIOCHOLINE' 
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2C5F 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-10-27 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Colletier, J.P.'  1 
'Fournier, D.'     2 
'Greenblatt, H.M.' 3 
'Sussman, J.L.'    4 
'Zaccai, G.'       5 
'Silman, I.'       6 
'Weik, M.'         7 
# 
_citation.id                        primary 
_citation.title                     'Structural Insights Into Substrate Traffic and Inhibition in Acetylcholinesterase.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            25 
_citation.page_first                2746 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16763558 
_citation.pdbx_database_id_DOI      10.1038/SJ.EMBOJ.7601175 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Colletier, J.P.'  1 ? 
primary 'Fournier, D.'     2 ? 
primary 'Greenblatt, H.M.' 3 ? 
primary 'Stojan, J.'       4 ? 
primary 'Sussman, J.L.'    5 ? 
primary 'Zaccai, G.'       6 ? 
primary 'Silman, I.'       7 ? 
primary 'Weik, M.'         8 ? 
# 
_cell.entry_id           2C5F 
_cell.length_a           112.260 
_cell.length_b           112.260 
_cell.length_c           137.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2C5F 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                          60736.516 1   3.1.1.7 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose      221.208   2   ?       ? ? ? 
3 non-polymer syn 'TRIETHYLENE GLYCOL'                          150.173   3   ?       ? ? ? 
4 non-polymer syn 4,4-DIHYDROXY-N,N,N-TRIMETHYLPENTAN-1-AMINIUM 162.250   1   ?       ? ? ? 
5 non-polymer syn N,N,N-TRIMETHYL-4-OXOPENTAN-1-AMINIUM         144.235   1   ?       ? ? ? 
6 water       nat water                                         18.015    824 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2C5F 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                       ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                      ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                    ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'     133.103 
CHH non-polymer                  . N,N,N-TRIMETHYL-4-OXOPENTAN-1-AMINIUM         4-KETOAMYLTRIMETHYLAMMONIUM 'C8 H18 N O 1'   
144.235 
CYS 'L-peptide linking'          y CYSTEINE                                      ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                     ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                       ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                     ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                         ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                    ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                       ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                        ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                    ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose      
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
NWA non-polymer                  . 4,4-DIHYDROXY-N,N,N-TRIMETHYLPENTAN-1-AMINIUM ? 'C8 H20 N O2 1'  162.250 
PGE non-polymer                  . 'TRIETHYLENE GLYCOL'                          ? 'C6 H14 O4'      150.173 
PHE 'L-peptide linking'          y PHENYLALANINE                                 ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                       ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                        ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                     ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                      ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                        ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2C5F 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.39 
_exptl_crystal.density_percent_sol   63.47 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '32% PEG200, 150MM MES, PH6, 4 DEG. C, pH 6.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-03-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979688 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE BM30A' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   BM30A 
_diffrn_source.pdbx_wavelength             0.979688 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2C5F 
_reflns.observed_criterion_sigma_I   3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.600 
_reflns.number_obs                   30595 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.8 
_reflns.pdbx_Rmerge_I_obs            0.08000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.1200 
_reflns.B_iso_Wilson_estimate        42.6 
_reflns.pdbx_redundancy              5.980 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.70 
_reflns_shell.percent_possible_all   97.0 
_reflns_shell.Rmerge_I_obs           0.30000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.920 
_reflns_shell.pdbx_redundancy        5.59 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2C5F 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     30590 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.6 
_refine.ls_percent_reflns_obs                    98.2 
_refine.ls_R_factor_obs                          0.1626 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1626 
_refine.ls_R_factor_R_free                       0.2195 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1560 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.3 
_refine.aniso_B[1][1]                            -10.267 
_refine.aniso_B[2][2]                            -10.267 
_refine.aniso_B[3][3]                            20.535 
_refine.aniso_B[1][2]                            -5.185 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.321095 
_refine.solvent_model_param_bsol                 74.9725 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1EA5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2C5F 
_refine_analyze.Luzzati_coordinate_error_obs    0.24 
_refine_analyze.Luzzati_sigma_a_obs             0.30 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.36 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4245 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             824 
_refine_hist.number_atoms_total               5147 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007373 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.33526  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.5     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?        ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.26     1.5  ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.06     2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.05     2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.04     2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.6 
_refine_ls_shell.d_res_low                        2.76 
_refine_ls_shell.number_reflns_R_work             4722 
_refine_ls_shell.R_factor_R_work                  0.240 
_refine_ls_shell.percent_reflns_obs               98 
_refine_ls_shell.R_factor_R_free                  0.288 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            5.5 
_refine_ls_shell.number_reflns_R_free             275 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM    WATER.TOP        
'X-RAY DIFFRACTION' 4 PEG.PARAM          PEG.TOP          
'X-RAY DIFFRACTION' 5 AS.PARAM           AS.TOP           
# 
_struct.entry_id                  2C5F 
_struct.title                     
'Torpedo californica acetylcholinesterase in complex with a non hydrolysable substrate analogue, 4-oxo-N,N,N-trimethylpentanaminium' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2C5F 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HYDROLASE, SERINE ESTERASE, SYNAPSE, MEMBRANE, NEUROTRANSMITTER CLEAVAGE, ALPHA/BETA HYDROLASE, SUBSTRATE HYDROLYSIS, MICHAELIS-MENTEN COMPLEX, SUBSTRATE INHIBITION, ALTERNATIVE SPLICING, GLYCOPROTEIN, GPI-ANCHOR, LIPOPROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 215 ? PHE A 219 ? SER A 215 PHE A 219 5 ? 5  
HELX_P HELX_P10 10 SER A 237 ? LEU A 252 ? SER A 237 LEU A 252 1 ? 16 
HELX_P HELX_P11 11 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? TYR A 375 ? ASN A 364 TYR A 375 1 ? 12 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? THR A 412 ? VAL A 400 THR A 412 1 ? 13 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 59  A NAG 1537 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale2 covale one ? A SER 200 OG  ? ? ? 1_555 G NWA .   C5 ? ? A SER 200 A NWA 1541 1_555 ? ? ? ? ? ? ? 1.433 ? ?               
covale3 covale one ? A ASN 416 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 416 A NAG 1536 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? PRO A 21  ? THR A 18  PRO A 21  
AB 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  ILE A 319 ? ASN A 324 ? ILE A 319 ASN A 324 
AB 9  THR A 418 ? PHE A 423 ? THR A 418 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 20  ? N VAL A 20  O ILE A 27  ? O ILE A 27  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N LEU A 224 ? N LEU A 224 O LEU A 320 ? O LEU A 320 
AB 8  9  N LEU A 321 ? N LEU A 321 O TYR A 419 ? O TYR A 419 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
# 
_database_PDB_matrix.entry_id          2C5F 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2C5F 
_atom_sites.fract_transf_matrix[1][1]   0.008908 
_atom_sites.fract_transf_matrix[1][2]   0.005143 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010286 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007299 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -12.932 88.086 34.359 1.00 62.15  ? 4    SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.211 88.520 35.590 1.00 61.86  ? 4    SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.055 87.580 35.904 1.00 61.28  ? 4    SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.135 86.378 35.652 1.00 62.78  ? 4    SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -13.168 88.555 36.784 1.00 62.44  ? 4    SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.510 89.025 37.950 1.00 63.70  ? 4    SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -9.986  88.135 36.465 1.00 59.55  ? 5    GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -8.810  87.353 36.813 1.00 58.38  ? 5    GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.107  86.374 37.947 1.00 58.06  ? 5    GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.451  85.341 38.069 1.00 59.28  ? 5    GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -7.669  88.282 37.225 1.00 58.98  ? 5    GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.318  87.599 37.335 1.00 61.89  ? 5    GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.214  88.560 37.740 1.00 63.94  ? 5    GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -4.021  88.204 37.630 1.00 65.00  ? 5    GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -5.539  89.681 38.178 1.00 67.16  ? 5    GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.090 86.704 38.779 1.00 56.23  ? 6    LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.459 85.845 39.895 1.00 54.54  ? 6    LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.484 84.790 39.494 1.00 53.78  ? 6    LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -11.931 83.993 40.320 1.00 53.12  ? 6    LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.017 86.682 41.045 1.00 54.04  ? 6    LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.070 87.716 41.650 1.00 54.53  ? 6    LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -10.729 88.311 42.885 1.00 54.59  ? 6    LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -8.741  87.070 42.017 1.00 53.38  ? 6    LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -11.861 84.787 38.224 1.00 52.92  ? 7    LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -12.826 83.817 37.741 1.00 53.21  ? 7    LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.109 82.828 36.837 1.00 53.40  ? 7    LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -11.391 83.221 35.915 1.00 53.86  ? 7    LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -13.944 84.525 36.982 1.00 54.58  ? 7    LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.136 83.661 36.569 1.00 57.13  ? 7    LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -15.738 82.976 37.791 1.00 58.34  ? 7    LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.170 84.535 35.877 1.00 57.48  ? 7    LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.282 81.542 37.127 1.00 53.36  ? 8    VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -11.651 80.482 36.347 1.00 51.04  ? 8    VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -12.634 79.350 36.114 1.00 50.91  ? 8    VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.308 78.893 37.040 1.00 51.28  ? 8    VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.408 79.898 37.070 1.00 51.86  ? 8    VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -9.850  78.710 36.287 1.00 51.00  ? 8    VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.338  80.965 37.222 1.00 48.52  ? 8    VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -12.725 78.906 34.868 1.00 50.51  ? 9    ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.614 77.809 34.529 1.00 48.69  ? 9    ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -12.769 76.541 34.428 1.00 47.68  ? 9    ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -11.744 76.519 33.739 1.00 47.27  ? 9    ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.323 78.094 33.205 1.00 49.42  ? 9    ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.296 76.999 32.819 1.00 51.63  ? 9    ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.129 76.578 33.622 1.00 52.02  ? 9    ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.202 76.536 31.581 1.00 54.25  ? 9    ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.188 75.499 35.141 1.00 46.58  ? 10   THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.475 74.226 35.136 1.00 45.08  ? 10   THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.404 73.141 34.631 1.00 45.30  ? 10   THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.588 73.386 34.406 1.00 45.26  ? 10   THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.004 73.815 36.546 1.00 43.11  ? 10   THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.134 73.400 37.324 1.00 40.75  ? 10   THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.295 74.973 37.229 1.00 38.95  ? 10   THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -12.866 71.938 34.471 1.00 45.77  ? 11   LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.650 70.816 33.984 1.00 45.23  ? 11   LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.745 70.403 34.958 1.00 46.89  ? 11   LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.685 69.708 34.581 1.00 49.27  ? 11   LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.721 69.638 33.697 1.00 44.65  ? 11   LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.732 69.935 32.583 1.00 43.21  ? 11   LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.649 68.884 32.461 1.00 40.76  ? 11   LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.679  69.255 31.353 1.00 39.57  ? 11   LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.563  68.288 31.209 1.00 43.08  ? 11   LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.632 70.838 36.207 1.00 48.70  ? 12   SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.623 70.492 37.224 1.00 50.83  ? 12   SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.624 71.622 37.425 1.00 50.68  ? 12   SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.667 71.441 38.062 1.00 49.39  ? 12   SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -14.931 70.189 38.555 1.00 51.78  ? 12   SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.041 69.092 38.431 1.00 54.29  ? 12   SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.289 72.786 36.878 1.00 50.28  ? 13   GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.149 73.948 36.994 1.00 49.66  ? 13   GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.334 75.211 37.175 1.00 49.66  ? 13   GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.107 75.170 37.133 1.00 49.05  ? 13   GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.014 76.334 37.382 1.00 49.85  ? 14   LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.340 77.615 37.570 1.00 51.01  ? 14   LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.073 77.935 39.035 1.00 50.31  ? 14   LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -16.864 77.587 39.912 1.00 50.56  ? 14   LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.172 78.740 36.947 1.00 53.19  ? 14   LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -16.975 78.896 35.451 1.00 57.03  ? 14   LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -17.987 79.845 34.835 1.00 59.50  ? 14   LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.382 79.226 34.823 1.00 63.57  ? 14   LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.347 80.018 34.001 1.00 64.79  ? 14   LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -14.948 78.596 39.296 1.00 48.28  ? 15   VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -14.588 78.987 40.655 1.00 48.15  ? 15   VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.245 80.478 40.714 1.00 49.57  ? 15   VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -13.629 81.028 39.791 1.00 48.41  ? 15   VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.370 78.180 41.189 1.00 46.99  ? 15   VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -13.664 76.694 41.149 1.00 43.10  ? 15   VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -12.131 78.509 40.380 1.00 46.78  ? 15   VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -14.657 81.134 41.796 1.00 50.63  ? 16   MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.375 82.556 41.972 1.00 53.55  ? 16   MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.349 82.743 43.087 1.00 52.73  ? 16   MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -13.635 82.493 44.259 1.00 52.75  ? 16   MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -15.666 83.325 42.299 1.00 57.50  ? 16   MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.481 84.816 42.637 1.00 61.38  ? 16   MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -14.639 85.815 41.372 1.00 69.19  ? 16   MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -16.024 86.263 40.299 1.00 67.17  ? 16   MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.153 83.176 42.706 1.00 52.05  ? 17   GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.094 83.387 43.671 1.00 53.17  ? 17   GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.250 84.658 44.484 1.00 54.48  ? 17   GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.347 85.208 44.601 1.00 54.05  ? 17   GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.139 85.118 45.053 1.00 54.13  ? 18   THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.127 86.326 45.862 1.00 54.56  ? 18   THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -8.743  86.953 45.813 1.00 54.07  ? 18   THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -7.739  86.250 45.896 1.00 55.53  ? 18   THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.498 86.021 47.328 1.00 55.44  ? 18   THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.510 87.239 48.075 1.00 57.38  ? 18   THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -9.493  85.067 47.959 1.00 57.79  ? 18   THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -8.688  88.275 45.667 1.00 54.93  ? 19   ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.409  88.973 45.596 1.00 54.91  ? 19   ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -6.795  89.065 46.983 1.00 54.97  ? 19   ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.436  89.514 47.938 1.00 54.65  ? 19   ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -7.585  90.368 44.991 1.00 56.05  ? 19   ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.272  91.013 44.573 1.00 60.24  ? 19   ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.494  92.174 43.611 1.00 63.54  ? 19   ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.235  92.804 43.207 1.00 68.58  ? 19   ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -4.289  92.204 42.488 1.00 70.82  ? 19   ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -4.451  90.950 42.081 1.00 72.90  ? 19   ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -3.173  92.854 42.182 1.00 70.20  ? 19   ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -5.545  88.629 47.084 1.00 53.59  ? 20   VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -4.848  88.616 48.356 1.00 52.04  ? 20   VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -3.585  89.448 48.339 1.00 50.60  ? 20   VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -2.796  89.384 47.396 1.00 50.43  ? 20   VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -4.483  87.166 48.755 1.00 52.29  ? 20   VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -3.597  87.162 49.981 1.00 52.84  ? 20   VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -5.747  86.375 49.024 1.00 52.91  ? 20   VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.382  90.255 49.389 1.00 50.82  ? 21   PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.198  91.109 49.502 1.00 50.38  ? 21   PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.024  90.289 50.014 1.00 51.31  ? 21   PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.173  89.484 50.932 1.00 51.07  ? 21   PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -2.637  92.166 50.505 1.00 49.43  ? 21   PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.506  91.373 51.439 1.00 49.50  ? 21   PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.336  90.532 50.481 1.00 49.78  ? 21   PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? 0.138   90.491 49.408 1.00 52.19  ? 22   VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 1.342   89.776 49.799 1.00 53.06  ? 22   VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.549   90.675 49.575 1.00 53.64  ? 22   VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.846   91.057 48.443 1.00 52.13  ? 22   VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.513   88.461 48.979 1.00 54.04  ? 22   VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 1.404   88.752 47.488 1.00 54.26  ? 22   VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.865   87.821 49.280 1.00 50.96  ? 22   VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 3.234   91.012 50.666 1.00 53.65  ? 23   LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.419   91.862 50.608 1.00 55.68  ? 23   LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 4.182   93.136 49.794 1.00 57.11  ? 23   LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.846   93.376 48.780 1.00 55.73  ? 23   LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.595   91.084 50.011 1.00 53.52  ? 23   LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.979   89.785 50.717 1.00 53.63  ? 23   LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 7.139   89.142 49.984 1.00 55.71  ? 23   LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.357   90.065 52.157 1.00 54.02  ? 23   LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 3.235   93.949 50.247 1.00 58.69  ? 24   SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 2.908   95.201 49.568 1.00 61.57  ? 24   SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.643   94.964 48.085 1.00 60.85  ? 24   SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 3.147   95.694 47.229 1.00 62.97  ? 24   SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 4.050   96.208 49.722 1.00 62.13  ? 24   SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 5.159   95.846 48.912 1.00 66.32  ? 24   SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.861   93.931 47.792 1.00 59.75  ? 25   SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.505   93.585 46.421 1.00 57.52  ? 25   SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? 0.273   92.692 46.470 1.00 57.51  ? 25   SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.366  92.577 47.516 1.00 57.09  ? 25   SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.661   92.862 45.730 1.00 56.13  ? 25   SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 2.390   92.691 44.351 1.00 55.39  ? 25   SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.065  92.050 45.357 1.00 58.07  ? 26   HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.250  91.197 45.333 1.00 60.09  ? 26   HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.163  90.015 44.371 1.00 59.43  ? 26   HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.483  90.084 43.350 1.00 60.40  ? 26   HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.480  92.036 44.968 1.00 64.61  ? 26   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -2.854  93.057 46.001 1.00 69.98  ? 26   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -3.657  92.764 47.083 1.00 72.36  ? 26   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -2.522  94.365 46.124 1.00 71.06  ? 26   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.804  93.846 47.828 1.00 72.52  ? 26   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -3.124  94.831 47.269 1.00 73.33  ? 26   HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -1.855  88.931 44.718 1.00 57.60  ? 27   ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -1.921  87.733 43.883 1.00 55.98  ? 27   ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.298  87.123 44.069 1.00 54.01  ? 27   ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.037  87.521 44.969 1.00 53.62  ? 27   ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -0.872  86.668 44.261 1.00 56.51  ? 27   ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.121  86.161 45.678 1.00 56.42  ? 27   ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? 0.527   87.240 44.108 1.00 57.89  ? 27   ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -0.121  85.116 46.116 1.00 59.10  ? 27   ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -3.642  86.160 43.220 1.00 51.76  ? 28   SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -4.943  85.515 43.302 1.00 50.19  ? 28   SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -4.882  84.282 44.191 1.00 49.45  ? 28   SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -3.866  83.592 44.249 1.00 48.36  ? 28   SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -5.427  85.119 41.907 1.00 50.88  ? 28   SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.563  86.250 41.069 1.00 52.08  ? 28   SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -5.980  84.013 44.884 1.00 48.37  ? 29   ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.057  82.865 45.767 1.00 48.55  ? 29   ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.395  82.175 45.584 1.00 48.95  ? 29   ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.445  82.823 45.640 1.00 50.55  ? 29   ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -5.895  83.302 47.211 1.00 48.55  ? 29   ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.356  80.866 45.349 1.00 45.94  ? 30   PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -8.579  80.092 45.178 1.00 45.37  ? 30   PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -8.601  79.066 46.298 1.00 46.27  ? 30   PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -8.003  77.994 46.188 1.00 48.24  ? 30   PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -8.592  79.407 43.811 1.00 42.47  ? 30   PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -8.518  80.366 42.658 1.00 40.59  ? 30   PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.309  80.966 42.310 1.00 39.20  ? 30   PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -9.665  80.697 41.939 1.00 39.43  ? 30   PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.240  81.881 41.266 1.00 38.26  ? 30   PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -9.612  81.609 40.892 1.00 39.16  ? 30   PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.393  82.205 40.553 1.00 40.26  ? 30   PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.290  79.409 47.380 1.00 45.54  ? 31   LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.354  78.545 48.546 1.00 45.88  ? 31   LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -10.599 77.671 48.619 1.00 46.27  ? 31   LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -11.694 78.089 48.230 1.00 46.06  ? 31   LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.254  79.402 49.811 1.00 44.78  ? 31   LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.201  80.517 49.727 1.00 45.57  ? 31   LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.176  81.304 51.027 1.00 42.91  ? 31   LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -6.834  79.926 49.433 1.00 42.73  ? 31   LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.410 76.448 49.112 1.00 45.78  ? 32   GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.509 75.513 49.277 1.00 44.94  ? 32   GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.150 74.918 48.037 1.00 45.42  ? 32   GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.365 74.707 48.015 1.00 45.38  ? 32   GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.362 74.639 47.004 1.00 44.08  ? 33   ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -11.932 74.045 45.801 1.00 44.68  ? 33   ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.117 72.551 46.050 1.00 45.01  ? 33   ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.167 71.857 46.410 1.00 47.28  ? 33   ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.011 74.235 44.587 1.00 43.17  ? 33   ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -10.892 75.720 44.246 1.00 42.60  ? 33   ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -11.559 73.475 43.406 1.00 40.72  ? 33   ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -9.952  76.010 43.103 1.00 42.09  ? 33   ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.344 72.038 45.875 1.00 45.21  ? 34   PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.607 70.611 46.095 1.00 44.84  ? 34   PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.005 69.739 44.994 1.00 45.27  ? 34   PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.070 70.092 43.818 1.00 47.36  ? 34   PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.133 70.550 46.121 1.00 44.26  ? 34   PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.517 71.617 45.130 1.00 42.15  ? 34   PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.577 72.751 45.494 1.00 43.66  ? 34   PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.413 68.607 45.372 1.00 44.89  ? 35   PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -11.819 67.704 44.388 1.00 44.64  ? 35   PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.333 66.276 44.524 1.00 44.38  ? 35   PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -11.940 65.389 43.768 1.00 46.42  ? 35   PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.280 67.731 44.474 1.00 44.93  ? 35   PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.716  67.108 45.721 1.00 44.23  ? 35   PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -9.698  65.727 45.884 1.00 44.24  ? 35   PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.185  67.906 46.731 1.00 43.68  ? 35   PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.161  65.150 47.034 1.00 43.98  ? 35   PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.645  67.339 47.887 1.00 42.72  ? 35   PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.632  65.960 48.038 1.00 42.99  ? 35   PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.218 66.058 45.489 1.00 43.81  ? 36   ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -13.801 64.740 45.706 1.00 43.01  ? 36   ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.137 64.917 46.398 1.00 44.50  ? 36   ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.404 65.969 46.975 1.00 45.67  ? 36   ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -12.883 63.894 46.569 1.00 41.22  ? 36   ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -15.985 63.898 46.327 1.00 45.75  ? 37   GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.277 63.951 46.993 1.00 46.04  ? 37   GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.027 63.842 48.489 1.00 47.02  ? 37   GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.133 63.117 48.918 1.00 48.17  ? 37   GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.156 62.786 46.544 1.00 48.03  ? 37   GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -18.732 62.955 45.157 1.00 52.46  ? 37   GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -19.652 64.152 45.068 1.00 54.00  ? 37   GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -20.683 64.153 45.770 1.00 54.45  ? 37   GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.339 65.091 44.305 1.00 56.07  ? 37   GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -17.797 64.573 49.304 1.00 47.56  ? 38   PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.614 64.512 50.756 1.00 47.82  ? 38   PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -17.677 63.069 51.251 1.00 48.53  ? 38   PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.742 62.462 51.258 1.00 49.10  ? 38   PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -18.773 65.351 51.274 1.00 46.00  ? 38   PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -18.891 66.398 50.224 1.00 46.01  ? 38   PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -18.795 65.595 48.948 1.00 46.36  ? 38   PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.534 62.511 51.687 1.00 49.37  ? 39   PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.431 61.134 52.186 1.00 50.00  ? 39   PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.203 60.911 53.479 1.00 51.62  ? 39   PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.658 60.405 54.458 1.00 52.77  ? 39   PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -14.930 60.961 52.378 1.00 49.27  ? 39   PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.515 62.320 52.829 1.00 48.52  ? 39   PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.255 63.225 51.874 1.00 47.73  ? 39   PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.479 61.271 53.469 1.00 53.63  ? 40   VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.318 61.147 54.654 1.00 54.74  ? 40   VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.308 59.984 54.596 1.00 56.14  ? 40   VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.479 59.342 53.553 1.00 55.75  ? 40   VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.107 62.446 54.879 1.00 54.58  ? 40   VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.148 63.594 55.144 1.00 52.14  ? 40   VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -20.953 62.752 53.649 1.00 54.20  ? 40   VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -20.953 59.722 55.731 1.00 56.46  ? 41   GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -21.935 58.656 55.816 1.00 57.74  ? 41   GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.394 57.267 55.553 1.00 59.44  ? 41   GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.410 56.847 56.167 1.00 60.48  ? 41   GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.046 56.547 54.646 1.00 60.50  ? 42   ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.624 55.197 54.302 1.00 61.52  ? 42   ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.317 55.220 53.520 1.00 59.62  ? 42   ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.742 54.169 53.238 1.00 58.67  ? 42   ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.709 54.487 53.484 1.00 66.96  ? 42   ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.125 55.274 52.243 1.00 72.53  ? 42   ASN A CG  1 
ATOM   283  O OD1 . ASN A 1 42  ? -22.300 55.592 51.378 1.00 73.58  ? 42   ASN A OD1 1 
ATOM   284  N ND2 . ASN A 1 42  ? -24.416 55.585 52.149 1.00 76.07  ? 42   ASN A ND2 1 
ATOM   285  N N   . MET A 1 43  ? -19.852 56.417 53.175 1.00 57.17  ? 43   MET A N   1 
ATOM   286  C CA  . MET A 1 43  ? -18.605 56.554 52.435 1.00 56.15  ? 43   MET A CA  1 
ATOM   287  C C   . MET A 1 43  ? -17.389 56.598 53.366 1.00 54.42  ? 43   MET A C   1 
ATOM   288  O O   . MET A 1 43  ? -16.249 56.620 52.898 1.00 54.39  ? 43   MET A O   1 
ATOM   289  C CB  . MET A 1 43  ? -18.620 57.820 51.570 1.00 58.43  ? 43   MET A CB  1 
ATOM   290  C CG  . MET A 1 43  ? -19.678 57.853 50.484 1.00 58.25  ? 43   MET A CG  1 
ATOM   291  S SD  . MET A 1 43  ? -19.092 58.752 49.025 1.00 62.60  ? 43   MET A SD  1 
ATOM   292  C CE  . MET A 1 43  ? -19.090 60.394 49.603 1.00 60.66  ? 43   MET A CE  1 
ATOM   293  N N   . ARG A 1 44  ? -17.625 56.621 54.676 1.00 50.86  ? 44   ARG A N   1 
ATOM   294  C CA  . ARG A 1 44  ? -16.522 56.659 55.631 1.00 49.16  ? 44   ARG A CA  1 
ATOM   295  C C   . ARG A 1 44  ? -15.673 55.406 55.499 1.00 48.09  ? 44   ARG A C   1 
ATOM   296  O O   . ARG A 1 44  ? -16.190 54.294 55.550 1.00 49.74  ? 44   ARG A O   1 
ATOM   297  C CB  . ARG A 1 44  ? -17.041 56.775 57.068 1.00 48.66  ? 44   ARG A CB  1 
ATOM   298  C CG  . ARG A 1 44  ? -15.924 56.773 58.118 1.00 47.48  ? 44   ARG A CG  1 
ATOM   299  C CD  . ARG A 1 44  ? -16.454 56.749 59.550 1.00 42.93  ? 44   ARG A CD  1 
ATOM   300  N NE  . ARG A 1 44  ? -17.012 58.027 59.979 1.00 38.08  ? 44   ARG A NE  1 
ATOM   301  C CZ  . ARG A 1 44  ? -17.723 58.185 61.092 1.00 39.43  ? 44   ARG A CZ  1 
ATOM   302  N NH1 . ARG A 1 44  ? -17.962 57.146 61.886 1.00 36.42  ? 44   ARG A NH1 1 
ATOM   303  N NH2 . ARG A 1 44  ? -18.204 59.378 61.413 1.00 38.51  ? 44   ARG A NH2 1 
ATOM   304  N N   . PHE A 1 45  ? -14.369 55.606 55.327 1.00 47.84  ? 45   PHE A N   1 
ATOM   305  C CA  . PHE A 1 45  ? -13.383 54.537 55.177 1.00 47.61  ? 45   PHE A CA  1 
ATOM   306  C C   . PHE A 1 45  ? -13.280 54.072 53.733 1.00 48.66  ? 45   PHE A C   1 
ATOM   307  O O   . PHE A 1 45  ? -12.396 53.284 53.400 1.00 48.12  ? 45   PHE A O   1 
ATOM   308  C CB  . PHE A 1 45  ? -13.704 53.322 56.068 1.00 47.79  ? 45   PHE A CB  1 
ATOM   309  C CG  . PHE A 1 45  ? -13.859 53.651 57.531 1.00 48.97  ? 45   PHE A CG  1 
ATOM   310  C CD1 . PHE A 1 45  ? -12.919 54.431 58.193 1.00 48.50  ? 45   PHE A CD1 1 
ATOM   311  C CD2 . PHE A 1 45  ? -14.945 53.157 58.253 1.00 49.83  ? 45   PHE A CD2 1 
ATOM   312  C CE1 . PHE A 1 45  ? -13.059 54.715 59.555 1.00 49.81  ? 45   PHE A CE1 1 
ATOM   313  C CE2 . PHE A 1 45  ? -15.093 53.435 59.616 1.00 49.05  ? 45   PHE A CE2 1 
ATOM   314  C CZ  . PHE A 1 45  ? -14.149 54.215 60.266 1.00 48.36  ? 45   PHE A CZ  1 
ATOM   315  N N   . ARG A 1 46  ? -14.177 54.558 52.877 1.00 49.83  ? 46   ARG A N   1 
ATOM   316  C CA  . ARG A 1 46  ? -14.171 54.167 51.467 1.00 52.38  ? 46   ARG A CA  1 
ATOM   317  C C   . ARG A 1 46  ? -13.207 54.978 50.618 1.00 51.93  ? 46   ARG A C   1 
ATOM   318  O O   . ARG A 1 46  ? -12.737 56.036 51.039 1.00 52.54  ? 46   ARG A O   1 
ATOM   319  C CB  . ARG A 1 46  ? -15.574 54.292 50.860 1.00 54.60  ? 46   ARG A CB  1 
ATOM   320  C CG  . ARG A 1 46  ? -16.515 53.149 51.190 1.00 61.04  ? 46   ARG A CG  1 
ATOM   321  C CD  . ARG A 1 46  ? -17.798 53.253 50.383 1.00 66.58  ? 46   ARG A CD  1 
ATOM   322  N NE  . ARG A 1 46  ? -17.573 53.010 48.959 1.00 74.04  ? 46   ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 46  ? -17.283 51.819 48.435 1.00 77.24  ? 46   ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 46  ? -17.182 50.753 49.218 1.00 78.66  ? 46   ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 46  ? -17.097 51.692 47.123 1.00 77.82  ? 46   ARG A NH2 1 
ATOM   326  N N   . ARG A 1 47  ? -12.909 54.468 49.423 1.00 51.79  ? 47   ARG A N   1 
ATOM   327  C CA  . ARG A 1 47  ? -12.033 55.171 48.493 1.00 51.63  ? 47   ARG A CA  1 
ATOM   328  C C   . ARG A 1 47  ? -12.757 56.453 48.101 1.00 50.40  ? 47   ARG A C   1 
ATOM   329  O O   . ARG A 1 47  ? -13.987 56.497 48.071 1.00 48.40  ? 47   ARG A O   1 
ATOM   330  C CB  . ARG A 1 47  ? -11.775 54.340 47.231 1.00 53.26  ? 47   ARG A CB  1 
ATOM   331  C CG  . ARG A 1 47  ? -10.919 53.099 47.436 1.00 59.02  ? 47   ARG A CG  1 
ATOM   332  C CD  . ARG A 1 47  ? -10.512 52.476 46.094 1.00 63.86  ? 47   ARG A CD  1 
ATOM   333  N NE  . ARG A 1 47  ? -9.692  51.273 46.256 1.00 66.69  ? 47   ARG A NE  1 
ATOM   334  C CZ  . ARG A 1 47  ? -10.147 50.107 46.713 1.00 68.62  ? 47   ARG A CZ  1 
ATOM   335  N NH1 . ARG A 1 47  ? -11.427 49.970 47.058 1.00 67.82  ? 47   ARG A NH1 1 
ATOM   336  N NH2 . ARG A 1 47  ? -9.319  49.075 46.830 1.00 69.39  ? 47   ARG A NH2 1 
ATOM   337  N N   . PRO A 1 48  ? -12.004 57.517 47.797 1.00 49.92  ? 48   PRO A N   1 
ATOM   338  C CA  . PRO A 1 48  ? -12.654 58.772 47.413 1.00 49.03  ? 48   PRO A CA  1 
ATOM   339  C C   . PRO A 1 48  ? -13.300 58.711 46.030 1.00 49.12  ? 48   PRO A C   1 
ATOM   340  O O   . PRO A 1 48  ? -12.799 58.036 45.132 1.00 47.40  ? 48   PRO A O   1 
ATOM   341  C CB  . PRO A 1 48  ? -11.509 59.772 47.462 1.00 47.42  ? 48   PRO A CB  1 
ATOM   342  C CG  . PRO A 1 48  ? -10.334 58.939 47.045 1.00 46.41  ? 48   PRO A CG  1 
ATOM   343  C CD  . PRO A 1 48  ? -10.538 57.664 47.822 1.00 46.92  ? 48   PRO A CD  1 
ATOM   344  N N   . GLU A 1 49  ? -14.420 59.409 45.875 1.00 50.46  ? 49   GLU A N   1 
ATOM   345  C CA  . GLU A 1 49  ? -15.118 59.476 44.594 1.00 52.19  ? 49   GLU A CA  1 
ATOM   346  C C   . GLU A 1 49  ? -14.859 60.873 44.049 1.00 50.17  ? 49   GLU A C   1 
ATOM   347  O O   . GLU A 1 49  ? -14.816 61.843 44.804 1.00 50.00  ? 49   GLU A O   1 
ATOM   348  C CB  . GLU A 1 49  ? -16.627 59.280 44.774 1.00 55.46  ? 49   GLU A CB  1 
ATOM   349  C CG  . GLU A 1 49  ? -17.048 57.901 45.250 1.00 63.63  ? 49   GLU A CG  1 
ATOM   350  C CD  . GLU A 1 49  ? -16.916 56.830 44.173 1.00 70.17  ? 49   GLU A CD  1 
ATOM   351  O OE1 . GLU A 1 49  ? -15.792 56.614 43.664 1.00 71.73  ? 49   GLU A OE1 1 
ATOM   352  O OE2 . GLU A 1 49  ? -17.945 56.197 43.838 1.00 75.05  ? 49   GLU A OE2 1 
ATOM   353  N N   . PRO A 1 50  ? -14.666 60.997 42.732 1.00 48.94  ? 50   PRO A N   1 
ATOM   354  C CA  . PRO A 1 50  ? -14.421 62.334 42.180 1.00 49.01  ? 50   PRO A CA  1 
ATOM   355  C C   . PRO A 1 50  ? -15.615 63.263 42.403 1.00 49.61  ? 50   PRO A C   1 
ATOM   356  O O   . PRO A 1 50  ? -16.767 62.827 42.382 1.00 49.46  ? 50   PRO A O   1 
ATOM   357  C CB  . PRO A 1 50  ? -14.149 62.054 40.701 1.00 48.00  ? 50   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 50  ? -14.911 60.787 40.440 1.00 48.19  ? 50   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 50  ? -14.639 59.970 41.679 1.00 48.36  ? 50   PRO A CD  1 
ATOM   360  N N   . LYS A 1 51  ? -15.337 64.541 42.636 1.00 50.20  ? 51   LYS A N   1 
ATOM   361  C CA  . LYS A 1 51  ? -16.394 65.522 42.867 1.00 50.65  ? 51   LYS A CA  1 
ATOM   362  C C   . LYS A 1 51  ? -17.263 65.708 41.627 1.00 51.35  ? 51   LYS A C   1 
ATOM   363  O O   . LYS A 1 51  ? -16.754 65.962 40.537 1.00 51.56  ? 51   LYS A O   1 
ATOM   364  C CB  . LYS A 1 51  ? -15.774 66.864 43.262 1.00 50.76  ? 51   LYS A CB  1 
ATOM   365  C CG  . LYS A 1 51  ? -16.756 68.012 43.402 1.00 50.48  ? 51   LYS A CG  1 
ATOM   366  C CD  . LYS A 1 51  ? -17.696 67.811 44.572 1.00 50.95  ? 51   LYS A CD  1 
ATOM   367  C CE  . LYS A 1 51  ? -18.475 69.085 44.859 1.00 51.77  ? 51   LYS A CE  1 
ATOM   368  N NZ  . LYS A 1 51  ? -19.440 68.922 45.985 1.00 55.03  ? 51   LYS A NZ  1 
ATOM   369  N N   . LYS A 1 52  ? -18.574 65.577 41.794 1.00 51.39  ? 52   LYS A N   1 
ATOM   370  C CA  . LYS A 1 52  ? -19.493 65.756 40.679 1.00 53.50  ? 52   LYS A CA  1 
ATOM   371  C C   . LYS A 1 52  ? -19.485 67.216 40.235 1.00 53.25  ? 52   LYS A C   1 
ATOM   372  O O   . LYS A 1 52  ? -19.572 68.124 41.057 1.00 53.14  ? 52   LYS A O   1 
ATOM   373  C CB  . LYS A 1 52  ? -20.904 65.342 41.091 1.00 56.32  ? 52   LYS A CB  1 
ATOM   374  C CG  . LYS A 1 52  ? -21.073 63.837 41.226 1.00 62.52  ? 52   LYS A CG  1 
ATOM   375  C CD  . LYS A 1 52  ? -21.727 63.449 42.548 1.00 66.75  ? 52   LYS A CD  1 
ATOM   376  C CE  . LYS A 1 52  ? -23.119 64.047 42.706 1.00 68.40  ? 52   LYS A CE  1 
ATOM   377  N NZ  . LYS A 1 52  ? -23.696 63.747 44.052 1.00 69.71  ? 52   LYS A NZ  1 
ATOM   378  N N   . PRO A 1 53  ? -19.372 67.459 38.922 1.00 53.24  ? 53   PRO A N   1 
ATOM   379  C CA  . PRO A 1 53  ? -19.351 68.821 38.380 1.00 53.99  ? 53   PRO A CA  1 
ATOM   380  C C   . PRO A 1 53  ? -20.528 69.639 38.889 1.00 54.79  ? 53   PRO A C   1 
ATOM   381  O O   . PRO A 1 53  ? -21.627 69.114 39.073 1.00 56.80  ? 53   PRO A O   1 
ATOM   382  C CB  . PRO A 1 53  ? -19.412 68.585 36.878 1.00 53.92  ? 53   PRO A CB  1 
ATOM   383  C CG  . PRO A 1 53  ? -18.679 67.293 36.725 1.00 52.26  ? 53   PRO A CG  1 
ATOM   384  C CD  . PRO A 1 53  ? -19.266 66.470 37.839 1.00 53.13  ? 53   PRO A CD  1 
ATOM   385  N N   . TRP A 1 54  ? -20.302 70.927 39.112 1.00 54.41  ? 54   TRP A N   1 
ATOM   386  C CA  . TRP A 1 54  ? -21.358 71.789 39.626 1.00 54.36  ? 54   TRP A CA  1 
ATOM   387  C C   . TRP A 1 54  ? -21.723 72.910 38.669 1.00 55.91  ? 54   TRP A C   1 
ATOM   388  O O   . TRP A 1 54  ? -20.901 73.354 37.866 1.00 54.30  ? 54   TRP A O   1 
ATOM   389  C CB  . TRP A 1 54  ? -20.922 72.395 40.961 1.00 52.94  ? 54   TRP A CB  1 
ATOM   390  C CG  . TRP A 1 54  ? -19.684 73.230 40.831 1.00 52.27  ? 54   TRP A CG  1 
ATOM   391  C CD1 . TRP A 1 54  ? -19.604 74.518 40.376 1.00 50.94  ? 54   TRP A CD1 1 
ATOM   392  C CD2 . TRP A 1 54  ? -18.337 72.803 41.065 1.00 50.73  ? 54   TRP A CD2 1 
ATOM   393  N NE1 . TRP A 1 54  ? -18.292 74.914 40.306 1.00 50.83  ? 54   TRP A NE1 1 
ATOM   394  C CE2 . TRP A 1 54  ? -17.492 73.881 40.724 1.00 50.55  ? 54   TRP A CE2 1 
ATOM   395  C CE3 . TRP A 1 54  ? -17.762 71.610 41.527 1.00 50.07  ? 54   TRP A CE3 1 
ATOM   396  C CZ2 . TRP A 1 54  ? -16.101 73.805 40.828 1.00 51.19  ? 54   TRP A CZ2 1 
ATOM   397  C CZ3 . TRP A 1 54  ? -16.380 71.532 41.631 1.00 50.46  ? 54   TRP A CZ3 1 
ATOM   398  C CH2 . TRP A 1 54  ? -15.564 72.626 41.282 1.00 52.00  ? 54   TRP A CH2 1 
ATOM   399  N N   . SER A 1 55  ? -22.968 73.363 38.765 1.00 58.35  ? 55   SER A N   1 
ATOM   400  C CA  . SER A 1 55  ? -23.447 74.464 37.941 1.00 60.91  ? 55   SER A CA  1 
ATOM   401  C C   . SER A 1 55  ? -23.172 75.742 38.723 1.00 60.66  ? 55   SER A C   1 
ATOM   402  O O   . SER A 1 55  ? -22.973 75.701 39.937 1.00 62.76  ? 55   SER A O   1 
ATOM   403  C CB  . SER A 1 55  ? -24.952 74.343 37.692 1.00 62.71  ? 55   SER A CB  1 
ATOM   404  O OG  . SER A 1 55  ? -25.252 73.222 36.881 1.00 67.59  ? 55   SER A OG  1 
ATOM   405  N N   . GLY A 1 56  ? -23.154 76.875 38.038 1.00 58.73  ? 56   GLY A N   1 
ATOM   406  C CA  . GLY A 1 56  ? -22.909 78.121 38.734 1.00 57.51  ? 56   GLY A CA  1 
ATOM   407  C C   . GLY A 1 56  ? -21.459 78.328 39.115 1.00 56.16  ? 56   GLY A C   1 
ATOM   408  O O   . GLY A 1 56  ? -20.576 77.598 38.665 1.00 55.26  ? 56   GLY A O   1 
ATOM   409  N N   . VAL A 1 57  ? -21.218 79.327 39.956 1.00 54.56  ? 57   VAL A N   1 
ATOM   410  C CA  . VAL A 1 57  ? -19.871 79.657 40.388 1.00 53.00  ? 57   VAL A CA  1 
ATOM   411  C C   . VAL A 1 57  ? -19.615 79.183 41.809 1.00 53.18  ? 57   VAL A C   1 
ATOM   412  O O   . VAL A 1 57  ? -20.438 79.390 42.702 1.00 52.38  ? 57   VAL A O   1 
ATOM   413  C CB  . VAL A 1 57  ? -19.636 81.182 40.317 1.00 51.41  ? 57   VAL A CB  1 
ATOM   414  C CG1 . VAL A 1 57  ? -18.209 81.513 40.706 1.00 50.60  ? 57   VAL A CG1 1 
ATOM   415  C CG2 . VAL A 1 57  ? -19.936 81.685 38.918 1.00 48.68  ? 57   VAL A CG2 1 
ATOM   416  N N   . TRP A 1 58  ? -18.473 78.531 42.007 1.00 53.53  ? 58   TRP A N   1 
ATOM   417  C CA  . TRP A 1 58  ? -18.096 78.037 43.323 1.00 52.59  ? 58   TRP A CA  1 
ATOM   418  C C   . TRP A 1 58  ? -17.309 79.137 44.027 1.00 52.43  ? 58   TRP A C   1 
ATOM   419  O O   . TRP A 1 58  ? -16.335 79.653 43.475 1.00 52.35  ? 58   TRP A O   1 
ATOM   420  C CB  . TRP A 1 58  ? -17.238 76.767 43.204 1.00 51.43  ? 58   TRP A CB  1 
ATOM   421  C CG  . TRP A 1 58  ? -16.869 76.196 44.541 1.00 50.73  ? 58   TRP A CG  1 
ATOM   422  C CD1 . TRP A 1 58  ? -15.919 76.673 45.405 1.00 49.59  ? 58   TRP A CD1 1 
ATOM   423  C CD2 . TRP A 1 58  ? -17.522 75.118 45.223 1.00 50.20  ? 58   TRP A CD2 1 
ATOM   424  N NE1 . TRP A 1 58  ? -15.950 75.966 46.582 1.00 49.35  ? 58   TRP A NE1 1 
ATOM   425  C CE2 . TRP A 1 58  ? -16.924 75.006 46.498 1.00 49.82  ? 58   TRP A CE2 1 
ATOM   426  C CE3 . TRP A 1 58  ? -18.558 74.238 44.881 1.00 49.92  ? 58   TRP A CE3 1 
ATOM   427  C CZ2 . TRP A 1 58  ? -17.329 74.049 47.434 1.00 48.99  ? 58   TRP A CZ2 1 
ATOM   428  C CZ3 . TRP A 1 58  ? -18.959 73.285 45.812 1.00 49.34  ? 58   TRP A CZ3 1 
ATOM   429  C CH2 . TRP A 1 58  ? -18.345 73.200 47.074 1.00 48.02  ? 58   TRP A CH2 1 
ATOM   430  N N   . ASN A 1 59  ? -17.736 79.499 45.234 1.00 53.04  ? 59   ASN A N   1 
ATOM   431  C CA  . ASN A 1 59  ? -17.059 80.542 45.993 1.00 55.85  ? 59   ASN A CA  1 
ATOM   432  C C   . ASN A 1 59  ? -15.785 80.007 46.639 1.00 55.03  ? 59   ASN A C   1 
ATOM   433  O O   . ASN A 1 59  ? -15.836 79.312 47.655 1.00 56.13  ? 59   ASN A O   1 
ATOM   434  C CB  . ASN A 1 59  ? -17.988 81.119 47.069 1.00 59.65  ? 59   ASN A CB  1 
ATOM   435  C CG  . ASN A 1 59  ? -17.392 82.339 47.749 1.00 66.62  ? 59   ASN A CG  1 
ATOM   436  O OD1 . ASN A 1 59  ? -16.392 82.885 47.270 1.00 66.80  ? 59   ASN A OD1 1 
ATOM   437  N ND2 . ASN A 1 59  ? -17.999 82.788 48.845 1.00 73.71  ? 59   ASN A ND2 1 
ATOM   438  N N   . ALA A 1 60  ? -14.644 80.338 46.042 1.00 52.51  ? 60   ALA A N   1 
ATOM   439  C CA  . ALA A 1 60  ? -13.353 79.888 46.548 1.00 51.06  ? 60   ALA A CA  1 
ATOM   440  C C   . ALA A 1 60  ? -12.619 81.052 47.187 1.00 50.55  ? 60   ALA A C   1 
ATOM   441  O O   . ALA A 1 60  ? -11.450 81.304 46.886 1.00 51.23  ? 60   ALA A O   1 
ATOM   442  C CB  . ALA A 1 60  ? -12.523 79.315 45.411 1.00 49.88  ? 60   ALA A CB  1 
ATOM   443  N N   . SER A 1 61  ? -13.305 81.755 48.079 1.00 50.74  ? 61   SER A N   1 
ATOM   444  C CA  . SER A 1 61  ? -12.723 82.920 48.734 1.00 51.18  ? 61   SER A CA  1 
ATOM   445  C C   . SER A 1 61  ? -12.246 82.683 50.161 1.00 50.30  ? 61   SER A C   1 
ATOM   446  O O   . SER A 1 61  ? -11.525 83.510 50.719 1.00 49.54  ? 61   SER A O   1 
ATOM   447  C CB  . SER A 1 61  ? -13.731 84.070 48.717 1.00 50.11  ? 61   SER A CB  1 
ATOM   448  O OG  . SER A 1 61  ? -14.946 83.680 49.332 1.00 51.25  ? 61   SER A OG  1 
ATOM   449  N N   . THR A 1 62  ? -12.647 81.561 50.752 1.00 50.52  ? 62   THR A N   1 
ATOM   450  C CA  . THR A 1 62  ? -12.240 81.245 52.119 1.00 51.16  ? 62   THR A CA  1 
ATOM   451  C C   . THR A 1 62  ? -11.787 79.792 52.303 1.00 49.53  ? 62   THR A C   1 
ATOM   452  O O   . THR A 1 62  ? -12.223 78.892 51.584 1.00 48.08  ? 62   THR A O   1 
ATOM   453  C CB  . THR A 1 62  ? -13.385 81.522 53.109 1.00 52.40  ? 62   THR A CB  1 
ATOM   454  O OG1 . THR A 1 62  ? -14.495 80.665 52.816 1.00 54.06  ? 62   THR A OG1 1 
ATOM   455  C CG2 . THR A 1 62  ? -13.832 82.963 53.000 1.00 52.79  ? 62   THR A CG2 1 
ATOM   456  N N   . TYR A 1 63  ? -10.911 79.579 53.281 1.00 48.07  ? 63   TYR A N   1 
ATOM   457  C CA  . TYR A 1 63  ? -10.388 78.253 53.585 1.00 46.05  ? 63   TYR A CA  1 
ATOM   458  C C   . TYR A 1 63  ? -11.485 77.243 53.900 1.00 46.09  ? 63   TYR A C   1 
ATOM   459  O O   . TYR A 1 63  ? -12.507 77.576 54.500 1.00 47.79  ? 63   TYR A O   1 
ATOM   460  C CB  . TYR A 1 63  ? -9.431  78.313 54.773 1.00 43.21  ? 63   TYR A CB  1 
ATOM   461  C CG  . TYR A 1 63  ? -8.026  78.735 54.437 1.00 40.92  ? 63   TYR A CG  1 
ATOM   462  C CD1 . TYR A 1 63  ? -7.400  78.279 53.279 1.00 40.88  ? 63   TYR A CD1 1 
ATOM   463  C CD2 . TYR A 1 63  ? -7.280  79.504 55.332 1.00 41.78  ? 63   TYR A CD2 1 
ATOM   464  C CE1 . TYR A 1 63  ? -6.062  78.567 53.024 1.00 40.99  ? 63   TYR A CE1 1 
ATOM   465  C CE2 . TYR A 1 63  ? -5.938  79.800 55.089 1.00 40.93  ? 63   TYR A CE2 1 
ATOM   466  C CZ  . TYR A 1 63  ? -5.336  79.326 53.936 1.00 41.64  ? 63   TYR A CZ  1 
ATOM   467  O OH  . TYR A 1 63  ? -4.004  79.590 53.706 1.00 43.57  ? 63   TYR A OH  1 
ATOM   468  N N   . PRO A 1 64  ? -11.275 75.980 53.512 1.00 45.35  ? 64   PRO A N   1 
ATOM   469  C CA  . PRO A 1 64  ? -12.267 74.936 53.769 1.00 44.28  ? 64   PRO A CA  1 
ATOM   470  C C   . PRO A 1 64  ? -12.133 74.400 55.191 1.00 44.91  ? 64   PRO A C   1 
ATOM   471  O O   . PRO A 1 64  ? -11.304 74.872 55.968 1.00 43.73  ? 64   PRO A O   1 
ATOM   472  C CB  . PRO A 1 64  ? -11.903 73.881 52.740 1.00 44.22  ? 64   PRO A CB  1 
ATOM   473  C CG  . PRO A 1 64  ? -10.402 73.941 52.759 1.00 40.78  ? 64   PRO A CG  1 
ATOM   474  C CD  . PRO A 1 64  ? -10.122 75.440 52.761 1.00 43.41  ? 64   PRO A CD  1 
ATOM   475  N N   . ASN A 1 65  ? -12.954 73.413 55.527 1.00 45.66  ? 65   ASN A N   1 
ATOM   476  C CA  . ASN A 1 65  ? -12.888 72.789 56.840 1.00 46.84  ? 65   ASN A CA  1 
ATOM   477  C C   . ASN A 1 65  ? -11.608 71.953 56.895 1.00 46.74  ? 65   ASN A C   1 
ATOM   478  O O   . ASN A 1 65  ? -10.949 71.733 55.878 1.00 46.55  ? 65   ASN A O   1 
ATOM   479  C CB  . ASN A 1 65  ? -14.085 71.858 57.050 1.00 48.93  ? 65   ASN A CB  1 
ATOM   480  C CG  . ASN A 1 65  ? -15.405 72.599 57.128 1.00 52.32  ? 65   ASN A CG  1 
ATOM   481  O OD1 . ASN A 1 65  ? -16.441 72.073 56.721 1.00 52.13  ? 65   ASN A OD1 1 
ATOM   482  N ND2 . ASN A 1 65  ? -15.380 73.818 57.664 1.00 51.08  ? 65   ASN A ND2 1 
ATOM   483  N N   . ASN A 1 66  ? -11.262 71.487 58.086 1.00 45.12  ? 66   ASN A N   1 
ATOM   484  C CA  . ASN A 1 66  ? -10.089 70.647 58.257 1.00 44.66  ? 66   ASN A CA  1 
ATOM   485  C C   . ASN A 1 66  ? -10.655 69.262 58.549 1.00 43.22  ? 66   ASN A C   1 
ATOM   486  O O   . ASN A 1 66  ? -11.754 69.151 59.087 1.00 43.76  ? 66   ASN A O   1 
ATOM   487  C CB  . ASN A 1 66  ? -9.250  71.163 59.426 1.00 44.90  ? 66   ASN A CB  1 
ATOM   488  C CG  . ASN A 1 66  ? -8.673  72.549 59.162 1.00 46.53  ? 66   ASN A CG  1 
ATOM   489  O OD1 . ASN A 1 66  ? -8.499  73.352 60.082 1.00 45.37  ? 66   ASN A OD1 1 
ATOM   490  N ND2 . ASN A 1 66  ? -8.359  72.828 57.901 1.00 46.47  ? 66   ASN A ND2 1 
ATOM   491  N N   . CYS A 1 67  ? -9.937  68.209 58.184 1.00 42.09  ? 67   CYS A N   1 
ATOM   492  C CA  . CYS A 1 67  ? -10.436 66.860 58.432 1.00 43.03  ? 67   CYS A CA  1 
ATOM   493  C C   . CYS A 1 67  ? -10.480 66.528 59.924 1.00 42.64  ? 67   CYS A C   1 
ATOM   494  O O   . CYS A 1 67  ? -9.735  67.101 60.717 1.00 42.00  ? 67   CYS A O   1 
ATOM   495  C CB  . CYS A 1 67  ? -9.574  65.828 57.695 1.00 42.64  ? 67   CYS A CB  1 
ATOM   496  S SG  . CYS A 1 67  ? -9.621  65.957 55.874 1.00 45.76  ? 67   CYS A SG  1 
ATOM   497  N N   . GLN A 1 68  ? -11.365 65.611 60.305 1.00 42.32  ? 68   GLN A N   1 
ATOM   498  C CA  . GLN A 1 68  ? -11.476 65.199 61.700 1.00 43.08  ? 68   GLN A CA  1 
ATOM   499  C C   . GLN A 1 68  ? -10.139 64.617 62.145 1.00 42.90  ? 68   GLN A C   1 
ATOM   500  O O   . GLN A 1 68  ? -9.600  63.721 61.496 1.00 41.47  ? 68   GLN A O   1 
ATOM   501  C CB  . GLN A 1 68  ? -12.575 64.153 61.859 1.00 43.48  ? 68   GLN A CB  1 
ATOM   502  C CG  . GLN A 1 68  ? -13.975 64.708 61.685 1.00 46.71  ? 68   GLN A CG  1 
ATOM   503  C CD  . GLN A 1 68  ? -14.402 65.633 62.818 1.00 49.35  ? 68   GLN A CD  1 
ATOM   504  O OE1 . GLN A 1 68  ? -15.520 66.153 62.818 1.00 51.83  ? 68   GLN A OE1 1 
ATOM   505  N NE2 . GLN A 1 68  ? -13.517 65.841 63.789 1.00 48.82  ? 68   GLN A NE2 1 
ATOM   506  N N   . GLN A 1 69  ? -9.618  65.121 63.261 1.00 43.22  ? 69   GLN A N   1 
ATOM   507  C CA  . GLN A 1 69  ? -8.326  64.678 63.777 1.00 42.15  ? 69   GLN A CA  1 
ATOM   508  C C   . GLN A 1 69  ? -8.142  64.959 65.262 1.00 42.50  ? 69   GLN A C   1 
ATOM   509  O O   . GLN A 1 69  ? -8.861  65.766 65.851 1.00 44.03  ? 69   GLN A O   1 
ATOM   510  C CB  . GLN A 1 69  ? -7.212  65.399 63.018 1.00 41.60  ? 69   GLN A CB  1 
ATOM   511  C CG  . GLN A 1 69  ? -7.381  66.920 63.035 1.00 38.12  ? 69   GLN A CG  1 
ATOM   512  C CD  . GLN A 1 69  ? -6.360  67.655 62.183 1.00 38.76  ? 69   GLN A CD  1 
ATOM   513  O OE1 . GLN A 1 69  ? -5.181  67.757 62.538 1.00 38.16  ? 69   GLN A OE1 1 
ATOM   514  N NE2 . GLN A 1 69  ? -6.812  68.172 61.048 1.00 37.34  ? 69   GLN A NE2 1 
ATOM   515  N N   . TYR A 1 70  ? -7.162  64.286 65.851 1.00 41.78  ? 70   TYR A N   1 
ATOM   516  C CA  . TYR A 1 70  ? -6.816  64.479 67.249 1.00 41.98  ? 70   TYR A CA  1 
ATOM   517  C C   . TYR A 1 70  ? -6.238  65.887 67.319 1.00 42.62  ? 70   TYR A C   1 
ATOM   518  O O   . TYR A 1 70  ? -5.493  66.293 66.423 1.00 41.27  ? 70   TYR A O   1 
ATOM   519  C CB  . TYR A 1 70  ? -5.749  63.467 67.661 1.00 43.92  ? 70   TYR A CB  1 
ATOM   520  C CG  . TYR A 1 70  ? -5.045  63.788 68.957 1.00 45.70  ? 70   TYR A CG  1 
ATOM   521  C CD1 . TYR A 1 70  ? -5.590  63.413 70.188 1.00 47.05  ? 70   TYR A CD1 1 
ATOM   522  C CD2 . TYR A 1 70  ? -3.815  64.450 68.954 1.00 47.20  ? 70   TYR A CD2 1 
ATOM   523  C CE1 . TYR A 1 70  ? -4.926  63.686 71.385 1.00 47.28  ? 70   TYR A CE1 1 
ATOM   524  C CE2 . TYR A 1 70  ? -3.138  64.729 70.141 1.00 47.72  ? 70   TYR A CE2 1 
ATOM   525  C CZ  . TYR A 1 70  ? -3.699  64.342 71.353 1.00 49.36  ? 70   TYR A CZ  1 
ATOM   526  O OH  . TYR A 1 70  ? -3.027  64.597 72.527 1.00 48.91  ? 70   TYR A OH  1 
ATOM   527  N N   . VAL A 1 71  ? -6.580  66.626 68.373 1.00 42.62  ? 71   VAL A N   1 
ATOM   528  C CA  . VAL A 1 71  ? -6.101  68.000 68.551 1.00 41.91  ? 71   VAL A CA  1 
ATOM   529  C C   . VAL A 1 71  ? -5.170  68.069 69.753 1.00 42.30  ? 71   VAL A C   1 
ATOM   530  O O   . VAL A 1 71  ? -5.545  67.671 70.856 1.00 42.21  ? 71   VAL A O   1 
ATOM   531  C CB  . VAL A 1 71  ? -7.282  68.993 68.784 1.00 42.63  ? 71   VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 71  ? -6.750  70.400 68.962 1.00 41.74  ? 71   VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 71  ? -8.267  68.935 67.622 1.00 40.62  ? 71   VAL A CG2 1 
ATOM   534  N N   . ASP A 1 72  ? -3.960  68.579 69.535 1.00 42.76  ? 72   ASP A N   1 
ATOM   535  C CA  . ASP A 1 72  ? -2.970  68.692 70.598 1.00 42.80  ? 72   ASP A CA  1 
ATOM   536  C C   . ASP A 1 72  ? -3.302  69.788 71.591 1.00 44.50  ? 72   ASP A C   1 
ATOM   537  O O   . ASP A 1 72  ? -3.266  70.967 71.262 1.00 45.62  ? 72   ASP A O   1 
ATOM   538  C CB  . ASP A 1 72  ? -1.584  68.941 70.006 1.00 44.36  ? 72   ASP A CB  1 
ATOM   539  C CG  . ASP A 1 72  ? -0.526  69.178 71.073 1.00 45.06  ? 72   ASP A CG  1 
ATOM   540  O OD1 . ASP A 1 72  ? -0.654  68.633 72.188 1.00 47.21  ? 72   ASP A OD1 1 
ATOM   541  O OD2 . ASP A 1 72  ? 0.450   69.896 70.791 1.00 45.70  ? 72   ASP A OD2 1 
ATOM   542  N N   A GLU A 1 73  ? -3.632  69.386 72.813 0.50 45.63  ? 73   GLU A N   1 
ATOM   543  N N   B GLU A 1 73  ? -3.625  69.382 72.813 0.50 45.44  ? 73   GLU A N   1 
ATOM   544  C CA  A GLU A 1 73  ? -3.970  70.325 73.876 0.50 46.22  ? 73   GLU A CA  1 
ATOM   545  C CA  B GLU A 1 73  ? -3.971  70.314 73.878 0.50 45.88  ? 73   GLU A CA  1 
ATOM   546  C C   A GLU A 1 73  ? -2.963  70.187 75.014 0.50 46.97  ? 73   GLU A C   1 
ATOM   547  C C   B GLU A 1 73  ? -2.965  70.178 75.016 0.50 46.76  ? 73   GLU A C   1 
ATOM   548  O O   A GLU A 1 73  ? -3.259  70.499 76.167 0.50 46.02  ? 73   GLU A O   1 
ATOM   549  O O   B GLU A 1 73  ? -3.262  70.484 76.171 0.50 45.82  ? 73   GLU A O   1 
ATOM   550  C CB  A GLU A 1 73  ? -5.383  70.046 74.395 0.50 46.36  ? 73   GLU A CB  1 
ATOM   551  C CB  B GLU A 1 73  ? -5.379  70.016 74.391 0.50 45.59  ? 73   GLU A CB  1 
ATOM   552  C CG  A GLU A 1 73  ? -6.479  70.272 73.370 0.50 48.00  ? 73   GLU A CG  1 
ATOM   553  C CG  B GLU A 1 73  ? -6.458  70.179 73.338 0.50 46.64  ? 73   GLU A CG  1 
ATOM   554  C CD  A GLU A 1 73  ? -6.632  71.731 72.986 0.50 49.81  ? 73   GLU A CD  1 
ATOM   555  C CD  B GLU A 1 73  ? -7.802  69.642 73.785 0.50 47.85  ? 73   GLU A CD  1 
ATOM   556  O OE1 A GLU A 1 73  ? -7.426  72.026 72.067 0.50 50.65  ? 73   GLU A OE1 1 
ATOM   557  O OE1 B GLU A 1 73  ? -8.783  69.807 73.030 0.50 48.84  ? 73   GLU A OE1 1 
ATOM   558  O OE2 A GLU A 1 73  ? -5.963  72.585 73.606 0.50 50.08  ? 73   GLU A OE2 1 
ATOM   559  O OE2 B GLU A 1 73  ? -7.879  69.049 74.883 0.50 47.80  ? 73   GLU A OE2 1 
ATOM   560  N N   . GLN A 1 74  ? -1.769  69.714 74.677 1.00 47.29  ? 74   GLN A N   1 
ATOM   561  C CA  . GLN A 1 74  ? -0.719  69.528 75.661 1.00 48.12  ? 74   GLN A CA  1 
ATOM   562  C C   . GLN A 1 74  ? -0.231  70.850 76.269 1.00 47.47  ? 74   GLN A C   1 
ATOM   563  O O   . GLN A 1 74  ? 0.216   70.872 77.412 1.00 49.46  ? 74   GLN A O   1 
ATOM   564  C CB  . GLN A 1 74  ? 0.449   68.770 75.023 1.00 49.71  ? 74   GLN A CB  1 
ATOM   565  C CG  . GLN A 1 74  ? 1.497   68.332 76.011 1.00 52.62  ? 74   GLN A CG  1 
ATOM   566  C CD  . GLN A 1 74  ? 0.926   67.460 77.103 1.00 54.38  ? 74   GLN A CD  1 
ATOM   567  O OE1 . GLN A 1 74  ? 1.456   67.416 78.211 1.00 57.76  ? 74   GLN A OE1 1 
ATOM   568  N NE2 . GLN A 1 74  ? -0.156  66.751 76.796 1.00 54.60  ? 74   GLN A NE2 1 
ATOM   569  N N   . PHE A 1 75  ? -0.320  71.942 75.513 1.00 45.12  ? 75   PHE A N   1 
ATOM   570  C CA  . PHE A 1 75  ? 0.115   73.260 75.997 1.00 44.46  ? 75   PHE A CA  1 
ATOM   571  C C   . PHE A 1 75  ? -0.878  74.333 75.561 1.00 44.55  ? 75   PHE A C   1 
ATOM   572  O O   . PHE A 1 75  ? -0.579  75.157 74.698 1.00 40.98  ? 75   PHE A O   1 
ATOM   573  C CB  . PHE A 1 75  ? 1.500   73.607 75.438 1.00 42.55  ? 75   PHE A CB  1 
ATOM   574  C CG  . PHE A 1 75  ? 2.545   72.573 75.728 1.00 41.78  ? 75   PHE A CG  1 
ATOM   575  C CD1 . PHE A 1 75  ? 3.025   72.389 77.023 1.00 40.71  ? 75   PHE A CD1 1 
ATOM   576  C CD2 . PHE A 1 75  ? 3.008   71.741 74.714 1.00 41.41  ? 75   PHE A CD2 1 
ATOM   577  C CE1 . PHE A 1 75  ? 3.946   71.388 77.306 1.00 40.58  ? 75   PHE A CE1 1 
ATOM   578  C CE2 . PHE A 1 75  ? 3.927   70.737 74.982 1.00 42.77  ? 75   PHE A CE2 1 
ATOM   579  C CZ  . PHE A 1 75  ? 4.399   70.557 76.286 1.00 42.82  ? 75   PHE A CZ  1 
ATOM   580  N N   . PRO A 1 76  ? -2.081  74.330 76.155 1.00 46.83  ? 76   PRO A N   1 
ATOM   581  C CA  . PRO A 1 76  ? -3.134  75.296 75.835 1.00 46.76  ? 76   PRO A CA  1 
ATOM   582  C C   . PRO A 1 76  ? -2.624  76.730 75.790 1.00 49.36  ? 76   PRO A C   1 
ATOM   583  O O   . PRO A 1 76  ? -2.016  77.212 76.749 1.00 49.91  ? 76   PRO A O   1 
ATOM   584  C CB  . PRO A 1 76  ? -4.143  75.072 76.949 1.00 46.43  ? 76   PRO A CB  1 
ATOM   585  C CG  . PRO A 1 76  ? -4.033  73.593 77.176 1.00 45.43  ? 76   PRO A CG  1 
ATOM   586  C CD  . PRO A 1 76  ? -2.536  73.394 77.200 1.00 46.46  ? 76   PRO A CD  1 
ATOM   587  N N   . GLY A 1 77  ? -2.863  77.399 74.665 1.00 49.81  ? 77   GLY A N   1 
ATOM   588  C CA  . GLY A 1 77  ? -2.422  78.772 74.511 1.00 49.99  ? 77   GLY A CA  1 
ATOM   589  C C   . GLY A 1 77  ? -1.011  78.924 73.969 1.00 49.50  ? 77   GLY A C   1 
ATOM   590  O O   . GLY A 1 77  ? -0.628  80.002 73.519 1.00 51.39  ? 77   GLY A O   1 
ATOM   591  N N   . PHE A 1 78  ? -0.231  77.853 74.003 1.00 47.25  ? 78   PHE A N   1 
ATOM   592  C CA  . PHE A 1 78  ? 1.134   77.915 73.508 1.00 46.56  ? 78   PHE A CA  1 
ATOM   593  C C   . PHE A 1 78  ? 1.124   77.879 71.985 1.00 46.38  ? 78   PHE A C   1 
ATOM   594  O O   . PHE A 1 78  ? 0.557   76.971 71.379 1.00 46.74  ? 78   PHE A O   1 
ATOM   595  C CB  . PHE A 1 78  ? 1.947   76.749 74.072 1.00 46.45  ? 78   PHE A CB  1 
ATOM   596  C CG  . PHE A 1 78  ? 3.407   76.807 73.734 1.00 47.93  ? 78   PHE A CG  1 
ATOM   597  C CD1 . PHE A 1 78  ? 4.175   77.915 74.086 1.00 46.33  ? 78   PHE A CD1 1 
ATOM   598  C CD2 . PHE A 1 78  ? 4.023   75.744 73.070 1.00 47.70  ? 78   PHE A CD2 1 
ATOM   599  C CE1 . PHE A 1 78  ? 5.535   77.962 73.784 1.00 46.88  ? 78   PHE A CE1 1 
ATOM   600  C CE2 . PHE A 1 78  ? 5.379   75.781 72.764 1.00 47.08  ? 78   PHE A CE2 1 
ATOM   601  C CZ  . PHE A 1 78  ? 6.139   76.892 73.121 1.00 47.11  ? 78   PHE A CZ  1 
ATOM   602  N N   . SER A 1 79  ? 1.757   78.872 71.371 1.00 46.62  ? 79   SER A N   1 
ATOM   603  C CA  . SER A 1 79  ? 1.803   78.975 69.913 1.00 46.71  ? 79   SER A CA  1 
ATOM   604  C C   . SER A 1 79  ? 2.644   77.891 69.239 1.00 46.28  ? 79   SER A C   1 
ATOM   605  O O   . SER A 1 79  ? 2.316   77.440 68.143 1.00 45.78  ? 79   SER A O   1 
ATOM   606  C CB  . SER A 1 79  ? 2.329   80.352 69.503 1.00 44.85  ? 79   SER A CB  1 
ATOM   607  O OG  . SER A 1 79  ? 3.676   80.521 69.907 1.00 46.88  ? 79   SER A OG  1 
ATOM   608  N N   . GLY A 1 80  ? 3.723   77.475 69.897 1.00 45.79  ? 80   GLY A N   1 
ATOM   609  C CA  . GLY A 1 80  ? 4.590   76.456 69.331 1.00 44.49  ? 80   GLY A CA  1 
ATOM   610  C C   . GLY A 1 80  ? 3.877   75.168 68.959 1.00 44.80  ? 80   GLY A C   1 
ATOM   611  O O   . GLY A 1 80  ? 4.256   74.486 68.009 1.00 45.31  ? 80   GLY A O   1 
ATOM   612  N N   . SER A 1 81  ? 2.832   74.833 69.701 1.00 44.00  ? 81   SER A N   1 
ATOM   613  C CA  . SER A 1 81  ? 2.099   73.610 69.438 1.00 45.18  ? 81   SER A CA  1 
ATOM   614  C C   . SER A 1 81  ? 0.784   73.858 68.724 1.00 45.30  ? 81   SER A C   1 
ATOM   615  O O   . SER A 1 81  ? 0.375   73.073 67.876 1.00 45.66  ? 81   SER A O   1 
ATOM   616  C CB  . SER A 1 81  ? 1.842   72.866 70.749 1.00 44.46  ? 81   SER A CB  1 
ATOM   617  O OG  . SER A 1 81  ? 1.151   73.688 71.667 1.00 47.16  ? 81   SER A OG  1 
ATOM   618  N N   . GLU A 1 82  ? 0.125   74.957 69.063 1.00 46.73  ? 82   GLU A N   1 
ATOM   619  C CA  . GLU A 1 82  ? -1.157  75.283 68.455 1.00 46.36  ? 82   GLU A CA  1 
ATOM   620  C C   . GLU A 1 82  ? -1.070  75.780 67.015 1.00 44.63  ? 82   GLU A C   1 
ATOM   621  O O   . GLU A 1 82  ? -2.086  75.866 66.324 1.00 43.18  ? 82   GLU A O   1 
ATOM   622  C CB  . GLU A 1 82  ? -1.895  76.298 69.326 1.00 48.60  ? 82   GLU A CB  1 
ATOM   623  C CG  . GLU A 1 82  ? -2.410  75.694 70.618 1.00 54.79  ? 82   GLU A CG  1 
ATOM   624  C CD  . GLU A 1 82  ? -3.202  76.678 71.450 1.00 57.82  ? 82   GLU A CD  1 
ATOM   625  O OE1 . GLU A 1 82  ? -3.905  76.238 72.387 1.00 58.97  ? 82   GLU A OE1 1 
ATOM   626  O OE2 . GLU A 1 82  ? -3.115  77.894 71.171 1.00 61.42  ? 82   GLU A OE2 1 
ATOM   627  N N   . MET A 1 83  ? 0.135   76.107 66.559 1.00 42.28  ? 83   MET A N   1 
ATOM   628  C CA  . MET A 1 83  ? 0.302   76.561 65.185 1.00 41.99  ? 83   MET A CA  1 
ATOM   629  C C   . MET A 1 83  ? 0.136   75.360 64.246 1.00 41.20  ? 83   MET A C   1 
ATOM   630  O O   . MET A 1 83  ? -0.015  75.523 63.033 1.00 40.62  ? 83   MET A O   1 
ATOM   631  C CB  . MET A 1 83  ? 1.688   77.190 64.980 1.00 42.24  ? 83   MET A CB  1 
ATOM   632  C CG  . MET A 1 83  ? 2.842   76.208 65.054 1.00 44.18  ? 83   MET A CG  1 
ATOM   633  S SD  . MET A 1 83  ? 4.395   76.897 64.463 1.00 48.50  ? 83   MET A SD  1 
ATOM   634  C CE  . MET A 1 83  ? 5.235   77.219 65.990 1.00 45.72  ? 83   MET A CE  1 
ATOM   635  N N   . TRP A 1 84  ? 0.162   74.158 64.819 1.00 39.27  ? 84   TRP A N   1 
ATOM   636  C CA  . TRP A 1 84  ? 0.025   72.933 64.048 1.00 38.70  ? 84   TRP A CA  1 
ATOM   637  C C   . TRP A 1 84  ? -1.385  72.392 64.148 1.00 38.89  ? 84   TRP A C   1 
ATOM   638  O O   . TRP A 1 84  ? -1.768  71.520 63.372 1.00 38.67  ? 84   TRP A O   1 
ATOM   639  C CB  . TRP A 1 84  ? 1.009   71.865 64.543 1.00 38.65  ? 84   TRP A CB  1 
ATOM   640  C CG  . TRP A 1 84  ? 2.441   72.295 64.488 1.00 38.42  ? 84   TRP A CG  1 
ATOM   641  C CD1 . TRP A 1 84  ? 3.250   72.607 65.546 1.00 40.03  ? 84   TRP A CD1 1 
ATOM   642  C CD2 . TRP A 1 84  ? 3.222   72.509 63.308 1.00 36.69  ? 84   TRP A CD2 1 
ATOM   643  N NE1 . TRP A 1 84  ? 4.490   73.007 65.094 1.00 39.83  ? 84   TRP A NE1 1 
ATOM   644  C CE2 . TRP A 1 84  ? 4.499   72.955 63.725 1.00 37.91  ? 84   TRP A CE2 1 
ATOM   645  C CE3 . TRP A 1 84  ? 2.968   72.370 61.937 1.00 35.00  ? 84   TRP A CE3 1 
ATOM   646  C CZ2 . TRP A 1 84  ? 5.518   73.265 62.816 1.00 35.50  ? 84   TRP A CZ2 1 
ATOM   647  C CZ3 . TRP A 1 84  ? 3.978   72.679 61.037 1.00 35.05  ? 84   TRP A CZ3 1 
ATOM   648  C CH2 . TRP A 1 84  ? 5.240   73.122 61.482 1.00 34.66  ? 84   TRP A CH2 1 
ATOM   649  N N   . ASN A 1 85  ? -2.152  72.895 65.111 1.00 39.84  ? 85   ASN A N   1 
ATOM   650  C CA  . ASN A 1 85  ? -3.528  72.443 65.278 1.00 40.83  ? 85   ASN A CA  1 
ATOM   651  C C   . ASN A 1 85  ? -4.429  73.012 64.197 1.00 40.18  ? 85   ASN A C   1 
ATOM   652  O O   . ASN A 1 85  ? -4.129  74.047 63.604 1.00 40.04  ? 85   ASN A O   1 
ATOM   653  C CB  . ASN A 1 85  ? -4.084  72.850 66.642 1.00 42.98  ? 85   ASN A CB  1 
ATOM   654  C CG  . ASN A 1 85  ? -3.596  71.957 67.758 1.00 44.77  ? 85   ASN A CG  1 
ATOM   655  O OD1 . ASN A 1 85  ? -3.251  70.799 67.526 1.00 48.18  ? 85   ASN A OD1 1 
ATOM   656  N ND2 . ASN A 1 85  ? -3.586  72.481 68.982 1.00 43.58  ? 85   ASN A ND2 1 
ATOM   657  N N   . PRO A 1 86  ? -5.548  72.331 63.916 1.00 40.33  ? 86   PRO A N   1 
ATOM   658  C CA  . PRO A 1 86  ? -6.466  72.825 62.888 1.00 40.47  ? 86   PRO A CA  1 
ATOM   659  C C   . PRO A 1 86  ? -7.006  74.198 63.280 1.00 40.65  ? 86   PRO A C   1 
ATOM   660  O O   . PRO A 1 86  ? -7.496  74.382 64.395 1.00 39.72  ? 86   PRO A O   1 
ATOM   661  C CB  . PRO A 1 86  ? -7.548  71.748 62.846 1.00 38.91  ? 86   PRO A CB  1 
ATOM   662  C CG  . PRO A 1 86  ? -7.537  71.198 64.236 1.00 39.40  ? 86   PRO A CG  1 
ATOM   663  C CD  . PRO A 1 86  ? -6.068  71.100 64.537 1.00 39.96  ? 86   PRO A CD  1 
ATOM   664  N N   . ASN A 1 87  ? -6.902  75.157 62.364 1.00 40.67  ? 87   ASN A N   1 
ATOM   665  C CA  . ASN A 1 87  ? -7.367  76.514 62.629 1.00 42.72  ? 87   ASN A CA  1 
ATOM   666  C C   . ASN A 1 87  ? -8.732  76.802 62.023 1.00 44.25  ? 87   ASN A C   1 
ATOM   667  O O   . ASN A 1 87  ? -9.147  77.955 61.924 1.00 45.97  ? 87   ASN A O   1 
ATOM   668  C CB  . ASN A 1 87  ? -6.350  77.531 62.117 1.00 42.01  ? 87   ASN A CB  1 
ATOM   669  C CG  . ASN A 1 87  ? -6.043  77.351 60.654 1.00 43.69  ? 87   ASN A CG  1 
ATOM   670  O OD1 . ASN A 1 87  ? -6.337  76.308 60.071 1.00 45.96  ? 87   ASN A OD1 1 
ATOM   671  N ND2 . ASN A 1 87  ? -5.430  78.360 60.050 1.00 44.05  ? 87   ASN A ND2 1 
ATOM   672  N N   A ARG A 1 88  ? -9.428  75.750 61.616 0.50 44.92  ? 88   ARG A N   1 
ATOM   673  N N   B ARG A 1 88  ? -9.423  75.745 61.610 0.50 43.55  ? 88   ARG A N   1 
ATOM   674  C CA  A ARG A 1 88  ? -10.756 75.904 61.046 0.50 45.87  ? 88   ARG A CA  1 
ATOM   675  C CA  B ARG A 1 88  ? -10.756 75.861 61.022 0.50 43.36  ? 88   ARG A CA  1 
ATOM   676  C C   A ARG A 1 88  ? -11.596 74.717 61.500 0.50 46.26  ? 88   ARG A C   1 
ATOM   677  C C   B ARG A 1 88  ? -11.681 74.875 61.724 0.50 43.60  ? 88   ARG A C   1 
ATOM   678  O O   A ARG A 1 88  ? -11.054 73.677 61.864 0.50 47.52  ? 88   ARG A O   1 
ATOM   679  O O   B ARG A 1 88  ? -11.300 74.251 62.716 0.50 43.77  ? 88   ARG A O   1 
ATOM   680  C CB  A ARG A 1 88  ? -10.676 75.964 59.520 0.50 45.62  ? 88   ARG A CB  1 
ATOM   681  C CB  B ARG A 1 88  ? -10.718 75.525 59.530 0.50 42.04  ? 88   ARG A CB  1 
ATOM   682  C CG  A ARG A 1 88  ? -11.873 76.637 58.882 0.50 46.42  ? 88   ARG A CG  1 
ATOM   683  C CG  B ARG A 1 88  ? -9.700  76.319 58.735 0.50 41.37  ? 88   ARG A CG  1 
ATOM   684  C CD  A ARG A 1 88  ? -11.473 77.653 57.804 0.50 47.74  ? 88   ARG A CD  1 
ATOM   685  C CD  B ARG A 1 88  ? -10.035 77.799 58.721 0.50 42.07  ? 88   ARG A CD  1 
ATOM   686  N NE  A ARG A 1 88  ? -10.956 78.915 58.340 0.50 47.76  ? 88   ARG A NE  1 
ATOM   687  N NE  B ARG A 1 88  ? -11.308 78.074 58.059 0.50 40.41  ? 88   ARG A NE  1 
ATOM   688  C CZ  A ARG A 1 88  ? -9.740  79.082 58.854 0.50 48.81  ? 88   ARG A CZ  1 
ATOM   689  C CZ  B ARG A 1 88  ? -11.799 79.294 57.868 0.50 39.66  ? 88   ARG A CZ  1 
ATOM   690  N NH1 A ARG A 1 88  ? -9.372  80.270 59.313 0.50 47.62  ? 88   ARG A NH1 1 
ATOM   691  N NH1 B ARG A 1 88  ? -11.122 80.353 58.291 0.50 37.91  ? 88   ARG A NH1 1 
ATOM   692  N NH2 A ARG A 1 88  ? -8.886  78.067 58.907 0.50 50.57  ? 88   ARG A NH2 1 
ATOM   693  N NH2 B ARG A 1 88  ? -12.964 79.455 57.254 0.50 38.05  ? 88   ARG A NH2 1 
ATOM   694  N N   A GLU A 1 89  ? -12.914 74.874 61.489 0.50 46.37  ? 89   GLU A N   1 
ATOM   695  N N   B GLU A 1 89  ? -12.898 74.736 61.213 0.50 44.08  ? 89   GLU A N   1 
ATOM   696  C CA  A GLU A 1 89  ? -13.813 73.811 61.926 0.50 46.94  ? 89   GLU A CA  1 
ATOM   697  C CA  B GLU A 1 89  ? -13.846 73.794 61.792 0.50 45.11  ? 89   GLU A CA  1 
ATOM   698  C C   A GLU A 1 89  ? -13.461 72.452 61.311 0.50 45.70  ? 89   GLU A C   1 
ATOM   699  C C   B GLU A 1 89  ? -13.509 72.408 61.255 0.50 44.51  ? 89   GLU A C   1 
ATOM   700  O O   A GLU A 1 89  ? -13.084 72.365 60.146 0.50 45.87  ? 89   GLU A O   1 
ATOM   701  O O   B GLU A 1 89  ? -13.182 72.255 60.081 0.50 44.78  ? 89   GLU A O   1 
ATOM   702  C CB  A GLU A 1 89  ? -15.262 74.176 61.586 0.50 49.11  ? 89   GLU A CB  1 
ATOM   703  C CB  B GLU A 1 89  ? -15.284 74.147 61.396 0.50 46.65  ? 89   GLU A CB  1 
ATOM   704  C CG  A GLU A 1 89  ? -16.270 73.734 62.641 0.50 52.08  ? 89   GLU A CG  1 
ATOM   705  C CG  B GLU A 1 89  ? -16.290 73.058 61.765 0.50 48.52  ? 89   GLU A CG  1 
ATOM   706  C CD  A GLU A 1 89  ? -16.190 74.572 63.908 0.50 54.12  ? 89   GLU A CD  1 
ATOM   707  C CD  B GLU A 1 89  ? -17.678 73.299 61.203 0.50 50.00  ? 89   GLU A CD  1 
ATOM   708  O OE1 A GLU A 1 89  ? -16.718 74.131 64.954 0.50 54.33  ? 89   GLU A OE1 1 
ATOM   709  O OE1 B GLU A 1 89  ? -18.528 72.391 61.340 0.50 51.33  ? 89   GLU A OE1 1 
ATOM   710  O OE2 A GLU A 1 89  ? -15.607 75.678 63.854 0.50 53.90  ? 89   GLU A OE2 1 
ATOM   711  O OE2 B GLU A 1 89  ? -17.922 74.384 60.631 0.50 49.48  ? 89   GLU A OE2 1 
ATOM   712  N N   . MET A 1 90  ? -13.578 71.395 62.107 1.00 44.42  ? 90   MET A N   1 
ATOM   713  C CA  . MET A 1 90  ? -13.279 70.051 61.643 1.00 44.08  ? 90   MET A CA  1 
ATOM   714  C C   . MET A 1 90  ? -14.546 69.443 61.068 1.00 44.36  ? 90   MET A C   1 
ATOM   715  O O   . MET A 1 90  ? -15.652 69.782 61.496 1.00 45.54  ? 90   MET A O   1 
ATOM   716  C CB  . MET A 1 90  ? -12.747 69.184 62.788 1.00 42.81  ? 90   MET A CB  1 
ATOM   717  C CG  . MET A 1 90  ? -11.361 69.591 63.263 1.00 44.69  ? 90   MET A CG  1 
ATOM   718  S SD  . MET A 1 90  ? -10.564 68.357 64.319 1.00 47.73  ? 90   MET A SD  1 
ATOM   719  C CE  . MET A 1 90  ? -11.446 68.611 65.840 1.00 45.98  ? 90   MET A CE  1 
ATOM   720  N N   . SER A 1 91  ? -14.384 68.550 60.095 1.00 43.14  ? 91   SER A N   1 
ATOM   721  C CA  . SER A 1 91  ? -15.522 67.903 59.451 1.00 42.33  ? 91   SER A CA  1 
ATOM   722  C C   . SER A 1 91  ? -15.050 66.791 58.522 1.00 43.08  ? 91   SER A C   1 
ATOM   723  O O   . SER A 1 91  ? -13.993 66.907 57.903 1.00 42.23  ? 91   SER A O   1 
ATOM   724  C CB  . SER A 1 91  ? -16.315 68.936 58.644 1.00 40.45  ? 91   SER A CB  1 
ATOM   725  O OG  . SER A 1 91  ? -17.332 68.322 57.875 1.00 37.00  ? 91   SER A OG  1 
ATOM   726  N N   . GLU A 1 92  ? -15.827 65.717 58.413 1.00 42.94  ? 92   GLU A N   1 
ATOM   727  C CA  . GLU A 1 92  ? -15.433 64.637 57.524 1.00 43.64  ? 92   GLU A CA  1 
ATOM   728  C C   . GLU A 1 92  ? -15.484 65.151 56.094 1.00 43.51  ? 92   GLU A C   1 
ATOM   729  O O   . GLU A 1 92  ? -14.847 64.591 55.200 1.00 45.16  ? 92   GLU A O   1 
ATOM   730  C CB  . GLU A 1 92  ? -16.341 63.422 57.698 1.00 44.75  ? 92   GLU A CB  1 
ATOM   731  C CG  . GLU A 1 92  ? -16.174 62.746 59.046 1.00 45.90  ? 92   GLU A CG  1 
ATOM   732  C CD  . GLU A 1 92  ? -16.881 61.407 59.126 1.00 48.50  ? 92   GLU A CD  1 
ATOM   733  O OE1 . GLU A 1 92  ? -16.421 60.443 58.476 1.00 49.28  ? 92   GLU A OE1 1 
ATOM   734  O OE2 . GLU A 1 92  ? -17.901 61.317 59.841 1.00 49.03  ? 92   GLU A OE2 1 
ATOM   735  N N   . ASP A 1 93  ? -16.247 66.220 55.883 1.00 43.28  ? 93   ASP A N   1 
ATOM   736  C CA  . ASP A 1 93  ? -16.353 66.845 54.566 1.00 43.88  ? 93   ASP A CA  1 
ATOM   737  C C   . ASP A 1 93  ? -15.191 67.818 54.559 1.00 43.22  ? 93   ASP A C   1 
ATOM   738  O O   . ASP A 1 93  ? -15.344 68.987 54.911 1.00 42.81  ? 93   ASP A O   1 
ATOM   739  C CB  . ASP A 1 93  ? -17.678 67.601 54.438 1.00 45.22  ? 93   ASP A CB  1 
ATOM   740  C CG  . ASP A 1 93  ? -17.806 68.341 53.119 1.00 45.92  ? 93   ASP A CG  1 
ATOM   741  O OD1 . ASP A 1 93  ? -18.894 68.887 52.859 1.00 49.28  ? 93   ASP A OD1 1 
ATOM   742  O OD2 . ASP A 1 93  ? -16.828 68.382 52.345 1.00 45.76  ? 93   ASP A OD2 1 
ATOM   743  N N   . CYS A 1 94  ? -14.029 67.326 54.150 1.00 42.39  ? 94   CYS A N   1 
ATOM   744  C CA  . CYS A 1 94  ? -12.820 68.129 54.181 1.00 40.85  ? 94   CYS A CA  1 
ATOM   745  C C   . CYS A 1 94  ? -11.913 67.968 52.971 1.00 40.81  ? 94   CYS A C   1 
ATOM   746  O O   . CYS A 1 94  ? -10.782 68.459 52.978 1.00 38.02  ? 94   CYS A O   1 
ATOM   747  C CB  . CYS A 1 94  ? -12.040 67.743 55.428 1.00 42.74  ? 94   CYS A CB  1 
ATOM   748  S SG  . CYS A 1 94  ? -11.607 65.968 55.435 1.00 41.65  ? 94   CYS A SG  1 
ATOM   749  N N   . LEU A 1 95  ? -12.391 67.279 51.940 1.00 40.99  ? 95   LEU A N   1 
ATOM   750  C CA  . LEU A 1 95  ? -11.576 67.057 50.752 1.00 40.48  ? 95   LEU A CA  1 
ATOM   751  C C   . LEU A 1 95  ? -11.548 68.235 49.776 1.00 39.75  ? 95   LEU A C   1 
ATOM   752  O O   . LEU A 1 95  ? -12.250 68.249 48.767 1.00 39.96  ? 95   LEU A O   1 
ATOM   753  C CB  . LEU A 1 95  ? -12.028 65.766 50.058 1.00 38.16  ? 95   LEU A CB  1 
ATOM   754  C CG  . LEU A 1 95  ? -11.243 64.496 50.441 1.00 39.44  ? 95   LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 95  ? -10.668 64.590 51.851 1.00 35.18  ? 95   LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 95  ? -12.157 63.285 50.309 1.00 38.69  ? 95   LEU A CD2 1 
ATOM   757  N N   . TYR A 1 96  ? -10.707 69.216 50.091 1.00 39.79  ? 96   TYR A N   1 
ATOM   758  C CA  . TYR A 1 96  ? -10.550 70.411 49.276 1.00 38.66  ? 96   TYR A CA  1 
ATOM   759  C C   . TYR A 1 96  ? -9.083  70.732 49.058 1.00 38.78  ? 96   TYR A C   1 
ATOM   760  O O   . TYR A 1 96  ? -8.214  70.187 49.734 1.00 38.16  ? 96   TYR A O   1 
ATOM   761  C CB  . TYR A 1 96  ? -11.211 71.606 49.961 1.00 39.74  ? 96   TYR A CB  1 
ATOM   762  C CG  . TYR A 1 96  ? -12.666 71.390 50.268 1.00 38.60  ? 96   TYR A CG  1 
ATOM   763  C CD1 . TYR A 1 96  ? -13.061 70.655 51.383 1.00 40.24  ? 96   TYR A CD1 1 
ATOM   764  C CD2 . TYR A 1 96  ? -13.649 71.860 49.406 1.00 37.69  ? 96   TYR A CD2 1 
ATOM   765  C CE1 . TYR A 1 96  ? -14.408 70.388 51.628 1.00 40.14  ? 96   TYR A CE1 1 
ATOM   766  C CE2 . TYR A 1 96  ? -14.994 71.595 49.637 1.00 38.96  ? 96   TYR A CE2 1 
ATOM   767  C CZ  . TYR A 1 96  ? -15.367 70.858 50.746 1.00 39.26  ? 96   TYR A CZ  1 
ATOM   768  O OH  . TYR A 1 96  ? -16.696 70.561 50.950 1.00 43.59  ? 96   TYR A OH  1 
ATOM   769  N N   . LEU A 1 97  ? -8.812  71.621 48.107 1.00 39.06  ? 97   LEU A N   1 
ATOM   770  C CA  . LEU A 1 97  ? -7.447  72.038 47.823 1.00 39.10  ? 97   LEU A CA  1 
ATOM   771  C C   . LEU A 1 97  ? -7.424  73.558 47.650 1.00 38.98  ? 97   LEU A C   1 
ATOM   772  O O   . LEU A 1 97  ? -8.458  74.171 47.400 1.00 40.38  ? 97   LEU A O   1 
ATOM   773  C CB  . LEU A 1 97  ? -6.913  71.319 46.578 1.00 38.00  ? 97   LEU A CB  1 
ATOM   774  C CG  . LEU A 1 97  ? -7.633  71.422 45.233 1.00 40.41  ? 97   LEU A CG  1 
ATOM   775  C CD1 . LEU A 1 97  ? -7.383  72.781 44.595 1.00 38.83  ? 97   LEU A CD1 1 
ATOM   776  C CD2 . LEU A 1 97  ? -7.116  70.311 44.318 1.00 40.59  ? 97   LEU A CD2 1 
ATOM   777  N N   . ASN A 1 98  ? -6.248  74.159 47.803 1.00 40.43  ? 98   ASN A N   1 
ATOM   778  C CA  . ASN A 1 98  ? -6.082  75.609 47.694 1.00 40.74  ? 98   ASN A CA  1 
ATOM   779  C C   . ASN A 1 98  ? -5.031  75.967 46.654 1.00 41.77  ? 98   ASN A C   1 
ATOM   780  O O   . ASN A 1 98  ? -4.020  75.272 46.523 1.00 43.16  ? 98   ASN A O   1 
ATOM   781  C CB  . ASN A 1 98  ? -5.649  76.192 49.042 1.00 39.44  ? 98   ASN A CB  1 
ATOM   782  C CG  . ASN A 1 98  ? -6.484  75.683 50.193 1.00 39.97  ? 98   ASN A CG  1 
ATOM   783  O OD1 . ASN A 1 98  ? -7.699  75.888 50.239 1.00 41.02  ? 98   ASN A OD1 1 
ATOM   784  N ND2 . ASN A 1 98  ? -5.836  75.012 51.135 1.00 39.63  ? 98   ASN A ND2 1 
ATOM   785  N N   . ILE A 1 99  ? -5.253  77.062 45.929 1.00 42.27  ? 99   ILE A N   1 
ATOM   786  C CA  . ILE A 1 99  ? -4.300  77.483 44.906 1.00 42.86  ? 99   ILE A CA  1 
ATOM   787  C C   . ILE A 1 99  ? -3.954  78.963 45.004 1.00 45.10  ? 99   ILE A C   1 
ATOM   788  O O   . ILE A 1 99  ? -4.842  79.813 45.087 1.00 47.71  ? 99   ILE A O   1 
ATOM   789  C CB  . ILE A 1 99  ? -4.843  77.246 43.472 1.00 41.09  ? 99   ILE A CB  1 
ATOM   790  C CG1 . ILE A 1 99  ? -5.518  75.875 43.370 1.00 39.05  ? 99   ILE A CG1 1 
ATOM   791  C CG2 . ILE A 1 99  ? -3.694  77.348 42.470 1.00 38.25  ? 99   ILE A CG2 1 
ATOM   792  C CD1 . ILE A 1 99  ? -6.241  75.643 42.057 1.00 37.23  ? 99   ILE A CD1 1 
ATOM   793  N N   . TRP A 1 100 ? -2.661  79.265 44.998 1.00 45.90  ? 100  TRP A N   1 
ATOM   794  C CA  . TRP A 1 100 ? -2.197  80.646 45.030 1.00 47.03  ? 100  TRP A CA  1 
ATOM   795  C C   . TRP A 1 100 ? -1.637  80.884 43.637 1.00 47.12  ? 100  TRP A C   1 
ATOM   796  O O   . TRP A 1 100 ? -0.659  80.255 43.239 1.00 47.46  ? 100  TRP A O   1 
ATOM   797  C CB  . TRP A 1 100 ? -1.119  80.836 46.101 1.00 47.14  ? 100  TRP A CB  1 
ATOM   798  C CG  . TRP A 1 100 ? -1.699  80.988 47.471 1.00 48.98  ? 100  TRP A CG  1 
ATOM   799  C CD1 . TRP A 1 100 ? -2.155  82.141 48.046 1.00 50.26  ? 100  TRP A CD1 1 
ATOM   800  C CD2 . TRP A 1 100 ? -1.963  79.940 48.413 1.00 50.56  ? 100  TRP A CD2 1 
ATOM   801  N NE1 . TRP A 1 100 ? -2.691  81.876 49.287 1.00 49.53  ? 100  TRP A NE1 1 
ATOM   802  C CE2 . TRP A 1 100 ? -2.585  80.532 49.537 1.00 49.77  ? 100  TRP A CE2 1 
ATOM   803  C CE3 . TRP A 1 100 ? -1.738  78.555 48.416 1.00 50.01  ? 100  TRP A CE3 1 
ATOM   804  C CZ2 . TRP A 1 100 ? -2.982  79.787 50.654 1.00 50.35  ? 100  TRP A CZ2 1 
ATOM   805  C CZ3 . TRP A 1 100 ? -2.134  77.815 49.528 1.00 49.78  ? 100  TRP A CZ3 1 
ATOM   806  C CH2 . TRP A 1 100 ? -2.749  78.434 50.631 1.00 49.64  ? 100  TRP A CH2 1 
ATOM   807  N N   . VAL A 1 101 ? -2.289  81.776 42.896 1.00 48.13  ? 101  VAL A N   1 
ATOM   808  C CA  . VAL A 1 101 ? -1.910  82.088 41.521 1.00 47.62  ? 101  VAL A CA  1 
ATOM   809  C C   . VAL A 1 101 ? -1.336  83.490 41.377 1.00 46.76  ? 101  VAL A C   1 
ATOM   810  O O   . VAL A 1 101 ? -1.937  84.464 41.836 1.00 45.35  ? 101  VAL A O   1 
ATOM   811  C CB  . VAL A 1 101 ? -3.135  81.985 40.578 1.00 47.92  ? 101  VAL A CB  1 
ATOM   812  C CG1 . VAL A 1 101 ? -2.695  82.137 39.125 1.00 48.35  ? 101  VAL A CG1 1 
ATOM   813  C CG2 . VAL A 1 101 ? -3.855  80.669 40.803 1.00 48.21  ? 101  VAL A CG2 1 
ATOM   814  N N   . PRO A 1 102 ? -0.164  83.609 40.731 1.00 47.08  ? 102  PRO A N   1 
ATOM   815  C CA  . PRO A 1 102 ? 0.483   84.909 40.526 1.00 49.16  ? 102  PRO A CA  1 
ATOM   816  C C   . PRO A 1 102 ? -0.406  85.847 39.709 1.00 51.11  ? 102  PRO A C   1 
ATOM   817  O O   . PRO A 1 102 ? -1.234  85.395 38.916 1.00 50.72  ? 102  PRO A O   1 
ATOM   818  C CB  . PRO A 1 102 ? 1.764   84.544 39.781 1.00 48.35  ? 102  PRO A CB  1 
ATOM   819  C CG  . PRO A 1 102 ? 2.079   83.175 40.310 1.00 46.98  ? 102  PRO A CG  1 
ATOM   820  C CD  . PRO A 1 102 ? 0.719   82.515 40.290 1.00 47.14  ? 102  PRO A CD  1 
ATOM   821  N N   . SER A 1 103 ? -0.242  87.150 39.917 1.00 53.20  ? 103  SER A N   1 
ATOM   822  C CA  . SER A 1 103 ? -1.022  88.145 39.186 1.00 54.29  ? 103  SER A CA  1 
ATOM   823  C C   . SER A 1 103 ? -0.076  89.076 38.438 1.00 54.18  ? 103  SER A C   1 
ATOM   824  O O   . SER A 1 103 ? 0.858   89.621 39.018 1.00 54.67  ? 103  SER A O   1 
ATOM   825  C CB  . SER A 1 103 ? -1.893  88.960 40.145 1.00 54.37  ? 103  SER A CB  1 
ATOM   826  O OG  . SER A 1 103 ? -2.860  89.713 39.430 1.00 54.50  ? 103  SER A OG  1 
ATOM   827  N N   . PRO A 1 104 ? -0.296  89.254 37.129 1.00 55.26  ? 104  PRO A N   1 
ATOM   828  C CA  . PRO A 1 104 ? -1.370  88.632 36.348 1.00 54.94  ? 104  PRO A CA  1 
ATOM   829  C C   . PRO A 1 104 ? -1.180  87.125 36.179 1.00 54.65  ? 104  PRO A C   1 
ATOM   830  O O   . PRO A 1 104 ? -0.056  86.622 36.211 1.00 53.40  ? 104  PRO A O   1 
ATOM   831  C CB  . PRO A 1 104 ? -1.298  89.375 35.020 1.00 55.29  ? 104  PRO A CB  1 
ATOM   832  C CG  . PRO A 1 104 ? 0.177   89.671 34.893 1.00 55.02  ? 104  PRO A CG  1 
ATOM   833  C CD  . PRO A 1 104 ? 0.526   90.140 36.283 1.00 54.94  ? 104  PRO A CD  1 
ATOM   834  N N   . ARG A 1 105 ? -2.292  86.418 35.996 1.00 55.19  ? 105  ARG A N   1 
ATOM   835  C CA  . ARG A 1 105 ? -2.281  84.968 35.829 1.00 55.58  ? 105  ARG A CA  1 
ATOM   836  C C   . ARG A 1 105 ? -1.290  84.530 34.763 1.00 55.84  ? 105  ARG A C   1 
ATOM   837  O O   . ARG A 1 105 ? -1.310  85.044 33.648 1.00 57.98  ? 105  ARG A O   1 
ATOM   838  C CB  . ARG A 1 105 ? -3.679  84.472 35.440 1.00 53.12  ? 105  ARG A CB  1 
ATOM   839  C CG  . ARG A 1 105 ? -3.769  82.973 35.222 1.00 51.43  ? 105  ARG A CG  1 
ATOM   840  C CD  . ARG A 1 105 ? -5.114  82.592 34.645 1.00 49.97  ? 105  ARG A CD  1 
ATOM   841  N NE  . ARG A 1 105 ? -6.199  83.180 35.420 1.00 50.82  ? 105  ARG A NE  1 
ATOM   842  C CZ  . ARG A 1 105 ? -7.479  83.120 35.072 1.00 53.70  ? 105  ARG A CZ  1 
ATOM   843  N NH1 . ARG A 1 105 ? -8.406  83.688 35.840 1.00 51.76  ? 105  ARG A NH1 1 
ATOM   844  N NH2 . ARG A 1 105 ? -7.835  82.496 33.953 1.00 53.18  ? 105  ARG A NH2 1 
ATOM   845  N N   . PRO A 1 106 ? -0.401  83.581 35.094 1.00 55.94  ? 106  PRO A N   1 
ATOM   846  C CA  . PRO A 1 106 ? 0.581   83.106 34.111 1.00 55.39  ? 106  PRO A CA  1 
ATOM   847  C C   . PRO A 1 106 ? -0.114  82.237 33.061 1.00 55.10  ? 106  PRO A C   1 
ATOM   848  O O   . PRO A 1 106 ? -1.323  82.011 33.147 1.00 54.88  ? 106  PRO A O   1 
ATOM   849  C CB  . PRO A 1 106 ? 1.574   82.326 34.968 1.00 54.28  ? 106  PRO A CB  1 
ATOM   850  C CG  . PRO A 1 106 ? 0.713   81.790 36.060 1.00 55.42  ? 106  PRO A CG  1 
ATOM   851  C CD  . PRO A 1 106 ? -0.170  82.964 36.413 1.00 55.36  ? 106  PRO A CD  1 
ATOM   852  N N   . LYS A 1 107 ? 0.635   81.755 32.074 1.00 54.95  ? 107  LYS A N   1 
ATOM   853  C CA  . LYS A 1 107 ? 0.050   80.922 31.027 1.00 56.14  ? 107  LYS A CA  1 
ATOM   854  C C   . LYS A 1 107 ? 0.432   79.457 31.208 1.00 56.55  ? 107  LYS A C   1 
ATOM   855  O O   . LYS A 1 107 ? -0.392  78.559 31.011 1.00 56.56  ? 107  LYS A O   1 
ATOM   856  C CB  . LYS A 1 107 ? 0.509   81.396 29.644 1.00 57.00  ? 107  LYS A CB  1 
ATOM   857  C CG  . LYS A 1 107 ? 0.310   82.886 29.374 1.00 57.93  ? 107  LYS A CG  1 
ATOM   858  C CD  . LYS A 1 107 ? -1.149  83.309 29.477 1.00 57.24  ? 107  LYS A CD  1 
ATOM   859  C CE  . LYS A 1 107 ? -1.293  84.818 29.310 1.00 55.94  ? 107  LYS A CE  1 
ATOM   860  N NZ  . LYS A 1 107 ? -2.691  85.271 29.558 1.00 56.04  ? 107  LYS A NZ  1 
ATOM   861  N N   . SER A 1 108 ? 1.683   79.219 31.586 1.00 56.12  ? 108  SER A N   1 
ATOM   862  C CA  . SER A 1 108 ? 2.168   77.860 31.791 1.00 55.85  ? 108  SER A CA  1 
ATOM   863  C C   . SER A 1 108 ? 3.409   77.848 32.682 1.00 54.95  ? 108  SER A C   1 
ATOM   864  O O   . SER A 1 108 ? 4.503   77.478 32.246 1.00 55.76  ? 108  SER A O   1 
ATOM   865  C CB  . SER A 1 108 ? 2.490   77.216 30.441 1.00 56.03  ? 108  SER A CB  1 
ATOM   866  O OG  . SER A 1 108 ? 2.912   75.876 30.607 1.00 57.30  ? 108  SER A OG  1 
ATOM   867  N N   . THR A 1 109 ? 3.234   78.249 33.936 1.00 53.64  ? 109  THR A N   1 
ATOM   868  C CA  . THR A 1 109 ? 4.352   78.289 34.871 1.00 52.00  ? 109  THR A CA  1 
ATOM   869  C C   . THR A 1 109 ? 4.437   77.040 35.762 1.00 50.37  ? 109  THR A C   1 
ATOM   870  O O   . THR A 1 109 ? 3.496   76.239 35.827 1.00 49.46  ? 109  THR A O   1 
ATOM   871  C CB  . THR A 1 109 ? 4.272   79.547 35.763 1.00 51.21  ? 109  THR A CB  1 
ATOM   872  O OG1 . THR A 1 109 ? 5.479   79.670 36.524 1.00 53.60  ? 109  THR A OG1 1 
ATOM   873  C CG2 . THR A 1 109 ? 3.086   79.454 36.717 1.00 50.40  ? 109  THR A CG2 1 
ATOM   874  N N   . THR A 1 110 ? 5.574   76.888 36.438 1.00 47.39  ? 110  THR A N   1 
ATOM   875  C CA  . THR A 1 110 ? 5.821   75.761 37.331 1.00 45.08  ? 110  THR A CA  1 
ATOM   876  C C   . THR A 1 110 ? 4.772   75.619 38.430 1.00 44.68  ? 110  THR A C   1 
ATOM   877  O O   . THR A 1 110 ? 4.332   76.611 39.017 1.00 44.41  ? 110  THR A O   1 
ATOM   878  C CB  . THR A 1 110 ? 7.180   75.905 37.998 1.00 45.03  ? 110  THR A CB  1 
ATOM   879  O OG1 . THR A 1 110 ? 8.183   76.066 36.991 1.00 45.47  ? 110  THR A OG1 1 
ATOM   880  C CG2 . THR A 1 110 ? 7.490   74.683 38.837 1.00 45.01  ? 110  THR A CG2 1 
ATOM   881  N N   . VAL A 1 111 ? 4.391   74.374 38.708 1.00 42.23  ? 111  VAL A N   1 
ATOM   882  C CA  . VAL A 1 111 ? 3.399   74.071 39.734 1.00 40.12  ? 111  VAL A CA  1 
ATOM   883  C C   . VAL A 1 111 ? 4.012   73.268 40.891 1.00 39.82  ? 111  VAL A C   1 
ATOM   884  O O   . VAL A 1 111 ? 4.751   72.308 40.669 1.00 38.44  ? 111  VAL A O   1 
ATOM   885  C CB  . VAL A 1 111 ? 2.208   73.253 39.141 1.00 39.27  ? 111  VAL A CB  1 
ATOM   886  C CG1 . VAL A 1 111 ? 1.179   72.959 40.226 1.00 35.97  ? 111  VAL A CG1 1 
ATOM   887  C CG2 . VAL A 1 111 ? 1.560   74.013 37.998 1.00 35.85  ? 111  VAL A CG2 1 
ATOM   888  N N   . MET A 1 112 ? 3.704   73.675 42.120 1.00 38.92  ? 112  MET A N   1 
ATOM   889  C CA  . MET A 1 112 ? 4.194   72.989 43.312 1.00 38.03  ? 112  MET A CA  1 
ATOM   890  C C   . MET A 1 112 ? 2.995   72.615 44.169 1.00 39.43  ? 112  MET A C   1 
ATOM   891  O O   . MET A 1 112 ? 2.174   73.471 44.501 1.00 40.71  ? 112  MET A O   1 
ATOM   892  C CB  . MET A 1 112 ? 5.137   73.888 44.113 1.00 38.24  ? 112  MET A CB  1 
ATOM   893  C CG  . MET A 1 112 ? 6.477   74.146 43.444 1.00 37.98  ? 112  MET A CG  1 
ATOM   894  S SD  . MET A 1 112 ? 7.566   75.237 44.397 1.00 43.59  ? 112  MET A SD  1 
ATOM   895  C CE  . MET A 1 112 ? 8.407   74.063 45.431 1.00 42.26  ? 112  MET A CE  1 
ATOM   896  N N   . VAL A 1 113 ? 2.892   71.334 44.515 1.00 38.56  ? 113  VAL A N   1 
ATOM   897  C CA  . VAL A 1 113 ? 1.790   70.843 45.334 1.00 37.05  ? 113  VAL A CA  1 
ATOM   898  C C   . VAL A 1 113 ? 2.299   70.409 46.706 1.00 37.98  ? 113  VAL A C   1 
ATOM   899  O O   . VAL A 1 113 ? 3.165   69.538 46.812 1.00 36.31  ? 113  VAL A O   1 
ATOM   900  C CB  . VAL A 1 113 ? 1.082   69.650 44.656 1.00 36.84  ? 113  VAL A CB  1 
ATOM   901  C CG1 . VAL A 1 113 ? -0.102  69.200 45.493 1.00 32.97  ? 113  VAL A CG1 1 
ATOM   902  C CG2 . VAL A 1 113 ? 0.627   70.050 43.266 1.00 34.27  ? 113  VAL A CG2 1 
ATOM   903  N N   . TRP A 1 114 ? 1.738   71.021 47.746 1.00 37.83  ? 114  TRP A N   1 
ATOM   904  C CA  . TRP A 1 114 ? 2.116   70.754 49.129 1.00 36.50  ? 114  TRP A CA  1 
ATOM   905  C C   . TRP A 1 114 ? 1.263   69.696 49.805 1.00 36.75  ? 114  TRP A C   1 
ATOM   906  O O   . TRP A 1 114 ? 0.031   69.745 49.752 1.00 37.30  ? 114  TRP A O   1 
ATOM   907  C CB  . TRP A 1 114 ? 2.046   72.052 49.951 1.00 36.21  ? 114  TRP A CB  1 
ATOM   908  C CG  . TRP A 1 114 ? 2.287   71.860 51.425 1.00 34.28  ? 114  TRP A CG  1 
ATOM   909  C CD1 . TRP A 1 114 ? 1.356   71.918 52.426 1.00 32.92  ? 114  TRP A CD1 1 
ATOM   910  C CD2 . TRP A 1 114 ? 3.537   71.553 52.057 1.00 33.14  ? 114  TRP A CD2 1 
ATOM   911  N NE1 . TRP A 1 114 ? 1.951   71.665 53.641 1.00 32.24  ? 114  TRP A NE1 1 
ATOM   912  C CE2 . TRP A 1 114 ? 3.287   71.438 53.445 1.00 32.11  ? 114  TRP A CE2 1 
ATOM   913  C CE3 . TRP A 1 114 ? 4.845   71.363 51.586 1.00 31.72  ? 114  TRP A CE3 1 
ATOM   914  C CZ2 . TRP A 1 114 ? 4.298   71.141 54.367 1.00 33.42  ? 114  TRP A CZ2 1 
ATOM   915  C CZ3 . TRP A 1 114 ? 5.851   71.066 52.503 1.00 31.48  ? 114  TRP A CZ3 1 
ATOM   916  C CH2 . TRP A 1 114 ? 5.571   70.958 53.878 1.00 31.39  ? 114  TRP A CH2 1 
ATOM   917  N N   . ILE A 1 115 ? 1.935   68.747 50.453 1.00 36.80  ? 115  ILE A N   1 
ATOM   918  C CA  . ILE A 1 115 ? 1.271   67.670 51.180 1.00 36.09  ? 115  ILE A CA  1 
ATOM   919  C C   . ILE A 1 115 ? 1.684   67.774 52.648 1.00 36.13  ? 115  ILE A C   1 
ATOM   920  O O   . ILE A 1 115 ? 2.823   67.451 53.011 1.00 34.29  ? 115  ILE A O   1 
ATOM   921  C CB  . ILE A 1 115 ? 1.681   66.286 50.642 1.00 37.67  ? 115  ILE A CB  1 
ATOM   922  C CG1 . ILE A 1 115 ? 1.484   66.239 49.122 1.00 37.01  ? 115  ILE A CG1 1 
ATOM   923  C CG2 . ILE A 1 115 ? 0.834   65.199 51.315 1.00 35.64  ? 115  ILE A CG2 1 
ATOM   924  C CD1 . ILE A 1 115 ? 1.911   64.929 48.479 1.00 36.73  ? 115  ILE A CD1 1 
ATOM   925  N N   . TYR A 1 116 ? 0.753   68.216 53.490 1.00 35.07  ? 116  TYR A N   1 
ATOM   926  C CA  . TYR A 1 116 ? 1.040   68.394 54.909 1.00 35.08  ? 116  TYR A CA  1 
ATOM   927  C C   . TYR A 1 116 ? 1.379   67.121 55.674 1.00 35.03  ? 116  TYR A C   1 
ATOM   928  O O   . TYR A 1 116 ? 0.950   66.028 55.314 1.00 35.21  ? 116  TYR A O   1 
ATOM   929  C CB  . TYR A 1 116 ? -0.121  69.125 55.607 1.00 33.29  ? 116  TYR A CB  1 
ATOM   930  C CG  . TYR A 1 116 ? -1.464  68.419 55.597 1.00 33.77  ? 116  TYR A CG  1 
ATOM   931  C CD1 . TYR A 1 116 ? -1.687  67.264 56.351 1.00 32.77  ? 116  TYR A CD1 1 
ATOM   932  C CD2 . TYR A 1 116 ? -2.530  68.937 54.862 1.00 34.69  ? 116  TYR A CD2 1 
ATOM   933  C CE1 . TYR A 1 116 ? -2.952  66.643 56.374 1.00 32.47  ? 116  TYR A CE1 1 
ATOM   934  C CE2 . TYR A 1 116 ? -3.792  68.331 54.875 1.00 33.49  ? 116  TYR A CE2 1 
ATOM   935  C CZ  . TYR A 1 116 ? -3.998  67.189 55.626 1.00 33.83  ? 116  TYR A CZ  1 
ATOM   936  O OH  . TYR A 1 116 ? -5.241  66.597 55.599 1.00 30.79  ? 116  TYR A OH  1 
ATOM   937  N N   . GLY A 1 117 ? 2.171   67.283 56.730 1.00 36.24  ? 117  GLY A N   1 
ATOM   938  C CA  . GLY A 1 117 ? 2.554   66.157 57.563 1.00 35.70  ? 117  GLY A CA  1 
ATOM   939  C C   . GLY A 1 117 ? 1.659   66.120 58.788 1.00 34.61  ? 117  GLY A C   1 
ATOM   940  O O   . GLY A 1 117 ? 0.646   66.820 58.840 1.00 34.64  ? 117  GLY A O   1 
ATOM   941  N N   . GLY A 1 118 ? 2.031   65.319 59.779 1.00 33.95  ? 118  GLY A N   1 
ATOM   942  C CA  . GLY A 1 118 ? 1.225   65.208 60.982 1.00 33.42  ? 118  GLY A CA  1 
ATOM   943  C C   . GLY A 1 118 ? 1.040   63.752 61.379 1.00 35.10  ? 118  GLY A C   1 
ATOM   944  O O   . GLY A 1 118 ? 0.001   63.375 61.935 1.00 34.12  ? 118  GLY A O   1 
ATOM   945  N N   . GLY A 1 119 ? 2.047   62.931 61.079 1.00 32.81  ? 119  GLY A N   1 
ATOM   946  C CA  . GLY A 1 119 ? 1.995   61.518 61.414 1.00 31.94  ? 119  GLY A CA  1 
ATOM   947  C C   . GLY A 1 119 ? 0.813   60.726 60.876 1.00 33.06  ? 119  GLY A C   1 
ATOM   948  O O   . GLY A 1 119 ? 0.517   59.640 61.375 1.00 32.37  ? 119  GLY A O   1 
ATOM   949  N N   . PHE A 1 120 ? 0.140   61.252 59.858 1.00 33.04  ? 120  PHE A N   1 
ATOM   950  C CA  . PHE A 1 120 ? -1.021  60.575 59.276 1.00 33.99  ? 120  PHE A CA  1 
ATOM   951  C C   . PHE A 1 120 ? -2.206  60.563 60.232 1.00 33.84  ? 120  PHE A C   1 
ATOM   952  O O   . PHE A 1 120 ? -3.230  59.957 59.928 1.00 35.73  ? 120  PHE A O   1 
ATOM   953  C CB  . PHE A 1 120 ? -0.692  59.121 58.892 1.00 32.54  ? 120  PHE A CB  1 
ATOM   954  C CG  . PHE A 1 120 ? 0.265   58.989 57.734 1.00 30.80  ? 120  PHE A CG  1 
ATOM   955  C CD1 . PHE A 1 120 ? -0.092  59.426 56.462 1.00 28.15  ? 120  PHE A CD1 1 
ATOM   956  C CD2 . PHE A 1 120 ? 1.531   58.430 57.921 1.00 28.96  ? 120  PHE A CD2 1 
ATOM   957  C CE1 . PHE A 1 120 ? 0.801   59.309 55.394 1.00 29.37  ? 120  PHE A CE1 1 
ATOM   958  C CE2 . PHE A 1 120 ? 2.434   58.310 56.857 1.00 26.37  ? 120  PHE A CE2 1 
ATOM   959  C CZ  . PHE A 1 120 ? 2.070   58.748 55.596 1.00 27.62  ? 120  PHE A CZ  1 
ATOM   960  N N   . TYR A 1 121 ? -2.066  61.217 61.384 1.00 34.18  ? 121  TYR A N   1 
ATOM   961  C CA  . TYR A 1 121 ? -3.149  61.276 62.369 1.00 36.52  ? 121  TYR A CA  1 
ATOM   962  C C   . TYR A 1 121 ? -3.673  62.706 62.538 1.00 37.71  ? 121  TYR A C   1 
ATOM   963  O O   . TYR A 1 121 ? -4.703  62.936 63.188 1.00 38.26  ? 121  TYR A O   1 
ATOM   964  C CB  . TYR A 1 121 ? -2.672  60.736 63.725 1.00 35.82  ? 121  TYR A CB  1 
ATOM   965  C CG  . TYR A 1 121 ? -1.675  61.618 64.454 1.00 34.27  ? 121  TYR A CG  1 
ATOM   966  C CD1 . TYR A 1 121 ? -2.097  62.707 65.212 1.00 35.07  ? 121  TYR A CD1 1 
ATOM   967  C CD2 . TYR A 1 121 ? -0.308  61.355 64.389 1.00 34.93  ? 121  TYR A CD2 1 
ATOM   968  C CE1 . TYR A 1 121 ? -1.184  63.505 65.890 1.00 37.03  ? 121  TYR A CE1 1 
ATOM   969  C CE2 . TYR A 1 121 ? 0.613   62.144 65.055 1.00 32.38  ? 121  TYR A CE2 1 
ATOM   970  C CZ  . TYR A 1 121 ? 0.174   63.216 65.806 1.00 37.30  ? 121  TYR A CZ  1 
ATOM   971  O OH  . TYR A 1 121 ? 1.088   63.992 66.489 1.00 36.35  ? 121  TYR A OH  1 
ATOM   972  N N   . SER A 1 122 ? -2.962  63.659 61.942 1.00 35.94  ? 122  SER A N   1 
ATOM   973  C CA  . SER A 1 122 ? -3.330  65.064 62.024 1.00 35.69  ? 122  SER A CA  1 
ATOM   974  C C   . SER A 1 122 ? -2.776  65.823 60.828 1.00 36.63  ? 122  SER A C   1 
ATOM   975  O O   . SER A 1 122 ? -2.073  65.249 59.993 1.00 34.92  ? 122  SER A O   1 
ATOM   976  C CB  . SER A 1 122 ? -2.762  65.669 63.305 1.00 36.57  ? 122  SER A CB  1 
ATOM   977  O OG  . SER A 1 122 ? -1.352  65.529 63.344 1.00 36.52  ? 122  SER A OG  1 
ATOM   978  N N   . GLY A 1 123 ? -3.090  67.116 60.761 1.00 37.45  ? 123  GLY A N   1 
ATOM   979  C CA  . GLY A 1 123 ? -2.613  67.954 59.674 1.00 37.78  ? 123  GLY A CA  1 
ATOM   980  C C   . GLY A 1 123 ? -3.705  68.805 59.048 1.00 39.35  ? 123  GLY A C   1 
ATOM   981  O O   . GLY A 1 123 ? -4.875  68.416 59.028 1.00 40.07  ? 123  GLY A O   1 
ATOM   982  N N   . SER A 1 124 ? -3.328  69.973 58.538 1.00 39.38  ? 124  SER A N   1 
ATOM   983  C CA  . SER A 1 124 ? -4.277  70.879 57.896 1.00 39.48  ? 124  SER A CA  1 
ATOM   984  C C   . SER A 1 124 ? -3.560  71.646 56.803 1.00 40.10  ? 124  SER A C   1 
ATOM   985  O O   . SER A 1 124 ? -2.391  72.006 56.954 1.00 39.59  ? 124  SER A O   1 
ATOM   986  C CB  . SER A 1 124 ? -4.853  71.881 58.902 1.00 38.51  ? 124  SER A CB  1 
ATOM   987  O OG  . SER A 1 124 ? -5.642  71.239 59.883 1.00 40.42  ? 124  SER A OG  1 
ATOM   988  N N   . SER A 1 125 ? -4.262  71.905 55.707 1.00 40.56  ? 125  SER A N   1 
ATOM   989  C CA  . SER A 1 125 ? -3.684  72.633 54.586 1.00 40.99  ? 125  SER A CA  1 
ATOM   990  C C   . SER A 1 125 ? -3.861  74.127 54.785 1.00 41.82  ? 125  SER A C   1 
ATOM   991  O O   . SER A 1 125 ? -3.308  74.931 54.034 1.00 41.54  ? 125  SER A O   1 
ATOM   992  C CB  . SER A 1 125 ? -4.383  72.240 53.287 1.00 42.06  ? 125  SER A CB  1 
ATOM   993  O OG  . SER A 1 125 ? -5.718  72.724 53.279 1.00 41.32  ? 125  SER A OG  1 
ATOM   994  N N   . THR A 1 126 ? -4.621  74.490 55.813 1.00 42.57  ? 126  THR A N   1 
ATOM   995  C CA  . THR A 1 126 ? -4.928  75.886 56.090 1.00 43.61  ? 126  THR A CA  1 
ATOM   996  C C   . THR A 1 126 ? -4.077  76.588 57.140 1.00 44.23  ? 126  THR A C   1 
ATOM   997  O O   . THR A 1 126 ? -4.289  77.766 57.420 1.00 44.57  ? 126  THR A O   1 
ATOM   998  C CB  . THR A 1 126 ? -6.399  76.021 56.493 1.00 43.75  ? 126  THR A CB  1 
ATOM   999  O OG1 . THR A 1 126 ? -6.635  75.260 57.684 1.00 45.86  ? 126  THR A OG1 1 
ATOM   1000 C CG2 . THR A 1 126 ? -7.299  75.482 55.384 1.00 41.00  ? 126  THR A CG2 1 
ATOM   1001 N N   . LEU A 1 127 ? -3.116  75.881 57.723 1.00 43.69  ? 127  LEU A N   1 
ATOM   1002 C CA  . LEU A 1 127 ? -2.264  76.487 58.738 1.00 43.05  ? 127  LEU A CA  1 
ATOM   1003 C C   . LEU A 1 127 ? -1.564  77.751 58.223 1.00 44.85  ? 127  LEU A C   1 
ATOM   1004 O O   . LEU A 1 127 ? -1.296  77.889 57.030 1.00 46.86  ? 127  LEU A O   1 
ATOM   1005 C CB  . LEU A 1 127 ? -1.216  75.482 59.213 1.00 41.62  ? 127  LEU A CB  1 
ATOM   1006 C CG  . LEU A 1 127 ? -1.702  74.159 59.803 1.00 39.73  ? 127  LEU A CG  1 
ATOM   1007 C CD1 . LEU A 1 127 ? -0.497  73.330 60.236 1.00 38.18  ? 127  LEU A CD1 1 
ATOM   1008 C CD2 . LEU A 1 127 ? -2.617  74.421 60.978 1.00 37.30  ? 127  LEU A CD2 1 
ATOM   1009 N N   . ASP A 1 128 ? -1.268  78.673 59.133 1.00 45.62  ? 128  ASP A N   1 
ATOM   1010 C CA  . ASP A 1 128 ? -0.588  79.916 58.777 1.00 45.36  ? 128  ASP A CA  1 
ATOM   1011 C C   . ASP A 1 128 ? 0.777   79.638 58.147 1.00 45.42  ? 128  ASP A C   1 
ATOM   1012 O O   . ASP A 1 128 ? 1.159   80.254 57.149 1.00 46.12  ? 128  ASP A O   1 
ATOM   1013 C CB  . ASP A 1 128 ? -0.381  80.784 60.022 1.00 46.06  ? 128  ASP A CB  1 
ATOM   1014 C CG  . ASP A 1 128 ? -1.677  81.339 60.574 1.00 49.32  ? 128  ASP A CG  1 
ATOM   1015 O OD1 . ASP A 1 128 ? -1.640  81.943 61.666 1.00 52.58  ? 128  ASP A OD1 1 
ATOM   1016 O OD2 . ASP A 1 128 ? -2.730  81.183 59.918 1.00 49.43  ? 128  ASP A OD2 1 
ATOM   1017 N N   . VAL A 1 129 ? 1.512   78.707 58.743 1.00 44.08  ? 129  VAL A N   1 
ATOM   1018 C CA  . VAL A 1 129 ? 2.841   78.380 58.264 1.00 41.55  ? 129  VAL A CA  1 
ATOM   1019 C C   . VAL A 1 129 ? 2.833   77.706 56.883 1.00 42.92  ? 129  VAL A C   1 
ATOM   1020 O O   . VAL A 1 129 ? 3.897   77.486 56.297 1.00 41.48  ? 129  VAL A O   1 
ATOM   1021 C CB  . VAL A 1 129 ? 3.568   77.505 59.305 1.00 39.99  ? 129  VAL A CB  1 
ATOM   1022 C CG1 . VAL A 1 129 ? 2.892   76.154 59.414 1.00 39.82  ? 129  VAL A CG1 1 
ATOM   1023 C CG2 . VAL A 1 129 ? 5.022   77.370 58.957 1.00 36.62  ? 129  VAL A CG2 1 
ATOM   1024 N N   . TYR A 1 130 ? 1.642   77.390 56.359 1.00 42.71  ? 130  TYR A N   1 
ATOM   1025 C CA  . TYR A 1 130 ? 1.528   76.765 55.033 1.00 42.25  ? 130  TYR A CA  1 
ATOM   1026 C C   . TYR A 1 130 ? 0.983   77.723 53.973 1.00 43.08  ? 130  TYR A C   1 
ATOM   1027 O O   . TYR A 1 130 ? 0.739   77.316 52.835 1.00 41.00  ? 130  TYR A O   1 
ATOM   1028 C CB  . TYR A 1 130 ? 0.610   75.534 55.053 1.00 41.10  ? 130  TYR A CB  1 
ATOM   1029 C CG  . TYR A 1 130 ? 1.069   74.373 55.894 1.00 38.81  ? 130  TYR A CG  1 
ATOM   1030 C CD1 . TYR A 1 130 ? 2.413   74.195 56.220 1.00 37.99  ? 130  TYR A CD1 1 
ATOM   1031 C CD2 . TYR A 1 130 ? 0.151   73.435 56.357 1.00 39.36  ? 130  TYR A CD2 1 
ATOM   1032 C CE1 . TYR A 1 130 ? 2.827   73.117 56.989 1.00 36.96  ? 130  TYR A CE1 1 
ATOM   1033 C CE2 . TYR A 1 130 ? 0.557   72.348 57.124 1.00 39.89  ? 130  TYR A CE2 1 
ATOM   1034 C CZ  . TYR A 1 130 ? 1.893   72.198 57.437 1.00 38.03  ? 130  TYR A CZ  1 
ATOM   1035 O OH  . TYR A 1 130 ? 2.279   71.129 58.208 1.00 37.39  ? 130  TYR A OH  1 
ATOM   1036 N N   . ASN A 1 131 ? 0.768   78.982 54.346 1.00 45.45  ? 131  ASN A N   1 
ATOM   1037 C CA  . ASN A 1 131 ? 0.256   79.973 53.406 1.00 45.75  ? 131  ASN A CA  1 
ATOM   1038 C C   . ASN A 1 131 ? 1.241   80.107 52.245 1.00 45.69  ? 131  ASN A C   1 
ATOM   1039 O O   . ASN A 1 131 ? 2.362   80.590 52.426 1.00 44.80  ? 131  ASN A O   1 
ATOM   1040 C CB  . ASN A 1 131 ? 0.098   81.325 54.095 1.00 47.91  ? 131  ASN A CB  1 
ATOM   1041 C CG  . ASN A 1 131 ? -0.629  82.334 53.230 1.00 50.69  ? 131  ASN A CG  1 
ATOM   1042 O OD1 . ASN A 1 131 ? -0.381  82.425 52.030 1.00 51.86  ? 131  ASN A OD1 1 
ATOM   1043 N ND2 . ASN A 1 131 ? -1.528  83.105 53.837 1.00 52.86  ? 131  ASN A ND2 1 
ATOM   1044 N N   . GLY A 1 132 ? 0.818   79.692 51.055 1.00 45.05  ? 132  GLY A N   1 
ATOM   1045 C CA  . GLY A 1 132 ? 1.707   79.752 49.908 1.00 46.82  ? 132  GLY A CA  1 
ATOM   1046 C C   . GLY A 1 132 ? 1.756   81.037 49.099 1.00 47.37  ? 132  GLY A C   1 
ATOM   1047 O O   . GLY A 1 132 ? 2.281   81.036 47.987 1.00 47.26  ? 132  GLY A O   1 
ATOM   1048 N N   . LYS A 1 133 ? 1.244   82.139 49.638 1.00 48.16  ? 133  LYS A N   1 
ATOM   1049 C CA  . LYS A 1 133 ? 1.253   83.385 48.882 1.00 48.65  ? 133  LYS A CA  1 
ATOM   1050 C C   . LYS A 1 133 ? 2.651   83.968 48.718 1.00 49.04  ? 133  LYS A C   1 
ATOM   1051 O O   . LYS A 1 133 ? 2.947   84.589 47.697 1.00 49.22  ? 133  LYS A O   1 
ATOM   1052 C CB  . LYS A 1 133 ? 0.315   84.414 49.526 1.00 48.33  ? 133  LYS A CB  1 
ATOM   1053 C CG  . LYS A 1 133 ? 0.800   85.022 50.823 1.00 49.52  ? 133  LYS A CG  1 
ATOM   1054 C CD  . LYS A 1 133 ? -0.261  85.955 51.387 1.00 49.38  ? 133  LYS A CD  1 
ATOM   1055 C CE  . LYS A 1 133 ? 0.214   86.645 52.652 1.00 49.67  ? 133  LYS A CE  1 
ATOM   1056 N NZ  . LYS A 1 133 ? -0.881  87.415 53.299 1.00 50.25  ? 133  LYS A NZ  1 
ATOM   1057 N N   . TYR A 1 134 ? 3.513   83.752 49.707 1.00 48.67  ? 134  TYR A N   1 
ATOM   1058 C CA  . TYR A 1 134 ? 4.877   84.266 49.646 1.00 48.90  ? 134  TYR A CA  1 
ATOM   1059 C C   . TYR A 1 134 ? 5.707   83.510 48.622 1.00 48.74  ? 134  TYR A C   1 
ATOM   1060 O O   . TYR A 1 134 ? 6.478   84.105 47.868 1.00 50.30  ? 134  TYR A O   1 
ATOM   1061 C CB  . TYR A 1 134 ? 5.550   84.160 51.015 1.00 50.15  ? 134  TYR A CB  1 
ATOM   1062 C CG  . TYR A 1 134 ? 4.745   84.782 52.122 1.00 50.89  ? 134  TYR A CG  1 
ATOM   1063 C CD1 . TYR A 1 134 ? 4.538   86.161 52.168 1.00 53.29  ? 134  TYR A CD1 1 
ATOM   1064 C CD2 . TYR A 1 134 ? 4.145   83.990 53.093 1.00 50.16  ? 134  TYR A CD2 1 
ATOM   1065 C CE1 . TYR A 1 134 ? 3.745   86.738 53.154 1.00 52.79  ? 134  TYR A CE1 1 
ATOM   1066 C CE2 . TYR A 1 134 ? 3.352   84.550 54.081 1.00 53.71  ? 134  TYR A CE2 1 
ATOM   1067 C CZ  . TYR A 1 134 ? 3.156   85.925 54.106 1.00 54.45  ? 134  TYR A CZ  1 
ATOM   1068 O OH  . TYR A 1 134 ? 2.364   86.480 55.082 1.00 57.80  ? 134  TYR A OH  1 
ATOM   1069 N N   . LEU A 1 135 ? 5.552   82.193 48.598 1.00 48.72  ? 135  LEU A N   1 
ATOM   1070 C CA  . LEU A 1 135 ? 6.305   81.364 47.669 1.00 48.80  ? 135  LEU A CA  1 
ATOM   1071 C C   . LEU A 1 135 ? 5.784   81.552 46.249 1.00 48.70  ? 135  LEU A C   1 
ATOM   1072 O O   . LEU A 1 135 ? 6.560   81.610 45.296 1.00 51.65  ? 135  LEU A O   1 
ATOM   1073 C CB  . LEU A 1 135 ? 6.213   79.896 48.094 1.00 47.42  ? 135  LEU A CB  1 
ATOM   1074 C CG  . LEU A 1 135 ? 7.046   78.833 47.371 1.00 46.31  ? 135  LEU A CG  1 
ATOM   1075 C CD1 . LEU A 1 135 ? 8.509   79.235 47.305 1.00 44.84  ? 135  LEU A CD1 1 
ATOM   1076 C CD2 . LEU A 1 135 ? 6.887   77.514 48.117 1.00 44.34  ? 135  LEU A CD2 1 
ATOM   1077 N N   . ALA A 1 136 ? 4.469   81.660 46.108 1.00 48.14  ? 136  ALA A N   1 
ATOM   1078 C CA  . ALA A 1 136 ? 3.871   81.844 44.796 1.00 48.25  ? 136  ALA A CA  1 
ATOM   1079 C C   . ALA A 1 136 ? 4.289   83.198 44.231 1.00 49.80  ? 136  ALA A C   1 
ATOM   1080 O O   . ALA A 1 136 ? 4.668   83.314 43.064 1.00 48.86  ? 136  ALA A O   1 
ATOM   1081 C CB  . ALA A 1 136 ? 2.353   81.762 44.905 1.00 46.27  ? 136  ALA A CB  1 
ATOM   1082 N N   . TYR A 1 137 ? 4.223   84.219 45.077 1.00 50.95  ? 137  TYR A N   1 
ATOM   1083 C CA  . TYR A 1 137 ? 4.579   85.572 44.679 1.00 52.61  ? 137  TYR A CA  1 
ATOM   1084 C C   . TYR A 1 137 ? 6.071   85.744 44.399 1.00 51.99  ? 137  TYR A C   1 
ATOM   1085 O O   . TYR A 1 137 ? 6.467   86.230 43.339 1.00 51.34  ? 137  TYR A O   1 
ATOM   1086 C CB  . TYR A 1 137 ? 4.148   86.562 45.766 1.00 55.17  ? 137  TYR A CB  1 
ATOM   1087 C CG  . TYR A 1 137 ? 4.621   87.969 45.512 1.00 58.24  ? 137  TYR A CG  1 
ATOM   1088 C CD1 . TYR A 1 137 ? 4.091   88.728 44.467 1.00 60.33  ? 137  TYR A CD1 1 
ATOM   1089 C CD2 . TYR A 1 137 ? 5.638   88.528 46.283 1.00 60.16  ? 137  TYR A CD2 1 
ATOM   1090 C CE1 . TYR A 1 137 ? 4.567   90.011 44.194 1.00 61.55  ? 137  TYR A CE1 1 
ATOM   1091 C CE2 . TYR A 1 137 ? 6.124   89.808 46.020 1.00 62.32  ? 137  TYR A CE2 1 
ATOM   1092 C CZ  . TYR A 1 137 ? 5.584   90.543 44.975 1.00 62.35  ? 137  TYR A CZ  1 
ATOM   1093 O OH  . TYR A 1 137 ? 6.068   91.805 44.709 1.00 63.94  ? 137  TYR A OH  1 
ATOM   1094 N N   . THR A 1 138 ? 6.894   85.335 45.354 1.00 51.49  ? 138  THR A N   1 
ATOM   1095 C CA  . THR A 1 138 ? 8.337   85.471 45.233 1.00 51.37  ? 138  THR A CA  1 
ATOM   1096 C C   . THR A 1 138 ? 8.972   84.653 44.119 1.00 52.54  ? 138  THR A C   1 
ATOM   1097 O O   . THR A 1 138 ? 9.877   85.130 43.439 1.00 55.15  ? 138  THR A O   1 
ATOM   1098 C CB  . THR A 1 138 ? 9.033   85.095 46.557 1.00 49.71  ? 138  THR A CB  1 
ATOM   1099 O OG1 . THR A 1 138 ? 8.538   85.930 47.609 1.00 48.18  ? 138  THR A OG1 1 
ATOM   1100 C CG2 . THR A 1 138 ? 10.539  85.269 46.439 1.00 47.60  ? 138  THR A CG2 1 
ATOM   1101 N N   . GLU A 1 139 ? 8.500   83.428 43.921 1.00 53.25  ? 139  GLU A N   1 
ATOM   1102 C CA  . GLU A 1 139 ? 9.089   82.564 42.906 1.00 53.24  ? 139  GLU A CA  1 
ATOM   1103 C C   . GLU A 1 139 ? 8.284   82.408 41.626 1.00 53.37  ? 139  GLU A C   1 
ATOM   1104 O O   . GLU A 1 139 ? 8.698   81.699 40.709 1.00 52.31  ? 139  GLU A O   1 
ATOM   1105 C CB  . GLU A 1 139 ? 9.378   81.191 43.509 1.00 53.04  ? 139  GLU A CB  1 
ATOM   1106 C CG  . GLU A 1 139 ? 10.436  81.222 44.602 1.00 49.83  ? 139  GLU A CG  1 
ATOM   1107 C CD  . GLU A 1 139 ? 11.773  81.714 44.095 1.00 48.67  ? 139  GLU A CD  1 
ATOM   1108 O OE1 . GLU A 1 139 ? 12.248  81.187 43.070 1.00 50.42  ? 139  GLU A OE1 1 
ATOM   1109 O OE2 . GLU A 1 139 ? 12.355  82.620 44.721 1.00 49.85  ? 139  GLU A OE2 1 
ATOM   1110 N N   A GLU A 1 140 ? 7.136   83.072 41.559 0.50 53.40  ? 140  GLU A N   1 
ATOM   1111 N N   B GLU A 1 140 ? 7.132   83.068 41.580 0.50 53.43  ? 140  GLU A N   1 
ATOM   1112 C CA  A GLU A 1 140 ? 6.290   83.008 40.374 0.50 53.53  ? 140  GLU A CA  1 
ATOM   1113 C CA  B GLU A 1 140 ? 6.267   83.026 40.411 0.50 53.55  ? 140  GLU A CA  1 
ATOM   1114 C C   A GLU A 1 140 ? 5.937   81.572 40.008 0.50 52.30  ? 140  GLU A C   1 
ATOM   1115 C C   B GLU A 1 140 ? 5.924   81.594 40.014 0.50 52.34  ? 140  GLU A C   1 
ATOM   1116 O O   A GLU A 1 140 ? 6.213   81.117 38.898 0.50 52.97  ? 140  GLU A O   1 
ATOM   1117 O O   B GLU A 1 140 ? 6.191   81.163 38.890 0.50 53.03  ? 140  GLU A O   1 
ATOM   1118 C CB  A GLU A 1 140 ? 6.994   83.686 39.193 0.50 55.44  ? 140  GLU A CB  1 
ATOM   1119 C CB  B GLU A 1 140 ? 6.944   83.768 39.252 0.50 55.65  ? 140  GLU A CB  1 
ATOM   1120 C CG  A GLU A 1 140 ? 6.289   84.935 38.680 0.50 58.43  ? 140  GLU A CG  1 
ATOM   1121 C CG  B GLU A 1 140 ? 7.194   85.251 39.552 0.50 58.24  ? 140  GLU A CG  1 
ATOM   1122 C CD  A GLU A 1 140 ? 5.036   84.614 37.886 0.50 59.72  ? 140  GLU A CD  1 
ATOM   1123 C CD  B GLU A 1 140 ? 8.070   85.937 38.516 0.50 60.29  ? 140  GLU A CD  1 
ATOM   1124 O OE1 A GLU A 1 140 ? 4.283   85.552 37.551 0.50 60.00  ? 140  GLU A OE1 1 
ATOM   1125 O OE1 B GLU A 1 140 ? 7.707   85.927 37.319 0.50 60.98  ? 140  GLU A OE1 1 
ATOM   1126 O OE2 A GLU A 1 140 ? 4.809   83.423 37.588 0.50 61.08  ? 140  GLU A OE2 1 
ATOM   1127 O OE2 B GLU A 1 140 ? 9.122   86.494 38.901 0.50 60.70  ? 140  GLU A OE2 1 
ATOM   1128 N N   . VAL A 1 141 ? 5.332   80.861 40.952 1.00 50.33  ? 141  VAL A N   1 
ATOM   1129 C CA  . VAL A 1 141 ? 4.928   79.483 40.726 1.00 47.15  ? 141  VAL A CA  1 
ATOM   1130 C C   . VAL A 1 141 ? 3.486   79.376 41.184 1.00 46.39  ? 141  VAL A C   1 
ATOM   1131 O O   . VAL A 1 141 ? 3.022   80.193 41.979 1.00 45.31  ? 141  VAL A O   1 
ATOM   1132 C CB  . VAL A 1 141 ? 5.771   78.469 41.557 1.00 46.81  ? 141  VAL A CB  1 
ATOM   1133 C CG1 . VAL A 1 141 ? 7.240   78.511 41.143 1.00 44.64  ? 141  VAL A CG1 1 
ATOM   1134 C CG2 . VAL A 1 141 ? 5.627   78.769 43.033 1.00 45.17  ? 141  VAL A CG2 1 
ATOM   1135 N N   . VAL A 1 142 ? 2.769   78.387 40.666 1.00 45.98  ? 142  VAL A N   1 
ATOM   1136 C CA  . VAL A 1 142 ? 1.389   78.174 41.078 1.00 45.89  ? 142  VAL A CA  1 
ATOM   1137 C C   . VAL A 1 142 ? 1.490   77.207 42.254 1.00 45.70  ? 142  VAL A C   1 
ATOM   1138 O O   . VAL A 1 142 ? 1.850   76.043 42.078 1.00 45.62  ? 142  VAL A O   1 
ATOM   1139 C CB  . VAL A 1 142 ? 0.545   77.543 39.949 1.00 46.06  ? 142  VAL A CB  1 
ATOM   1140 C CG1 . VAL A 1 142 ? -0.840  77.181 40.467 1.00 46.38  ? 142  VAL A CG1 1 
ATOM   1141 C CG2 . VAL A 1 142 ? 0.423   78.523 38.789 1.00 47.32  ? 142  VAL A CG2 1 
ATOM   1142 N N   . LEU A 1 143 ? 1.197   77.704 43.452 1.00 44.23  ? 143  LEU A N   1 
ATOM   1143 C CA  . LEU A 1 143 ? 1.286   76.902 44.665 1.00 42.13  ? 143  LEU A CA  1 
ATOM   1144 C C   . LEU A 1 143 ? -0.048  76.269 45.025 1.00 41.40  ? 143  LEU A C   1 
ATOM   1145 O O   . LEU A 1 143 ? -1.053  76.960 45.195 1.00 42.28  ? 143  LEU A O   1 
ATOM   1146 C CB  . LEU A 1 143 ? 1.781   77.775 45.825 1.00 42.11  ? 143  LEU A CB  1 
ATOM   1147 C CG  . LEU A 1 143 ? 2.427   77.117 47.052 1.00 41.72  ? 143  LEU A CG  1 
ATOM   1148 C CD1 . LEU A 1 143 ? 1.414   76.270 47.797 1.00 43.26  ? 143  LEU A CD1 1 
ATOM   1149 C CD2 . LEU A 1 143 ? 3.607   76.275 46.612 1.00 41.64  ? 143  LEU A CD2 1 
ATOM   1150 N N   . VAL A 1 144 ? -0.049  74.947 45.148 1.00 39.75  ? 144  VAL A N   1 
ATOM   1151 C CA  . VAL A 1 144 ? -1.260  74.219 45.498 1.00 38.85  ? 144  VAL A CA  1 
ATOM   1152 C C   . VAL A 1 144 ? -1.038  73.407 46.767 1.00 38.67  ? 144  VAL A C   1 
ATOM   1153 O O   . VAL A 1 144 ? 0.019   72.797 46.948 1.00 39.61  ? 144  VAL A O   1 
ATOM   1154 C CB  . VAL A 1 144 ? -1.679  73.226 44.377 1.00 38.41  ? 144  VAL A CB  1 
ATOM   1155 C CG1 . VAL A 1 144 ? -2.901  72.444 44.808 1.00 36.06  ? 144  VAL A CG1 1 
ATOM   1156 C CG2 . VAL A 1 144 ? -1.969  73.972 43.087 1.00 38.05  ? 144  VAL A CG2 1 
ATOM   1157 N N   . SER A 1 145 ? -2.027  73.417 47.653 1.00 35.33  ? 145  SER A N   1 
ATOM   1158 C CA  . SER A 1 145 ? -1.946  72.628 48.868 1.00 34.62  ? 145  SER A CA  1 
ATOM   1159 C C   . SER A 1 145 ? -3.208  71.763 48.946 1.00 35.54  ? 145  SER A C   1 
ATOM   1160 O O   . SER A 1 145 ? -4.330  72.268 48.963 1.00 33.11  ? 145  SER A O   1 
ATOM   1161 C CB  . SER A 1 145 ? -1.812  73.519 50.112 1.00 34.25  ? 145  SER A CB  1 
ATOM   1162 O OG  . SER A 1 145 ? -2.964  74.299 50.346 1.00 37.99  ? 145  SER A OG  1 
ATOM   1163 N N   . LEU A 1 146 ? -3.018  70.450 48.962 1.00 34.85  ? 146  LEU A N   1 
ATOM   1164 C CA  . LEU A 1 146 ? -4.145  69.536 49.029 1.00 35.39  ? 146  LEU A CA  1 
ATOM   1165 C C   . LEU A 1 146 ? -4.466  69.150 50.470 1.00 35.78  ? 146  LEU A C   1 
ATOM   1166 O O   . LEU A 1 146 ? -3.862  69.650 51.414 1.00 36.24  ? 146  LEU A O   1 
ATOM   1167 C CB  . LEU A 1 146 ? -3.846  68.285 48.198 1.00 34.27  ? 146  LEU A CB  1 
ATOM   1168 C CG  . LEU A 1 146 ? -2.524  67.545 48.437 1.00 34.25  ? 146  LEU A CG  1 
ATOM   1169 C CD1 . LEU A 1 146 ? -2.561  66.732 49.734 1.00 29.76  ? 146  LEU A CD1 1 
ATOM   1170 C CD2 . LEU A 1 146 ? -2.283  66.629 47.255 1.00 30.68  ? 146  LEU A CD2 1 
ATOM   1171 N N   . SER A 1 147 ? -5.444  68.274 50.632 1.00 34.55  ? 147  SER A N   1 
ATOM   1172 C CA  . SER A 1 147 ? -5.811  67.799 51.951 1.00 34.79  ? 147  SER A CA  1 
ATOM   1173 C C   . SER A 1 147 ? -6.162  66.326 51.796 1.00 33.59  ? 147  SER A C   1 
ATOM   1174 O O   . SER A 1 147 ? -6.421  65.857 50.688 1.00 31.52  ? 147  SER A O   1 
ATOM   1175 C CB  . SER A 1 147 ? -6.999  68.584 52.498 1.00 33.39  ? 147  SER A CB  1 
ATOM   1176 O OG  . SER A 1 147 ? -8.135  68.405 51.678 1.00 38.54  ? 147  SER A OG  1 
ATOM   1177 N N   . TYR A 1 148 ? -6.135  65.591 52.898 1.00 33.84  ? 148  TYR A N   1 
ATOM   1178 C CA  . TYR A 1 148 ? -6.456  64.176 52.865 1.00 33.53  ? 148  TYR A CA  1 
ATOM   1179 C C   . TYR A 1 148 ? -6.880  63.709 54.246 1.00 34.69  ? 148  TYR A C   1 
ATOM   1180 O O   . TYR A 1 148 ? -6.452  64.262 55.258 1.00 33.01  ? 148  TYR A O   1 
ATOM   1181 C CB  . TYR A 1 148 ? -5.250  63.355 52.389 1.00 32.57  ? 148  TYR A CB  1 
ATOM   1182 C CG  . TYR A 1 148 ? -4.009  63.486 53.247 1.00 33.29  ? 148  TYR A CG  1 
ATOM   1183 C CD1 . TYR A 1 148 ? -3.135  64.554 53.086 1.00 33.03  ? 148  TYR A CD1 1 
ATOM   1184 C CD2 . TYR A 1 148 ? -3.713  62.539 54.225 1.00 33.42  ? 148  TYR A CD2 1 
ATOM   1185 C CE1 . TYR A 1 148 ? -1.995  64.676 53.876 1.00 32.95  ? 148  TYR A CE1 1 
ATOM   1186 C CE2 . TYR A 1 148 ? -2.584  62.652 55.017 1.00 33.15  ? 148  TYR A CE2 1 
ATOM   1187 C CZ  . TYR A 1 148 ? -1.727  63.720 54.840 1.00 34.15  ? 148  TYR A CZ  1 
ATOM   1188 O OH  . TYR A 1 148 ? -0.600  63.819 55.633 1.00 34.37  ? 148  TYR A OH  1 
ATOM   1189 N N   . ARG A 1 149 ? -7.732  62.692 54.277 1.00 36.65  ? 149  ARG A N   1 
ATOM   1190 C CA  . ARG A 1 149 ? -8.215  62.133 55.530 1.00 37.62  ? 149  ARG A CA  1 
ATOM   1191 C C   . ARG A 1 149 ? -7.071  61.529 56.342 1.00 37.61  ? 149  ARG A C   1 
ATOM   1192 O O   . ARG A 1 149 ? -6.199  60.830 55.807 1.00 36.09  ? 149  ARG A O   1 
ATOM   1193 C CB  . ARG A 1 149 ? -9.275  61.061 55.255 1.00 37.26  ? 149  ARG A CB  1 
ATOM   1194 C CG  . ARG A 1 149 ? -10.631 61.622 54.861 1.00 37.93  ? 149  ARG A CG  1 
ATOM   1195 C CD  . ARG A 1 149 ? -11.550 60.533 54.352 1.00 38.21  ? 149  ARG A CD  1 
ATOM   1196 N NE  . ARG A 1 149 ? -11.143 60.076 53.029 1.00 38.00  ? 149  ARG A NE  1 
ATOM   1197 C CZ  . ARG A 1 149 ? -11.733 59.087 52.368 1.00 38.08  ? 149  ARG A CZ  1 
ATOM   1198 N NH1 . ARG A 1 149 ? -12.759 58.445 52.915 1.00 37.40  ? 149  ARG A NH1 1 
ATOM   1199 N NH2 . ARG A 1 149 ? -11.302 58.746 51.158 1.00 36.72  ? 149  ARG A NH2 1 
ATOM   1200 N N   . VAL A 1 150 ? -7.081  61.816 57.638 1.00 35.50  ? 150  VAL A N   1 
ATOM   1201 C CA  . VAL A 1 150 ? -6.069  61.306 58.543 1.00 35.24  ? 150  VAL A CA  1 
ATOM   1202 C C   . VAL A 1 150 ? -6.763  60.448 59.596 1.00 37.51  ? 150  VAL A C   1 
ATOM   1203 O O   . VAL A 1 150 ? -7.995  60.323 59.591 1.00 36.52  ? 150  VAL A O   1 
ATOM   1204 C CB  . VAL A 1 150 ? -5.299  62.468 59.221 1.00 36.12  ? 150  VAL A CB  1 
ATOM   1205 C CG1 . VAL A 1 150 ? -4.494  63.221 58.176 1.00 34.27  ? 150  VAL A CG1 1 
ATOM   1206 C CG2 . VAL A 1 150 ? -6.271  63.425 59.910 1.00 31.59  ? 150  VAL A CG2 1 
ATOM   1207 N N   . GLY A 1 151 ? -5.981  59.851 60.490 1.00 38.25  ? 151  GLY A N   1 
ATOM   1208 C CA  . GLY A 1 151 ? -6.568  59.019 61.525 1.00 37.51  ? 151  GLY A CA  1 
ATOM   1209 C C   . GLY A 1 151 ? -7.270  57.816 60.928 1.00 39.59  ? 151  GLY A C   1 
ATOM   1210 O O   . GLY A 1 151 ? -6.997  57.435 59.786 1.00 39.78  ? 151  GLY A O   1 
ATOM   1211 N N   . ALA A 1 152 ? -8.175  57.216 61.698 1.00 39.77  ? 152  ALA A N   1 
ATOM   1212 C CA  . ALA A 1 152 ? -8.917  56.050 61.238 1.00 37.70  ? 152  ALA A CA  1 
ATOM   1213 C C   . ALA A 1 152 ? -9.658  56.384 59.953 1.00 38.05  ? 152  ALA A C   1 
ATOM   1214 O O   . ALA A 1 152 ? -9.724  55.570 59.035 1.00 38.08  ? 152  ALA A O   1 
ATOM   1215 C CB  . ALA A 1 152 ? -9.898  55.611 62.303 1.00 39.36  ? 152  ALA A CB  1 
ATOM   1216 N N   . PHE A 1 153 ? -10.206 57.595 59.907 1.00 38.00  ? 153  PHE A N   1 
ATOM   1217 C CA  . PHE A 1 153 ? -10.954 58.099 58.762 1.00 37.52  ? 153  PHE A CA  1 
ATOM   1218 C C   . PHE A 1 153 ? -10.226 57.900 57.437 1.00 37.33  ? 153  PHE A C   1 
ATOM   1219 O O   . PHE A 1 153 ? -10.854 57.620 56.417 1.00 38.19  ? 153  PHE A O   1 
ATOM   1220 C CB  . PHE A 1 153 ? -11.233 59.590 58.949 1.00 37.80  ? 153  PHE A CB  1 
ATOM   1221 C CG  . PHE A 1 153 ? -11.899 59.919 60.246 1.00 40.71  ? 153  PHE A CG  1 
ATOM   1222 C CD1 . PHE A 1 153 ? -13.269 59.728 60.408 1.00 41.59  ? 153  PHE A CD1 1 
ATOM   1223 C CD2 . PHE A 1 153 ? -11.156 60.409 61.316 1.00 41.60  ? 153  PHE A CD2 1 
ATOM   1224 C CE1 . PHE A 1 153 ? -13.893 60.025 61.621 1.00 42.91  ? 153  PHE A CE1 1 
ATOM   1225 C CE2 . PHE A 1 153 ? -11.769 60.710 62.536 1.00 42.92  ? 153  PHE A CE2 1 
ATOM   1226 C CZ  . PHE A 1 153 ? -13.141 60.518 62.687 1.00 42.57  ? 153  PHE A CZ  1 
ATOM   1227 N N   . GLY A 1 154 ? -8.905  58.050 57.447 1.00 36.05  ? 154  GLY A N   1 
ATOM   1228 C CA  . GLY A 1 154 ? -8.161  57.891 56.214 1.00 34.16  ? 154  GLY A CA  1 
ATOM   1229 C C   . GLY A 1 154 ? -7.292  56.654 56.107 1.00 34.65  ? 154  GLY A C   1 
ATOM   1230 O O   . GLY A 1 154 ? -6.812  56.329 55.017 1.00 31.95  ? 154  GLY A O   1 
ATOM   1231 N N   . PHE A 1 155 ? -7.110  55.936 57.213 1.00 34.79  ? 155  PHE A N   1 
ATOM   1232 C CA  . PHE A 1 155 ? -6.238  54.774 57.182 1.00 35.00  ? 155  PHE A CA  1 
ATOM   1233 C C   . PHE A 1 155 ? -6.670  53.501 57.882 1.00 37.25  ? 155  PHE A C   1 
ATOM   1234 O O   . PHE A 1 155 ? -5.875  52.563 57.983 1.00 37.66  ? 155  PHE A O   1 
ATOM   1235 C CB  . PHE A 1 155 ? -4.848  55.192 57.670 1.00 33.68  ? 155  PHE A CB  1 
ATOM   1236 C CG  . PHE A 1 155 ? -4.201  56.210 56.780 1.00 33.12  ? 155  PHE A CG  1 
ATOM   1237 C CD1 . PHE A 1 155 ? -3.629  55.828 55.573 1.00 33.34  ? 155  PHE A CD1 1 
ATOM   1238 C CD2 . PHE A 1 155 ? -4.258  57.560 57.094 1.00 33.22  ? 155  PHE A CD2 1 
ATOM   1239 C CE1 . PHE A 1 155 ? -3.131  56.777 54.691 1.00 35.87  ? 155  PHE A CE1 1 
ATOM   1240 C CE2 . PHE A 1 155 ? -3.763  58.520 56.217 1.00 33.68  ? 155  PHE A CE2 1 
ATOM   1241 C CZ  . PHE A 1 155 ? -3.199  58.131 55.014 1.00 34.23  ? 155  PHE A CZ  1 
ATOM   1242 N N   . LEU A 1 156 ? -7.908  53.452 58.368 1.00 38.34  ? 156  LEU A N   1 
ATOM   1243 C CA  . LEU A 1 156 ? -8.392  52.230 59.003 1.00 40.24  ? 156  LEU A CA  1 
ATOM   1244 C C   . LEU A 1 156 ? -8.211  51.173 57.916 1.00 40.90  ? 156  LEU A C   1 
ATOM   1245 O O   . LEU A 1 156 ? -8.622  51.390 56.775 1.00 39.84  ? 156  LEU A O   1 
ATOM   1246 C CB  . LEU A 1 156 ? -9.871  52.346 59.353 1.00 42.33  ? 156  LEU A CB  1 
ATOM   1247 C CG  . LEU A 1 156 ? -10.381 51.093 60.061 1.00 43.21  ? 156  LEU A CG  1 
ATOM   1248 C CD1 . LEU A 1 156 ? -10.043 51.208 61.536 1.00 40.67  ? 156  LEU A CD1 1 
ATOM   1249 C CD2 . LEU A 1 156 ? -11.881 50.941 59.857 1.00 41.34  ? 156  LEU A CD2 1 
ATOM   1250 N N   . ALA A 1 157 ? -7.604  50.037 58.246 1.00 41.68  ? 157  ALA A N   1 
ATOM   1251 C CA  . ALA A 1 157 ? -7.367  49.027 57.223 1.00 42.44  ? 157  ALA A CA  1 
ATOM   1252 C C   . ALA A 1 157 ? -7.805  47.606 57.533 1.00 45.42  ? 157  ALA A C   1 
ATOM   1253 O O   . ALA A 1 157 ? -7.271  46.958 58.436 1.00 45.78  ? 157  ALA A O   1 
ATOM   1254 C CB  . ALA A 1 157 ? -5.894  49.027 56.844 1.00 40.35  ? 157  ALA A CB  1 
ATOM   1255 N N   . LEU A 1 158 ? -8.778  47.127 56.764 1.00 47.22  ? 158  LEU A N   1 
ATOM   1256 C CA  . LEU A 1 158 ? -9.280  45.762 56.893 1.00 48.10  ? 158  LEU A CA  1 
ATOM   1257 C C   . LEU A 1 158 ? -9.113  45.141 55.511 1.00 48.10  ? 158  LEU A C   1 
ATOM   1258 O O   . LEU A 1 158 ? -10.083 44.911 54.793 1.00 48.64  ? 158  LEU A O   1 
ATOM   1259 C CB  . LEU A 1 158 ? -10.755 45.760 57.312 1.00 48.24  ? 158  LEU A CB  1 
ATOM   1260 C CG  . LEU A 1 158 ? -11.018 46.153 58.770 1.00 49.30  ? 158  LEU A CG  1 
ATOM   1261 C CD1 . LEU A 1 158 ? -12.509 46.323 59.012 1.00 47.09  ? 158  LEU A CD1 1 
ATOM   1262 C CD2 . LEU A 1 158 ? -10.430 45.088 59.694 1.00 47.54  ? 158  LEU A CD2 1 
ATOM   1263 N N   . HIS A 1 159 ? -7.862  44.896 55.142 1.00 49.40  ? 159  HIS A N   1 
ATOM   1264 C CA  . HIS A 1 159 ? -7.528  44.324 53.848 1.00 51.97  ? 159  HIS A CA  1 
ATOM   1265 C C   . HIS A 1 159 ? -8.427  43.160 53.491 1.00 54.50  ? 159  HIS A C   1 
ATOM   1266 O O   . HIS A 1 159 ? -8.607  42.234 54.286 1.00 55.34  ? 159  HIS A O   1 
ATOM   1267 C CB  . HIS A 1 159 ? -6.081  43.855 53.839 1.00 52.39  ? 159  HIS A CB  1 
ATOM   1268 C CG  . HIS A 1 159 ? -5.633  43.331 52.514 1.00 54.12  ? 159  HIS A CG  1 
ATOM   1269 N ND1 . HIS A 1 159 ? -5.563  44.121 51.386 1.00 54.54  ? 159  HIS A ND1 1 
ATOM   1270 C CD2 . HIS A 1 159 ? -5.227  42.096 52.135 1.00 54.58  ? 159  HIS A CD2 1 
ATOM   1271 C CE1 . HIS A 1 159 ? -5.131  43.397 50.369 1.00 56.05  ? 159  HIS A CE1 1 
ATOM   1272 N NE2 . HIS A 1 159 ? -4.919  42.164 50.797 1.00 56.83  ? 159  HIS A NE2 1 
ATOM   1273 N N   . GLY A 1 160 ? -8.967  43.201 52.277 1.00 56.22  ? 160  GLY A N   1 
ATOM   1274 C CA  . GLY A 1 160 ? -9.866  42.155 51.823 1.00 56.78  ? 160  GLY A CA  1 
ATOM   1275 C C   . GLY A 1 160 ? -11.235 42.779 51.640 1.00 57.14  ? 160  GLY A C   1 
ATOM   1276 O O   . GLY A 1 160 ? -11.972 42.447 50.713 1.00 57.88  ? 160  GLY A O   1 
ATOM   1277 N N   . SER A 1 161 ? -11.565 43.699 52.540 1.00 57.14  ? 161  SER A N   1 
ATOM   1278 C CA  . SER A 1 161 ? -12.830 44.411 52.500 1.00 56.81  ? 161  SER A CA  1 
ATOM   1279 C C   . SER A 1 161 ? -12.715 45.533 51.491 1.00 57.39  ? 161  SER A C   1 
ATOM   1280 O O   . SER A 1 161 ? -11.617 46.006 51.200 1.00 57.51  ? 161  SER A O   1 
ATOM   1281 C CB  . SER A 1 161 ? -13.138 45.011 53.867 1.00 58.03  ? 161  SER A CB  1 
ATOM   1282 O OG  . SER A 1 161 ? -14.039 46.100 53.746 1.00 60.32  ? 161  SER A OG  1 
ATOM   1283 N N   . GLN A 1 162 ? -13.846 45.961 50.952 1.00 57.18  ? 162  GLN A N   1 
ATOM   1284 C CA  . GLN A 1 162 ? -13.832 47.050 49.995 1.00 57.87  ? 162  GLN A CA  1 
ATOM   1285 C C   . GLN A 1 162 ? -14.476 48.279 50.609 1.00 56.93  ? 162  GLN A C   1 
ATOM   1286 O O   . GLN A 1 162 ? -14.498 49.344 50.001 1.00 56.22  ? 162  GLN A O   1 
ATOM   1287 C CB  . GLN A 1 162 ? -14.563 46.654 48.713 1.00 59.78  ? 162  GLN A CB  1 
ATOM   1288 C CG  . GLN A 1 162 ? -13.776 45.721 47.801 1.00 63.66  ? 162  GLN A CG  1 
ATOM   1289 C CD  . GLN A 1 162 ? -12.434 46.305 47.374 1.00 66.94  ? 162  GLN A CD  1 
ATOM   1290 O OE1 . GLN A 1 162 ? -12.339 47.483 47.007 1.00 67.18  ? 162  GLN A OE1 1 
ATOM   1291 N NE2 . GLN A 1 162 ? -11.391 45.477 47.409 1.00 65.76  ? 162  GLN A NE2 1 
ATOM   1292 N N   . GLU A 1 163 ? -15.001 48.127 51.820 1.00 56.82  ? 163  GLU A N   1 
ATOM   1293 C CA  . GLU A 1 163 ? -15.634 49.243 52.515 1.00 57.81  ? 163  GLU A CA  1 
ATOM   1294 C C   . GLU A 1 163 ? -14.605 49.986 53.359 1.00 56.11  ? 163  GLU A C   1 
ATOM   1295 O O   . GLU A 1 163 ? -14.821 51.137 53.732 1.00 56.88  ? 163  GLU A O   1 
ATOM   1296 C CB  . GLU A 1 163 ? -16.770 48.752 53.416 1.00 60.47  ? 163  GLU A CB  1 
ATOM   1297 C CG  . GLU A 1 163 ? -17.957 48.165 52.674 1.00 62.52  ? 163  GLU A CG  1 
ATOM   1298 C CD  . GLU A 1 163 ? -18.539 49.120 51.648 1.00 64.93  ? 163  GLU A CD  1 
ATOM   1299 O OE1 . GLU A 1 163 ? -18.722 50.313 51.977 1.00 65.79  ? 163  GLU A OE1 1 
ATOM   1300 O OE2 . GLU A 1 163 ? -18.828 48.675 50.515 1.00 66.88  ? 163  GLU A OE2 1 
ATOM   1301 N N   . ALA A 1 164 ? -13.497 49.313 53.666 1.00 53.70  ? 164  ALA A N   1 
ATOM   1302 C CA  . ALA A 1 164 ? -12.403 49.888 54.455 1.00 50.64  ? 164  ALA A CA  1 
ATOM   1303 C C   . ALA A 1 164 ? -11.104 49.166 54.094 1.00 49.03  ? 164  ALA A C   1 
ATOM   1304 O O   . ALA A 1 164 ? -10.508 48.481 54.927 1.00 49.38  ? 164  ALA A O   1 
ATOM   1305 C CB  . ALA A 1 164 ? -12.687 49.741 55.950 1.00 48.58  ? 164  ALA A CB  1 
ATOM   1306 N N   . PRO A 1 165 ? -10.650 49.319 52.837 1.00 46.70  ? 165  PRO A N   1 
ATOM   1307 C CA  . PRO A 1 165 ? -9.430  48.703 52.311 1.00 44.48  ? 165  PRO A CA  1 
ATOM   1308 C C   . PRO A 1 165 ? -8.132  49.282 52.859 1.00 44.06  ? 165  PRO A C   1 
ATOM   1309 O O   . PRO A 1 165 ? -7.082  48.639 52.789 1.00 46.00  ? 165  PRO A O   1 
ATOM   1310 C CB  . PRO A 1 165 ? -9.556  48.944 50.813 1.00 44.35  ? 165  PRO A CB  1 
ATOM   1311 C CG  . PRO A 1 165 ? -10.189 50.290 50.769 1.00 43.41  ? 165  PRO A CG  1 
ATOM   1312 C CD  . PRO A 1 165 ? -11.285 50.163 51.806 1.00 44.51  ? 165  PRO A CD  1 
ATOM   1313 N N   . GLY A 1 166 ? -8.202  50.493 53.400 1.00 41.70  ? 166  GLY A N   1 
ATOM   1314 C CA  . GLY A 1 166 ? -7.004  51.128 53.907 1.00 40.31  ? 166  GLY A CA  1 
ATOM   1315 C C   . GLY A 1 166 ? -6.400  52.003 52.817 1.00 41.01  ? 166  GLY A C   1 
ATOM   1316 O O   . GLY A 1 166 ? -6.797  51.916 51.652 1.00 40.62  ? 166  GLY A O   1 
ATOM   1317 N N   . ASN A 1 167 ? -5.453  52.858 53.197 1.00 40.51  ? 167  ASN A N   1 
ATOM   1318 C CA  . ASN A 1 167 ? -4.776  53.754 52.260 1.00 38.52  ? 167  ASN A CA  1 
ATOM   1319 C C   . ASN A 1 167 ? -5.689  54.764 51.567 1.00 37.20  ? 167  ASN A C   1 
ATOM   1320 O O   . ASN A 1 167 ? -5.252  55.459 50.651 1.00 36.89  ? 167  ASN A O   1 
ATOM   1321 C CB  . ASN A 1 167 ? -4.044  52.936 51.191 1.00 36.27  ? 167  ASN A CB  1 
ATOM   1322 C CG  . ASN A 1 167 ? -2.886  52.135 51.756 1.00 38.52  ? 167  ASN A CG  1 
ATOM   1323 O OD1 . ASN A 1 167 ? -2.351  51.240 51.097 1.00 42.02  ? 167  ASN A OD1 1 
ATOM   1324 N ND2 . ASN A 1 167 ? -2.488  52.455 52.975 1.00 36.26  ? 167  ASN A ND2 1 
ATOM   1325 N N   . VAL A 1 168 ? -6.946  54.860 51.988 1.00 36.12  ? 168  VAL A N   1 
ATOM   1326 C CA  . VAL A 1 168 ? -7.851  55.799 51.328 1.00 38.26  ? 168  VAL A CA  1 
ATOM   1327 C C   . VAL A 1 168 ? -7.350  57.241 51.449 1.00 38.24  ? 168  VAL A C   1 
ATOM   1328 O O   . VAL A 1 168 ? -7.617  58.077 50.582 1.00 38.80  ? 168  VAL A O   1 
ATOM   1329 C CB  . VAL A 1 168 ? -9.312  55.674 51.862 1.00 39.25  ? 168  VAL A CB  1 
ATOM   1330 C CG1 . VAL A 1 168 ? -9.826  54.257 51.616 1.00 38.36  ? 168  VAL A CG1 1 
ATOM   1331 C CG2 . VAL A 1 168 ? -9.383  56.021 53.336 1.00 41.88  ? 168  VAL A CG2 1 
ATOM   1332 N N   . GLY A 1 169 ? -6.607  57.525 52.514 1.00 37.66  ? 169  GLY A N   1 
ATOM   1333 C CA  . GLY A 1 169 ? -6.051  58.855 52.685 1.00 35.10  ? 169  GLY A CA  1 
ATOM   1334 C C   . GLY A 1 169 ? -5.019  59.130 51.600 1.00 34.93  ? 169  GLY A C   1 
ATOM   1335 O O   . GLY A 1 169 ? -4.861  60.269 51.151 1.00 34.01  ? 169  GLY A O   1 
ATOM   1336 N N   . LEU A 1 170 ? -4.306  58.086 51.179 1.00 33.28  ? 170  LEU A N   1 
ATOM   1337 C CA  . LEU A 1 170 ? -3.307  58.231 50.128 1.00 32.89  ? 170  LEU A CA  1 
ATOM   1338 C C   . LEU A 1 170 ? -4.037  58.456 48.819 1.00 34.04  ? 170  LEU A C   1 
ATOM   1339 O O   . LEU A 1 170 ? -3.586  59.224 47.965 1.00 34.71  ? 170  LEU A O   1 
ATOM   1340 C CB  . LEU A 1 170 ? -2.427  56.979 50.025 1.00 31.51  ? 170  LEU A CB  1 
ATOM   1341 C CG  . LEU A 1 170 ? -1.296  56.859 51.054 1.00 33.36  ? 170  LEU A CG  1 
ATOM   1342 C CD1 . LEU A 1 170 ? -0.627  55.487 50.969 1.00 33.16  ? 170  LEU A CD1 1 
ATOM   1343 C CD2 . LEU A 1 170 ? -0.281  57.970 50.804 1.00 30.88  ? 170  LEU A CD2 1 
ATOM   1344 N N   . LEU A 1 171 ? -5.173  57.786 48.660 1.00 34.76  ? 171  LEU A N   1 
ATOM   1345 C CA  . LEU A 1 171 ? -5.953  57.943 47.445 1.00 36.26  ? 171  LEU A CA  1 
ATOM   1346 C C   . LEU A 1 171 ? -6.550  59.353 47.365 1.00 37.04  ? 171  LEU A C   1 
ATOM   1347 O O   . LEU A 1 171 ? -6.747  59.878 46.273 1.00 37.63  ? 171  LEU A O   1 
ATOM   1348 C CB  . LEU A 1 171 ? -7.044  56.873 47.370 1.00 34.75  ? 171  LEU A CB  1 
ATOM   1349 C CG  . LEU A 1 171 ? -6.537  55.431 47.227 1.00 34.32  ? 171  LEU A CG  1 
ATOM   1350 C CD1 . LEU A 1 171 ? -7.734  54.497 47.166 1.00 36.34  ? 171  LEU A CD1 1 
ATOM   1351 C CD2 . LEU A 1 171 ? -5.675  55.277 45.976 1.00 29.20  ? 171  LEU A CD2 1 
ATOM   1352 N N   . ASP A 1 172 ? -6.830  59.969 48.512 1.00 37.09  ? 172  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 172 ? -7.362  61.333 48.511 1.00 38.09  ? 172  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 172 ? -6.300  62.243 47.902 1.00 37.82  ? 172  ASP A C   1 
ATOM   1355 O O   . ASP A 1 172 ? -6.592  63.125 47.097 1.00 38.95  ? 172  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 172 ? -7.670  61.824 49.932 1.00 37.20  ? 172  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 172 ? -8.812  61.072 50.585 1.00 38.74  ? 172  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 172 ? -9.588  60.404 49.867 1.00 37.18  ? 172  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 172 ? -8.941  61.162 51.825 1.00 40.12  ? 172  ASP A OD2 1 
ATOM   1360 N N   . GLN A 1 173 ? -5.058  62.020 48.305 1.00 37.46  ? 173  GLN A N   1 
ATOM   1361 C CA  . GLN A 1 173 ? -3.950  62.805 47.798 1.00 36.26  ? 173  GLN A CA  1 
ATOM   1362 C C   . GLN A 1 173 ? -3.864  62.629 46.290 1.00 37.11  ? 173  GLN A C   1 
ATOM   1363 O O   . GLN A 1 173 ? -3.738  63.606 45.542 1.00 36.39  ? 173  GLN A O   1 
ATOM   1364 C CB  . GLN A 1 173 ? -2.651  62.346 48.460 1.00 35.54  ? 173  GLN A CB  1 
ATOM   1365 C CG  . GLN A 1 173 ? -2.579  62.659 49.944 1.00 34.45  ? 173  GLN A CG  1 
ATOM   1366 C CD  . GLN A 1 173 ? -1.304  62.149 50.580 1.00 33.69  ? 173  GLN A CD  1 
ATOM   1367 O OE1 . GLN A 1 173 ? -0.342  61.831 49.886 1.00 35.74  ? 173  GLN A OE1 1 
ATOM   1368 N NE2 . GLN A 1 173 ? -1.282  62.089 51.908 1.00 31.23  ? 173  GLN A NE2 1 
ATOM   1369 N N   . ARG A 1 174 ? -3.946  61.378 45.845 1.00 38.05  ? 174  ARG A N   1 
ATOM   1370 C CA  . ARG A 1 174 ? -3.872  61.069 44.422 1.00 36.16  ? 174  ARG A CA  1 
ATOM   1371 C C   . ARG A 1 174 ? -4.998  61.737 43.642 1.00 36.48  ? 174  ARG A C   1 
ATOM   1372 O O   . ARG A 1 174 ? -4.773  62.260 42.547 1.00 34.98  ? 174  ARG A O   1 
ATOM   1373 C CB  . ARG A 1 174 ? -3.919  59.560 44.204 1.00 35.66  ? 174  ARG A CB  1 
ATOM   1374 C CG  . ARG A 1 174 ? -3.899  59.141 42.740 1.00 33.81  ? 174  ARG A CG  1 
ATOM   1375 C CD  . ARG A 1 174 ? -4.080  57.651 42.600 1.00 32.83  ? 174  ARG A CD  1 
ATOM   1376 N NE  . ARG A 1 174 ? -2.885  56.919 43.002 1.00 35.76  ? 174  ARG A NE  1 
ATOM   1377 C CZ  . ARG A 1 174 ? -2.829  55.597 43.150 1.00 38.98  ? 174  ARG A CZ  1 
ATOM   1378 N NH1 . ARG A 1 174 ? -3.907  54.850 42.936 1.00 36.58  ? 174  ARG A NH1 1 
ATOM   1379 N NH2 . ARG A 1 174 ? -1.689  55.019 43.495 1.00 37.92  ? 174  ARG A NH2 1 
ATOM   1380 N N   A MET A 1 175 ? -6.200  61.721 44.213 0.50 37.14  ? 175  MET A N   1 
ATOM   1381 N N   B MET A 1 175 ? -6.208  61.722 44.198 0.50 36.59  ? 175  MET A N   1 
ATOM   1382 C CA  A MET A 1 175 ? -7.366  62.328 43.577 0.50 38.56  ? 175  MET A CA  1 
ATOM   1383 C CA  B MET A 1 175 ? -7.346  62.337 43.518 0.50 37.57  ? 175  MET A CA  1 
ATOM   1384 C C   A MET A 1 175 ? -7.104  63.816 43.361 0.50 38.95  ? 175  MET A C   1 
ATOM   1385 C C   B MET A 1 175 ? -7.088  63.829 43.342 0.50 38.34  ? 175  MET A C   1 
ATOM   1386 O O   A MET A 1 175 ? -7.505  64.389 42.349 0.50 40.00  ? 175  MET A O   1 
ATOM   1387 O O   B MET A 1 175 ? -7.480  64.421 42.337 0.50 39.46  ? 175  MET A O   1 
ATOM   1388 C CB  A MET A 1 175 ? -8.602  62.147 44.462 0.50 38.05  ? 175  MET A CB  1 
ATOM   1389 C CB  B MET A 1 175 ? -8.643  62.112 44.304 0.50 35.86  ? 175  MET A CB  1 
ATOM   1390 C CG  A MET A 1 175 ? -9.905  62.640 43.845 0.50 39.50  ? 175  MET A CG  1 
ATOM   1391 C CG  B MET A 1 175 ? -9.894  62.595 43.565 0.50 35.46  ? 175  MET A CG  1 
ATOM   1392 S SD  A MET A 1 175 ? -10.585 61.521 42.595 0.50 39.90  ? 175  MET A SD  1 
ATOM   1393 S SD  B MET A 1 175 ? -11.459 61.959 44.233 0.50 33.05  ? 175  MET A SD  1 
ATOM   1394 C CE  A MET A 1 175 ? -11.526 60.409 43.619 0.50 36.30  ? 175  MET A CE  1 
ATOM   1395 C CE  B MET A 1 175 ? -11.515 60.354 43.460 0.50 29.68  ? 175  MET A CE  1 
ATOM   1396 N N   . ALA A 1 176 ? -6.422  64.433 44.320 1.00 39.33  ? 176  ALA A N   1 
ATOM   1397 C CA  . ALA A 1 176 ? -6.098  65.850 44.244 1.00 39.70  ? 176  ALA A CA  1 
ATOM   1398 C C   . ALA A 1 176 ? -5.064  66.051 43.143 1.00 39.15  ? 176  ALA A C   1 
ATOM   1399 O O   . ALA A 1 176 ? -5.191  66.961 42.326 1.00 39.72  ? 176  ALA A O   1 
ATOM   1400 C CB  . ALA A 1 176 ? -5.554  66.345 45.584 1.00 38.91  ? 176  ALA A CB  1 
ATOM   1401 N N   . LEU A 1 177 ? -4.041  65.197 43.125 1.00 38.37  ? 177  LEU A N   1 
ATOM   1402 C CA  . LEU A 1 177 ? -3.000  65.282 42.105 1.00 38.82  ? 177  LEU A CA  1 
ATOM   1403 C C   . LEU A 1 177 ? -3.627  65.105 40.730 1.00 39.98  ? 177  LEU A C   1 
ATOM   1404 O O   . LEU A 1 177 ? -3.200  65.731 39.759 1.00 39.78  ? 177  LEU A O   1 
ATOM   1405 C CB  . LEU A 1 177 ? -1.940  64.200 42.312 1.00 38.00  ? 177  LEU A CB  1 
ATOM   1406 C CG  . LEU A 1 177 ? -1.061  64.294 43.559 1.00 39.55  ? 177  LEU A CG  1 
ATOM   1407 C CD1 . LEU A 1 177 ? -0.078  63.123 43.588 1.00 38.55  ? 177  LEU A CD1 1 
ATOM   1408 C CD2 . LEU A 1 177 ? -0.303  65.611 43.549 1.00 39.42  ? 177  LEU A CD2 1 
ATOM   1409 N N   . GLN A 1 178 ? -4.641  64.246 40.654 1.00 40.58  ? 178  GLN A N   1 
ATOM   1410 C CA  . GLN A 1 178 ? -5.338  63.994 39.400 1.00 41.95  ? 178  GLN A CA  1 
ATOM   1411 C C   . GLN A 1 178 ? -6.054  65.274 38.971 1.00 42.33  ? 178  GLN A C   1 
ATOM   1412 O O   . GLN A 1 178 ? -5.989  65.660 37.803 1.00 43.29  ? 178  GLN A O   1 
ATOM   1413 C CB  . GLN A 1 178 ? -6.345  62.848 39.579 1.00 42.89  ? 178  GLN A CB  1 
ATOM   1414 C CG  . GLN A 1 178 ? -7.140  62.437 38.328 1.00 42.37  ? 178  GLN A CG  1 
ATOM   1415 C CD  . GLN A 1 178 ? -6.253  61.980 37.181 1.00 43.85  ? 178  GLN A CD  1 
ATOM   1416 O OE1 . GLN A 1 178 ? -5.900  62.768 36.308 1.00 47.17  ? 178  GLN A OE1 1 
ATOM   1417 N NE2 . GLN A 1 178 ? -5.881  60.707 37.187 1.00 43.04  ? 178  GLN A NE2 1 
ATOM   1418 N N   . TRP A 1 179 ? -6.716  65.936 39.920 1.00 40.76  ? 179  TRP A N   1 
ATOM   1419 C CA  . TRP A 1 179 ? -7.433  67.176 39.629 1.00 40.73  ? 179  TRP A CA  1 
ATOM   1420 C C   . TRP A 1 179 ? -6.467  68.251 39.126 1.00 40.91  ? 179  TRP A C   1 
ATOM   1421 O O   . TRP A 1 179 ? -6.759  68.958 38.162 1.00 41.18  ? 179  TRP A O   1 
ATOM   1422 C CB  . TRP A 1 179 ? -8.152  67.689 40.878 1.00 41.14  ? 179  TRP A CB  1 
ATOM   1423 C CG  . TRP A 1 179 ? -9.231  68.708 40.587 1.00 42.97  ? 179  TRP A CG  1 
ATOM   1424 C CD1 . TRP A 1 179 ? -10.556 68.458 40.322 1.00 43.69  ? 179  TRP A CD1 1 
ATOM   1425 C CD2 . TRP A 1 179 ? -9.077  70.135 40.528 1.00 42.88  ? 179  TRP A CD2 1 
ATOM   1426 N NE1 . TRP A 1 179 ? -11.231 69.642 40.108 1.00 41.82  ? 179  TRP A NE1 1 
ATOM   1427 C CE2 . TRP A 1 179 ? -10.348 70.682 40.227 1.00 42.39  ? 179  TRP A CE2 1 
ATOM   1428 C CE3 . TRP A 1 179 ? -7.991  71.002 40.700 1.00 42.51  ? 179  TRP A CE3 1 
ATOM   1429 C CZ2 . TRP A 1 179 ? -10.555 72.055 40.095 1.00 42.13  ? 179  TRP A CZ2 1 
ATOM   1430 C CZ3 . TRP A 1 179 ? -8.203  72.369 40.568 1.00 43.81  ? 179  TRP A CZ3 1 
ATOM   1431 C CH2 . TRP A 1 179 ? -9.473  72.880 40.269 1.00 42.61  ? 179  TRP A CH2 1 
ATOM   1432 N N   . VAL A 1 180 ? -5.320  68.378 39.784 1.00 40.29  ? 180  VAL A N   1 
ATOM   1433 C CA  . VAL A 1 180 ? -4.314  69.358 39.386 1.00 39.94  ? 180  VAL A CA  1 
ATOM   1434 C C   . VAL A 1 180 ? -3.829  69.049 37.970 1.00 40.96  ? 180  VAL A C   1 
ATOM   1435 O O   . VAL A 1 180 ? -3.626  69.950 37.151 1.00 41.55  ? 180  VAL A O   1 
ATOM   1436 C CB  . VAL A 1 180 ? -3.110  69.338 40.358 1.00 38.99  ? 180  VAL A CB  1 
ATOM   1437 C CG1 . VAL A 1 180 ? -2.016  70.261 39.859 1.00 37.82  ? 180  VAL A CG1 1 
ATOM   1438 C CG2 . VAL A 1 180 ? -3.565  69.760 41.752 1.00 37.41  ? 180  VAL A CG2 1 
ATOM   1439 N N   . HIS A 1 181 ? -3.658  67.764 37.685 1.00 42.05  ? 181  HIS A N   1 
ATOM   1440 C CA  . HIS A 1 181 ? -3.213  67.319 36.374 1.00 41.03  ? 181  HIS A CA  1 
ATOM   1441 C C   . HIS A 1 181 ? -4.209  67.719 35.294 1.00 42.17  ? 181  HIS A C   1 
ATOM   1442 O O   . HIS A 1 181 ? -3.825  68.152 34.201 1.00 42.32  ? 181  HIS A O   1 
ATOM   1443 C CB  . HIS A 1 181 ? -3.076  65.805 36.369 1.00 42.52  ? 181  HIS A CB  1 
ATOM   1444 C CG  . HIS A 1 181 ? -2.769  65.231 35.022 1.00 44.10  ? 181  HIS A CG  1 
ATOM   1445 N ND1 . HIS A 1 181 ? -1.499  65.224 34.486 1.00 43.97  ? 181  HIS A ND1 1 
ATOM   1446 C CD2 . HIS A 1 181 ? -3.572  64.654 34.097 1.00 42.82  ? 181  HIS A CD2 1 
ATOM   1447 C CE1 . HIS A 1 181 ? -1.532  64.667 33.290 1.00 43.32  ? 181  HIS A CE1 1 
ATOM   1448 N NE2 . HIS A 1 181 ? -2.778  64.313 33.029 1.00 44.34  ? 181  HIS A NE2 1 
ATOM   1449 N N   . ASP A 1 182 ? -5.492  67.566 35.606 1.00 40.75  ? 182  ASP A N   1 
ATOM   1450 C CA  . ASP A 1 182 ? -6.549  67.875 34.657 1.00 41.26  ? 182  ASP A CA  1 
ATOM   1451 C C   . ASP A 1 182 ? -6.974  69.339 34.569 1.00 43.34  ? 182  ASP A C   1 
ATOM   1452 O O   . ASP A 1 182 ? -7.417  69.790 33.511 1.00 45.03  ? 182  ASP A O   1 
ATOM   1453 C CB  . ASP A 1 182 ? -7.795  67.043 34.967 1.00 39.68  ? 182  ASP A CB  1 
ATOM   1454 C CG  . ASP A 1 182 ? -7.532  65.552 34.947 1.00 40.51  ? 182  ASP A CG  1 
ATOM   1455 O OD1 . ASP A 1 182 ? -6.658  65.091 34.174 1.00 38.67  ? 182  ASP A OD1 1 
ATOM   1456 O OD2 . ASP A 1 182 ? -8.223  64.835 35.700 1.00 40.94  ? 182  ASP A OD2 1 
ATOM   1457 N N   . ASN A 1 183 ? -6.834  70.088 35.660 1.00 43.72  ? 183  ASN A N   1 
ATOM   1458 C CA  . ASN A 1 183 ? -7.287  71.471 35.668 1.00 42.68  ? 183  ASN A CA  1 
ATOM   1459 C C   . ASN A 1 183 ? -6.282  72.585 35.922 1.00 43.62  ? 183  ASN A C   1 
ATOM   1460 O O   . ASN A 1 183 ? -6.569  73.738 35.611 1.00 45.26  ? 183  ASN A O   1 
ATOM   1461 C CB  . ASN A 1 183 ? -8.426  71.602 36.681 1.00 43.43  ? 183  ASN A CB  1 
ATOM   1462 C CG  . ASN A 1 183 ? -9.584  70.665 36.380 1.00 46.49  ? 183  ASN A CG  1 
ATOM   1463 O OD1 . ASN A 1 183 ? -10.355 70.886 35.443 1.00 48.73  ? 183  ASN A OD1 1 
ATOM   1464 N ND2 . ASN A 1 183 ? -9.705  69.605 37.167 1.00 45.75  ? 183  ASN A ND2 1 
ATOM   1465 N N   . ILE A 1 184 ? -5.108  72.273 36.461 1.00 44.13  ? 184  ILE A N   1 
ATOM   1466 C CA  . ILE A 1 184 ? -4.146  73.335 36.768 1.00 44.37  ? 184  ILE A CA  1 
ATOM   1467 C C   . ILE A 1 184 ? -3.847  74.286 35.606 1.00 46.17  ? 184  ILE A C   1 
ATOM   1468 O O   . ILE A 1 184 ? -3.548  75.467 35.824 1.00 47.04  ? 184  ILE A O   1 
ATOM   1469 C CB  . ILE A 1 184 ? -2.805  72.759 37.338 1.00 42.88  ? 184  ILE A CB  1 
ATOM   1470 C CG1 . ILE A 1 184 ? -2.138  73.805 38.229 1.00 42.01  ? 184  ILE A CG1 1 
ATOM   1471 C CG2 . ILE A 1 184 ? -1.846  72.391 36.230 1.00 41.31  ? 184  ILE A CG2 1 
ATOM   1472 C CD1 . ILE A 1 184 ? -2.979  74.187 39.425 1.00 42.38  ? 184  ILE A CD1 1 
ATOM   1473 N N   . GLN A 1 185 ? -3.942  73.783 34.377 1.00 46.86  ? 185  GLN A N   1 
ATOM   1474 C CA  . GLN A 1 185 ? -3.673  74.594 33.189 1.00 47.67  ? 185  GLN A CA  1 
ATOM   1475 C C   . GLN A 1 185 ? -4.560  75.837 33.139 1.00 47.86  ? 185  GLN A C   1 
ATOM   1476 O O   . GLN A 1 185 ? -4.123  76.905 32.711 1.00 48.24  ? 185  GLN A O   1 
ATOM   1477 C CB  . GLN A 1 185 ? -3.893  73.764 31.918 1.00 48.65  ? 185  GLN A CB  1 
ATOM   1478 C CG  . GLN A 1 185 ? -5.353  73.460 31.603 1.00 49.04  ? 185  GLN A CG  1 
ATOM   1479 C CD  . GLN A 1 185 ? -5.510  72.287 30.641 1.00 51.08  ? 185  GLN A CD  1 
ATOM   1480 O OE1 . GLN A 1 185 ? -5.125  71.162 30.956 1.00 52.86  ? 185  GLN A OE1 1 
ATOM   1481 N NE2 . GLN A 1 185 ? -6.080  72.546 29.468 1.00 49.42  ? 185  GLN A NE2 1 
ATOM   1482 N N   . PHE A 1 186 ? -5.803  75.701 33.585 1.00 45.77  ? 186  PHE A N   1 
ATOM   1483 C CA  . PHE A 1 186 ? -6.730  76.817 33.561 1.00 44.26  ? 186  PHE A CA  1 
ATOM   1484 C C   . PHE A 1 186 ? -6.363  77.927 34.539 1.00 45.60  ? 186  PHE A C   1 
ATOM   1485 O O   . PHE A 1 186 ? -6.935  79.016 34.486 1.00 46.80  ? 186  PHE A O   1 
ATOM   1486 C CB  . PHE A 1 186 ? -8.144  76.312 33.833 1.00 42.67  ? 186  PHE A CB  1 
ATOM   1487 C CG  . PHE A 1 186 ? -8.579  75.238 32.885 1.00 39.54  ? 186  PHE A CG  1 
ATOM   1488 C CD1 . PHE A 1 186 ? -8.636  75.485 31.518 1.00 38.15  ? 186  PHE A CD1 1 
ATOM   1489 C CD2 . PHE A 1 186 ? -8.870  73.961 33.349 1.00 38.83  ? 186  PHE A CD2 1 
ATOM   1490 C CE1 . PHE A 1 186 ? -8.972  74.472 30.621 1.00 37.77  ? 186  PHE A CE1 1 
ATOM   1491 C CE2 . PHE A 1 186 ? -9.206  72.940 32.463 1.00 39.18  ? 186  PHE A CE2 1 
ATOM   1492 C CZ  . PHE A 1 186 ? -9.257  73.196 31.097 1.00 38.28  ? 186  PHE A CZ  1 
ATOM   1493 N N   . PHE A 1 187 ? -5.413  77.652 35.429 1.00 44.39  ? 187  PHE A N   1 
ATOM   1494 C CA  . PHE A 1 187 ? -4.982  78.645 36.404 1.00 42.89  ? 187  PHE A CA  1 
ATOM   1495 C C   . PHE A 1 187 ? -3.604  79.159 36.020 1.00 43.39  ? 187  PHE A C   1 
ATOM   1496 O O   . PHE A 1 187 ? -2.964  79.891 36.777 1.00 44.02  ? 187  PHE A O   1 
ATOM   1497 C CB  . PHE A 1 187 ? -4.937  78.049 37.818 1.00 42.36  ? 187  PHE A CB  1 
ATOM   1498 C CG  . PHE A 1 187 ? -6.270  77.548 38.313 1.00 41.67  ? 187  PHE A CG  1 
ATOM   1499 C CD1 . PHE A 1 187 ? -6.742  76.295 37.934 1.00 41.31  ? 187  PHE A CD1 1 
ATOM   1500 C CD2 . PHE A 1 187 ? -7.059  78.335 39.153 1.00 42.64  ? 187  PHE A CD2 1 
ATOM   1501 C CE1 . PHE A 1 187 ? -7.975  75.830 38.381 1.00 41.91  ? 187  PHE A CE1 1 
ATOM   1502 C CE2 . PHE A 1 187 ? -8.298  77.883 39.609 1.00 40.12  ? 187  PHE A CE2 1 
ATOM   1503 C CZ  . PHE A 1 187 ? -8.757  76.628 39.224 1.00 43.97  ? 187  PHE A CZ  1 
ATOM   1504 N N   . GLY A 1 188 ? -3.144  78.766 34.840 1.00 42.29  ? 188  GLY A N   1 
ATOM   1505 C CA  . GLY A 1 188 ? -1.847  79.215 34.374 1.00 41.22  ? 188  GLY A CA  1 
ATOM   1506 C C   . GLY A 1 188 ? -0.725  78.259 34.698 1.00 42.31  ? 188  GLY A C   1 
ATOM   1507 O O   . GLY A 1 188 ? 0.440   78.538 34.409 1.00 42.39  ? 188  GLY A O   1 
ATOM   1508 N N   . GLY A 1 189 ? -1.071  77.123 35.295 1.00 42.67  ? 189  GLY A N   1 
ATOM   1509 C CA  . GLY A 1 189 ? -0.059  76.151 35.647 1.00 41.54  ? 189  GLY A CA  1 
ATOM   1510 C C   . GLY A 1 189 ? 0.233   75.169 34.535 1.00 42.13  ? 189  GLY A C   1 
ATOM   1511 O O   . GLY A 1 189 ? -0.614  74.919 33.679 1.00 43.22  ? 189  GLY A O   1 
ATOM   1512 N N   . ASP A 1 190 ? 1.443   74.618 34.546 1.00 42.33  ? 190  ASP A N   1 
ATOM   1513 C CA  . ASP A 1 190 ? 1.860   73.627 33.559 1.00 42.64  ? 190  ASP A CA  1 
ATOM   1514 C C   . ASP A 1 190 ? 1.716   72.229 34.180 1.00 43.65  ? 190  ASP A C   1 
ATOM   1515 O O   . ASP A 1 190 ? 2.495   71.841 35.050 1.00 45.46  ? 190  ASP A O   1 
ATOM   1516 C CB  . ASP A 1 190 ? 3.309   73.877 33.149 1.00 42.36  ? 190  ASP A CB  1 
ATOM   1517 C CG  . ASP A 1 190 ? 3.817   72.841 32.177 1.00 43.32  ? 190  ASP A CG  1 
ATOM   1518 O OD1 . ASP A 1 190 ? 2.982   72.153 31.556 1.00 42.30  ? 190  ASP A OD1 1 
ATOM   1519 O OD2 . ASP A 1 190 ? 5.049   72.718 32.020 1.00 47.26  ? 190  ASP A OD2 1 
ATOM   1520 N N   . PRO A 1 191 ? 0.725   71.447 33.723 1.00 43.45  ? 191  PRO A N   1 
ATOM   1521 C CA  . PRO A 1 191 ? 0.486   70.100 34.252 1.00 43.35  ? 191  PRO A CA  1 
ATOM   1522 C C   . PRO A 1 191 ? 1.684   69.183 34.067 1.00 44.55  ? 191  PRO A C   1 
ATOM   1523 O O   . PRO A 1 191 ? 1.781   68.132 34.706 1.00 43.09  ? 191  PRO A O   1 
ATOM   1524 C CB  . PRO A 1 191 ? -0.711  69.604 33.440 1.00 42.31  ? 191  PRO A CB  1 
ATOM   1525 C CG  . PRO A 1 191 ? -1.270  70.836 32.783 1.00 44.37  ? 191  PRO A CG  1 
ATOM   1526 C CD  . PRO A 1 191 ? -0.063  71.665 32.503 1.00 42.94  ? 191  PRO A CD  1 
ATOM   1527 N N   . LYS A 1 192 ? 2.591   69.581 33.185 1.00 46.16  ? 192  LYS A N   1 
ATOM   1528 C CA  . LYS A 1 192 ? 3.756   68.765 32.900 1.00 48.26  ? 192  LYS A CA  1 
ATOM   1529 C C   . LYS A 1 192 ? 4.981   69.145 33.716 1.00 46.94  ? 192  LYS A C   1 
ATOM   1530 O O   . LYS A 1 192 ? 6.069   68.601 33.520 1.00 45.65  ? 192  LYS A O   1 
ATOM   1531 C CB  . LYS A 1 192 ? 4.060   68.817 31.404 1.00 50.97  ? 192  LYS A CB  1 
ATOM   1532 C CG  . LYS A 1 192 ? 3.957   67.447 30.720 1.00 58.76  ? 192  LYS A CG  1 
ATOM   1533 C CD  . LYS A 1 192 ? 2.594   66.764 30.934 1.00 59.87  ? 192  LYS A CD  1 
ATOM   1534 C CE  . LYS A 1 192 ? 1.455   67.552 30.284 1.00 63.12  ? 192  LYS A CE  1 
ATOM   1535 N NZ  . LYS A 1 192 ? 0.145   66.839 30.355 1.00 60.34  ? 192  LYS A NZ  1 
ATOM   1536 N N   . THR A 1 193 ? 4.799   70.081 34.636 1.00 44.70  ? 193  THR A N   1 
ATOM   1537 C CA  . THR A 1 193 ? 5.896   70.498 35.488 1.00 44.33  ? 193  THR A CA  1 
ATOM   1538 C C   . THR A 1 193 ? 5.369   70.709 36.902 1.00 42.38  ? 193  THR A C   1 
ATOM   1539 O O   . THR A 1 193 ? 5.448   71.804 37.461 1.00 41.32  ? 193  THR A O   1 
ATOM   1540 C CB  . THR A 1 193 ? 6.555   71.780 34.954 1.00 44.78  ? 193  THR A CB  1 
ATOM   1541 O OG1 . THR A 1 193 ? 6.963   71.568 33.598 1.00 47.43  ? 193  THR A OG1 1 
ATOM   1542 C CG2 . THR A 1 193 ? 7.788   72.124 35.770 1.00 43.63  ? 193  THR A CG2 1 
ATOM   1543 N N   . VAL A 1 194 ? 4.813   69.635 37.457 1.00 39.93  ? 194  VAL A N   1 
ATOM   1544 C CA  . VAL A 1 194 ? 4.259   69.642 38.803 1.00 37.51  ? 194  VAL A CA  1 
ATOM   1545 C C   . VAL A 1 194 ? 5.198   68.934 39.772 1.00 37.87  ? 194  VAL A C   1 
ATOM   1546 O O   . VAL A 1 194 ? 5.573   67.778 39.563 1.00 39.02  ? 194  VAL A O   1 
ATOM   1547 C CB  . VAL A 1 194 ? 2.904   68.919 38.857 1.00 37.53  ? 194  VAL A CB  1 
ATOM   1548 C CG1 . VAL A 1 194 ? 2.388   68.897 40.291 1.00 35.39  ? 194  VAL A CG1 1 
ATOM   1549 C CG2 . VAL A 1 194 ? 1.904   69.608 37.939 1.00 37.48  ? 194  VAL A CG2 1 
ATOM   1550 N N   . THR A 1 195 ? 5.587   69.636 40.826 1.00 36.50  ? 195  THR A N   1 
ATOM   1551 C CA  . THR A 1 195 ? 6.455   69.061 41.832 1.00 36.00  ? 195  THR A CA  1 
ATOM   1552 C C   . THR A 1 195 ? 5.662   68.912 43.118 1.00 37.21  ? 195  THR A C   1 
ATOM   1553 O O   . THR A 1 195 ? 5.092   69.885 43.613 1.00 36.24  ? 195  THR A O   1 
ATOM   1554 C CB  . THR A 1 195 ? 7.670   69.959 42.127 1.00 35.56  ? 195  THR A CB  1 
ATOM   1555 O OG1 . THR A 1 195 ? 8.600   69.880 41.042 1.00 39.71  ? 195  THR A OG1 1 
ATOM   1556 C CG2 . THR A 1 195 ? 8.359   69.517 43.415 1.00 31.98  ? 195  THR A CG2 1 
ATOM   1557 N N   . ILE A 1 196 ? 5.604   67.695 43.650 1.00 35.57  ? 196  ILE A N   1 
ATOM   1558 C CA  . ILE A 1 196 ? 4.907   67.488 44.908 1.00 35.03  ? 196  ILE A CA  1 
ATOM   1559 C C   . ILE A 1 196 ? 5.962   67.552 46.004 1.00 34.22  ? 196  ILE A C   1 
ATOM   1560 O O   . ILE A 1 196 ? 7.087   67.093 45.816 1.00 33.64  ? 196  ILE A O   1 
ATOM   1561 C CB  . ILE A 1 196 ? 4.198   66.119 44.962 1.00 35.05  ? 196  ILE A CB  1 
ATOM   1562 C CG1 . ILE A 1 196 ? 5.211   64.987 44.785 1.00 36.53  ? 196  ILE A CG1 1 
ATOM   1563 C CG2 . ILE A 1 196 ? 3.127   66.055 43.890 1.00 36.35  ? 196  ILE A CG2 1 
ATOM   1564 C CD1 . ILE A 1 196 ? 4.612   63.603 44.935 1.00 33.45  ? 196  ILE A CD1 1 
ATOM   1565 N N   . PHE A 1 197 ? 5.615   68.159 47.130 1.00 34.40  ? 197  PHE A N   1 
ATOM   1566 C CA  . PHE A 1 197 ? 6.543   68.247 48.247 1.00 35.00  ? 197  PHE A CA  1 
ATOM   1567 C C   . PHE A 1 197 ? 5.760   68.265 49.551 1.00 34.52  ? 197  PHE A C   1 
ATOM   1568 O O   . PHE A 1 197 ? 4.639   68.767 49.603 1.00 34.49  ? 197  PHE A O   1 
ATOM   1569 C CB  . PHE A 1 197 ? 7.472   69.480 48.111 1.00 36.74  ? 197  PHE A CB  1 
ATOM   1570 C CG  . PHE A 1 197 ? 6.798   70.818 48.328 1.00 35.77  ? 197  PHE A CG  1 
ATOM   1571 C CD1 . PHE A 1 197 ? 5.684   71.194 47.586 1.00 37.13  ? 197  PHE A CD1 1 
ATOM   1572 C CD2 . PHE A 1 197 ? 7.333   71.732 49.242 1.00 36.63  ? 197  PHE A CD2 1 
ATOM   1573 C CE1 . PHE A 1 197 ? 5.111   72.463 47.743 1.00 38.44  ? 197  PHE A CE1 1 
ATOM   1574 C CE2 . PHE A 1 197 ? 6.774   73.003 49.410 1.00 36.48  ? 197  PHE A CE2 1 
ATOM   1575 C CZ  . PHE A 1 197 ? 5.659   73.371 48.658 1.00 37.92  ? 197  PHE A CZ  1 
ATOM   1576 N N   . GLY A 1 198 ? 6.345   67.678 50.590 1.00 35.43  ? 198  GLY A N   1 
ATOM   1577 C CA  . GLY A 1 198 ? 5.692   67.612 51.885 1.00 35.77  ? 198  GLY A CA  1 
ATOM   1578 C C   . GLY A 1 198 ? 6.705   67.337 52.978 1.00 36.75  ? 198  GLY A C   1 
ATOM   1579 O O   . GLY A 1 198 ? 7.856   66.995 52.690 1.00 38.34  ? 198  GLY A O   1 
ATOM   1580 N N   . GLU A 1 199 ? 6.290   67.480 54.232 1.00 36.25  ? 199  GLU A N   1 
ATOM   1581 C CA  . GLU A 1 199 ? 7.196   67.263 55.352 1.00 35.41  ? 199  GLU A CA  1 
ATOM   1582 C C   . GLU A 1 199 ? 6.697   66.162 56.289 1.00 34.75  ? 199  GLU A C   1 
ATOM   1583 O O   . GLU A 1 199 ? 5.495   66.008 56.484 1.00 34.03  ? 199  GLU A O   1 
ATOM   1584 C CB  . GLU A 1 199 ? 7.381   68.585 56.113 1.00 33.68  ? 199  GLU A CB  1 
ATOM   1585 C CG  . GLU A 1 199 ? 8.344   68.516 57.279 1.00 33.07  ? 199  GLU A CG  1 
ATOM   1586 C CD  . GLU A 1 199 ? 7.658   68.162 58.575 1.00 34.59  ? 199  GLU A CD  1 
ATOM   1587 O OE1 . GLU A 1 199 ? 8.359   67.800 59.540 1.00 36.69  ? 199  GLU A OE1 1 
ATOM   1588 O OE2 . GLU A 1 199 ? 6.417   68.256 58.633 1.00 34.91  ? 199  GLU A OE2 1 
ATOM   1589 N N   . SER A 1 200 ? 7.627   65.399 56.862 1.00 35.72  ? 200  SER A N   1 
ATOM   1590 C CA  . SER A 1 200 ? 7.278   64.312 57.778 1.00 36.30  ? 200  SER A CA  1 
ATOM   1591 C C   . SER A 1 200 ? 6.385   63.289 57.056 1.00 34.58  ? 200  SER A C   1 
ATOM   1592 O O   . SER A 1 200 ? 6.813   62.689 56.074 1.00 35.04  ? 200  SER A O   1 
ATOM   1593 C CB  . SER A 1 200 ? 6.561   64.877 59.010 1.00 37.97  ? 200  SER A CB  1 
ATOM   1594 O OG  . SER A 1 200 ? 6.596   63.943 60.077 1.00 46.25  ? 200  SER A OG  1 
ATOM   1595 N N   . ALA A 1 201 ? 5.153   63.094 57.530 1.00 32.25  ? 201  ALA A N   1 
ATOM   1596 C CA  . ALA A 1 201 ? 4.234   62.150 56.888 1.00 32.06  ? 201  ALA A CA  1 
ATOM   1597 C C   . ALA A 1 201 ? 3.932   62.627 55.475 1.00 33.06  ? 201  ALA A C   1 
ATOM   1598 O O   . ALA A 1 201 ? 3.562   61.831 54.608 1.00 32.72  ? 201  ALA A O   1 
ATOM   1599 C CB  . ALA A 1 201 ? 2.932   62.023 57.681 1.00 29.58  ? 201  ALA A CB  1 
ATOM   1600 N N   . GLY A 1 202 ? 4.081   63.934 55.256 1.00 32.83  ? 202  GLY A N   1 
ATOM   1601 C CA  . GLY A 1 202 ? 3.853   64.499 53.941 1.00 31.25  ? 202  GLY A CA  1 
ATOM   1602 C C   . GLY A 1 202 ? 5.057   64.134 53.096 1.00 32.88  ? 202  GLY A C   1 
ATOM   1603 O O   . GLY A 1 202 ? 4.955   63.962 51.881 1.00 35.70  ? 202  GLY A O   1 
ATOM   1604 N N   . GLY A 1 203 ? 6.209   64.008 53.745 1.00 31.33  ? 203  GLY A N   1 
ATOM   1605 C CA  . GLY A 1 203 ? 7.411   63.627 53.031 1.00 31.97  ? 203  GLY A CA  1 
ATOM   1606 C C   . GLY A 1 203 ? 7.333   62.147 52.705 1.00 33.21  ? 203  GLY A C   1 
ATOM   1607 O O   . GLY A 1 203 ? 7.750   61.704 51.629 1.00 33.94  ? 203  GLY A O   1 
ATOM   1608 N N   . ALA A 1 204 ? 6.797   61.372 53.642 1.00 31.60  ? 204  ALA A N   1 
ATOM   1609 C CA  . ALA A 1 204 ? 6.647   59.941 53.425 1.00 32.31  ? 204  ALA A CA  1 
ATOM   1610 C C   . ALA A 1 204 ? 5.629   59.748 52.295 1.00 31.65  ? 204  ALA A C   1 
ATOM   1611 O O   . ALA A 1 204 ? 5.809   58.895 51.423 1.00 29.64  ? 204  ALA A O   1 
ATOM   1612 C CB  . ALA A 1 204 ? 6.167   59.259 54.701 1.00 30.80  ? 204  ALA A CB  1 
ATOM   1613 N N   . SER A 1 205 ? 4.570   60.558 52.319 1.00 30.56  ? 205  SER A N   1 
ATOM   1614 C CA  . SER A 1 205 ? 3.530   60.501 51.302 1.00 30.64  ? 205  SER A CA  1 
ATOM   1615 C C   . SER A 1 205 ? 4.150   60.703 49.918 1.00 32.59  ? 205  SER A C   1 
ATOM   1616 O O   . SER A 1 205 ? 3.910   59.914 48.994 1.00 31.85  ? 205  SER A O   1 
ATOM   1617 C CB  . SER A 1 205 ? 2.469   61.582 51.561 1.00 29.70  ? 205  SER A CB  1 
ATOM   1618 O OG  . SER A 1 205 ? 1.604   61.229 52.630 1.00 27.68  ? 205  SER A OG  1 
ATOM   1619 N N   . VAL A 1 206 ? 4.952   61.758 49.780 1.00 31.25  ? 206  VAL A N   1 
ATOM   1620 C CA  . VAL A 1 206 ? 5.606   62.046 48.508 1.00 32.07  ? 206  VAL A CA  1 
ATOM   1621 C C   . VAL A 1 206 ? 6.349   60.822 47.989 1.00 32.36  ? 206  VAL A C   1 
ATOM   1622 O O   . VAL A 1 206 ? 6.231   60.466 46.817 1.00 33.67  ? 206  VAL A O   1 
ATOM   1623 C CB  . VAL A 1 206 ? 6.603   63.219 48.635 1.00 30.73  ? 206  VAL A CB  1 
ATOM   1624 C CG1 . VAL A 1 206 ? 7.424   63.347 47.367 1.00 27.12  ? 206  VAL A CG1 1 
ATOM   1625 C CG2 . VAL A 1 206 ? 5.839   64.512 48.906 1.00 29.05  ? 206  VAL A CG2 1 
ATOM   1626 N N   . GLY A 1 207 ? 7.109   60.180 48.871 1.00 30.42  ? 207  GLY A N   1 
ATOM   1627 C CA  . GLY A 1 207 ? 7.856   59.001 48.483 1.00 29.71  ? 207  GLY A CA  1 
ATOM   1628 C C   . GLY A 1 207 ? 6.938   57.855 48.097 1.00 30.39  ? 207  GLY A C   1 
ATOM   1629 O O   . GLY A 1 207 ? 7.239   57.077 47.195 1.00 30.47  ? 207  GLY A O   1 
ATOM   1630 N N   . MET A 1 208 ? 5.808   57.748 48.779 1.00 30.18  ? 208  MET A N   1 
ATOM   1631 C CA  . MET A 1 208 ? 4.866   56.685 48.481 1.00 31.86  ? 208  MET A CA  1 
ATOM   1632 C C   . MET A 1 208 ? 4.229   56.848 47.094 1.00 34.10  ? 208  MET A C   1 
ATOM   1633 O O   . MET A 1 208 ? 3.871   55.857 46.453 1.00 35.17  ? 208  MET A O   1 
ATOM   1634 C CB  . MET A 1 208 ? 3.804   56.620 49.576 1.00 28.72  ? 208  MET A CB  1 
ATOM   1635 C CG  . MET A 1 208 ? 4.396   56.249 50.926 1.00 28.60  ? 208  MET A CG  1 
ATOM   1636 S SD  . MET A 1 208 ? 3.228   56.220 52.284 1.00 31.28  ? 208  MET A SD  1 
ATOM   1637 C CE  . MET A 1 208 ? 4.166   55.303 53.515 1.00 28.10  ? 208  MET A CE  1 
ATOM   1638 N N   . HIS A 1 209 ? 4.104   58.088 46.628 1.00 32.73  ? 209  HIS A N   1 
ATOM   1639 C CA  . HIS A 1 209 ? 3.537   58.341 45.313 1.00 32.85  ? 209  HIS A CA  1 
ATOM   1640 C C   . HIS A 1 209 ? 4.594   58.057 44.258 1.00 35.04  ? 209  HIS A C   1 
ATOM   1641 O O   . HIS A 1 209 ? 4.265   57.761 43.107 1.00 35.68  ? 209  HIS A O   1 
ATOM   1642 C CB  . HIS A 1 209 ? 3.044   59.786 45.195 1.00 31.23  ? 209  HIS A CB  1 
ATOM   1643 C CG  . HIS A 1 209 ? 1.787   60.053 45.960 1.00 29.97  ? 209  HIS A CG  1 
ATOM   1644 N ND1 . HIS A 1 209 ? 0.621   59.352 45.738 1.00 30.55  ? 209  HIS A ND1 1 
ATOM   1645 C CD2 . HIS A 1 209 ? 1.517   60.929 46.956 1.00 30.31  ? 209  HIS A CD2 1 
ATOM   1646 C CE1 . HIS A 1 209 ? -0.314  59.784 46.566 1.00 30.36  ? 209  HIS A CE1 1 
ATOM   1647 N NE2 . HIS A 1 209 ? 0.205   60.741 47.316 1.00 31.16  ? 209  HIS A NE2 1 
ATOM   1648 N N   . ILE A 1 210 ? 5.863   58.155 44.650 1.00 35.68  ? 210  ILE A N   1 
ATOM   1649 C CA  . ILE A 1 210 ? 6.962   57.858 43.737 1.00 34.63  ? 210  ILE A CA  1 
ATOM   1650 C C   . ILE A 1 210 ? 6.990   56.348 43.540 1.00 35.50  ? 210  ILE A C   1 
ATOM   1651 O O   . ILE A 1 210 ? 7.320   55.854 42.465 1.00 35.76  ? 210  ILE A O   1 
ATOM   1652 C CB  . ILE A 1 210 ? 8.317   58.296 44.321 1.00 35.29  ? 210  ILE A CB  1 
ATOM   1653 C CG1 . ILE A 1 210 ? 8.452   59.815 44.222 1.00 35.64  ? 210  ILE A CG1 1 
ATOM   1654 C CG2 . ILE A 1 210 ? 9.459   57.610 43.585 1.00 33.27  ? 210  ILE A CG2 1 
ATOM   1655 C CD1 . ILE A 1 210 ? 9.701   60.352 44.868 1.00 35.79  ? 210  ILE A CD1 1 
ATOM   1656 N N   . LEU A 1 211 ? 6.631   55.621 44.593 1.00 36.68  ? 211  LEU A N   1 
ATOM   1657 C CA  . LEU A 1 211 ? 6.613   54.163 44.557 1.00 37.18  ? 211  LEU A CA  1 
ATOM   1658 C C   . LEU A 1 211 ? 5.363   53.567 43.907 1.00 38.70  ? 211  LEU A C   1 
ATOM   1659 O O   . LEU A 1 211 ? 5.457   52.640 43.101 1.00 40.87  ? 211  LEU A O   1 
ATOM   1660 C CB  . LEU A 1 211 ? 6.753   53.608 45.974 1.00 34.09  ? 211  LEU A CB  1 
ATOM   1661 C CG  . LEU A 1 211 ? 8.147   53.629 46.601 1.00 33.96  ? 211  LEU A CG  1 
ATOM   1662 C CD1 . LEU A 1 211 ? 8.030   53.417 48.092 1.00 34.82  ? 211  LEU A CD1 1 
ATOM   1663 C CD2 . LEU A 1 211 ? 9.007   52.538 45.985 1.00 37.73  ? 211  LEU A CD2 1 
ATOM   1664 N N   . SER A 1 212 ? 4.197   54.099 44.254 1.00 38.53  ? 212  SER A N   1 
ATOM   1665 C CA  . SER A 1 212 ? 2.936   53.588 43.728 1.00 38.62  ? 212  SER A CA  1 
ATOM   1666 C C   . SER A 1 212 ? 2.736   53.791 42.220 1.00 39.48  ? 212  SER A C   1 
ATOM   1667 O O   . SER A 1 212 ? 2.670   54.921 41.731 1.00 41.10  ? 212  SER A O   1 
ATOM   1668 C CB  . SER A 1 212 ? 1.774   54.224 44.492 1.00 36.39  ? 212  SER A CB  1 
ATOM   1669 O OG  . SER A 1 212 ? 0.560   53.547 44.228 1.00 38.37  ? 212  SER A OG  1 
ATOM   1670 N N   . PRO A 1 213 ? 2.624   52.688 41.465 1.00 39.84  ? 213  PRO A N   1 
ATOM   1671 C CA  . PRO A 1 213 ? 2.427   52.763 40.013 1.00 39.88  ? 213  PRO A CA  1 
ATOM   1672 C C   . PRO A 1 213 ? 1.275   53.692 39.623 1.00 39.36  ? 213  PRO A C   1 
ATOM   1673 O O   . PRO A 1 213 ? 1.360   54.417 38.633 1.00 38.66  ? 213  PRO A O   1 
ATOM   1674 C CB  . PRO A 1 213 ? 2.150   51.312 39.633 1.00 38.13  ? 213  PRO A CB  1 
ATOM   1675 C CG  . PRO A 1 213 ? 3.002   50.558 40.610 1.00 39.60  ? 213  PRO A CG  1 
ATOM   1676 C CD  . PRO A 1 213 ? 2.718   51.284 41.907 1.00 39.86  ? 213  PRO A CD  1 
ATOM   1677 N N   . GLY A 1 214 ? 0.209   53.676 40.417 1.00 39.17  ? 214  GLY A N   1 
ATOM   1678 C CA  . GLY A 1 214 ? -0.942  54.510 40.123 1.00 38.18  ? 214  GLY A CA  1 
ATOM   1679 C C   . GLY A 1 214 ? -0.805  55.992 40.418 1.00 40.84  ? 214  GLY A C   1 
ATOM   1680 O O   . GLY A 1 214 ? -1.756  56.742 40.205 1.00 43.85  ? 214  GLY A O   1 
ATOM   1681 N N   . SER A 1 215 ? 0.353   56.436 40.901 1.00 39.87  ? 215  SER A N   1 
ATOM   1682 C CA  . SER A 1 215 ? 0.526   57.853 41.205 1.00 38.92  ? 215  SER A CA  1 
ATOM   1683 C C   . SER A 1 215 ? 1.644   58.491 40.385 1.00 40.33  ? 215  SER A C   1 
ATOM   1684 O O   . SER A 1 215 ? 1.632   59.697 40.136 1.00 40.43  ? 215  SER A O   1 
ATOM   1685 C CB  . SER A 1 215 ? 0.818   58.041 42.701 1.00 39.04  ? 215  SER A CB  1 
ATOM   1686 O OG  . SER A 1 215 ? -0.303  57.709 43.509 1.00 36.37  ? 215  SER A OG  1 
ATOM   1687 N N   . ARG A 1 216 ? 2.599   57.672 39.959 1.00 40.41  ? 216  ARG A N   1 
ATOM   1688 C CA  . ARG A 1 216 ? 3.759   58.127 39.195 1.00 40.05  ? 216  ARG A CA  1 
ATOM   1689 C C   . ARG A 1 216 ? 3.525   59.096 38.039 1.00 40.03  ? 216  ARG A C   1 
ATOM   1690 O O   . ARG A 1 216 ? 4.292   60.036 37.842 1.00 41.26  ? 216  ARG A O   1 
ATOM   1691 C CB  . ARG A 1 216 ? 4.515   56.921 38.637 1.00 40.82  ? 216  ARG A CB  1 
ATOM   1692 C CG  . ARG A 1 216 ? 4.888   55.883 39.658 1.00 39.72  ? 216  ARG A CG  1 
ATOM   1693 C CD  . ARG A 1 216 ? 5.670   54.775 39.010 1.00 40.49  ? 216  ARG A CD  1 
ATOM   1694 N NE  . ARG A 1 216 ? 5.883   53.671 39.936 1.00 41.97  ? 216  ARG A NE  1 
ATOM   1695 C CZ  . ARG A 1 216 ? 6.525   52.554 39.622 1.00 41.92  ? 216  ARG A CZ  1 
ATOM   1696 N NH1 . ARG A 1 216 ? 7.020   52.395 38.401 1.00 41.51  ? 216  ARG A NH1 1 
ATOM   1697 N NH2 . ARG A 1 216 ? 6.663   51.597 40.529 1.00 43.56  ? 216  ARG A NH2 1 
ATOM   1698 N N   . ASP A 1 217 ? 2.483   58.857 37.261 1.00 39.84  ? 217  ASP A N   1 
ATOM   1699 C CA  . ASP A 1 217 ? 2.220   59.693 36.104 1.00 40.37  ? 217  ASP A CA  1 
ATOM   1700 C C   . ASP A 1 217 ? 1.555   61.025 36.431 1.00 40.78  ? 217  ASP A C   1 
ATOM   1701 O O   . ASP A 1 217 ? 1.391   61.860 35.551 1.00 41.92  ? 217  ASP A O   1 
ATOM   1702 C CB  . ASP A 1 217 ? 1.353   58.930 35.093 1.00 40.39  ? 217  ASP A CB  1 
ATOM   1703 C CG  . ASP A 1 217 ? 1.940   57.575 34.699 1.00 40.82  ? 217  ASP A CG  1 
ATOM   1704 O OD1 . ASP A 1 217 ? 1.318   56.894 33.861 1.00 42.53  ? 217  ASP A OD1 1 
ATOM   1705 O OD2 . ASP A 1 217 ? 3.005   57.176 35.219 1.00 40.84  ? 217  ASP A OD2 1 
ATOM   1706 N N   . LEU A 1 218 ? 1.182   61.237 37.687 1.00 40.28  ? 218  LEU A N   1 
ATOM   1707 C CA  . LEU A 1 218 ? 0.513   62.477 38.056 1.00 39.97  ? 218  LEU A CA  1 
ATOM   1708 C C   . LEU A 1 218 ? 1.420   63.637 38.490 1.00 40.63  ? 218  LEU A C   1 
ATOM   1709 O O   . LEU A 1 218 ? 0.923   64.692 38.890 1.00 41.43  ? 218  LEU A O   1 
ATOM   1710 C CB  . LEU A 1 218 ? -0.520  62.204 39.149 1.00 40.01  ? 218  LEU A CB  1 
ATOM   1711 C CG  . LEU A 1 218 ? -1.600  61.152 38.866 1.00 40.66  ? 218  LEU A CG  1 
ATOM   1712 C CD1 . LEU A 1 218 ? -2.530  61.081 40.065 1.00 40.04  ? 218  LEU A CD1 1 
ATOM   1713 C CD2 . LEU A 1 218 ? -2.388  61.497 37.605 1.00 40.69  ? 218  LEU A CD2 1 
ATOM   1714 N N   . PHE A 1 219 ? 2.737   63.458 38.422 1.00 38.36  ? 219  PHE A N   1 
ATOM   1715 C CA  . PHE A 1 219 ? 3.647   64.540 38.792 1.00 37.44  ? 219  PHE A CA  1 
ATOM   1716 C C   . PHE A 1 219 ? 4.993   64.402 38.090 1.00 37.40  ? 219  PHE A C   1 
ATOM   1717 O O   . PHE A 1 219 ? 5.301   63.357 37.526 1.00 37.86  ? 219  PHE A O   1 
ATOM   1718 C CB  . PHE A 1 219 ? 3.843   64.615 40.317 1.00 36.73  ? 219  PHE A CB  1 
ATOM   1719 C CG  . PHE A 1 219 ? 4.481   63.395 40.915 1.00 35.87  ? 219  PHE A CG  1 
ATOM   1720 C CD1 . PHE A 1 219 ? 3.734   62.243 41.146 1.00 35.64  ? 219  PHE A CD1 1 
ATOM   1721 C CD2 . PHE A 1 219 ? 5.833   63.394 41.233 1.00 34.04  ? 219  PHE A CD2 1 
ATOM   1722 C CE1 . PHE A 1 219 ? 4.325   61.113 41.682 1.00 35.06  ? 219  PHE A CE1 1 
ATOM   1723 C CE2 . PHE A 1 219 ? 6.435   62.266 41.770 1.00 36.07  ? 219  PHE A CE2 1 
ATOM   1724 C CZ  . PHE A 1 219 ? 5.679   61.122 41.995 1.00 35.72  ? 219  PHE A CZ  1 
ATOM   1725 N N   . ARG A 1 220 ? 5.791   65.463 38.132 1.00 36.77  ? 220  ARG A N   1 
ATOM   1726 C CA  . ARG A 1 220 ? 7.084   65.474 37.469 1.00 36.72  ? 220  ARG A CA  1 
ATOM   1727 C C   . ARG A 1 220 ? 8.278   65.243 38.401 1.00 37.80  ? 220  ARG A C   1 
ATOM   1728 O O   . ARG A 1 220 ? 9.135   64.407 38.111 1.00 38.10  ? 220  ARG A O   1 
ATOM   1729 C CB  . ARG A 1 220 ? 7.239   66.810 36.729 1.00 37.69  ? 220  ARG A CB  1 
ATOM   1730 C CG  . ARG A 1 220 ? 8.554   67.026 35.993 1.00 39.23  ? 220  ARG A CG  1 
ATOM   1731 C CD  . ARG A 1 220 ? 8.764   65.978 34.918 1.00 46.11  ? 220  ARG A CD  1 
ATOM   1732 N NE  . ARG A 1 220 ? 9.812   66.355 33.972 1.00 49.78  ? 220  ARG A NE  1 
ATOM   1733 C CZ  . ARG A 1 220 ? 9.698   67.330 33.075 1.00 51.00  ? 220  ARG A CZ  1 
ATOM   1734 N NH1 . ARG A 1 220 ? 8.579   68.038 32.998 1.00 50.10  ? 220  ARG A NH1 1 
ATOM   1735 N NH2 . ARG A 1 220 ? 10.700  67.589 32.246 1.00 50.07  ? 220  ARG A NH2 1 
ATOM   1736 N N   . ARG A 1 221 ? 8.334   65.984 39.509 1.00 37.08  ? 221  ARG A N   1 
ATOM   1737 C CA  . ARG A 1 221 ? 9.439   65.878 40.464 1.00 35.62  ? 221  ARG A CA  1 
ATOM   1738 C C   . ARG A 1 221 ? 8.939   65.773 41.894 1.00 35.79  ? 221  ARG A C   1 
ATOM   1739 O O   . ARG A 1 221 ? 7.742   65.942 42.155 1.00 34.07  ? 221  ARG A O   1 
ATOM   1740 C CB  . ARG A 1 221 ? 10.355  67.099 40.364 1.00 36.11  ? 221  ARG A CB  1 
ATOM   1741 C CG  . ARG A 1 221 ? 10.877  67.347 38.987 1.00 36.96  ? 221  ARG A CG  1 
ATOM   1742 C CD  . ARG A 1 221 ? 11.916  68.441 38.955 1.00 38.13  ? 221  ARG A CD  1 
ATOM   1743 N NE  . ARG A 1 221 ? 12.527  68.470 37.633 1.00 44.25  ? 221  ARG A NE  1 
ATOM   1744 C CZ  . ARG A 1 221 ? 12.013  69.089 36.578 1.00 44.86  ? 221  ARG A CZ  1 
ATOM   1745 N NH1 . ARG A 1 221 ? 10.876  69.758 36.679 1.00 47.74  ? 221  ARG A NH1 1 
ATOM   1746 N NH2 . ARG A 1 221 ? 12.624  69.006 35.408 1.00 48.91  ? 221  ARG A NH2 1 
ATOM   1747 N N   . ALA A 1 222 ? 9.867   65.533 42.821 1.00 34.32  ? 222  ALA A N   1 
ATOM   1748 C CA  . ALA A 1 222 ? 9.505   65.382 44.221 1.00 34.56  ? 222  ALA A CA  1 
ATOM   1749 C C   . ALA A 1 222 ? 10.516  65.939 45.219 1.00 36.03  ? 222  ALA A C   1 
ATOM   1750 O O   . ALA A 1 222 ? 11.733  65.875 45.013 1.00 37.80  ? 222  ALA A O   1 
ATOM   1751 C CB  . ALA A 1 222 ? 9.247   63.905 44.524 1.00 33.58  ? 222  ALA A CB  1 
ATOM   1752 N N   . ILE A 1 223 ? 9.984   66.491 46.305 1.00 35.93  ? 223  ILE A N   1 
ATOM   1753 C CA  . ILE A 1 223 ? 10.791  67.042 47.384 1.00 33.87  ? 223  ILE A CA  1 
ATOM   1754 C C   . ILE A 1 223 ? 10.281  66.423 48.680 1.00 33.38  ? 223  ILE A C   1 
ATOM   1755 O O   . ILE A 1 223 ? 9.092   66.513 49.005 1.00 32.79  ? 223  ILE A O   1 
ATOM   1756 C CB  . ILE A 1 223 ? 10.664  68.575 47.468 1.00 32.97  ? 223  ILE A CB  1 
ATOM   1757 C CG1 . ILE A 1 223 ? 11.272  69.217 46.224 1.00 31.91  ? 223  ILE A CG1 1 
ATOM   1758 C CG2 . ILE A 1 223 ? 11.394  69.087 48.700 1.00 32.64  ? 223  ILE A CG2 1 
ATOM   1759 C CD1 . ILE A 1 223 ? 11.083  70.714 46.162 1.00 32.97  ? 223  ILE A CD1 1 
ATOM   1760 N N   . LEU A 1 224 ? 11.183  65.781 49.409 1.00 33.06  ? 224  LEU A N   1 
ATOM   1761 C CA  . LEU A 1 224 ? 10.823  65.137 50.663 1.00 33.21  ? 224  LEU A CA  1 
ATOM   1762 C C   . LEU A 1 224 ? 11.563  65.786 51.828 1.00 33.16  ? 224  LEU A C   1 
ATOM   1763 O O   . LEU A 1 224 ? 12.790  65.749 51.897 1.00 33.55  ? 224  LEU A O   1 
ATOM   1764 C CB  . LEU A 1 224 ? 11.151  63.636 50.610 1.00 32.10  ? 224  LEU A CB  1 
ATOM   1765 C CG  . LEU A 1 224 ? 10.512  62.776 49.511 1.00 30.80  ? 224  LEU A CG  1 
ATOM   1766 C CD1 . LEU A 1 224 ? 11.201  63.023 48.176 1.00 27.96  ? 224  LEU A CD1 1 
ATOM   1767 C CD2 . LEU A 1 224 ? 10.649  61.306 49.881 1.00 30.11  ? 224  LEU A CD2 1 
ATOM   1768 N N   . GLN A 1 225 ? 10.804  66.377 52.741 1.00 33.84  ? 225  GLN A N   1 
ATOM   1769 C CA  . GLN A 1 225 ? 11.364  67.044 53.908 1.00 33.61  ? 225  GLN A CA  1 
ATOM   1770 C C   . GLN A 1 225 ? 11.157  66.216 55.184 1.00 34.82  ? 225  GLN A C   1 
ATOM   1771 O O   . GLN A 1 225 ? 10.015  66.018 55.625 1.00 33.92  ? 225  GLN A O   1 
ATOM   1772 C CB  . GLN A 1 225 ? 10.709  68.419 54.072 1.00 33.79  ? 225  GLN A CB  1 
ATOM   1773 C CG  . GLN A 1 225 ? 11.043  69.414 52.955 1.00 34.46  ? 225  GLN A CG  1 
ATOM   1774 C CD  . GLN A 1 225 ? 10.115  70.619 52.955 1.00 34.62  ? 225  GLN A CD  1 
ATOM   1775 O OE1 . GLN A 1 225 ? 9.831   71.194 54.005 1.00 36.96  ? 225  GLN A OE1 1 
ATOM   1776 N NE2 . GLN A 1 225 ? 9.646   71.012 51.778 1.00 32.11  ? 225  GLN A NE2 1 
ATOM   1777 N N   . SER A 1 226 ? 12.265  65.730 55.755 1.00 32.39  ? 226  SER A N   1 
ATOM   1778 C CA  . SER A 1 226 ? 12.253  64.952 56.996 1.00 32.01  ? 226  SER A CA  1 
ATOM   1779 C C   . SER A 1 226 ? 11.229  63.822 56.991 1.00 33.58  ? 226  SER A C   1 
ATOM   1780 O O   . SER A 1 226 ? 10.523  63.610 57.973 1.00 34.04  ? 226  SER A O   1 
ATOM   1781 C CB  . SER A 1 226 ? 11.953  65.870 58.189 1.00 31.61  ? 226  SER A CB  1 
ATOM   1782 O OG  . SER A 1 226 ? 12.856  66.959 58.267 1.00 30.94  ? 226  SER A OG  1 
ATOM   1783 N N   . GLY A 1 227 ? 11.151  63.093 55.888 1.00 34.46  ? 227  GLY A N   1 
ATOM   1784 C CA  . GLY A 1 227 ? 10.188  62.014 55.800 1.00 31.85  ? 227  GLY A CA  1 
ATOM   1785 C C   . GLY A 1 227 ? 10.561  61.159 54.622 1.00 32.28  ? 227  GLY A C   1 
ATOM   1786 O O   . GLY A 1 227 ? 11.075  61.654 53.621 1.00 33.43  ? 227  GLY A O   1 
ATOM   1787 N N   A SER A 1 228 ? 10.315  59.863 54.722 0.50 31.12  ? 228  SER A N   1 
ATOM   1788 N N   B SER A 1 228 ? 10.292  59.866 54.745 0.50 31.95  ? 228  SER A N   1 
ATOM   1789 C CA  A SER A 1 228 ? 10.617  58.959 53.623 0.50 30.12  ? 228  SER A CA  1 
ATOM   1790 C CA  B SER A 1 228 ? 10.646  58.913 53.706 0.50 31.76  ? 228  SER A CA  1 
ATOM   1791 C C   A SER A 1 228 ? 9.611   57.818 53.698 0.50 30.91  ? 228  SER A C   1 
ATOM   1792 C C   B SER A 1 228 ? 9.630   57.764 53.727 0.50 31.78  ? 228  SER A C   1 
ATOM   1793 O O   A SER A 1 228 ? 9.119   57.489 54.773 0.50 32.05  ? 228  SER A O   1 
ATOM   1794 O O   B SER A 1 228 ? 9.149   57.381 54.790 0.50 32.96  ? 228  SER A O   1 
ATOM   1795 C CB  A SER A 1 228 ? 12.061  58.445 53.719 0.50 25.90  ? 228  SER A CB  1 
ATOM   1796 C CB  B SER A 1 228 ? 12.059  58.399 53.999 0.50 29.05  ? 228  SER A CB  1 
ATOM   1797 O OG  A SER A 1 228 ? 12.288  57.738 54.918 0.50 24.43  ? 228  SER A OG  1 
ATOM   1798 O OG  B SER A 1 228 ? 12.616  57.725 52.899 0.50 31.68  ? 228  SER A OG  1 
ATOM   1799 N N   . PRO A 1 229 ? 9.288   57.203 52.555 1.00 32.52  ? 229  PRO A N   1 
ATOM   1800 C CA  . PRO A 1 229 ? 8.316   56.099 52.530 1.00 32.23  ? 229  PRO A CA  1 
ATOM   1801 C C   . PRO A 1 229 ? 8.616   54.893 53.421 1.00 32.71  ? 229  PRO A C   1 
ATOM   1802 O O   . PRO A 1 229 ? 7.701   54.209 53.881 1.00 33.66  ? 229  PRO A O   1 
ATOM   1803 C CB  . PRO A 1 229 ? 8.248   55.734 51.049 1.00 31.72  ? 229  PRO A CB  1 
ATOM   1804 C CG  . PRO A 1 229 ? 9.624   56.146 50.526 1.00 32.93  ? 229  PRO A CG  1 
ATOM   1805 C CD  . PRO A 1 229 ? 9.853   57.457 51.216 1.00 30.14  ? 229  PRO A CD  1 
ATOM   1806 N N   . ASN A 1 230 ? 9.895   54.644 53.669 1.00 33.34  ? 230  ASN A N   1 
ATOM   1807 C CA  . ASN A 1 230 ? 10.323  53.511 54.480 1.00 32.05  ? 230  ASN A CA  1 
ATOM   1808 C C   . ASN A 1 230 ? 10.466  53.801 55.969 1.00 33.41  ? 230  ASN A C   1 
ATOM   1809 O O   . ASN A 1 230 ? 11.022  52.988 56.709 1.00 33.92  ? 230  ASN A O   1 
ATOM   1810 C CB  . ASN A 1 230 ? 11.652  52.986 53.960 1.00 33.69  ? 230  ASN A CB  1 
ATOM   1811 C CG  . ASN A 1 230 ? 12.708  54.074 53.865 1.00 36.06  ? 230  ASN A CG  1 
ATOM   1812 O OD1 . ASN A 1 230 ? 13.870  53.856 54.205 1.00 40.88  ? 230  ASN A OD1 1 
ATOM   1813 N ND2 . ASN A 1 230 ? 12.313  55.247 53.392 1.00 34.10  ? 230  ASN A ND2 1 
ATOM   1814 N N   . CYS A 1 231 ? 9.982   54.952 56.421 1.00 32.19  ? 231  CYS A N   1 
ATOM   1815 C CA  . CYS A 1 231 ? 10.082  55.268 57.840 1.00 34.57  ? 231  CYS A CA  1 
ATOM   1816 C C   . CYS A 1 231 ? 9.324   54.225 58.659 1.00 36.49  ? 231  CYS A C   1 
ATOM   1817 O O   . CYS A 1 231 ? 8.189   53.861 58.330 1.00 38.04  ? 231  CYS A O   1 
ATOM   1818 C CB  . CYS A 1 231 ? 9.540   56.667 58.116 1.00 35.00  ? 231  CYS A CB  1 
ATOM   1819 S SG  . CYS A 1 231 ? 10.701  57.967 57.621 1.00 38.42  ? 231  CYS A SG  1 
ATOM   1820 N N   . PRO A 1 232 ? 9.937   53.744 59.752 1.00 36.47  ? 232  PRO A N   1 
ATOM   1821 C CA  . PRO A 1 232 ? 9.342   52.728 60.630 1.00 34.25  ? 232  PRO A CA  1 
ATOM   1822 C C   . PRO A 1 232 ? 7.928   53.023 61.120 1.00 35.11  ? 232  PRO A C   1 
ATOM   1823 O O   . PRO A 1 232 ? 7.201   52.105 61.503 1.00 35.48  ? 232  PRO A O   1 
ATOM   1824 C CB  . PRO A 1 232 ? 10.353  52.626 61.771 1.00 33.32  ? 232  PRO A CB  1 
ATOM   1825 C CG  . PRO A 1 232 ? 10.911  54.019 61.844 1.00 34.34  ? 232  PRO A CG  1 
ATOM   1826 C CD  . PRO A 1 232 ? 11.116  54.361 60.389 1.00 35.34  ? 232  PRO A CD  1 
ATOM   1827 N N   . TRP A 1 233 ? 7.544   54.297 61.102 1.00 33.34  ? 233  TRP A N   1 
ATOM   1828 C CA  . TRP A 1 233 ? 6.222   54.724 61.552 1.00 31.56  ? 233  TRP A CA  1 
ATOM   1829 C C   . TRP A 1 233 ? 5.250   54.995 60.401 1.00 31.88  ? 233  TRP A C   1 
ATOM   1830 O O   . TRP A 1 233 ? 4.047   55.135 60.618 1.00 31.46  ? 233  TRP A O   1 
ATOM   1831 C CB  . TRP A 1 233 ? 6.351   56.006 62.376 1.00 30.77  ? 233  TRP A CB  1 
ATOM   1832 C CG  . TRP A 1 233 ? 7.168   57.066 61.678 1.00 31.96  ? 233  TRP A CG  1 
ATOM   1833 C CD1 . TRP A 1 233 ? 8.509   57.294 61.822 1.00 32.10  ? 233  TRP A CD1 1 
ATOM   1834 C CD2 . TRP A 1 233 ? 6.714   57.987 60.672 1.00 30.27  ? 233  TRP A CD2 1 
ATOM   1835 N NE1 . TRP A 1 233 ? 8.917   58.293 60.970 1.00 31.61  ? 233  TRP A NE1 1 
ATOM   1836 C CE2 . TRP A 1 233 ? 7.838   58.737 60.253 1.00 31.14  ? 233  TRP A CE2 1 
ATOM   1837 C CE3 . TRP A 1 233 ? 5.470   58.248 60.084 1.00 31.07  ? 233  TRP A CE3 1 
ATOM   1838 C CZ2 . TRP A 1 233 ? 7.756   59.734 59.271 1.00 30.41  ? 233  TRP A CZ2 1 
ATOM   1839 C CZ3 . TRP A 1 233 ? 5.385   59.239 59.106 1.00 33.26  ? 233  TRP A CZ3 1 
ATOM   1840 C CH2 . TRP A 1 233 ? 6.526   59.971 58.709 1.00 32.51  ? 233  TRP A CH2 1 
ATOM   1841 N N   . ALA A 1 234 ? 5.776   55.075 59.184 1.00 31.23  ? 234  ALA A N   1 
ATOM   1842 C CA  . ALA A 1 234 ? 4.967   55.388 58.012 1.00 31.76  ? 234  ALA A CA  1 
ATOM   1843 C C   . ALA A 1 234 ? 4.040   54.301 57.474 1.00 33.11  ? 234  ALA A C   1 
ATOM   1844 O O   . ALA A 1 234 ? 3.154   54.591 56.672 1.00 33.13  ? 234  ALA A O   1 
ATOM   1845 C CB  . ALA A 1 234 ? 5.874   55.883 56.891 1.00 32.42  ? 234  ALA A CB  1 
ATOM   1846 N N   . SER A 1 235 ? 4.222   53.056 57.894 1.00 33.30  ? 235  SER A N   1 
ATOM   1847 C CA  . SER A 1 235 ? 3.360   51.994 57.385 1.00 33.73  ? 235  SER A CA  1 
ATOM   1848 C C   . SER A 1 235 ? 3.309   50.778 58.293 1.00 34.56  ? 235  SER A C   1 
ATOM   1849 O O   . SER A 1 235 ? 4.150   50.623 59.175 1.00 36.81  ? 235  SER A O   1 
ATOM   1850 C CB  . SER A 1 235 ? 3.831   51.559 55.994 1.00 32.86  ? 235  SER A CB  1 
ATOM   1851 O OG  . SER A 1 235 ? 5.084   50.904 56.063 1.00 31.18  ? 235  SER A OG  1 
ATOM   1852 N N   . VAL A 1 236 ? 2.315   49.925 58.066 1.00 33.98  ? 236  VAL A N   1 
ATOM   1853 C CA  . VAL A 1 236 ? 2.140   48.701 58.838 1.00 34.50  ? 236  VAL A CA  1 
ATOM   1854 C C   . VAL A 1 236 ? 1.684   47.584 57.901 1.00 36.22  ? 236  VAL A C   1 
ATOM   1855 O O   . VAL A 1 236 ? 1.200   47.840 56.800 1.00 37.03  ? 236  VAL A O   1 
ATOM   1856 C CB  . VAL A 1 236 ? 1.071   48.853 59.944 1.00 33.95  ? 236  VAL A CB  1 
ATOM   1857 C CG1 . VAL A 1 236 ? 1.516   49.881 60.976 1.00 32.18  ? 236  VAL A CG1 1 
ATOM   1858 C CG2 . VAL A 1 236 ? -0.266  49.228 59.322 1.00 29.16  ? 236  VAL A CG2 1 
ATOM   1859 N N   . SER A 1 237 ? 1.829   46.345 58.344 1.00 36.02  ? 237  SER A N   1 
ATOM   1860 C CA  . SER A 1 237 ? 1.425   45.217 57.524 1.00 36.81  ? 237  SER A CA  1 
ATOM   1861 C C   . SER A 1 237 ? -0.096  45.094 57.491 1.00 37.65  ? 237  SER A C   1 
ATOM   1862 O O   . SER A 1 237 ? -0.813  45.757 58.244 1.00 37.43  ? 237  SER A O   1 
ATOM   1863 C CB  . SER A 1 237 ? 2.035   43.926 58.072 1.00 36.49  ? 237  SER A CB  1 
ATOM   1864 O OG  . SER A 1 237 ? 1.509   43.623 59.354 1.00 37.48  ? 237  SER A OG  1 
ATOM   1865 N N   . VAL A 1 238 ? -0.576  44.241 56.599 1.00 38.49  ? 238  VAL A N   1 
ATOM   1866 C CA  . VAL A 1 238 ? -2.001  43.997 56.453 1.00 40.01  ? 238  VAL A CA  1 
ATOM   1867 C C   . VAL A 1 238 ? -2.549  43.431 57.758 1.00 39.69  ? 238  VAL A C   1 
ATOM   1868 O O   . VAL A 1 238 ? -3.636  43.803 58.201 1.00 39.33  ? 238  VAL A O   1 
ATOM   1869 C CB  . VAL A 1 238 ? -2.251  43.007 55.302 1.00 41.46  ? 238  VAL A CB  1 
ATOM   1870 C CG1 . VAL A 1 238 ? -3.635  42.414 55.411 1.00 45.68  ? 238  VAL A CG1 1 
ATOM   1871 C CG2 . VAL A 1 238 ? -2.081  43.722 53.974 1.00 42.79  ? 238  VAL A CG2 1 
ATOM   1872 N N   . ALA A 1 239 ? -1.777  42.537 58.369 1.00 38.56  ? 239  ALA A N   1 
ATOM   1873 C CA  . ALA A 1 239 ? -2.159  41.914 59.629 1.00 39.73  ? 239  ALA A CA  1 
ATOM   1874 C C   . ALA A 1 239 ? -2.239  42.937 60.766 1.00 39.73  ? 239  ALA A C   1 
ATOM   1875 O O   . ALA A 1 239 ? -3.229  42.978 61.498 1.00 42.10  ? 239  ALA A O   1 
ATOM   1876 C CB  . ALA A 1 239 ? -1.163  40.816 59.985 1.00 40.58  ? 239  ALA A CB  1 
ATOM   1877 N N   . GLU A 1 240 ? -1.202  43.760 60.911 1.00 39.06  ? 240  GLU A N   1 
ATOM   1878 C CA  . GLU A 1 240 ? -1.170  44.776 61.963 1.00 38.27  ? 240  GLU A CA  1 
ATOM   1879 C C   . GLU A 1 240 ? -2.289  45.806 61.788 1.00 37.41  ? 240  GLU A C   1 
ATOM   1880 O O   . GLU A 1 240 ? -2.907  46.239 62.769 1.00 35.96  ? 240  GLU A O   1 
ATOM   1881 C CB  . GLU A 1 240 ? 0.194   45.475 61.979 1.00 39.99  ? 240  GLU A CB  1 
ATOM   1882 C CG  . GLU A 1 240 ? 0.376   46.528 63.077 1.00 41.09  ? 240  GLU A CG  1 
ATOM   1883 C CD  . GLU A 1 240 ? 0.089   45.995 64.472 1.00 43.22  ? 240  GLU A CD  1 
ATOM   1884 O OE1 . GLU A 1 240 ? 0.192   44.766 64.681 1.00 44.42  ? 240  GLU A OE1 1 
ATOM   1885 O OE2 . GLU A 1 240 ? -0.229  46.810 65.364 1.00 42.68  ? 240  GLU A OE2 1 
ATOM   1886 N N   . GLY A 1 241 ? -2.549  46.193 60.543 1.00 36.09  ? 241  GLY A N   1 
ATOM   1887 C CA  . GLY A 1 241 ? -3.609  47.151 60.286 1.00 37.67  ? 241  GLY A CA  1 
ATOM   1888 C C   . GLY A 1 241 ? -4.945  46.595 60.751 1.00 39.10  ? 241  GLY A C   1 
ATOM   1889 O O   . GLY A 1 241 ? -5.726  47.284 61.405 1.00 37.00  ? 241  GLY A O   1 
ATOM   1890 N N   . ARG A 1 242 ? -5.196  45.332 60.413 1.00 40.79  ? 242  ARG A N   1 
ATOM   1891 C CA  . ARG A 1 242 ? -6.433  44.648 60.782 1.00 42.72  ? 242  ARG A CA  1 
ATOM   1892 C C   . ARG A 1 242 ? -6.570  44.559 62.302 1.00 42.89  ? 242  ARG A C   1 
ATOM   1893 O O   . ARG A 1 242 ? -7.625  44.878 62.864 1.00 42.12  ? 242  ARG A O   1 
ATOM   1894 C CB  . ARG A 1 242 ? -6.455  43.242 60.155 1.00 44.02  ? 242  ARG A CB  1 
ATOM   1895 C CG  . ARG A 1 242 ? -7.636  42.361 60.563 1.00 44.44  ? 242  ARG A CG  1 
ATOM   1896 C CD  . ARG A 1 242 ? -7.682  41.068 59.739 1.00 43.11  ? 242  ARG A CD  1 
ATOM   1897 N NE  . ARG A 1 242 ? -8.167  41.295 58.376 1.00 41.26  ? 242  ARG A NE  1 
ATOM   1898 C CZ  . ARG A 1 242 ? -9.430  41.595 58.068 1.00 43.71  ? 242  ARG A CZ  1 
ATOM   1899 N NH1 . ARG A 1 242 ? -10.354 41.703 59.020 1.00 39.78  ? 242  ARG A NH1 1 
ATOM   1900 N NH2 . ARG A 1 242 ? -9.773  41.805 56.804 1.00 43.87  ? 242  ARG A NH2 1 
ATOM   1901 N N   . ARG A 1 243 ? -5.498  44.130 62.963 1.00 42.29  ? 243  ARG A N   1 
ATOM   1902 C CA  . ARG A 1 243 ? -5.498  44.010 64.418 1.00 41.93  ? 243  ARG A CA  1 
ATOM   1903 C C   . ARG A 1 243 ? -5.896  45.334 65.081 1.00 41.62  ? 243  ARG A C   1 
ATOM   1904 O O   . ARG A 1 243 ? -6.657  45.347 66.051 1.00 42.38  ? 243  ARG A O   1 
ATOM   1905 C CB  . ARG A 1 243 ? -4.114  43.585 64.916 1.00 40.25  ? 243  ARG A CB  1 
ATOM   1906 C CG  . ARG A 1 243 ? -4.066  43.327 66.409 1.00 40.82  ? 243  ARG A CG  1 
ATOM   1907 C CD  . ARG A 1 243 ? -2.644  43.291 66.944 1.00 40.92  ? 243  ARG A CD  1 
ATOM   1908 N NE  . ARG A 1 243 ? -2.024  44.614 66.915 1.00 43.75  ? 243  ARG A NE  1 
ATOM   1909 C CZ  . ARG A 1 243 ? -2.351  45.619 67.725 1.00 42.93  ? 243  ARG A CZ  1 
ATOM   1910 N NH1 . ARG A 1 243 ? -3.294  45.466 68.644 1.00 36.56  ? 243  ARG A NH1 1 
ATOM   1911 N NH2 . ARG A 1 243 ? -1.735  46.788 67.609 1.00 44.48  ? 243  ARG A NH2 1 
ATOM   1912 N N   . ARG A 1 244 ? -5.385  46.445 64.550 1.00 40.62  ? 244  ARG A N   1 
ATOM   1913 C CA  . ARG A 1 244 ? -5.689  47.762 65.105 1.00 39.38  ? 244  ARG A CA  1 
ATOM   1914 C C   . ARG A 1 244 ? -7.126  48.184 64.850 1.00 38.81  ? 244  ARG A C   1 
ATOM   1915 O O   . ARG A 1 244 ? -7.736  48.850 65.691 1.00 39.53  ? 244  ARG A O   1 
ATOM   1916 C CB  . ARG A 1 244 ? -4.729  48.817 64.543 1.00 37.01  ? 244  ARG A CB  1 
ATOM   1917 C CG  . ARG A 1 244 ? -3.289  48.572 64.944 1.00 35.78  ? 244  ARG A CG  1 
ATOM   1918 C CD  . ARG A 1 244 ? -2.368  49.653 64.444 1.00 34.86  ? 244  ARG A CD  1 
ATOM   1919 N NE  . ARG A 1 244 ? -0.979  49.383 64.799 1.00 34.79  ? 244  ARG A NE  1 
ATOM   1920 C CZ  . ARG A 1 244 ? 0.028   50.219 64.568 1.00 34.74  ? 244  ARG A CZ  1 
ATOM   1921 N NH1 . ARG A 1 244 ? -0.188  51.389 63.982 1.00 35.11  ? 244  ARG A NH1 1 
ATOM   1922 N NH2 . ARG A 1 244 ? 1.257   49.880 64.915 1.00 35.04  ? 244  ARG A NH2 1 
ATOM   1923 N N   . ALA A 1 245 ? -7.664  47.799 63.695 1.00 38.65  ? 245  ALA A N   1 
ATOM   1924 C CA  . ALA A 1 245 ? -9.044  48.137 63.351 1.00 40.02  ? 245  ALA A CA  1 
ATOM   1925 C C   . ALA A 1 245 ? -9.984  47.385 64.294 1.00 41.65  ? 245  ALA A C   1 
ATOM   1926 O O   . ALA A 1 245 ? -10.955 47.952 64.811 1.00 39.95  ? 245  ALA A O   1 
ATOM   1927 C CB  . ALA A 1 245 ? -9.333  47.762 61.907 1.00 38.34  ? 245  ALA A CB  1 
ATOM   1928 N N   . VAL A 1 246 ? -9.684  46.107 64.514 1.00 41.01  ? 246  VAL A N   1 
ATOM   1929 C CA  . VAL A 1 246 ? -10.481 45.281 65.409 1.00 41.64  ? 246  VAL A CA  1 
ATOM   1930 C C   . VAL A 1 246 ? -10.386 45.862 66.821 1.00 43.00  ? 246  VAL A C   1 
ATOM   1931 O O   . VAL A 1 246 ? -11.400 46.001 67.511 1.00 43.75  ? 246  VAL A O   1 
ATOM   1932 C CB  . VAL A 1 246 ? -9.973  43.811 65.426 1.00 41.50  ? 246  VAL A CB  1 
ATOM   1933 C CG1 . VAL A 1 246 ? -10.754 43.000 66.449 1.00 39.36  ? 246  VAL A CG1 1 
ATOM   1934 C CG2 . VAL A 1 246 ? -10.109 43.195 64.041 1.00 38.73  ? 246  VAL A CG2 1 
ATOM   1935 N N   . GLU A 1 247 ? -9.169  46.209 67.242 1.00 42.41  ? 247  GLU A N   1 
ATOM   1936 C CA  . GLU A 1 247 ? -8.960  46.780 68.572 1.00 43.09  ? 247  GLU A CA  1 
ATOM   1937 C C   . GLU A 1 247 ? -9.708  48.106 68.720 1.00 43.51  ? 247  GLU A C   1 
ATOM   1938 O O   . GLU A 1 247 ? -10.192 48.441 69.805 1.00 44.09  ? 247  GLU A O   1 
ATOM   1939 C CB  . GLU A 1 247 ? -7.466  46.989 68.837 1.00 44.47  ? 247  GLU A CB  1 
ATOM   1940 C CG  . GLU A 1 247 ? -7.144  47.476 70.247 1.00 47.94  ? 247  GLU A CG  1 
ATOM   1941 C CD  . GLU A 1 247 ? -7.487  46.458 71.338 1.00 52.07  ? 247  GLU A CD  1 
ATOM   1942 O OE1 . GLU A 1 247 ? -7.393  46.815 72.534 1.00 50.41  ? 247  GLU A OE1 1 
ATOM   1943 O OE2 . GLU A 1 247 ? -7.844  45.302 71.008 1.00 52.72  ? 247  GLU A OE2 1 
ATOM   1944 N N   . LEU A 1 248 ? -9.809  48.861 67.629 1.00 42.99  ? 248  LEU A N   1 
ATOM   1945 C CA  . LEU A 1 248 ? -10.522 50.132 67.674 1.00 43.05  ? 248  LEU A CA  1 
ATOM   1946 C C   . LEU A 1 248 ? -11.997 49.824 67.870 1.00 45.61  ? 248  LEU A C   1 
ATOM   1947 O O   . LEU A 1 248 ? -12.702 50.539 68.583 1.00 47.45  ? 248  LEU A O   1 
ATOM   1948 C CB  . LEU A 1 248 ? -10.329 50.910 66.374 1.00 40.87  ? 248  LEU A CB  1 
ATOM   1949 C CG  . LEU A 1 248 ? -11.023 52.272 66.302 1.00 38.49  ? 248  LEU A CG  1 
ATOM   1950 C CD1 . LEU A 1 248 ? -10.383 53.222 67.288 1.00 38.70  ? 248  LEU A CD1 1 
ATOM   1951 C CD2 . LEU A 1 248 ? -10.917 52.832 64.896 1.00 38.63  ? 248  LEU A CD2 1 
ATOM   1952 N N   . GLY A 1 249 ? -12.460 48.753 67.230 1.00 46.95  ? 249  GLY A N   1 
ATOM   1953 C CA  . GLY A 1 249 ? -13.852 48.362 67.360 1.00 47.19  ? 249  GLY A CA  1 
ATOM   1954 C C   . GLY A 1 249 ? -14.114 47.867 68.767 1.00 47.97  ? 249  GLY A C   1 
ATOM   1955 O O   . GLY A 1 249 ? -15.165 48.128 69.358 1.00 45.82  ? 249  GLY A O   1 
ATOM   1956 N N   . ARG A 1 250 ? -13.136 47.149 69.305 1.00 47.47  ? 250  ARG A N   1 
ATOM   1957 C CA  . ARG A 1 250 ? -13.240 46.621 70.651 1.00 48.76  ? 250  ARG A CA  1 
ATOM   1958 C C   . ARG A 1 250 ? -13.354 47.785 71.648 1.00 49.46  ? 250  ARG A C   1 
ATOM   1959 O O   . ARG A 1 250 ? -14.045 47.677 72.660 1.00 49.61  ? 250  ARG A O   1 
ATOM   1960 C CB  . ARG A 1 250 ? -12.015 45.758 70.960 1.00 47.67  ? 250  ARG A CB  1 
ATOM   1961 C CG  . ARG A 1 250 ? -12.110 44.995 72.256 1.00 51.22  ? 250  ARG A CG  1 
ATOM   1962 C CD  . ARG A 1 250 ? -10.893 44.100 72.493 1.00 54.50  ? 250  ARG A CD  1 
ATOM   1963 N NE  . ARG A 1 250 ? -10.900 42.866 71.708 1.00 58.92  ? 250  ARG A NE  1 
ATOM   1964 C CZ  . ARG A 1 250 ? -10.249 42.689 70.559 1.00 62.48  ? 250  ARG A CZ  1 
ATOM   1965 N NH1 . ARG A 1 250 ? -10.321 41.521 69.929 1.00 61.51  ? 250  ARG A NH1 1 
ATOM   1966 N NH2 . ARG A 1 250 ? -9.521  43.672 70.038 1.00 63.46  ? 250  ARG A NH2 1 
ATOM   1967 N N   . ASN A 1 251 ? -12.697 48.903 71.349 1.00 49.86  ? 251  ASN A N   1 
ATOM   1968 C CA  . ASN A 1 251 ? -12.736 50.076 72.224 1.00 49.82  ? 251  ASN A CA  1 
ATOM   1969 C C   . ASN A 1 251 ? -14.080 50.798 72.184 1.00 51.92  ? 251  ASN A C   1 
ATOM   1970 O O   . ASN A 1 251 ? -14.429 51.538 73.110 1.00 51.33  ? 251  ASN A O   1 
ATOM   1971 C CB  . ASN A 1 251 ? -11.619 51.057 71.843 1.00 48.96  ? 251  ASN A CB  1 
ATOM   1972 C CG  . ASN A 1 251 ? -10.325 50.800 72.602 1.00 45.81  ? 251  ASN A CG  1 
ATOM   1973 O OD1 . ASN A 1 251 ? -10.033 51.468 73.594 1.00 45.61  ? 251  ASN A OD1 1 
ATOM   1974 N ND2 . ASN A 1 251 ? -9.551  49.822 72.144 1.00 42.54  ? 251  ASN A ND2 1 
ATOM   1975 N N   . LEU A 1 252 ? -14.838 50.578 71.116 1.00 53.86  ? 252  LEU A N   1 
ATOM   1976 C CA  . LEU A 1 252 ? -16.137 51.224 70.969 1.00 55.39  ? 252  LEU A CA  1 
ATOM   1977 C C   . LEU A 1 252 ? -17.316 50.272 71.144 1.00 56.96  ? 252  LEU A C   1 
ATOM   1978 O O   . LEU A 1 252 ? -18.439 50.586 70.749 1.00 56.57  ? 252  LEU A O   1 
ATOM   1979 C CB  . LEU A 1 252 ? -16.217 51.918 69.609 1.00 54.21  ? 252  LEU A CB  1 
ATOM   1980 C CG  . LEU A 1 252 ? -15.201 53.049 69.446 1.00 53.46  ? 252  LEU A CG  1 
ATOM   1981 C CD1 . LEU A 1 252 ? -15.181 53.524 68.004 1.00 53.96  ? 252  LEU A CD1 1 
ATOM   1982 C CD2 . LEU A 1 252 ? -15.551 54.191 70.394 1.00 54.04  ? 252  LEU A CD2 1 
ATOM   1983 N N   . ASN A 1 253 ? -17.054 49.112 71.740 1.00 59.67  ? 253  ASN A N   1 
ATOM   1984 C CA  . ASN A 1 253 ? -18.090 48.113 71.996 1.00 60.83  ? 253  ASN A CA  1 
ATOM   1985 C C   . ASN A 1 253 ? -18.789 47.701 70.709 1.00 61.31  ? 253  ASN A C   1 
ATOM   1986 O O   . ASN A 1 253 ? -20.016 47.696 70.632 1.00 62.32  ? 253  ASN A O   1 
ATOM   1987 C CB  . ASN A 1 253 ? -19.118 48.683 72.978 1.00 63.30  ? 253  ASN A CB  1 
ATOM   1988 C CG  . ASN A 1 253 ? -18.468 49.378 74.168 1.00 66.07  ? 253  ASN A CG  1 
ATOM   1989 O OD1 . ASN A 1 253 ? -17.784 48.745 74.979 1.00 65.91  ? 253  ASN A OD1 1 
ATOM   1990 N ND2 . ASN A 1 253 ? -18.672 50.693 74.270 1.00 65.24  ? 253  ASN A ND2 1 
ATOM   1991 N N   . CYS A 1 254 ? -18.002 47.351 69.699 1.00 61.15  ? 254  CYS A N   1 
ATOM   1992 C CA  . CYS A 1 254 ? -18.544 46.950 68.408 1.00 60.95  ? 254  CYS A CA  1 
ATOM   1993 C C   . CYS A 1 254 ? -18.650 45.442 68.257 1.00 61.55  ? 254  CYS A C   1 
ATOM   1994 O O   . CYS A 1 254 ? -17.926 44.689 68.907 1.00 61.83  ? 254  CYS A O   1 
ATOM   1995 C CB  . CYS A 1 254 ? -17.662 47.471 67.269 1.00 60.99  ? 254  CYS A CB  1 
ATOM   1996 S SG  . CYS A 1 254 ? -17.800 49.234 66.839 1.00 61.81  ? 254  CYS A SG  1 
ATOM   1997 N N   . ASN A 1 255 ? -19.559 45.009 67.387 1.00 62.13  ? 255  ASN A N   1 
ATOM   1998 C CA  . ASN A 1 255 ? -19.728 43.594 67.098 1.00 62.21  ? 255  ASN A CA  1 
ATOM   1999 C C   . ASN A 1 255 ? -18.507 43.278 66.247 1.00 61.35  ? 255  ASN A C   1 
ATOM   2000 O O   . ASN A 1 255 ? -18.245 43.975 65.271 1.00 60.36  ? 255  ASN A O   1 
ATOM   2001 C CB  . ASN A 1 255 ? -20.999 43.366 66.279 1.00 64.65  ? 255  ASN A CB  1 
ATOM   2002 C CG  . ASN A 1 255 ? -21.196 41.907 65.895 1.00 66.63  ? 255  ASN A CG  1 
ATOM   2003 O OD1 . ASN A 1 255 ? -20.314 41.277 65.302 1.00 66.57  ? 255  ASN A OD1 1 
ATOM   2004 N ND2 . ASN A 1 255 ? -22.361 41.367 66.224 1.00 69.26  ? 255  ASN A ND2 1 
ATOM   2005 N N   . LEU A 1 256 ? -17.759 42.243 66.609 1.00 61.04  ? 256  LEU A N   1 
ATOM   2006 C CA  . LEU A 1 256 ? -16.562 41.898 65.854 1.00 62.30  ? 256  LEU A CA  1 
ATOM   2007 C C   . LEU A 1 256 ? -16.667 40.562 65.128 1.00 63.82  ? 256  LEU A C   1 
ATOM   2008 O O   . LEU A 1 256 ? -15.655 39.906 64.876 1.00 64.13  ? 256  LEU A O   1 
ATOM   2009 C CB  . LEU A 1 256 ? -15.351 41.880 66.791 1.00 61.17  ? 256  LEU A CB  1 
ATOM   2010 C CG  . LEU A 1 256 ? -15.167 43.133 67.655 1.00 60.61  ? 256  LEU A CG  1 
ATOM   2011 C CD1 . LEU A 1 256 ? -13.968 42.950 68.571 1.00 60.84  ? 256  LEU A CD1 1 
ATOM   2012 C CD2 . LEU A 1 256 ? -14.984 44.357 66.771 1.00 59.79  ? 256  LEU A CD2 1 
ATOM   2013 N N   . ASN A 1 257 ? -17.887 40.168 64.775 1.00 65.08  ? 257  ASN A N   1 
ATOM   2014 C CA  . ASN A 1 257 ? -18.109 38.900 64.083 1.00 66.34  ? 257  ASN A CA  1 
ATOM   2015 C C   . ASN A 1 257 ? -17.657 38.904 62.634 1.00 64.99  ? 257  ASN A C   1 
ATOM   2016 O O   . ASN A 1 257 ? -17.405 37.844 62.058 1.00 65.63  ? 257  ASN A O   1 
ATOM   2017 C CB  . ASN A 1 257 ? -19.584 38.517 64.147 1.00 69.73  ? 257  ASN A CB  1 
ATOM   2018 C CG  . ASN A 1 257 ? -20.014 38.109 65.537 1.00 72.86  ? 257  ASN A CG  1 
ATOM   2019 O OD1 . ASN A 1 257 ? -21.208 38.033 65.834 1.00 75.27  ? 257  ASN A OD1 1 
ATOM   2020 N ND2 . ASN A 1 257 ? -19.038 37.836 66.401 1.00 73.20  ? 257  ASN A ND2 1 
ATOM   2021 N N   . SER A 1 258 ? -17.558 40.092 62.044 1.00 63.58  ? 258  SER A N   1 
ATOM   2022 C CA  . SER A 1 258 ? -17.133 40.208 60.652 1.00 61.41  ? 258  SER A CA  1 
ATOM   2023 C C   . SER A 1 258 ? -16.768 41.641 60.302 1.00 59.78  ? 258  SER A C   1 
ATOM   2024 O O   . SER A 1 258 ? -17.182 42.583 60.981 1.00 58.65  ? 258  SER A O   1 
ATOM   2025 C CB  . SER A 1 258 ? -18.251 39.755 59.718 1.00 59.85  ? 258  SER A CB  1 
ATOM   2026 O OG  . SER A 1 258 ? -19.316 40.691 59.744 1.00 58.93  ? 258  SER A OG  1 
ATOM   2027 N N   . ASP A 1 259 ? -16.000 41.794 59.228 1.00 57.85  ? 259  ASP A N   1 
ATOM   2028 C CA  . ASP A 1 259 ? -15.600 43.109 58.766 1.00 56.70  ? 259  ASP A CA  1 
ATOM   2029 C C   . ASP A 1 259 ? -16.865 43.916 58.513 1.00 56.45  ? 259  ASP A C   1 
ATOM   2030 O O   . ASP A 1 259 ? -16.945 45.095 58.854 1.00 57.29  ? 259  ASP A O   1 
ATOM   2031 C CB  . ASP A 1 259 ? -14.782 42.997 57.473 1.00 55.71  ? 259  ASP A CB  1 
ATOM   2032 C CG  . ASP A 1 259 ? -13.397 42.410 57.702 1.00 56.79  ? 259  ASP A CG  1 
ATOM   2033 O OD1 . ASP A 1 259 ? -13.116 41.966 58.836 1.00 58.09  ? 259  ASP A OD1 1 
ATOM   2034 O OD2 . ASP A 1 259 ? -12.586 42.388 56.750 1.00 56.14  ? 259  ASP A OD2 1 
ATOM   2035 N N   A GLU A 1 260 ? -17.860 43.281 57.903 0.50 56.56  ? 260  GLU A N   1 
ATOM   2036 N N   B GLU A 1 260 ? -17.860 43.256 57.933 0.50 56.24  ? 260  GLU A N   1 
ATOM   2037 C CA  A GLU A 1 260 ? -19.117 43.956 57.600 0.50 56.42  ? 260  GLU A CA  1 
ATOM   2038 C CA  B GLU A 1 260 ? -19.134 43.886 57.626 0.50 55.86  ? 260  GLU A CA  1 
ATOM   2039 C C   A GLU A 1 260 ? -19.741 44.554 58.854 0.50 55.86  ? 260  GLU A C   1 
ATOM   2040 C C   B GLU A 1 260 ? -19.763 44.465 58.891 0.50 55.59  ? 260  GLU A C   1 
ATOM   2041 O O   A GLU A 1 260 ? -20.122 45.727 58.875 0.50 55.39  ? 260  GLU A O   1 
ATOM   2042 O O   B GLU A 1 260 ? -20.191 45.620 58.912 0.50 55.20  ? 260  GLU A O   1 
ATOM   2043 C CB  A GLU A 1 260 ? -20.098 42.977 56.949 0.50 57.74  ? 260  GLU A CB  1 
ATOM   2044 C CB  B GLU A 1 260 ? -20.079 42.859 56.992 0.50 56.38  ? 260  GLU A CB  1 
ATOM   2045 C CG  A GLU A 1 260 ? -21.495 43.540 56.739 0.50 58.31  ? 260  GLU A CG  1 
ATOM   2046 C CG  B GLU A 1 260 ? -19.530 42.179 55.734 0.50 55.78  ? 260  GLU A CG  1 
ATOM   2047 C CD  A GLU A 1 260 ? -22.408 42.571 56.015 0.50 59.68  ? 260  GLU A CD  1 
ATOM   2048 C CD  B GLU A 1 260 ? -18.284 41.345 55.997 0.50 55.32  ? 260  GLU A CD  1 
ATOM   2049 O OE1 A GLU A 1 260 ? -22.492 41.400 56.443 0.50 60.42  ? 260  GLU A OE1 1 
ATOM   2050 O OE1 B GLU A 1 260 ? -18.330 40.469 56.885 0.50 54.71  ? 260  GLU A OE1 1 
ATOM   2051 O OE2 A GLU A 1 260 ? -23.046 42.980 55.021 0.50 60.17  ? 260  GLU A OE2 1 
ATOM   2052 O OE2 B GLU A 1 260 ? -17.262 41.559 55.311 0.50 54.74  ? 260  GLU A OE2 1 
ATOM   2053 N N   A GLU A 1 261 ? -19.843 43.743 59.900 0.50 55.25  ? 261  GLU A N   1 
ATOM   2054 N N   B GLU A 1 261 ? -19.812 43.655 59.945 0.50 55.32  ? 261  GLU A N   1 
ATOM   2055 C CA  A GLU A 1 261 ? -20.421 44.190 61.159 0.50 54.91  ? 261  GLU A CA  1 
ATOM   2056 C CA  B GLU A 1 261 ? -20.382 44.077 61.222 0.50 55.34  ? 261  GLU A CA  1 
ATOM   2057 C C   A GLU A 1 261 ? -19.540 45.247 61.819 0.50 54.26  ? 261  GLU A C   1 
ATOM   2058 C C   B GLU A 1 261 ? -19.548 45.192 61.852 0.50 54.53  ? 261  GLU A C   1 
ATOM   2059 O O   A GLU A 1 261 ? -20.039 46.265 62.309 0.50 53.60  ? 261  GLU A O   1 
ATOM   2060 O O   B GLU A 1 261 ? -20.083 46.191 62.342 0.50 53.98  ? 261  GLU A O   1 
ATOM   2061 C CB  A GLU A 1 261 ? -20.621 42.989 62.087 0.50 56.08  ? 261  GLU A CB  1 
ATOM   2062 C CB  B GLU A 1 261 ? -20.441 42.889 62.193 0.50 57.10  ? 261  GLU A CB  1 
ATOM   2063 C CG  A GLU A 1 261 ? -21.790 42.095 61.676 0.50 56.88  ? 261  GLU A CG  1 
ATOM   2064 C CG  B GLU A 1 261 ? -21.548 41.868 61.928 0.50 58.72  ? 261  GLU A CG  1 
ATOM   2065 C CD  A GLU A 1 261 ? -21.497 40.620 61.854 0.50 55.81  ? 261  GLU A CD  1 
ATOM   2066 C CD  B GLU A 1 261 ? -22.861 42.234 62.604 0.50 59.17  ? 261  GLU A CD  1 
ATOM   2067 O OE1 A GLU A 1 261 ? -22.445 39.811 61.799 0.50 56.01  ? 261  GLU A OE1 1 
ATOM   2068 O OE1 B GLU A 1 261 ? -23.811 41.426 62.539 0.50 57.95  ? 261  GLU A OE1 1 
ATOM   2069 O OE2 A GLU A 1 261 ? -20.314 40.270 62.035 0.50 56.87  ? 261  GLU A OE2 1 
ATOM   2070 O OE2 B GLU A 1 261 ? -22.940 43.329 63.201 0.50 60.31  ? 261  GLU A OE2 1 
ATOM   2071 N N   . LEU A 1 262 ? -18.231 45.008 61.830 1.00 53.64  ? 262  LEU A N   1 
ATOM   2072 C CA  . LEU A 1 262 ? -17.296 45.964 62.413 1.00 51.42  ? 262  LEU A CA  1 
ATOM   2073 C C   . LEU A 1 262 ? -17.384 47.319 61.734 1.00 50.70  ? 262  LEU A C   1 
ATOM   2074 O O   . LEU A 1 262 ? -17.551 48.340 62.393 1.00 51.19  ? 262  LEU A O   1 
ATOM   2075 C CB  . LEU A 1 262 ? -15.862 45.430 62.309 1.00 50.87  ? 262  LEU A CB  1 
ATOM   2076 C CG  . LEU A 1 262 ? -14.696 46.338 62.721 1.00 49.43  ? 262  LEU A CG  1 
ATOM   2077 C CD1 . LEU A 1 262 ? -14.922 46.881 64.110 1.00 47.50  ? 262  LEU A CD1 1 
ATOM   2078 C CD2 . LEU A 1 262 ? -13.391 45.554 62.667 1.00 48.15  ? 262  LEU A CD2 1 
ATOM   2079 N N   . ILE A 1 263 ? -17.284 47.323 60.412 1.00 50.38  ? 263  ILE A N   1 
ATOM   2080 C CA  . ILE A 1 263 ? -17.330 48.565 59.658 1.00 52.17  ? 263  ILE A CA  1 
ATOM   2081 C C   . ILE A 1 263 ? -18.629 49.327 59.864 1.00 54.28  ? 263  ILE A C   1 
ATOM   2082 O O   . ILE A 1 263 ? -18.617 50.550 59.993 1.00 55.03  ? 263  ILE A O   1 
ATOM   2083 C CB  . ILE A 1 263 ? -17.143 48.315 58.144 1.00 51.19  ? 263  ILE A CB  1 
ATOM   2084 C CG1 . ILE A 1 263 ? -15.790 47.651 57.887 1.00 50.67  ? 263  ILE A CG1 1 
ATOM   2085 C CG2 . ILE A 1 263 ? -17.245 49.634 57.386 1.00 49.49  ? 263  ILE A CG2 1 
ATOM   2086 C CD1 . ILE A 1 263 ? -15.563 47.247 56.444 1.00 50.59  ? 263  ILE A CD1 1 
ATOM   2087 N N   . HIS A 1 264 ? -19.749 48.613 59.897 1.00 57.43  ? 264  HIS A N   1 
ATOM   2088 C CA  . HIS A 1 264 ? -21.040 49.264 60.076 1.00 59.22  ? 264  HIS A CA  1 
ATOM   2089 C C   . HIS A 1 264 ? -21.100 50.010 61.397 1.00 58.53  ? 264  HIS A C   1 
ATOM   2090 O O   . HIS A 1 264 ? -21.641 51.114 61.479 1.00 58.55  ? 264  HIS A O   1 
ATOM   2091 C CB  . HIS A 1 264 ? -22.173 48.242 60.026 1.00 63.84  ? 264  HIS A CB  1 
ATOM   2092 C CG  . HIS A 1 264 ? -23.510 48.819 60.376 1.00 68.81  ? 264  HIS A CG  1 
ATOM   2093 N ND1 . HIS A 1 264 ? -24.099 49.829 59.643 1.00 70.77  ? 264  HIS A ND1 1 
ATOM   2094 C CD2 . HIS A 1 264 ? -24.353 48.558 61.403 1.00 69.86  ? 264  HIS A CD2 1 
ATOM   2095 C CE1 . HIS A 1 264 ? -25.245 50.167 60.206 1.00 71.20  ? 264  HIS A CE1 1 
ATOM   2096 N NE2 . HIS A 1 264 ? -25.424 49.411 61.276 1.00 71.19  ? 264  HIS A NE2 1 
ATOM   2097 N N   . CYS A 1 265 ? -20.542 49.388 62.428 1.00 58.05  ? 265  CYS A N   1 
ATOM   2098 C CA  . CYS A 1 265 ? -20.512 49.960 63.768 1.00 57.63  ? 265  CYS A CA  1 
ATOM   2099 C C   . CYS A 1 265 ? -19.665 51.229 63.812 1.00 56.33  ? 265  CYS A C   1 
ATOM   2100 O O   . CYS A 1 265 ? -20.105 52.264 64.320 1.00 55.86  ? 265  CYS A O   1 
ATOM   2101 C CB  . CYS A 1 265 ? -19.957 48.926 64.745 1.00 58.92  ? 265  CYS A CB  1 
ATOM   2102 S SG  . CYS A 1 265 ? -19.782 49.468 66.475 1.00 63.29  ? 265  CYS A SG  1 
ATOM   2103 N N   . LEU A 1 266 ? -18.451 51.140 63.273 1.00 53.90  ? 266  LEU A N   1 
ATOM   2104 C CA  . LEU A 1 266 ? -17.542 52.277 63.246 1.00 51.64  ? 266  LEU A CA  1 
ATOM   2105 C C   . LEU A 1 266 ? -18.157 53.436 62.486 1.00 51.50  ? 266  LEU A C   1 
ATOM   2106 O O   . LEU A 1 266 ? -17.899 54.599 62.796 1.00 51.65  ? 266  LEU A O   1 
ATOM   2107 C CB  . LEU A 1 266 ? -16.216 51.871 62.600 1.00 48.11  ? 266  LEU A CB  1 
ATOM   2108 C CG  . LEU A 1 266 ? -15.459 50.802 63.385 1.00 43.61  ? 266  LEU A CG  1 
ATOM   2109 C CD1 . LEU A 1 266 ? -14.249 50.349 62.602 1.00 43.05  ? 266  LEU A CD1 1 
ATOM   2110 C CD2 . LEU A 1 266 ? -15.067 51.362 64.744 1.00 41.04  ? 266  LEU A CD2 1 
ATOM   2111 N N   . ARG A 1 267 ? -18.982 53.115 61.496 1.00 52.48  ? 267  ARG A N   1 
ATOM   2112 C CA  . ARG A 1 267 ? -19.627 54.145 60.696 1.00 54.04  ? 267  ARG A CA  1 
ATOM   2113 C C   . ARG A 1 267 ? -20.764 54.844 61.421 1.00 54.42  ? 267  ARG A C   1 
ATOM   2114 O O   . ARG A 1 267 ? -21.119 55.965 61.074 1.00 53.86  ? 267  ARG A O   1 
ATOM   2115 C CB  . ARG A 1 267 ? -20.131 53.557 59.380 1.00 54.40  ? 267  ARG A CB  1 
ATOM   2116 C CG  . ARG A 1 267 ? -19.014 53.295 58.394 1.00 56.80  ? 267  ARG A CG  1 
ATOM   2117 C CD  . ARG A 1 267 ? -19.518 52.789 57.061 1.00 55.67  ? 267  ARG A CD  1 
ATOM   2118 N NE  . ARG A 1 267 ? -18.418 52.706 56.108 1.00 57.11  ? 267  ARG A NE  1 
ATOM   2119 C CZ  . ARG A 1 267 ? -18.487 52.076 54.942 1.00 57.36  ? 267  ARG A CZ  1 
ATOM   2120 N NH1 . ARG A 1 267 ? -19.610 51.469 54.585 1.00 58.32  ? 267  ARG A NH1 1 
ATOM   2121 N NH2 . ARG A 1 267 ? -17.431 52.047 54.138 1.00 56.90  ? 267  ARG A NH2 1 
ATOM   2122 N N   . GLU A 1 268 ? -21.330 54.190 62.430 1.00 56.40  ? 268  GLU A N   1 
ATOM   2123 C CA  . GLU A 1 268 ? -22.426 54.790 63.183 1.00 59.65  ? 268  GLU A CA  1 
ATOM   2124 C C   . GLU A 1 268 ? -21.896 55.678 64.300 1.00 58.53  ? 268  GLU A C   1 
ATOM   2125 O O   . GLU A 1 268 ? -22.641 56.469 64.877 1.00 58.14  ? 268  GLU A O   1 
ATOM   2126 C CB  . GLU A 1 268 ? -23.333 53.711 63.787 1.00 64.39  ? 268  GLU A CB  1 
ATOM   2127 C CG  . GLU A 1 268 ? -23.969 52.768 62.772 1.00 72.13  ? 268  GLU A CG  1 
ATOM   2128 C CD  . GLU A 1 268 ? -24.569 53.497 61.575 1.00 76.69  ? 268  GLU A CD  1 
ATOM   2129 O OE1 . GLU A 1 268 ? -25.381 54.430 61.780 1.00 77.99  ? 268  GLU A OE1 1 
ATOM   2130 O OE2 . GLU A 1 268 ? -24.222 53.126 60.428 1.00 78.39  ? 268  GLU A OE2 1 
ATOM   2131 N N   . LYS A 1 269 ? -20.610 55.538 64.608 1.00 57.47  ? 269  LYS A N   1 
ATOM   2132 C CA  . LYS A 1 269 ? -19.995 56.329 65.663 1.00 55.20  ? 269  LYS A CA  1 
ATOM   2133 C C   . LYS A 1 269 ? -19.682 57.726 65.160 1.00 55.23  ? 269  LYS A C   1 
ATOM   2134 O O   . LYS A 1 269 ? -19.361 57.916 63.988 1.00 56.41  ? 269  LYS A O   1 
ATOM   2135 C CB  . LYS A 1 269 ? -18.708 55.663 66.132 1.00 55.75  ? 269  LYS A CB  1 
ATOM   2136 C CG  . LYS A 1 269 ? -18.877 54.235 66.602 1.00 56.98  ? 269  LYS A CG  1 
ATOM   2137 C CD  . LYS A 1 269 ? -19.748 54.149 67.842 1.00 58.34  ? 269  LYS A CD  1 
ATOM   2138 C CE  . LYS A 1 269 ? -19.890 52.707 68.303 1.00 59.26  ? 269  LYS A CE  1 
ATOM   2139 N NZ  . LYS A 1 269 ? -20.599 52.609 69.610 1.00 62.66  ? 269  LYS A NZ  1 
ATOM   2140 N N   . LYS A 1 270 ? -19.780 58.705 66.051 1.00 55.05  ? 270  LYS A N   1 
ATOM   2141 C CA  . LYS A 1 270 ? -19.492 60.086 65.693 1.00 55.10  ? 270  LYS A CA  1 
ATOM   2142 C C   . LYS A 1 270 ? -17.980 60.238 65.559 1.00 54.13  ? 270  LYS A C   1 
ATOM   2143 O O   . LYS A 1 270 ? -17.215 59.475 66.151 1.00 53.41  ? 270  LYS A O   1 
ATOM   2144 C CB  . LYS A 1 270 ? -20.028 61.033 66.765 1.00 58.10  ? 270  LYS A CB  1 
ATOM   2145 C CG  . LYS A 1 270 ? -21.525 60.896 67.003 1.00 62.85  ? 270  LYS A CG  1 
ATOM   2146 C CD  . LYS A 1 270 ? -22.052 61.964 67.949 1.00 67.02  ? 270  LYS A CD  1 
ATOM   2147 C CE  . LYS A 1 270 ? -21.963 63.360 67.325 1.00 71.76  ? 270  LYS A CE  1 
ATOM   2148 N NZ  . LYS A 1 270 ? -22.827 63.514 66.111 1.00 72.65  ? 270  LYS A NZ  1 
ATOM   2149 N N   . PRO A 1 271 ? -17.526 61.235 64.791 1.00 52.56  ? 271  PRO A N   1 
ATOM   2150 C CA  . PRO A 1 271 ? -16.087 61.440 64.605 1.00 52.02  ? 271  PRO A CA  1 
ATOM   2151 C C   . PRO A 1 271 ? -15.258 61.409 65.892 1.00 49.94  ? 271  PRO A C   1 
ATOM   2152 O O   . PRO A 1 271 ? -14.368 60.572 66.047 1.00 47.74  ? 271  PRO A O   1 
ATOM   2153 C CB  . PRO A 1 271 ? -16.023 62.798 63.906 1.00 53.13  ? 271  PRO A CB  1 
ATOM   2154 C CG  . PRO A 1 271 ? -17.320 62.850 63.156 1.00 53.08  ? 271  PRO A CG  1 
ATOM   2155 C CD  . PRO A 1 271 ? -18.291 62.331 64.174 1.00 51.41  ? 271  PRO A CD  1 
ATOM   2156 N N   . GLN A 1 272 ? -15.563 62.316 66.814 1.00 49.69  ? 272  GLN A N   1 
ATOM   2157 C CA  . GLN A 1 272 ? -14.826 62.408 68.067 1.00 49.76  ? 272  GLN A CA  1 
ATOM   2158 C C   . GLN A 1 272 ? -14.781 61.116 68.863 1.00 49.03  ? 272  GLN A C   1 
ATOM   2159 O O   . GLN A 1 272 ? -13.884 60.923 69.678 1.00 49.28  ? 272  GLN A O   1 
ATOM   2160 C CB  . GLN A 1 272 ? -15.400 63.520 68.940 1.00 49.73  ? 272  GLN A CB  1 
ATOM   2161 C CG  . GLN A 1 272 ? -14.492 63.906 70.094 1.00 51.01  ? 272  GLN A CG  1 
ATOM   2162 C CD  . GLN A 1 272 ? -13.063 64.153 69.637 1.00 52.38  ? 272  GLN A CD  1 
ATOM   2163 O OE1 . GLN A 1 272 ? -12.826 64.897 68.685 1.00 51.64  ? 272  GLN A OE1 1 
ATOM   2164 N NE2 . GLN A 1 272 ? -12.105 63.529 70.315 1.00 53.10  ? 272  GLN A NE2 1 
ATOM   2165 N N   . GLU A 1 273 ? -15.743 60.231 68.629 1.00 49.53  ? 273  GLU A N   1 
ATOM   2166 C CA  . GLU A 1 273 ? -15.777 58.956 69.337 1.00 49.40  ? 273  GLU A CA  1 
ATOM   2167 C C   . GLU A 1 273 ? -14.600 58.088 68.922 1.00 47.76  ? 273  GLU A C   1 
ATOM   2168 O O   . GLU A 1 273 ? -13.946 57.467 69.757 1.00 48.47  ? 273  GLU A O   1 
ATOM   2169 C CB  . GLU A 1 273 ? -17.095 58.228 69.062 1.00 52.51  ? 273  GLU A CB  1 
ATOM   2170 C CG  . GLU A 1 273 ? -18.295 58.864 69.757 1.00 57.79  ? 273  GLU A CG  1 
ATOM   2171 C CD  . GLU A 1 273 ? -19.566 58.060 69.583 1.00 61.11  ? 273  GLU A CD  1 
ATOM   2172 O OE1 . GLU A 1 273 ? -20.223 58.199 68.531 1.00 61.70  ? 273  GLU A OE1 1 
ATOM   2173 O OE2 . GLU A 1 273 ? -19.898 57.274 70.498 1.00 64.68  ? 273  GLU A OE2 1 
ATOM   2174 N N   . LEU A 1 274 ? -14.326 58.049 67.626 1.00 46.35  ? 274  LEU A N   1 
ATOM   2175 C CA  . LEU A 1 274 ? -13.208 57.267 67.129 1.00 46.63  ? 274  LEU A CA  1 
ATOM   2176 C C   . LEU A 1 274 ? -11.901 57.918 67.567 1.00 45.61  ? 274  LEU A C   1 
ATOM   2177 O O   . LEU A 1 274 ? -10.940 57.235 67.893 1.00 45.51  ? 274  LEU A O   1 
ATOM   2178 C CB  . LEU A 1 274 ? -13.255 57.172 65.601 1.00 46.46  ? 274  LEU A CB  1 
ATOM   2179 C CG  . LEU A 1 274 ? -14.083 56.051 64.965 1.00 46.71  ? 274  LEU A CG  1 
ATOM   2180 C CD1 . LEU A 1 274 ? -15.469 56.032 65.553 1.00 47.77  ? 274  LEU A CD1 1 
ATOM   2181 C CD2 . LEU A 1 274 ? -14.153 56.261 63.463 1.00 47.24  ? 274  LEU A CD2 1 
ATOM   2182 N N   . ILE A 1 275 ? -11.877 59.245 67.586 1.00 44.72  ? 275  ILE A N   1 
ATOM   2183 C CA  . ILE A 1 275 ? -10.680 59.978 67.971 1.00 44.18  ? 275  ILE A CA  1 
ATOM   2184 C C   . ILE A 1 275 ? -10.326 59.842 69.455 1.00 45.37  ? 275  ILE A C   1 
ATOM   2185 O O   . ILE A 1 275 ? -9.148  59.840 69.814 1.00 45.59  ? 275  ILE A O   1 
ATOM   2186 C CB  . ILE A 1 275 ? -10.822 61.473 67.607 1.00 42.73  ? 275  ILE A CB  1 
ATOM   2187 C CG1 . ILE A 1 275 ? -10.934 61.623 66.090 1.00 40.24  ? 275  ILE A CG1 1 
ATOM   2188 C CG2 . ILE A 1 275 ? -9.625  62.261 68.116 1.00 42.48  ? 275  ILE A CG2 1 
ATOM   2189 C CD1 . ILE A 1 275 ? -11.299 63.020 65.644 1.00 39.80  ? 275  ILE A CD1 1 
ATOM   2190 N N   . ASP A 1 276 ? -11.329 59.712 70.318 1.00 44.31  ? 276  ASP A N   1 
ATOM   2191 C CA  . ASP A 1 276 ? -11.052 59.584 71.745 1.00 44.07  ? 276  ASP A CA  1 
ATOM   2192 C C   . ASP A 1 276 ? -10.299 58.321 72.141 1.00 43.41  ? 276  ASP A C   1 
ATOM   2193 O O   . ASP A 1 276 ? -9.569  58.325 73.127 1.00 44.85  ? 276  ASP A O   1 
ATOM   2194 C CB  . ASP A 1 276 ? -12.337 59.641 72.563 1.00 45.69  ? 276  ASP A CB  1 
ATOM   2195 C CG  . ASP A 1 276 ? -12.958 61.016 72.586 1.00 48.29  ? 276  ASP A CG  1 
ATOM   2196 O OD1 . ASP A 1 276 ? -12.216 62.023 72.543 1.00 47.35  ? 276  ASP A OD1 1 
ATOM   2197 O OD2 . ASP A 1 276 ? -14.202 61.081 72.668 1.00 52.65  ? 276  ASP A OD2 1 
ATOM   2198 N N   . VAL A 1 277 ? -10.477 57.242 71.386 1.00 41.89  ? 277  VAL A N   1 
ATOM   2199 C CA  . VAL A 1 277 ? -9.819  55.978 71.702 1.00 40.40  ? 277  VAL A CA  1 
ATOM   2200 C C   . VAL A 1 277 ? -8.749  55.587 70.695 1.00 41.05  ? 277  VAL A C   1 
ATOM   2201 O O   . VAL A 1 277 ? -8.166  54.508 70.785 1.00 40.23  ? 277  VAL A O   1 
ATOM   2202 C CB  . VAL A 1 277 ? -10.839 54.821 71.765 1.00 42.80  ? 277  VAL A CB  1 
ATOM   2203 C CG1 . VAL A 1 277 ? -11.869 55.086 72.846 1.00 40.40  ? 277  VAL A CG1 1 
ATOM   2204 C CG2 . VAL A 1 277 ? -11.521 54.656 70.413 1.00 42.63  ? 277  VAL A CG2 1 
ATOM   2205 N N   . GLU A 1 278 ? -8.488  56.469 69.740 1.00 41.01  ? 278  GLU A N   1 
ATOM   2206 C CA  . GLU A 1 278 ? -7.504  56.207 68.698 1.00 40.87  ? 278  GLU A CA  1 
ATOM   2207 C C   . GLU A 1 278 ? -6.144  55.702 69.182 1.00 41.49  ? 278  GLU A C   1 
ATOM   2208 O O   . GLU A 1 278 ? -5.604  54.743 68.635 1.00 41.57  ? 278  GLU A O   1 
ATOM   2209 C CB  . GLU A 1 278 ? -7.312  57.467 67.849 1.00 41.89  ? 278  GLU A CB  1 
ATOM   2210 C CG  . GLU A 1 278 ? -6.095  57.435 66.938 1.00 42.17  ? 278  GLU A CG  1 
ATOM   2211 C CD  . GLU A 1 278 ? -6.020  58.639 66.015 1.00 43.85  ? 278  GLU A CD  1 
ATOM   2212 O OE1 . GLU A 1 278 ? -4.951  58.841 65.402 1.00 44.11  ? 278  GLU A OE1 1 
ATOM   2213 O OE2 . GLU A 1 278 ? -7.025  59.379 65.898 1.00 42.30  ? 278  GLU A OE2 1 
ATOM   2214 N N   . TRP A 1 279 ? -5.593  56.340 70.207 1.00 41.02  ? 279  TRP A N   1 
ATOM   2215 C CA  . TRP A 1 279 ? -4.286  55.952 70.711 1.00 40.95  ? 279  TRP A CA  1 
ATOM   2216 C C   . TRP A 1 279 ? -4.254  54.675 71.535 1.00 42.02  ? 279  TRP A C   1 
ATOM   2217 O O   . TRP A 1 279 ? -3.182  54.236 71.949 1.00 43.41  ? 279  TRP A O   1 
ATOM   2218 C CB  . TRP A 1 279 ? -3.676  57.106 71.510 1.00 41.45  ? 279  TRP A CB  1 
ATOM   2219 C CG  . TRP A 1 279 ? -3.552  58.345 70.693 1.00 40.40  ? 279  TRP A CG  1 
ATOM   2220 C CD1 . TRP A 1 279 ? -4.483  59.331 70.556 1.00 40.81  ? 279  TRP A CD1 1 
ATOM   2221 C CD2 . TRP A 1 279 ? -2.459  58.702 69.843 1.00 40.07  ? 279  TRP A CD2 1 
ATOM   2222 N NE1 . TRP A 1 279 ? -4.038  60.284 69.672 1.00 40.76  ? 279  TRP A NE1 1 
ATOM   2223 C CE2 . TRP A 1 279 ? -2.798  59.923 69.219 1.00 40.56  ? 279  TRP A CE2 1 
ATOM   2224 C CE3 . TRP A 1 279 ? -1.224  58.108 69.546 1.00 40.69  ? 279  TRP A CE3 1 
ATOM   2225 C CZ2 . TRP A 1 279 ? -1.945  60.566 68.312 1.00 40.85  ? 279  TRP A CZ2 1 
ATOM   2226 C CZ3 . TRP A 1 279 ? -0.376  58.746 68.646 1.00 40.46  ? 279  TRP A CZ3 1 
ATOM   2227 C CH2 . TRP A 1 279 ? -0.742  59.964 68.040 1.00 40.33  ? 279  TRP A CH2 1 
ATOM   2228 N N   . ASN A 1 280 ? -5.413  54.064 71.762 1.00 42.26  ? 280  ASN A N   1 
ATOM   2229 C CA  . ASN A 1 280 ? -5.454  52.835 72.544 1.00 41.18  ? 280  ASN A CA  1 
ATOM   2230 C C   . ASN A 1 280 ? -5.131  51.589 71.731 1.00 40.60  ? 280  ASN A C   1 
ATOM   2231 O O   . ASN A 1 280 ? -5.062  50.497 72.283 1.00 42.64  ? 280  ASN A O   1 
ATOM   2232 C CB  . ASN A 1 280 ? -6.826  52.648 73.198 1.00 41.62  ? 280  ASN A CB  1 
ATOM   2233 C CG  . ASN A 1 280 ? -7.228  53.824 74.079 1.00 43.80  ? 280  ASN A CG  1 
ATOM   2234 O OD1 . ASN A 1 280 ? -6.382  54.564 74.581 1.00 43.36  ? 280  ASN A OD1 1 
ATOM   2235 N ND2 . ASN A 1 280 ? -8.528  53.986 74.283 1.00 43.03  ? 280  ASN A ND2 1 
ATOM   2236 N N   . VAL A 1 281 ? -4.907  51.738 70.431 1.00 39.69  ? 281  VAL A N   1 
ATOM   2237 C CA  . VAL A 1 281 ? -4.630  50.570 69.597 1.00 39.61  ? 281  VAL A CA  1 
ATOM   2238 C C   . VAL A 1 281 ? -3.154  50.254 69.327 1.00 41.43  ? 281  VAL A C   1 
ATOM   2239 O O   . VAL A 1 281 ? -2.839  49.212 68.754 1.00 40.98  ? 281  VAL A O   1 
ATOM   2240 C CB  . VAL A 1 281 ? -5.375  50.673 68.242 1.00 40.23  ? 281  VAL A CB  1 
ATOM   2241 C CG1 . VAL A 1 281 ? -6.880  50.850 68.486 1.00 37.03  ? 281  VAL A CG1 1 
ATOM   2242 C CG2 . VAL A 1 281 ? -4.826  51.829 67.431 1.00 37.24  ? 281  VAL A CG2 1 
ATOM   2243 N N   . LEU A 1 282 ? -2.252  51.144 69.728 1.00 41.09  ? 282  LEU A N   1 
ATOM   2244 C CA  . LEU A 1 282 ? -0.829  50.901 69.530 1.00 41.25  ? 282  LEU A CA  1 
ATOM   2245 C C   . LEU A 1 282 ? -0.417  49.588 70.198 1.00 41.97  ? 282  LEU A C   1 
ATOM   2246 O O   . LEU A 1 282 ? -0.850  49.280 71.310 1.00 42.43  ? 282  LEU A O   1 
ATOM   2247 C CB  . LEU A 1 282 ? -0.008  52.058 70.101 1.00 39.40  ? 282  LEU A CB  1 
ATOM   2248 C CG  . LEU A 1 282 ? -0.104  53.329 69.257 1.00 38.74  ? 282  LEU A CG  1 
ATOM   2249 C CD1 . LEU A 1 282 ? 0.524   54.501 69.993 1.00 38.97  ? 282  LEU A CD1 1 
ATOM   2250 C CD2 . LEU A 1 282 ? 0.573   53.089 67.912 1.00 35.64  ? 282  LEU A CD2 1 
ATOM   2251 N N   . PRO A 1 283 ? 0.428   48.796 69.524 1.00 41.72  ? 283  PRO A N   1 
ATOM   2252 C CA  . PRO A 1 283 ? 0.893   47.513 70.052 1.00 42.33  ? 283  PRO A CA  1 
ATOM   2253 C C   . PRO A 1 283 ? 1.896   47.615 71.194 1.00 44.20  ? 283  PRO A C   1 
ATOM   2254 O O   . PRO A 1 283 ? 1.978   46.718 72.034 1.00 45.29  ? 283  PRO A O   1 
ATOM   2255 C CB  . PRO A 1 283 ? 1.494   46.840 68.821 1.00 42.66  ? 283  PRO A CB  1 
ATOM   2256 C CG  . PRO A 1 283 ? 2.084   47.997 68.088 1.00 41.56  ? 283  PRO A CG  1 
ATOM   2257 C CD  . PRO A 1 283 ? 0.983   49.037 68.179 1.00 41.41  ? 283  PRO A CD  1 
ATOM   2258 N N   . PHE A 1 284 ? 2.663   48.701 71.226 1.00 44.96  ? 284  PHE A N   1 
ATOM   2259 C CA  . PHE A 1 284 ? 3.660   48.876 72.272 1.00 45.22  ? 284  PHE A CA  1 
ATOM   2260 C C   . PHE A 1 284 ? 3.646   50.257 72.887 1.00 44.71  ? 284  PHE A C   1 
ATOM   2261 O O   . PHE A 1 284 ? 3.028   51.188 72.369 1.00 45.11  ? 284  PHE A O   1 
ATOM   2262 C CB  . PHE A 1 284 ? 5.065   48.648 71.725 1.00 46.33  ? 284  PHE A CB  1 
ATOM   2263 C CG  . PHE A 1 284 ? 5.182   47.466 70.826 1.00 49.27  ? 284  PHE A CG  1 
ATOM   2264 C CD1 . PHE A 1 284 ? 5.031   46.177 71.326 1.00 50.98  ? 284  PHE A CD1 1 
ATOM   2265 C CD2 . PHE A 1 284 ? 5.443   47.643 69.471 1.00 49.51  ? 284  PHE A CD2 1 
ATOM   2266 C CE1 . PHE A 1 284 ? 5.138   45.076 70.487 1.00 53.45  ? 284  PHE A CE1 1 
ATOM   2267 C CE2 . PHE A 1 284 ? 5.553   46.559 68.621 1.00 51.92  ? 284  PHE A CE2 1 
ATOM   2268 C CZ  . PHE A 1 284 ? 5.401   45.267 69.126 1.00 54.63  ? 284  PHE A CZ  1 
ATOM   2269 N N   . ASP A 1 285 ? 4.342   50.365 74.013 1.00 43.57  ? 285  ASP A N   1 
ATOM   2270 C CA  . ASP A 1 285 ? 4.500   51.625 74.709 1.00 42.66  ? 285  ASP A CA  1 
ATOM   2271 C C   . ASP A 1 285 ? 5.627   52.214 73.857 1.00 43.04  ? 285  ASP A C   1 
ATOM   2272 O O   . ASP A 1 285 ? 6.729   51.656 73.797 1.00 43.00  ? 285  ASP A O   1 
ATOM   2273 C CB  . ASP A 1 285 ? 4.968   51.364 76.136 1.00 42.36  ? 285  ASP A CB  1 
ATOM   2274 C CG  . ASP A 1 285 ? 4.948   52.604 76.994 1.00 42.85  ? 285  ASP A CG  1 
ATOM   2275 O OD1 . ASP A 1 285 ? 4.414   53.640 76.540 1.00 43.64  ? 285  ASP A OD1 1 
ATOM   2276 O OD2 . ASP A 1 285 ? 5.458   52.531 78.133 1.00 42.92  ? 285  ASP A OD2 1 
ATOM   2277 N N   . SER A 1 286 ? 5.356   53.325 73.184 1.00 40.98  ? 286  SER A N   1 
ATOM   2278 C CA  . SER A 1 286 ? 6.359   53.890 72.300 1.00 39.36  ? 286  SER A CA  1 
ATOM   2279 C C   . SER A 1 286 ? 6.128   55.342 71.929 1.00 38.18  ? 286  SER A C   1 
ATOM   2280 O O   . SER A 1 286 ? 5.055   55.892 72.143 1.00 38.44  ? 286  SER A O   1 
ATOM   2281 C CB  . SER A 1 286 ? 6.359   53.077 71.016 1.00 40.11  ? 286  SER A CB  1 
ATOM   2282 O OG  . SER A 1 286 ? 5.048   53.088 70.467 1.00 40.82  ? 286  SER A OG  1 
ATOM   2283 N N   . ILE A 1 287 ? 7.153   55.962 71.365 1.00 36.58  ? 287  ILE A N   1 
ATOM   2284 C CA  . ILE A 1 287 ? 7.032   57.333 70.905 1.00 36.71  ? 287  ILE A CA  1 
ATOM   2285 C C   . ILE A 1 287 ? 7.283   57.261 69.411 1.00 35.56  ? 287  ILE A C   1 
ATOM   2286 O O   . ILE A 1 287 ? 7.869   56.301 68.922 1.00 35.12  ? 287  ILE A O   1 
ATOM   2287 C CB  . ILE A 1 287 ? 8.058   58.278 71.570 1.00 39.18  ? 287  ILE A CB  1 
ATOM   2288 C CG1 . ILE A 1 287 ? 9.473   57.726 71.414 1.00 38.84  ? 287  ILE A CG1 1 
ATOM   2289 C CG2 . ILE A 1 287 ? 7.695   58.490 73.024 1.00 40.19  ? 287  ILE A CG2 1 
ATOM   2290 C CD1 . ILE A 1 287 ? 10.540  58.631 71.984 1.00 40.29  ? 287  ILE A CD1 1 
ATOM   2291 N N   . PHE A 1 288 ? 6.831   58.270 68.685 1.00 33.96  ? 288  PHE A N   1 
ATOM   2292 C CA  . PHE A 1 288 ? 6.991   58.298 67.240 1.00 32.97  ? 288  PHE A CA  1 
ATOM   2293 C C   . PHE A 1 288 ? 6.338   57.080 66.568 1.00 33.85  ? 288  PHE A C   1 
ATOM   2294 O O   . PHE A 1 288 ? 6.910   56.458 65.672 1.00 33.99  ? 288  PHE A O   1 
ATOM   2295 C CB  . PHE A 1 288 ? 8.471   58.378 66.858 1.00 31.97  ? 288  PHE A CB  1 
ATOM   2296 C CG  . PHE A 1 288 ? 8.747   59.353 65.749 1.00 30.70  ? 288  PHE A CG  1 
ATOM   2297 C CD1 . PHE A 1 288 ? 7.952   59.366 64.600 1.00 28.74  ? 288  PHE A CD1 1 
ATOM   2298 C CD2 . PHE A 1 288 ? 9.785   60.270 65.856 1.00 26.64  ? 288  PHE A CD2 1 
ATOM   2299 C CE1 . PHE A 1 288 ? 8.188   60.284 63.574 1.00 26.42  ? 288  PHE A CE1 1 
ATOM   2300 C CE2 . PHE A 1 288 ? 10.027  61.186 64.838 1.00 27.20  ? 288  PHE A CE2 1 
ATOM   2301 C CZ  . PHE A 1 288 ? 9.226   61.194 63.695 1.00 25.04  ? 288  PHE A CZ  1 
ATOM   2302 N N   . ARG A 1 289 ? 5.142   56.735 67.038 1.00 33.15  ? 289  ARG A N   1 
ATOM   2303 C CA  . ARG A 1 289 ? 4.361   55.637 66.477 1.00 33.18  ? 289  ARG A CA  1 
ATOM   2304 C C   . ARG A 1 289 ? 2.913   56.112 66.432 1.00 33.24  ? 289  ARG A C   1 
ATOM   2305 O O   . ARG A 1 289 ? 2.389   56.660 67.403 1.00 32.56  ? 289  ARG A O   1 
ATOM   2306 C CB  . ARG A 1 289 ? 4.500   54.367 67.318 1.00 30.09  ? 289  ARG A CB  1 
ATOM   2307 C CG  . ARG A 1 289 ? 5.857   53.697 67.169 1.00 29.56  ? 289  ARG A CG  1 
ATOM   2308 C CD  . ARG A 1 289 ? 6.102   53.237 65.735 1.00 28.31  ? 289  ARG A CD  1 
ATOM   2309 N NE  . ARG A 1 289 ? 7.375   52.528 65.600 1.00 29.59  ? 289  ARG A NE  1 
ATOM   2310 C CZ  . ARG A 1 289 ? 8.570   53.115 65.560 1.00 28.96  ? 289  ARG A CZ  1 
ATOM   2311 N NH1 . ARG A 1 289 ? 8.672   54.434 65.639 1.00 28.50  ? 289  ARG A NH1 1 
ATOM   2312 N NH2 . ARG A 1 289 ? 9.666   52.381 65.446 1.00 26.12  ? 289  ARG A NH2 1 
ATOM   2313 N N   . PHE A 1 290 ? 2.278   55.920 65.287 1.00 33.17  ? 290  PHE A N   1 
ATOM   2314 C CA  . PHE A 1 290 ? 0.915   56.373 65.101 1.00 34.45  ? 290  PHE A CA  1 
ATOM   2315 C C   . PHE A 1 290 ? 0.006   55.213 64.725 1.00 35.91  ? 290  PHE A C   1 
ATOM   2316 O O   . PHE A 1 290 ? 0.399   54.300 63.997 1.00 34.68  ? 290  PHE A O   1 
ATOM   2317 C CB  . PHE A 1 290 ? 0.930   57.467 64.038 1.00 35.39  ? 290  PHE A CB  1 
ATOM   2318 C CG  . PHE A 1 290 ? 2.118   58.386 64.162 1.00 34.26  ? 290  PHE A CG  1 
ATOM   2319 C CD1 . PHE A 1 290 ? 2.318   59.135 65.322 1.00 33.37  ? 290  PHE A CD1 1 
ATOM   2320 C CD2 . PHE A 1 290 ? 3.071   58.459 63.148 1.00 34.62  ? 290  PHE A CD2 1 
ATOM   2321 C CE1 . PHE A 1 290 ? 3.451   59.939 65.471 1.00 33.11  ? 290  PHE A CE1 1 
ATOM   2322 C CE2 . PHE A 1 290 ? 4.210   59.260 63.284 1.00 33.77  ? 290  PHE A CE2 1 
ATOM   2323 C CZ  . PHE A 1 290 ? 4.401   60.001 64.446 1.00 33.93  ? 290  PHE A CZ  1 
ATOM   2324 N N   . SER A 1 291 ? -1.216  55.265 65.237 1.00 37.52  ? 291  SER A N   1 
ATOM   2325 C CA  . SER A 1 291 ? -2.215  54.219 65.041 1.00 39.32  ? 291  SER A CA  1 
ATOM   2326 C C   . SER A 1 291 ? -2.630  53.825 63.627 1.00 39.01  ? 291  SER A C   1 
ATOM   2327 O O   . SER A 1 291 ? -2.513  52.657 63.246 1.00 36.85  ? 291  SER A O   1 
ATOM   2328 C CB  . SER A 1 291 ? -3.463  54.577 65.841 1.00 39.32  ? 291  SER A CB  1 
ATOM   2329 O OG  . SER A 1 291 ? -3.144  54.622 67.221 1.00 40.78  ? 291  SER A OG  1 
ATOM   2330 N N   . PHE A 1 292 ? -3.123  54.785 62.856 1.00 38.41  ? 292  PHE A N   1 
ATOM   2331 C CA  . PHE A 1 292 ? -3.580  54.492 61.505 1.00 37.89  ? 292  PHE A CA  1 
ATOM   2332 C C   . PHE A 1 292 ? -2.732  55.146 60.430 1.00 37.25  ? 292  PHE A C   1 
ATOM   2333 O O   . PHE A 1 292 ? -2.768  56.359 60.222 1.00 36.85  ? 292  PHE A O   1 
ATOM   2334 C CB  . PHE A 1 292 ? -5.048  54.884 61.405 1.00 36.68  ? 292  PHE A CB  1 
ATOM   2335 C CG  . PHE A 1 292 ? -5.896  54.177 62.412 1.00 38.61  ? 292  PHE A CG  1 
ATOM   2336 C CD1 . PHE A 1 292 ? -6.212  52.831 62.241 1.00 40.01  ? 292  PHE A CD1 1 
ATOM   2337 C CD2 . PHE A 1 292 ? -6.301  54.819 63.580 1.00 38.32  ? 292  PHE A CD2 1 
ATOM   2338 C CE1 . PHE A 1 292 ? -6.917  52.129 63.219 1.00 38.83  ? 292  PHE A CE1 1 
ATOM   2339 C CE2 . PHE A 1 292 ? -7.004  54.128 64.564 1.00 37.19  ? 292  PHE A CE2 1 
ATOM   2340 C CZ  . PHE A 1 292 ? -7.311  52.783 64.385 1.00 38.28  ? 292  PHE A CZ  1 
ATOM   2341 N N   . VAL A 1 293 ? -1.968  54.305 59.746 1.00 35.91  ? 293  VAL A N   1 
ATOM   2342 C CA  . VAL A 1 293 ? -1.049  54.748 58.715 1.00 36.15  ? 293  VAL A CA  1 
ATOM   2343 C C   . VAL A 1 293 ? -1.166  53.848 57.486 1.00 36.01  ? 293  VAL A C   1 
ATOM   2344 O O   . VAL A 1 293 ? -1.840  52.826 57.529 1.00 36.23  ? 293  VAL A O   1 
ATOM   2345 C CB  . VAL A 1 293 ? 0.402   54.687 59.260 1.00 36.48  ? 293  VAL A CB  1 
ATOM   2346 C CG1 . VAL A 1 293 ? 0.525   55.549 60.508 1.00 34.40  ? 293  VAL A CG1 1 
ATOM   2347 C CG2 . VAL A 1 293 ? 0.774   53.240 59.596 1.00 35.03  ? 293  VAL A CG2 1 
ATOM   2348 N N   . PRO A 1 294 ? -0.519  54.229 56.370 1.00 35.63  ? 294  PRO A N   1 
ATOM   2349 C CA  . PRO A 1 294 ? -0.563  53.433 55.144 1.00 35.10  ? 294  PRO A CA  1 
ATOM   2350 C C   . PRO A 1 294 ? -0.272  51.958 55.408 1.00 36.04  ? 294  PRO A C   1 
ATOM   2351 O O   . PRO A 1 294 ? 0.490   51.612 56.311 1.00 37.28  ? 294  PRO A O   1 
ATOM   2352 C CB  . PRO A 1 294 ? 0.502   54.089 54.281 1.00 35.16  ? 294  PRO A CB  1 
ATOM   2353 C CG  . PRO A 1 294 ? 0.331   55.522 54.621 1.00 34.78  ? 294  PRO A CG  1 
ATOM   2354 C CD  . PRO A 1 294 ? 0.182   55.505 56.131 1.00 36.17  ? 294  PRO A CD  1 
ATOM   2355 N N   . VAL A 1 295 ? -0.887  51.097 54.607 1.00 35.14  ? 295  VAL A N   1 
ATOM   2356 C CA  . VAL A 1 295 ? -0.728  49.659 54.745 1.00 34.05  ? 295  VAL A CA  1 
ATOM   2357 C C   . VAL A 1 295 ? -0.141  49.047 53.481 1.00 33.84  ? 295  VAL A C   1 
ATOM   2358 O O   . VAL A 1 295 ? -0.516  49.437 52.381 1.00 32.76  ? 295  VAL A O   1 
ATOM   2359 C CB  . VAL A 1 295 ? -2.091  48.984 55.021 1.00 34.41  ? 295  VAL A CB  1 
ATOM   2360 C CG1 . VAL A 1 295 ? -3.046  49.210 53.846 1.00 30.52  ? 295  VAL A CG1 1 
ATOM   2361 C CG2 . VAL A 1 295 ? -1.887  47.508 55.252 1.00 35.01  ? 295  VAL A CG2 1 
ATOM   2362 N N   . ILE A 1 296 ? 0.782   48.099 53.642 1.00 34.57  ? 296  ILE A N   1 
ATOM   2363 C CA  . ILE A 1 296 ? 1.395   47.423 52.500 1.00 36.06  ? 296  ILE A CA  1 
ATOM   2364 C C   . ILE A 1 296 ? 0.362   46.390 52.065 1.00 39.11  ? 296  ILE A C   1 
ATOM   2365 O O   . ILE A 1 296 ? 0.361   45.248 52.522 1.00 39.94  ? 296  ILE A O   1 
ATOM   2366 C CB  . ILE A 1 296 ? 2.709   46.743 52.904 1.00 33.38  ? 296  ILE A CB  1 
ATOM   2367 C CG1 . ILE A 1 296 ? 3.579   47.732 53.684 1.00 32.70  ? 296  ILE A CG1 1 
ATOM   2368 C CG2 . ILE A 1 296 ? 3.459   46.287 51.673 1.00 34.27  ? 296  ILE A CG2 1 
ATOM   2369 C CD1 . ILE A 1 296 ? 3.699   49.112 53.032 1.00 30.65  ? 296  ILE A CD1 1 
ATOM   2370 N N   . ASP A 1 297 ? -0.509  46.825 51.161 1.00 40.99  ? 297  ASP A N   1 
ATOM   2371 C CA  . ASP A 1 297 ? -1.645  46.050 50.668 1.00 42.18  ? 297  ASP A CA  1 
ATOM   2372 C C   . ASP A 1 297 ? -1.487  45.208 49.404 1.00 42.78  ? 297  ASP A C   1 
ATOM   2373 O O   . ASP A 1 297 ? -2.343  44.379 49.111 1.00 43.28  ? 297  ASP A O   1 
ATOM   2374 C CB  . ASP A 1 297 ? -2.806  47.016 50.446 1.00 41.61  ? 297  ASP A CB  1 
ATOM   2375 C CG  . ASP A 1 297 ? -2.481  48.070 49.394 1.00 42.10  ? 297  ASP A CG  1 
ATOM   2376 O OD1 . ASP A 1 297 ? -1.287  48.205 49.045 1.00 42.59  ? 297  ASP A OD1 1 
ATOM   2377 O OD2 . ASP A 1 297 ? -3.404  48.763 48.918 1.00 45.51  ? 297  ASP A OD2 1 
ATOM   2378 N N   . GLY A 1 298 ? -0.428  45.424 48.640 1.00 43.40  ? 298  GLY A N   1 
ATOM   2379 C CA  . GLY A 1 298 ? -0.282  44.656 47.418 1.00 45.36  ? 298  GLY A CA  1 
ATOM   2380 C C   . GLY A 1 298 ? -1.006  45.327 46.261 1.00 46.72  ? 298  GLY A C   1 
ATOM   2381 O O   . GLY A 1 298 ? -1.044  44.800 45.153 1.00 48.54  ? 298  GLY A O   1 
ATOM   2382 N N   . GLU A 1 299 ? -1.591  46.491 46.520 1.00 47.68  ? 299  GLU A N   1 
ATOM   2383 C CA  . GLU A 1 299 ? -2.297  47.253 45.495 1.00 48.10  ? 299  GLU A CA  1 
ATOM   2384 C C   . GLU A 1 299 ? -1.608  48.605 45.331 1.00 46.15  ? 299  GLU A C   1 
ATOM   2385 O O   . GLU A 1 299 ? -0.809  48.781 44.415 1.00 46.35  ? 299  GLU A O   1 
ATOM   2386 C CB  . GLU A 1 299 ? -3.761  47.431 45.887 1.00 51.62  ? 299  GLU A CB  1 
ATOM   2387 C CG  . GLU A 1 299 ? -4.560  46.145 45.760 1.00 60.63  ? 299  GLU A CG  1 
ATOM   2388 C CD  . GLU A 1 299 ? -5.690  46.042 46.772 1.00 65.73  ? 299  GLU A CD  1 
ATOM   2389 O OE1 . GLU A 1 299 ? -6.593  46.913 46.765 1.00 69.34  ? 299  GLU A OE1 1 
ATOM   2390 O OE2 . GLU A 1 299 ? -5.669  45.085 47.579 1.00 68.16  ? 299  GLU A OE2 1 
ATOM   2391 N N   . PHE A 1 300 ? -1.910  49.556 46.209 1.00 42.76  ? 300  PHE A N   1 
ATOM   2392 C CA  . PHE A 1 300 ? -1.262  50.857 46.139 1.00 39.41  ? 300  PHE A CA  1 
ATOM   2393 C C   . PHE A 1 300 ? 0.245   50.583 46.135 1.00 38.33  ? 300  PHE A C   1 
ATOM   2394 O O   . PHE A 1 300 ? 1.002   51.230 45.414 1.00 36.76  ? 300  PHE A O   1 
ATOM   2395 C CB  . PHE A 1 300 ? -1.664  51.711 47.342 1.00 39.07  ? 300  PHE A CB  1 
ATOM   2396 C CG  . PHE A 1 300 ? -1.138  53.116 47.292 1.00 38.80  ? 300  PHE A CG  1 
ATOM   2397 C CD1 . PHE A 1 300 ? 0.195   53.388 47.597 1.00 38.34  ? 300  PHE A CD1 1 
ATOM   2398 C CD2 . PHE A 1 300 ? -1.977  54.171 46.943 1.00 37.79  ? 300  PHE A CD2 1 
ATOM   2399 C CE1 . PHE A 1 300 ? 0.686   54.689 47.557 1.00 35.86  ? 300  PHE A CE1 1 
ATOM   2400 C CE2 . PHE A 1 300 ? -1.499  55.475 46.899 1.00 35.99  ? 300  PHE A CE2 1 
ATOM   2401 C CZ  . PHE A 1 300 ? -0.166  55.737 47.206 1.00 36.40  ? 300  PHE A CZ  1 
ATOM   2402 N N   . PHE A 1 301 ? 0.664   49.613 46.944 1.00 37.41  ? 301  PHE A N   1 
ATOM   2403 C CA  . PHE A 1 301 ? 2.065   49.196 47.012 1.00 37.54  ? 301  PHE A CA  1 
ATOM   2404 C C   . PHE A 1 301 ? 2.067   47.751 46.516 1.00 39.49  ? 301  PHE A C   1 
ATOM   2405 O O   . PHE A 1 301 ? 1.569   46.859 47.195 1.00 39.49  ? 301  PHE A O   1 
ATOM   2406 C CB  . PHE A 1 301 ? 2.588   49.233 48.450 1.00 33.27  ? 301  PHE A CB  1 
ATOM   2407 C CG  . PHE A 1 301 ? 2.518   50.592 49.096 1.00 33.17  ? 301  PHE A CG  1 
ATOM   2408 C CD1 . PHE A 1 301 ? 3.392   51.604 48.717 1.00 32.13  ? 301  PHE A CD1 1 
ATOM   2409 C CD2 . PHE A 1 301 ? 1.603   50.848 50.112 1.00 30.47  ? 301  PHE A CD2 1 
ATOM   2410 C CE1 . PHE A 1 301 ? 3.363   52.847 49.339 1.00 30.39  ? 301  PHE A CE1 1 
ATOM   2411 C CE2 . PHE A 1 301 ? 1.568   52.093 50.741 1.00 31.58  ? 301  PHE A CE2 1 
ATOM   2412 C CZ  . PHE A 1 301 ? 2.454   53.094 50.351 1.00 28.56  ? 301  PHE A CZ  1 
ATOM   2413 N N   . PRO A 1 302 ? 2.619   47.505 45.320 1.00 42.07  ? 302  PRO A N   1 
ATOM   2414 C CA  . PRO A 1 302 ? 2.688   46.168 44.711 1.00 43.06  ? 302  PRO A CA  1 
ATOM   2415 C C   . PRO A 1 302 ? 3.333   45.115 45.607 1.00 43.42  ? 302  PRO A C   1 
ATOM   2416 O O   . PRO A 1 302 ? 2.781   44.031 45.795 1.00 44.98  ? 302  PRO A O   1 
ATOM   2417 C CB  . PRO A 1 302 ? 3.506   46.405 43.440 1.00 44.37  ? 302  PRO A CB  1 
ATOM   2418 C CG  . PRO A 1 302 ? 3.219   47.830 43.110 1.00 45.78  ? 302  PRO A CG  1 
ATOM   2419 C CD  . PRO A 1 302 ? 3.284   48.497 44.460 1.00 42.80  ? 302  PRO A CD  1 
ATOM   2420 N N   . THR A 1 303 ? 4.509   45.430 46.144 1.00 40.86  ? 303  THR A N   1 
ATOM   2421 C CA  . THR A 1 303 ? 5.221   44.504 47.016 1.00 39.83  ? 303  THR A CA  1 
ATOM   2422 C C   . THR A 1 303 ? 5.803   45.272 48.196 1.00 39.84  ? 303  THR A C   1 
ATOM   2423 O O   . THR A 1 303 ? 5.455   46.432 48.419 1.00 39.03  ? 303  THR A O   1 
ATOM   2424 C CB  . THR A 1 303 ? 6.359   43.812 46.262 1.00 40.41  ? 303  THR A CB  1 
ATOM   2425 O OG1 . THR A 1 303 ? 7.364   44.775 45.924 1.00 40.54  ? 303  THR A OG1 1 
ATOM   2426 C CG2 . THR A 1 303 ? 5.835   43.184 44.980 1.00 40.18  ? 303  THR A CG2 1 
ATOM   2427 N N   . SER A 1 304 ? 6.689   44.638 48.957 1.00 39.80  ? 304  SER A N   1 
ATOM   2428 C CA  . SER A 1 304 ? 7.291   45.319 50.099 1.00 39.11  ? 304  SER A CA  1 
ATOM   2429 C C   . SER A 1 304 ? 8.066   46.536 49.593 1.00 38.33  ? 304  SER A C   1 
ATOM   2430 O O   . SER A 1 304 ? 8.679   46.488 48.525 1.00 36.34  ? 304  SER A O   1 
ATOM   2431 C CB  . SER A 1 304 ? 8.240   44.383 50.854 1.00 37.25  ? 304  SER A CB  1 
ATOM   2432 O OG  . SER A 1 304 ? 9.460   44.218 50.150 1.00 37.69  ? 304  SER A OG  1 
ATOM   2433 N N   . LEU A 1 305 ? 8.032   47.625 50.356 1.00 37.28  ? 305  LEU A N   1 
ATOM   2434 C CA  . LEU A 1 305 ? 8.734   48.838 49.971 1.00 35.89  ? 305  LEU A CA  1 
ATOM   2435 C C   . LEU A 1 305 ? 10.211  48.568 49.687 1.00 37.59  ? 305  LEU A C   1 
ATOM   2436 O O   . LEU A 1 305 ? 10.783  49.119 48.742 1.00 37.76  ? 305  LEU A O   1 
ATOM   2437 C CB  . LEU A 1 305 ? 8.618   49.882 51.077 1.00 36.53  ? 305  LEU A CB  1 
ATOM   2438 C CG  . LEU A 1 305 ? 7.208   50.273 51.517 1.00 38.05  ? 305  LEU A CG  1 
ATOM   2439 C CD1 . LEU A 1 305 ? 7.311   51.417 52.517 1.00 35.17  ? 305  LEU A CD1 1 
ATOM   2440 C CD2 . LEU A 1 305 ? 6.366   50.689 50.309 1.00 36.51  ? 305  LEU A CD2 1 
ATOM   2441 N N   . GLU A 1 306 ? 10.823  47.712 50.500 1.00 37.17  ? 306  GLU A N   1 
ATOM   2442 C CA  . GLU A 1 306 ? 12.235  47.392 50.343 1.00 37.67  ? 306  GLU A CA  1 
ATOM   2443 C C   . GLU A 1 306 ? 12.516  46.642 49.050 1.00 38.85  ? 306  GLU A C   1 
ATOM   2444 O O   . GLU A 1 306 ? 13.538  46.882 48.412 1.00 40.17  ? 306  GLU A O   1 
ATOM   2445 C CB  . GLU A 1 306 ? 12.734  46.586 51.555 1.00 38.72  ? 306  GLU A CB  1 
ATOM   2446 C CG  . GLU A 1 306 ? 14.230  46.218 51.549 1.00 42.29  ? 306  GLU A CG  1 
ATOM   2447 C CD  . GLU A 1 306 ? 15.172  47.422 51.444 1.00 46.61  ? 306  GLU A CD  1 
ATOM   2448 O OE1 . GLU A 1 306 ? 14.735  48.571 51.670 1.00 49.20  ? 306  GLU A OE1 1 
ATOM   2449 O OE2 . GLU A 1 306 ? 16.367  47.215 51.142 1.00 47.19  ? 306  GLU A OE2 1 
ATOM   2450 N N   . SER A 1 307 ? 11.625  45.740 48.646 1.00 39.64  ? 307  SER A N   1 
ATOM   2451 C CA  . SER A 1 307 ? 11.871  45.008 47.405 1.00 40.74  ? 307  SER A CA  1 
ATOM   2452 C C   . SER A 1 307 ? 11.662  45.924 46.205 1.00 39.75  ? 307  SER A C   1 
ATOM   2453 O O   . SER A 1 307 ? 12.319  45.766 45.175 1.00 41.09  ? 307  SER A O   1 
ATOM   2454 C CB  . SER A 1 307 ? 10.984  43.756 47.299 1.00 38.68  ? 307  SER A CB  1 
ATOM   2455 O OG  . SER A 1 307 ? 9.610   44.068 47.272 1.00 44.19  ? 307  SER A OG  1 
ATOM   2456 N N   . MET A 1 308 ? 10.758  46.890 46.341 1.00 39.90  ? 308  MET A N   1 
ATOM   2457 C CA  . MET A 1 308 ? 10.510  47.845 45.265 1.00 38.05  ? 308  MET A CA  1 
ATOM   2458 C C   . MET A 1 308 ? 11.735  48.747 45.100 1.00 37.70  ? 308  MET A C   1 
ATOM   2459 O O   . MET A 1 308 ? 12.174  49.007 43.985 1.00 39.59  ? 308  MET A O   1 
ATOM   2460 C CB  . MET A 1 308 ? 9.275   48.699 45.572 1.00 38.57  ? 308  MET A CB  1 
ATOM   2461 C CG  . MET A 1 308 ? 7.945   47.966 45.431 1.00 36.87  ? 308  MET A CG  1 
ATOM   2462 S SD  . MET A 1 308 ? 6.510   49.017 45.813 1.00 38.99  ? 308  MET A SD  1 
ATOM   2463 C CE  . MET A 1 308 ? 6.442   50.031 44.338 1.00 36.85  ? 308  MET A CE  1 
ATOM   2464 N N   . LEU A 1 309 ? 12.296  49.218 46.209 1.00 37.34  ? 309  LEU A N   1 
ATOM   2465 C CA  . LEU A 1 309 ? 13.470  50.084 46.142 1.00 38.52  ? 309  LEU A CA  1 
ATOM   2466 C C   . LEU A 1 309 ? 14.678  49.359 45.562 1.00 40.22  ? 309  LEU A C   1 
ATOM   2467 O O   . LEU A 1 309 ? 15.450  49.932 44.789 1.00 39.58  ? 309  LEU A O   1 
ATOM   2468 C CB  . LEU A 1 309 ? 13.812  50.616 47.532 1.00 37.27  ? 309  LEU A CB  1 
ATOM   2469 C CG  . LEU A 1 309 ? 12.834  51.610 48.160 1.00 37.38  ? 309  LEU A CG  1 
ATOM   2470 C CD1 . LEU A 1 309 ? 13.194  51.822 49.621 1.00 35.93  ? 309  LEU A CD1 1 
ATOM   2471 C CD2 . LEU A 1 309 ? 12.875  52.924 47.391 1.00 36.98  ? 309  LEU A CD2 1 
ATOM   2472 N N   . ASN A 1 310 ? 14.836  48.097 45.948 1.00 41.71  ? 310  ASN A N   1 
ATOM   2473 C CA  . ASN A 1 310 ? 15.940  47.270 45.473 1.00 44.33  ? 310  ASN A CA  1 
ATOM   2474 C C   . ASN A 1 310 ? 15.847  47.028 43.983 1.00 42.90  ? 310  ASN A C   1 
ATOM   2475 O O   . ASN A 1 310 ? 16.843  47.124 43.270 1.00 43.91  ? 310  ASN A O   1 
ATOM   2476 C CB  . ASN A 1 310 ? 15.948  45.908 46.184 1.00 48.00  ? 310  ASN A CB  1 
ATOM   2477 C CG  . ASN A 1 310 ? 16.617  45.959 47.543 1.00 52.61  ? 310  ASN A CG  1 
ATOM   2478 O OD1 . ASN A 1 310 ? 16.424  45.068 48.374 1.00 56.57  ? 310  ASN A OD1 1 
ATOM   2479 N ND2 . ASN A 1 310 ? 17.415  46.998 47.776 1.00 52.21  ? 310  ASN A ND2 1 
ATOM   2480 N N   . SER A 1 311 ? 14.643  46.713 43.518 1.00 42.12  ? 311  SER A N   1 
ATOM   2481 C CA  . SER A 1 311 ? 14.415  46.423 42.108 1.00 42.47  ? 311  SER A CA  1 
ATOM   2482 C C   . SER A 1 311 ? 14.246  47.651 41.229 1.00 42.23  ? 311  SER A C   1 
ATOM   2483 O O   . SER A 1 311 ? 14.213  47.534 40.006 1.00 45.01  ? 311  SER A O   1 
ATOM   2484 C CB  . SER A 1 311 ? 13.183  45.529 41.953 1.00 42.13  ? 311  SER A CB  1 
ATOM   2485 O OG  . SER A 1 311 ? 12.027  46.167 42.464 1.00 41.60  ? 311  SER A OG  1 
ATOM   2486 N N   . GLY A 1 312 ? 14.135  48.825 41.835 1.00 41.02  ? 312  GLY A N   1 
ATOM   2487 C CA  . GLY A 1 312 ? 13.957  50.025 41.038 1.00 40.96  ? 312  GLY A CA  1 
ATOM   2488 C C   . GLY A 1 312 ? 12.517  50.172 40.570 1.00 40.61  ? 312  GLY A C   1 
ATOM   2489 O O   . GLY A 1 312 ? 12.227  50.866 39.594 1.00 39.18  ? 312  GLY A O   1 
ATOM   2490 N N   . ASN A 1 313 ? 11.606  49.505 41.269 1.00 39.39  ? 313  ASN A N   1 
ATOM   2491 C CA  . ASN A 1 313 ? 10.198  49.576 40.924 1.00 39.32  ? 313  ASN A CA  1 
ATOM   2492 C C   . ASN A 1 313 ? 9.635   50.874 41.486 1.00 39.51  ? 313  ASN A C   1 
ATOM   2493 O O   . ASN A 1 313 ? 8.945   50.876 42.511 1.00 39.20  ? 313  ASN A O   1 
ATOM   2494 C CB  . ASN A 1 313 ? 9.441   48.383 41.511 1.00 40.21  ? 313  ASN A CB  1 
ATOM   2495 C CG  . ASN A 1 313 ? 8.019   48.268 40.979 1.00 42.36  ? 313  ASN A CG  1 
ATOM   2496 O OD1 . ASN A 1 313 ? 7.224   47.464 41.472 1.00 42.80  ? 313  ASN A OD1 1 
ATOM   2497 N ND2 . ASN A 1 313 ? 7.696   49.065 39.963 1.00 42.22  ? 313  ASN A ND2 1 
ATOM   2498 N N   . PHE A 1 314 ? 9.953   51.981 40.821 1.00 38.30  ? 314  PHE A N   1 
ATOM   2499 C CA  . PHE A 1 314 ? 9.473   53.286 41.244 1.00 37.72  ? 314  PHE A CA  1 
ATOM   2500 C C   . PHE A 1 314 ? 9.708   54.331 40.168 1.00 38.10  ? 314  PHE A C   1 
ATOM   2501 O O   . PHE A 1 314 ? 10.472  54.103 39.237 1.00 39.42  ? 314  PHE A O   1 
ATOM   2502 C CB  . PHE A 1 314 ? 10.144  53.702 42.560 1.00 37.01  ? 314  PHE A CB  1 
ATOM   2503 C CG  . PHE A 1 314 ? 11.652  53.657 42.533 1.00 35.17  ? 314  PHE A CG  1 
ATOM   2504 C CD1 . PHE A 1 314 ? 12.387  54.605 41.824 1.00 34.29  ? 314  PHE A CD1 1 
ATOM   2505 C CD2 . PHE A 1 314 ? 12.342  52.692 43.267 1.00 34.74  ? 314  PHE A CD2 1 
ATOM   2506 C CE1 . PHE A 1 314 ? 13.790  54.597 41.853 1.00 31.80  ? 314  PHE A CE1 1 
ATOM   2507 C CE2 . PHE A 1 314 ? 13.745  52.676 43.301 1.00 33.61  ? 314  PHE A CE2 1 
ATOM   2508 C CZ  . PHE A 1 314 ? 14.466  53.632 42.594 1.00 30.46  ? 314  PHE A CZ  1 
ATOM   2509 N N   . LYS A 1 315 ? 9.033   55.468 40.283 1.00 37.87  ? 315  LYS A N   1 
ATOM   2510 C CA  . LYS A 1 315 ? 9.179   56.542 39.305 1.00 39.15  ? 315  LYS A CA  1 
ATOM   2511 C C   . LYS A 1 315 ? 10.610  57.060 39.319 1.00 39.46  ? 315  LYS A C   1 
ATOM   2512 O O   . LYS A 1 315 ? 11.155  57.400 40.376 1.00 39.08  ? 315  LYS A O   1 
ATOM   2513 C CB  . LYS A 1 315 ? 8.218   57.694 39.622 1.00 39.07  ? 315  LYS A CB  1 
ATOM   2514 C CG  . LYS A 1 315 ? 8.295   58.856 38.648 1.00 37.98  ? 315  LYS A CG  1 
ATOM   2515 C CD  . LYS A 1 315 ? 7.541   60.068 39.184 1.00 38.86  ? 315  LYS A CD  1 
ATOM   2516 C CE  . LYS A 1 315 ? 7.618   61.255 38.234 1.00 36.07  ? 315  LYS A CE  1 
ATOM   2517 N NZ  . LYS A 1 315 ? 6.860   61.023 36.976 1.00 32.00  ? 315  LYS A NZ  1 
ATOM   2518 N N   . LYS A 1 316 ? 11.219  57.120 38.143 1.00 39.52  ? 316  LYS A N   1 
ATOM   2519 C CA  . LYS A 1 316 ? 12.591  57.594 38.038 1.00 40.94  ? 316  LYS A CA  1 
ATOM   2520 C C   . LYS A 1 316 ? 12.608  59.021 37.520 1.00 40.12  ? 316  LYS A C   1 
ATOM   2521 O O   . LYS A 1 316 ? 12.293  59.268 36.364 1.00 40.31  ? 316  LYS A O   1 
ATOM   2522 C CB  . LYS A 1 316 ? 13.385  56.665 37.124 1.00 42.14  ? 316  LYS A CB  1 
ATOM   2523 C CG  . LYS A 1 316 ? 13.336  55.229 37.615 1.00 45.17  ? 316  LYS A CG  1 
ATOM   2524 C CD  . LYS A 1 316 ? 14.292  54.322 36.882 1.00 48.62  ? 316  LYS A CD  1 
ATOM   2525 C CE  . LYS A 1 316 ? 14.168  52.900 37.401 1.00 50.43  ? 316  LYS A CE  1 
ATOM   2526 N NZ  . LYS A 1 316 ? 12.804  52.355 37.148 1.00 52.08  ? 316  LYS A NZ  1 
ATOM   2527 N N   . THR A 1 317 ? 12.971  59.950 38.401 1.00 40.45  ? 317  THR A N   1 
ATOM   2528 C CA  . THR A 1 317 ? 13.015  61.370 38.087 1.00 39.73  ? 317  THR A CA  1 
ATOM   2529 C C   . THR A 1 317 ? 14.051  62.016 39.009 1.00 41.10  ? 317  THR A C   1 
ATOM   2530 O O   . THR A 1 317 ? 14.933  61.323 39.524 1.00 42.53  ? 317  THR A O   1 
ATOM   2531 C CB  . THR A 1 317 ? 11.616  62.010 38.323 1.00 39.06  ? 317  THR A CB  1 
ATOM   2532 O OG1 . THR A 1 317 ? 11.636  63.383 37.923 1.00 39.94  ? 317  THR A OG1 1 
ATOM   2533 C CG2 . THR A 1 317 ? 11.218  61.919 39.792 1.00 35.98  ? 317  THR A CG2 1 
ATOM   2534 N N   . GLN A 1 318 ? 13.958  63.330 39.210 1.00 39.94  ? 318  GLN A N   1 
ATOM   2535 C CA  . GLN A 1 318 ? 14.890  64.022 40.103 1.00 39.85  ? 318  GLN A CA  1 
ATOM   2536 C C   . GLN A 1 318 ? 14.196  64.273 41.436 1.00 39.55  ? 318  GLN A C   1 
ATOM   2537 O O   . GLN A 1 318 ? 12.975  64.459 41.493 1.00 38.83  ? 318  GLN A O   1 
ATOM   2538 C CB  . GLN A 1 318 ? 15.331  65.388 39.543 1.00 42.41  ? 318  GLN A CB  1 
ATOM   2539 C CG  . GLN A 1 318 ? 15.924  65.405 38.137 1.00 42.97  ? 318  GLN A CG  1 
ATOM   2540 C CD  . GLN A 1 318 ? 14.852  65.407 37.069 1.00 45.11  ? 318  GLN A CD  1 
ATOM   2541 O OE1 . GLN A 1 318 ? 13.838  66.097 37.195 1.00 42.50  ? 318  GLN A OE1 1 
ATOM   2542 N NE2 . GLN A 1 318 ? 15.070  64.639 36.007 1.00 47.76  ? 318  GLN A NE2 1 
ATOM   2543 N N   . ILE A 1 319 ? 14.972  64.280 42.513 1.00 38.25  ? 319  ILE A N   1 
ATOM   2544 C CA  . ILE A 1 319 ? 14.405  64.549 43.827 1.00 36.40  ? 319  ILE A CA  1 
ATOM   2545 C C   . ILE A 1 319 ? 15.343  65.405 44.664 1.00 36.21  ? 319  ILE A C   1 
ATOM   2546 O O   . ILE A 1 319 ? 16.570  65.367 44.497 1.00 35.08  ? 319  ILE A O   1 
ATOM   2547 C CB  . ILE A 1 319 ? 14.104  63.253 44.630 1.00 36.36  ? 319  ILE A CB  1 
ATOM   2548 C CG1 . ILE A 1 319 ? 15.408  62.522 44.964 1.00 34.48  ? 319  ILE A CG1 1 
ATOM   2549 C CG2 . ILE A 1 319 ? 13.145  62.366 43.854 1.00 35.63  ? 319  ILE A CG2 1 
ATOM   2550 C CD1 . ILE A 1 319 ? 15.232  61.386 45.944 1.00 33.27  ? 319  ILE A CD1 1 
ATOM   2551 N N   . LEU A 1 320 ? 14.740  66.184 45.556 1.00 34.84  ? 320  LEU A N   1 
ATOM   2552 C CA  . LEU A 1 320 ? 15.464  67.044 46.474 1.00 33.16  ? 320  LEU A CA  1 
ATOM   2553 C C   . LEU A 1 320 ? 14.873  66.707 47.843 1.00 33.81  ? 320  LEU A C   1 
ATOM   2554 O O   . LEU A 1 320 ? 13.652  66.675 48.016 1.00 33.43  ? 320  LEU A O   1 
ATOM   2555 C CB  . LEU A 1 320 ? 15.237  68.512 46.108 1.00 32.46  ? 320  LEU A CB  1 
ATOM   2556 C CG  . LEU A 1 320 ? 16.020  69.580 46.880 1.00 34.39  ? 320  LEU A CG  1 
ATOM   2557 C CD1 . LEU A 1 320 ? 16.248  70.796 45.982 1.00 33.08  ? 320  LEU A CD1 1 
ATOM   2558 C CD2 . LEU A 1 320 ? 15.268  69.962 48.145 1.00 32.44  ? 320  LEU A CD2 1 
ATOM   2559 N N   . LEU A 1 321 ? 15.738  66.429 48.809 1.00 33.90  ? 321  LEU A N   1 
ATOM   2560 C CA  . LEU A 1 321 ? 15.282  66.053 50.138 1.00 33.97  ? 321  LEU A CA  1 
ATOM   2561 C C   . LEU A 1 321 ? 16.344  66.307 51.194 1.00 34.35  ? 321  LEU A C   1 
ATOM   2562 O O   . LEU A 1 321 ? 17.519  66.525 50.884 1.00 35.60  ? 321  LEU A O   1 
ATOM   2563 C CB  . LEU A 1 321 ? 14.892  64.566 50.153 1.00 35.23  ? 321  LEU A CB  1 
ATOM   2564 C CG  . LEU A 1 321 ? 16.004  63.522 49.936 1.00 33.28  ? 321  LEU A CG  1 
ATOM   2565 C CD1 . LEU A 1 321 ? 15.403  62.121 49.954 1.00 32.22  ? 321  LEU A CD1 1 
ATOM   2566 C CD2 . LEU A 1 321 ? 16.701  63.753 48.605 1.00 34.11  ? 321  LEU A CD2 1 
ATOM   2567 N N   . GLY A 1 322 ? 15.920  66.266 52.450 1.00 33.45  ? 322  GLY A N   1 
ATOM   2568 C CA  . GLY A 1 322 ? 16.847  66.496 53.533 1.00 35.96  ? 322  GLY A CA  1 
ATOM   2569 C C   . GLY A 1 322 ? 16.206  66.312 54.891 1.00 37.45  ? 322  GLY A C   1 
ATOM   2570 O O   . GLY A 1 322 ? 15.030  65.943 54.999 1.00 35.61  ? 322  GLY A O   1 
ATOM   2571 N N   . VAL A 1 323 ? 16.991  66.589 55.930 1.00 36.85  ? 323  VAL A N   1 
ATOM   2572 C CA  . VAL A 1 323 ? 16.539  66.442 57.304 1.00 35.82  ? 323  VAL A CA  1 
ATOM   2573 C C   . VAL A 1 323 ? 16.981  67.641 58.132 1.00 36.99  ? 323  VAL A C   1 
ATOM   2574 O O   . VAL A 1 323 ? 17.740  68.480 57.655 1.00 38.48  ? 323  VAL A O   1 
ATOM   2575 C CB  . VAL A 1 323 ? 17.128  65.156 57.926 1.00 34.33  ? 323  VAL A CB  1 
ATOM   2576 C CG1 . VAL A 1 323 ? 16.697  63.956 57.122 1.00 32.39  ? 323  VAL A CG1 1 
ATOM   2577 C CG2 . VAL A 1 323 ? 18.647  65.229 57.941 1.00 33.39  ? 323  VAL A CG2 1 
ATOM   2578 N N   . ASN A 1 324 ? 16.479  67.724 59.361 1.00 36.82  ? 324  ASN A N   1 
ATOM   2579 C CA  . ASN A 1 324 ? 16.838  68.794 60.286 1.00 35.08  ? 324  ASN A CA  1 
ATOM   2580 C C   . ASN A 1 324 ? 17.787  68.181 61.327 1.00 37.03  ? 324  ASN A C   1 
ATOM   2581 O O   . ASN A 1 324 ? 17.820  66.963 61.514 1.00 36.11  ? 324  ASN A O   1 
ATOM   2582 C CB  . ASN A 1 324 ? 15.596  69.361 60.983 1.00 33.95  ? 324  ASN A CB  1 
ATOM   2583 C CG  . ASN A 1 324 ? 14.675  70.131 60.035 1.00 35.89  ? 324  ASN A CG  1 
ATOM   2584 O OD1 . ASN A 1 324 ? 14.953  70.273 58.843 1.00 33.84  ? 324  ASN A OD1 1 
ATOM   2585 N ND2 . ASN A 1 324 ? 13.570  70.632 60.574 1.00 32.94  ? 324  ASN A ND2 1 
ATOM   2586 N N   . LYS A 1 325 ? 18.551  69.024 62.010 1.00 37.45  ? 325  LYS A N   1 
ATOM   2587 C CA  . LYS A 1 325 ? 19.506  68.541 62.992 1.00 36.30  ? 325  LYS A CA  1 
ATOM   2588 C C   . LYS A 1 325 ? 18.918  67.760 64.162 1.00 36.68  ? 325  LYS A C   1 
ATOM   2589 O O   . LYS A 1 325 ? 19.434  66.700 64.524 1.00 34.96  ? 325  LYS A O   1 
ATOM   2590 C CB  . LYS A 1 325 ? 20.321  69.705 63.541 1.00 36.02  ? 325  LYS A CB  1 
ATOM   2591 C CG  . LYS A 1 325 ? 21.453  69.266 64.446 1.00 38.42  ? 325  LYS A CG  1 
ATOM   2592 C CD  . LYS A 1 325 ? 22.136  70.458 65.093 1.00 41.39  ? 325  LYS A CD  1 
ATOM   2593 C CE  . LYS A 1 325 ? 23.313  70.007 65.936 1.00 41.45  ? 325  LYS A CE  1 
ATOM   2594 N NZ  . LYS A 1 325 ? 22.917  68.939 66.898 1.00 45.91  ? 325  LYS A NZ  1 
ATOM   2595 N N   . ASP A 1 326 ? 17.849  68.283 64.758 1.00 37.33  ? 326  ASP A N   1 
ATOM   2596 C CA  . ASP A 1 326 ? 17.239  67.638 65.916 1.00 37.05  ? 326  ASP A CA  1 
ATOM   2597 C C   . ASP A 1 326 ? 15.829  67.107 65.672 1.00 39.20  ? 326  ASP A C   1 
ATOM   2598 O O   . ASP A 1 326 ? 14.854  67.585 66.256 1.00 39.76  ? 326  ASP A O   1 
ATOM   2599 C CB  . ASP A 1 326 ? 17.252  68.622 67.077 1.00 37.55  ? 326  ASP A CB  1 
ATOM   2600 C CG  . ASP A 1 326 ? 18.633  69.211 67.305 1.00 39.20  ? 326  ASP A CG  1 
ATOM   2601 O OD1 . ASP A 1 326 ? 19.560  68.435 67.614 1.00 35.99  ? 326  ASP A OD1 1 
ATOM   2602 O OD2 . ASP A 1 326 ? 18.801  70.442 67.155 1.00 39.75  ? 326  ASP A OD2 1 
ATOM   2603 N N   . GLU A 1 327 ? 15.750  66.091 64.818 1.00 39.39  ? 327  GLU A N   1 
ATOM   2604 C CA  . GLU A 1 327 ? 14.495  65.453 64.439 1.00 39.69  ? 327  GLU A CA  1 
ATOM   2605 C C   . GLU A 1 327 ? 13.730  64.750 65.567 1.00 40.61  ? 327  GLU A C   1 
ATOM   2606 O O   . GLU A 1 327 ? 12.507  64.635 65.504 1.00 42.62  ? 327  GLU A O   1 
ATOM   2607 C CB  . GLU A 1 327 ? 14.762  64.439 63.325 1.00 38.09  ? 327  GLU A CB  1 
ATOM   2608 C CG  . GLU A 1 327 ? 15.207  65.039 62.006 1.00 37.26  ? 327  GLU A CG  1 
ATOM   2609 C CD  . GLU A 1 327 ? 14.078  65.740 61.288 1.00 37.36  ? 327  GLU A CD  1 
ATOM   2610 O OE1 . GLU A 1 327 ? 14.259  66.114 60.112 1.00 35.97  ? 327  GLU A OE1 1 
ATOM   2611 O OE2 . GLU A 1 327 ? 13.008  65.918 61.906 1.00 37.81  ? 327  GLU A OE2 1 
ATOM   2612 N N   . GLY A 1 328 ? 14.431  64.278 66.592 1.00 40.31  ? 328  GLY A N   1 
ATOM   2613 C CA  . GLY A 1 328 ? 13.745  63.568 67.659 1.00 39.59  ? 328  GLY A CA  1 
ATOM   2614 C C   . GLY A 1 328 ? 13.266  64.324 68.886 1.00 40.02  ? 328  GLY A C   1 
ATOM   2615 O O   . GLY A 1 328 ? 12.469  63.797 69.658 1.00 40.52  ? 328  GLY A O   1 
ATOM   2616 N N   . SER A 1 329 ? 13.718  65.557 69.073 1.00 40.84  ? 329  SER A N   1 
ATOM   2617 C CA  . SER A 1 329 ? 13.335  66.319 70.257 1.00 39.81  ? 329  SER A CA  1 
ATOM   2618 C C   . SER A 1 329 ? 11.829  66.498 70.474 1.00 38.99  ? 329  SER A C   1 
ATOM   2619 O O   . SER A 1 329 ? 11.342  66.448 71.602 1.00 37.34  ? 329  SER A O   1 
ATOM   2620 C CB  . SER A 1 329 ? 14.017  67.688 70.225 1.00 39.70  ? 329  SER A CB  1 
ATOM   2621 O OG  . SER A 1 329 ? 13.538  68.459 69.141 1.00 42.09  ? 329  SER A OG  1 
ATOM   2622 N N   . PHE A 1 330 ? 11.090  66.694 69.396 1.00 40.06  ? 330  PHE A N   1 
ATOM   2623 C CA  . PHE A 1 330 ? 9.658   66.912 69.502 1.00 40.49  ? 330  PHE A CA  1 
ATOM   2624 C C   . PHE A 1 330 ? 8.888   65.798 70.216 1.00 41.18  ? 330  PHE A C   1 
ATOM   2625 O O   . PHE A 1 330 ? 8.129   66.063 71.155 1.00 41.92  ? 330  PHE A O   1 
ATOM   2626 C CB  . PHE A 1 330 ? 9.074   67.120 68.112 1.00 43.46  ? 330  PHE A CB  1 
ATOM   2627 C CG  . PHE A 1 330 ? 7.689   67.661 68.124 1.00 48.63  ? 330  PHE A CG  1 
ATOM   2628 C CD1 . PHE A 1 330 ? 7.465   69.013 68.354 1.00 51.30  ? 330  PHE A CD1 1 
ATOM   2629 C CD2 . PHE A 1 330 ? 6.595   66.813 67.941 1.00 52.87  ? 330  PHE A CD2 1 
ATOM   2630 C CE1 . PHE A 1 330 ? 6.172   69.523 68.404 1.00 54.82  ? 330  PHE A CE1 1 
ATOM   2631 C CE2 . PHE A 1 330 ? 5.287   67.310 67.988 1.00 55.99  ? 330  PHE A CE2 1 
ATOM   2632 C CZ  . PHE A 1 330 ? 5.076   68.668 68.221 1.00 55.92  ? 330  PHE A CZ  1 
ATOM   2633 N N   . PHE A 1 331 ? 9.088   64.555 69.784 1.00 40.01  ? 331  PHE A N   1 
ATOM   2634 C CA  . PHE A 1 331 ? 8.378   63.426 70.371 1.00 37.53  ? 331  PHE A CA  1 
ATOM   2635 C C   . PHE A 1 331 ? 8.853   62.986 71.739 1.00 36.60  ? 331  PHE A C   1 
ATOM   2636 O O   . PHE A 1 331 ? 8.123   62.312 72.461 1.00 38.23  ? 331  PHE A O   1 
ATOM   2637 C CB  . PHE A 1 331 ? 8.391   62.244 69.400 1.00 39.38  ? 331  PHE A CB  1 
ATOM   2638 C CG  . PHE A 1 331 ? 7.734   62.558 68.088 1.00 38.99  ? 331  PHE A CG  1 
ATOM   2639 C CD1 . PHE A 1 331 ? 8.466   63.071 67.026 1.00 41.20  ? 331  PHE A CD1 1 
ATOM   2640 C CD2 . PHE A 1 331 ? 6.361   62.452 67.950 1.00 37.62  ? 331  PHE A CD2 1 
ATOM   2641 C CE1 . PHE A 1 331 ? 7.817   63.478 65.849 1.00 40.19  ? 331  PHE A CE1 1 
ATOM   2642 C CE2 . PHE A 1 331 ? 5.729   62.855 66.792 1.00 40.12  ? 331  PHE A CE2 1 
ATOM   2643 C CZ  . PHE A 1 331 ? 6.464   63.370 65.740 1.00 37.17  ? 331  PHE A CZ  1 
ATOM   2644 N N   . LEU A 1 332 ? 10.079  63.345 72.098 1.00 34.30  ? 332  LEU A N   1 
ATOM   2645 C CA  . LEU A 1 332 ? 10.584  62.985 73.411 1.00 32.92  ? 332  LEU A CA  1 
ATOM   2646 C C   . LEU A 1 332 ? 9.860   63.866 74.422 1.00 34.65  ? 332  LEU A C   1 
ATOM   2647 O O   . LEU A 1 332 ? 9.472   63.410 75.501 1.00 34.44  ? 332  LEU A O   1 
ATOM   2648 C CB  . LEU A 1 332 ? 12.090  63.217 73.490 1.00 32.57  ? 332  LEU A CB  1 
ATOM   2649 C CG  . LEU A 1 332 ? 12.960  62.151 72.817 1.00 32.50  ? 332  LEU A CG  1 
ATOM   2650 C CD1 . LEU A 1 332 ? 14.323  62.735 72.509 1.00 28.94  ? 332  LEU A CD1 1 
ATOM   2651 C CD2 . LEU A 1 332 ? 13.078  60.934 73.726 1.00 28.25  ? 332  LEU A CD2 1 
ATOM   2652 N N   . LEU A 1 333 ? 9.666   65.128 74.055 1.00 33.75  ? 333  LEU A N   1 
ATOM   2653 C CA  . LEU A 1 333 ? 8.980   66.071 74.923 1.00 35.35  ? 333  LEU A CA  1 
ATOM   2654 C C   . LEU A 1 333 ? 7.565   65.607 75.227 1.00 35.38  ? 333  LEU A C   1 
ATOM   2655 O O   . LEU A 1 333 ? 7.081   65.755 76.341 1.00 37.05  ? 333  LEU A O   1 
ATOM   2656 C CB  . LEU A 1 333 ? 8.918   67.453 74.270 1.00 34.44  ? 333  LEU A CB  1 
ATOM   2657 C CG  . LEU A 1 333 ? 8.011   68.455 74.986 1.00 34.48  ? 333  LEU A CG  1 
ATOM   2658 C CD1 . LEU A 1 333 ? 8.543   68.706 76.390 1.00 30.97  ? 333  LEU A CD1 1 
ATOM   2659 C CD2 . LEU A 1 333 ? 7.926   69.753 74.182 1.00 36.07  ? 333  LEU A CD2 1 
ATOM   2660 N N   . TYR A 1 334 ? 6.896   65.044 74.235 1.00 36.98  ? 334  TYR A N   1 
ATOM   2661 C CA  . TYR A 1 334 ? 5.537   64.598 74.454 1.00 38.29  ? 334  TYR A CA  1 
ATOM   2662 C C   . TYR A 1 334 ? 5.370   63.262 75.163 1.00 38.75  ? 334  TYR A C   1 
ATOM   2663 O O   . TYR A 1 334 ? 4.344   63.039 75.791 1.00 41.50  ? 334  TYR A O   1 
ATOM   2664 C CB  . TYR A 1 334 ? 4.776   64.569 73.134 1.00 36.36  ? 334  TYR A CB  1 
ATOM   2665 C CG  . TYR A 1 334 ? 4.272   65.923 72.710 1.00 36.61  ? 334  TYR A CG  1 
ATOM   2666 C CD1 . TYR A 1 334 ? 5.143   66.904 72.245 1.00 37.86  ? 334  TYR A CD1 1 
ATOM   2667 C CD2 . TYR A 1 334 ? 2.922   66.238 72.813 1.00 36.91  ? 334  TYR A CD2 1 
ATOM   2668 C CE1 . TYR A 1 334 ? 4.676   68.169 71.895 1.00 37.86  ? 334  TYR A CE1 1 
ATOM   2669 C CE2 . TYR A 1 334 ? 2.448   67.495 72.471 1.00 37.82  ? 334  TYR A CE2 1 
ATOM   2670 C CZ  . TYR A 1 334 ? 3.327   68.455 72.014 1.00 37.34  ? 334  TYR A CZ  1 
ATOM   2671 O OH  . TYR A 1 334 ? 2.854   69.699 71.689 1.00 37.56  ? 334  TYR A OH  1 
ATOM   2672 N N   . GLY A 1 335 ? 6.356   62.376 75.091 1.00 39.14  ? 335  GLY A N   1 
ATOM   2673 C CA  . GLY A 1 335 ? 6.180   61.089 75.743 1.00 41.43  ? 335  GLY A CA  1 
ATOM   2674 C C   . GLY A 1 335 ? 7.280   60.512 76.623 1.00 42.20  ? 335  GLY A C   1 
ATOM   2675 O O   . GLY A 1 335 ? 6.992   59.710 77.512 1.00 43.95  ? 335  GLY A O   1 
ATOM   2676 N N   . ALA A 1 336 ? 8.532   60.891 76.399 1.00 41.08  ? 336  ALA A N   1 
ATOM   2677 C CA  . ALA A 1 336 ? 9.610   60.347 77.211 1.00 40.60  ? 336  ALA A CA  1 
ATOM   2678 C C   . ALA A 1 336 ? 9.685   60.959 78.611 1.00 41.48  ? 336  ALA A C   1 
ATOM   2679 O O   . ALA A 1 336 ? 9.575   62.173 78.792 1.00 42.15  ? 336  ALA A O   1 
ATOM   2680 C CB  . ALA A 1 336 ? 10.932  60.517 76.494 1.00 40.65  ? 336  ALA A CB  1 
ATOM   2681 N N   . PRO A 1 337 ? 9.884   60.115 79.627 1.00 41.22  ? 337  PRO A N   1 
ATOM   2682 C CA  . PRO A 1 337 ? 9.972   60.601 81.005 1.00 40.17  ? 337  PRO A CA  1 
ATOM   2683 C C   . PRO A 1 337 ? 11.227  61.445 81.229 1.00 40.74  ? 337  PRO A C   1 
ATOM   2684 O O   . PRO A 1 337 ? 12.304  61.115 80.731 1.00 37.29  ? 337  PRO A O   1 
ATOM   2685 C CB  . PRO A 1 337 ? 9.998   59.314 81.812 1.00 41.26  ? 337  PRO A CB  1 
ATOM   2686 C CG  . PRO A 1 337 ? 10.753  58.379 80.898 1.00 41.49  ? 337  PRO A CG  1 
ATOM   2687 C CD  . PRO A 1 337 ? 10.125  58.661 79.559 1.00 40.08  ? 337  PRO A CD  1 
ATOM   2688 N N   . GLY A 1 338 ? 11.075  62.537 81.977 1.00 40.08  ? 338  GLY A N   1 
ATOM   2689 C CA  . GLY A 1 338 ? 12.204  63.402 82.265 1.00 38.62  ? 338  GLY A CA  1 
ATOM   2690 C C   . GLY A 1 338 ? 12.301  64.642 81.394 1.00 40.21  ? 338  GLY A C   1 
ATOM   2691 O O   . GLY A 1 338 ? 13.047  65.576 81.714 1.00 39.08  ? 338  GLY A O   1 
ATOM   2692 N N   . PHE A 1 339 ? 11.563  64.655 80.288 1.00 39.55  ? 339  PHE A N   1 
ATOM   2693 C CA  . PHE A 1 339 ? 11.579  65.801 79.390 1.00 39.90  ? 339  PHE A CA  1 
ATOM   2694 C C   . PHE A 1 339 ? 10.439  66.737 79.729 1.00 40.06  ? 339  PHE A C   1 
ATOM   2695 O O   . PHE A 1 339 ? 9.332   66.298 80.021 1.00 40.90  ? 339  PHE A O   1 
ATOM   2696 C CB  . PHE A 1 339 ? 11.457  65.356 77.932 1.00 37.81  ? 339  PHE A CB  1 
ATOM   2697 C CG  . PHE A 1 339 ? 12.619  64.545 77.453 1.00 37.49  ? 339  PHE A CG  1 
ATOM   2698 C CD1 . PHE A 1 339 ? 12.709  63.186 77.747 1.00 37.38  ? 339  PHE A CD1 1 
ATOM   2699 C CD2 . PHE A 1 339 ? 13.636  65.141 76.706 1.00 37.21  ? 339  PHE A CD2 1 
ATOM   2700 C CE1 . PHE A 1 339 ? 13.798  62.427 77.302 1.00 33.19  ? 339  PHE A CE1 1 
ATOM   2701 C CE2 . PHE A 1 339 ? 14.724  64.393 76.258 1.00 34.50  ? 339  PHE A CE2 1 
ATOM   2702 C CZ  . PHE A 1 339 ? 14.802  63.032 76.558 1.00 33.99  ? 339  PHE A CZ  1 
ATOM   2703 N N   . SER A 1 340 ? 10.713  68.034 79.693 1.00 42.24  ? 340  SER A N   1 
ATOM   2704 C CA  . SER A 1 340 ? 9.698   69.033 79.995 1.00 42.99  ? 340  SER A CA  1 
ATOM   2705 C C   . SER A 1 340 ? 9.909   70.228 79.103 1.00 43.32  ? 340  SER A C   1 
ATOM   2706 O O   . SER A 1 340 ? 11.027  70.494 78.663 1.00 43.85  ? 340  SER A O   1 
ATOM   2707 C CB  . SER A 1 340 ? 9.788   69.468 81.455 1.00 42.62  ? 340  SER A CB  1 
ATOM   2708 O OG  . SER A 1 340 ? 9.292   68.452 82.302 1.00 48.19  ? 340  SER A OG  1 
ATOM   2709 N N   . LYS A 1 341 ? 8.832   70.956 78.848 1.00 43.70  ? 341  LYS A N   1 
ATOM   2710 C CA  . LYS A 1 341 ? 8.904   72.120 77.992 1.00 43.78  ? 341  LYS A CA  1 
ATOM   2711 C C   . LYS A 1 341 ? 9.623   73.292 78.653 1.00 44.03  ? 341  LYS A C   1 
ATOM   2712 O O   . LYS A 1 341 ? 10.358  74.027 77.988 1.00 42.13  ? 341  LYS A O   1 
ATOM   2713 C CB  . LYS A 1 341 ? 7.495   72.539 77.576 1.00 44.10  ? 341  LYS A CB  1 
ATOM   2714 C CG  . LYS A 1 341 ? 7.453   73.654 76.532 1.00 47.05  ? 341  LYS A CG  1 
ATOM   2715 C CD  . LYS A 1 341 ? 6.021   73.946 76.113 1.00 48.03  ? 341  LYS A CD  1 
ATOM   2716 C CE  . LYS A 1 341 ? 5.751   75.437 76.101 1.00 49.75  ? 341  LYS A CE  1 
ATOM   2717 N NZ  . LYS A 1 341 ? 6.118   76.074 77.400 1.00 51.65  ? 341  LYS A NZ  1 
ATOM   2718 N N   . ASP A 1 342 ? 9.434   73.454 79.960 1.00 43.90  ? 342  ASP A N   1 
ATOM   2719 C CA  . ASP A 1 342 ? 10.046  74.575 80.661 1.00 43.32  ? 342  ASP A CA  1 
ATOM   2720 C C   . ASP A 1 342 ? 11.330  74.297 81.445 1.00 43.98  ? 342  ASP A C   1 
ATOM   2721 O O   . ASP A 1 342 ? 11.790  75.157 82.193 1.00 43.42  ? 342  ASP A O   1 
ATOM   2722 C CB  . ASP A 1 342 ? 9.018   75.231 81.587 1.00 44.06  ? 342  ASP A CB  1 
ATOM   2723 C CG  . ASP A 1 342 ? 7.768   75.690 80.848 1.00 45.31  ? 342  ASP A CG  1 
ATOM   2724 O OD1 . ASP A 1 342 ? 7.806   75.805 79.601 1.00 45.01  ? 342  ASP A OD1 1 
ATOM   2725 O OD2 . ASP A 1 342 ? 6.745   75.949 81.520 1.00 45.71  ? 342  ASP A OD2 1 
ATOM   2726 N N   . SER A 1 343 ? 11.911  73.112 81.296 1.00 44.02  ? 343  SER A N   1 
ATOM   2727 C CA  . SER A 1 343 ? 13.158  72.814 81.992 1.00 46.04  ? 343  SER A CA  1 
ATOM   2728 C C   . SER A 1 343 ? 14.211  72.505 80.938 1.00 46.62  ? 343  SER A C   1 
ATOM   2729 O O   . SER A 1 343 ? 13.900  72.486 79.750 1.00 48.24  ? 343  SER A O   1 
ATOM   2730 C CB  . SER A 1 343 ? 12.992  71.616 82.927 1.00 48.00  ? 343  SER A CB  1 
ATOM   2731 O OG  . SER A 1 343 ? 12.704  70.427 82.213 1.00 54.36  ? 343  SER A OG  1 
ATOM   2732 N N   . GLU A 1 344 ? 15.453  72.284 81.357 1.00 47.02  ? 344  GLU A N   1 
ATOM   2733 C CA  . GLU A 1 344 ? 16.516  71.950 80.412 1.00 47.68  ? 344  GLU A CA  1 
ATOM   2734 C C   . GLU A 1 344 ? 16.464  70.463 80.058 1.00 45.73  ? 344  GLU A C   1 
ATOM   2735 O O   . GLU A 1 344 ? 17.205  69.988 79.201 1.00 45.56  ? 344  GLU A O   1 
ATOM   2736 C CB  . GLU A 1 344 ? 17.887  72.291 80.996 1.00 52.56  ? 344  GLU A CB  1 
ATOM   2737 C CG  . GLU A 1 344 ? 18.235  73.763 80.935 1.00 61.25  ? 344  GLU A CG  1 
ATOM   2738 C CD  . GLU A 1 344 ? 19.665  74.035 81.375 1.00 67.23  ? 344  GLU A CD  1 
ATOM   2739 O OE1 . GLU A 1 344 ? 20.063  75.225 81.412 1.00 69.83  ? 344  GLU A OE1 1 
ATOM   2740 O OE2 . GLU A 1 344 ? 20.392  73.059 81.681 1.00 69.29  ? 344  GLU A OE2 1 
ATOM   2741 N N   . SER A 1 345 ? 15.588  69.733 80.734 1.00 43.58  ? 345  SER A N   1 
ATOM   2742 C CA  . SER A 1 345 ? 15.414  68.310 80.494 1.00 42.63  ? 345  SER A CA  1 
ATOM   2743 C C   . SER A 1 345 ? 16.697  67.487 80.508 1.00 42.86  ? 345  SER A C   1 
ATOM   2744 O O   . SER A 1 345 ? 16.950  66.710 79.585 1.00 42.70  ? 345  SER A O   1 
ATOM   2745 C CB  . SER A 1 345 ? 14.683  68.088 79.167 1.00 41.86  ? 345  SER A CB  1 
ATOM   2746 O OG  . SER A 1 345 ? 13.367  68.604 79.222 1.00 42.35  ? 345  SER A OG  1 
ATOM   2747 N N   . LYS A 1 346 ? 17.507  67.658 81.549 1.00 43.29  ? 346  LYS A N   1 
ATOM   2748 C CA  . LYS A 1 346 ? 18.731  66.877 81.679 1.00 45.69  ? 346  LYS A CA  1 
ATOM   2749 C C   . LYS A 1 346 ? 18.273  65.477 82.097 1.00 46.11  ? 346  LYS A C   1 
ATOM   2750 O O   . LYS A 1 346 ? 17.571  65.306 83.091 1.00 47.12  ? 346  LYS A O   1 
ATOM   2751 C CB  . LYS A 1 346 ? 19.656  67.501 82.726 1.00 47.76  ? 346  LYS A CB  1 
ATOM   2752 C CG  . LYS A 1 346 ? 20.182  68.875 82.317 1.00 51.48  ? 346  LYS A CG  1 
ATOM   2753 C CD  . LYS A 1 346 ? 21.120  69.459 83.360 1.00 54.52  ? 346  LYS A CD  1 
ATOM   2754 C CE  . LYS A 1 346 ? 21.604  70.845 82.948 1.00 58.76  ? 346  LYS A CE  1 
ATOM   2755 N NZ  . LYS A 1 346 ? 22.474  71.485 83.984 1.00 60.77  ? 346  LYS A NZ  1 
ATOM   2756 N N   . ILE A 1 347 ? 18.673  64.475 81.327 1.00 44.44  ? 347  ILE A N   1 
ATOM   2757 C CA  . ILE A 1 347 ? 18.234  63.112 81.572 1.00 44.68  ? 347  ILE A CA  1 
ATOM   2758 C C   . ILE A 1 347 ? 19.139  62.193 82.387 1.00 45.95  ? 347  ILE A C   1 
ATOM   2759 O O   . ILE A 1 347 ? 20.313  61.990 82.068 1.00 44.90  ? 347  ILE A O   1 
ATOM   2760 C CB  . ILE A 1 347 ? 17.907  62.434 80.214 1.00 44.15  ? 347  ILE A CB  1 
ATOM   2761 C CG1 . ILE A 1 347 ? 16.890  63.293 79.457 1.00 42.85  ? 347  ILE A CG1 1 
ATOM   2762 C CG2 . ILE A 1 347 ? 17.370  61.030 80.418 1.00 43.32  ? 347  ILE A CG2 1 
ATOM   2763 C CD1 . ILE A 1 347 ? 15.664  63.653 80.271 1.00 40.28  ? 347  ILE A CD1 1 
ATOM   2764 N N   . SER A 1 348 ? 18.567  61.630 83.444 1.00 46.25  ? 348  SER A N   1 
ATOM   2765 C CA  . SER A 1 348 ? 19.287  60.700 84.297 1.00 48.77  ? 348  SER A CA  1 
ATOM   2766 C C   . SER A 1 348 ? 19.505  59.423 83.492 1.00 49.64  ? 348  SER A C   1 
ATOM   2767 O O   . SER A 1 348 ? 18.869  59.218 82.454 1.00 49.95  ? 348  SER A O   1 
ATOM   2768 C CB  . SER A 1 348 ? 18.457  60.376 85.540 1.00 49.99  ? 348  SER A CB  1 
ATOM   2769 O OG  . SER A 1 348 ? 17.294  59.638 85.203 1.00 49.32  ? 348  SER A OG  1 
ATOM   2770 N N   . ARG A 1 349 ? 20.396  58.559 83.963 1.00 50.15  ? 349  ARG A N   1 
ATOM   2771 C CA  . ARG A 1 349 ? 20.654  57.316 83.256 1.00 51.23  ? 349  ARG A CA  1 
ATOM   2772 C C   . ARG A 1 349 ? 19.393  56.443 83.257 1.00 51.85  ? 349  ARG A C   1 
ATOM   2773 O O   . ARG A 1 349 ? 19.119  55.743 82.283 1.00 51.71  ? 349  ARG A O   1 
ATOM   2774 C CB  . ARG A 1 349 ? 21.811  56.561 83.904 1.00 50.35  ? 349  ARG A CB  1 
ATOM   2775 C CG  . ARG A 1 349 ? 22.290  55.364 83.102 1.00 53.19  ? 349  ARG A CG  1 
ATOM   2776 C CD  . ARG A 1 349 ? 23.694  55.586 82.542 1.00 55.69  ? 349  ARG A CD  1 
ATOM   2777 N NE  . ARG A 1 349 ? 23.726  56.457 81.367 1.00 55.05  ? 349  ARG A NE  1 
ATOM   2778 C CZ  . ARG A 1 349 ? 23.500  56.042 80.124 1.00 56.04  ? 349  ARG A CZ  1 
ATOM   2779 N NH1 . ARG A 1 349 ? 23.222  54.766 79.889 1.00 56.34  ? 349  ARG A NH1 1 
ATOM   2780 N NH2 . ARG A 1 349 ? 23.557  56.898 79.111 1.00 55.34  ? 349  ARG A NH2 1 
ATOM   2781 N N   A GLU A 1 350 ? 18.630  56.494 84.347 0.50 52.62  ? 350  GLU A N   1 
ATOM   2782 N N   B GLU A 1 350 ? 18.632  56.486 84.348 0.50 52.21  ? 350  GLU A N   1 
ATOM   2783 C CA  A GLU A 1 350 ? 17.403  55.708 84.462 0.50 53.79  ? 350  GLU A CA  1 
ATOM   2784 C CA  B GLU A 1 350 ? 17.403  55.703 84.436 0.50 53.07  ? 350  GLU A CA  1 
ATOM   2785 C C   A GLU A 1 350 ? 16.418  56.117 83.361 0.50 53.38  ? 350  GLU A C   1 
ATOM   2786 C C   B GLU A 1 350 ? 16.443  56.120 83.325 0.50 52.92  ? 350  GLU A C   1 
ATOM   2787 O O   A GLU A 1 350 ? 15.862  55.267 82.663 0.50 53.77  ? 350  GLU A O   1 
ATOM   2788 O O   B GLU A 1 350 ? 15.927  55.279 82.584 0.50 53.28  ? 350  GLU A O   1 
ATOM   2789 C CB  A GLU A 1 350 ? 16.767  55.922 85.841 0.50 55.52  ? 350  GLU A CB  1 
ATOM   2790 C CB  B GLU A 1 350 ? 16.718  55.905 85.791 0.50 53.97  ? 350  GLU A CB  1 
ATOM   2791 C CG  A GLU A 1 350 ? 16.161  54.670 86.479 0.50 58.18  ? 350  GLU A CG  1 
ATOM   2792 C CG  B GLU A 1 350 ? 17.368  55.187 86.964 0.50 55.41  ? 350  GLU A CG  1 
ATOM   2793 C CD  A GLU A 1 350 ? 15.029  54.062 85.664 0.50 60.48  ? 350  GLU A CD  1 
ATOM   2794 C CD  B GLU A 1 350 ? 18.698  55.784 87.361 0.50 56.51  ? 350  GLU A CD  1 
ATOM   2795 O OE1 A GLU A 1 350 ? 14.075  54.797 85.329 0.50 61.46  ? 350  GLU A OE1 1 
ATOM   2796 O OE1 B GLU A 1 350 ? 19.657  55.703 86.565 0.50 56.57  ? 350  GLU A OE1 1 
ATOM   2797 O OE2 A GLU A 1 350 ? 15.085  52.848 85.363 0.50 60.58  ? 350  GLU A OE2 1 
ATOM   2798 O OE2 B GLU A 1 350 ? 18.784  56.339 88.475 0.50 58.70  ? 350  GLU A OE2 1 
ATOM   2799 N N   . ASP A 1 351 ? 16.207  57.423 83.213 1.00 52.53  ? 351  ASP A N   1 
ATOM   2800 C CA  . ASP A 1 351 ? 15.307  57.941 82.192 1.00 50.28  ? 351  ASP A CA  1 
ATOM   2801 C C   . ASP A 1 351 ? 15.862  57.704 80.790 1.00 48.33  ? 351  ASP A C   1 
ATOM   2802 O O   . ASP A 1 351 ? 15.104  57.599 79.827 1.00 47.74  ? 351  ASP A O   1 
ATOM   2803 C CB  . ASP A 1 351 ? 15.046  59.432 82.410 1.00 50.58  ? 351  ASP A CB  1 
ATOM   2804 C CG  . ASP A 1 351 ? 14.064  59.694 83.542 1.00 52.49  ? 351  ASP A CG  1 
ATOM   2805 O OD1 . ASP A 1 351 ? 13.434  58.727 84.019 1.00 52.90  ? 351  ASP A OD1 1 
ATOM   2806 O OD2 . ASP A 1 351 ? 13.910  60.868 83.948 1.00 51.51  ? 351  ASP A OD2 1 
ATOM   2807 N N   . PHE A 1 352 ? 17.181  57.615 80.671 1.00 45.43  ? 352  PHE A N   1 
ATOM   2808 C CA  . PHE A 1 352 ? 17.782  57.364 79.370 1.00 44.80  ? 352  PHE A CA  1 
ATOM   2809 C C   . PHE A 1 352 ? 17.347  55.980 78.923 1.00 46.23  ? 352  PHE A C   1 
ATOM   2810 O O   . PHE A 1 352 ? 16.904  55.779 77.796 1.00 46.76  ? 352  PHE A O   1 
ATOM   2811 C CB  . PHE A 1 352 ? 19.305  57.392 79.458 1.00 41.46  ? 352  PHE A CB  1 
ATOM   2812 C CG  . PHE A 1 352 ? 19.991  57.198 78.134 1.00 39.48  ? 352  PHE A CG  1 
ATOM   2813 C CD1 . PHE A 1 352 ? 20.123  58.255 77.239 1.00 39.19  ? 352  PHE A CD1 1 
ATOM   2814 C CD2 . PHE A 1 352 ? 20.489  55.947 77.772 1.00 40.14  ? 352  PHE A CD2 1 
ATOM   2815 C CE1 . PHE A 1 352 ? 20.742  58.070 76.000 1.00 39.06  ? 352  PHE A CE1 1 
ATOM   2816 C CE2 . PHE A 1 352 ? 21.110  55.746 76.538 1.00 37.43  ? 352  PHE A CE2 1 
ATOM   2817 C CZ  . PHE A 1 352 ? 21.235  56.810 75.651 1.00 39.11  ? 352  PHE A CZ  1 
ATOM   2818 N N   . MET A 1 353 ? 17.481  55.027 79.837 1.00 49.04  ? 353  MET A N   1 
ATOM   2819 C CA  . MET A 1 353 ? 17.131  53.641 79.579 1.00 51.32  ? 353  MET A CA  1 
ATOM   2820 C C   . MET A 1 353 ? 15.652  53.502 79.246 1.00 51.35  ? 353  MET A C   1 
ATOM   2821 O O   . MET A 1 353 ? 15.280  52.758 78.335 1.00 51.60  ? 353  MET A O   1 
ATOM   2822 C CB  . MET A 1 353 ? 17.483  52.786 80.797 1.00 54.01  ? 353  MET A CB  1 
ATOM   2823 C CG  . MET A 1 353 ? 18.911  52.985 81.256 1.00 58.84  ? 353  MET A CG  1 
ATOM   2824 S SD  . MET A 1 353 ? 19.489  51.735 82.414 1.00 65.54  ? 353  MET A SD  1 
ATOM   2825 C CE  . MET A 1 353 ? 20.304  50.584 81.285 1.00 62.93  ? 353  MET A CE  1 
ATOM   2826 N N   . SER A 1 354 ? 14.816  54.219 79.992 1.00 49.31  ? 354  SER A N   1 
ATOM   2827 C CA  . SER A 1 354 ? 13.382  54.192 79.771 1.00 47.48  ? 354  SER A CA  1 
ATOM   2828 C C   . SER A 1 354 ? 13.112  54.764 78.385 1.00 46.68  ? 354  SER A C   1 
ATOM   2829 O O   . SER A 1 354 ? 12.282  54.245 77.631 1.00 45.61  ? 354  SER A O   1 
ATOM   2830 C CB  . SER A 1 354 ? 12.674  55.041 80.826 1.00 49.28  ? 354  SER A CB  1 
ATOM   2831 O OG  . SER A 1 354 ? 12.984  54.589 82.130 1.00 55.03  ? 354  SER A OG  1 
ATOM   2832 N N   . GLY A 1 355 ? 13.826  55.841 78.067 1.00 43.97  ? 355  GLY A N   1 
ATOM   2833 C CA  . GLY A 1 355 ? 13.674  56.494 76.783 1.00 41.68  ? 355  GLY A CA  1 
ATOM   2834 C C   . GLY A 1 355 ? 14.095  55.610 75.628 1.00 40.56  ? 355  GLY A C   1 
ATOM   2835 O O   . GLY A 1 355 ? 13.446  55.589 74.585 1.00 40.48  ? 355  GLY A O   1 
ATOM   2836 N N   . VAL A 1 356 ? 15.183  54.873 75.798 1.00 39.94  ? 356  VAL A N   1 
ATOM   2837 C CA  . VAL A 1 356 ? 15.644  54.000 74.729 1.00 41.25  ? 356  VAL A CA  1 
ATOM   2838 C C   . VAL A 1 356 ? 14.585  52.962 74.387 1.00 42.91  ? 356  VAL A C   1 
ATOM   2839 O O   . VAL A 1 356 ? 14.312  52.708 73.212 1.00 42.70  ? 356  VAL A O   1 
ATOM   2840 C CB  . VAL A 1 356 ? 16.943  53.285 75.117 1.00 40.94  ? 356  VAL A CB  1 
ATOM   2841 C CG1 . VAL A 1 356 ? 17.298  52.232 74.070 1.00 39.38  ? 356  VAL A CG1 1 
ATOM   2842 C CG2 . VAL A 1 356 ? 18.059  54.312 75.252 1.00 39.57  ? 356  VAL A CG2 1 
ATOM   2843 N N   . LYS A 1 357 ? 13.981  52.376 75.417 1.00 44.08  ? 357  LYS A N   1 
ATOM   2844 C CA  . LYS A 1 357 ? 12.952  51.361 75.225 1.00 44.82  ? 357  LYS A CA  1 
ATOM   2845 C C   . LYS A 1 357 ? 11.706  51.917 74.530 1.00 44.13  ? 357  LYS A C   1 
ATOM   2846 O O   . LYS A 1 357 ? 11.028  51.200 73.793 1.00 43.36  ? 357  LYS A O   1 
ATOM   2847 C CB  . LYS A 1 357 ? 12.570  50.742 76.572 1.00 47.76  ? 357  LYS A CB  1 
ATOM   2848 C CG  . LYS A 1 357 ? 11.942  49.361 76.454 1.00 50.16  ? 357  LYS A CG  1 
ATOM   2849 C CD  . LYS A 1 357 ? 11.919  48.651 77.795 1.00 53.86  ? 357  LYS A CD  1 
ATOM   2850 C CE  . LYS A 1 357 ? 11.705  47.145 77.629 1.00 55.44  ? 357  LYS A CE  1 
ATOM   2851 N NZ  . LYS A 1 357 ? 10.436  46.813 76.924 1.00 57.09  ? 357  LYS A NZ  1 
ATOM   2852 N N   . LEU A 1 358 ? 11.403  53.191 74.761 1.00 42.57  ? 358  LEU A N   1 
ATOM   2853 C CA  . LEU A 1 358 ? 10.247  53.814 74.131 1.00 41.19  ? 358  LEU A CA  1 
ATOM   2854 C C   . LEU A 1 358 ? 10.523  54.136 72.664 1.00 41.94  ? 358  LEU A C   1 
ATOM   2855 O O   . LEU A 1 358 ? 9.602   54.175 71.847 1.00 41.13  ? 358  LEU A O   1 
ATOM   2856 C CB  . LEU A 1 358 ? 9.889   55.111 74.845 1.00 42.19  ? 358  LEU A CB  1 
ATOM   2857 C CG  . LEU A 1 358 ? 9.265   55.056 76.231 1.00 43.60  ? 358  LEU A CG  1 
ATOM   2858 C CD1 . LEU A 1 358 ? 9.097   56.481 76.762 1.00 41.74  ? 358  LEU A CD1 1 
ATOM   2859 C CD2 . LEU A 1 358 ? 7.924   54.338 76.148 1.00 42.10  ? 358  LEU A CD2 1 
ATOM   2860 N N   . SER A 1 359 ? 11.796  54.367 72.345 1.00 40.85  ? 359  SER A N   1 
ATOM   2861 C CA  . SER A 1 359 ? 12.224  54.725 70.994 1.00 40.57  ? 359  SER A CA  1 
ATOM   2862 C C   . SER A 1 359 ? 12.396  53.559 70.025 1.00 40.22  ? 359  SER A C   1 
ATOM   2863 O O   . SER A 1 359 ? 12.230  53.718 68.818 1.00 41.10  ? 359  SER A O   1 
ATOM   2864 C CB  . SER A 1 359 ? 13.531  55.520 71.063 1.00 39.29  ? 359  SER A CB  1 
ATOM   2865 O OG  . SER A 1 359 ? 13.357  56.685 71.845 1.00 42.35  ? 359  SER A OG  1 
ATOM   2866 N N   . VAL A 1 360 ? 12.747  52.394 70.545 1.00 39.85  ? 360  VAL A N   1 
ATOM   2867 C CA  . VAL A 1 360 ? 12.929  51.220 69.704 1.00 41.39  ? 360  VAL A CA  1 
ATOM   2868 C C   . VAL A 1 360 ? 12.046  50.139 70.301 1.00 43.50  ? 360  VAL A C   1 
ATOM   2869 O O   . VAL A 1 360 ? 12.536  49.153 70.842 1.00 42.94  ? 360  VAL A O   1 
ATOM   2870 C CB  . VAL A 1 360 ? 14.383  50.753 69.733 1.00 40.35  ? 360  VAL A CB  1 
ATOM   2871 C CG1 . VAL A 1 360 ? 14.632  49.778 68.602 1.00 39.48  ? 360  VAL A CG1 1 
ATOM   2872 C CG2 . VAL A 1 360 ? 15.307  51.952 69.656 1.00 39.21  ? 360  VAL A CG2 1 
ATOM   2873 N N   . PRO A 1 361 ? 10.721  50.315 70.203 1.00 46.41  ? 361  PRO A N   1 
ATOM   2874 C CA  . PRO A 1 361 ? 9.713   49.390 70.731 1.00 48.36  ? 361  PRO A CA  1 
ATOM   2875 C C   . PRO A 1 361 ? 9.824   47.938 70.292 1.00 50.88  ? 361  PRO A C   1 
ATOM   2876 O O   . PRO A 1 361 ? 9.565   47.029 71.082 1.00 51.10  ? 361  PRO A O   1 
ATOM   2877 C CB  . PRO A 1 361 ? 8.397   50.040 70.303 1.00 47.94  ? 361  PRO A CB  1 
ATOM   2878 C CG  . PRO A 1 361 ? 8.763   50.728 69.033 1.00 47.57  ? 361  PRO A CG  1 
ATOM   2879 C CD  . PRO A 1 361 ? 10.085  51.352 69.369 1.00 46.54  ? 361  PRO A CD  1 
ATOM   2880 N N   . HIS A 1 362 ? 10.218  47.723 69.043 1.00 54.65  ? 362  HIS A N   1 
ATOM   2881 C CA  . HIS A 1 362 ? 10.351  46.375 68.493 1.00 58.84  ? 362  HIS A CA  1 
ATOM   2882 C C   . HIS A 1 362 ? 11.646  45.670 68.891 1.00 59.04  ? 362  HIS A C   1 
ATOM   2883 O O   . HIS A 1 362 ? 11.958  44.599 68.355 1.00 59.58  ? 362  HIS A O   1 
ATOM   2884 C CB  . HIS A 1 362 ? 10.294  46.436 66.966 1.00 63.18  ? 362  HIS A CB  1 
ATOM   2885 C CG  . HIS A 1 362 ? 11.381  47.270 66.356 1.00 66.69  ? 362  HIS A CG  1 
ATOM   2886 N ND1 . HIS A 1 362 ? 11.521  48.617 66.616 1.00 68.24  ? 362  HIS A ND1 1 
ATOM   2887 C CD2 . HIS A 1 362 ? 12.384  46.945 65.505 1.00 68.32  ? 362  HIS A CD2 1 
ATOM   2888 C CE1 . HIS A 1 362 ? 12.563  49.086 65.951 1.00 69.61  ? 362  HIS A CE1 1 
ATOM   2889 N NE2 . HIS A 1 362 ? 13.105  48.092 65.269 1.00 69.32  ? 362  HIS A NE2 1 
ATOM   2890 N N   . ALA A 1 363 ? 12.384  46.247 69.838 1.00 57.31  ? 363  ALA A N   1 
ATOM   2891 C CA  . ALA A 1 363 ? 13.662  45.675 70.242 1.00 54.96  ? 363  ALA A CA  1 
ATOM   2892 C C   . ALA A 1 363 ? 13.692  44.821 71.501 1.00 53.65  ? 363  ALA A C   1 
ATOM   2893 O O   . ALA A 1 363 ? 13.073  45.146 72.513 1.00 52.19  ? 363  ALA A O   1 
ATOM   2894 C CB  . ALA A 1 363 ? 14.697  46.784 70.362 1.00 53.87  ? 363  ALA A CB  1 
ATOM   2895 N N   . ASN A 1 364 ? 14.438  43.722 71.416 1.00 51.67  ? 364  ASN A N   1 
ATOM   2896 C CA  . ASN A 1 364 ? 14.624  42.814 72.536 1.00 49.80  ? 364  ASN A CA  1 
ATOM   2897 C C   . ASN A 1 364 ? 15.769  43.402 73.366 1.00 49.97  ? 364  ASN A C   1 
ATOM   2898 O O   . ASN A 1 364 ? 16.312  44.451 73.015 1.00 50.30  ? 364  ASN A O   1 
ATOM   2899 C CB  . ASN A 1 364 ? 14.992  41.418 72.026 1.00 47.87  ? 364  ASN A CB  1 
ATOM   2900 C CG  . ASN A 1 364 ? 16.246  41.421 71.165 1.00 49.95  ? 364  ASN A CG  1 
ATOM   2901 O OD1 . ASN A 1 364 ? 16.604  40.409 70.568 1.00 47.36  ? 364  ASN A OD1 1 
ATOM   2902 N ND2 . ASN A 1 364 ? 16.920  42.564 71.100 1.00 51.94  ? 364  ASN A ND2 1 
ATOM   2903 N N   . ASP A 1 365 ? 16.139  42.727 74.449 1.00 49.46  ? 365  ASP A N   1 
ATOM   2904 C CA  . ASP A 1 365 ? 17.204  43.197 75.335 1.00 49.80  ? 365  ASP A CA  1 
ATOM   2905 C C   . ASP A 1 365 ? 18.537  43.464 74.657 1.00 47.75  ? 365  ASP A C   1 
ATOM   2906 O O   . ASP A 1 365 ? 19.141  44.520 74.848 1.00 46.63  ? 365  ASP A O   1 
ATOM   2907 C CB  . ASP A 1 365 ? 17.414  42.194 76.467 1.00 55.28  ? 365  ASP A CB  1 
ATOM   2908 C CG  . ASP A 1 365 ? 16.465  42.419 77.624 1.00 60.79  ? 365  ASP A CG  1 
ATOM   2909 O OD1 . ASP A 1 365 ? 15.284  42.754 77.383 1.00 64.13  ? 365  ASP A OD1 1 
ATOM   2910 O OD2 . ASP A 1 365 ? 16.902  42.255 78.781 1.00 66.19  ? 365  ASP A OD2 1 
ATOM   2911 N N   . LEU A 1 366 ? 19.001  42.500 73.876 1.00 44.90  ? 366  LEU A N   1 
ATOM   2912 C CA  . LEU A 1 366 ? 20.263  42.639 73.180 1.00 42.97  ? 366  LEU A CA  1 
ATOM   2913 C C   . LEU A 1 366 ? 20.223  43.876 72.286 1.00 42.63  ? 366  LEU A C   1 
ATOM   2914 O O   . LEU A 1 366 ? 21.181  44.651 72.240 1.00 42.60  ? 366  LEU A O   1 
ATOM   2915 C CB  . LEU A 1 366 ? 20.525  41.386 72.352 1.00 42.38  ? 366  LEU A CB  1 
ATOM   2916 C CG  . LEU A 1 366 ? 21.854  41.280 71.615 1.00 44.21  ? 366  LEU A CG  1 
ATOM   2917 C CD1 . LEU A 1 366 ? 23.012  41.479 72.586 1.00 43.04  ? 366  LEU A CD1 1 
ATOM   2918 C CD2 . LEU A 1 366 ? 21.929  39.919 70.940 1.00 44.34  ? 366  LEU A CD2 1 
ATOM   2919 N N   . GLY A 1 367 ? 19.110  44.058 71.580 1.00 41.82  ? 367  GLY A N   1 
ATOM   2920 C CA  . GLY A 1 367 ? 18.964  45.209 70.708 1.00 40.52  ? 367  GLY A CA  1 
ATOM   2921 C C   . GLY A 1 367 ? 19.060  46.496 71.509 1.00 40.61  ? 367  GLY A C   1 
ATOM   2922 O O   . GLY A 1 367 ? 19.797  47.415 71.142 1.00 40.43  ? 367  GLY A O   1 
ATOM   2923 N N   . LEU A 1 368 ? 18.321  46.559 72.613 1.00 39.03  ? 368  LEU A N   1 
ATOM   2924 C CA  . LEU A 1 368 ? 18.333  47.736 73.468 1.00 38.06  ? 368  LEU A CA  1 
ATOM   2925 C C   . LEU A 1 368 ? 19.748  48.018 73.960 1.00 39.95  ? 368  LEU A C   1 
ATOM   2926 O O   . LEU A 1 368 ? 20.171  49.173 74.035 1.00 39.66  ? 368  LEU A O   1 
ATOM   2927 C CB  . LEU A 1 368 ? 17.383  47.537 74.648 1.00 36.45  ? 368  LEU A CB  1 
ATOM   2928 C CG  . LEU A 1 368 ? 15.895  47.403 74.276 1.00 39.47  ? 368  LEU A CG  1 
ATOM   2929 C CD1 . LEU A 1 368 ? 15.081  47.140 75.523 1.00 35.80  ? 368  LEU A CD1 1 
ATOM   2930 C CD2 . LEU A 1 368 ? 15.396  48.675 73.585 1.00 37.63  ? 368  LEU A CD2 1 
ATOM   2931 N N   . ASP A 1 369 ? 20.488  46.963 74.285 1.00 40.53  ? 369  ASP A N   1 
ATOM   2932 C CA  . ASP A 1 369 ? 21.858  47.139 74.744 1.00 41.43  ? 369  ASP A CA  1 
ATOM   2933 C C   . ASP A 1 369 ? 22.704  47.700 73.611 1.00 41.15  ? 369  ASP A C   1 
ATOM   2934 O O   . ASP A 1 369 ? 23.555  48.564 73.824 1.00 41.07  ? 369  ASP A O   1 
ATOM   2935 C CB  . ASP A 1 369 ? 22.462  45.810 75.214 1.00 42.98  ? 369  ASP A CB  1 
ATOM   2936 C CG  . ASP A 1 369 ? 21.920  45.364 76.557 1.00 45.06  ? 369  ASP A CG  1 
ATOM   2937 O OD1 . ASP A 1 369 ? 21.254  46.180 77.228 1.00 46.87  ? 369  ASP A OD1 1 
ATOM   2938 O OD2 . ASP A 1 369 ? 22.169  44.204 76.951 1.00 46.58  ? 369  ASP A OD2 1 
ATOM   2939 N N   . ALA A 1 370 ? 22.464  47.205 72.403 1.00 39.08  ? 370  ALA A N   1 
ATOM   2940 C CA  . ALA A 1 370 ? 23.218  47.656 71.251 1.00 38.76  ? 370  ALA A CA  1 
ATOM   2941 C C   . ALA A 1 370 ? 23.061  49.162 71.077 1.00 38.91  ? 370  ALA A C   1 
ATOM   2942 O O   . ALA A 1 370 ? 24.049  49.885 70.896 1.00 39.64  ? 370  ALA A O   1 
ATOM   2943 C CB  . ALA A 1 370 ? 22.745  46.924 70.005 1.00 38.62  ? 370  ALA A CB  1 
ATOM   2944 N N   . VAL A 1 371 ? 21.815  49.626 71.138 1.00 37.41  ? 371  VAL A N   1 
ATOM   2945 C CA  . VAL A 1 371 ? 21.504  51.043 70.987 1.00 35.51  ? 371  VAL A CA  1 
ATOM   2946 C C   . VAL A 1 371 ? 22.160  51.845 72.102 1.00 36.71  ? 371  VAL A C   1 
ATOM   2947 O O   . VAL A 1 371 ? 22.870  52.818 71.846 1.00 38.28  ? 371  VAL A O   1 
ATOM   2948 C CB  . VAL A 1 371 ? 19.968  51.289 71.014 1.00 35.82  ? 371  VAL A CB  1 
ATOM   2949 C CG1 . VAL A 1 371 ? 19.667  52.790 70.987 1.00 28.27  ? 371  VAL A CG1 1 
ATOM   2950 C CG2 . VAL A 1 371 ? 19.307  50.577 69.829 1.00 32.09  ? 371  VAL A CG2 1 
ATOM   2951 N N   . THR A 1 372 ? 21.931  51.429 73.341 1.00 36.39  ? 372  THR A N   1 
ATOM   2952 C CA  . THR A 1 372 ? 22.507  52.123 74.485 1.00 37.74  ? 372  THR A CA  1 
ATOM   2953 C C   . THR A 1 372 ? 24.018  52.284 74.337 1.00 38.87  ? 372  THR A C   1 
ATOM   2954 O O   . THR A 1 372 ? 24.553  53.373 74.544 1.00 39.92  ? 372  THR A O   1 
ATOM   2955 C CB  . THR A 1 372 ? 22.210  51.374 75.807 1.00 38.97  ? 372  THR A CB  1 
ATOM   2956 O OG1 . THR A 1 372 ? 20.793  51.345 76.031 1.00 39.45  ? 372  THR A OG1 1 
ATOM   2957 C CG2 . THR A 1 372 ? 22.891  52.067 76.989 1.00 35.88  ? 372  THR A CG2 1 
ATOM   2958 N N   . LEU A 1 373 ? 24.705  51.205 73.976 1.00 38.58  ? 373  LEU A N   1 
ATOM   2959 C CA  . LEU A 1 373 ? 26.153  51.254 73.820 1.00 39.27  ? 373  LEU A CA  1 
ATOM   2960 C C   . LEU A 1 373 ? 26.559  52.221 72.720 1.00 41.53  ? 373  LEU A C   1 
ATOM   2961 O O   . LEU A 1 373 ? 27.515  52.985 72.862 1.00 40.84  ? 373  LEU A O   1 
ATOM   2962 C CB  . LEU A 1 373 ? 26.696  49.862 73.494 1.00 38.76  ? 373  LEU A CB  1 
ATOM   2963 C CG  . LEU A 1 373 ? 28.195  49.736 73.212 1.00 40.83  ? 373  LEU A CG  1 
ATOM   2964 C CD1 . LEU A 1 373 ? 29.000  50.267 74.398 1.00 41.30  ? 373  LEU A CD1 1 
ATOM   2965 C CD2 . LEU A 1 373 ? 28.541  48.276 72.945 1.00 40.61  ? 373  LEU A CD2 1 
ATOM   2966 N N   . GLN A 1 374 ? 25.817  52.179 71.622 1.00 41.11  ? 374  GLN A N   1 
ATOM   2967 C CA  . GLN A 1 374 ? 26.088  53.022 70.468 1.00 41.07  ? 374  GLN A CA  1 
ATOM   2968 C C   . GLN A 1 374 ? 25.983  54.521 70.768 1.00 41.54  ? 374  GLN A C   1 
ATOM   2969 O O   . GLN A 1 374 ? 26.670  55.336 70.151 1.00 41.43  ? 374  GLN A O   1 
ATOM   2970 C CB  . GLN A 1 374 ? 25.110  52.661 69.352 1.00 42.55  ? 374  GLN A CB  1 
ATOM   2971 C CG  . GLN A 1 374 ? 25.486  53.166 67.988 1.00 41.99  ? 374  GLN A CG  1 
ATOM   2972 C CD  . GLN A 1 374 ? 26.746  52.516 67.478 1.00 43.56  ? 374  GLN A CD  1 
ATOM   2973 O OE1 . GLN A 1 374 ? 27.160  51.463 67.976 1.00 45.60  ? 374  GLN A OE1 1 
ATOM   2974 N NE2 . GLN A 1 374 ? 27.362  53.126 66.472 1.00 43.06  ? 374  GLN A NE2 1 
ATOM   2975 N N   . TYR A 1 375 ? 25.136  54.885 71.722 1.00 40.89  ? 375  TYR A N   1 
ATOM   2976 C CA  . TYR A 1 375 ? 24.933  56.293 72.036 1.00 40.60  ? 375  TYR A CA  1 
ATOM   2977 C C   . TYR A 1 375 ? 25.353  56.744 73.427 1.00 40.86  ? 375  TYR A C   1 
ATOM   2978 O O   . TYR A 1 375 ? 24.984  57.829 73.866 1.00 42.09  ? 375  TYR A O   1 
ATOM   2979 C CB  . TYR A 1 375 ? 23.457  56.654 71.817 1.00 37.47  ? 375  TYR A CB  1 
ATOM   2980 C CG  . TYR A 1 375 ? 23.049  56.709 70.362 1.00 35.61  ? 375  TYR A CG  1 
ATOM   2981 C CD1 . TYR A 1 375 ? 22.791  55.542 69.629 1.00 34.98  ? 375  TYR A CD1 1 
ATOM   2982 C CD2 . TYR A 1 375 ? 22.947  57.929 69.707 1.00 35.48  ? 375  TYR A CD2 1 
ATOM   2983 C CE1 . TYR A 1 375 ? 22.443  55.603 68.277 1.00 32.36  ? 375  TYR A CE1 1 
ATOM   2984 C CE2 . TYR A 1 375 ? 22.601  58.002 68.364 1.00 35.20  ? 375  TYR A CE2 1 
ATOM   2985 C CZ  . TYR A 1 375 ? 22.352  56.847 67.655 1.00 33.99  ? 375  TYR A CZ  1 
ATOM   2986 O OH  . TYR A 1 375 ? 22.020  56.966 66.329 1.00 35.05  ? 375  TYR A OH  1 
ATOM   2987 N N   . THR A 1 376 ? 26.128  55.930 74.126 1.00 40.77  ? 376  THR A N   1 
ATOM   2988 C CA  . THR A 1 376 ? 26.545  56.310 75.464 1.00 40.56  ? 376  THR A CA  1 
ATOM   2989 C C   . THR A 1 376 ? 28.033  56.576 75.556 1.00 40.55  ? 376  THR A C   1 
ATOM   2990 O O   . THR A 1 376 ? 28.843  55.819 75.032 1.00 40.50  ? 376  THR A O   1 
ATOM   2991 C CB  . THR A 1 376 ? 26.186  55.216 76.495 1.00 40.39  ? 376  THR A CB  1 
ATOM   2992 O OG1 . THR A 1 376 ? 24.773  54.977 76.468 1.00 40.59  ? 376  THR A OG1 1 
ATOM   2993 C CG2 . THR A 1 376 ? 26.589  55.650 77.897 1.00 37.68  ? 376  THR A CG2 1 
ATOM   2994 N N   . ASP A 1 377 ? 28.387  57.675 76.207 1.00 41.99  ? 377  ASP A N   1 
ATOM   2995 C CA  . ASP A 1 377 ? 29.787  58.007 76.414 1.00 42.22  ? 377  ASP A CA  1 
ATOM   2996 C C   . ASP A 1 377 ? 30.105  57.407 77.779 1.00 42.45  ? 377  ASP A C   1 
ATOM   2997 O O   . ASP A 1 377 ? 29.734  57.972 78.806 1.00 41.45  ? 377  ASP A O   1 
ATOM   2998 C CB  . ASP A 1 377 ? 29.986  59.519 76.466 1.00 42.39  ? 377  ASP A CB  1 
ATOM   2999 C CG  . ASP A 1 377 ? 31.430  59.903 76.744 1.00 44.96  ? 377  ASP A CG  1 
ATOM   3000 O OD1 . ASP A 1 377 ? 32.247  58.992 77.022 1.00 41.85  ? 377  ASP A OD1 1 
ATOM   3001 O OD2 . ASP A 1 377 ? 31.745  61.114 76.686 1.00 44.55  ? 377  ASP A OD2 1 
ATOM   3002 N N   . TRP A 1 378 ? 30.774  56.261 77.791 1.00 42.51  ? 378  TRP A N   1 
ATOM   3003 C CA  . TRP A 1 378 ? 31.099  55.609 79.051 1.00 46.22  ? 378  TRP A CA  1 
ATOM   3004 C C   . TRP A 1 378 ? 32.169  56.280 79.902 1.00 46.08  ? 378  TRP A C   1 
ATOM   3005 O O   . TRP A 1 378 ? 32.529  55.769 80.956 1.00 46.48  ? 378  TRP A O   1 
ATOM   3006 C CB  . TRP A 1 378 ? 31.452  54.139 78.805 1.00 48.15  ? 378  TRP A CB  1 
ATOM   3007 C CG  . TRP A 1 378 ? 30.244  53.350 78.414 1.00 51.36  ? 378  TRP A CG  1 
ATOM   3008 C CD1 . TRP A 1 378 ? 29.998  52.764 77.207 1.00 52.13  ? 378  TRP A CD1 1 
ATOM   3009 C CD2 . TRP A 1 378 ? 29.074  53.136 79.209 1.00 52.03  ? 378  TRP A CD2 1 
ATOM   3010 N NE1 . TRP A 1 378 ? 28.746  52.203 77.199 1.00 52.42  ? 378  TRP A NE1 1 
ATOM   3011 C CE2 . TRP A 1 378 ? 28.157  52.416 78.416 1.00 52.24  ? 378  TRP A CE2 1 
ATOM   3012 C CE3 . TRP A 1 378 ? 28.711  53.489 80.516 1.00 54.64  ? 378  TRP A CE3 1 
ATOM   3013 C CZ2 . TRP A 1 378 ? 26.898  52.038 78.884 1.00 53.89  ? 378  TRP A CZ2 1 
ATOM   3014 C CZ3 . TRP A 1 378 ? 27.455  53.113 80.984 1.00 54.63  ? 378  TRP A CZ3 1 
ATOM   3015 C CH2 . TRP A 1 378 ? 26.564  52.394 80.167 1.00 53.50  ? 378  TRP A CH2 1 
ATOM   3016 N N   . MET A 1 379 ? 32.675  57.423 79.453 1.00 48.33  ? 379  MET A N   1 
ATOM   3017 C CA  . MET A 1 379 ? 33.672  58.156 80.232 1.00 50.54  ? 379  MET A CA  1 
ATOM   3018 C C   . MET A 1 379 ? 32.940  59.227 81.024 1.00 51.68  ? 379  MET A C   1 
ATOM   3019 O O   . MET A 1 379 ? 33.521  59.875 81.894 1.00 53.76  ? 379  MET A O   1 
ATOM   3020 C CB  . MET A 1 379 ? 34.682  58.872 79.337 1.00 50.41  ? 379  MET A CB  1 
ATOM   3021 C CG  . MET A 1 379 ? 35.647  58.001 78.592 1.00 52.16  ? 379  MET A CG  1 
ATOM   3022 S SD  . MET A 1 379 ? 36.944  59.062 77.924 1.00 56.91  ? 379  MET A SD  1 
ATOM   3023 C CE  . MET A 1 379 ? 36.097  59.827 76.561 1.00 49.58  ? 379  MET A CE  1 
ATOM   3024 N N   . ASP A 1 380 ? 31.661  59.410 80.716 1.00 50.93  ? 380  ASP A N   1 
ATOM   3025 C CA  . ASP A 1 380 ? 30.870  60.447 81.355 1.00 51.14  ? 380  ASP A CA  1 
ATOM   3026 C C   . ASP A 1 380 ? 29.385  60.124 81.155 1.00 51.84  ? 380  ASP A C   1 
ATOM   3027 O O   . ASP A 1 380 ? 28.608  60.967 80.706 1.00 53.34  ? 380  ASP A O   1 
ATOM   3028 C CB  . ASP A 1 380 ? 31.267  61.777 80.695 1.00 49.58  ? 380  ASP A CB  1 
ATOM   3029 C CG  . ASP A 1 380 ? 30.530  62.970 81.254 1.00 51.04  ? 380  ASP A CG  1 
ATOM   3030 O OD1 . ASP A 1 380 ? 30.217  62.981 82.463 1.00 52.58  ? 380  ASP A OD1 1 
ATOM   3031 O OD2 . ASP A 1 380 ? 30.284  63.915 80.475 1.00 50.28  ? 380  ASP A OD2 1 
ATOM   3032 N N   . ASP A 1 381 ? 28.997  58.901 81.517 1.00 52.35  ? 381  ASP A N   1 
ATOM   3033 C CA  . ASP A 1 381 ? 27.623  58.428 81.336 1.00 53.69  ? 381  ASP A CA  1 
ATOM   3034 C C   . ASP A 1 381 ? 26.523  59.040 82.202 1.00 54.04  ? 381  ASP A C   1 
ATOM   3035 O O   . ASP A 1 381 ? 25.341  58.762 81.984 1.00 54.96  ? 381  ASP A O   1 
ATOM   3036 C CB  . ASP A 1 381 ? 27.573  56.912 81.490 1.00 54.77  ? 381  ASP A CB  1 
ATOM   3037 C CG  . ASP A 1 381 ? 27.828  56.476 82.901 1.00 56.96  ? 381  ASP A CG  1 
ATOM   3038 O OD1 . ASP A 1 381 ? 28.896  56.828 83.438 1.00 56.59  ? 381  ASP A OD1 1 
ATOM   3039 O OD2 . ASP A 1 381 ? 26.960  55.786 83.472 1.00 60.87  ? 381  ASP A OD2 1 
ATOM   3040 N N   . ASN A 1 382 ? 26.887  59.858 83.181 1.00 53.51  ? 382  ASN A N   1 
ATOM   3041 C CA  . ASN A 1 382 ? 25.875  60.488 84.020 1.00 53.48  ? 382  ASN A CA  1 
ATOM   3042 C C   . ASN A 1 382 ? 25.587  61.921 83.588 1.00 52.50  ? 382  ASN A C   1 
ATOM   3043 O O   . ASN A 1 382 ? 24.716  62.593 84.150 1.00 53.62  ? 382  ASN A O   1 
ATOM   3044 C CB  . ASN A 1 382 ? 26.293  60.444 85.487 1.00 55.77  ? 382  ASN A CB  1 
ATOM   3045 C CG  . ASN A 1 382 ? 25.834  59.173 86.175 1.00 58.05  ? 382  ASN A CG  1 
ATOM   3046 O OD1 . ASN A 1 382 ? 26.590  58.545 86.914 1.00 61.82  ? 382  ASN A OD1 1 
ATOM   3047 N ND2 . ASN A 1 382 ? 24.583  58.788 85.934 1.00 58.34  ? 382  ASN A ND2 1 
ATOM   3048 N N   . ASN A 1 383 ? 26.313  62.384 82.580 1.00 50.18  ? 383  ASN A N   1 
ATOM   3049 C CA  . ASN A 1 383 ? 26.103  63.723 82.068 1.00 48.14  ? 383  ASN A CA  1 
ATOM   3050 C C   . ASN A 1 383 ? 24.665  63.806 81.543 1.00 47.46  ? 383  ASN A C   1 
ATOM   3051 O O   . ASN A 1 383 ? 24.329  63.207 80.517 1.00 47.16  ? 383  ASN A O   1 
ATOM   3052 C CB  . ASN A 1 383 ? 27.088  64.004 80.940 1.00 48.31  ? 383  ASN A CB  1 
ATOM   3053 C CG  . ASN A 1 383 ? 27.012  65.426 80.448 1.00 49.97  ? 383  ASN A CG  1 
ATOM   3054 O OD1 . ASN A 1 383 ? 25.924  65.957 80.210 1.00 50.79  ? 383  ASN A OD1 1 
ATOM   3055 N ND2 . ASN A 1 383 ? 28.170  66.054 80.281 1.00 49.99  ? 383  ASN A ND2 1 
ATOM   3056 N N   . GLY A 1 384 ? 23.824  64.550 82.256 1.00 46.47  ? 384  GLY A N   1 
ATOM   3057 C CA  . GLY A 1 384 ? 22.428  64.701 81.877 1.00 43.18  ? 384  GLY A CA  1 
ATOM   3058 C C   . GLY A 1 384 ? 22.168  65.342 80.528 1.00 42.53  ? 384  GLY A C   1 
ATOM   3059 O O   . GLY A 1 384 ? 21.124  65.103 79.922 1.00 42.85  ? 384  GLY A O   1 
ATOM   3060 N N   . ILE A 1 385 ? 23.104  66.158 80.056 1.00 41.00  ? 385  ILE A N   1 
ATOM   3061 C CA  . ILE A 1 385 ? 22.945  66.821 78.768 1.00 39.72  ? 385  ILE A CA  1 
ATOM   3062 C C   . ILE A 1 385 ? 23.292  65.859 77.648 1.00 40.65  ? 385  ILE A C   1 
ATOM   3063 O O   . ILE A 1 385 ? 22.667  65.868 76.588 1.00 41.11  ? 385  ILE A O   1 
ATOM   3064 C CB  . ILE A 1 385 ? 23.843  68.074 78.678 1.00 39.64  ? 385  ILE A CB  1 
ATOM   3065 C CG1 . ILE A 1 385 ? 23.294  69.154 79.609 1.00 39.28  ? 385  ILE A CG1 1 
ATOM   3066 C CG2 . ILE A 1 385 ? 23.910  68.591 77.251 1.00 35.81  ? 385  ILE A CG2 1 
ATOM   3067 C CD1 . ILE A 1 385 ? 24.156  70.393 79.688 1.00 40.52  ? 385  ILE A CD1 1 
ATOM   3068 N N   . LYS A 1 386 ? 24.291  65.019 77.890 1.00 42.51  ? 386  LYS A N   1 
ATOM   3069 C CA  . LYS A 1 386 ? 24.711  64.040 76.896 1.00 42.95  ? 386  LYS A CA  1 
ATOM   3070 C C   . LYS A 1 386 ? 23.638  62.974 76.752 1.00 41.83  ? 386  LYS A C   1 
ATOM   3071 O O   . LYS A 1 386 ? 23.385  62.478 75.656 1.00 41.30  ? 386  LYS A O   1 
ATOM   3072 C CB  . LYS A 1 386 ? 26.048  63.409 77.296 1.00 43.01  ? 386  LYS A CB  1 
ATOM   3073 C CG  . LYS A 1 386 ? 27.253  64.258 76.931 1.00 44.53  ? 386  LYS A CG  1 
ATOM   3074 C CD  . LYS A 1 386 ? 28.536  63.606 77.397 1.00 48.00  ? 386  LYS A CD  1 
ATOM   3075 C CE  . LYS A 1 386 ? 29.756  64.379 76.926 1.00 49.41  ? 386  LYS A CE  1 
ATOM   3076 N NZ  . LYS A 1 386 ? 31.018  63.765 77.446 1.00 50.98  ? 386  LYS A NZ  1 
ATOM   3077 N N   . ASN A 1 387 ? 23.008  62.630 77.870 1.00 41.30  ? 387  ASN A N   1 
ATOM   3078 C CA  . ASN A 1 387 ? 21.941  61.644 77.869 1.00 39.94  ? 387  ASN A CA  1 
ATOM   3079 C C   . ASN A 1 387 ? 20.745  62.200 77.102 1.00 40.06  ? 387  ASN A C   1 
ATOM   3080 O O   . ASN A 1 387 ? 20.151  61.512 76.273 1.00 40.42  ? 387  ASN A O   1 
ATOM   3081 C CB  . ASN A 1 387 ? 21.539  61.313 79.302 1.00 40.90  ? 387  ASN A CB  1 
ATOM   3082 C CG  . ASN A 1 387 ? 22.589  60.493 80.023 1.00 43.67  ? 387  ASN A CG  1 
ATOM   3083 O OD1 . ASN A 1 387 ? 22.542  60.337 81.240 1.00 46.14  ? 387  ASN A OD1 1 
ATOM   3084 N ND2 . ASN A 1 387 ? 23.540  59.954 79.270 1.00 44.55  ? 387  ASN A ND2 1 
ATOM   3085 N N   . ARG A 1 388 ? 20.398  63.451 77.383 1.00 38.79  ? 388  ARG A N   1 
ATOM   3086 C CA  . ARG A 1 388 ? 19.278  64.100 76.716 1.00 37.83  ? 388  ARG A CA  1 
ATOM   3087 C C   . ARG A 1 388 ? 19.527  64.120 75.212 1.00 37.89  ? 388  ARG A C   1 
ATOM   3088 O O   . ARG A 1 388 ? 18.743  63.591 74.426 1.00 36.89  ? 388  ARG A O   1 
ATOM   3089 C CB  . ARG A 1 388 ? 19.126  65.536 77.229 1.00 37.64  ? 388  ARG A CB  1 
ATOM   3090 C CG  . ARG A 1 388 ? 17.932  66.309 76.664 1.00 37.44  ? 388  ARG A CG  1 
ATOM   3091 C CD  . ARG A 1 388 ? 18.062  67.807 76.942 1.00 37.15  ? 388  ARG A CD  1 
ATOM   3092 N NE  . ARG A 1 388 ? 19.170  68.392 76.188 1.00 38.84  ? 388  ARG A NE  1 
ATOM   3093 C CZ  . ARG A 1 388 ? 19.814  69.502 76.535 1.00 36.51  ? 388  ARG A CZ  1 
ATOM   3094 N NH1 . ARG A 1 388 ? 19.469  70.160 77.629 1.00 35.60  ? 388  ARG A NH1 1 
ATOM   3095 N NH2 . ARG A 1 388 ? 20.815  69.951 75.792 1.00 37.29  ? 388  ARG A NH2 1 
ATOM   3096 N N   . ASP A 1 389 ? 20.633  64.737 74.818 1.00 37.37  ? 389  ASP A N   1 
ATOM   3097 C CA  . ASP A 1 389 ? 20.978  64.836 73.412 1.00 36.74  ? 389  ASP A CA  1 
ATOM   3098 C C   . ASP A 1 389 ? 21.184  63.474 72.772 1.00 37.00  ? 389  ASP A C   1 
ATOM   3099 O O   . ASP A 1 389 ? 21.011  63.320 71.562 1.00 36.19  ? 389  ASP A O   1 
ATOM   3100 C CB  . ASP A 1 389 ? 22.227  65.692 73.247 1.00 37.72  ? 389  ASP A CB  1 
ATOM   3101 C CG  . ASP A 1 389 ? 22.015  67.114 73.719 1.00 40.24  ? 389  ASP A CG  1 
ATOM   3102 O OD1 . ASP A 1 389 ? 20.838  67.545 73.796 1.00 38.14  ? 389  ASP A OD1 1 
ATOM   3103 O OD2 . ASP A 1 389 ? 23.022  67.802 74.001 1.00 40.07  ? 389  ASP A OD2 1 
ATOM   3104 N N   . GLY A 1 390 ? 21.557  62.491 73.587 1.00 36.82  ? 390  GLY A N   1 
ATOM   3105 C CA  . GLY A 1 390 ? 21.757  61.148 73.081 1.00 36.80  ? 390  GLY A CA  1 
ATOM   3106 C C   . GLY A 1 390 ? 20.428  60.561 72.637 1.00 37.31  ? 390  GLY A C   1 
ATOM   3107 O O   . GLY A 1 390 ? 20.333  59.955 71.563 1.00 37.97  ? 390  GLY A O   1 
ATOM   3108 N N   . LEU A 1 391 ? 19.402  60.743 73.467 1.00 35.98  ? 391  LEU A N   1 
ATOM   3109 C CA  . LEU A 1 391 ? 18.066  60.250 73.162 1.00 36.44  ? 391  LEU A CA  1 
ATOM   3110 C C   . LEU A 1 391 ? 17.519  60.989 71.948 1.00 37.93  ? 391  LEU A C   1 
ATOM   3111 O O   . LEU A 1 391 ? 16.849  60.394 71.098 1.00 38.75  ? 391  LEU A O   1 
ATOM   3112 C CB  . LEU A 1 391 ? 17.125  60.458 74.350 1.00 35.34  ? 391  LEU A CB  1 
ATOM   3113 C CG  . LEU A 1 391 ? 17.039  59.323 75.369 1.00 38.32  ? 391  LEU A CG  1 
ATOM   3114 C CD1 . LEU A 1 391 ? 16.083  59.715 76.489 1.00 36.88  ? 391  LEU A CD1 1 
ATOM   3115 C CD2 . LEU A 1 391 ? 16.556  58.047 74.679 1.00 37.58  ? 391  LEU A CD2 1 
ATOM   3116 N N   . ASP A 1 392 ? 17.809  62.285 71.872 1.00 37.01  ? 392  ASP A N   1 
ATOM   3117 C CA  . ASP A 1 392 ? 17.358  63.098 70.755 1.00 38.69  ? 392  ASP A CA  1 
ATOM   3118 C C   . ASP A 1 392 ? 17.884  62.493 69.448 1.00 38.40  ? 392  ASP A C   1 
ATOM   3119 O O   . ASP A 1 392 ? 17.140  62.348 68.474 1.00 39.00  ? 392  ASP A O   1 
ATOM   3120 C CB  . ASP A 1 392 ? 17.865  64.533 70.905 1.00 41.35  ? 392  ASP A CB  1 
ATOM   3121 C CG  . ASP A 1 392 ? 17.098  65.520 70.038 1.00 45.14  ? 392  ASP A CG  1 
ATOM   3122 O OD1 . ASP A 1 392 ? 16.466  65.093 69.044 1.00 46.57  ? 392  ASP A OD1 1 
ATOM   3123 O OD2 . ASP A 1 392 ? 17.136  66.730 70.344 1.00 47.37  ? 392  ASP A OD2 1 
ATOM   3124 N N   . ASP A 1 393 ? 19.165  62.135 69.433 1.00 36.52  ? 393  ASP A N   1 
ATOM   3125 C CA  . ASP A 1 393 ? 19.767  61.544 68.246 1.00 36.15  ? 393  ASP A CA  1 
ATOM   3126 C C   . ASP A 1 393 ? 19.180  60.182 67.905 1.00 36.85  ? 393  ASP A C   1 
ATOM   3127 O O   . ASP A 1 393 ? 18.944  59.881 66.732 1.00 35.63  ? 393  ASP A O   1 
ATOM   3128 C CB  . ASP A 1 393 ? 21.281  61.425 68.409 1.00 36.19  ? 393  ASP A CB  1 
ATOM   3129 C CG  . ASP A 1 393 ? 21.979  62.761 68.284 1.00 36.65  ? 393  ASP A CG  1 
ATOM   3130 O OD1 . ASP A 1 393 ? 21.548  63.571 67.437 1.00 37.20  ? 393  ASP A OD1 1 
ATOM   3131 O OD2 . ASP A 1 393 ? 22.958  63.000 69.018 1.00 38.31  ? 393  ASP A OD2 1 
ATOM   3132 N N   . ILE A 1 394 ? 18.950  59.359 68.927 1.00 35.78  ? 394  ILE A N   1 
ATOM   3133 C CA  . ILE A 1 394 ? 18.378  58.029 68.727 1.00 34.00  ? 394  ILE A CA  1 
ATOM   3134 C C   . ILE A 1 394 ? 17.006  58.132 68.050 1.00 32.67  ? 394  ILE A C   1 
ATOM   3135 O O   . ILE A 1 394 ? 16.769  57.520 67.014 1.00 34.79  ? 394  ILE A O   1 
ATOM   3136 C CB  . ILE A 1 394 ? 18.241  57.282 70.075 1.00 34.16  ? 394  ILE A CB  1 
ATOM   3137 C CG1 . ILE A 1 394 ? 19.631  56.926 70.606 1.00 32.17  ? 394  ILE A CG1 1 
ATOM   3138 C CG2 . ILE A 1 394 ? 17.404  56.033 69.903 1.00 30.19  ? 394  ILE A CG2 1 
ATOM   3139 C CD1 . ILE A 1 394 ? 19.631  56.412 72.032 1.00 32.42  ? 394  ILE A CD1 1 
ATOM   3140 N N   . VAL A 1 395 ? 16.111  58.915 68.634 1.00 31.19  ? 395  VAL A N   1 
ATOM   3141 C CA  . VAL A 1 395 ? 14.779  59.097 68.075 1.00 30.59  ? 395  VAL A CA  1 
ATOM   3142 C C   . VAL A 1 395 ? 14.860  59.676 66.658 1.00 32.78  ? 395  VAL A C   1 
ATOM   3143 O O   . VAL A 1 395 ? 14.157  59.215 65.750 1.00 33.55  ? 395  VAL A O   1 
ATOM   3144 C CB  . VAL A 1 395 ? 13.936  60.026 68.977 1.00 29.94  ? 395  VAL A CB  1 
ATOM   3145 C CG1 . VAL A 1 395 ? 12.593  60.327 68.339 1.00 26.62  ? 395  VAL A CG1 1 
ATOM   3146 C CG2 . VAL A 1 395 ? 13.753  59.370 70.344 1.00 28.03  ? 395  VAL A CG2 1 
ATOM   3147 N N   . GLY A 1 396 ? 15.729  60.668 66.469 1.00 31.43  ? 396  GLY A N   1 
ATOM   3148 C CA  . GLY A 1 396 ? 15.878  61.286 65.162 1.00 29.50  ? 396  GLY A CA  1 
ATOM   3149 C C   . GLY A 1 396 ? 16.534  60.390 64.122 1.00 31.17  ? 396  GLY A C   1 
ATOM   3150 O O   . GLY A 1 396 ? 16.074  60.326 62.973 1.00 32.35  ? 396  GLY A O   1 
ATOM   3151 N N   . ASP A 1 397 ? 17.611  59.705 64.504 1.00 29.72  ? 397  ASP A N   1 
ATOM   3152 C CA  . ASP A 1 397 ? 18.298  58.820 63.569 1.00 29.89  ? 397  ASP A CA  1 
ATOM   3153 C C   . ASP A 1 397 ? 17.414  57.641 63.182 1.00 31.10  ? 397  ASP A C   1 
ATOM   3154 O O   . ASP A 1 397 ? 17.261  57.325 62.003 1.00 31.14  ? 397  ASP A O   1 
ATOM   3155 C CB  . ASP A 1 397 ? 19.607  58.282 64.169 1.00 29.50  ? 397  ASP A CB  1 
ATOM   3156 C CG  . ASP A 1 397 ? 20.655  59.374 64.399 1.00 31.47  ? 397  ASP A CG  1 
ATOM   3157 O OD1 . ASP A 1 397 ? 20.571  60.455 63.771 1.00 29.00  ? 397  ASP A OD1 1 
ATOM   3158 O OD2 . ASP A 1 397 ? 21.579  59.134 65.204 1.00 30.61  ? 397  ASP A OD2 1 
ATOM   3159 N N   . HIS A 1 398 ? 16.825  57.000 64.184 1.00 31.32  ? 398  HIS A N   1 
ATOM   3160 C CA  . HIS A 1 398 ? 15.978  55.846 63.948 1.00 33.85  ? 398  HIS A CA  1 
ATOM   3161 C C   . HIS A 1 398 ? 14.705  56.127 63.158 1.00 34.52  ? 398  HIS A C   1 
ATOM   3162 O O   . HIS A 1 398 ? 14.356  55.370 62.258 1.00 36.51  ? 398  HIS A O   1 
ATOM   3163 C CB  . HIS A 1 398 ? 15.587  55.189 65.272 1.00 33.56  ? 398  HIS A CB  1 
ATOM   3164 C CG  . HIS A 1 398 ? 14.565  54.105 65.119 1.00 34.87  ? 398  HIS A CG  1 
ATOM   3165 N ND1 . HIS A 1 398 ? 14.795  52.963 64.381 1.00 36.06  ? 398  HIS A ND1 1 
ATOM   3166 C CD2 . HIS A 1 398 ? 13.294  54.005 65.578 1.00 35.38  ? 398  HIS A CD2 1 
ATOM   3167 C CE1 . HIS A 1 398 ? 13.711  52.208 64.391 1.00 35.26  ? 398  HIS A CE1 1 
ATOM   3168 N NE2 . HIS A 1 398 ? 12.785  52.818 65.111 1.00 33.83  ? 398  HIS A NE2 1 
ATOM   3169 N N   . ASN A 1 399 ? 14.016  57.211 63.485 1.00 33.29  ? 399  ASN A N   1 
ATOM   3170 C CA  . ASN A 1 399 ? 12.763  57.522 62.822 1.00 31.87  ? 399  ASN A CA  1 
ATOM   3171 C C   . ASN A 1 399 ? 12.801  58.370 61.557 1.00 32.88  ? 399  ASN A C   1 
ATOM   3172 O O   . ASN A 1 399 ? 11.896  58.279 60.725 1.00 32.36  ? 399  ASN A O   1 
ATOM   3173 C CB  . ASN A 1 399 ? 11.819  58.175 63.832 1.00 31.66  ? 399  ASN A CB  1 
ATOM   3174 C CG  . ASN A 1 399 ? 11.354  57.209 64.896 1.00 34.61  ? 399  ASN A CG  1 
ATOM   3175 O OD1 . ASN A 1 399 ? 10.623  56.262 64.611 1.00 37.08  ? 399  ASN A OD1 1 
ATOM   3176 N ND2 . ASN A 1 399 ? 11.784  57.434 66.130 1.00 36.00  ? 399  ASN A ND2 1 
ATOM   3177 N N   . VAL A 1 400 ? 13.832  59.189 61.392 1.00 32.86  ? 400  VAL A N   1 
ATOM   3178 C CA  . VAL A 1 400 ? 13.867  60.061 60.227 1.00 31.87  ? 400  VAL A CA  1 
ATOM   3179 C C   . VAL A 1 400 ? 15.120  60.001 59.370 1.00 33.76  ? 400  VAL A C   1 
ATOM   3180 O O   . VAL A 1 400 ? 15.070  59.592 58.212 1.00 34.78  ? 400  VAL A O   1 
ATOM   3181 C CB  . VAL A 1 400 ? 13.634  61.535 60.661 1.00 31.20  ? 400  VAL A CB  1 
ATOM   3182 C CG1 . VAL A 1 400 ? 13.668  62.449 59.460 1.00 28.60  ? 400  VAL A CG1 1 
ATOM   3183 C CG2 . VAL A 1 400 ? 12.307  61.658 61.396 1.00 27.82  ? 400  VAL A CG2 1 
ATOM   3184 N N   . ILE A 1 401 ? 16.246  60.409 59.941 1.00 35.18  ? 401  ILE A N   1 
ATOM   3185 C CA  . ILE A 1 401 ? 17.499  60.447 59.206 1.00 33.47  ? 401  ILE A CA  1 
ATOM   3186 C C   . ILE A 1 401 ? 17.957  59.143 58.557 1.00 34.65  ? 401  ILE A C   1 
ATOM   3187 O O   . ILE A 1 401 ? 18.115  59.083 57.338 1.00 34.46  ? 401  ILE A O   1 
ATOM   3188 C CB  . ILE A 1 401 ? 18.616  61.017 60.100 1.00 32.74  ? 401  ILE A CB  1 
ATOM   3189 C CG1 . ILE A 1 401 ? 18.213  62.432 60.550 1.00 32.99  ? 401  ILE A CG1 1 
ATOM   3190 C CG2 . ILE A 1 401 ? 19.932  61.049 59.342 1.00 30.34  ? 401  ILE A CG2 1 
ATOM   3191 C CD1 . ILE A 1 401 ? 19.234  63.160 61.401 1.00 32.78  ? 401  ILE A CD1 1 
ATOM   3192 N N   . CYS A 1 402 ? 18.167  58.095 59.343 1.00 34.99  ? 402  CYS A N   1 
ATOM   3193 C CA  . CYS A 1 402 ? 18.630  56.847 58.751 1.00 33.98  ? 402  CYS A CA  1 
ATOM   3194 C C   . CYS A 1 402 ? 17.652  56.240 57.744 1.00 33.97  ? 402  CYS A C   1 
ATOM   3195 O O   . CYS A 1 402 ? 18.072  55.673 56.735 1.00 32.96  ? 402  CYS A O   1 
ATOM   3196 C CB  . CYS A 1 402 ? 19.031  55.866 59.850 1.00 34.61  ? 402  CYS A CB  1 
ATOM   3197 S SG  . CYS A 1 402 ? 20.520  56.496 60.710 1.00 37.70  ? 402  CYS A SG  1 
ATOM   3198 N N   . PRO A 1 403 ? 16.338  56.332 58.005 1.00 33.70  ? 403  PRO A N   1 
ATOM   3199 C CA  . PRO A 1 403 ? 15.412  55.769 57.017 1.00 33.29  ? 403  PRO A CA  1 
ATOM   3200 C C   . PRO A 1 403 ? 15.576  56.575 55.719 1.00 34.79  ? 403  PRO A C   1 
ATOM   3201 O O   . PRO A 1 403 ? 15.675  56.014 54.624 1.00 35.26  ? 403  PRO A O   1 
ATOM   3202 C CB  . PRO A 1 403 ? 14.044  56.000 57.654 1.00 31.86  ? 403  PRO A CB  1 
ATOM   3203 C CG  . PRO A 1 403 ? 14.343  55.859 59.110 1.00 33.99  ? 403  PRO A CG  1 
ATOM   3204 C CD  . PRO A 1 403 ? 15.642  56.621 59.273 1.00 32.29  ? 403  PRO A CD  1 
ATOM   3205 N N   . LEU A 1 404 ? 15.624  57.899 55.849 1.00 32.20  ? 404  LEU A N   1 
ATOM   3206 C CA  . LEU A 1 404 ? 15.776  58.754 54.683 1.00 32.58  ? 404  LEU A CA  1 
ATOM   3207 C C   . LEU A 1 404 ? 17.091  58.495 53.945 1.00 33.77  ? 404  LEU A C   1 
ATOM   3208 O O   . LEU A 1 404 ? 17.124  58.536 52.710 1.00 35.05  ? 404  LEU A O   1 
ATOM   3209 C CB  . LEU A 1 404 ? 15.668  60.231 55.079 1.00 29.77  ? 404  LEU A CB  1 
ATOM   3210 C CG  . LEU A 1 404 ? 15.715  61.226 53.912 1.00 29.80  ? 404  LEU A CG  1 
ATOM   3211 C CD1 . LEU A 1 404 ? 14.780  62.412 54.170 1.00 25.34  ? 404  LEU A CD1 1 
ATOM   3212 C CD2 . LEU A 1 404 ? 17.156  61.687 53.701 1.00 26.50  ? 404  LEU A CD2 1 
ATOM   3213 N N   . MET A 1 405 ? 18.168  58.235 54.683 1.00 33.09  ? 405  MET A N   1 
ATOM   3214 C CA  . MET A 1 405 ? 19.461  57.963 54.052 1.00 34.30  ? 405  MET A CA  1 
ATOM   3215 C C   . MET A 1 405 ? 19.430  56.646 53.279 1.00 35.36  ? 405  MET A C   1 
ATOM   3216 O O   . MET A 1 405 ? 20.080  56.512 52.239 1.00 33.67  ? 405  MET A O   1 
ATOM   3217 C CB  . MET A 1 405 ? 20.591  57.925 55.088 1.00 33.95  ? 405  MET A CB  1 
ATOM   3218 C CG  . MET A 1 405 ? 20.975  59.296 55.624 1.00 32.17  ? 405  MET A CG  1 
ATOM   3219 S SD  . MET A 1 405 ? 21.164  60.512 54.296 1.00 38.15  ? 405  MET A SD  1 
ATOM   3220 C CE  . MET A 1 405 ? 22.593  59.842 53.442 1.00 29.82  ? 405  MET A CE  1 
ATOM   3221 N N   . HIS A 1 406 ? 18.675  55.675 53.789 1.00 36.72  ? 406  HIS A N   1 
ATOM   3222 C CA  . HIS A 1 406 ? 18.544  54.382 53.120 1.00 37.41  ? 406  HIS A CA  1 
ATOM   3223 C C   . HIS A 1 406 ? 17.783  54.616 51.819 1.00 36.98  ? 406  HIS A C   1 
ATOM   3224 O O   . HIS A 1 406 ? 18.138  54.083 50.770 1.00 38.62  ? 406  HIS A O   1 
ATOM   3225 C CB  . HIS A 1 406 ? 17.768  53.389 53.998 1.00 37.75  ? 406  HIS A CB  1 
ATOM   3226 C CG  . HIS A 1 406 ? 17.551  52.051 53.355 1.00 40.68  ? 406  HIS A CG  1 
ATOM   3227 N ND1 . HIS A 1 406 ? 18.570  51.141 53.158 1.00 38.42  ? 406  HIS A ND1 1 
ATOM   3228 C CD2 . HIS A 1 406 ? 16.432  51.479 52.846 1.00 40.85  ? 406  HIS A CD2 1 
ATOM   3229 C CE1 . HIS A 1 406 ? 18.088  50.069 52.555 1.00 40.08  ? 406  HIS A CE1 1 
ATOM   3230 N NE2 . HIS A 1 406 ? 16.794  50.248 52.354 1.00 41.40  ? 406  HIS A NE2 1 
ATOM   3231 N N   . PHE A 1 407 ? 16.737  55.428 51.899 1.00 36.17  ? 407  PHE A N   1 
ATOM   3232 C CA  . PHE A 1 407 ? 15.926  55.736 50.734 1.00 35.43  ? 407  PHE A CA  1 
ATOM   3233 C C   . PHE A 1 407 ? 16.741  56.470 49.682 1.00 36.01  ? 407  PHE A C   1 
ATOM   3234 O O   . PHE A 1 407 ? 16.716  56.107 48.507 1.00 36.20  ? 407  PHE A O   1 
ATOM   3235 C CB  . PHE A 1 407 ? 14.725  56.602 51.126 1.00 32.86  ? 407  PHE A CB  1 
ATOM   3236 C CG  . PHE A 1 407 ? 13.909  57.068 49.956 1.00 33.64  ? 407  PHE A CG  1 
ATOM   3237 C CD1 . PHE A 1 407 ? 13.082  56.185 49.265 1.00 35.25  ? 407  PHE A CD1 1 
ATOM   3238 C CD2 . PHE A 1 407 ? 13.992  58.387 49.519 1.00 34.44  ? 407  PHE A CD2 1 
ATOM   3239 C CE1 . PHE A 1 407 ? 12.348  56.610 48.150 1.00 33.53  ? 407  PHE A CE1 1 
ATOM   3240 C CE2 . PHE A 1 407 ? 13.267  58.826 48.407 1.00 34.82  ? 407  PHE A CE2 1 
ATOM   3241 C CZ  . PHE A 1 407 ? 12.441  57.931 47.720 1.00 33.41  ? 407  PHE A CZ  1 
ATOM   3242 N N   . VAL A 1 408 ? 17.469  57.502 50.092 1.00 35.87  ? 408  VAL A N   1 
ATOM   3243 C CA  . VAL A 1 408 ? 18.235  58.260 49.116 1.00 37.75  ? 408  VAL A CA  1 
ATOM   3244 C C   . VAL A 1 408 ? 19.305  57.418 48.445 1.00 37.18  ? 408  VAL A C   1 
ATOM   3245 O O   . VAL A 1 408 ? 19.514  57.525 47.242 1.00 36.63  ? 408  VAL A O   1 
ATOM   3246 C CB  . VAL A 1 408 ? 18.882  59.528 49.734 1.00 38.31  ? 408  VAL A CB  1 
ATOM   3247 C CG1 . VAL A 1 408 ? 19.872  59.155 50.806 1.00 42.34  ? 408  VAL A CG1 1 
ATOM   3248 C CG2 . VAL A 1 408 ? 19.574  60.325 48.649 1.00 42.73  ? 408  VAL A CG2 1 
ATOM   3249 N N   . ASN A 1 409 ? 19.980  56.572 49.210 1.00 37.14  ? 409  ASN A N   1 
ATOM   3250 C CA  . ASN A 1 409 ? 21.011  55.745 48.621 1.00 39.35  ? 409  ASN A CA  1 
ATOM   3251 C C   . ASN A 1 409 ? 20.413  54.714 47.657 1.00 41.12  ? 409  ASN A C   1 
ATOM   3252 O O   . ASN A 1 409 ? 21.020  54.385 46.636 1.00 41.66  ? 409  ASN A O   1 
ATOM   3253 C CB  . ASN A 1 409 ? 21.852  55.081 49.722 1.00 40.35  ? 409  ASN A CB  1 
ATOM   3254 C CG  . ASN A 1 409 ? 22.917  56.032 50.295 1.00 44.14  ? 409  ASN A CG  1 
ATOM   3255 O OD1 . ASN A 1 409 ? 22.915  56.358 51.485 1.00 41.03  ? 409  ASN A OD1 1 
ATOM   3256 N ND2 . ASN A 1 409 ? 23.826  56.484 49.433 1.00 45.16  ? 409  ASN A ND2 1 
ATOM   3257 N N   . LYS A 1 410 ? 19.219  54.220 47.959 1.00 40.82  ? 410  LYS A N   1 
ATOM   3258 C CA  . LYS A 1 410 ? 18.577  53.251 47.080 1.00 41.56  ? 410  LYS A CA  1 
ATOM   3259 C C   . LYS A 1 410 ? 18.015  53.915 45.819 1.00 42.04  ? 410  LYS A C   1 
ATOM   3260 O O   . LYS A 1 410 ? 18.121  53.365 44.719 1.00 41.89  ? 410  LYS A O   1 
ATOM   3261 C CB  . LYS A 1 410 ? 17.436  52.538 47.808 1.00 42.28  ? 410  LYS A CB  1 
ATOM   3262 C CG  . LYS A 1 410 ? 17.879  51.484 48.801 1.00 44.12  ? 410  LYS A CG  1 
ATOM   3263 C CD  . LYS A 1 410 ? 18.571  50.337 48.094 1.00 43.50  ? 410  LYS A CD  1 
ATOM   3264 C CE  . LYS A 1 410 ? 18.909  49.232 49.065 1.00 44.58  ? 410  LYS A CE  1 
ATOM   3265 N NZ  . LYS A 1 410 ? 19.623  48.123 48.368 1.00 47.19  ? 410  LYS A NZ  1 
ATOM   3266 N N   . TYR A 1 411 ? 17.408  55.089 45.981 1.00 40.34  ? 411  TYR A N   1 
ATOM   3267 C CA  . TYR A 1 411 ? 16.815  55.791 44.851 1.00 38.56  ? 411  TYR A CA  1 
ATOM   3268 C C   . TYR A 1 411 ? 17.884  56.256 43.872 1.00 40.02  ? 411  TYR A C   1 
ATOM   3269 O O   . TYR A 1 411 ? 17.800  55.992 42.675 1.00 40.82  ? 411  TYR A O   1 
ATOM   3270 C CB  . TYR A 1 411 ? 16.015  57.004 45.332 1.00 37.37  ? 411  TYR A CB  1 
ATOM   3271 C CG  . TYR A 1 411 ? 15.213  57.669 44.238 1.00 36.32  ? 411  TYR A CG  1 
ATOM   3272 C CD1 . TYR A 1 411 ? 13.961  57.178 43.876 1.00 35.10  ? 411  TYR A CD1 1 
ATOM   3273 C CD2 . TYR A 1 411 ? 15.731  58.752 43.521 1.00 35.81  ? 411  TYR A CD2 1 
ATOM   3274 C CE1 . TYR A 1 411 ? 13.245  57.738 42.829 1.00 34.95  ? 411  TYR A CE1 1 
ATOM   3275 C CE2 . TYR A 1 411 ? 15.024  59.320 42.470 1.00 35.02  ? 411  TYR A CE2 1 
ATOM   3276 C CZ  . TYR A 1 411 ? 13.780  58.803 42.130 1.00 37.09  ? 411  TYR A CZ  1 
ATOM   3277 O OH  . TYR A 1 411 ? 13.079  59.330 41.072 1.00 39.61  ? 411  TYR A OH  1 
ATOM   3278 N N   . THR A 1 412 ? 18.884  56.957 44.393 1.00 40.45  ? 412  THR A N   1 
ATOM   3279 C CA  . THR A 1 412 ? 19.976  57.490 43.586 1.00 41.08  ? 412  THR A CA  1 
ATOM   3280 C C   . THR A 1 412 ? 20.567  56.461 42.623 1.00 41.71  ? 412  THR A C   1 
ATOM   3281 O O   . THR A 1 412 ? 21.213  56.815 41.641 1.00 42.04  ? 412  THR A O   1 
ATOM   3282 C CB  . THR A 1 412 ? 21.076  58.054 44.506 1.00 39.95  ? 412  THR A CB  1 
ATOM   3283 O OG1 . THR A 1 412 ? 20.517  59.112 45.293 1.00 42.85  ? 412  THR A OG1 1 
ATOM   3284 C CG2 . THR A 1 412 ? 22.244  58.596 43.704 1.00 36.23  ? 412  THR A CG2 1 
ATOM   3285 N N   . LYS A 1 413 ? 20.329  55.190 42.906 1.00 43.00  ? 413  LYS A N   1 
ATOM   3286 C CA  . LYS A 1 413 ? 20.824  54.109 42.073 1.00 45.24  ? 413  LYS A CA  1 
ATOM   3287 C C   . LYS A 1 413 ? 20.112  54.095 40.723 1.00 44.90  ? 413  LYS A C   1 
ATOM   3288 O O   . LYS A 1 413 ? 20.733  53.842 39.699 1.00 46.04  ? 413  LYS A O   1 
ATOM   3289 C CB  . LYS A 1 413 ? 20.598  52.779 42.787 1.00 49.58  ? 413  LYS A CB  1 
ATOM   3290 C CG  . LYS A 1 413 ? 21.635  51.716 42.503 1.00 56.66  ? 413  LYS A CG  1 
ATOM   3291 C CD  . LYS A 1 413 ? 21.693  50.731 43.669 1.00 63.09  ? 413  LYS A CD  1 
ATOM   3292 C CE  . LYS A 1 413 ? 22.925  49.836 43.602 1.00 66.83  ? 413  LYS A CE  1 
ATOM   3293 N NZ  . LYS A 1 413 ? 23.007  48.915 44.780 1.00 68.41  ? 413  LYS A NZ  1 
ATOM   3294 N N   . PHE A 1 414 ? 18.812  54.378 40.724 1.00 42.78  ? 414  PHE A N   1 
ATOM   3295 C CA  . PHE A 1 414 ? 18.016  54.371 39.498 1.00 42.88  ? 414  PHE A CA  1 
ATOM   3296 C C   . PHE A 1 414 ? 17.519  55.757 39.073 1.00 43.08  ? 414  PHE A C   1 
ATOM   3297 O O   . PHE A 1 414 ? 17.149  55.967 37.912 1.00 40.82  ? 414  PHE A O   1 
ATOM   3298 C CB  . PHE A 1 414 ? 16.801  53.454 39.679 1.00 42.35  ? 414  PHE A CB  1 
ATOM   3299 C CG  . PHE A 1 414 ? 17.148  52.008 39.885 1.00 42.60  ? 414  PHE A CG  1 
ATOM   3300 C CD1 . PHE A 1 414 ? 17.284  51.148 38.798 1.00 43.98  ? 414  PHE A CD1 1 
ATOM   3301 C CD2 . PHE A 1 414 ? 17.319  51.497 41.165 1.00 42.65  ? 414  PHE A CD2 1 
ATOM   3302 C CE1 . PHE A 1 414 ? 17.581  49.800 38.987 1.00 42.59  ? 414  PHE A CE1 1 
ATOM   3303 C CE2 . PHE A 1 414 ? 17.618  50.147 41.367 1.00 42.71  ? 414  PHE A CE2 1 
ATOM   3304 C CZ  . PHE A 1 414 ? 17.748  49.300 40.276 1.00 43.34  ? 414  PHE A CZ  1 
ATOM   3305 N N   . GLY A 1 415 ? 17.505  56.689 40.020 1.00 43.34  ? 415  GLY A N   1 
ATOM   3306 C CA  . GLY A 1 415 ? 17.026  58.036 39.758 1.00 44.86  ? 415  GLY A CA  1 
ATOM   3307 C C   . GLY A 1 415 ? 17.768  58.827 38.703 1.00 45.53  ? 415  GLY A C   1 
ATOM   3308 O O   . GLY A 1 415 ? 18.771  58.366 38.160 1.00 45.91  ? 415  GLY A O   1 
ATOM   3309 N N   . ASN A 1 416 ? 17.277  60.032 38.430 1.00 46.62  ? 416  ASN A N   1 
ATOM   3310 C CA  . ASN A 1 416 ? 17.866  60.901 37.420 1.00 48.78  ? 416  ASN A CA  1 
ATOM   3311 C C   . ASN A 1 416 ? 18.445  62.184 38.015 1.00 47.88  ? 416  ASN A C   1 
ATOM   3312 O O   . ASN A 1 416 ? 18.602  63.182 37.312 1.00 46.87  ? 416  ASN A O   1 
ATOM   3313 C CB  . ASN A 1 416 ? 16.803  61.262 36.377 1.00 53.74  ? 416  ASN A CB  1 
ATOM   3314 C CG  . ASN A 1 416 ? 17.382  61.983 35.177 1.00 57.85  ? 416  ASN A CG  1 
ATOM   3315 O OD1 . ASN A 1 416 ? 16.777  62.921 34.655 1.00 58.31  ? 416  ASN A OD1 1 
ATOM   3316 N ND2 . ASN A 1 416 ? 18.552  61.537 34.731 1.00 62.27  ? 416  ASN A ND2 1 
ATOM   3317 N N   . GLY A 1 417 ? 18.759  62.159 39.306 1.00 48.37  ? 417  GLY A N   1 
ATOM   3318 C CA  . GLY A 1 417 ? 19.310  63.341 39.950 1.00 47.20  ? 417  GLY A CA  1 
ATOM   3319 C C   . GLY A 1 417 ? 18.834  63.528 41.379 1.00 46.02  ? 417  GLY A C   1 
ATOM   3320 O O   . GLY A 1 417 ? 17.634  63.646 41.634 1.00 45.70  ? 417  GLY A O   1 
ATOM   3321 N N   . THR A 1 418 ? 19.780  63.568 42.312 1.00 45.27  ? 418  THR A N   1 
ATOM   3322 C CA  . THR A 1 418 ? 19.462  63.719 43.725 1.00 43.89  ? 418  THR A CA  1 
ATOM   3323 C C   . THR A 1 418 ? 20.174  64.913 44.344 1.00 44.36  ? 418  THR A C   1 
ATOM   3324 O O   . THR A 1 418 ? 21.342  65.165 44.054 1.00 44.16  ? 418  THR A O   1 
ATOM   3325 C CB  . THR A 1 418 ? 19.875  62.457 44.512 1.00 44.50  ? 418  THR A CB  1 
ATOM   3326 O OG1 . THR A 1 418 ? 19.267  61.302 43.921 1.00 40.55  ? 418  THR A OG1 1 
ATOM   3327 C CG2 . THR A 1 418 ? 19.451  62.568 45.969 1.00 43.32  ? 418  THR A CG2 1 
ATOM   3328 N N   . TYR A 1 419 ? 19.460  65.640 45.201 1.00 43.95  ? 419  TYR A N   1 
ATOM   3329 C CA  . TYR A 1 419 ? 20.015  66.801 45.899 1.00 41.68  ? 419  TYR A CA  1 
ATOM   3330 C C   . TYR A 1 419 ? 19.658  66.685 47.380 1.00 40.77  ? 419  TYR A C   1 
ATOM   3331 O O   . TYR A 1 419 ? 18.489  66.790 47.747 1.00 41.48  ? 419  TYR A O   1 
ATOM   3332 C CB  . TYR A 1 419 ? 19.446  68.086 45.304 1.00 42.22  ? 419  TYR A CB  1 
ATOM   3333 C CG  . TYR A 1 419 ? 19.951  68.350 43.906 1.00 42.60  ? 419  TYR A CG  1 
ATOM   3334 C CD1 . TYR A 1 419 ? 21.173  68.987 43.694 1.00 42.31  ? 419  TYR A CD1 1 
ATOM   3335 C CD2 . TYR A 1 419 ? 19.234  67.915 42.791 1.00 41.90  ? 419  TYR A CD2 1 
ATOM   3336 C CE1 . TYR A 1 419 ? 21.669  69.182 42.404 1.00 42.67  ? 419  TYR A CE1 1 
ATOM   3337 C CE2 . TYR A 1 419 ? 19.721  68.105 41.499 1.00 41.13  ? 419  TYR A CE2 1 
ATOM   3338 C CZ  . TYR A 1 419 ? 20.934  68.740 41.315 1.00 42.34  ? 419  TYR A CZ  1 
ATOM   3339 O OH  . TYR A 1 419 ? 21.405  68.943 40.043 1.00 43.20  ? 419  TYR A OH  1 
ATOM   3340 N N   . LEU A 1 420 ? 20.670  66.469 48.221 1.00 38.65  ? 420  LEU A N   1 
ATOM   3341 C CA  . LEU A 1 420 ? 20.473  66.287 49.661 1.00 37.50  ? 420  LEU A CA  1 
ATOM   3342 C C   . LEU A 1 420 ? 20.908  67.462 50.533 1.00 38.21  ? 420  LEU A C   1 
ATOM   3343 O O   . LEU A 1 420 ? 21.974  68.033 50.322 1.00 39.99  ? 420  LEU A O   1 
ATOM   3344 C CB  . LEU A 1 420 ? 21.218  65.027 50.122 1.00 33.93  ? 420  LEU A CB  1 
ATOM   3345 C CG  . LEU A 1 420 ? 20.980  64.548 51.555 1.00 33.15  ? 420  LEU A CG  1 
ATOM   3346 C CD1 . LEU A 1 420 ? 19.504  64.204 51.751 1.00 32.06  ? 420  LEU A CD1 1 
ATOM   3347 C CD2 . LEU A 1 420 ? 21.856  63.341 51.835 1.00 34.89  ? 420  LEU A CD2 1 
ATOM   3348 N N   . TYR A 1 421 ? 20.098  67.799 51.534 1.00 37.69  ? 421  TYR A N   1 
ATOM   3349 C CA  . TYR A 1 421 ? 20.432  68.909 52.425 1.00 36.48  ? 421  TYR A CA  1 
ATOM   3350 C C   . TYR A 1 421 ? 20.322  68.523 53.890 1.00 37.14  ? 421  TYR A C   1 
ATOM   3351 O O   . TYR A 1 421 ? 19.625  67.570 54.247 1.00 36.21  ? 421  TYR A O   1 
ATOM   3352 C CB  . TYR A 1 421 ? 19.507  70.105 52.168 1.00 33.07  ? 421  TYR A CB  1 
ATOM   3353 C CG  . TYR A 1 421 ? 18.102  69.920 52.691 1.00 28.32  ? 421  TYR A CG  1 
ATOM   3354 C CD1 . TYR A 1 421 ? 17.810  70.074 54.046 1.00 27.53  ? 421  TYR A CD1 1 
ATOM   3355 C CD2 . TYR A 1 421 ? 17.062  69.579 51.830 1.00 26.49  ? 421  TYR A CD2 1 
ATOM   3356 C CE1 . TYR A 1 421 ? 16.507  69.888 54.532 1.00 27.49  ? 421  TYR A CE1 1 
ATOM   3357 C CE2 . TYR A 1 421 ? 15.760  69.394 52.301 1.00 25.67  ? 421  TYR A CE2 1 
ATOM   3358 C CZ  . TYR A 1 421 ? 15.492  69.549 53.650 1.00 27.13  ? 421  TYR A CZ  1 
ATOM   3359 O OH  . TYR A 1 421 ? 14.209  69.360 54.107 1.00 28.76  ? 421  TYR A OH  1 
ATOM   3360 N N   . PHE A 1 422 ? 21.004  69.292 54.731 1.00 37.13  ? 422  PHE A N   1 
ATOM   3361 C CA  . PHE A 1 422 ? 20.990  69.082 56.166 1.00 37.09  ? 422  PHE A CA  1 
ATOM   3362 C C   . PHE A 1 422 ? 20.723  70.450 56.760 1.00 38.00  ? 422  PHE A C   1 
ATOM   3363 O O   . PHE A 1 422 ? 21.624  71.285 56.852 1.00 37.02  ? 422  PHE A O   1 
ATOM   3364 C CB  . PHE A 1 422 ? 22.340  68.556 56.649 1.00 37.77  ? 422  PHE A CB  1 
ATOM   3365 C CG  . PHE A 1 422 ? 22.396  68.288 58.132 1.00 36.00  ? 422  PHE A CG  1 
ATOM   3366 C CD1 . PHE A 1 422 ? 21.779  67.166 58.675 1.00 36.00  ? 422  PHE A CD1 1 
ATOM   3367 C CD2 . PHE A 1 422 ? 23.075  69.158 58.985 1.00 34.34  ? 422  PHE A CD2 1 
ATOM   3368 C CE1 . PHE A 1 422 ? 21.835  66.910 60.048 1.00 35.47  ? 422  PHE A CE1 1 
ATOM   3369 C CE2 . PHE A 1 422 ? 23.139  68.914 60.352 1.00 34.03  ? 422  PHE A CE2 1 
ATOM   3370 C CZ  . PHE A 1 422 ? 22.517  67.787 60.886 1.00 36.01  ? 422  PHE A CZ  1 
ATOM   3371 N N   . PHE A 1 423 ? 19.470  70.668 57.144 1.00 38.48  ? 423  PHE A N   1 
ATOM   3372 C CA  . PHE A 1 423 ? 19.017  71.924 57.724 1.00 38.53  ? 423  PHE A CA  1 
ATOM   3373 C C   . PHE A 1 423 ? 19.351  72.001 59.211 1.00 40.49  ? 423  PHE A C   1 
ATOM   3374 O O   . PHE A 1 423 ? 18.795  71.244 60.012 1.00 41.20  ? 423  PHE A O   1 
ATOM   3375 C CB  . PHE A 1 423 ? 17.509  72.045 57.538 1.00 36.71  ? 423  PHE A CB  1 
ATOM   3376 C CG  . PHE A 1 423 ? 16.943  73.345 58.014 1.00 36.81  ? 423  PHE A CG  1 
ATOM   3377 C CD1 . PHE A 1 423 ? 17.026  74.485 57.221 1.00 36.21  ? 423  PHE A CD1 1 
ATOM   3378 C CD2 . PHE A 1 423 ? 16.321  73.432 59.253 1.00 36.43  ? 423  PHE A CD2 1 
ATOM   3379 C CE1 . PHE A 1 423 ? 16.490  75.696 57.658 1.00 36.93  ? 423  PHE A CE1 1 
ATOM   3380 C CE2 . PHE A 1 423 ? 15.783  74.641 59.694 1.00 38.60  ? 423  PHE A CE2 1 
ATOM   3381 C CZ  . PHE A 1 423 ? 15.869  75.773 58.892 1.00 35.84  ? 423  PHE A CZ  1 
ATOM   3382 N N   . ASN A 1 424 ? 20.237  72.923 59.590 1.00 41.35  ? 424  ASN A N   1 
ATOM   3383 C CA  . ASN A 1 424 ? 20.615  73.041 60.994 1.00 41.84  ? 424  ASN A CA  1 
ATOM   3384 C C   . ASN A 1 424 ? 20.614  74.442 61.584 1.00 41.96  ? 424  ASN A C   1 
ATOM   3385 O O   . ASN A 1 424 ? 21.443  74.748 62.434 1.00 44.97  ? 424  ASN A O   1 
ATOM   3386 C CB  . ASN A 1 424 ? 21.987  72.394 61.224 1.00 41.26  ? 424  ASN A CB  1 
ATOM   3387 C CG  . ASN A 1 424 ? 23.091  73.053 60.418 1.00 40.98  ? 424  ASN A CG  1 
ATOM   3388 O OD1 . ASN A 1 424 ? 22.829  73.838 59.516 1.00 40.63  ? 424  ASN A OD1 1 
ATOM   3389 N ND2 . ASN A 1 424 ? 24.336  72.719 60.734 1.00 41.39  ? 424  ASN A ND2 1 
ATOM   3390 N N   . HIS A 1 425 ? 19.697  75.295 61.146 1.00 41.58  ? 425  HIS A N   1 
ATOM   3391 C CA  . HIS A 1 425 ? 19.623  76.639 61.705 1.00 42.40  ? 425  HIS A CA  1 
ATOM   3392 C C   . HIS A 1 425 ? 18.440  76.726 62.663 1.00 43.98  ? 425  HIS A C   1 
ATOM   3393 O O   . HIS A 1 425 ? 17.330  76.333 62.311 1.00 44.61  ? 425  HIS A O   1 
ATOM   3394 C CB  . HIS A 1 425 ? 19.439  77.693 60.609 1.00 42.36  ? 425  HIS A CB  1 
ATOM   3395 C CG  . HIS A 1 425 ? 19.324  79.092 61.140 1.00 43.42  ? 425  HIS A CG  1 
ATOM   3396 N ND1 . HIS A 1 425 ? 20.399  79.779 61.666 1.00 43.56  ? 425  HIS A ND1 1 
ATOM   3397 C CD2 . HIS A 1 425 ? 18.248  79.898 61.307 1.00 42.55  ? 425  HIS A CD2 1 
ATOM   3398 C CE1 . HIS A 1 425 ? 19.988  80.943 62.139 1.00 42.65  ? 425  HIS A CE1 1 
ATOM   3399 N NE2 . HIS A 1 425 ? 18.687  81.040 61.935 1.00 42.14  ? 425  HIS A NE2 1 
ATOM   3400 N N   . ARG A 1 426 ? 18.671  77.230 63.873 1.00 44.47  ? 426  ARG A N   1 
ATOM   3401 C CA  . ARG A 1 426 ? 17.587  77.375 64.843 1.00 46.33  ? 426  ARG A CA  1 
ATOM   3402 C C   . ARG A 1 426 ? 17.036  78.803 64.786 1.00 45.84  ? 426  ARG A C   1 
ATOM   3403 O O   . ARG A 1 426 ? 17.752  79.756 65.073 1.00 46.63  ? 426  ARG A O   1 
ATOM   3404 C CB  . ARG A 1 426 ? 18.071  77.082 66.269 1.00 46.29  ? 426  ARG A CB  1 
ATOM   3405 C CG  . ARG A 1 426 ? 16.947  77.201 67.300 1.00 48.58  ? 426  ARG A CG  1 
ATOM   3406 C CD  . ARG A 1 426 ? 17.456  77.216 68.725 1.00 50.08  ? 426  ARG A CD  1 
ATOM   3407 N NE  . ARG A 1 426 ? 16.434  77.689 69.658 1.00 52.16  ? 426  ARG A NE  1 
ATOM   3408 C CZ  . ARG A 1 426 ? 15.459  76.937 70.164 1.00 53.28  ? 426  ARG A CZ  1 
ATOM   3409 N NH1 . ARG A 1 426 ? 15.361  75.655 69.833 1.00 54.60  ? 426  ARG A NH1 1 
ATOM   3410 N NH2 . ARG A 1 426 ? 14.582  77.467 71.008 1.00 51.91  ? 426  ARG A NH2 1 
ATOM   3411 N N   . ALA A 1 427 ? 15.767  78.939 64.413 1.00 45.86  ? 427  ALA A N   1 
ATOM   3412 C CA  . ALA A 1 427 ? 15.117  80.244 64.315 1.00 47.80  ? 427  ALA A CA  1 
ATOM   3413 C C   . ALA A 1 427 ? 15.366  81.106 65.557 1.00 49.91  ? 427  ALA A C   1 
ATOM   3414 O O   . ALA A 1 427 ? 15.207  80.648 66.695 1.00 51.77  ? 427  ALA A O   1 
ATOM   3415 C CB  . ALA A 1 427 ? 13.618  80.059 64.096 1.00 46.14  ? 427  ALA A CB  1 
ATOM   3416 N N   . SER A 1 428 ? 15.752  82.359 65.331 1.00 49.36  ? 428  SER A N   1 
ATOM   3417 C CA  . SER A 1 428 ? 16.033  83.289 66.419 1.00 49.64  ? 428  SER A CA  1 
ATOM   3418 C C   . SER A 1 428 ? 14.795  83.571 67.262 1.00 49.74  ? 428  SER A C   1 
ATOM   3419 O O   . SER A 1 428 ? 14.906  83.967 68.417 1.00 50.40  ? 428  SER A O   1 
ATOM   3420 C CB  . SER A 1 428 ? 16.572  84.609 65.861 1.00 47.98  ? 428  SER A CB  1 
ATOM   3421 O OG  . SER A 1 428 ? 15.577  85.274 65.100 1.00 47.25  ? 428  SER A OG  1 
ATOM   3422 N N   . ASN A 1 429 ? 13.617  83.356 66.687 1.00 49.86  ? 429  ASN A N   1 
ATOM   3423 C CA  . ASN A 1 429 ? 12.367  83.622 67.393 1.00 49.90  ? 429  ASN A CA  1 
ATOM   3424 C C   . ASN A 1 429 ? 11.610  82.362 67.778 1.00 50.86  ? 429  ASN A C   1 
ATOM   3425 O O   . ASN A 1 429 ? 10.401  82.411 68.026 1.00 51.92  ? 429  ASN A O   1 
ATOM   3426 C CB  . ASN A 1 429 ? 11.462  84.483 66.521 1.00 49.92  ? 429  ASN A CB  1 
ATOM   3427 C CG  . ASN A 1 429 ? 11.132  83.814 65.204 1.00 51.20  ? 429  ASN A CG  1 
ATOM   3428 O OD1 . ASN A 1 429 ? 11.673  82.753 64.883 1.00 50.00  ? 429  ASN A OD1 1 
ATOM   3429 N ND2 . ASN A 1 429 ? 10.247  84.433 64.428 1.00 51.97  ? 429  ASN A ND2 1 
ATOM   3430 N N   . LEU A 1 430 ? 12.307  81.232 67.824 1.00 50.80  ? 430  LEU A N   1 
ATOM   3431 C CA  . LEU A 1 430 ? 11.665  79.973 68.177 1.00 49.91  ? 430  LEU A CA  1 
ATOM   3432 C C   . LEU A 1 430 ? 11.137  80.072 69.607 1.00 50.24  ? 430  LEU A C   1 
ATOM   3433 O O   . LEU A 1 430 ? 11.849  80.520 70.507 1.00 52.40  ? 430  LEU A O   1 
ATOM   3434 C CB  . LEU A 1 430 ? 12.672  78.831 68.050 1.00 50.04  ? 430  LEU A CB  1 
ATOM   3435 C CG  . LEU A 1 430 ? 12.116  77.429 67.812 1.00 48.74  ? 430  LEU A CG  1 
ATOM   3436 C CD1 . LEU A 1 430 ? 11.197  77.430 66.613 1.00 49.75  ? 430  LEU A CD1 1 
ATOM   3437 C CD2 . LEU A 1 430 ? 13.262  76.482 67.575 1.00 49.72  ? 430  LEU A CD2 1 
ATOM   3438 N N   . VAL A 1 431 ? 9.892   79.661 69.819 1.00 48.05  ? 431  VAL A N   1 
ATOM   3439 C CA  . VAL A 1 431 ? 9.301   79.734 71.150 1.00 45.57  ? 431  VAL A CA  1 
ATOM   3440 C C   . VAL A 1 431 ? 9.519   78.489 72.006 1.00 44.39  ? 431  VAL A C   1 
ATOM   3441 O O   . VAL A 1 431 ? 9.222   78.496 73.198 1.00 43.41  ? 431  VAL A O   1 
ATOM   3442 C CB  . VAL A 1 431 ? 7.789   80.025 71.063 1.00 46.77  ? 431  VAL A CB  1 
ATOM   3443 C CG1 . VAL A 1 431 ? 7.564   81.334 70.321 1.00 43.06  ? 431  VAL A CG1 1 
ATOM   3444 C CG2 . VAL A 1 431 ? 7.074   78.878 70.364 1.00 46.03  ? 431  VAL A CG2 1 
ATOM   3445 N N   . TRP A 1 432 ? 10.038  77.424 71.399 1.00 44.18  ? 432  TRP A N   1 
ATOM   3446 C CA  . TRP A 1 432 ? 10.301  76.181 72.121 1.00 40.70  ? 432  TRP A CA  1 
ATOM   3447 C C   . TRP A 1 432 ? 11.620  76.291 72.876 1.00 39.91  ? 432  TRP A C   1 
ATOM   3448 O O   . TRP A 1 432 ? 12.469  77.115 72.539 1.00 39.93  ? 432  TRP A O   1 
ATOM   3449 C CB  . TRP A 1 432 ? 10.371  74.999 71.151 1.00 40.12  ? 432  TRP A CB  1 
ATOM   3450 C CG  . TRP A 1 432 ? 9.068   74.648 70.478 1.00 38.94  ? 432  TRP A CG  1 
ATOM   3451 C CD1 . TRP A 1 432 ? 8.658   75.024 69.229 1.00 40.59  ? 432  TRP A CD1 1 
ATOM   3452 C CD2 . TRP A 1 432 ? 8.015   73.844 71.017 1.00 38.93  ? 432  TRP A CD2 1 
ATOM   3453 N NE1 . TRP A 1 432 ? 7.414   74.501 68.955 1.00 38.20  ? 432  TRP A NE1 1 
ATOM   3454 C CE2 . TRP A 1 432 ? 6.996   73.773 70.036 1.00 39.41  ? 432  TRP A CE2 1 
ATOM   3455 C CE3 . TRP A 1 432 ? 7.830   73.178 72.234 1.00 39.28  ? 432  TRP A CE3 1 
ATOM   3456 C CZ2 . TRP A 1 432 ? 5.812   73.060 70.238 1.00 39.83  ? 432  TRP A CZ2 1 
ATOM   3457 C CZ3 . TRP A 1 432 ? 6.649   72.469 72.435 1.00 40.68  ? 432  TRP A CZ3 1 
ATOM   3458 C CH2 . TRP A 1 432 ? 5.657   72.417 71.440 1.00 41.21  ? 432  TRP A CH2 1 
ATOM   3459 N N   . PRO A 1 433 ? 11.814  75.459 73.911 1.00 40.04  ? 433  PRO A N   1 
ATOM   3460 C CA  . PRO A 1 433 ? 13.066  75.518 74.676 1.00 39.01  ? 433  PRO A CA  1 
ATOM   3461 C C   . PRO A 1 433 ? 14.302  75.246 73.818 1.00 40.62  ? 433  PRO A C   1 
ATOM   3462 O O   . PRO A 1 433 ? 14.220  74.603 72.771 1.00 40.83  ? 433  PRO A O   1 
ATOM   3463 C CB  . PRO A 1 433 ? 12.860  74.462 75.762 1.00 38.61  ? 433  PRO A CB  1 
ATOM   3464 C CG  . PRO A 1 433 ? 11.923  73.468 75.110 1.00 37.00  ? 433  PRO A CG  1 
ATOM   3465 C CD  . PRO A 1 433 ? 10.942  74.373 74.398 1.00 39.32  ? 433  PRO A CD  1 
ATOM   3466 N N   . GLU A 1 434 ? 15.445  75.737 74.282 1.00 42.59  ? 434  GLU A N   1 
ATOM   3467 C CA  . GLU A 1 434 ? 16.709  75.585 73.578 1.00 43.05  ? 434  GLU A CA  1 
ATOM   3468 C C   . GLU A 1 434 ? 17.172  74.141 73.444 1.00 41.67  ? 434  GLU A C   1 
ATOM   3469 O O   . GLU A 1 434 ? 17.813  73.788 72.451 1.00 38.91  ? 434  GLU A O   1 
ATOM   3470 C CB  . GLU A 1 434 ? 17.796  76.393 74.289 1.00 47.27  ? 434  GLU A CB  1 
ATOM   3471 C CG  . GLU A 1 434 ? 17.584  77.897 74.244 1.00 56.45  ? 434  GLU A CG  1 
ATOM   3472 C CD  . GLU A 1 434 ? 18.103  78.530 72.962 1.00 62.16  ? 434  GLU A CD  1 
ATOM   3473 O OE1 . GLU A 1 434 ? 17.815  79.726 72.726 1.00 64.80  ? 434  GLU A OE1 1 
ATOM   3474 O OE2 . GLU A 1 434 ? 18.811  77.836 72.195 1.00 65.22  ? 434  GLU A OE2 1 
ATOM   3475 N N   . TRP A 1 435 ? 16.863  73.305 74.432 1.00 40.66  ? 435  TRP A N   1 
ATOM   3476 C CA  . TRP A 1 435 ? 17.309  71.912 74.376 1.00 41.42  ? 435  TRP A CA  1 
ATOM   3477 C C   . TRP A 1 435 ? 16.754  71.133 73.179 1.00 41.07  ? 435  TRP A C   1 
ATOM   3478 O O   . TRP A 1 435 ? 17.314  70.106 72.788 1.00 42.21  ? 435  TRP A O   1 
ATOM   3479 C CB  . TRP A 1 435 ? 16.986  71.168 75.690 1.00 39.33  ? 435  TRP A CB  1 
ATOM   3480 C CG  . TRP A 1 435 ? 15.525  70.859 75.948 1.00 39.50  ? 435  TRP A CG  1 
ATOM   3481 C CD1 . TRP A 1 435 ? 14.675  71.536 76.783 1.00 38.76  ? 435  TRP A CD1 1 
ATOM   3482 C CD2 . TRP A 1 435 ? 14.761  69.772 75.398 1.00 38.34  ? 435  TRP A CD2 1 
ATOM   3483 N NE1 . TRP A 1 435 ? 13.434  70.935 76.790 1.00 37.15  ? 435  TRP A NE1 1 
ATOM   3484 C CE2 . TRP A 1 435 ? 13.458  69.854 75.949 1.00 36.92  ? 435  TRP A CE2 1 
ATOM   3485 C CE3 . TRP A 1 435 ? 15.050  68.738 74.496 1.00 37.30  ? 435  TRP A CE3 1 
ATOM   3486 C CZ2 . TRP A 1 435 ? 12.447  68.942 75.626 1.00 36.07  ? 435  TRP A CZ2 1 
ATOM   3487 C CZ3 . TRP A 1 435 ? 14.042  67.829 74.175 1.00 37.06  ? 435  TRP A CZ3 1 
ATOM   3488 C CH2 . TRP A 1 435 ? 12.757  67.939 74.740 1.00 37.06  ? 435  TRP A CH2 1 
ATOM   3489 N N   . MET A 1 436 ? 15.668  71.630 72.590 1.00 39.59  ? 436  MET A N   1 
ATOM   3490 C CA  . MET A 1 436 ? 15.050  70.968 71.446 1.00 37.43  ? 436  MET A CA  1 
ATOM   3491 C C   . MET A 1 436 ? 15.793  71.233 70.135 1.00 36.98  ? 436  MET A C   1 
ATOM   3492 O O   . MET A 1 436 ? 15.578  70.534 69.145 1.00 37.78  ? 436  MET A O   1 
ATOM   3493 C CB  . MET A 1 436 ? 13.571  71.382 71.340 1.00 35.70  ? 436  MET A CB  1 
ATOM   3494 C CG  . MET A 1 436 ? 12.702  70.808 72.464 1.00 32.54  ? 436  MET A CG  1 
ATOM   3495 S SD  . MET A 1 436 ? 11.001  71.426 72.517 1.00 35.10  ? 436  MET A SD  1 
ATOM   3496 C CE  . MET A 1 436 ? 10.189  70.345 71.290 1.00 33.71  ? 436  MET A CE  1 
ATOM   3497 N N   . GLY A 1 437 ? 16.670  72.236 70.138 1.00 37.68  ? 437  GLY A N   1 
ATOM   3498 C CA  . GLY A 1 437 ? 17.458  72.570 68.955 1.00 36.64  ? 437  GLY A CA  1 
ATOM   3499 C C   . GLY A 1 437 ? 16.701  72.923 67.680 1.00 36.88  ? 437  GLY A C   1 
ATOM   3500 O O   . GLY A 1 437 ? 15.767  73.728 67.695 1.00 35.82  ? 437  GLY A O   1 
ATOM   3501 N N   . VAL A 1 438 ? 17.130  72.338 66.564 1.00 35.35  ? 438  VAL A N   1 
ATOM   3502 C CA  . VAL A 1 438 ? 16.495  72.569 65.272 1.00 35.62  ? 438  VAL A CA  1 
ATOM   3503 C C   . VAL A 1 438 ? 15.428  71.480 65.165 1.00 35.70  ? 438  VAL A C   1 
ATOM   3504 O O   . VAL A 1 438 ? 15.673  70.374 64.684 1.00 35.76  ? 438  VAL A O   1 
ATOM   3505 C CB  . VAL A 1 438 ? 17.517  72.445 64.128 1.00 35.01  ? 438  VAL A CB  1 
ATOM   3506 C CG1 . VAL A 1 438 ? 16.921  72.933 62.832 1.00 34.60  ? 438  VAL A CG1 1 
ATOM   3507 C CG2 . VAL A 1 438 ? 18.756  73.233 64.471 1.00 35.92  ? 438  VAL A CG2 1 
ATOM   3508 N N   . ILE A 1 439 ? 14.244  71.831 65.640 1.00 35.15  ? 439  ILE A N   1 
ATOM   3509 C CA  . ILE A 1 439 ? 13.092  70.953 65.711 1.00 35.74  ? 439  ILE A CA  1 
ATOM   3510 C C   . ILE A 1 439 ? 12.459  70.449 64.422 1.00 38.36  ? 439  ILE A C   1 
ATOM   3511 O O   . ILE A 1 439 ? 12.486  71.106 63.378 1.00 40.57  ? 439  ILE A O   1 
ATOM   3512 C CB  . ILE A 1 439 ? 12.006  71.639 66.546 1.00 36.75  ? 439  ILE A CB  1 
ATOM   3513 C CG1 . ILE A 1 439 ? 12.610  72.052 67.893 1.00 36.39  ? 439  ILE A CG1 1 
ATOM   3514 C CG2 . ILE A 1 439 ? 10.791  70.725 66.711 1.00 36.31  ? 439  ILE A CG2 1 
ATOM   3515 C CD1 . ILE A 1 439 ? 11.799  73.077 68.643 1.00 38.22  ? 439  ILE A CD1 1 
ATOM   3516 N N   . HIS A 1 440 ? 11.880  69.259 64.529 1.00 38.56  ? 440  HIS A N   1 
ATOM   3517 C CA  . HIS A 1 440 ? 11.181  68.610 63.443 1.00 38.88  ? 440  HIS A CA  1 
ATOM   3518 C C   . HIS A 1 440 ? 10.124  69.587 62.920 1.00 39.17  ? 440  HIS A C   1 
ATOM   3519 O O   . HIS A 1 440 ? 9.317   70.104 63.691 1.00 38.55  ? 440  HIS A O   1 
ATOM   3520 C CB  . HIS A 1 440 ? 10.509  67.349 63.991 1.00 39.42  ? 440  HIS A CB  1 
ATOM   3521 C CG  . HIS A 1 440 ? 9.838   66.506 62.953 1.00 41.72  ? 440  HIS A CG  1 
ATOM   3522 N ND1 . HIS A 1 440 ? 10.527  65.903 61.923 1.00 41.07  ? 440  HIS A ND1 1 
ATOM   3523 C CD2 . HIS A 1 440 ? 8.544   66.128 62.811 1.00 41.78  ? 440  HIS A CD2 1 
ATOM   3524 C CE1 . HIS A 1 440 ? 9.690   65.187 61.193 1.00 42.62  ? 440  HIS A CE1 1 
ATOM   3525 N NE2 . HIS A 1 440 ? 8.480   65.307 61.711 1.00 44.70  ? 440  HIS A NE2 1 
ATOM   3526 N N   . GLY A 1 441 ? 10.148  69.858 61.619 1.00 38.40  ? 441  GLY A N   1 
ATOM   3527 C CA  . GLY A 1 441 ? 9.162   70.751 61.038 1.00 38.65  ? 441  GLY A CA  1 
ATOM   3528 C C   . GLY A 1 441 ? 9.443   72.241 61.082 1.00 40.15  ? 441  GLY A C   1 
ATOM   3529 O O   . GLY A 1 441 ? 8.638   73.030 60.588 1.00 39.59  ? 441  GLY A O   1 
ATOM   3530 N N   . TYR A 1 442 ? 10.569  72.655 61.649 1.00 40.97  ? 442  TYR A N   1 
ATOM   3531 C CA  . TYR A 1 442 ? 10.823  74.080 61.703 1.00 40.90  ? 442  TYR A CA  1 
ATOM   3532 C C   . TYR A 1 442 ? 11.659  74.644 60.575 1.00 41.73  ? 442  TYR A C   1 
ATOM   3533 O O   . TYR A 1 442 ? 12.226  75.730 60.685 1.00 42.36  ? 442  TYR A O   1 
ATOM   3534 C CB  . TYR A 1 442 ? 11.360  74.470 63.081 1.00 40.05  ? 442  TYR A CB  1 
ATOM   3535 C CG  . TYR A 1 442 ? 10.213  74.561 64.059 1.00 41.27  ? 442  TYR A CG  1 
ATOM   3536 C CD1 . TYR A 1 442 ? 9.620   73.410 64.578 1.00 41.46  ? 442  TYR A CD1 1 
ATOM   3537 C CD2 . TYR A 1 442 ? 9.606   75.789 64.333 1.00 42.36  ? 442  TYR A CD2 1 
ATOM   3538 C CE1 . TYR A 1 442 ? 8.442   73.480 65.332 1.00 40.94  ? 442  TYR A CE1 1 
ATOM   3539 C CE2 . TYR A 1 442 ? 8.430   75.868 65.084 1.00 39.74  ? 442  TYR A CE2 1 
ATOM   3540 C CZ  . TYR A 1 442 ? 7.851   74.715 65.574 1.00 40.75  ? 442  TYR A CZ  1 
ATOM   3541 O OH  . TYR A 1 442 ? 6.662   74.792 66.266 1.00 40.36  ? 442  TYR A OH  1 
ATOM   3542 N N   . GLU A 1 443 ? 11.703  73.901 59.475 1.00 41.21  ? 443  GLU A N   1 
ATOM   3543 C CA  . GLU A 1 443 ? 12.405  74.342 58.279 1.00 39.44  ? 443  GLU A CA  1 
ATOM   3544 C C   . GLU A 1 443 ? 11.284  74.779 57.328 1.00 40.12  ? 443  GLU A C   1 
ATOM   3545 O O   . GLU A 1 443 ? 11.521  75.469 56.341 1.00 42.43  ? 443  GLU A O   1 
ATOM   3546 C CB  . GLU A 1 443 ? 13.202  73.199 57.644 1.00 38.69  ? 443  GLU A CB  1 
ATOM   3547 C CG  . GLU A 1 443 ? 12.408  72.327 56.673 1.00 37.02  ? 443  GLU A CG  1 
ATOM   3548 C CD  . GLU A 1 443 ? 11.408  71.412 57.358 1.00 38.47  ? 443  GLU A CD  1 
ATOM   3549 O OE1 . GLU A 1 443 ? 10.621  70.770 56.636 1.00 37.96  ? 443  GLU A OE1 1 
ATOM   3550 O OE2 . GLU A 1 443 ? 11.408  71.328 58.606 1.00 36.10  ? 443  GLU A OE2 1 
ATOM   3551 N N   . ILE A 1 444 ? 10.057  74.373 57.650 1.00 39.85  ? 444  ILE A N   1 
ATOM   3552 C CA  . ILE A 1 444 ? 8.881   74.694 56.844 1.00 40.23  ? 444  ILE A CA  1 
ATOM   3553 C C   . ILE A 1 444 ? 8.651   76.198 56.685 1.00 41.65  ? 444  ILE A C   1 
ATOM   3554 O O   . ILE A 1 444 ? 8.405   76.682 55.573 1.00 41.59  ? 444  ILE A O   1 
ATOM   3555 C CB  . ILE A 1 444 ? 7.600   74.074 57.450 1.00 39.57  ? 444  ILE A CB  1 
ATOM   3556 C CG1 . ILE A 1 444 ? 7.694   72.547 57.433 1.00 36.42  ? 444  ILE A CG1 1 
ATOM   3557 C CG2 . ILE A 1 444 ? 6.378   74.542 56.668 1.00 39.03  ? 444  ILE A CG2 1 
ATOM   3558 C CD1 . ILE A 1 444 ? 6.494   71.857 58.059 1.00 33.00  ? 444  ILE A CD1 1 
ATOM   3559 N N   . GLU A 1 445 ? 8.717   76.932 57.794 1.00 42.43  ? 445  GLU A N   1 
ATOM   3560 C CA  . GLU A 1 445 ? 8.509   78.380 57.764 1.00 41.44  ? 445  GLU A CA  1 
ATOM   3561 C C   . GLU A 1 445 ? 9.504   79.068 56.832 1.00 40.85  ? 445  GLU A C   1 
ATOM   3562 O O   . GLU A 1 445 ? 9.201   80.114 56.255 1.00 41.51  ? 445  GLU A O   1 
ATOM   3563 C CB  . GLU A 1 445 ? 8.591   78.956 59.183 1.00 41.14  ? 445  GLU A CB  1 
ATOM   3564 C CG  . GLU A 1 445 ? 9.838   78.579 59.948 1.00 40.78  ? 445  GLU A CG  1 
ATOM   3565 C CD  . GLU A 1 445 ? 9.670   78.795 61.437 1.00 42.99  ? 445  GLU A CD  1 
ATOM   3566 O OE1 . GLU A 1 445 ? 8.700   78.252 62.005 1.00 43.95  ? 445  GLU A OE1 1 
ATOM   3567 O OE2 . GLU A 1 445 ? 10.505  79.500 62.044 1.00 45.19  ? 445  GLU A OE2 1 
ATOM   3568 N N   . PHE A 1 446 ? 10.687  78.484 56.675 1.00 38.96  ? 446  PHE A N   1 
ATOM   3569 C CA  . PHE A 1 446 ? 11.664  79.062 55.769 1.00 38.31  ? 446  PHE A CA  1 
ATOM   3570 C C   . PHE A 1 446 ? 11.298  78.668 54.347 1.00 39.51  ? 446  PHE A C   1 
ATOM   3571 O O   . PHE A 1 446 ? 11.488  79.451 53.416 1.00 39.51  ? 446  PHE A O   1 
ATOM   3572 C CB  . PHE A 1 446 ? 13.075  78.585 56.099 1.00 38.31  ? 446  PHE A CB  1 
ATOM   3573 C CG  . PHE A 1 446 ? 13.632  79.192 57.346 1.00 41.75  ? 446  PHE A CG  1 
ATOM   3574 C CD1 . PHE A 1 446 ? 13.240  78.728 58.602 1.00 41.89  ? 446  PHE A CD1 1 
ATOM   3575 C CD2 . PHE A 1 446 ? 14.512  80.268 57.274 1.00 41.27  ? 446  PHE A CD2 1 
ATOM   3576 C CE1 . PHE A 1 446 ? 13.715  79.331 59.767 1.00 42.43  ? 446  PHE A CE1 1 
ATOM   3577 C CE2 . PHE A 1 446 ? 14.992  80.877 58.432 1.00 42.58  ? 446  PHE A CE2 1 
ATOM   3578 C CZ  . PHE A 1 446 ? 14.591  80.406 59.683 1.00 42.86  ? 446  PHE A CZ  1 
ATOM   3579 N N   . VAL A 1 447 ? 10.764  77.458 54.180 1.00 39.09  ? 447  VAL A N   1 
ATOM   3580 C CA  . VAL A 1 447 ? 10.364  76.987 52.859 1.00 37.18  ? 447  VAL A CA  1 
ATOM   3581 C C   . VAL A 1 447 ? 9.192   77.824 52.346 1.00 38.93  ? 447  VAL A C   1 
ATOM   3582 O O   . VAL A 1 447 ? 9.102   78.119 51.153 1.00 38.73  ? 447  VAL A O   1 
ATOM   3583 C CB  . VAL A 1 447 ? 9.940   75.495 52.887 1.00 37.35  ? 447  VAL A CB  1 
ATOM   3584 C CG1 . VAL A 1 447 ? 9.308   75.097 51.555 1.00 32.13  ? 447  VAL A CG1 1 
ATOM   3585 C CG2 . VAL A 1 447 ? 11.155  74.613 53.169 1.00 35.81  ? 447  VAL A CG2 1 
ATOM   3586 N N   . PHE A 1 448 ? 8.296   78.218 53.245 1.00 38.71  ? 448  PHE A N   1 
ATOM   3587 C CA  . PHE A 1 448 ? 7.155   79.015 52.830 1.00 40.16  ? 448  PHE A CA  1 
ATOM   3588 C C   . PHE A 1 448 ? 7.365   80.532 52.893 1.00 41.09  ? 448  PHE A C   1 
ATOM   3589 O O   . PHE A 1 448 ? 6.431   81.299 52.686 1.00 40.09  ? 448  PHE A O   1 
ATOM   3590 C CB  . PHE A 1 448 ? 5.914   78.609 53.624 1.00 39.71  ? 448  PHE A CB  1 
ATOM   3591 C CG  . PHE A 1 448 ? 5.267   77.349 53.120 1.00 39.12  ? 448  PHE A CG  1 
ATOM   3592 C CD1 . PHE A 1 448 ? 5.862   76.110 53.327 1.00 38.99  ? 448  PHE A CD1 1 
ATOM   3593 C CD2 . PHE A 1 448 ? 4.072   77.405 52.412 1.00 40.16  ? 448  PHE A CD2 1 
ATOM   3594 C CE1 . PHE A 1 448 ? 5.274   74.943 52.836 1.00 38.33  ? 448  PHE A CE1 1 
ATOM   3595 C CE2 . PHE A 1 448 ? 3.472   76.237 51.914 1.00 39.61  ? 448  PHE A CE2 1 
ATOM   3596 C CZ  . PHE A 1 448 ? 4.075   75.007 52.127 1.00 38.46  ? 448  PHE A CZ  1 
ATOM   3597 N N   . GLY A 1 449 ? 8.591   80.957 53.181 1.00 41.95  ? 449  GLY A N   1 
ATOM   3598 C CA  . GLY A 1 449 ? 8.900   82.376 53.216 1.00 44.36  ? 449  GLY A CA  1 
ATOM   3599 C C   . GLY A 1 449 ? 8.405   83.256 54.353 1.00 46.45  ? 449  GLY A C   1 
ATOM   3600 O O   . GLY A 1 449 ? 8.334   84.474 54.191 1.00 47.37  ? 449  GLY A O   1 
ATOM   3601 N N   . LEU A 1 450 ? 8.068   82.674 55.497 1.00 46.77  ? 450  LEU A N   1 
ATOM   3602 C CA  . LEU A 1 450 ? 7.598   83.472 56.628 1.00 47.51  ? 450  LEU A CA  1 
ATOM   3603 C C   . LEU A 1 450 ? 8.604   84.544 57.078 1.00 48.00  ? 450  LEU A C   1 
ATOM   3604 O O   . LEU A 1 450 ? 8.209   85.622 57.514 1.00 48.03  ? 450  LEU A O   1 
ATOM   3605 C CB  . LEU A 1 450 ? 7.239   82.563 57.809 1.00 47.58  ? 450  LEU A CB  1 
ATOM   3606 C CG  . LEU A 1 450 ? 5.887   81.838 57.740 1.00 48.18  ? 450  LEU A CG  1 
ATOM   3607 C CD1 . LEU A 1 450 ? 4.775   82.823 57.984 1.00 48.40  ? 450  LEU A CD1 1 
ATOM   3608 C CD2 . LEU A 1 450 ? 5.708   81.171 56.384 1.00 49.42  ? 450  LEU A CD2 1 
ATOM   3609 N N   . PRO A 1 451 ? 9.915   84.258 56.988 1.00 48.89  ? 451  PRO A N   1 
ATOM   3610 C CA  . PRO A 1 451 ? 10.920  85.247 57.399 1.00 50.72  ? 451  PRO A CA  1 
ATOM   3611 C C   . PRO A 1 451 ? 10.916  86.550 56.579 1.00 52.79  ? 451  PRO A C   1 
ATOM   3612 O O   . PRO A 1 451 ? 11.676  87.475 56.868 1.00 53.03  ? 451  PRO A O   1 
ATOM   3613 C CB  . PRO A 1 451 ? 12.234  84.479 57.258 1.00 49.09  ? 451  PRO A CB  1 
ATOM   3614 C CG  . PRO A 1 451 ? 11.821  83.082 57.584 1.00 49.49  ? 451  PRO A CG  1 
ATOM   3615 C CD  . PRO A 1 451 ? 10.542  82.936 56.805 1.00 48.53  ? 451  PRO A CD  1 
ATOM   3616 N N   . LEU A 1 452 ? 10.072  86.626 55.557 1.00 54.54  ? 452  LEU A N   1 
ATOM   3617 C CA  . LEU A 1 452 ? 10.007  87.836 54.747 1.00 55.77  ? 452  LEU A CA  1 
ATOM   3618 C C   . LEU A 1 452 ? 8.997   88.813 55.321 1.00 56.82  ? 452  LEU A C   1 
ATOM   3619 O O   . LEU A 1 452 ? 8.900   89.948 54.859 1.00 59.53  ? 452  LEU A O   1 
ATOM   3620 C CB  . LEU A 1 452 ? 9.629   87.512 53.299 1.00 54.58  ? 452  LEU A CB  1 
ATOM   3621 C CG  . LEU A 1 452 ? 10.745  87.122 52.325 1.00 55.38  ? 452  LEU A CG  1 
ATOM   3622 C CD1 . LEU A 1 452 ? 11.462  85.874 52.809 1.00 54.62  ? 452  LEU A CD1 1 
ATOM   3623 C CD2 . LEU A 1 452 ? 10.146  86.899 50.942 1.00 54.33  ? 452  LEU A CD2 1 
ATOM   3624 N N   . VAL A 1 453 ? 8.249   88.369 56.327 1.00 57.07  ? 453  VAL A N   1 
ATOM   3625 C CA  . VAL A 1 453 ? 7.239   89.206 56.967 1.00 58.93  ? 453  VAL A CA  1 
ATOM   3626 C C   . VAL A 1 453 ? 7.825   89.829 58.234 1.00 61.65  ? 453  VAL A C   1 
ATOM   3627 O O   . VAL A 1 453 ? 7.811   89.213 59.301 1.00 62.03  ? 453  VAL A O   1 
ATOM   3628 C CB  . VAL A 1 453 ? 6.000   88.368 57.341 1.00 58.41  ? 453  VAL A CB  1 
ATOM   3629 C CG1 . VAL A 1 453 ? 4.900   89.262 57.877 1.00 57.11  ? 453  VAL A CG1 1 
ATOM   3630 C CG2 . VAL A 1 453 ? 5.518   87.597 56.129 1.00 58.79  ? 453  VAL A CG2 1 
ATOM   3631 N N   . LYS A 1 454 ? 8.335   91.052 58.106 1.00 63.43  ? 454  LYS A N   1 
ATOM   3632 C CA  . LYS A 1 454 ? 8.956   91.774 59.217 1.00 64.70  ? 454  LYS A CA  1 
ATOM   3633 C C   . LYS A 1 454 ? 8.290   91.630 60.583 1.00 64.49  ? 454  LYS A C   1 
ATOM   3634 O O   . LYS A 1 454 ? 8.969   91.530 61.603 1.00 64.34  ? 454  LYS A O   1 
ATOM   3635 C CB  . LYS A 1 454 ? 9.060   93.265 58.880 1.00 68.16  ? 454  LYS A CB  1 
ATOM   3636 C CG  . LYS A 1 454 ? 10.145  93.631 57.862 1.00 72.42  ? 454  LYS A CG  1 
ATOM   3637 C CD  . LYS A 1 454 ? 9.872   93.034 56.483 1.00 75.02  ? 454  LYS A CD  1 
ATOM   3638 C CE  . LYS A 1 454 ? 10.833  93.582 55.426 1.00 75.95  ? 454  LYS A CE  1 
ATOM   3639 N NZ  . LYS A 1 454 ? 12.263  93.266 55.713 1.00 76.89  ? 454  LYS A NZ  1 
ATOM   3640 N N   . GLU A 1 455 ? 6.964   91.622 60.599 1.00 64.34  ? 455  GLU A N   1 
ATOM   3641 C CA  . GLU A 1 455 ? 6.200   91.519 61.835 1.00 64.78  ? 455  GLU A CA  1 
ATOM   3642 C C   . GLU A 1 455 ? 6.415   90.213 62.604 1.00 65.68  ? 455  GLU A C   1 
ATOM   3643 O O   . GLU A 1 455 ? 6.080   90.128 63.785 1.00 67.36  ? 455  GLU A O   1 
ATOM   3644 C CB  . GLU A 1 455 ? 4.709   91.683 61.536 1.00 66.74  ? 455  GLU A CB  1 
ATOM   3645 C CG  . GLU A 1 455 ? 4.356   92.870 60.636 1.00 71.32  ? 455  GLU A CG  1 
ATOM   3646 C CD  . GLU A 1 455 ? 4.677   92.634 59.160 1.00 74.81  ? 455  GLU A CD  1 
ATOM   3647 O OE1 . GLU A 1 455 ? 5.873   92.615 58.792 1.00 77.04  ? 455  GLU A OE1 1 
ATOM   3648 O OE2 . GLU A 1 455 ? 3.727   92.468 58.361 1.00 76.48  ? 455  GLU A OE2 1 
ATOM   3649 N N   . LEU A 1 456 ? 6.959   89.195 61.939 1.00 65.58  ? 456  LEU A N   1 
ATOM   3650 C CA  . LEU A 1 456 ? 7.196   87.907 62.588 1.00 64.16  ? 456  LEU A CA  1 
ATOM   3651 C C   . LEU A 1 456 ? 8.503   87.911 63.374 1.00 63.71  ? 456  LEU A C   1 
ATOM   3652 O O   . LEU A 1 456 ? 8.845   86.940 64.049 1.00 63.93  ? 456  LEU A O   1 
ATOM   3653 C CB  . LEU A 1 456 ? 7.194   86.780 61.552 1.00 63.13  ? 456  LEU A CB  1 
ATOM   3654 C CG  . LEU A 1 456 ? 5.843   86.592 60.852 1.00 62.72  ? 456  LEU A CG  1 
ATOM   3655 C CD1 . LEU A 1 456 ? 5.921   85.430 59.877 1.00 61.45  ? 456  LEU A CD1 1 
ATOM   3656 C CD2 . LEU A 1 456 ? 4.757   86.343 61.889 1.00 60.59  ? 456  LEU A CD2 1 
ATOM   3657 N N   . ASN A 1 457 ? 9.227   89.017 63.272 1.00 63.25  ? 457  ASN A N   1 
ATOM   3658 C CA  . ASN A 1 457 ? 10.476  89.211 63.993 1.00 62.51  ? 457  ASN A CA  1 
ATOM   3659 C C   . ASN A 1 457 ? 11.614  88.232 63.724 1.00 60.66  ? 457  ASN A C   1 
ATOM   3660 O O   . ASN A 1 457 ? 12.184  87.678 64.663 1.00 62.25  ? 457  ASN A O   1 
ATOM   3661 C CB  . ASN A 1 457 ? 10.193  89.249 65.502 1.00 65.39  ? 457  ASN A CB  1 
ATOM   3662 C CG  . ASN A 1 457 ? 9.159   90.306 65.878 1.00 67.84  ? 457  ASN A CG  1 
ATOM   3663 O OD1 . ASN A 1 457 ? 9.227   91.448 65.418 1.00 70.56  ? 457  ASN A OD1 1 
ATOM   3664 N ND2 . ASN A 1 457 ? 8.204   89.931 66.727 1.00 66.93  ? 457  ASN A ND2 1 
ATOM   3665 N N   . TYR A 1 458 ? 11.945  88.016 62.455 1.00 56.52  ? 458  TYR A N   1 
ATOM   3666 C CA  . TYR A 1 458 ? 13.060  87.141 62.093 1.00 52.98  ? 458  TYR A CA  1 
ATOM   3667 C C   . TYR A 1 458 ? 14.223  88.095 61.841 1.00 52.48  ? 458  TYR A C   1 
ATOM   3668 O O   . TYR A 1 458 ? 14.023  89.306 61.752 1.00 53.20  ? 458  TYR A O   1 
ATOM   3669 C CB  . TYR A 1 458 ? 12.768  86.363 60.802 1.00 51.61  ? 458  TYR A CB  1 
ATOM   3670 C CG  . TYR A 1 458 ? 11.883  85.145 60.959 1.00 49.42  ? 458  TYR A CG  1 
ATOM   3671 C CD1 . TYR A 1 458 ? 12.424  83.896 61.285 1.00 49.06  ? 458  TYR A CD1 1 
ATOM   3672 C CD2 . TYR A 1 458 ? 10.506  85.237 60.780 1.00 47.60  ? 458  TYR A CD2 1 
ATOM   3673 C CE1 . TYR A 1 458 ? 11.610  82.769 61.429 1.00 45.67  ? 458  TYR A CE1 1 
ATOM   3674 C CE2 . TYR A 1 458 ? 9.686   84.124 60.922 1.00 48.74  ? 458  TYR A CE2 1 
ATOM   3675 C CZ  . TYR A 1 458 ? 10.241  82.892 61.247 1.00 46.81  ? 458  TYR A CZ  1 
ATOM   3676 O OH  . TYR A 1 458 ? 9.416   81.800 61.407 1.00 44.12  ? 458  TYR A OH  1 
ATOM   3677 N N   . THR A 1 459 ? 15.433  87.566 61.718 1.00 50.74  ? 459  THR A N   1 
ATOM   3678 C CA  . THR A 1 459 ? 16.579  88.424 61.463 1.00 49.94  ? 459  THR A CA  1 
ATOM   3679 C C   . THR A 1 459 ? 16.807  88.539 59.964 1.00 51.94  ? 459  THR A C   1 
ATOM   3680 O O   . THR A 1 459 ? 16.272  87.753 59.185 1.00 54.64  ? 459  THR A O   1 
ATOM   3681 C CB  . THR A 1 459 ? 17.866  87.875 62.100 1.00 48.28  ? 459  THR A CB  1 
ATOM   3682 O OG1 . THR A 1 459 ? 18.298  86.710 61.386 1.00 46.49  ? 459  THR A OG1 1 
ATOM   3683 C CG2 . THR A 1 459 ? 17.631  87.534 63.559 1.00 45.85  ? 459  THR A CG2 1 
ATOM   3684 N N   . ALA A 1 460 ? 17.606  89.522 59.568 1.00 51.89  ? 460  ALA A N   1 
ATOM   3685 C CA  . ALA A 1 460 ? 17.917  89.750 58.166 1.00 50.27  ? 460  ALA A CA  1 
ATOM   3686 C C   . ALA A 1 460 ? 18.508  88.499 57.523 1.00 50.01  ? 460  ALA A C   1 
ATOM   3687 O O   . ALA A 1 460 ? 18.103  88.093 56.436 1.00 49.34  ? 460  ALA A O   1 
ATOM   3688 C CB  . ALA A 1 460 ? 18.896  90.909 58.046 1.00 50.08  ? 460  ALA A CB  1 
ATOM   3689 N N   . GLU A 1 461 ? 19.479  87.901 58.204 1.00 51.69  ? 461  GLU A N   1 
ATOM   3690 C CA  . GLU A 1 461 ? 20.146  86.698 57.721 1.00 53.28  ? 461  GLU A CA  1 
ATOM   3691 C C   . GLU A 1 461 ? 19.123  85.596 57.478 1.00 52.74  ? 461  GLU A C   1 
ATOM   3692 O O   . GLU A 1 461 ? 19.207  84.863 56.491 1.00 52.03  ? 461  GLU A O   1 
ATOM   3693 C CB  . GLU A 1 461 ? 21.185  86.221 58.741 1.00 56.62  ? 461  GLU A CB  1 
ATOM   3694 C CG  . GLU A 1 461 ? 22.287  87.231 59.032 1.00 62.73  ? 461  GLU A CG  1 
ATOM   3695 C CD  . GLU A 1 461 ? 21.809  88.419 59.860 1.00 67.12  ? 461  GLU A CD  1 
ATOM   3696 O OE1 . GLU A 1 461 ? 22.584  89.390 59.991 1.00 72.01  ? 461  GLU A OE1 1 
ATOM   3697 O OE2 . GLU A 1 461 ? 20.673  88.388 60.387 1.00 68.27  ? 461  GLU A OE2 1 
ATOM   3698 N N   . GLU A 1 462 ? 18.154  85.487 58.379 1.00 51.41  ? 462  GLU A N   1 
ATOM   3699 C CA  . GLU A 1 462 ? 17.119  84.476 58.253 1.00 51.07  ? 462  GLU A CA  1 
ATOM   3700 C C   . GLU A 1 462 ? 16.207  84.752 57.068 1.00 51.63  ? 462  GLU A C   1 
ATOM   3701 O O   . GLU A 1 462 ? 15.703  83.825 56.432 1.00 49.98  ? 462  GLU A O   1 
ATOM   3702 C CB  . GLU A 1 462 ? 16.318  84.391 59.550 1.00 49.57  ? 462  GLU A CB  1 
ATOM   3703 C CG  . GLU A 1 462 ? 17.051  83.598 60.615 1.00 49.08  ? 462  GLU A CG  1 
ATOM   3704 C CD  . GLU A 1 462 ? 16.382  83.640 61.967 1.00 50.72  ? 462  GLU A CD  1 
ATOM   3705 O OE1 . GLU A 1 462 ? 16.834  82.884 62.855 1.00 49.67  ? 462  GLU A OE1 1 
ATOM   3706 O OE2 . GLU A 1 462 ? 15.423  84.427 62.143 1.00 49.83  ? 462  GLU A OE2 1 
ATOM   3707 N N   . GLU A 1 463 ? 15.996  86.027 56.766 1.00 52.36  ? 463  GLU A N   1 
ATOM   3708 C CA  . GLU A 1 463 ? 15.165  86.383 55.628 1.00 52.67  ? 463  GLU A CA  1 
ATOM   3709 C C   . GLU A 1 463 ? 15.929  85.954 54.383 1.00 51.39  ? 463  GLU A C   1 
ATOM   3710 O O   . GLU A 1 463 ? 15.340  85.471 53.414 1.00 49.90  ? 463  GLU A O   1 
ATOM   3711 C CB  . GLU A 1 463 ? 14.923  87.890 55.577 1.00 55.22  ? 463  GLU A CB  1 
ATOM   3712 C CG  . GLU A 1 463 ? 14.080  88.327 54.384 1.00 58.91  ? 463  GLU A CG  1 
ATOM   3713 C CD  . GLU A 1 463 ? 13.941  89.839 54.269 1.00 61.61  ? 463  GLU A CD  1 
ATOM   3714 O OE1 . GLU A 1 463 ? 13.226  90.298 53.352 1.00 61.32  ? 463  GLU A OE1 1 
ATOM   3715 O OE2 . GLU A 1 463 ? 14.542  90.569 55.091 1.00 62.73  ? 463  GLU A OE2 1 
ATOM   3716 N N   . ALA A 1 464 ? 17.247  86.130 54.427 1.00 48.60  ? 464  ALA A N   1 
ATOM   3717 C CA  . ALA A 1 464 ? 18.103  85.768 53.307 1.00 49.24  ? 464  ALA A CA  1 
ATOM   3718 C C   . ALA A 1 464 ? 18.104  84.260 53.067 1.00 49.51  ? 464  ALA A C   1 
ATOM   3719 O O   . ALA A 1 464 ? 18.069  83.810 51.917 1.00 49.57  ? 464  ALA A O   1 
ATOM   3720 C CB  . ALA A 1 464 ? 19.527  86.265 53.548 1.00 47.84  ? 464  ALA A CB  1 
ATOM   3721 N N   . LEU A 1 465 ? 18.146  83.481 54.148 1.00 48.02  ? 465  LEU A N   1 
ATOM   3722 C CA  . LEU A 1 465 ? 18.143  82.025 54.039 1.00 46.68  ? 465  LEU A CA  1 
ATOM   3723 C C   . LEU A 1 465 ? 16.816  81.568 53.437 1.00 46.64  ? 465  LEU A C   1 
ATOM   3724 O O   . LEU A 1 465 ? 16.784  80.725 52.540 1.00 46.99  ? 465  LEU A O   1 
ATOM   3725 C CB  . LEU A 1 465 ? 18.343  81.380 55.414 1.00 45.01  ? 465  LEU A CB  1 
ATOM   3726 C CG  . LEU A 1 465 ? 18.278  79.849 55.458 1.00 44.29  ? 465  LEU A CG  1 
ATOM   3727 C CD1 . LEU A 1 465 ? 19.233  79.245 54.439 1.00 43.21  ? 465  LEU A CD1 1 
ATOM   3728 C CD2 . LEU A 1 465 ? 18.632  79.372 56.852 1.00 42.03  ? 465  LEU A CD2 1 
ATOM   3729 N N   . SER A 1 466 ? 15.722  82.142 53.925 1.00 45.15  ? 466  SER A N   1 
ATOM   3730 C CA  . SER A 1 466 ? 14.399  81.801 53.430 1.00 43.91  ? 466  SER A CA  1 
ATOM   3731 C C   . SER A 1 466 ? 14.311  82.023 51.918 1.00 45.56  ? 466  SER A C   1 
ATOM   3732 O O   . SER A 1 466 ? 13.820  81.162 51.184 1.00 46.91  ? 466  SER A O   1 
ATOM   3733 C CB  . SER A 1 466 ? 13.342  82.639 54.152 1.00 42.28  ? 466  SER A CB  1 
ATOM   3734 O OG  . SER A 1 466 ? 12.032  82.281 53.757 1.00 41.25  ? 466  SER A OG  1 
ATOM   3735 N N   A ARG A 1 467 ? 14.786  83.176 51.455 0.50 44.95  ? 467  ARG A N   1 
ATOM   3736 N N   B ARG A 1 467 ? 14.783  83.175 51.451 0.50 46.04  ? 467  ARG A N   1 
ATOM   3737 C CA  A ARG A 1 467 ? 14.752  83.483 50.031 0.50 43.68  ? 467  ARG A CA  1 
ATOM   3738 C CA  B ARG A 1 467 ? 14.742  83.463 50.023 0.50 45.65  ? 467  ARG A CA  1 
ATOM   3739 C C   A ARG A 1 467 ? 15.631  82.509 49.263 0.50 43.36  ? 467  ARG A C   1 
ATOM   3740 C C   B ARG A 1 467 ? 15.621  82.483 49.268 0.50 44.60  ? 467  ARG A C   1 
ATOM   3741 O O   A ARG A 1 467 ? 15.273  82.061 48.177 0.50 44.04  ? 467  ARG A O   1 
ATOM   3742 O O   B ARG A 1 467 ? 15.254  82.004 48.199 0.50 45.12  ? 467  ARG A O   1 
ATOM   3743 C CB  A ARG A 1 467 ? 15.217  84.920 49.779 0.50 42.38  ? 467  ARG A CB  1 
ATOM   3744 C CB  B ARG A 1 467 ? 15.209  84.892 49.731 0.50 46.73  ? 467  ARG A CB  1 
ATOM   3745 C CG  A ARG A 1 467 ? 14.196  85.985 50.164 0.50 39.78  ? 467  ARG A CG  1 
ATOM   3746 C CG  B ARG A 1 467 ? 14.156  85.963 49.972 0.50 47.60  ? 467  ARG A CG  1 
ATOM   3747 C CD  A ARG A 1 467 ? 14.731  87.395 49.908 0.50 37.59  ? 467  ARG A CD  1 
ATOM   3748 C CD  B ARG A 1 467 ? 14.533  87.268 49.273 0.50 49.53  ? 467  ARG A CD  1 
ATOM   3749 N NE  A ARG A 1 467 ? 13.712  88.413 50.145 0.50 36.69  ? 467  ARG A NE  1 
ATOM   3750 N NE  B ARG A 1 467 ? 13.471  88.262 49.372 0.50 50.30  ? 467  ARG A NE  1 
ATOM   3751 C CZ  A ARG A 1 467 ? 12.616  88.564 49.406 0.50 36.08  ? 467  ARG A CZ  1 
ATOM   3752 C CZ  B ARG A 1 467 ? 13.156  88.899 50.493 0.50 51.60  ? 467  ARG A CZ  1 
ATOM   3753 N NH1 A ARG A 1 467 ? 12.394  87.768 48.367 0.50 35.27  ? 467  ARG A NH1 1 
ATOM   3754 N NH1 B ARG A 1 467 ? 13.834  88.646 51.602 0.50 52.39  ? 467  ARG A NH1 1 
ATOM   3755 N NH2 A ARG A 1 467 ? 11.727  89.498 49.720 0.50 34.28  ? 467  ARG A NH2 1 
ATOM   3756 N NH2 B ARG A 1 467 ? 12.154  89.769 50.514 0.50 50.75  ? 467  ARG A NH2 1 
ATOM   3757 N N   . ARG A 1 468 ? 16.783  82.180 49.832 1.00 43.75  ? 468  ARG A N   1 
ATOM   3758 C CA  . ARG A 1 468 ? 17.702  81.254 49.194 1.00 44.35  ? 468  ARG A CA  1 
ATOM   3759 C C   . ARG A 1 468 ? 17.074  79.859 49.133 1.00 44.24  ? 468  ARG A C   1 
ATOM   3760 O O   . ARG A 1 468 ? 17.223  79.151 48.141 1.00 45.13  ? 468  ARG A O   1 
ATOM   3761 C CB  . ARG A 1 468 ? 19.024  81.227 49.960 1.00 45.00  ? 468  ARG A CB  1 
ATOM   3762 C CG  . ARG A 1 468 ? 20.135  80.480 49.262 1.00 47.83  ? 468  ARG A CG  1 
ATOM   3763 C CD  . ARG A 1 468 ? 21.477  80.910 49.831 1.00 52.61  ? 468  ARG A CD  1 
ATOM   3764 N NE  . ARG A 1 468 ? 21.678  80.466 51.209 1.00 55.42  ? 468  ARG A NE  1 
ATOM   3765 C CZ  . ARG A 1 468 ? 22.154  79.269 51.544 1.00 58.89  ? 468  ARG A CZ  1 
ATOM   3766 N NH1 . ARG A 1 468 ? 22.481  78.396 50.598 1.00 59.32  ? 468  ARG A NH1 1 
ATOM   3767 N NH2 . ARG A 1 468 ? 22.306  78.941 52.822 1.00 59.83  ? 468  ARG A NH2 1 
ATOM   3768 N N   . ILE A 1 469 ? 16.358  79.469 50.185 1.00 43.24  ? 469  ILE A N   1 
ATOM   3769 C CA  . ILE A 1 469 ? 15.715  78.160 50.201 1.00 42.38  ? 469  ILE A CA  1 
ATOM   3770 C C   . ILE A 1 469 ? 14.548  78.135 49.228 1.00 42.76  ? 469  ILE A C   1 
ATOM   3771 O O   . ILE A 1 469 ? 14.429  77.206 48.420 1.00 43.83  ? 469  ILE A O   1 
ATOM   3772 C CB  . ILE A 1 469 ? 15.224  77.780 51.624 1.00 41.49  ? 469  ILE A CB  1 
ATOM   3773 C CG1 . ILE A 1 469 ? 16.426  77.384 52.485 1.00 38.08  ? 469  ILE A CG1 1 
ATOM   3774 C CG2 . ILE A 1 469 ? 14.224  76.624 51.555 1.00 39.14  ? 469  ILE A CG2 1 
ATOM   3775 C CD1 . ILE A 1 469 ? 16.085  77.099 53.916 1.00 41.80  ? 469  ILE A CD1 1 
ATOM   3776 N N   . MET A 1 470 ? 13.690  79.149 49.298 1.00 41.32  ? 470  MET A N   1 
ATOM   3777 C CA  . MET A 1 470 ? 12.548  79.223 48.397 1.00 42.24  ? 470  MET A CA  1 
ATOM   3778 C C   . MET A 1 470 ? 12.988  79.144 46.944 1.00 42.73  ? 470  MET A C   1 
ATOM   3779 O O   . MET A 1 470 ? 12.334  78.507 46.121 1.00 42.63  ? 470  MET A O   1 
ATOM   3780 C CB  . MET A 1 470 ? 11.776  80.527 48.589 1.00 42.96  ? 470  MET A CB  1 
ATOM   3781 C CG  . MET A 1 470 ? 10.924  80.585 49.832 1.00 45.44  ? 470  MET A CG  1 
ATOM   3782 S SD  . MET A 1 470 ? 9.701   81.888 49.681 1.00 48.28  ? 470  MET A SD  1 
ATOM   3783 C CE  . MET A 1 470 ? 10.701  83.316 50.042 1.00 45.05  ? 470  MET A CE  1 
ATOM   3784 N N   . HIS A 1 471 ? 14.100  79.800 46.625 1.00 43.22  ? 471  HIS A N   1 
ATOM   3785 C CA  . HIS A 1 471 ? 14.582  79.799 45.256 1.00 43.17  ? 471  HIS A CA  1 
ATOM   3786 C C   . HIS A 1 471 ? 15.166  78.440 44.871 1.00 43.56  ? 471  HIS A C   1 
ATOM   3787 O O   . HIS A 1 471 ? 15.076  78.033 43.710 1.00 43.46  ? 471  HIS A O   1 
ATOM   3788 C CB  . HIS A 1 471 ? 15.609  80.912 45.049 1.00 43.48  ? 471  HIS A CB  1 
ATOM   3789 C CG  . HIS A 1 471 ? 15.798  81.287 43.613 1.00 43.64  ? 471  HIS A CG  1 
ATOM   3790 N ND1 . HIS A 1 471 ? 16.995  81.119 42.949 1.00 41.98  ? 471  HIS A ND1 1 
ATOM   3791 C CD2 . HIS A 1 471 ? 14.929  81.791 42.705 1.00 41.85  ? 471  HIS A CD2 1 
ATOM   3792 C CE1 . HIS A 1 471 ? 16.854  81.504 41.693 1.00 42.28  ? 471  HIS A CE1 1 
ATOM   3793 N NE2 . HIS A 1 471 ? 15.611  81.915 41.518 1.00 42.67  ? 471  HIS A NE2 1 
ATOM   3794 N N   . TYR A 1 472 ? 15.766  77.741 45.836 1.00 43.19  ? 472  TYR A N   1 
ATOM   3795 C CA  . TYR A 1 472 ? 16.308  76.406 45.577 1.00 43.10  ? 472  TYR A CA  1 
ATOM   3796 C C   . TYR A 1 472 ? 15.139  75.486 45.210 1.00 42.68  ? 472  TYR A C   1 
ATOM   3797 O O   . TYR A 1 472 ? 15.160  74.805 44.180 1.00 41.02  ? 472  TYR A O   1 
ATOM   3798 C CB  . TYR A 1 472 ? 16.974  75.823 46.819 1.00 43.74  ? 472  TYR A CB  1 
ATOM   3799 C CG  . TYR A 1 472 ? 18.379  76.283 47.100 1.00 45.97  ? 472  TYR A CG  1 
ATOM   3800 C CD1 . TYR A 1 472 ? 19.306  76.445 46.072 1.00 46.52  ? 472  TYR A CD1 1 
ATOM   3801 C CD2 . TYR A 1 472 ? 18.810  76.466 48.413 1.00 45.84  ? 472  TYR A CD2 1 
ATOM   3802 C CE1 . TYR A 1 472 ? 20.630  76.768 46.350 1.00 47.13  ? 472  TYR A CE1 1 
ATOM   3803 C CE2 . TYR A 1 472 ? 20.119  76.788 48.699 1.00 47.56  ? 472  TYR A CE2 1 
ATOM   3804 C CZ  . TYR A 1 472 ? 21.026  76.937 47.668 1.00 48.86  ? 472  TYR A CZ  1 
ATOM   3805 O OH  . TYR A 1 472 ? 22.329  77.253 47.967 1.00 49.86  ? 472  TYR A OH  1 
ATOM   3806 N N   . TRP A 1 473 ? 14.129  75.468 46.080 1.00 41.16  ? 473  TRP A N   1 
ATOM   3807 C CA  . TRP A 1 473 ? 12.943  74.643 45.878 1.00 41.04  ? 473  TRP A CA  1 
ATOM   3808 C C   . TRP A 1 473 ? 12.254  74.965 44.556 1.00 41.80  ? 473  TRP A C   1 
ATOM   3809 O O   . TRP A 1 473 ? 11.922  74.062 43.786 1.00 42.83  ? 473  TRP A O   1 
ATOM   3810 C CB  . TRP A 1 473 ? 11.926  74.856 47.009 1.00 39.18  ? 473  TRP A CB  1 
ATOM   3811 C CG  . TRP A 1 473 ? 12.030  73.926 48.208 1.00 39.11  ? 473  TRP A CG  1 
ATOM   3812 C CD1 . TRP A 1 473 ? 10.985  73.328 48.868 1.00 38.16  ? 473  TRP A CD1 1 
ATOM   3813 C CD2 . TRP A 1 473 ? 13.213  73.567 48.939 1.00 37.70  ? 473  TRP A CD2 1 
ATOM   3814 N NE1 . TRP A 1 473 ? 11.442  72.632 49.957 1.00 38.09  ? 473  TRP A NE1 1 
ATOM   3815 C CE2 . TRP A 1 473 ? 12.804  72.760 50.027 1.00 38.09  ? 473  TRP A CE2 1 
ATOM   3816 C CE3 . TRP A 1 473 ? 14.574  73.850 48.785 1.00 36.66  ? 473  TRP A CE3 1 
ATOM   3817 C CZ2 . TRP A 1 473 ? 13.710  72.237 50.953 1.00 36.09  ? 473  TRP A CZ2 1 
ATOM   3818 C CZ3 . TRP A 1 473 ? 15.473  73.328 49.706 1.00 36.12  ? 473  TRP A CZ3 1 
ATOM   3819 C CH2 . TRP A 1 473 ? 15.036  72.531 50.777 1.00 34.80  ? 473  TRP A CH2 1 
ATOM   3820 N N   . ALA A 1 474 ? 12.041  76.252 44.291 1.00 40.90  ? 474  ALA A N   1 
ATOM   3821 C CA  . ALA A 1 474 ? 11.350  76.656 43.075 1.00 39.58  ? 474  ALA A CA  1 
ATOM   3822 C C   . ALA A 1 474 ? 12.154  76.406 41.813 1.00 39.22  ? 474  ALA A C   1 
ATOM   3823 O O   . ALA A 1 474 ? 11.597  76.009 40.794 1.00 39.92  ? 474  ALA A O   1 
ATOM   3824 C CB  . ALA A 1 474 ? 10.947  78.117 43.163 1.00 40.87  ? 474  ALA A CB  1 
ATOM   3825 N N   . THR A 1 475 ? 13.461  76.637 41.870 1.00 39.90  ? 475  THR A N   1 
ATOM   3826 C CA  . THR A 1 475 ? 14.301  76.413 40.702 1.00 40.53  ? 475  THR A CA  1 
ATOM   3827 C C   . THR A 1 475 ? 14.376  74.922 40.406 1.00 41.94  ? 475  THR A C   1 
ATOM   3828 O O   . THR A 1 475 ? 14.437  74.513 39.245 1.00 42.43  ? 475  THR A O   1 
ATOM   3829 C CB  . THR A 1 475 ? 15.721  76.949 40.921 1.00 41.44  ? 475  THR A CB  1 
ATOM   3830 O OG1 . THR A 1 475 ? 15.659  78.347 41.238 1.00 42.38  ? 475  THR A OG1 1 
ATOM   3831 C CG2 . THR A 1 475 ? 16.562  76.750 39.668 1.00 39.18  ? 475  THR A CG2 1 
ATOM   3832 N N   . PHE A 1 476 ? 14.366  74.113 41.462 1.00 42.37  ? 476  PHE A N   1 
ATOM   3833 C CA  . PHE A 1 476 ? 14.420  72.669 41.308 1.00 42.40  ? 476  PHE A CA  1 
ATOM   3834 C C   . PHE A 1 476 ? 13.123  72.167 40.678 1.00 42.40  ? 476  PHE A C   1 
ATOM   3835 O O   . PHE A 1 476 ? 13.144  71.390 39.726 1.00 42.96  ? 476  PHE A O   1 
ATOM   3836 C CB  . PHE A 1 476 ? 14.625  71.993 42.668 1.00 43.02  ? 476  PHE A CB  1 
ATOM   3837 C CG  . PHE A 1 476 ? 14.415  70.505 42.639 1.00 42.40  ? 476  PHE A CG  1 
ATOM   3838 C CD1 . PHE A 1 476 ? 15.392  69.658 42.134 1.00 43.13  ? 476  PHE A CD1 1 
ATOM   3839 C CD2 . PHE A 1 476 ? 13.216  69.955 43.073 1.00 41.64  ? 476  PHE A CD2 1 
ATOM   3840 C CE1 . PHE A 1 476 ? 15.174  68.286 42.062 1.00 44.65  ? 476  PHE A CE1 1 
ATOM   3841 C CE2 . PHE A 1 476 ? 12.989  68.587 43.003 1.00 41.44  ? 476  PHE A CE2 1 
ATOM   3842 C CZ  . PHE A 1 476 ? 13.968  67.752 42.498 1.00 42.60  ? 476  PHE A CZ  1 
ATOM   3843 N N   . ALA A 1 477 ? 11.992  72.615 41.208 1.00 43.77  ? 477  ALA A N   1 
ATOM   3844 C CA  . ALA A 1 477 ? 10.698  72.188 40.691 1.00 45.02  ? 477  ALA A CA  1 
ATOM   3845 C C   . ALA A 1 477 ? 10.601  72.489 39.205 1.00 47.44  ? 477  ALA A C   1 
ATOM   3846 O O   . ALA A 1 477 ? 10.069  71.690 38.434 1.00 46.34  ? 477  ALA A O   1 
ATOM   3847 C CB  . ALA A 1 477 ? 9.581   72.895 41.433 1.00 43.44  ? 477  ALA A CB  1 
ATOM   3848 N N   . LYS A 1 478 ? 11.143  73.639 38.814 1.00 49.23  ? 478  LYS A N   1 
ATOM   3849 C CA  . LYS A 1 478 ? 11.116  74.095 37.430 1.00 49.92  ? 478  LYS A CA  1 
ATOM   3850 C C   . LYS A 1 478 ? 12.121  73.436 36.492 1.00 49.57  ? 478  LYS A C   1 
ATOM   3851 O O   . LYS A 1 478 ? 11.809  73.179 35.327 1.00 49.17  ? 478  LYS A O   1 
ATOM   3852 C CB  . LYS A 1 478 ? 11.334  75.609 37.387 1.00 52.93  ? 478  LYS A CB  1 
ATOM   3853 C CG  . LYS A 1 478 ? 11.527  76.167 35.984 1.00 57.28  ? 478  LYS A CG  1 
ATOM   3854 C CD  . LYS A 1 478 ? 11.960  77.621 36.028 1.00 61.80  ? 478  LYS A CD  1 
ATOM   3855 C CE  . LYS A 1 478 ? 12.290  78.143 34.636 1.00 65.29  ? 478  LYS A CE  1 
ATOM   3856 N NZ  . LYS A 1 478 ? 12.753  79.563 34.673 1.00 66.17  ? 478  LYS A NZ  1 
ATOM   3857 N N   . THR A 1 479 ? 13.319  73.160 36.994 1.00 47.88  ? 479  THR A N   1 
ATOM   3858 C CA  . THR A 1 479 ? 14.358  72.587 36.155 1.00 45.56  ? 479  THR A CA  1 
ATOM   3859 C C   . THR A 1 479 ? 14.924  71.231 36.539 1.00 46.12  ? 479  THR A C   1 
ATOM   3860 O O   . THR A 1 479 ? 15.575  70.591 35.715 1.00 48.53  ? 479  THR A O   1 
ATOM   3861 C CB  . THR A 1 479 ? 15.538  73.555 36.045 1.00 45.26  ? 479  THR A CB  1 
ATOM   3862 O OG1 . THR A 1 479 ? 16.231  73.618 37.301 1.00 42.73  ? 479  THR A OG1 1 
ATOM   3863 C CG2 . THR A 1 479 ? 15.038  74.940 35.673 1.00 42.13  ? 479  THR A CG2 1 
ATOM   3864 N N   . GLY A 1 480 ? 14.698  70.794 37.774 1.00 45.76  ? 480  GLY A N   1 
ATOM   3865 C CA  . GLY A 1 480 ? 15.227  69.512 38.211 1.00 43.21  ? 480  GLY A CA  1 
ATOM   3866 C C   . GLY A 1 480 ? 16.605  69.699 38.812 1.00 43.69  ? 480  GLY A C   1 
ATOM   3867 O O   . GLY A 1 480 ? 17.314  68.735 39.104 1.00 42.64  ? 480  GLY A O   1 
ATOM   3868 N N   . ASN A 1 481 ? 16.971  70.965 38.992 1.00 42.82  ? 481  ASN A N   1 
ATOM   3869 C CA  . ASN A 1 481 ? 18.260  71.360 39.552 1.00 43.55  ? 481  ASN A CA  1 
ATOM   3870 C C   . ASN A 1 481 ? 17.989  72.616 40.386 1.00 44.90  ? 481  ASN A C   1 
ATOM   3871 O O   . ASN A 1 481 ? 17.404  73.576 39.890 1.00 46.95  ? 481  ASN A O   1 
ATOM   3872 C CB  . ASN A 1 481 ? 19.236  71.698 38.422 1.00 42.80  ? 481  ASN A CB  1 
ATOM   3873 C CG  . ASN A 1 481 ? 20.640  71.965 38.916 1.00 44.91  ? 481  ASN A CG  1 
ATOM   3874 O OD1 . ASN A 1 481 ? 20.842  72.589 39.959 1.00 45.97  ? 481  ASN A OD1 1 
ATOM   3875 N ND2 . ASN A 1 481 ? 21.626  71.507 38.156 1.00 44.78  ? 481  ASN A ND2 1 
ATOM   3876 N N   . PRO A 1 482 ? 18.396  72.625 41.666 1.00 45.85  ? 482  PRO A N   1 
ATOM   3877 C CA  . PRO A 1 482 ? 18.150  73.813 42.490 1.00 46.44  ? 482  PRO A CA  1 
ATOM   3878 C C   . PRO A 1 482 ? 19.023  75.028 42.144 1.00 47.74  ? 482  PRO A C   1 
ATOM   3879 O O   . PRO A 1 482 ? 18.680  76.156 42.490 1.00 46.20  ? 482  PRO A O   1 
ATOM   3880 C CB  . PRO A 1 482 ? 18.405  73.302 43.905 1.00 44.31  ? 482  PRO A CB  1 
ATOM   3881 C CG  . PRO A 1 482 ? 19.500  72.306 43.693 1.00 43.83  ? 482  PRO A CG  1 
ATOM   3882 C CD  . PRO A 1 482 ? 19.027  71.554 42.461 1.00 43.02  ? 482  PRO A CD  1 
ATOM   3883 N N   . ASN A 1 483 ? 20.139  74.793 41.455 1.00 50.16  ? 483  ASN A N   1 
ATOM   3884 C CA  . ASN A 1 483 ? 21.066  75.865 41.081 1.00 53.86  ? 483  ASN A CA  1 
ATOM   3885 C C   . ASN A 1 483 ? 20.694  76.653 39.825 1.00 57.74  ? 483  ASN A C   1 
ATOM   3886 O O   . ASN A 1 483 ? 20.081  76.127 38.895 1.00 56.82  ? 483  ASN A O   1 
ATOM   3887 C CB  . ASN A 1 483 ? 22.476  75.308 40.874 1.00 50.20  ? 483  ASN A CB  1 
ATOM   3888 C CG  . ASN A 1 483 ? 22.933  74.431 42.013 1.00 49.36  ? 483  ASN A CG  1 
ATOM   3889 O OD1 . ASN A 1 483 ? 22.965  73.207 41.889 1.00 48.07  ? 483  ASN A OD1 1 
ATOM   3890 N ND2 . ASN A 1 483 ? 23.290  75.049 43.134 1.00 45.87  ? 483  ASN A ND2 1 
ATOM   3891 N N   . GLU A 1 484 ? 21.082  77.926 39.807 1.00 63.68  ? 484  GLU A N   1 
ATOM   3892 C CA  . GLU A 1 484 ? 20.841  78.788 38.654 1.00 69.04  ? 484  GLU A CA  1 
ATOM   3893 C C   . GLU A 1 484 ? 21.897  78.409 37.623 1.00 72.11  ? 484  GLU A C   1 
ATOM   3894 O O   . GLU A 1 484 ? 23.090  78.421 37.920 1.00 70.71  ? 484  GLU A O   1 
ATOM   3895 C CB  . GLU A 1 484 ? 21.005  80.259 39.040 1.00 70.79  ? 484  GLU A CB  1 
ATOM   3896 C CG  . GLU A 1 484 ? 19.802  80.860 39.737 1.00 73.10  ? 484  GLU A CG  1 
ATOM   3897 C CD  . GLU A 1 484 ? 18.699  81.201 38.764 1.00 74.22  ? 484  GLU A CD  1 
ATOM   3898 O OE1 . GLU A 1 484 ? 18.411  80.367 37.880 1.00 76.72  ? 484  GLU A OE1 1 
ATOM   3899 O OE2 . GLU A 1 484 ? 18.120  82.300 38.885 1.00 75.25  ? 484  GLU A OE2 1 
ATOM   3900 N N   . PRO A 1 485 ? 21.470  78.068 36.397 1.00 76.39  ? 485  PRO A N   1 
ATOM   3901 C CA  . PRO A 1 485 ? 22.364  77.673 35.302 1.00 79.42  ? 485  PRO A CA  1 
ATOM   3902 C C   . PRO A 1 485 ? 23.774  78.266 35.374 1.00 82.06  ? 485  PRO A C   1 
ATOM   3903 O O   . PRO A 1 485 ? 24.714  77.616 35.837 1.00 83.05  ? 485  PRO A O   1 
ATOM   3904 C CB  . PRO A 1 485 ? 21.599  78.128 34.068 1.00 79.27  ? 485  PRO A CB  1 
ATOM   3905 C CG  . PRO A 1 485 ? 20.186  77.824 34.456 1.00 78.65  ? 485  PRO A CG  1 
ATOM   3906 C CD  . PRO A 1 485 ? 20.105  78.316 35.893 1.00 77.49  ? 485  PRO A CD  1 
ATOM   3907 N N   . HIS A 1 486 ? 23.917  79.499 34.907 1.00 84.26  ? 486  HIS A N   1 
ATOM   3908 C CA  . HIS A 1 486 ? 25.207  80.172 34.927 1.00 86.83  ? 486  HIS A CA  1 
ATOM   3909 C C   . HIS A 1 486 ? 25.195  81.188 36.063 1.00 87.36  ? 486  HIS A C   1 
ATOM   3910 O O   . HIS A 1 486 ? 25.173  82.396 35.825 1.00 88.36  ? 486  HIS A O   1 
ATOM   3911 C CB  . HIS A 1 486 ? 25.438  80.883 33.593 1.00 89.17  ? 486  HIS A CB  1 
ATOM   3912 C CG  . HIS A 1 486 ? 25.045  80.066 32.401 1.00 92.75  ? 486  HIS A CG  1 
ATOM   3913 N ND1 . HIS A 1 486 ? 25.620  78.846 32.111 1.00 94.51  ? 486  HIS A ND1 1 
ATOM   3914 C CD2 . HIS A 1 486 ? 24.125  80.287 31.431 1.00 93.87  ? 486  HIS A CD2 1 
ATOM   3915 C CE1 . HIS A 1 486 ? 25.071  78.352 31.015 1.00 94.84  ? 486  HIS A CE1 1 
ATOM   3916 N NE2 . HIS A 1 486 ? 24.161  79.206 30.582 1.00 94.83  ? 486  HIS A NE2 1 
ATOM   3917 N N   . SER A 1 487 ? 25.200  80.693 37.298 1.00 87.32  ? 487  SER A N   1 
ATOM   3918 C CA  . SER A 1 487 ? 25.173  81.563 38.471 1.00 86.51  ? 487  SER A CA  1 
ATOM   3919 C C   . SER A 1 487 ? 26.542  81.740 39.114 1.00 85.76  ? 487  SER A C   1 
ATOM   3920 O O   . SER A 1 487 ? 27.452  80.934 38.915 1.00 85.25  ? 487  SER A O   1 
ATOM   3921 C CB  . SER A 1 487 ? 24.192  81.017 39.513 1.00 87.11  ? 487  SER A CB  1 
ATOM   3922 O OG  . SER A 1 487 ? 24.150  81.844 40.663 1.00 87.62  ? 487  SER A OG  1 
ATOM   3923 N N   . GLN A 1 488 ? 26.671  82.802 39.900 1.00 85.00  ? 488  GLN A N   1 
ATOM   3924 C CA  . GLN A 1 488 ? 27.924  83.105 40.570 1.00 83.99  ? 488  GLN A CA  1 
ATOM   3925 C C   . GLN A 1 488 ? 27.896  82.665 42.032 1.00 81.82  ? 488  GLN A C   1 
ATOM   3926 O O   . GLN A 1 488 ? 28.903  82.758 42.736 1.00 81.20  ? 488  GLN A O   1 
ATOM   3927 C CB  . GLN A 1 488 ? 28.202  84.608 40.488 1.00 86.34  ? 488  GLN A CB  1 
ATOM   3928 C CG  . GLN A 1 488 ? 29.670  84.944 40.309 1.00 89.78  ? 488  GLN A CG  1 
ATOM   3929 C CD  . GLN A 1 488 ? 30.249  84.316 39.053 1.00 91.89  ? 488  GLN A CD  1 
ATOM   3930 O OE1 . GLN A 1 488 ? 29.807  84.607 37.936 1.00 92.20  ? 488  GLN A OE1 1 
ATOM   3931 N NE2 . GLN A 1 488 ? 31.239  83.444 39.230 1.00 92.61  ? 488  GLN A NE2 1 
ATOM   3932 N N   A GLU A 1 489 ? 26.740  82.186 42.482 0.50 80.03  ? 489  GLU A N   1 
ATOM   3933 N N   B GLU A 1 489 ? 26.738  82.186 42.481 0.50 80.68  ? 489  GLU A N   1 
ATOM   3934 C CA  A GLU A 1 489 ? 26.585  81.740 43.861 0.50 77.68  ? 489  GLU A CA  1 
ATOM   3935 C CA  B GLU A 1 489 ? 26.573  81.730 43.857 0.50 78.86  ? 489  GLU A CA  1 
ATOM   3936 C C   A GLU A 1 489 ? 27.095  80.312 44.033 0.50 75.93  ? 489  GLU A C   1 
ATOM   3937 C C   B GLU A 1 489 ? 27.097  80.309 44.032 0.50 76.67  ? 489  GLU A C   1 
ATOM   3938 O O   A GLU A 1 489 ? 27.388  79.624 43.053 0.50 75.22  ? 489  GLU A O   1 
ATOM   3939 O O   B GLU A 1 489 ? 27.397  79.622 43.054 0.50 75.90  ? 489  GLU A O   1 
ATOM   3940 C CB  A GLU A 1 489 ? 25.114  81.825 44.274 0.50 77.28  ? 489  GLU A CB  1 
ATOM   3941 C CB  B GLU A 1 489 ? 25.096  81.782 44.261 0.50 79.81  ? 489  GLU A CB  1 
ATOM   3942 C CG  A GLU A 1 489 ? 24.456  83.158 43.935 0.50 76.90  ? 489  GLU A CG  1 
ATOM   3943 C CG  B GLU A 1 489 ? 24.474  83.165 44.174 0.50 81.64  ? 489  GLU A CG  1 
ATOM   3944 C CD  A GLU A 1 489 ? 25.127  84.346 44.607 0.50 76.62  ? 489  GLU A CD  1 
ATOM   3945 C CD  B GLU A 1 489 ? 23.045  83.196 44.686 0.50 82.94  ? 489  GLU A CD  1 
ATOM   3946 O OE1 A GLU A 1 489 ? 24.730  85.493 44.312 0.50 76.46  ? 489  GLU A OE1 1 
ATOM   3947 O OE1 B GLU A 1 489 ? 22.426  84.282 44.656 0.50 82.68  ? 489  GLU A OE1 1 
ATOM   3948 O OE2 A GLU A 1 489 ? 26.044  84.138 45.431 0.50 75.84  ? 489  GLU A OE2 1 
ATOM   3949 O OE2 B GLU A 1 489 ? 22.542  82.136 45.119 0.50 83.89  ? 489  GLU A OE2 1 
ATOM   3950 N N   . SER A 1 490 ? 27.203  79.875 45.284 1.00 75.16  ? 490  SER A N   1 
ATOM   3951 C CA  . SER A 1 490 ? 27.688  78.532 45.595 1.00 72.26  ? 490  SER A CA  1 
ATOM   3952 C C   . SER A 1 490 ? 26.790  77.468 44.977 1.00 69.09  ? 490  SER A C   1 
ATOM   3953 O O   . SER A 1 490 ? 25.561  77.577 45.014 1.00 68.20  ? 490  SER A O   1 
ATOM   3954 C CB  . SER A 1 490 ? 27.754  78.335 47.110 1.00 72.29  ? 490  SER A CB  1 
ATOM   3955 O OG  . SER A 1 490 ? 28.560  79.332 47.715 1.00 74.45  ? 490  SER A OG  1 
ATOM   3956 N N   . LYS A 1 491 ? 27.408  76.434 44.415 1.00 65.12  ? 491  LYS A N   1 
ATOM   3957 C CA  . LYS A 1 491 ? 26.651  75.370 43.778 1.00 62.44  ? 491  LYS A CA  1 
ATOM   3958 C C   . LYS A 1 491 ? 26.355  74.193 44.696 1.00 58.56  ? 491  LYS A C   1 
ATOM   3959 O O   . LYS A 1 491 ? 27.263  73.630 45.312 1.00 57.74  ? 491  LYS A O   1 
ATOM   3960 C CB  . LYS A 1 491 ? 27.392  74.868 42.539 1.00 65.12  ? 491  LYS A CB  1 
ATOM   3961 C CG  . LYS A 1 491 ? 27.606  75.933 41.480 1.00 69.78  ? 491  LYS A CG  1 
ATOM   3962 C CD  . LYS A 1 491 ? 26.285  76.514 41.000 1.00 72.46  ? 491  LYS A CD  1 
ATOM   3963 C CE  . LYS A 1 491 ? 26.512  77.643 40.006 1.00 75.30  ? 491  LYS A CE  1 
ATOM   3964 N NZ  . LYS A 1 491 ? 25.232  78.161 39.446 1.00 76.39  ? 491  LYS A NZ  1 
ATOM   3965 N N   . TRP A 1 492 ? 25.074  73.839 44.778 1.00 52.91  ? 492  TRP A N   1 
ATOM   3966 C CA  . TRP A 1 492 ? 24.608  72.710 45.570 1.00 47.64  ? 492  TRP A CA  1 
ATOM   3967 C C   . TRP A 1 492 ? 24.973  71.506 44.709 1.00 46.74  ? 492  TRP A C   1 
ATOM   3968 O O   . TRP A 1 492 ? 24.334  71.247 43.688 1.00 47.05  ? 492  TRP A O   1 
ATOM   3969 C CB  . TRP A 1 492 ? 23.092  72.797 45.735 1.00 46.84  ? 492  TRP A CB  1 
ATOM   3970 C CG  . TRP A 1 492 ? 22.469  71.749 46.619 1.00 44.65  ? 492  TRP A CG  1 
ATOM   3971 C CD1 . TRP A 1 492 ? 22.973  70.513 46.921 1.00 43.27  ? 492  TRP A CD1 1 
ATOM   3972 C CD2 . TRP A 1 492 ? 21.187  71.824 47.254 1.00 42.62  ? 492  TRP A CD2 1 
ATOM   3973 N NE1 . TRP A 1 492 ? 22.083  69.817 47.700 1.00 43.70  ? 492  TRP A NE1 1 
ATOM   3974 C CE2 . TRP A 1 492 ? 20.977  70.597 47.921 1.00 43.37  ? 492  TRP A CE2 1 
ATOM   3975 C CE3 . TRP A 1 492 ? 20.191  72.810 47.322 1.00 41.22  ? 492  TRP A CE3 1 
ATOM   3976 C CZ2 . TRP A 1 492 ? 19.810  70.328 48.651 1.00 42.03  ? 492  TRP A CZ2 1 
ATOM   3977 C CZ3 . TRP A 1 492 ? 19.029  72.542 48.048 1.00 41.43  ? 492  TRP A CZ3 1 
ATOM   3978 C CH2 . TRP A 1 492 ? 18.850  71.309 48.702 1.00 40.28  ? 492  TRP A CH2 1 
ATOM   3979 N N   . PRO A 1 493 ? 26.009  70.752 45.105 1.00 44.75  ? 493  PRO A N   1 
ATOM   3980 C CA  . PRO A 1 493 ? 26.396  69.597 44.302 1.00 43.01  ? 493  PRO A CA  1 
ATOM   3981 C C   . PRO A 1 493 ? 25.351  68.494 44.278 1.00 43.88  ? 493  PRO A C   1 
ATOM   3982 O O   . PRO A 1 493 ? 24.551  68.350 45.202 1.00 45.12  ? 493  PRO A O   1 
ATOM   3983 C CB  . PRO A 1 493 ? 27.699  69.155 44.951 1.00 42.27  ? 493  PRO A CB  1 
ATOM   3984 C CG  . PRO A 1 493 ? 27.462  69.467 46.385 1.00 45.25  ? 493  PRO A CG  1 
ATOM   3985 C CD  . PRO A 1 493 ? 26.824  70.836 46.330 1.00 43.64  ? 493  PRO A CD  1 
ATOM   3986 N N   . LEU A 1 494 ? 25.368  67.727 43.196 1.00 44.34  ? 494  LEU A N   1 
ATOM   3987 C CA  . LEU A 1 494 ? 24.458  66.612 42.996 1.00 44.96  ? 494  LEU A CA  1 
ATOM   3988 C C   . LEU A 1 494 ? 24.914  65.463 43.903 1.00 45.76  ? 494  LEU A C   1 
ATOM   3989 O O   . LEU A 1 494 ? 26.117  65.230 44.064 1.00 45.89  ? 494  LEU A O   1 
ATOM   3990 C CB  . LEU A 1 494 ? 24.523  66.194 41.524 1.00 44.47  ? 494  LEU A CB  1 
ATOM   3991 C CG  . LEU A 1 494 ? 23.570  65.183 40.890 1.00 45.80  ? 494  LEU A CG  1 
ATOM   3992 C CD1 . LEU A 1 494 ? 22.140  65.687 40.909 1.00 41.54  ? 494  LEU A CD1 1 
ATOM   3993 C CD2 . LEU A 1 494 ? 24.014  64.962 39.454 1.00 47.08  ? 494  LEU A CD2 1 
ATOM   3994 N N   . PHE A 1 495 ? 23.959  64.767 44.513 1.00 45.51  ? 495  PHE A N   1 
ATOM   3995 C CA  . PHE A 1 495 ? 24.278  63.638 45.379 1.00 42.66  ? 495  PHE A CA  1 
ATOM   3996 C C   . PHE A 1 495 ? 24.483  62.429 44.492 1.00 43.54  ? 495  PHE A C   1 
ATOM   3997 O O   . PHE A 1 495 ? 23.619  62.089 43.685 1.00 43.67  ? 495  PHE A O   1 
ATOM   3998 C CB  . PHE A 1 495 ? 23.136  63.366 46.360 1.00 40.87  ? 495  PHE A CB  1 
ATOM   3999 C CG  . PHE A 1 495 ? 23.306  62.096 47.162 1.00 38.52  ? 495  PHE A CG  1 
ATOM   4000 C CD1 . PHE A 1 495 ? 23.023  60.851 46.596 1.00 36.45  ? 495  PHE A CD1 1 
ATOM   4001 C CD2 . PHE A 1 495 ? 23.751  62.144 48.481 1.00 37.46  ? 495  PHE A CD2 1 
ATOM   4002 C CE1 . PHE A 1 495 ? 23.181  59.672 47.332 1.00 34.57  ? 495  PHE A CE1 1 
ATOM   4003 C CE2 . PHE A 1 495 ? 23.914  60.968 49.230 1.00 38.02  ? 495  PHE A CE2 1 
ATOM   4004 C CZ  . PHE A 1 495 ? 23.626  59.729 48.651 1.00 35.70  ? 495  PHE A CZ  1 
ATOM   4005 N N   . THR A 1 496 ? 25.628  61.778 44.641 1.00 44.42  ? 496  THR A N   1 
ATOM   4006 C CA  . THR A 1 496 ? 25.934  60.606 43.836 1.00 45.12  ? 496  THR A CA  1 
ATOM   4007 C C   . THR A 1 496 ? 26.237  59.404 44.715 1.00 46.15  ? 496  THR A C   1 
ATOM   4008 O O   . THR A 1 496 ? 26.603  59.546 45.879 1.00 45.91  ? 496  THR A O   1 
ATOM   4009 C CB  . THR A 1 496 ? 27.152  60.858 42.927 1.00 44.81  ? 496  THR A CB  1 
ATOM   4010 O OG1 . THR A 1 496 ? 28.314  61.103 43.734 1.00 45.03  ? 496  THR A OG1 1 
ATOM   4011 C CG2 . THR A 1 496 ? 26.899  62.053 42.020 1.00 41.90  ? 496  THR A CG2 1 
ATOM   4012 N N   . THR A 1 497 ? 26.080  58.218 44.142 1.00 48.05  ? 497  THR A N   1 
ATOM   4013 C CA  . THR A 1 497 ? 26.355  56.981 44.854 1.00 49.71  ? 497  THR A CA  1 
ATOM   4014 C C   . THR A 1 497 ? 27.811  56.976 45.329 1.00 51.30  ? 497  THR A C   1 
ATOM   4015 O O   . THR A 1 497 ? 28.124  56.524 46.434 1.00 51.86  ? 497  THR A O   1 
ATOM   4016 C CB  . THR A 1 497 ? 26.137  55.763 43.929 1.00 50.15  ? 497  THR A CB  1 
ATOM   4017 O OG1 . THR A 1 497 ? 24.773  55.726 43.487 1.00 50.52  ? 497  THR A OG1 1 
ATOM   4018 C CG2 . THR A 1 497 ? 26.464  54.482 44.660 1.00 51.02  ? 497  THR A CG2 1 
ATOM   4019 N N   . LYS A 1 498 ? 28.696  57.499 44.487 1.00 51.49  ? 498  LYS A N   1 
ATOM   4020 C CA  . LYS A 1 498 ? 30.117  57.534 44.794 1.00 52.58  ? 498  LYS A CA  1 
ATOM   4021 C C   . LYS A 1 498 ? 30.493  58.558 45.863 1.00 51.61  ? 498  LYS A C   1 
ATOM   4022 O O   . LYS A 1 498 ? 30.921  58.192 46.955 1.00 51.60  ? 498  LYS A O   1 
ATOM   4023 C CB  . LYS A 1 498 ? 30.906  57.811 43.513 1.00 55.45  ? 498  LYS A CB  1 
ATOM   4024 C CG  . LYS A 1 498 ? 32.403  57.558 43.625 1.00 60.51  ? 498  LYS A CG  1 
ATOM   4025 C CD  . LYS A 1 498 ? 33.126  57.997 42.353 1.00 64.10  ? 498  LYS A CD  1 
ATOM   4026 C CE  . LYS A 1 498 ? 34.633  57.798 42.467 1.00 65.23  ? 498  LYS A CE  1 
ATOM   4027 N NZ  . LYS A 1 498 ? 35.348  58.362 41.284 1.00 67.13  ? 498  LYS A NZ  1 
ATOM   4028 N N   . GLU A 1 499 ? 30.324  59.838 45.548 1.00 51.94  ? 499  GLU A N   1 
ATOM   4029 C CA  . GLU A 1 499 ? 30.679  60.920 46.465 1.00 51.66  ? 499  GLU A CA  1 
ATOM   4030 C C   . GLU A 1 499 ? 29.704  61.136 47.621 1.00 48.61  ? 499  GLU A C   1 
ATOM   4031 O O   . GLU A 1 499 ? 30.119  61.486 48.726 1.00 45.79  ? 499  GLU A O   1 
ATOM   4032 C CB  . GLU A 1 499 ? 30.837  62.221 45.680 1.00 56.94  ? 499  GLU A CB  1 
ATOM   4033 C CG  . GLU A 1 499 ? 31.592  62.059 44.369 1.00 63.55  ? 499  GLU A CG  1 
ATOM   4034 C CD  . GLU A 1 499 ? 33.004  61.539 44.553 1.00 67.98  ? 499  GLU A CD  1 
ATOM   4035 O OE1 . GLU A 1 499 ? 33.852  62.278 45.099 1.00 71.30  ? 499  GLU A OE1 1 
ATOM   4036 O OE2 . GLU A 1 499 ? 33.265  60.387 44.151 1.00 70.76  ? 499  GLU A OE2 1 
ATOM   4037 N N   . GLN A 1 500 ? 28.414  60.943 47.363 1.00 46.76  ? 500  GLN A N   1 
ATOM   4038 C CA  . GLN A 1 500 ? 27.388  61.102 48.397 1.00 44.98  ? 500  GLN A CA  1 
ATOM   4039 C C   . GLN A 1 500 ? 27.433  62.463 49.091 1.00 43.54  ? 500  GLN A C   1 
ATOM   4040 O O   . GLN A 1 500 ? 27.359  62.549 50.316 1.00 41.14  ? 500  GLN A O   1 
ATOM   4041 C CB  . GLN A 1 500 ? 27.539  59.991 49.437 1.00 43.76  ? 500  GLN A CB  1 
ATOM   4042 C CG  . GLN A 1 500 ? 27.231  58.612 48.893 1.00 45.60  ? 500  GLN A CG  1 
ATOM   4043 C CD  . GLN A 1 500 ? 27.588  57.518 49.870 1.00 47.52  ? 500  GLN A CD  1 
ATOM   4044 O OE1 . GLN A 1 500 ? 27.200  57.562 51.033 1.00 48.87  ? 500  GLN A OE1 1 
ATOM   4045 N NE2 . GLN A 1 500 ? 28.335  56.525 49.402 1.00 49.48  ? 500  GLN A NE2 1 
ATOM   4046 N N   . LYS A 1 501 ? 27.537  63.525 48.302 1.00 43.11  ? 501  LYS A N   1 
ATOM   4047 C CA  . LYS A 1 501 ? 27.616  64.875 48.850 1.00 42.98  ? 501  LYS A CA  1 
ATOM   4048 C C   . LYS A 1 501 ? 26.279  65.505 49.237 1.00 41.00  ? 501  LYS A C   1 
ATOM   4049 O O   . LYS A 1 501 ? 25.229  65.174 48.684 1.00 41.45  ? 501  LYS A O   1 
ATOM   4050 C CB  . LYS A 1 501 ? 28.309  65.798 47.849 1.00 45.78  ? 501  LYS A CB  1 
ATOM   4051 C CG  . LYS A 1 501 ? 29.692  65.357 47.428 1.00 47.75  ? 501  LYS A CG  1 
ATOM   4052 C CD  . LYS A 1 501 ? 30.252  66.328 46.399 1.00 51.23  ? 501  LYS A CD  1 
ATOM   4053 C CE  . LYS A 1 501 ? 31.709  66.035 46.067 1.00 53.30  ? 501  LYS A CE  1 
ATOM   4054 N NZ  . LYS A 1 501 ? 32.236  66.990 45.049 1.00 53.96  ? 501  LYS A NZ  1 
ATOM   4055 N N   . PHE A 1 502 ? 26.336  66.416 50.201 1.00 37.68  ? 502  PHE A N   1 
ATOM   4056 C CA  . PHE A 1 502 ? 25.160  67.152 50.644 1.00 36.79  ? 502  PHE A CA  1 
ATOM   4057 C C   . PHE A 1 502 ? 25.632  68.508 51.165 1.00 38.62  ? 502  PHE A C   1 
ATOM   4058 O O   . PHE A 1 502 ? 26.838  68.743 51.301 1.00 39.56  ? 502  PHE A O   1 
ATOM   4059 C CB  . PHE A 1 502 ? 24.393  66.393 51.740 1.00 35.75  ? 502  PHE A CB  1 
ATOM   4060 C CG  . PHE A 1 502 ? 25.109  66.313 53.070 1.00 32.32  ? 502  PHE A CG  1 
ATOM   4061 C CD1 . PHE A 1 502 ? 26.035  65.305 53.324 1.00 31.70  ? 502  PHE A CD1 1 
ATOM   4062 C CD2 . PHE A 1 502 ? 24.819  67.223 54.085 1.00 32.18  ? 502  PHE A CD2 1 
ATOM   4063 C CE1 . PHE A 1 502 ? 26.661  65.199 54.571 1.00 29.39  ? 502  PHE A CE1 1 
ATOM   4064 C CE2 . PHE A 1 502 ? 25.439  67.128 55.334 1.00 32.44  ? 502  PHE A CE2 1 
ATOM   4065 C CZ  . PHE A 1 502 ? 26.362  66.110 55.576 1.00 31.31  ? 502  PHE A CZ  1 
ATOM   4066 N N   . ILE A 1 503 ? 24.694  69.405 51.441 1.00 37.97  ? 503  ILE A N   1 
ATOM   4067 C CA  . ILE A 1 503 ? 25.060  70.719 51.944 1.00 39.49  ? 503  ILE A CA  1 
ATOM   4068 C C   . ILE A 1 503 ? 24.296  71.024 53.213 1.00 40.70  ? 503  ILE A C   1 
ATOM   4069 O O   . ILE A 1 503 ? 23.261  70.422 53.488 1.00 40.66  ? 503  ILE A O   1 
ATOM   4070 C CB  . ILE A 1 503 ? 24.731  71.856 50.935 1.00 38.96  ? 503  ILE A CB  1 
ATOM   4071 C CG1 . ILE A 1 503 ? 23.216  71.951 50.731 1.00 38.48  ? 503  ILE A CG1 1 
ATOM   4072 C CG2 . ILE A 1 503 ? 25.440  71.618 49.614 1.00 37.21  ? 503  ILE A CG2 1 
ATOM   4073 C CD1 . ILE A 1 503 ? 22.772  73.168 49.950 1.00 36.24  ? 503  ILE A CD1 1 
ATOM   4074 N N   . ASP A 1 504 ? 24.825  71.965 53.983 1.00 43.94  ? 504  ASP A N   1 
ATOM   4075 C CA  . ASP A 1 504 ? 24.182  72.410 55.207 1.00 46.40  ? 504  ASP A CA  1 
ATOM   4076 C C   . ASP A 1 504 ? 23.281  73.550 54.754 1.00 46.59  ? 504  ASP A C   1 
ATOM   4077 O O   . ASP A 1 504 ? 23.616  74.264 53.812 1.00 46.45  ? 504  ASP A O   1 
ATOM   4078 C CB  . ASP A 1 504 ? 25.212  72.971 56.189 1.00 50.31  ? 504  ASP A CB  1 
ATOM   4079 C CG  . ASP A 1 504 ? 26.131  71.911 56.753 1.00 54.91  ? 504  ASP A CG  1 
ATOM   4080 O OD1 . ASP A 1 504 ? 27.189  72.283 57.306 1.00 56.25  ? 504  ASP A OD1 1 
ATOM   4081 O OD2 . ASP A 1 504 ? 25.797  70.712 56.658 1.00 59.17  ? 504  ASP A OD2 1 
ATOM   4082 N N   . LEU A 1 505 ? 22.132  73.706 55.398 1.00 46.28  ? 505  LEU A N   1 
ATOM   4083 C CA  . LEU A 1 505 ? 21.235  74.799 55.063 1.00 46.90  ? 505  LEU A CA  1 
ATOM   4084 C C   . LEU A 1 505 ? 21.090  75.647 56.305 1.00 48.15  ? 505  LEU A C   1 
ATOM   4085 O O   . LEU A 1 505 ? 20.311  75.324 57.196 1.00 49.68  ? 505  LEU A O   1 
ATOM   4086 C CB  . LEU A 1 505 ? 19.859  74.292 54.633 1.00 46.42  ? 505  LEU A CB  1 
ATOM   4087 C CG  . LEU A 1 505 ? 19.639  73.997 53.154 1.00 44.94  ? 505  LEU A CG  1 
ATOM   4088 C CD1 . LEU A 1 505 ? 18.207  73.535 52.948 1.00 45.97  ? 505  LEU A CD1 1 
ATOM   4089 C CD2 . LEU A 1 505 ? 19.918  75.241 52.333 1.00 43.54  ? 505  LEU A CD2 1 
ATOM   4090 N N   . ASN A 1 506 ? 21.858  76.725 56.369 1.00 49.03  ? 506  ASN A N   1 
ATOM   4091 C CA  . ASN A 1 506 ? 21.809  77.621 57.513 1.00 49.80  ? 506  ASN A CA  1 
ATOM   4092 C C   . ASN A 1 506 ? 22.168  79.022 57.045 1.00 49.75  ? 506  ASN A C   1 
ATOM   4093 O O   . ASN A 1 506 ? 22.173  79.297 55.850 1.00 50.38  ? 506  ASN A O   1 
ATOM   4094 C CB  . ASN A 1 506 ? 22.784  77.155 58.587 1.00 48.06  ? 506  ASN A CB  1 
ATOM   4095 C CG  . ASN A 1 506 ? 24.163  76.928 58.038 1.00 49.26  ? 506  ASN A CG  1 
ATOM   4096 O OD1 . ASN A 1 506 ? 24.689  77.770 57.312 1.00 49.06  ? 506  ASN A OD1 1 
ATOM   4097 N ND2 . ASN A 1 506 ? 24.765  75.788 58.376 1.00 48.79  ? 506  ASN A ND2 1 
ATOM   4098 N N   . THR A 1 507 ? 22.487  79.904 57.980 1.00 50.74  ? 507  THR A N   1 
ATOM   4099 C CA  . THR A 1 507 ? 22.801  81.273 57.615 1.00 52.11  ? 507  THR A CA  1 
ATOM   4100 C C   . THR A 1 507 ? 24.260  81.538 57.249 1.00 53.73  ? 507  THR A C   1 
ATOM   4101 O O   . THR A 1 507 ? 24.586  82.616 56.760 1.00 55.78  ? 507  THR A O   1 
ATOM   4102 C CB  . THR A 1 507 ? 22.359  82.235 58.731 1.00 51.46  ? 507  THR A CB  1 
ATOM   4103 O OG1 . THR A 1 507 ? 22.904  81.797 59.980 1.00 52.30  ? 507  THR A OG1 1 
ATOM   4104 C CG2 . THR A 1 507 ? 20.836  82.265 58.836 1.00 48.78  ? 507  THR A CG2 1 
ATOM   4105 N N   . GLU A 1 508 ? 25.135  80.563 57.473 1.00 55.16  ? 508  GLU A N   1 
ATOM   4106 C CA  . GLU A 1 508 ? 26.552  80.722 57.146 1.00 56.99  ? 508  GLU A CA  1 
ATOM   4107 C C   . GLU A 1 508 ? 26.776  80.415 55.670 1.00 57.89  ? 508  GLU A C   1 
ATOM   4108 O O   . GLU A 1 508 ? 25.879  79.928 54.987 1.00 57.77  ? 508  GLU A O   1 
ATOM   4109 C CB  . GLU A 1 508 ? 27.409  79.765 57.979 1.00 59.50  ? 508  GLU A CB  1 
ATOM   4110 C CG  . GLU A 1 508 ? 27.523  80.106 59.449 1.00 64.30  ? 508  GLU A CG  1 
ATOM   4111 C CD  . GLU A 1 508 ? 26.181  80.198 60.129 1.00 68.67  ? 508  GLU A CD  1 
ATOM   4112 O OE1 . GLU A 1 508 ? 25.490  81.224 59.946 1.00 70.26  ? 508  GLU A OE1 1 
ATOM   4113 O OE2 . GLU A 1 508 ? 25.813  79.235 60.838 1.00 72.92  ? 508  GLU A OE2 1 
ATOM   4114 N N   . PRO A 1 509 ? 27.979  80.707 55.152 1.00 59.70  ? 509  PRO A N   1 
ATOM   4115 C CA  . PRO A 1 509 ? 28.228  80.415 53.737 1.00 60.03  ? 509  PRO A CA  1 
ATOM   4116 C C   . PRO A 1 509 ? 28.204  78.902 53.504 1.00 60.74  ? 509  PRO A C   1 
ATOM   4117 O O   . PRO A 1 509 ? 28.716  78.132 54.319 1.00 59.90  ? 509  PRO A O   1 
ATOM   4118 C CB  . PRO A 1 509 ? 29.601  81.038 53.491 1.00 58.90  ? 509  PRO A CB  1 
ATOM   4119 C CG  . PRO A 1 509 ? 30.253  80.957 54.842 1.00 59.62  ? 509  PRO A CG  1 
ATOM   4120 C CD  . PRO A 1 509 ? 29.138  81.380 55.761 1.00 59.17  ? 509  PRO A CD  1 
ATOM   4121 N N   . MET A 1 510 ? 27.603  78.487 52.394 1.00 61.40  ? 510  MET A N   1 
ATOM   4122 C CA  . MET A 1 510 ? 27.480  77.074 52.059 1.00 62.20  ? 510  MET A CA  1 
ATOM   4123 C C   . MET A 1 510 ? 28.731  76.235 52.292 1.00 62.56  ? 510  MET A C   1 
ATOM   4124 O O   . MET A 1 510 ? 29.856  76.683 52.071 1.00 63.67  ? 510  MET A O   1 
ATOM   4125 C CB  . MET A 1 510 ? 27.047  76.911 50.600 1.00 63.55  ? 510  MET A CB  1 
ATOM   4126 C CG  . MET A 1 510 ? 26.772  75.461 50.202 1.00 64.57  ? 510  MET A CG  1 
ATOM   4127 S SD  . MET A 1 510 ? 26.509  75.216 48.426 1.00 65.24  ? 510  MET A SD  1 
ATOM   4128 C CE  . MET A 1 510 ? 24.862  75.841 48.248 1.00 62.39  ? 510  MET A CE  1 
ATOM   4129 N N   . LYS A 1 511 ? 28.506  75.005 52.742 1.00 62.02  ? 511  LYS A N   1 
ATOM   4130 C CA  . LYS A 1 511 ? 29.569  74.043 52.996 1.00 60.24  ? 511  LYS A CA  1 
ATOM   4131 C C   . LYS A 1 511 ? 29.104  72.690 52.479 1.00 58.24  ? 511  LYS A C   1 
ATOM   4132 O O   . LYS A 1 511 ? 27.965  72.286 52.717 1.00 58.67  ? 511  LYS A O   1 
ATOM   4133 C CB  . LYS A 1 511 ? 29.859  73.917 54.493 1.00 61.82  ? 511  LYS A CB  1 
ATOM   4134 C CG  . LYS A 1 511 ? 30.872  74.896 55.041 1.00 66.82  ? 511  LYS A CG  1 
ATOM   4135 C CD  . LYS A 1 511 ? 31.424  74.397 56.374 1.00 69.47  ? 511  LYS A CD  1 
ATOM   4136 C CE  . LYS A 1 511 ? 32.588  75.254 56.853 1.00 71.35  ? 511  LYS A CE  1 
ATOM   4137 N NZ  . LYS A 1 511 ? 33.267  74.679 58.053 1.00 73.25  ? 511  LYS A NZ  1 
ATOM   4138 N N   . VAL A 1 512 ? 29.979  71.993 51.769 1.00 54.72  ? 512  VAL A N   1 
ATOM   4139 C CA  . VAL A 1 512 ? 29.639  70.683 51.254 1.00 52.63  ? 512  VAL A CA  1 
ATOM   4140 C C   . VAL A 1 512 ? 30.270  69.606 52.137 1.00 53.06  ? 512  VAL A C   1 
ATOM   4141 O O   . VAL A 1 512 ? 31.419  69.739 52.572 1.00 52.33  ? 512  VAL A O   1 
ATOM   4142 C CB  . VAL A 1 512 ? 30.123  70.525 49.797 1.00 53.11  ? 512  VAL A CB  1 
ATOM   4143 C CG1 . VAL A 1 512 ? 29.940  69.083 49.331 1.00 50.05  ? 512  VAL A CG1 1 
ATOM   4144 C CG2 . VAL A 1 512 ? 29.341  71.471 48.897 1.00 48.96  ? 512  VAL A CG2 1 
ATOM   4145 N N   . HIS A 1 513 ? 29.499  68.555 52.415 1.00 51.41  ? 513  HIS A N   1 
ATOM   4146 C CA  . HIS A 1 513 ? 29.966  67.441 53.232 1.00 48.76  ? 513  HIS A CA  1 
ATOM   4147 C C   . HIS A 1 513 ? 29.645  66.160 52.482 1.00 47.54  ? 513  HIS A C   1 
ATOM   4148 O O   . HIS A 1 513 ? 29.075  66.199 51.392 1.00 47.99  ? 513  HIS A O   1 
ATOM   4149 C CB  . HIS A 1 513 ? 29.239  67.412 54.579 1.00 48.74  ? 513  HIS A CB  1 
ATOM   4150 C CG  . HIS A 1 513 ? 29.273  68.709 55.323 1.00 49.71  ? 513  HIS A CG  1 
ATOM   4151 N ND1 . HIS A 1 513 ? 30.423  69.217 55.887 1.00 50.05  ? 513  HIS A ND1 1 
ATOM   4152 C CD2 . HIS A 1 513 ? 28.290  69.595 55.609 1.00 49.70  ? 513  HIS A CD2 1 
ATOM   4153 C CE1 . HIS A 1 513 ? 30.147  70.359 56.490 1.00 50.40  ? 513  HIS A CE1 1 
ATOM   4154 N NE2 . HIS A 1 513 ? 28.859  70.612 56.337 1.00 48.63  ? 513  HIS A NE2 1 
ATOM   4155 N N   . GLN A 1 514 ? 29.992  65.024 53.076 1.00 47.22  ? 514  GLN A N   1 
ATOM   4156 C CA  . GLN A 1 514 ? 29.718  63.734 52.460 1.00 46.26  ? 514  GLN A CA  1 
ATOM   4157 C C   . GLN A 1 514 ? 29.325  62.717 53.524 1.00 45.56  ? 514  GLN A C   1 
ATOM   4158 O O   . GLN A 1 514 ? 29.636  62.889 54.706 1.00 44.01  ? 514  GLN A O   1 
ATOM   4159 C CB  . GLN A 1 514 ? 30.951  63.227 51.713 1.00 47.55  ? 514  GLN A CB  1 
ATOM   4160 C CG  . GLN A 1 514 ? 31.529  64.225 50.731 1.00 51.01  ? 514  GLN A CG  1 
ATOM   4161 C CD  . GLN A 1 514 ? 32.789  63.715 50.064 1.00 52.27  ? 514  GLN A CD  1 
ATOM   4162 O OE1 . GLN A 1 514 ? 32.737  62.883 49.159 1.00 53.07  ? 514  GLN A OE1 1 
ATOM   4163 N NE2 . GLN A 1 514 ? 33.936  64.208 50.519 1.00 54.47  ? 514  GLN A NE2 1 
ATOM   4164 N N   . ARG A 1 515 ? 28.632  61.664 53.094 1.00 44.60  ? 515  ARG A N   1 
ATOM   4165 C CA  . ARG A 1 515 ? 28.207  60.592 53.987 1.00 43.49  ? 515  ARG A CA  1 
ATOM   4166 C C   . ARG A 1 515 ? 27.427  61.117 55.190 1.00 41.77  ? 515  ARG A C   1 
ATOM   4167 O O   . ARG A 1 515 ? 27.859  60.957 56.335 1.00 39.52  ? 515  ARG A O   1 
ATOM   4168 C CB  . ARG A 1 515 ? 29.433  59.830 54.486 1.00 46.61  ? 515  ARG A CB  1 
ATOM   4169 C CG  . ARG A 1 515 ? 30.384  59.348 53.403 1.00 49.70  ? 515  ARG A CG  1 
ATOM   4170 C CD  . ARG A 1 515 ? 29.876  58.094 52.754 1.00 54.75  ? 515  ARG A CD  1 
ATOM   4171 N NE  . ARG A 1 515 ? 30.969  57.233 52.308 1.00 60.58  ? 515  ARG A NE  1 
ATOM   4172 C CZ  . ARG A 1 515 ? 31.713  57.455 51.229 1.00 64.16  ? 515  ARG A CZ  1 
ATOM   4173 N NH1 . ARG A 1 515 ? 31.492  58.523 50.466 1.00 64.51  ? 515  ARG A NH1 1 
ATOM   4174 N NH2 . ARG A 1 515 ? 32.672  56.596 50.901 1.00 64.30  ? 515  ARG A NH2 1 
ATOM   4175 N N   . LEU A 1 516 ? 26.281  61.738 54.933 1.00 39.93  ? 516  LEU A N   1 
ATOM   4176 C CA  . LEU A 1 516 ? 25.457  62.279 56.005 1.00 39.82  ? 516  LEU A CA  1 
ATOM   4177 C C   . LEU A 1 516 ? 25.072  61.226 57.040 1.00 40.22  ? 516  LEU A C   1 
ATOM   4178 O O   . LEU A 1 516 ? 24.342  60.284 56.736 1.00 40.52  ? 516  LEU A O   1 
ATOM   4179 C CB  . LEU A 1 516 ? 24.193  62.926 55.421 1.00 39.64  ? 516  LEU A CB  1 
ATOM   4180 C CG  . LEU A 1 516 ? 23.052  63.323 56.368 1.00 38.59  ? 516  LEU A CG  1 
ATOM   4181 C CD1 . LEU A 1 516 ? 23.578  63.855 57.671 1.00 39.55  ? 516  LEU A CD1 1 
ATOM   4182 C CD2 . LEU A 1 516 ? 22.212  64.374 55.696 1.00 39.57  ? 516  LEU A CD2 1 
ATOM   4183 N N   . ARG A 1 517 ? 25.587  61.397 58.258 1.00 40.48  ? 517  ARG A N   1 
ATOM   4184 C CA  . ARG A 1 517 ? 25.312  60.509 59.392 1.00 40.67  ? 517  ARG A CA  1 
ATOM   4185 C C   . ARG A 1 517 ? 25.578  59.040 59.080 1.00 40.31  ? 517  ARG A C   1 
ATOM   4186 O O   . ARG A 1 517 ? 24.871  58.161 59.568 1.00 42.10  ? 517  ARG A O   1 
ATOM   4187 C CB  . ARG A 1 517 ? 23.853  60.678 59.826 1.00 40.68  ? 517  ARG A CB  1 
ATOM   4188 C CG  . ARG A 1 517 ? 23.620  60.716 61.334 1.00 42.76  ? 517  ARG A CG  1 
ATOM   4189 C CD  . ARG A 1 517 ? 23.559  62.145 61.879 1.00 43.41  ? 517  ARG A CD  1 
ATOM   4190 N NE  . ARG A 1 517 ? 23.187  62.148 63.294 1.00 47.44  ? 517  ARG A NE  1 
ATOM   4191 C CZ  . ARG A 1 517 ? 23.940  61.647 64.271 1.00 50.68  ? 517  ARG A CZ  1 
ATOM   4192 N NH1 . ARG A 1 517 ? 23.525  61.678 65.532 1.00 50.73  ? 517  ARG A NH1 1 
ATOM   4193 N NH2 . ARG A 1 517 ? 25.123  61.123 63.993 1.00 56.71  ? 517  ARG A NH2 1 
ATOM   4194 N N   . VAL A 1 518 ? 26.606  58.777 58.282 1.00 38.62  ? 518  VAL A N   1 
ATOM   4195 C CA  . VAL A 1 518 ? 26.940  57.417 57.870 1.00 37.44  ? 518  VAL A CA  1 
ATOM   4196 C C   . VAL A 1 518 ? 27.214  56.415 59.003 1.00 38.20  ? 518  VAL A C   1 
ATOM   4197 O O   . VAL A 1 518 ? 26.702  55.298 58.981 1.00 37.58  ? 518  VAL A O   1 
ATOM   4198 C CB  . VAL A 1 518 ? 28.145  57.432 56.880 1.00 37.32  ? 518  VAL A CB  1 
ATOM   4199 C CG1 . VAL A 1 518 ? 29.399  57.926 57.582 1.00 34.63  ? 518  VAL A CG1 1 
ATOM   4200 C CG2 . VAL A 1 518 ? 28.360  56.057 56.288 1.00 32.82  ? 518  VAL A CG2 1 
ATOM   4201 N N   . GLN A 1 519 ? 28.005  56.811 59.994 1.00 39.78  ? 519  GLN A N   1 
ATOM   4202 C CA  . GLN A 1 519 ? 28.338  55.921 61.110 1.00 39.30  ? 519  GLN A CA  1 
ATOM   4203 C C   . GLN A 1 519 ? 27.087  55.362 61.798 1.00 39.69  ? 519  GLN A C   1 
ATOM   4204 O O   . GLN A 1 519 ? 26.900  54.145 61.885 1.00 39.42  ? 519  GLN A O   1 
ATOM   4205 C CB  . GLN A 1 519 ? 29.192  56.669 62.135 1.00 37.40  ? 519  GLN A CB  1 
ATOM   4206 C CG  . GLN A 1 519 ? 30.001  55.777 63.075 1.00 41.38  ? 519  GLN A CG  1 
ATOM   4207 C CD  . GLN A 1 519 ? 31.062  54.943 62.351 1.00 42.48  ? 519  GLN A CD  1 
ATOM   4208 O OE1 . GLN A 1 519 ? 31.738  55.429 61.447 1.00 42.11  ? 519  GLN A OE1 1 
ATOM   4209 N NE2 . GLN A 1 519 ? 31.216  53.687 62.763 1.00 42.98  ? 519  GLN A NE2 1 
ATOM   4210 N N   . MET A 1 520 ? 26.231  56.256 62.280 1.00 39.11  ? 520  MET A N   1 
ATOM   4211 C CA  . MET A 1 520 ? 25.013  55.848 62.963 1.00 38.70  ? 520  MET A CA  1 
ATOM   4212 C C   . MET A 1 520 ? 24.026  55.125 62.058 1.00 36.99  ? 520  MET A C   1 
ATOM   4213 O O   . MET A 1 520 ? 23.337  54.209 62.498 1.00 35.29  ? 520  MET A O   1 
ATOM   4214 C CB  . MET A 1 520 ? 24.323  57.058 63.597 1.00 39.57  ? 520  MET A CB  1 
ATOM   4215 C CG  . MET A 1 520 ? 25.087  57.662 64.759 1.00 44.40  ? 520  MET A CG  1 
ATOM   4216 S SD  . MET A 1 520 ? 25.451  56.458 66.057 1.00 49.20  ? 520  MET A SD  1 
ATOM   4217 C CE  . MET A 1 520 ? 27.215  56.194 65.766 1.00 49.22  ? 520  MET A CE  1 
ATOM   4218 N N   . CYS A 1 521 ? 23.948  55.529 60.795 1.00 36.39  ? 521  CYS A N   1 
ATOM   4219 C CA  . CYS A 1 521 ? 23.009  54.879 59.899 1.00 35.05  ? 521  CYS A CA  1 
ATOM   4220 C C   . CYS A 1 521 ? 23.432  53.486 59.472 1.00 36.13  ? 521  CYS A C   1 
ATOM   4221 O O   . CYS A 1 521 ? 22.590  52.691 59.066 1.00 36.67  ? 521  CYS A O   1 
ATOM   4222 C CB  . CYS A 1 521 ? 22.712  55.770 58.701 1.00 35.24  ? 521  CYS A CB  1 
ATOM   4223 S SG  . CYS A 1 521 ? 21.692  57.200 59.195 1.00 37.98  ? 521  CYS A SG  1 
ATOM   4224 N N   . VAL A 1 522 ? 24.725  53.176 59.564 1.00 35.17  ? 522  VAL A N   1 
ATOM   4225 C CA  . VAL A 1 522 ? 25.179  51.826 59.240 1.00 34.15  ? 522  VAL A CA  1 
ATOM   4226 C C   . VAL A 1 522 ? 24.607  50.938 60.346 1.00 34.89  ? 522  VAL A C   1 
ATOM   4227 O O   . VAL A 1 522 ? 24.162  49.816 60.107 1.00 35.64  ? 522  VAL A O   1 
ATOM   4228 C CB  . VAL A 1 522 ? 26.717  51.706 59.257 1.00 34.54  ? 522  VAL A CB  1 
ATOM   4229 C CG1 . VAL A 1 522 ? 27.122  50.238 59.220 1.00 31.28  ? 522  VAL A CG1 1 
ATOM   4230 C CG2 . VAL A 1 522 ? 27.307  52.428 58.062 1.00 31.02  ? 522  VAL A CG2 1 
ATOM   4231 N N   . PHE A 1 523 ? 24.618  51.473 61.562 1.00 35.24  ? 523  PHE A N   1 
ATOM   4232 C CA  . PHE A 1 523 ? 24.088  50.781 62.735 1.00 35.37  ? 523  PHE A CA  1 
ATOM   4233 C C   . PHE A 1 523 ? 22.580  50.512 62.610 1.00 35.78  ? 523  PHE A C   1 
ATOM   4234 O O   . PHE A 1 523 ? 22.125  49.385 62.799 1.00 35.77  ? 523  PHE A O   1 
ATOM   4235 C CB  . PHE A 1 523 ? 24.350  51.614 64.002 1.00 33.39  ? 523  PHE A CB  1 
ATOM   4236 C CG  . PHE A 1 523 ? 23.670  51.080 65.226 1.00 34.98  ? 523  PHE A CG  1 
ATOM   4237 C CD1 . PHE A 1 523 ? 24.165  49.955 65.883 1.00 35.71  ? 523  PHE A CD1 1 
ATOM   4238 C CD2 . PHE A 1 523 ? 22.499  51.670 65.694 1.00 34.98  ? 523  PHE A CD2 1 
ATOM   4239 C CE1 . PHE A 1 523 ? 23.496  49.423 66.989 1.00 36.91  ? 523  PHE A CE1 1 
ATOM   4240 C CE2 . PHE A 1 523 ? 21.825  51.146 66.797 1.00 37.10  ? 523  PHE A CE2 1 
ATOM   4241 C CZ  . PHE A 1 523 ? 22.325  50.018 67.445 1.00 38.02  ? 523  PHE A CZ  1 
ATOM   4242 N N   . TRP A 1 524 ? 21.807  51.544 62.284 1.00 35.39  ? 524  TRP A N   1 
ATOM   4243 C CA  . TRP A 1 524 ? 20.363  51.386 62.162 1.00 35.88  ? 524  TRP A CA  1 
ATOM   4244 C C   . TRP A 1 524 ? 19.893  50.689 60.891 1.00 36.63  ? 524  TRP A C   1 
ATOM   4245 O O   . TRP A 1 524 ? 18.903  49.963 60.907 1.00 39.58  ? 524  TRP A O   1 
ATOM   4246 C CB  . TRP A 1 524 ? 19.658  52.743 62.240 1.00 33.04  ? 524  TRP A CB  1 
ATOM   4247 C CG  . TRP A 1 524 ? 19.749  53.433 63.571 1.00 31.82  ? 524  TRP A CG  1 
ATOM   4248 C CD1 . TRP A 1 524 ? 20.567  54.475 63.895 1.00 28.10  ? 524  TRP A CD1 1 
ATOM   4249 C CD2 . TRP A 1 524 ? 18.981  53.142 64.747 1.00 30.85  ? 524  TRP A CD2 1 
ATOM   4250 N NE1 . TRP A 1 524 ? 20.356  54.854 65.197 1.00 31.31  ? 524  TRP A NE1 1 
ATOM   4251 C CE2 . TRP A 1 524 ? 19.388  54.054 65.745 1.00 32.26  ? 524  TRP A CE2 1 
ATOM   4252 C CE3 . TRP A 1 524 ? 17.991  52.199 65.054 1.00 30.44  ? 524  TRP A CE3 1 
ATOM   4253 C CZ2 . TRP A 1 524 ? 18.835  54.052 67.037 1.00 30.98  ? 524  TRP A CZ2 1 
ATOM   4254 C CZ3 . TRP A 1 524 ? 17.444  52.197 66.335 1.00 32.71  ? 524  TRP A CZ3 1 
ATOM   4255 C CH2 . TRP A 1 524 ? 17.869  53.121 67.311 1.00 30.84  ? 524  TRP A CH2 1 
ATOM   4256 N N   . ASN A 1 525 ? 20.589  50.907 59.787 1.00 37.10  ? 525  ASN A N   1 
ATOM   4257 C CA  . ASN A 1 525 ? 20.164  50.309 58.530 1.00 38.37  ? 525  ASN A CA  1 
ATOM   4258 C C   . ASN A 1 525 ? 20.719  48.920 58.250 1.00 39.05  ? 525  ASN A C   1 
ATOM   4259 O O   . ASN A 1 525 ? 20.059  48.108 57.613 1.00 37.56  ? 525  ASN A O   1 
ATOM   4260 C CB  . ASN A 1 525 ? 20.509  51.252 57.376 1.00 36.47  ? 525  ASN A CB  1 
ATOM   4261 C CG  . ASN A 1 525 ? 19.730  52.558 57.443 1.00 37.74  ? 525  ASN A CG  1 
ATOM   4262 O OD1 . ASN A 1 525 ? 20.106  53.554 56.824 1.00 40.54  ? 525  ASN A OD1 1 
ATOM   4263 N ND2 . ASN A 1 525 ? 18.633  52.554 58.190 1.00 35.98  ? 525  ASN A ND2 1 
ATOM   4264 N N   . GLN A 1 526 ? 21.923  48.647 58.735 1.00 41.05  ? 526  GLN A N   1 
ATOM   4265 C CA  . GLN A 1 526 ? 22.556  47.357 58.505 1.00 42.77  ? 526  GLN A CA  1 
ATOM   4266 C C   . GLN A 1 526 ? 22.714  46.462 59.730 1.00 43.27  ? 526  GLN A C   1 
ATOM   4267 O O   . GLN A 1 526 ? 22.184  45.361 59.765 1.00 43.74  ? 526  GLN A O   1 
ATOM   4268 C CB  . GLN A 1 526 ? 23.927  47.557 57.859 1.00 45.55  ? 526  GLN A CB  1 
ATOM   4269 C CG  . GLN A 1 526 ? 23.909  47.696 56.337 1.00 53.83  ? 526  GLN A CG  1 
ATOM   4270 C CD  . GLN A 1 526 ? 23.235  48.971 55.836 1.00 59.57  ? 526  GLN A CD  1 
ATOM   4271 O OE1 . GLN A 1 526 ? 23.618  50.088 56.209 1.00 62.22  ? 526  GLN A OE1 1 
ATOM   4272 N NE2 . GLN A 1 526 ? 22.235  48.808 54.968 1.00 61.67  ? 526  GLN A NE2 1 
ATOM   4273 N N   . PHE A 1 527 ? 23.437  46.931 60.741 1.00 43.81  ? 527  PHE A N   1 
ATOM   4274 C CA  . PHE A 1 527 ? 23.681  46.112 61.925 1.00 40.76  ? 527  PHE A CA  1 
ATOM   4275 C C   . PHE A 1 527 ? 22.478  45.745 62.803 1.00 40.24  ? 527  PHE A C   1 
ATOM   4276 O O   . PHE A 1 527 ? 22.170  44.562 62.974 1.00 39.75  ? 527  PHE A O   1 
ATOM   4277 C CB  . PHE A 1 527 ? 24.771  46.757 62.798 1.00 39.71  ? 527  PHE A CB  1 
ATOM   4278 C CG  . PHE A 1 527 ? 25.123  45.945 64.010 1.00 36.60  ? 527  PHE A CG  1 
ATOM   4279 C CD1 . PHE A 1 527 ? 25.797  44.735 63.879 1.00 35.66  ? 527  PHE A CD1 1 
ATOM   4280 C CD2 . PHE A 1 527 ? 24.716  46.352 65.277 1.00 35.60  ? 527  PHE A CD2 1 
ATOM   4281 C CE1 . PHE A 1 527 ? 26.057  43.936 64.989 1.00 35.76  ? 527  PHE A CE1 1 
ATOM   4282 C CE2 . PHE A 1 527 ? 24.972  45.559 66.396 1.00 36.24  ? 527  PHE A CE2 1 
ATOM   4283 C CZ  . PHE A 1 527 ? 25.642  44.348 66.250 1.00 35.31  ? 527  PHE A CZ  1 
ATOM   4284 N N   . LEU A 1 528 ? 21.807  46.740 63.373 1.00 40.03  ? 528  LEU A N   1 
ATOM   4285 C CA  . LEU A 1 528 ? 20.678  46.457 64.254 1.00 39.83  ? 528  LEU A CA  1 
ATOM   4286 C C   . LEU A 1 528 ? 19.618  45.541 63.637 1.00 41.68  ? 528  LEU A C   1 
ATOM   4287 O O   . LEU A 1 528 ? 19.174  44.583 64.273 1.00 41.53  ? 528  LEU A O   1 
ATOM   4288 C CB  . LEU A 1 528 ? 20.031  47.757 64.736 1.00 36.76  ? 528  LEU A CB  1 
ATOM   4289 C CG  . LEU A 1 528 ? 18.914  47.540 65.763 1.00 37.20  ? 528  LEU A CG  1 
ATOM   4290 C CD1 . LEU A 1 528 ? 19.421  46.641 66.883 1.00 35.90  ? 528  LEU A CD1 1 
ATOM   4291 C CD2 . LEU A 1 528 ? 18.434  48.873 66.311 1.00 34.75  ? 528  LEU A CD2 1 
ATOM   4292 N N   . PRO A 1 529 ? 19.192  45.823 62.397 1.00 42.18  ? 529  PRO A N   1 
ATOM   4293 C CA  . PRO A 1 529 ? 18.181  44.962 61.777 1.00 44.52  ? 529  PRO A CA  1 
ATOM   4294 C C   . PRO A 1 529 ? 18.654  43.503 61.747 1.00 45.92  ? 529  PRO A C   1 
ATOM   4295 O O   . PRO A 1 529 ? 17.881  42.575 61.992 1.00 45.22  ? 529  PRO A O   1 
ATOM   4296 C CB  . PRO A 1 529 ? 18.044  45.551 60.372 1.00 43.97  ? 529  PRO A CB  1 
ATOM   4297 C CG  . PRO A 1 529 ? 18.360  46.999 60.575 1.00 43.21  ? 529  PRO A CG  1 
ATOM   4298 C CD  . PRO A 1 529 ? 19.547  46.941 61.505 1.00 43.35  ? 529  PRO A CD  1 
ATOM   4299 N N   . LYS A 1 530 ? 19.935  43.315 61.449 1.00 45.75  ? 530  LYS A N   1 
ATOM   4300 C CA  . LYS A 1 530 ? 20.508  41.981 61.384 1.00 48.16  ? 530  LYS A CA  1 
ATOM   4301 C C   . LYS A 1 530 ? 20.510  41.322 62.763 1.00 49.91  ? 530  LYS A C   1 
ATOM   4302 O O   . LYS A 1 530 ? 20.268  40.123 62.894 1.00 50.49  ? 530  LYS A O   1 
ATOM   4303 C CB  . LYS A 1 530 ? 21.934  42.051 60.836 1.00 48.69  ? 530  LYS A CB  1 
ATOM   4304 C CG  . LYS A 1 530 ? 22.508  40.697 60.487 1.00 54.06  ? 530  LYS A CG  1 
ATOM   4305 C CD  . LYS A 1 530 ? 23.873  40.799 59.821 1.00 54.95  ? 530  LYS A CD  1 
ATOM   4306 C CE  . LYS A 1 530 ? 24.418  39.403 59.521 1.00 57.92  ? 530  LYS A CE  1 
ATOM   4307 N NZ  . LYS A 1 530 ? 25.767  39.418 58.884 1.00 59.65  ? 530  LYS A NZ  1 
ATOM   4308 N N   . LEU A 1 531 ? 20.774  42.119 63.791 1.00 49.96  ? 531  LEU A N   1 
ATOM   4309 C CA  . LEU A 1 531 ? 20.814  41.615 65.154 1.00 50.21  ? 531  LEU A CA  1 
ATOM   4310 C C   . LEU A 1 531 ? 19.444  41.137 65.628 1.00 51.53  ? 531  LEU A C   1 
ATOM   4311 O O   . LEU A 1 531 ? 19.300  39.998 66.069 1.00 51.08  ? 531  LEU A O   1 
ATOM   4312 C CB  . LEU A 1 531 ? 21.366  42.700 66.091 1.00 48.78  ? 531  LEU A CB  1 
ATOM   4313 C CG  . LEU A 1 531 ? 21.505  42.391 67.585 1.00 47.85  ? 531  LEU A CG  1 
ATOM   4314 C CD1 . LEU A 1 531 ? 22.486  43.348 68.226 1.00 45.26  ? 531  LEU A CD1 1 
ATOM   4315 C CD2 . LEU A 1 531 ? 20.152  42.495 68.258 1.00 49.09  ? 531  LEU A CD2 1 
ATOM   4316 N N   . LEU A 1 532 ? 18.441  42.005 65.542 1.00 52.77  ? 532  LEU A N   1 
ATOM   4317 C CA  . LEU A 1 532 ? 17.089  41.651 65.968 1.00 53.86  ? 532  LEU A CA  1 
ATOM   4318 C C   . LEU A 1 532 ? 16.571  40.430 65.205 1.00 57.01  ? 532  LEU A C   1 
ATOM   4319 O O   . LEU A 1 532 ? 15.829  39.616 65.752 1.00 57.23  ? 532  LEU A O   1 
ATOM   4320 C CB  . LEU A 1 532 ? 16.133  42.832 65.759 1.00 50.00  ? 532  LEU A CB  1 
ATOM   4321 C CG  . LEU A 1 532 ? 16.442  44.121 66.524 1.00 47.81  ? 532  LEU A CG  1 
ATOM   4322 C CD1 . LEU A 1 532 ? 15.568  45.259 66.015 1.00 44.15  ? 532  LEU A CD1 1 
ATOM   4323 C CD2 . LEU A 1 532 ? 16.236  43.886 68.010 1.00 46.28  ? 532  LEU A CD2 1 
ATOM   4324 N N   . ASN A 1 533 ? 16.967  40.303 63.944 1.00 60.59  ? 533  ASN A N   1 
ATOM   4325 C CA  . ASN A 1 533 ? 16.535  39.178 63.126 1.00 65.07  ? 533  ASN A CA  1 
ATOM   4326 C C   . ASN A 1 533 ? 17.252  37.878 63.484 1.00 67.73  ? 533  ASN A C   1 
ATOM   4327 O O   . ASN A 1 533 ? 16.658  36.802 63.419 1.00 68.34  ? 533  ASN A O   1 
ATOM   4328 C CB  . ASN A 1 533 ? 16.737  39.494 61.641 1.00 66.40  ? 533  ASN A CB  1 
ATOM   4329 C CG  . ASN A 1 533 ? 16.458  38.302 60.748 1.00 68.19  ? 533  ASN A CG  1 
ATOM   4330 O OD1 . ASN A 1 533 ? 17.367  37.549 60.396 1.00 69.88  ? 533  ASN A OD1 1 
ATOM   4331 N ND2 . ASN A 1 533 ? 15.192  38.116 60.387 1.00 69.72  ? 533  ASN A ND2 1 
ATOM   4332 N N   . ALA A 1 534 ? 18.523  37.967 63.861 1.00 70.75  ? 534  ALA A N   1 
ATOM   4333 C CA  . ALA A 1 534 ? 19.278  36.772 64.224 1.00 73.64  ? 534  ALA A CA  1 
ATOM   4334 C C   . ALA A 1 534 ? 18.850  36.283 65.601 1.00 75.86  ? 534  ALA A C   1 
ATOM   4335 O O   . ALA A 1 534 ? 18.918  35.090 65.897 1.00 76.25  ? 534  ALA A O   1 
ATOM   4336 C CB  . ALA A 1 534 ? 20.764  37.068 64.217 1.00 73.41  ? 534  ALA A CB  1 
ATOM   4337 N N   . THR A 1 535 ? 18.406  37.212 66.439 1.00 79.01  ? 535  THR A N   1 
ATOM   4338 C CA  . THR A 1 535 ? 17.967  36.875 67.788 1.00 82.01  ? 535  THR A CA  1 
ATOM   4339 C C   . THR A 1 535 ? 16.443  36.874 67.888 1.00 83.31  ? 535  THR A C   1 
ATOM   4340 O O   . THR A 1 535 ? 15.914  37.476 68.850 1.00 84.10  ? 535  THR A O   1 
ATOM   4341 C CB  . THR A 1 535 ? 18.534  37.874 68.825 1.00 82.43  ? 535  THR A CB  1 
ATOM   4342 O OG1 . THR A 1 535 ? 18.090  39.201 68.514 1.00 82.94  ? 535  THR A OG1 1 
ATOM   4343 C CG2 . THR A 1 535 ? 20.056  37.845 68.813 1.00 83.36  ? 535  THR A CG2 1 
ATOM   4344 N N   . ALA A 1 536 ? 15.793  36.261 67.011 1.00 85.16  ? 536  ALA A N   1 
HETATM 4345 C C1  . NAG B 2 .   ? 19.159  62.129 33.554 1.00 65.40  ? 1536 NAG A C1  1 
HETATM 4346 C C2  . NAG B 2 .   ? 20.671  61.863 33.573 1.00 66.90  ? 1536 NAG A C2  1 
HETATM 4347 C C3  . NAG B 2 .   ? 21.343  62.336 32.275 1.00 69.26  ? 1536 NAG A C3  1 
HETATM 4348 C C4  . NAG B 2 .   ? 20.589  61.818 31.044 1.00 70.82  ? 1536 NAG A C4  1 
HETATM 4349 C C5  . NAG B 2 .   ? 19.113  62.188 31.164 1.00 69.82  ? 1536 NAG A C5  1 
HETATM 4350 C C6  . NAG B 2 .   ? 18.285  61.703 29.986 1.00 70.76  ? 1536 NAG A C6  1 
HETATM 4351 C C7  . NAG B 2 .   ? 21.437  61.913 35.859 1.00 63.95  ? 1536 NAG A C7  1 
HETATM 4352 C C8  . NAG B 2 .   ? 21.830  62.750 37.066 1.00 63.09  ? 1536 NAG A C8  1 
HETATM 4353 N N2  . NAG B 2 .   ? 21.271  62.548 34.703 1.00 65.53  ? 1536 NAG A N2  1 
HETATM 4354 O O3  . NAG B 2 .   ? 22.684  61.869 32.241 1.00 70.12  ? 1536 NAG A O3  1 
HETATM 4355 O O4  . NAG B 2 .   ? 21.137  62.390 29.863 1.00 72.07  ? 1536 NAG A O4  1 
HETATM 4356 O O5  . NAG B 2 .   ? 18.564  61.598 32.361 1.00 67.59  ? 1536 NAG A O5  1 
HETATM 4357 O O6  . NAG B 2 .   ? 17.615  60.487 30.285 1.00 71.98  ? 1536 NAG A O6  1 
HETATM 4358 O O7  . NAG B 2 .   ? 21.284  60.697 35.980 1.00 63.31  ? 1536 NAG A O7  1 
HETATM 4359 C C1  . NAG C 2 .   ? -18.215 84.216 48.992 1.00 80.44  ? 1537 NAG A C1  1 
HETATM 4360 C C2  . NAG C 2 .   ? -17.710 84.745 50.348 1.00 82.56  ? 1537 NAG A C2  1 
HETATM 4361 C C3  . NAG C 2 .   ? -18.420 86.065 50.692 1.00 84.81  ? 1537 NAG A C3  1 
HETATM 4362 C C4  . NAG C 2 .   ? -18.793 86.818 49.407 1.00 85.43  ? 1537 NAG A C4  1 
HETATM 4363 C C5  . NAG C 2 .   ? -19.785 85.982 48.570 1.00 84.52  ? 1537 NAG A C5  1 
HETATM 4364 C C6  . NAG C 2 .   ? -19.658 86.210 47.075 1.00 83.48  ? 1537 NAG A C6  1 
HETATM 4365 C C7  . NAG C 2 .   ? -18.180 84.158 52.648 1.00 86.32  ? 1537 NAG A C7  1 
HETATM 4366 C C8  . NAG C 2 .   ? -17.004 84.635 53.486 1.00 86.52  ? 1537 NAG A C8  1 
HETATM 4367 N N2  . NAG C 2 .   ? -17.931 83.767 51.398 1.00 85.59  ? 1537 NAG A N2  1 
HETATM 4368 O O3  . NAG C 2 .   ? -17.574 86.871 51.502 1.00 85.73  ? 1537 NAG A O3  1 
HETATM 4369 O O4  . NAG C 2 .   ? -19.377 88.072 49.735 1.00 86.10  ? 1537 NAG A O4  1 
HETATM 4370 O O5  . NAG C 2 .   ? -19.594 84.561 48.801 1.00 83.03  ? 1537 NAG A O5  1 
HETATM 4371 O O6  . NAG C 2 .   ? -20.583 85.404 46.360 1.00 81.01  ? 1537 NAG A O6  1 
HETATM 4372 O O7  . NAG C 2 .   ? -19.308 84.137 53.139 1.00 87.59  ? 1537 NAG A O7  1 
HETATM 4373 C C1  . PGE D 3 .   ? 23.510  73.295 70.412 1.00 87.76  ? 1538 PGE A C1  1 
HETATM 4374 O O1  . PGE D 3 .   ? 22.785  74.009 69.400 1.00 89.88  ? 1538 PGE A O1  1 
HETATM 4375 C C2  . PGE D 3 .   ? 22.901  73.481 71.852 1.00 86.53  ? 1538 PGE A C2  1 
HETATM 4376 O O2  . PGE D 3 .   ? 21.440  73.057 72.224 1.00 84.36  ? 1538 PGE A O2  1 
HETATM 4377 C C3  . PGE D 3 .   ? 21.001  71.636 72.090 1.00 82.25  ? 1538 PGE A C3  1 
HETATM 4378 C C4  . PGE D 3 .   ? 21.094  71.172 70.649 1.00 81.91  ? 1538 PGE A C4  1 
HETATM 4379 O O4  . PGE D 3 .   ? 21.628  66.302 70.362 1.00 88.52  ? 1538 PGE A O4  1 
HETATM 4380 C C6  . PGE D 3 .   ? 20.970  67.514 69.974 1.00 87.19  ? 1538 PGE A C6  1 
HETATM 4381 C C5  . PGE D 3 .   ? 21.538  68.750 70.685 1.00 84.95  ? 1538 PGE A C5  1 
HETATM 4382 O O3  . PGE D 3 .   ? 20.777  69.878 70.176 1.00 83.00  ? 1538 PGE A O3  1 
HETATM 4383 C C1  . PGE E 3 .   ? 27.713  59.187 70.653 1.00 84.89  ? 1539 PGE A C1  1 
HETATM 4384 O O1  . PGE E 3 .   ? 28.314  60.466 70.787 1.00 85.51  ? 1539 PGE A O1  1 
HETATM 4385 C C2  . PGE E 3 .   ? 28.266  58.251 71.701 1.00 85.13  ? 1539 PGE A C2  1 
HETATM 4386 O O2  . PGE E 3 .   ? 29.674  58.169 71.502 1.00 84.49  ? 1539 PGE A O2  1 
HETATM 4387 C C3  . PGE E 3 .   ? 30.257  57.292 72.466 1.00 84.21  ? 1539 PGE A C3  1 
HETATM 4388 C C4  . PGE E 3 .   ? 31.779  57.276 72.177 1.00 85.10  ? 1539 PGE A C4  1 
HETATM 4389 O O4  . PGE E 3 .   ? 34.599  60.361 73.208 1.00 86.92  ? 1539 PGE A O4  1 
HETATM 4390 C C6  . PGE E 3 .   ? 33.227  60.605 73.561 1.00 87.00  ? 1539 PGE A C6  1 
HETATM 4391 C C5  . PGE E 3 .   ? 32.462  59.271 73.591 1.00 86.35  ? 1539 PGE A C5  1 
HETATM 4392 O O3  . PGE E 3 .   ? 32.492  58.581 72.271 1.00 85.16  ? 1539 PGE A O3  1 
HETATM 4393 C C1  . PGE F 3 .   ? -9.832  45.665 75.028 1.00 81.63  ? 1540 PGE A C1  1 
HETATM 4394 O O1  . PGE F 3 .   ? -8.452  45.271 74.785 1.00 80.97  ? 1540 PGE A O1  1 
HETATM 4395 C C2  . PGE F 3 .   ? -10.015 47.200 75.175 1.00 80.90  ? 1540 PGE A C2  1 
HETATM 4396 O O2  . PGE F 3 .   ? -11.411 47.500 75.399 1.00 81.01  ? 1540 PGE A O2  1 
HETATM 4397 C C3  . PGE F 3 .   ? -11.656 48.903 75.536 1.00 81.93  ? 1540 PGE A C3  1 
HETATM 4398 C C4  . PGE F 3 .   ? -13.175 49.163 75.750 1.00 82.83  ? 1540 PGE A C4  1 
HETATM 4399 O O4  . PGE F 3 .   ? -15.404 46.697 78.267 1.00 86.43  ? 1540 PGE A O4  1 
HETATM 4400 C C6  . PGE F 3 .   ? -15.605 48.128 78.328 1.00 85.91  ? 1540 PGE A C6  1 
HETATM 4401 C C5  . PGE F 3 .   ? -15.083 48.815 77.040 1.00 84.46  ? 1540 PGE A C5  1 
HETATM 4402 O O3  . PGE F 3 .   ? -13.683 48.535 76.909 1.00 83.96  ? 1540 PGE A O3  1 
HETATM 4403 N N1  . NWA G 4 .   ? 4.465   68.629 62.271 1.00 53.61  ? 1541 NWA A N1  1 
HETATM 4404 C C2  . NWA G 4 .   ? 5.072   67.298 62.470 1.00 53.38  ? 1541 NWA A C2  1 
HETATM 4405 C C3  . NWA G 4 .   ? 4.536   66.072 61.719 1.00 50.98  ? 1541 NWA A C3  1 
HETATM 4406 C C5  . NWA G 4 .   ? 5.372   63.898 60.820 1.00 48.09  ? 1541 NWA A C5  1 
HETATM 4407 O O7  . NWA G 4 .   ? 4.250   63.523 60.010 1.00 44.98  ? 1541 NWA A O7  1 
HETATM 4408 C C6  . NWA G 4 .   ? 5.388   62.682 61.750 1.00 48.84  ? 1541 NWA A C6  1 
HETATM 4409 C C8  . NWA G 4 .   ? 3.159   68.758 62.938 1.00 52.72  ? 1541 NWA A C8  1 
HETATM 4410 C C9  . NWA G 4 .   ? 5.397   69.599 62.866 1.00 51.95  ? 1541 NWA A C9  1 
HETATM 4411 C C10 . NWA G 4 .   ? 4.294   69.049 60.867 1.00 54.08  ? 1541 NWA A C10 1 
HETATM 4412 C C4  . NWA G 4 .   ? 5.417   64.857 62.013 1.00 49.79  ? 1541 NWA A C4  1 
HETATM 4413 O O7  . CHH H 5 .   ? 1.955   64.478 69.626 1.00 81.31  ? 1542 CHH A O7  1 
HETATM 4414 C C5  . CHH H 5 .   ? 2.316   63.125 69.569 1.00 80.96  ? 1542 CHH A C5  1 
HETATM 4415 C C6  . CHH H 5 .   ? 3.420   62.859 68.905 1.00 82.40  ? 1542 CHH A C6  1 
HETATM 4416 C C4  . CHH H 5 .   ? 1.767   62.069 70.397 1.00 80.36  ? 1542 CHH A C4  1 
HETATM 4417 C C3  . CHH H 5 .   ? 0.838   62.770 71.226 1.00 81.10  ? 1542 CHH A C3  1 
HETATM 4418 C C2  . CHH H 5 .   ? 0.643   62.013 72.596 1.00 82.33  ? 1542 CHH A C2  1 
HETATM 4419 N N1  . CHH H 5 .   ? -0.525  61.071 72.729 1.00 82.85  ? 1542 CHH A N1  1 
HETATM 4420 C C9  . CHH H 5 .   ? -0.279  59.810 72.040 1.00 83.43  ? 1542 CHH A C9  1 
HETATM 4421 C C10 . CHH H 5 .   ? -0.574  60.684 74.115 1.00 84.63  ? 1542 CHH A C10 1 
HETATM 4422 C C8  . CHH H 5 .   ? -1.936  61.611 72.396 1.00 83.24  ? 1542 CHH A C8  1 
HETATM 4423 O O   . HOH I 6 .   ? -14.453 89.198 40.026 1.00 78.60  ? 2001 HOH A O   1 
HETATM 4424 O O   . HOH I 6 .   ? -15.326 87.536 33.062 1.00 66.78  ? 2002 HOH A O   1 
HETATM 4425 O O   . HOH I 6 .   ? -10.315 91.235 36.575 1.00 72.92  ? 2003 HOH A O   1 
HETATM 4426 O O   . HOH I 6 .   ? -5.055  91.152 35.768 1.00 62.38  ? 2004 HOH A O   1 
HETATM 4427 O O   . HOH I 6 .   ? -5.936  84.212 38.265 1.00 52.05  ? 2005 HOH A O   1 
HETATM 4428 O O   . HOH I 6 .   ? -16.753 90.312 31.414 1.00 73.40  ? 2006 HOH A O   1 
HETATM 4429 O O   . HOH I 6 .   ? -11.718 91.977 34.027 1.00 83.43  ? 2007 HOH A O   1 
HETATM 4430 O O   . HOH I 6 .   ? -18.454 85.341 41.531 1.00 94.66  ? 2008 HOH A O   1 
HETATM 4431 O O   . HOH I 6 .   ? -16.668 72.553 30.485 1.00 88.09  ? 2009 HOH A O   1 
HETATM 4432 O O   . HOH I 6 .   ? -19.340 85.755 38.162 1.00 71.07  ? 2010 HOH A O   1 
HETATM 4433 O O   . HOH I 6 .   ? -5.637  95.660 39.381 1.00 72.25  ? 2011 HOH A O   1 
HETATM 4434 O O   . HOH I 6 .   ? -10.957 79.686 32.897 1.00 69.14  ? 2012 HOH A O   1 
HETATM 4435 O O   . HOH I 6 .   ? -17.566 73.958 33.094 1.00 70.44  ? 2013 HOH A O   1 
HETATM 4436 O O   . HOH I 6 .   ? -14.152 78.274 28.769 1.00 47.92  ? 2014 HOH A O   1 
HETATM 4437 O O   . HOH I 6 .   ? -12.824 74.300 30.496 1.00 52.54  ? 2015 HOH A O   1 
HETATM 4438 O O   . HOH I 6 .   ? -12.709 76.676 29.925 1.00 44.66  ? 2016 HOH A O   1 
HETATM 4439 O O   . HOH I 6 .   ? -23.334 82.869 37.215 1.00 83.14  ? 2017 HOH A O   1 
HETATM 4440 O O   . HOH I 6 .   ? -18.524 83.193 33.163 1.00 71.12  ? 2018 HOH A O   1 
HETATM 4441 O O   . HOH I 6 .   ? -19.201 84.759 35.094 1.00 89.06  ? 2019 HOH A O   1 
HETATM 4442 O O   . HOH I 6 .   ? -8.972  84.093 66.609 1.00 77.87  ? 2020 HOH A O   1 
HETATM 4443 O O   . HOH I 6 .   ? -0.358  96.207 41.480 1.00 62.41  ? 2021 HOH A O   1 
HETATM 4444 O O   . HOH I 6 .   ? -3.094  96.632 40.097 1.00 75.61  ? 2022 HOH A O   1 
HETATM 4445 O O   . HOH I 6 .   ? -16.061 70.211 31.244 1.00 70.13  ? 2023 HOH A O   1 
HETATM 4446 O O   . HOH I 6 .   ? -18.558 71.641 34.037 1.00 53.19  ? 2024 HOH A O   1 
HETATM 4447 O O   . HOH I 6 .   ? -6.434  69.013 29.128 1.00 60.98  ? 2025 HOH A O   1 
HETATM 4448 O O   . HOH I 6 .   ? -19.219 64.337 35.382 1.00 80.46  ? 2026 HOH A O   1 
HETATM 4449 O O   . HOH I 6 .   ? -4.946  95.837 50.336 1.00 75.73  ? 2027 HOH A O   1 
HETATM 4450 O O   . HOH I 6 .   ? 0.566   96.568 53.204 1.00 84.99  ? 2028 HOH A O   1 
HETATM 4451 O O   . HOH I 6 .   ? -22.394 80.724 35.620 1.00 84.72  ? 2029 HOH A O   1 
HETATM 4452 O O   . HOH I 6 .   ? -20.961 83.030 35.045 1.00 52.56  ? 2030 HOH A O   1 
HETATM 4453 O O   . HOH I 6 .   ? 3.638   83.532 64.518 1.00 57.40  ? 2031 HOH A O   1 
HETATM 4454 O O   . HOH I 6 .   ? -4.477  82.133 65.838 1.00 65.60  ? 2032 HOH A O   1 
HETATM 4455 O O   . HOH I 6 .   ? -3.934  95.472 42.691 1.00 67.06  ? 2033 HOH A O   1 
HETATM 4456 O O   . HOH I 6 .   ? -6.655  89.137 41.927 1.00 60.05  ? 2034 HOH A O   1 
HETATM 4457 O O   . HOH I 6 .   ? -5.892  94.589 45.318 1.00 54.55  ? 2035 HOH A O   1 
HETATM 4458 O O   . HOH I 6 .   ? -1.070  95.056 43.778 1.00 63.94  ? 2036 HOH A O   1 
HETATM 4459 O O   . HOH I 6 .   ? -0.635  93.180 41.795 1.00 72.63  ? 2037 HOH A O   1 
HETATM 4460 O O   . HOH I 6 .   ? -8.891  53.937 43.307 1.00 59.43  ? 2038 HOH A O   1 
HETATM 4461 O O   . HOH I 6 .   ? -18.385 62.310 38.333 1.00 72.95  ? 2039 HOH A O   1 
HETATM 4462 O O   . HOH I 6 .   ? 6.833   93.211 47.416 1.00 61.88  ? 2040 HOH A O   1 
HETATM 4463 O O   . HOH I 6 .   ? 2.294   89.984 53.416 1.00 60.58  ? 2041 HOH A O   1 
HETATM 4464 O O   . HOH I 6 .   ? 4.877   94.332 52.990 1.00 84.89  ? 2042 HOH A O   1 
HETATM 4465 O O   . HOH I 6 .   ? 0.783   93.106 52.012 1.00 57.52  ? 2043 HOH A O   1 
HETATM 4466 O O   . HOH I 6 .   ? -22.828 70.474 35.548 1.00 71.61  ? 2044 HOH A O   1 
HETATM 4467 O O   . HOH I 6 .   ? 4.493   93.230 42.273 1.00 91.64  ? 2045 HOH A O   1 
HETATM 4468 O O   . HOH I 6 .   ? 2.147   95.491 42.736 1.00 73.08  ? 2046 HOH A O   1 
HETATM 4469 O O   . HOH I 6 .   ? 0.069   94.789 49.875 1.00 61.37  ? 2047 HOH A O   1 
HETATM 4470 O O   . HOH I 6 .   ? -22.177 75.449 43.994 1.00 51.10  ? 2048 HOH A O   1 
HETATM 4471 O O   . HOH I 6 .   ? -19.863 76.564 47.999 1.00 61.27  ? 2049 HOH A O   1 
HETATM 4472 O O   . HOH I 6 .   ? -22.209 80.172 46.556 1.00 64.91  ? 2050 HOH A O   1 
HETATM 4473 O O   . HOH I 6 .   ? -4.637  97.655 46.547 1.00 81.09  ? 2051 HOH A O   1 
HETATM 4474 O O   . HOH I 6 .   ? 1.924   90.868 42.011 1.00 76.21  ? 2052 HOH A O   1 
HETATM 4475 O O   . HOH I 6 .   ? -2.095  97.087 48.462 1.00 70.30  ? 2053 HOH A O   1 
HETATM 4476 O O   . HOH I 6 .   ? -7.625  83.373 54.468 1.00 77.23  ? 2054 HOH A O   1 
HETATM 4477 O O   . HOH I 6 .   ? -6.525  85.946 53.193 1.00 87.53  ? 2055 HOH A O   1 
HETATM 4478 O O   . HOH I 6 .   ? -7.993  37.737 60.834 1.00 89.48  ? 2056 HOH A O   1 
HETATM 4479 O O   . HOH I 6 .   ? -3.896  85.807 39.117 1.00 43.01  ? 2057 HOH A O   1 
HETATM 4480 O O   . HOH I 6 .   ? -5.667  60.078 74.269 1.00 52.71  ? 2058 HOH A O   1 
HETATM 4481 O O   . HOH I 6 .   ? -10.991 71.042 68.182 1.00 80.61  ? 2059 HOH A O   1 
HETATM 4482 O O   . HOH I 6 .   ? -11.470 68.491 70.064 1.00 62.58  ? 2060 HOH A O   1 
HETATM 4483 O O   . HOH I 6 .   ? -15.195 75.061 50.271 1.00 65.90  ? 2061 HOH A O   1 
HETATM 4484 O O   . HOH I 6 .   ? 4.036   81.350 75.928 1.00 83.68  ? 2062 HOH A O   1 
HETATM 4485 O O   . HOH I 6 .   ? 6.117   81.512 73.978 1.00 58.49  ? 2063 HOH A O   1 
HETATM 4486 O O   . HOH I 6 .   ? 4.304   80.798 65.427 1.00 72.19  ? 2064 HOH A O   1 
HETATM 4487 O O   . HOH I 6 .   ? -12.279 65.154 41.209 1.00 50.76  ? 2065 HOH A O   1 
HETATM 4488 O O   . HOH I 6 .   ? 0.840   80.489 66.041 1.00 87.42  ? 2066 HOH A O   1 
HETATM 4489 O O   . HOH I 6 .   ? 2.187   80.585 63.023 1.00 78.84  ? 2067 HOH A O   1 
HETATM 4490 O O   . HOH I 6 .   ? -15.657 60.607 48.204 1.00 46.55  ? 2068 HOH A O   1 
HETATM 4491 O O   . HOH I 6 .   ? -21.502 62.169 47.052 1.00 74.80  ? 2069 HOH A O   1 
HETATM 4492 O O   . HOH I 6 .   ? -21.431 66.778 45.337 1.00 73.18  ? 2070 HOH A O   1 
HETATM 4493 O O   . HOH I 6 .   ? -7.851  79.039 66.005 1.00 71.64  ? 2071 HOH A O   1 
HETATM 4494 O O   . HOH I 6 .   ? -6.136  80.307 64.531 1.00 99.77  ? 2072 HOH A O   1 
HETATM 4495 O O   . HOH I 6 .   ? -15.391 78.910 61.922 1.00 79.20  ? 2073 HOH A O   1 
HETATM 4496 O O   . HOH I 6 .   ? -9.926  76.709 66.514 1.00 51.02  ? 2074 HOH A O   1 
HETATM 4497 O O   . HOH I 6 .   ? 7.160   46.454 62.575 1.00 66.13  ? 2075 HOH A O   1 
HETATM 4498 O O   . HOH I 6 .   ? 8.790   45.782 57.373 1.00 66.25  ? 2076 HOH A O   1 
HETATM 4499 O O   . HOH I 6 .   ? 7.103   43.636 63.045 1.00 73.64  ? 2077 HOH A O   1 
HETATM 4500 O O   . HOH I 6 .   ? 3.962   37.191 62.573 1.00 75.72  ? 2078 HOH A O   1 
HETATM 4501 O O   . HOH I 6 .   ? 4.294   39.955 53.367 1.00 63.65  ? 2079 HOH A O   1 
HETATM 4502 O O   . HOH I 6 .   ? -21.221 62.633 50.010 1.00 54.61  ? 2080 HOH A O   1 
HETATM 4503 O O   . HOH I 6 .   ? -28.516 38.529 67.036 1.00 80.33  ? 2081 HOH A O   1 
HETATM 4504 O O   . HOH I 6 .   ? -21.820 60.338 51.463 1.00 56.74  ? 2082 HOH A O   1 
HETATM 4505 O O   . HOH I 6 .   ? -25.896 55.558 70.544 1.00 70.60  ? 2083 HOH A O   1 
HETATM 4506 O O   . HOH I 6 .   ? -13.799 70.276 72.422 1.00 93.30  ? 2084 HOH A O   1 
HETATM 4507 O O   . HOH I 6 .   ? -15.547 68.270 74.861 1.00 83.89  ? 2085 HOH A O   1 
HETATM 4508 O O   . HOH I 6 .   ? -20.646 52.480 51.217 1.00 76.88  ? 2086 HOH A O   1 
HETATM 4509 O O   . HOH I 6 .   ? -24.532 58.077 53.498 1.00 56.06  ? 2087 HOH A O   1 
HETATM 4510 O O   . HOH I 6 .   ? -23.266 58.223 50.763 1.00 66.27  ? 2088 HOH A O   1 
HETATM 4511 O O   . HOH I 6 .   ? -5.436  83.419 53.177 1.00 46.74  ? 2089 HOH A O   1 
HETATM 4512 O O   . HOH I 6 .   ? 3.419   86.490 33.161 1.00 76.88  ? 2090 HOH A O   1 
HETATM 4513 O O   . HOH I 6 .   ? -4.559  80.730 31.059 1.00 47.46  ? 2091 HOH A O   1 
HETATM 4514 O O   . HOH I 6 .   ? 4.247   41.972 51.406 1.00 39.71  ? 2092 HOH A O   1 
HETATM 4515 O O   . HOH I 6 .   ? 8.463   42.507 54.115 1.00 64.73  ? 2093 HOH A O   1 
HETATM 4516 O O   . HOH I 6 .   ? -9.903  52.534 54.289 1.00 49.01  ? 2094 HOH A O   1 
HETATM 4517 O O   . HOH I 6 .   ? -18.101 55.592 47.795 1.00 66.11  ? 2095 HOH A O   1 
HETATM 4518 O O   . HOH I 6 .   ? -11.163 49.850 43.383 1.00 62.80  ? 2096 HOH A O   1 
HETATM 4519 O O   . HOH I 6 .   ? -7.552  52.014 44.262 1.00 67.42  ? 2097 HOH A O   1 
HETATM 4520 O O   . HOH I 6 .   ? -9.764  47.582 43.925 1.00 69.13  ? 2098 HOH A O   1 
HETATM 4521 O O   . HOH I 6 .   ? -16.496 57.556 48.471 1.00 74.87  ? 2099 HOH A O   1 
HETATM 4522 O O   . HOH I 6 .   ? -15.049 54.133 46.301 1.00 72.44  ? 2100 HOH A O   1 
HETATM 4523 O O   . HOH I 6 .   ? -10.017 56.297 44.644 1.00 43.38  ? 2101 HOH A O   1 
HETATM 4524 O O   . HOH I 6 .   ? -19.843 58.968 44.904 1.00 83.41  ? 2102 HOH A O   1 
HETATM 4525 O O   . HOH I 6 .   ? 24.729  59.356 91.590 1.00 80.13  ? 2103 HOH A O   1 
HETATM 4526 O O   . HOH I 6 .   ? -18.410 60.483 41.432 1.00 62.11  ? 2104 HOH A O   1 
HETATM 4527 O O   . HOH I 6 .   ? 8.519   52.566 82.960 1.00 68.22  ? 2105 HOH A O   1 
HETATM 4528 O O   . HOH I 6 .   ? -17.707 69.046 48.328 1.00 37.97  ? 2106 HOH A O   1 
HETATM 4529 O O   . HOH I 6 .   ? -21.413 70.837 47.105 1.00 66.31  ? 2107 HOH A O   1 
HETATM 4530 O O   . HOH I 6 .   ? 2.075   83.627 60.895 1.00 55.04  ? 2108 HOH A O   1 
HETATM 4531 O O   . HOH I 6 .   ? -21.453 68.980 42.517 1.00 62.52  ? 2109 HOH A O   1 
HETATM 4532 O O   . HOH I 6 .   ? -3.281  85.144 56.767 1.00 89.99  ? 2110 HOH A O   1 
HETATM 4533 O O   . HOH I 6 .   ? -5.100  83.558 55.580 1.00 62.29  ? 2111 HOH A O   1 
HETATM 4534 O O   . HOH I 6 .   ? -22.889 67.119 37.967 1.00 66.97  ? 2112 HOH A O   1 
HETATM 4535 O O   . HOH I 6 .   ? 32.110  70.190 78.098 1.00 87.02  ? 2113 HOH A O   1 
HETATM 4536 O O   . HOH I 6 .   ? 30.767  71.388 76.195 1.00 72.14  ? 2114 HOH A O   1 
HETATM 4537 O O   . HOH I 6 .   ? -20.034 75.598 36.866 1.00 46.41  ? 2115 HOH A O   1 
HETATM 4538 O O   . HOH I 6 .   ? -20.801 71.840 35.090 1.00 51.43  ? 2116 HOH A O   1 
HETATM 4539 O O   . HOH I 6 .   ? 10.511  89.444 45.382 1.00 63.24  ? 2117 HOH A O   1 
HETATM 4540 O O   . HOH I 6 .   ? -25.070 70.497 37.513 1.00 71.32  ? 2118 HOH A O   1 
HETATM 4541 O O   . HOH I 6 .   ? 12.332  84.536 40.089 1.00 69.03  ? 2119 HOH A O   1 
HETATM 4542 O O   . HOH I 6 .   ? 16.197  84.908 43.996 1.00 54.52  ? 2120 HOH A O   1 
HETATM 4543 O O   . HOH I 6 .   ? 12.604  86.641 36.053 1.00 93.22  ? 2121 HOH A O   1 
HETATM 4544 O O   . HOH I 6 .   ? 13.553  83.284 36.035 1.00 78.88  ? 2122 HOH A O   1 
HETATM 4545 O O   . HOH I 6 .   ? -23.827 80.748 41.788 1.00 56.72  ? 2123 HOH A O   1 
HETATM 4546 O O   . HOH I 6 .   ? -23.389 81.964 39.637 1.00 81.62  ? 2124 HOH A O   1 
HETATM 4547 O O   . HOH I 6 .   ? -22.952 77.854 43.413 1.00 70.02  ? 2125 HOH A O   1 
HETATM 4548 O O   . HOH I 6 .   ? 25.926  62.066 38.648 1.00 65.38  ? 2126 HOH A O   1 
HETATM 4549 O O   . HOH I 6 .   ? 21.369  54.602 33.445 1.00 60.21  ? 2127 HOH A O   1 
HETATM 4550 O O   . HOH I 6 .   ? 21.736  51.921 33.295 1.00 70.36  ? 2128 HOH A O   1 
HETATM 4551 O O   . HOH I 6 .   ? -17.964 80.771 50.881 1.00 70.03  ? 2129 HOH A O   1 
HETATM 4552 O O   . HOH I 6 .   ? -19.695 78.044 46.171 1.00 55.37  ? 2130 HOH A O   1 
HETATM 4553 O O   . HOH I 6 .   ? -18.140 77.982 49.588 1.00 59.51  ? 2131 HOH A O   1 
HETATM 4554 O O   . HOH I 6 .   ? 23.043  84.628 66.760 1.00 83.81  ? 2132 HOH A O   1 
HETATM 4555 O O   . HOH I 6 .   ? -9.723  84.780 53.247 1.00 56.08  ? 2133 HOH A O   1 
HETATM 4556 O O   . HOH I 6 .   ? -14.784 77.363 52.402 1.00 79.49  ? 2134 HOH A O   1 
HETATM 4557 O O   . HOH I 6 .   ? -14.475 78.456 50.003 1.00 76.96  ? 2135 HOH A O   1 
HETATM 4558 O O   . HOH I 6 .   ? -7.851  37.774 57.240 1.00 55.02  ? 2136 HOH A O   1 
HETATM 4559 O O   . HOH I 6 .   ? -7.903  38.971 51.527 1.00 70.91  ? 2137 HOH A O   1 
HETATM 4560 O O   . HOH I 6 .   ? -5.367  39.397 53.939 1.00 84.25  ? 2138 HOH A O   1 
HETATM 4561 O O   . HOH I 6 .   ? -5.443  37.865 50.847 1.00 81.81  ? 2139 HOH A O   1 
HETATM 4562 O O   . HOH I 6 .   ? -6.498  39.388 46.289 1.00 75.96  ? 2140 HOH A O   1 
HETATM 4563 O O   . HOH I 6 .   ? -10.126 81.997 54.496 1.00 58.99  ? 2141 HOH A O   1 
HETATM 4564 O O   . HOH I 6 .   ? 4.954   91.454 72.436 1.00 88.46  ? 2142 HOH A O   1 
HETATM 4565 O O   . HOH I 6 .   ? 10.500  93.593 69.029 1.00 83.74  ? 2143 HOH A O   1 
HETATM 4566 O O   . HOH I 6 .   ? 9.045   95.010 71.090 1.00 87.53  ? 2144 HOH A O   1 
HETATM 4567 O O   . HOH I 6 .   ? 22.252  87.623 51.360 1.00 76.15  ? 2145 HOH A O   1 
HETATM 4568 O O   . HOH I 6 .   ? -15.384 73.253 53.121 1.00 60.90  ? 2146 HOH A O   1 
HETATM 4569 O O   . HOH I 6 .   ? 17.717  88.799 47.819 1.00 58.12  ? 2147 HOH A O   1 
HETATM 4570 O O   . HOH I 6 .   ? -7.335  70.695 55.802 1.00 47.93  ? 2148 HOH A O   1 
HETATM 4571 O O   . HOH I 6 .   ? -7.908  59.450 41.424 1.00 61.10  ? 2149 HOH A O   1 
HETATM 4572 O O   . HOH I 6 .   ? 27.785  67.111 38.677 1.00 54.56  ? 2150 HOH A O   1 
HETATM 4573 O O   . HOH I 6 .   ? -8.808  61.345 62.980 1.00 46.96  ? 2151 HOH A O   1 
HETATM 4574 O O   . HOH I 6 .   ? -9.450  62.611 59.124 1.00 33.38  ? 2152 HOH A O   1 
HETATM 4575 O O   . HOH I 6 .   ? -17.171 68.404 64.552 1.00 64.55  ? 2153 HOH A O   1 
HETATM 4576 O O   . HOH I 6 .   ? -12.179 63.496 58.558 1.00 47.00  ? 2154 HOH A O   1 
HETATM 4577 O O   . HOH I 6 .   ? -0.528  65.183 72.223 1.00 54.99  ? 2155 HOH A O   1 
HETATM 4578 O O   . HOH I 6 .   ? -3.580  68.382 65.555 1.00 59.96  ? 2156 HOH A O   1 
HETATM 4579 O O   . HOH I 6 .   ? -5.162  66.028 73.324 1.00 63.09  ? 2157 HOH A O   1 
HETATM 4580 O O   . HOH I 6 .   ? -4.261  62.408 74.256 1.00 52.27  ? 2158 HOH A O   1 
HETATM 4581 O O   . HOH I 6 .   ? 25.986  44.589 56.051 1.00 89.65  ? 2159 HOH A O   1 
HETATM 4582 O O   . HOH I 6 .   ? -8.359  65.918 70.351 1.00 57.04  ? 2160 HOH A O   1 
HETATM 4583 O O   . HOH I 6 .   ? -1.228  72.386 72.624 1.00 48.81  ? 2161 HOH A O   1 
HETATM 4584 O O   . HOH I 6 .   ? -6.712  74.503 70.020 1.00 65.95  ? 2162 HOH A O   1 
HETATM 4585 O O   . HOH I 6 .   ? -3.652  73.436 72.661 1.00 65.13  ? 2163 HOH A O   1 
HETATM 4586 O O   . HOH I 6 .   ? -2.878  67.000 73.518 1.00 71.39  ? 2164 HOH A O   1 
HETATM 4587 O O   . HOH I 6 .   ? -3.682  69.395 78.494 1.00 54.16  ? 2165 HOH A O   1 
HETATM 4588 O O   . HOH I 6 .   ? -8.635  70.541 76.555 1.00 65.81  ? 2166 HOH A O   1 
HETATM 4589 O O   . HOH I 6 .   ? -10.176 70.770 71.023 1.00 87.20  ? 2167 HOH A O   1 
HETATM 4590 O O   . HOH I 6 .   ? -6.575  75.143 73.678 1.00 67.81  ? 2168 HOH A O   1 
HETATM 4591 O O   . HOH I 6 .   ? 3.634   65.638 79.413 1.00 50.55  ? 2169 HOH A O   1 
HETATM 4592 O O   . HOH I 6 .   ? 0.821   72.801 79.629 1.00 82.90  ? 2170 HOH A O   1 
HETATM 4593 O O   . HOH I 6 .   ? -0.016  75.678 78.067 1.00 89.24  ? 2171 HOH A O   1 
HETATM 4594 O O   . HOH I 6 .   ? 1.768   81.593 73.225 1.00 62.61  ? 2172 HOH A O   1 
HETATM 4595 O O   . HOH I 6 .   ? 2.320   83.686 70.290 1.00 65.46  ? 2173 HOH A O   1 
HETATM 4596 O O   . HOH I 6 .   ? 4.064   81.931 72.442 1.00 55.44  ? 2174 HOH A O   1 
HETATM 4597 O O   . HOH I 6 .   ? 5.515   79.746 67.489 1.00 72.04  ? 2175 HOH A O   1 
HETATM 4598 O O   . HOH I 6 .   ? 0.880   70.351 68.082 1.00 46.52  ? 2176 HOH A O   1 
HETATM 4599 O O   . HOH I 6 .   ? -1.751  79.333 66.162 1.00 65.89  ? 2177 HOH A O   1 
HETATM 4600 O O   . HOH I 6 .   ? -1.599  80.557 69.652 1.00 77.53  ? 2178 HOH A O   1 
HETATM 4601 O O   . HOH I 6 .   ? 0.923   77.631 61.399 1.00 38.25  ? 2179 HOH A O   1 
HETATM 4602 O O   . HOH I 6 .   ? -0.147  69.626 61.901 1.00 28.61  ? 2180 HOH A O   1 
HETATM 4603 O O   . HOH I 6 .   ? -1.088  68.676 66.271 1.00 37.78  ? 2181 HOH A O   1 
HETATM 4604 O O   . HOH I 6 .   ? -3.153  76.434 63.935 1.00 44.66  ? 2182 HOH A O   1 
HETATM 4605 O O   . HOH I 6 .   ? -5.652  77.081 65.970 1.00 54.39  ? 2183 HOH A O   1 
HETATM 4606 O O   . HOH I 6 .   ? -7.557  73.468 66.762 1.00 55.73  ? 2184 HOH A O   1 
HETATM 4607 O O   . HOH I 6 .   ? 4.745   48.060 62.740 1.00 40.13  ? 2185 HOH A O   1 
HETATM 4608 O O   . HOH I 6 .   ? 8.005   49.333 58.300 1.00 51.08  ? 2186 HOH A O   1 
HETATM 4609 O O   . HOH I 6 .   ? -12.611 78.869 62.631 1.00 82.94  ? 2187 HOH A O   1 
HETATM 4610 O O   . HOH I 6 .   ? 3.860   43.883 55.192 1.00 34.63  ? 2188 HOH A O   1 
HETATM 4611 O O   . HOH I 6 .   ? 6.290   46.991 58.744 1.00 69.46  ? 2189 HOH A O   1 
HETATM 4612 O O   . HOH I 6 .   ? 4.922   41.891 56.965 1.00 57.45  ? 2190 HOH A O   1 
HETATM 4613 O O   . HOH I 6 .   ? 4.025   43.979 62.499 1.00 58.87  ? 2191 HOH A O   1 
HETATM 4614 O O   . HOH I 6 .   ? 2.044   39.234 62.293 1.00 75.85  ? 2192 HOH A O   1 
HETATM 4615 O O   . HOH I 6 .   ? 1.560   41.053 53.966 1.00 45.99  ? 2193 HOH A O   1 
HETATM 4616 O O   . HOH I 6 .   ? -6.875  40.628 64.092 1.00 70.49  ? 2194 HOH A O   1 
HETATM 4617 O O   . HOH I 6 .   ? -4.134  38.624 60.133 1.00 59.07  ? 2195 HOH A O   1 
HETATM 4618 O O   . HOH I 6 .   ? -1.938  40.148 63.968 1.00 57.84  ? 2196 HOH A O   1 
HETATM 4619 O O   . HOH I 6 .   ? -2.005  38.972 56.856 1.00 64.85  ? 2197 HOH A O   1 
HETATM 4620 O O   . HOH I 6 .   ? -14.152 76.750 57.049 1.00 60.19  ? 2198 HOH A O   1 
HETATM 4621 O O   . HOH I 6 .   ? -8.851  81.573 57.213 1.00 82.53  ? 2199 HOH A O   1 
HETATM 4622 O O   . HOH I 6 .   ? -11.277 72.984 65.479 1.00 58.27  ? 2200 HOH A O   1 
HETATM 4623 O O   . HOH I 6 .   ? -6.440  81.424 58.520 1.00 63.99  ? 2201 HOH A O   1 
HETATM 4624 O O   . HOH I 6 .   ? -12.084 76.368 65.022 1.00 70.22  ? 2202 HOH A O   1 
HETATM 4625 O O   . HOH I 6 .   ? -6.832  81.462 61.363 1.00 82.26  ? 2203 HOH A O   1 
HETATM 4626 O O   . HOH I 6 .   ? 6.646   44.861 65.715 1.00 87.37  ? 2204 HOH A O   1 
HETATM 4627 O O   . HOH I 6 .   ? 3.233   42.204 69.798 1.00 75.28  ? 2205 HOH A O   1 
HETATM 4628 O O   . HOH I 6 .   ? -4.304  39.656 57.780 1.00 45.79  ? 2206 HOH A O   1 
HETATM 4629 O O   . HOH I 6 .   ? -7.246  40.926 66.564 1.00 55.17  ? 2207 HOH A O   1 
HETATM 4630 O O   . HOH I 6 .   ? -1.968  44.546 72.718 1.00 82.37  ? 2208 HOH A O   1 
HETATM 4631 O O   . HOH I 6 .   ? -18.857 69.243 61.299 1.00 72.08  ? 2209 HOH A O   1 
HETATM 4632 O O   . HOH I 6 .   ? -14.109 77.849 64.466 1.00 73.24  ? 2210 HOH A O   1 
HETATM 4633 O O   . HOH I 6 .   ? -18.080 71.920 65.014 1.00 86.06  ? 2211 HOH A O   1 
HETATM 4634 O O   . HOH I 6 .   ? -17.660 77.428 63.936 1.00 76.16  ? 2212 HOH A O   1 
HETATM 4635 O O   . HOH I 6 .   ? -14.491 77.175 60.133 1.00 76.20  ? 2213 HOH A O   1 
HETATM 4636 O O   . HOH I 6 .   ? -22.074 42.572 70.001 1.00 76.05  ? 2214 HOH A O   1 
HETATM 4637 O O   . HOH I 6 .   ? -13.912 36.516 64.949 1.00 84.87  ? 2215 HOH A O   1 
HETATM 4638 O O   . HOH I 6 .   ? -26.049 39.764 65.744 1.00 66.15  ? 2216 HOH A O   1 
HETATM 4639 O O   . HOH I 6 .   ? -13.986 71.707 64.838 1.00 62.23  ? 2217 HOH A O   1 
HETATM 4640 O O   . HOH I 6 .   ? -20.168 68.416 58.957 1.00 89.82  ? 2218 HOH A O   1 
HETATM 4641 O O   . HOH I 6 .   ? -24.570 45.265 60.365 1.00 61.59  ? 2219 HOH A O   1 
HETATM 4642 O O   . HOH I 6 .   ? -17.633 66.169 60.380 1.00 57.07  ? 2220 HOH A O   1 
HETATM 4643 O O   . HOH I 6 .   ? -14.811 60.224 56.567 1.00 37.65  ? 2221 HOH A O   1 
HETATM 4644 O O   . HOH I 6 .   ? -19.152 63.856 60.307 1.00 69.79  ? 2222 HOH A O   1 
HETATM 4645 O O   . HOH I 6 .   ? -13.339 62.801 56.299 1.00 46.82  ? 2223 HOH A O   1 
HETATM 4646 O O   . HOH I 6 .   ? -19.822 60.204 58.339 1.00 49.67  ? 2224 HOH A O   1 
HETATM 4647 O O   . HOH I 6 .   ? -27.484 49.106 65.413 1.00 75.07  ? 2225 HOH A O   1 
HETATM 4648 O O   . HOH I 6 .   ? -23.854 53.480 68.089 1.00 71.51  ? 2226 HOH A O   1 
HETATM 4649 O O   . HOH I 6 .   ? -15.237 66.709 51.411 1.00 53.04  ? 2227 HOH A O   1 
HETATM 4650 O O   . HOH I 6 .   ? -23.744 56.114 68.584 1.00 56.18  ? 2228 HOH A O   1 
HETATM 4651 O O   . HOH I 6 .   ? -24.647 52.099 70.415 1.00 88.00  ? 2229 HOH A O   1 
HETATM 4652 O O   . HOH I 6 .   ? -21.164 61.843 62.681 1.00 73.46  ? 2230 HOH A O   1 
HETATM 4653 O O   . HOH I 6 .   ? -20.028 65.565 64.797 1.00 69.53  ? 2231 HOH A O   1 
HETATM 4654 O O   . HOH I 6 .   ? -9.501  70.291 53.984 1.00 44.35  ? 2232 HOH A O   1 
HETATM 4655 O O   . HOH I 6 .   ? -14.924 68.014 48.774 1.00 49.47  ? 2233 HOH A O   1 
HETATM 4656 O O   . HOH I 6 .   ? -19.473 70.249 50.063 1.00 69.25  ? 2234 HOH A O   1 
HETATM 4657 O O   . HOH I 6 .   ? -18.112 73.157 50.917 1.00 61.60  ? 2235 HOH A O   1 
HETATM 4658 O O   . HOH I 6 .   ? -13.643 67.179 72.153 1.00 81.28  ? 2236 HOH A O   1 
HETATM 4659 O O   . HOH I 6 .   ? -7.709  49.588 76.421 1.00 48.78  ? 2237 HOH A O   1 
HETATM 4660 O O   . HOH I 6 .   ? 0.566   49.126 75.069 1.00 45.67  ? 2238 HOH A O   1 
HETATM 4661 O O   . HOH I 6 .   ? 8.761   50.636 77.306 1.00 69.61  ? 2239 HOH A O   1 
HETATM 4662 O O   . HOH I 6 .   ? 7.450   55.552 80.262 1.00 52.40  ? 2240 HOH A O   1 
HETATM 4663 O O   . HOH I 6 .   ? -3.448  83.398 51.442 1.00 47.74  ? 2241 HOH A O   1 
HETATM 4664 O O   . HOH I 6 .   ? 7.969   47.559 66.043 1.00 73.94  ? 2242 HOH A O   1 
HETATM 4665 O O   . HOH I 6 .   ? 2.115   87.790 41.530 1.00 53.69  ? 2243 HOH A O   1 
HETATM 4666 O O   . HOH I 6 .   ? 2.281   87.163 36.532 1.00 64.57  ? 2244 HOH A O   1 
HETATM 4667 O O   . HOH I 6 .   ? -0.596  40.500 47.929 1.00 92.39  ? 2245 HOH A O   1 
HETATM 4668 O O   . HOH I 6 .   ? -0.834  40.323 52.682 1.00 62.87  ? 2246 HOH A O   1 
HETATM 4669 O O   . HOH I 6 .   ? 2.142   42.340 50.393 1.00 41.00  ? 2247 HOH A O   1 
HETATM 4670 O O   . HOH I 6 .   ? -2.994  86.588 32.181 1.00 63.04  ? 2248 HOH A O   1 
HETATM 4671 O O   . HOH I 6 .   ? -10.432 82.558 32.844 1.00 82.58  ? 2249 HOH A O   1 
HETATM 4672 O O   . HOH I 6 .   ? -4.428  88.062 34.632 1.00 49.58  ? 2250 HOH A O   1 
HETATM 4673 O O   . HOH I 6 .   ? 4.521   41.271 48.458 1.00 90.93  ? 2251 HOH A O   1 
HETATM 4674 O O   . HOH I 6 .   ? -3.716  83.059 31.803 1.00 71.87  ? 2252 HOH A O   1 
HETATM 4675 O O   . HOH I 6 .   ? 10.689  43.943 54.081 1.00 58.54  ? 2253 HOH A O   1 
HETATM 4676 O O   . HOH I 6 .   ? 6.530   40.871 51.696 1.00 84.45  ? 2254 HOH A O   1 
HETATM 4677 O O   . HOH I 6 .   ? 5.553   37.797 48.973 1.00 88.59  ? 2255 HOH A O   1 
HETATM 4678 O O   . HOH I 6 .   ? 2.929   82.928 32.028 1.00 65.12  ? 2256 HOH A O   1 
HETATM 4679 O O   . HOH I 6 .   ? -2.906  78.072 30.721 1.00 59.32  ? 2257 HOH A O   1 
HETATM 4680 O O   . HOH I 6 .   ? 5.849   44.514 53.553 1.00 35.86  ? 2258 HOH A O   1 
HETATM 4681 O O   . HOH I 6 .   ? 10.672  49.233 54.450 1.00 50.13  ? 2259 HOH A O   1 
HETATM 4682 O O   . HOH I 6 .   ? 1.049   74.648 29.520 1.00 71.85  ? 2260 HOH A O   1 
HETATM 4683 O O   . HOH I 6 .   ? 5.971   75.462 29.292 1.00 79.81  ? 2261 HOH A O   1 
HETATM 4684 O O   . HOH I 6 .   ? 3.857   80.626 31.590 1.00 55.31  ? 2262 HOH A O   1 
HETATM 4685 O O   . HOH I 6 .   ? 7.331   45.803 37.618 1.00 67.74  ? 2263 HOH A O   1 
HETATM 4686 O O   . HOH I 6 .   ? 10.290  78.631 38.097 1.00 66.54  ? 2264 HOH A O   1 
HETATM 4687 O O   . HOH I 6 .   ? 8.257   78.653 34.900 1.00 66.98  ? 2265 HOH A O   1 
HETATM 4688 O O   . HOH I 6 .   ? 7.654   76.158 33.902 1.00 81.38  ? 2266 HOH A O   1 
HETATM 4689 O O   . HOH I 6 .   ? -1.208  70.067 52.115 1.00 35.01  ? 2267 HOH A O   1 
HETATM 4690 O O   . HOH I 6 .   ? 23.500  66.286 64.384 1.00 79.31  ? 2268 HOH A O   1 
HETATM 4691 O O   . HOH I 6 .   ? 26.182  70.292 67.873 1.00 66.34  ? 2269 HOH A O   1 
HETATM 4692 O O   . HOH I 6 .   ? -0.421  63.544 58.520 1.00 31.05  ? 2270 HOH A O   1 
HETATM 4693 O O   . HOH I 6 .   ? 13.484  68.262 85.194 1.00 59.91  ? 2271 HOH A O   1 
HETATM 4694 O O   . HOH I 6 .   ? 13.340  65.592 86.003 1.00 73.41  ? 2272 HOH A O   1 
HETATM 4695 O O   . HOH I 6 .   ? 3.743   63.728 64.706 1.00 117.26 ? 2273 HOH A O   1 
HETATM 4696 O O   . HOH I 6 .   ? 2.810   65.960 64.470 1.00 53.24  ? 2274 HOH A O   1 
HETATM 4697 O O   . HOH I 6 .   ? -6.651  61.857 64.531 1.00 32.32  ? 2275 HOH A O   1 
HETATM 4698 O O   . HOH I 6 .   ? -0.119  66.527 67.551 1.00 53.83  ? 2276 HOH A O   1 
HETATM 4699 O O   . HOH I 6 .   ? 12.460  78.397 77.578 1.00 65.44  ? 2277 HOH A O   1 
HETATM 4700 O O   . HOH I 6 .   ? 14.846  76.322 78.877 1.00 49.95  ? 2278 HOH A O   1 
HETATM 4701 O O   . HOH I 6 .   ? 0.226   67.985 63.857 1.00 29.15  ? 2279 HOH A O   1 
HETATM 4702 O O   . HOH I 6 .   ? 14.583  73.884 85.426 1.00 53.44  ? 2280 HOH A O   1 
HETATM 4703 O O   . HOH I 6 .   ? 15.674  76.236 81.369 1.00 69.83  ? 2281 HOH A O   1 
HETATM 4704 O O   . HOH I 6 .   ? 18.727  78.190 77.634 1.00 77.34  ? 2282 HOH A O   1 
HETATM 4705 O O   . HOH I 6 .   ? -6.931  68.522 57.244 1.00 37.82  ? 2283 HOH A O   1 
HETATM 4706 O O   . HOH I 6 .   ? 15.967  62.934 87.298 1.00 55.33  ? 2284 HOH A O   1 
HETATM 4707 O O   . HOH I 6 .   ? 20.537  64.643 85.487 1.00 49.56  ? 2285 HOH A O   1 
HETATM 4708 O O   . HOH I 6 .   ? -4.082  70.283 61.880 1.00 26.80  ? 2286 HOH A O   1 
HETATM 4709 O O   . HOH I 6 .   ? -7.852  71.721 52.070 1.00 39.66  ? 2287 HOH A O   1 
HETATM 4710 O O   . HOH I 6 .   ? -1.570  75.820 52.193 1.00 43.41  ? 2288 HOH A O   1 
HETATM 4711 O O   . HOH I 6 .   ? 19.089  59.487 90.400 1.00 76.65  ? 2289 HOH A O   1 
HETATM 4712 O O   . HOH I 6 .   ? 22.535  58.872 90.375 1.00 69.39  ? 2290 HOH A O   1 
HETATM 4713 O O   . HOH I 6 .   ? 8.671   57.728 85.303 1.00 83.32  ? 2291 HOH A O   1 
HETATM 4714 O O   . HOH I 6 .   ? 9.116   53.539 79.793 1.00 70.73  ? 2292 HOH A O   1 
HETATM 4715 O O   . HOH I 6 .   ? 1.012   83.269 57.042 1.00 60.24  ? 2293 HOH A O   1 
HETATM 4716 O O   . HOH I 6 .   ? -4.223  80.323 61.927 1.00 60.68  ? 2294 HOH A O   1 
HETATM 4717 O O   . HOH I 6 .   ? -2.183  78.235 61.769 1.00 42.00  ? 2295 HOH A O   1 
HETATM 4718 O O   . HOH I 6 .   ? -0.597  84.836 60.489 1.00 77.69  ? 2296 HOH A O   1 
HETATM 4719 O O   . HOH I 6 .   ? -3.797  80.761 57.558 1.00 48.46  ? 2297 HOH A O   1 
HETATM 4720 O O   . HOH I 6 .   ? 8.488   43.159 68.019 1.00 80.95  ? 2298 HOH A O   1 
HETATM 4721 O O   . HOH I 6 .   ? 7.672   42.664 70.978 1.00 40.92  ? 2299 HOH A O   1 
HETATM 4722 O O   . HOH I 6 .   ? 9.071   48.840 62.405 1.00 51.16  ? 2300 HOH A O   1 
HETATM 4723 O O   . HOH I 6 .   ? 14.832  46.265 62.075 1.00 50.19  ? 2301 HOH A O   1 
HETATM 4724 O O   . HOH I 6 .   ? 0.332   69.696 59.179 1.00 28.59  ? 2302 HOH A O   1 
HETATM 4725 O O   . HOH I 6 .   ? 3.997   69.194 57.622 1.00 36.62  ? 2303 HOH A O   1 
HETATM 4726 O O   . HOH I 6 .   ? -1.607  83.274 57.029 1.00 72.70  ? 2304 HOH A O   1 
HETATM 4727 O O   . HOH I 6 .   ? 26.262  46.174 77.061 1.00 43.86  ? 2305 HOH A O   1 
HETATM 4728 O O   . HOH I 6 .   ? -0.516  90.667 54.009 1.00 76.84  ? 2306 HOH A O   1 
HETATM 4729 O O   . HOH I 6 .   ? -3.550  85.670 53.650 1.00 62.44  ? 2307 HOH A O   1 
HETATM 4730 O O   . HOH I 6 .   ? -3.221  89.296 54.458 1.00 63.60  ? 2308 HOH A O   1 
HETATM 4731 O O   . HOH I 6 .   ? 1.005   88.927 55.363 1.00 84.07  ? 2309 HOH A O   1 
HETATM 4732 O O   . HOH I 6 .   ? 4.393   80.928 50.606 1.00 40.32  ? 2310 HOH A O   1 
HETATM 4733 O O   . HOH I 6 .   ? 33.706  63.642 83.574 1.00 51.22  ? 2311 HOH A O   1 
HETATM 4734 O O   . HOH I 6 .   ? 31.037  67.801 77.839 1.00 62.49  ? 2312 HOH A O   1 
HETATM 4735 O O   . HOH I 6 .   ? 27.891  63.375 86.117 1.00 74.32  ? 2313 HOH A O   1 
HETATM 4736 O O   . HOH I 6 .   ? 27.447  66.252 84.002 1.00 60.55  ? 2314 HOH A O   1 
HETATM 4737 O O   . HOH I 6 .   ? 32.485  61.778 86.167 1.00 71.42  ? 2315 HOH A O   1 
HETATM 4738 O O   . HOH I 6 .   ? 4.526   86.704 40.876 1.00 94.17  ? 2316 HOH A O   1 
HETATM 4739 O O   . HOH I 6 .   ? 27.583  68.097 75.685 1.00 50.13  ? 2317 HOH A O   1 
HETATM 4740 O O   . HOH I 6 .   ? 12.097  86.930 44.079 1.00 57.70  ? 2318 HOH A O   1 
HETATM 4741 O O   . HOH I 6 .   ? 29.906  66.825 74.278 1.00 81.61  ? 2319 HOH A O   1 
HETATM 4742 O O   . HOH I 6 .   ? 19.409  74.458 77.035 1.00 49.09  ? 2320 HOH A O   1 
HETATM 4743 O O   . HOH I 6 .   ? 13.174  83.715 47.189 1.00 47.62  ? 2321 HOH A O   1 
HETATM 4744 O O   . HOH I 6 .   ? 13.662  84.452 42.760 1.00 67.77  ? 2322 HOH A O   1 
HETATM 4745 O O   . HOH I 6 .   ? 11.559  80.040 39.764 1.00 72.02  ? 2323 HOH A O   1 
HETATM 4746 O O   . HOH I 6 .   ? 25.708  73.978 72.783 1.00 77.67  ? 2324 HOH A O   1 
HETATM 4747 O O   . HOH I 6 .   ? 8.945   88.312 41.263 1.00 65.85  ? 2325 HOH A O   1 
HETATM 4748 O O   . HOH I 6 .   ? 10.644  84.376 37.945 1.00 89.03  ? 2326 HOH A O   1 
HETATM 4749 O O   . HOH I 6 .   ? 8.713   80.547 37.410 1.00 58.91  ? 2327 HOH A O   1 
HETATM 4750 O O   . HOH I 6 .   ? 25.505  53.307 50.872 1.00 87.69  ? 2328 HOH A O   1 
HETATM 4751 O O   . HOH I 6 .   ? 25.724  53.016 48.238 1.00 87.00  ? 2329 HOH A O   1 
HETATM 4752 O O   . HOH I 6 .   ? 20.388  47.434 52.102 1.00 68.98  ? 2330 HOH A O   1 
HETATM 4753 O O   . HOH I 6 .   ? 24.152  60.324 39.460 1.00 61.83  ? 2331 HOH A O   1 
HETATM 4754 O O   . HOH I 6 .   ? 15.328  56.563 33.579 1.00 68.31  ? 2332 HOH A O   1 
HETATM 4755 O O   . HOH I 6 .   ? 19.799  54.899 35.551 1.00 71.52  ? 2333 HOH A O   1 
HETATM 4756 O O   . HOH I 6 .   ? 22.236  57.146 34.746 1.00 59.62  ? 2334 HOH A O   1 
HETATM 4757 O O   . HOH I 6 .   ? 25.248  72.345 64.627 1.00 49.41  ? 2335 HOH A O   1 
HETATM 4758 O O   . HOH I 6 .   ? 27.402  70.297 60.960 1.00 58.93  ? 2336 HOH A O   1 
HETATM 4759 O O   . HOH I 6 .   ? 25.493  77.923 65.426 1.00 81.33  ? 2337 HOH A O   1 
HETATM 4760 O O   . HOH I 6 .   ? 22.523  81.352 64.222 1.00 70.03  ? 2338 HOH A O   1 
HETATM 4761 O O   . HOH I 6 .   ? 19.888  83.728 64.888 1.00 68.90  ? 2339 HOH A O   1 
HETATM 4762 O O   . HOH I 6 .   ? 12.949  84.240 71.690 1.00 65.51  ? 2340 HOH A O   1 
HETATM 4763 O O   . HOH I 6 .   ? -13.497 58.185 55.929 1.00 34.77  ? 2341 HOH A O   1 
HETATM 4764 O O   . HOH I 6 .   ? -4.193  52.252 55.862 1.00 30.66  ? 2342 HOH A O   1 
HETATM 4765 O O   . HOH I 6 .   ? -5.766  45.335 57.078 1.00 35.65  ? 2343 HOH A O   1 
HETATM 4766 O O   . HOH I 6 .   ? -8.479  39.060 54.277 1.00 82.93  ? 2344 HOH A O   1 
HETATM 4767 O O   . HOH I 6 .   ? -6.387  46.577 51.359 1.00 63.42  ? 2345 HOH A O   1 
HETATM 4768 O O   . HOH I 6 .   ? -4.929  40.097 48.692 1.00 74.29  ? 2346 HOH A O   1 
HETATM 4769 O O   . HOH I 6 .   ? 7.294   82.521 65.451 1.00 65.09  ? 2347 HOH A O   1 
HETATM 4770 O O   . HOH I 6 .   ? -9.195  45.468 50.410 1.00 56.79  ? 2348 HOH A O   1 
HETATM 4771 O O   . HOH I 6 .   ? -16.464 44.932 54.218 1.00 51.14  ? 2349 HOH A O   1 
HETATM 4772 O O   . HOH I 6 .   ? 13.135  91.098 58.593 1.00 80.29  ? 2350 HOH A O   1 
HETATM 4773 O O   . HOH I 6 .   ? -13.556 51.506 48.813 1.00 53.84  ? 2351 HOH A O   1 
HETATM 4774 O O   . HOH I 6 .   ? 5.032   89.851 70.066 1.00 75.43  ? 2352 HOH A O   1 
HETATM 4775 O O   . HOH I 6 .   ? 8.556   92.347 71.835 1.00 86.60  ? 2353 HOH A O   1 
HETATM 4776 O O   . HOH I 6 .   ? 3.675   81.555 61.298 1.00 78.43  ? 2354 HOH A O   1 
HETATM 4777 O O   . HOH I 6 .   ? 17.584  94.043 59.949 1.00 72.55  ? 2355 HOH A O   1 
HETATM 4778 O O   . HOH I 6 .   ? 20.891  89.886 53.002 1.00 60.42  ? 2356 HOH A O   1 
HETATM 4779 O O   . HOH I 6 .   ? -6.328  50.813 48.889 1.00 50.30  ? 2357 HOH A O   1 
HETATM 4780 O O   . HOH I 6 .   ? 18.446  84.051 47.058 1.00 49.37  ? 2358 HOH A O   1 
HETATM 4781 O O   . HOH I 6 .   ? 18.885  87.940 50.338 1.00 44.55  ? 2359 HOH A O   1 
HETATM 4782 O O   . HOH I 6 .   ? 16.781  86.501 46.258 1.00 47.17  ? 2360 HOH A O   1 
HETATM 4783 O O   . HOH I 6 .   ? -7.903  58.275 44.086 1.00 56.44  ? 2361 HOH A O   1 
HETATM 4784 O O   . HOH I 6 .   ? 19.340  73.999 34.705 1.00 59.10  ? 2362 HOH A O   1 
HETATM 4785 O O   . HOH I 6 .   ? 20.991  85.727 38.572 1.00 91.32  ? 2363 HOH A O   1 
HETATM 4786 O O   . HOH I 6 .   ? 22.358  74.323 35.183 1.00 70.70  ? 2364 HOH A O   1 
HETATM 4787 O O   . HOH I 6 .   ? -3.407  52.418 43.830 1.00 40.40  ? 2365 HOH A O   1 
HETATM 4788 O O   . HOH I 6 .   ? -6.612  55.443 42.215 1.00 83.60  ? 2366 HOH A O   1 
HETATM 4789 O O   . HOH I 6 .   ? -10.094 63.862 40.152 1.00 72.20  ? 2367 HOH A O   1 
HETATM 4790 O O   . HOH I 6 .   ? 28.975  64.682 39.570 1.00 58.80  ? 2368 HOH A O   1 
HETATM 4791 O O   . HOH I 6 .   ? 30.179  64.105 42.691 1.00 85.16  ? 2369 HOH A O   1 
HETATM 4792 O O   . HOH I 6 .   ? 29.904  59.007 40.288 1.00 66.83  ? 2370 HOH A O   1 
HETATM 4793 O O   . HOH I 6 .   ? 28.809  54.309 41.951 1.00 71.08  ? 2371 HOH A O   1 
HETATM 4794 O O   . HOH I 6 .   ? -3.751  61.188 34.525 1.00 71.15  ? 2372 HOH A O   1 
HETATM 4795 O O   . HOH I 6 .   ? -6.160  59.226 39.450 1.00 63.26  ? 2373 HOH A O   1 
HETATM 4796 O O   . HOH I 6 .   ? -4.725  58.362 36.615 1.00 50.21  ? 2374 HOH A O   1 
HETATM 4797 O O   . HOH I 6 .   ? 25.644  52.327 53.925 1.00 74.09  ? 2375 HOH A O   1 
HETATM 4798 O O   . HOH I 6 .   ? 25.520  66.445 59.711 1.00 48.24  ? 2376 HOH A O   1 
HETATM 4799 O O   . HOH I 6 .   ? 24.534  85.397 59.533 1.00 92.42  ? 2377 HOH A O   1 
HETATM 4800 O O   . HOH I 6 .   ? -4.848  67.377 31.062 1.00 65.09  ? 2378 HOH A O   1 
HETATM 4801 O O   . HOH I 6 .   ? -0.015  66.422 36.258 1.00 47.70  ? 2379 HOH A O   1 
HETATM 4802 O O   . HOH I 6 .   ? 25.234  83.014 52.252 1.00 61.87  ? 2380 HOH A O   1 
HETATM 4803 O O   . HOH I 6 .   ? 36.325  73.314 56.517 1.00 75.93  ? 2381 HOH A O   1 
HETATM 4804 O O   . HOH I 6 .   ? 33.355  76.277 53.117 1.00 76.50  ? 2382 HOH A O   1 
HETATM 4805 O O   . HOH I 6 .   ? -9.911  65.488 37.654 1.00 37.23  ? 2383 HOH A O   1 
HETATM 4806 O O   . HOH I 6 .   ? -9.056  62.872 34.294 1.00 65.46  ? 2384 HOH A O   1 
HETATM 4807 O O   . HOH I 6 .   ? -6.231  65.355 31.737 1.00 77.27  ? 2385 HOH A O   1 
HETATM 4808 O O   . HOH I 6 .   ? 30.824  65.699 58.079 1.00 74.52  ? 2386 HOH A O   1 
HETATM 4809 O O   . HOH I 6 .   ? 28.334  51.826 54.129 1.00 50.22  ? 2387 HOH A O   1 
HETATM 4810 O O   . HOH I 6 .   ? -11.770 67.391 36.904 1.00 38.84  ? 2388 HOH A O   1 
HETATM 4811 O O   . HOH I 6 .   ? 25.293  64.997 61.983 1.00 74.23  ? 2389 HOH A O   1 
HETATM 4812 O O   . HOH I 6 .   ? 29.963  58.347 65.196 1.00 63.93  ? 2390 HOH A O   1 
HETATM 4813 O O   . HOH I 6 .   ? 31.212  59.806 62.472 1.00 52.29  ? 2391 HOH A O   1 
HETATM 4814 O O   . HOH I 6 .   ? -4.231  70.945 33.454 1.00 35.35  ? 2392 HOH A O   1 
HETATM 4815 O O   . HOH I 6 .   ? -2.705  70.051 28.929 1.00 62.72  ? 2393 HOH A O   1 
HETATM 4816 O O   . HOH I 6 .   ? 14.711  46.938 59.467 1.00 70.21  ? 2394 HOH A O   1 
HETATM 4817 O O   . HOH I 6 .   ? -7.128  80.253 31.745 1.00 48.32  ? 2395 HOH A O   1 
HETATM 4818 O O   . HOH I 6 .   ? 28.983  49.493 55.266 1.00 58.60  ? 2396 HOH A O   1 
HETATM 4819 O O   . HOH I 6 .   ? 27.221  46.617 57.096 1.00 53.64  ? 2397 HOH A O   1 
HETATM 4820 O O   . HOH I 6 .   ? -1.307  74.830 30.892 1.00 64.10  ? 2398 HOH A O   1 
HETATM 4821 O O   . HOH I 6 .   ? 22.859  64.897 21.985 1.00 69.77  ? 2399 HOH A O   1 
HETATM 4822 O O   . HOH I 6 .   ? 6.465   74.914 31.939 1.00 72.32  ? 2400 HOH A O   1 
HETATM 4823 O O   . HOH I 6 .   ? 1.957   71.486 28.931 1.00 55.75  ? 2401 HOH A O   1 
HETATM 4824 O O   . HOH I 6 .   ? 4.401   70.732 29.164 1.00 76.85  ? 2402 HOH A O   1 
HETATM 4825 O O   . HOH I 6 .   ? 17.348  32.641 68.514 1.00 68.95  ? 2403 HOH A O   1 
HETATM 4826 O O   . HOH I 6 .   ? 11.978  36.060 68.752 1.00 61.97  ? 2404 HOH A O   1 
HETATM 4827 O O   . HOH I 6 .   ? 3.947   67.207 36.185 1.00 40.58  ? 2405 HOH A O   1 
HETATM 4828 O O   . HOH I 6 .   ? -0.674  65.042 28.824 1.00 65.30  ? 2406 HOH A O   1 
HETATM 4829 O O   . HOH I 6 .   ? -2.165  67.300 31.378 1.00 51.03  ? 2407 HOH A O   1 
HETATM 4830 O O   . HOH I 6 .   ? 9.303   71.985 32.610 1.00 54.89  ? 2408 HOH A O   1 
HETATM 4831 O O   . HOH I 6 .   ? -0.754  51.561 41.967 1.00 60.94  ? 2409 HOH A O   1 
HETATM 4832 O O   . HOH I 6 .   ? -4.309  56.244 38.454 1.00 55.09  ? 2410 HOH A O   1 
HETATM 4833 O O   . HOH I 6 .   ? 8.158   50.116 36.984 1.00 47.76  ? 2411 HOH A O   1 
HETATM 4834 O O   . HOH I 6 .   ? 5.507   58.282 35.479 1.00 67.10  ? 2412 HOH A O   1 
HETATM 4835 O O   . HOH I 6 .   ? 0.087   57.451 37.601 1.00 50.28  ? 2413 HOH A O   1 
HETATM 4836 O O   . HOH I 6 .   ? 1.671   64.622 34.687 1.00 52.91  ? 2414 HOH A O   1 
HETATM 4837 O O   . HOH I 6 .   ? -0.856  58.280 33.041 1.00 54.10  ? 2415 HOH A O   1 
HETATM 4838 O O   . HOH I 6 .   ? -0.485  66.686 39.353 1.00 52.58  ? 2416 HOH A O   1 
HETATM 4839 O O   . HOH I 6 .   ? 4.412   64.737 34.731 1.00 38.41  ? 2417 HOH A O   1 
HETATM 4840 O O   . HOH I 6 .   ? 13.148  65.815 32.812 1.00 69.61  ? 2418 HOH A O   1 
HETATM 4841 O O   . HOH I 6 .   ? 11.793  64.594 34.965 1.00 55.69  ? 2419 HOH A O   1 
HETATM 4842 O O   . HOH I 6 .   ? 11.658  70.480 33.603 1.00 47.59  ? 2420 HOH A O   1 
HETATM 4843 O O   . HOH I 6 .   ? 14.267  51.281 55.780 1.00 49.31  ? 2421 HOH A O   1 
HETATM 4844 O O   . HOH I 6 .   ? 13.006  51.733 58.745 1.00 57.91  ? 2422 HOH A O   1 
HETATM 4845 O O   . HOH I 6 .   ? 7.293   52.749 56.125 1.00 33.62  ? 2423 HOH A O   1 
HETATM 4846 O O   . HOH I 6 .   ? 3.073   54.461 63.094 1.00 27.11  ? 2424 HOH A O   1 
HETATM 4847 O O   . HOH I 6 .   ? 6.466   48.648 55.405 1.00 40.59  ? 2425 HOH A O   1 
HETATM 4848 O O   . HOH I 6 .   ? 4.883   50.675 61.758 1.00 32.43  ? 2426 HOH A O   1 
HETATM 4849 O O   . HOH I 6 .   ? 2.477   41.593 61.363 1.00 54.70  ? 2427 HOH A O   1 
HETATM 4850 O O   . HOH I 6 .   ? 5.032   46.125 56.741 1.00 66.59  ? 2428 HOH A O   1 
HETATM 4851 O O   . HOH I 6 .   ? 2.623   40.316 58.500 1.00 49.78  ? 2429 HOH A O   1 
HETATM 4852 O O   . HOH I 6 .   ? 3.347   46.250 60.725 1.00 36.69  ? 2430 HOH A O   1 
HETATM 4853 O O   . HOH I 6 .   ? 1.299   43.750 54.653 1.00 33.88  ? 2431 HOH A O   1 
HETATM 4854 O O   . HOH I 6 .   ? 0.240   40.851 57.130 1.00 45.27  ? 2432 HOH A O   1 
HETATM 4855 O O   . HOH I 6 .   ? -4.505  40.466 62.129 1.00 50.70  ? 2433 HOH A O   1 
HETATM 4856 O O   . HOH I 6 .   ? 3.680   44.863 65.388 1.00 54.50  ? 2434 HOH A O   1 
HETATM 4857 O O   . HOH I 6 .   ? 0.239   41.928 63.627 1.00 42.53  ? 2435 HOH A O   1 
HETATM 4858 O O   . HOH I 6 .   ? 1.806   43.606 67.092 1.00 65.85  ? 2436 HOH A O   1 
HETATM 4859 O O   . HOH I 6 .   ? -6.524  49.792 60.735 1.00 30.93  ? 2437 HOH A O   1 
HETATM 4860 O O   . HOH I 6 .   ? -6.057  41.187 56.468 1.00 56.55  ? 2438 HOH A O   1 
HETATM 4861 O O   . HOH I 6 .   ? -10.801 40.173 61.468 1.00 71.94  ? 2439 HOH A O   1 
HETATM 4862 O O   . HOH I 6 .   ? -3.500  47.077 71.140 1.00 57.75  ? 2440 HOH A O   1 
HETATM 4863 O O   . HOH I 6 .   ? -0.220  43.101 69.365 1.00 59.88  ? 2441 HOH A O   1 
HETATM 4864 O O   . HOH I 6 .   ? -7.522  43.161 67.604 1.00 52.73  ? 2442 HOH A O   1 
HETATM 4865 O O   . HOH I 6 .   ? 3.423   47.844 65.109 1.00 33.30  ? 2443 HOH A O   1 
HETATM 4866 O O   . HOH I 6 .   ? 4.481   50.165 66.453 1.00 41.93  ? 2444 HOH A O   1 
HETATM 4867 O O   . HOH I 6 .   ? 3.446   51.912 63.865 1.00 31.19  ? 2445 HOH A O   1 
HETATM 4868 O O   . HOH I 6 .   ? -10.204 42.146 75.054 1.00 71.21  ? 2446 HOH A O   1 
HETATM 4869 O O   . HOH I 6 .   ? -19.079 53.011 71.987 1.00 56.49  ? 2447 HOH A O   1 
HETATM 4870 O O   . HOH I 6 .   ? -21.708 44.923 71.536 1.00 74.17  ? 2448 HOH A O   1 
HETATM 4871 O O   . HOH I 6 .   ? -16.254 44.859 71.336 1.00 65.61  ? 2449 HOH A O   1 
HETATM 4872 O O   . HOH I 6 .   ? -21.625 46.352 66.146 1.00 65.25  ? 2450 HOH A O   1 
HETATM 4873 O O   . HOH I 6 .   ? -18.227 40.686 69.240 1.00 65.47  ? 2451 HOH A O   1 
HETATM 4874 O O   . HOH I 6 .   ? -13.274 40.980 62.611 1.00 50.17  ? 2452 HOH A O   1 
HETATM 4875 O O   . HOH I 6 .   ? -16.741 36.961 65.654 1.00 74.57  ? 2453 HOH A O   1 
HETATM 4876 O O   . HOH I 6 .   ? -24.258 38.588 67.470 1.00 73.84  ? 2454 HOH A O   1 
HETATM 4877 O O   . HOH I 6 .   ? -15.006 39.228 58.014 1.00 68.01  ? 2455 HOH A O   1 
HETATM 4878 O O   . HOH I 6 .   ? -23.374 42.486 58.875 1.00 81.01  ? 2456 HOH A O   1 
HETATM 4879 O O   . HOH I 6 .   ? -21.307 47.597 57.016 1.00 69.22  ? 2457 HOH A O   1 
HETATM 4880 O O   . HOH I 6 .   ? -21.521 39.059 56.997 1.00 79.33  ? 2458 HOH A O   1 
HETATM 4881 O O   . HOH I 6 .   ? -24.283 50.201 64.459 1.00 87.05  ? 2459 HOH A O   1 
HETATM 4882 O O   . HOH I 6 .   ? -22.738 51.614 66.141 1.00 95.90  ? 2460 HOH A O   1 
HETATM 4883 O O   . HOH I 6 .   ? -20.068 57.374 58.972 1.00 46.01  ? 2461 HOH A O   1 
HETATM 4884 O O   . HOH I 6 .   ? -22.361 50.355 56.386 1.00 70.94  ? 2462 HOH A O   1 
HETATM 4885 O O   . HOH I 6 .   ? -23.375 58.447 67.313 1.00 76.72  ? 2463 HOH A O   1 
HETATM 4886 O O   . HOH I 6 .   ? -23.395 52.816 56.947 1.00 77.77  ? 2464 HOH A O   1 
HETATM 4887 O O   . HOH I 6 .   ? -22.171 55.019 70.736 1.00 67.74  ? 2465 HOH A O   1 
HETATM 4888 O O   . HOH I 6 .   ? -21.847 50.045 70.481 1.00 70.73  ? 2466 HOH A O   1 
HETATM 4889 O O   . HOH I 6 .   ? -21.844 59.321 62.108 1.00 59.89  ? 2467 HOH A O   1 
HETATM 4890 O O   . HOH I 6 .   ? -21.881 66.404 67.386 1.00 87.46  ? 2468 HOH A O   1 
HETATM 4891 O O   . HOH I 6 .   ? -24.453 61.846 70.109 1.00 79.22  ? 2469 HOH A O   1 
HETATM 4892 O O   . HOH I 6 .   ? -17.600 64.526 66.551 1.00 52.07  ? 2470 HOH A O   1 
HETATM 4893 O O   . HOH I 6 .   ? -10.467 66.084 68.270 1.00 42.91  ? 2471 HOH A O   1 
HETATM 4894 O O   . HOH I 6 .   ? -14.235 65.899 66.574 1.00 59.98  ? 2472 HOH A O   1 
HETATM 4895 O O   . HOH I 6 .   ? -8.899  63.251 71.825 1.00 39.47  ? 2473 HOH A O   1 
HETATM 4896 O O   . HOH I 6 .   ? -18.254 56.089 72.809 1.00 60.50  ? 2474 HOH A O   1 
HETATM 4897 O O   . HOH I 6 .   ? -15.642 57.478 72.373 1.00 68.82  ? 2475 HOH A O   1 
HETATM 4898 O O   . HOH I 6 .   ? -21.792 61.937 71.022 1.00 79.80  ? 2476 HOH A O   1 
HETATM 4899 O O   . HOH I 6 .   ? -7.429  61.090 71.915 1.00 62.44  ? 2477 HOH A O   1 
HETATM 4900 O O   . HOH I 6 .   ? -6.889  57.330 72.816 1.00 49.03  ? 2478 HOH A O   1 
HETATM 4901 O O   . HOH I 6 .   ? -14.409 64.612 73.450 1.00 60.22  ? 2479 HOH A O   1 
HETATM 4902 O O   . HOH I 6 .   ? -10.300 63.344 73.996 1.00 63.65  ? 2480 HOH A O   1 
HETATM 4903 O O   . HOH I 6 .   ? -9.132  58.563 64.135 1.00 32.05  ? 2481 HOH A O   1 
HETATM 4904 O O   . HOH I 6 .   ? -3.802  57.342 63.533 1.00 35.70  ? 2482 HOH A O   1 
HETATM 4905 O O   . HOH I 6 .   ? -1.838  52.304 72.988 1.00 71.38  ? 2483 HOH A O   1 
HETATM 4906 O O   . HOH I 6 .   ? -0.860  55.413 73.196 1.00 53.51  ? 2484 HOH A O   1 
HETATM 4907 O O   . HOH I 6 .   ? -7.149  49.361 73.649 1.00 42.13  ? 2485 HOH A O   1 
HETATM 4908 O O   . HOH I 6 .   ? -1.382  46.907 73.924 1.00 63.21  ? 2486 HOH A O   1 
HETATM 4909 O O   . HOH I 6 .   ? 1.447   44.041 71.015 1.00 63.96  ? 2487 HOH A O   1 
HETATM 4910 O O   . HOH I 6 .   ? 3.533   50.694 68.984 1.00 37.18  ? 2488 HOH A O   1 
HETATM 4911 O O   . HOH I 6 .   ? 1.428   53.141 73.258 1.00 62.31  ? 2489 HOH A O   1 
HETATM 4912 O O   . HOH I 6 .   ? 8.493   49.729 74.867 1.00 48.31  ? 2490 HOH A O   1 
HETATM 4913 O O   . HOH I 6 .   ? 5.470   48.046 75.232 1.00 52.91  ? 2491 HOH A O   1 
HETATM 4914 O O   . HOH I 6 .   ? 4.957   54.414 80.069 1.00 40.69  ? 2492 HOH A O   1 
HETATM 4915 O O   . HOH I 6 .   ? 4.164   55.950 77.818 1.00 35.02  ? 2493 HOH A O   1 
HETATM 4916 O O   . HOH I 6 .   ? 3.509   58.325 73.834 1.00 58.25  ? 2494 HOH A O   1 
HETATM 4917 O O   . HOH I 6 .   ? 3.892   56.761 69.979 1.00 44.81  ? 2495 HOH A O   1 
HETATM 4918 O O   . HOH I 6 .   ? 1.619   56.829 72.710 1.00 48.51  ? 2496 HOH A O   1 
HETATM 4919 O O   . HOH I 6 .   ? 4.956   59.787 69.522 1.00 40.82  ? 2497 HOH A O   1 
HETATM 4920 O O   . HOH I 6 .   ? 6.926   49.688 65.946 1.00 55.34  ? 2498 HOH A O   1 
HETATM 4921 O O   . HOH I 6 .   ? -3.744  50.257 61.556 1.00 42.33  ? 2499 HOH A O   1 
HETATM 4922 O O   . HOH I 6 .   ? -2.274  57.669 66.242 1.00 44.02  ? 2500 HOH A O   1 
HETATM 4923 O O   . HOH I 6 .   ? -1.674  57.964 62.124 1.00 31.75  ? 2501 HOH A O   1 
HETATM 4924 O O   . HOH I 6 .   ? -3.435  51.246 59.104 1.00 31.23  ? 2502 HOH A O   1 
HETATM 4925 O O   . HOH I 6 .   ? -5.758  48.021 49.298 1.00 51.19  ? 2503 HOH A O   1 
HETATM 4926 O O   . HOH I 6 .   ? -0.269  41.826 50.695 1.00 43.24  ? 2504 HOH A O   1 
HETATM 4927 O O   . HOH I 6 .   ? -7.068  48.764 44.706 1.00 73.34  ? 2505 HOH A O   1 
HETATM 4928 O O   . HOH I 6 .   ? -5.216  51.087 46.141 1.00 52.06  ? 2506 HOH A O   1 
HETATM 4929 O O   . HOH I 6 .   ? 2.046   41.814 47.838 1.00 70.05  ? 2507 HOH A O   1 
HETATM 4930 O O   . HOH I 6 .   ? 7.746   45.588 43.465 1.00 75.59  ? 2508 HOH A O   1 
HETATM 4931 O O   . HOH I 6 .   ? 7.035   41.603 49.025 1.00 55.13  ? 2509 HOH A O   1 
HETATM 4932 O O   . HOH I 6 .   ? 11.288  42.346 51.331 1.00 61.90  ? 2510 HOH A O   1 
HETATM 4933 O O   . HOH I 6 .   ? 7.339   47.161 53.260 1.00 29.43  ? 2511 HOH A O   1 
HETATM 4934 O O   . HOH I 6 .   ? 13.046  49.751 53.449 1.00 65.51  ? 2512 HOH A O   1 
HETATM 4935 O O   . HOH I 6 .   ? 9.958   46.948 53.151 1.00 44.86  ? 2513 HOH A O   1 
HETATM 4936 O O   . HOH I 6 .   ? 13.611  42.956 49.686 1.00 58.20  ? 2514 HOH A O   1 
HETATM 4937 O O   . HOH I 6 .   ? 13.949  43.317 44.788 1.00 47.05  ? 2515 HOH A O   1 
HETATM 4938 O O   . HOH I 6 .   ? 9.041   40.682 46.089 1.00 57.23  ? 2516 HOH A O   1 
HETATM 4939 O O   . HOH I 6 .   ? 14.613  42.747 47.341 1.00 64.18  ? 2517 HOH A O   1 
HETATM 4940 O O   . HOH I 6 .   ? 12.423  47.262 37.497 1.00 65.52  ? 2518 HOH A O   1 
HETATM 4941 O O   . HOH I 6 .   ? 15.924  45.362 38.604 1.00 70.71  ? 2519 HOH A O   1 
HETATM 4942 O O   . HOH I 6 .   ? 9.984   44.797 42.915 1.00 61.94  ? 2520 HOH A O   1 
HETATM 4943 O O   . HOH I 6 .   ? 10.605  45.561 39.186 1.00 59.74  ? 2521 HOH A O   1 
HETATM 4944 O O   . HOH I 6 .   ? 9.904   47.560 37.814 1.00 64.03  ? 2522 HOH A O   1 
HETATM 4945 O O   . HOH I 6 .   ? 6.050   48.710 37.492 1.00 50.35  ? 2523 HOH A O   1 
HETATM 4946 O O   . HOH I 6 .   ? 5.045   46.921 39.978 1.00 44.06  ? 2524 HOH A O   1 
HETATM 4947 O O   . HOH I 6 .   ? 9.375   62.421 35.478 1.00 63.84  ? 2525 HOH A O   1 
HETATM 4948 O O   . HOH I 6 .   ? 6.695   62.761 34.710 1.00 48.10  ? 2526 HOH A O   1 
HETATM 4949 O O   . HOH I 6 .   ? 14.270  49.294 37.008 1.00 64.21  ? 2527 HOH A O   1 
HETATM 4950 O O   . HOH I 6 .   ? 11.562  49.387 36.181 1.00 71.94  ? 2528 HOH A O   1 
HETATM 4951 O O   . HOH I 6 .   ? 11.284  61.355 34.396 1.00 70.36  ? 2529 HOH A O   1 
HETATM 4952 O O   . HOH I 6 .   ? 9.644   56.412 35.764 1.00 41.04  ? 2530 HOH A O   1 
HETATM 4953 O O   . HOH I 6 .   ? 10.061  51.581 36.779 1.00 57.69  ? 2531 HOH A O   1 
HETATM 4954 O O   . HOH I 6 .   ? 24.052  70.464 69.502 1.00 62.94  ? 2532 HOH A O   1 
HETATM 4955 O O   . HOH I 6 .   ? 21.373  65.006 63.541 1.00 48.04  ? 2533 HOH A O   1 
HETATM 4956 O O   . HOH I 6 .   ? 12.038  67.334 66.731 1.00 35.09  ? 2534 HOH A O   1 
HETATM 4957 O O   . HOH I 6 .   ? 21.280  71.770 67.746 1.00 42.19  ? 2535 HOH A O   1 
HETATM 4958 O O   . HOH I 6 .   ? 19.321  65.541 68.296 1.00 47.66  ? 2536 HOH A O   1 
HETATM 4959 O O   . HOH I 6 .   ? 21.401  66.570 66.841 1.00 92.00  ? 2537 HOH A O   1 
HETATM 4960 O O   . HOH I 6 .   ? 10.795  64.318 67.506 1.00 99.02  ? 2538 HOH A O   1 
HETATM 4961 O O   . HOH I 6 .   ? 5.686   61.388 71.623 1.00 49.74  ? 2539 HOH A O   1 
HETATM 4962 O O   . HOH I 6 .   ? 2.055   64.455 76.469 1.00 57.68  ? 2540 HOH A O   1 
HETATM 4963 O O   . HOH I 6 .   ? 3.703   61.224 73.350 1.00 61.27  ? 2541 HOH A O   1 
HETATM 4964 O O   . HOH I 6 .   ? 4.621   57.600 75.933 1.00 34.41  ? 2542 HOH A O   1 
HETATM 4965 O O   . HOH I 6 .   ? 13.165  59.539 78.764 1.00 40.71  ? 2543 HOH A O   1 
HETATM 4966 O O   . HOH I 6 .   ? 14.768  65.556 83.616 1.00 39.02  ? 2544 HOH A O   1 
HETATM 4967 O O   . HOH I 6 .   ? 11.799  67.545 82.938 1.00 41.58  ? 2545 HOH A O   1 
HETATM 4968 O O   . HOH I 6 .   ? 6.989   66.195 81.442 1.00 45.15  ? 2546 HOH A O   1 
HETATM 4969 O O   . HOH I 6 .   ? 12.838  74.979 78.760 1.00 93.85  ? 2547 HOH A O   1 
HETATM 4970 O O   . HOH I 6 .   ? 10.338  76.719 77.602 1.00 43.28  ? 2548 HOH A O   1 
HETATM 4971 O O   . HOH I 6 .   ? 5.831   78.177 80.409 1.00 64.00  ? 2549 HOH A O   1 
HETATM 4972 O O   . HOH I 6 .   ? 7.632   72.341 81.789 1.00 37.50  ? 2550 HOH A O   1 
HETATM 4973 O O   . HOH I 6 .   ? 13.538  76.148 84.128 1.00 103.16 ? 2551 HOH A O   1 
HETATM 4974 O O   . HOH I 6 .   ? 4.482   74.806 80.821 1.00 77.69  ? 2552 HOH A O   1 
HETATM 4975 O O   . HOH I 6 .   ? 16.941  72.230 83.965 1.00 67.54  ? 2553 HOH A O   1 
HETATM 4976 O O   . HOH I 6 .   ? 17.559  77.274 79.900 1.00 76.00  ? 2554 HOH A O   1 
HETATM 4977 O O   . HOH I 6 .   ? 16.837  69.348 84.092 1.00 54.87  ? 2555 HOH A O   1 
HETATM 4978 O O   . HOH I 6 .   ? 17.809  64.650 86.467 1.00 74.94  ? 2556 HOH A O   1 
HETATM 4979 O O   . HOH I 6 .   ? 15.717  59.806 87.248 1.00 63.11  ? 2557 HOH A O   1 
HETATM 4980 O O   . HOH I 6 .   ? 21.017  52.728 79.415 1.00 76.90  ? 2558 HOH A O   1 
HETATM 4981 O O   . HOH I 6 .   ? 23.198  52.187 80.719 1.00 61.82  ? 2559 HOH A O   1 
HETATM 4982 O O   . HOH I 6 .   ? 20.509  57.956 87.473 1.00 111.32 ? 2560 HOH A O   1 
HETATM 4983 O O   . HOH I 6 .   ? 16.701  59.068 89.681 1.00 64.78  ? 2561 HOH A O   1 
HETATM 4984 O O   . HOH I 6 .   ? 11.814  62.061 85.564 1.00 62.76  ? 2562 HOH A O   1 
HETATM 4985 O O   . HOH I 6 .   ? 15.862  62.669 84.136 1.00 49.80  ? 2563 HOH A O   1 
HETATM 4986 O O   . HOH I 6 .   ? 11.397  58.923 86.240 1.00 65.34  ? 2564 HOH A O   1 
HETATM 4987 O O   . HOH I 6 .   ? 12.005  56.504 84.417 1.00 56.69  ? 2565 HOH A O   1 
HETATM 4988 O O   . HOH I 6 .   ? 16.534  49.951 77.818 1.00 46.05  ? 2566 HOH A O   1 
HETATM 4989 O O   . HOH I 6 .   ? 13.476  50.223 80.762 1.00 71.04  ? 2567 HOH A O   1 
HETATM 4990 O O   . HOH I 6 .   ? 10.680  52.230 78.414 1.00 71.17  ? 2568 HOH A O   1 
HETATM 4991 O O   . HOH I 6 .   ? 11.658  46.011 74.826 1.00 63.05  ? 2569 HOH A O   1 
HETATM 4992 O O   . HOH I 6 .   ? 10.575  55.831 68.271 1.00 33.29  ? 2570 HOH A O   1 
HETATM 4993 O O   . HOH I 6 .   ? 11.448  47.894 73.239 1.00 75.84  ? 2571 HOH A O   1 
HETATM 4994 O O   . HOH I 6 .   ? 10.567  44.688 71.114 1.00 66.82  ? 2572 HOH A O   1 
HETATM 4995 O O   . HOH I 6 .   ? 8.230   44.774 70.022 1.00 57.51  ? 2573 HOH A O   1 
HETATM 4996 O O   . HOH I 6 .   ? 8.276   47.924 73.148 1.00 74.85  ? 2574 HOH A O   1 
HETATM 4997 O O   . HOH I 6 .   ? 13.417  41.872 68.421 1.00 60.84  ? 2575 HOH A O   1 
HETATM 4998 O O   . HOH I 6 .   ? 15.116  48.519 63.476 1.00 44.84  ? 2576 HOH A O   1 
HETATM 4999 O O   . HOH I 6 .   ? 12.520  49.352 62.440 1.00 66.25  ? 2577 HOH A O   1 
HETATM 5000 O O   . HOH I 6 .   ? 12.194  43.559 65.838 1.00 61.63  ? 2578 HOH A O   1 
HETATM 5001 O O   . HOH I 6 .   ? 13.384  43.717 75.648 1.00 64.54  ? 2579 HOH A O   1 
HETATM 5002 O O   . HOH I 6 .   ? 13.944  40.328 75.273 1.00 53.48  ? 2580 HOH A O   1 
HETATM 5003 O O   . HOH I 6 .   ? 13.359  44.786 77.916 1.00 82.16  ? 2581 HOH A O   1 
HETATM 5004 O O   . HOH I 6 .   ? 18.033  39.707 74.238 1.00 49.04  ? 2582 HOH A O   1 
HETATM 5005 O O   . HOH I 6 .   ? 24.786  48.353 76.430 1.00 49.55  ? 2583 HOH A O   1 
HETATM 5006 O O   . HOH I 6 .   ? 25.037  43.955 77.283 1.00 53.09  ? 2584 HOH A O   1 
HETATM 5007 O O   . HOH I 6 .   ? 18.880  51.301 78.570 1.00 69.59  ? 2585 HOH A O   1 
HETATM 5008 O O   . HOH I 6 .   ? 26.424  58.372 68.141 1.00 83.99  ? 2586 HOH A O   1 
HETATM 5009 O O   . HOH I 6 .   ? 26.503  48.927 69.217 1.00 54.91  ? 2587 HOH A O   1 
HETATM 5010 O O   . HOH I 6 .   ? 29.530  55.028 69.092 1.00 76.96  ? 2588 HOH A O   1 
HETATM 5011 O O   . HOH I 6 .   ? 30.438  62.377 74.132 1.00 78.77  ? 2589 HOH A O   1 
HETATM 5012 O O   . HOH I 6 .   ? 26.534  59.825 76.464 1.00 56.85  ? 2590 HOH A O   1 
HETATM 5013 O O   . HOH I 6 .   ? 34.034  61.928 77.906 1.00 59.74  ? 2591 HOH A O   1 
HETATM 5014 O O   . HOH I 6 .   ? 34.514  63.088 80.860 1.00 69.82  ? 2592 HOH A O   1 
HETATM 5015 O O   . HOH I 6 .   ? 35.950  59.036 83.124 1.00 55.22  ? 2593 HOH A O   1 
HETATM 5016 O O   . HOH I 6 .   ? 29.889  65.645 83.349 1.00 55.76  ? 2594 HOH A O   1 
HETATM 5017 O O   . HOH I 6 .   ? 29.150  61.177 84.087 1.00 56.95  ? 2595 HOH A O   1 
HETATM 5018 O O   . HOH I 6 .   ? 31.710  67.045 80.283 1.00 64.15  ? 2596 HOH A O   1 
HETATM 5019 O O   . HOH I 6 .   ? 31.216  57.175 83.483 1.00 80.82  ? 2597 HOH A O   1 
HETATM 5020 O O   . HOH I 6 .   ? 30.320  59.179 85.411 1.00 66.21  ? 2598 HOH A O   1 
HETATM 5021 O O   . HOH I 6 .   ? 21.971  59.706 86.248 1.00 59.60  ? 2599 HOH A O   1 
HETATM 5022 O O   . HOH I 6 .   ? 25.794  68.219 82.174 1.00 58.70  ? 2600 HOH A O   1 
HETATM 5023 O O   . HOH I 6 .   ? 28.118  68.200 78.315 1.00 61.45  ? 2601 HOH A O   1 
HETATM 5024 O O   . HOH I 6 .   ? 24.616  66.590 84.155 1.00 55.52  ? 2602 HOH A O   1 
HETATM 5025 O O   . HOH I 6 .   ? 25.203  62.344 73.680 1.00 48.63  ? 2603 HOH A O   1 
HETATM 5026 O O   . HOH I 6 .   ? 32.932  66.044 75.970 1.00 73.78  ? 2604 HOH A O   1 
HETATM 5027 O O   . HOH I 6 .   ? 23.840  58.648 76.718 1.00 52.59  ? 2605 HOH A O   1 
HETATM 5028 O O   . HOH I 6 .   ? 26.111  60.552 78.940 1.00 69.94  ? 2606 HOH A O   1 
HETATM 5029 O O   . HOH I 6 .   ? 21.258  72.518 78.245 1.00 55.04  ? 2607 HOH A O   1 
HETATM 5030 O O   . HOH I 6 .   ? 22.552  72.236 75.746 1.00 46.03  ? 2608 HOH A O   1 
HETATM 5031 O O   . HOH I 6 .   ? 18.307  67.471 72.848 1.00 34.17  ? 2609 HOH A O   1 
HETATM 5032 O O   . HOH I 6 .   ? 23.744  70.605 73.773 1.00 39.73  ? 2610 HOH A O   1 
HETATM 5033 O O   . HOH I 6 .   ? 25.324  66.806 74.281 1.00 49.45  ? 2611 HOH A O   1 
HETATM 5034 O O   . HOH I 6 .   ? 17.613  64.012 66.010 1.00 49.91  ? 2612 HOH A O   1 
HETATM 5035 O O   . HOH I 6 .   ? 26.177  63.440 67.457 1.00 74.58  ? 2613 HOH A O   1 
HETATM 5036 O O   . HOH I 6 .   ? 24.110  65.466 66.836 1.00 72.95  ? 2614 HOH A O   1 
HETATM 5037 O O   . HOH I 6 .   ? 24.585  60.673 71.153 1.00 81.64  ? 2615 HOH A O   1 
HETATM 5038 O O   . HOH I 6 .   ? 20.464  62.895 64.883 1.00 32.57  ? 2616 HOH A O   1 
HETATM 5039 O O   . HOH I 6 .   ? 15.699  52.948 61.405 1.00 37.50  ? 2617 HOH A O   1 
HETATM 5040 O O   . HOH I 6 .   ? 12.836  59.819 56.701 1.00 58.67  ? 2618 HOH A O   1 
HETATM 5041 O O   . HOH I 6 .   ? 21.272  51.951 53.490 1.00 44.75  ? 2619 HOH A O   1 
HETATM 5042 O O   . HOH I 6 .   ? 22.021  51.967 48.948 1.00 65.51  ? 2620 HOH A O   1 
HETATM 5043 O O   . HOH I 6 .   ? 24.303  55.625 54.784 1.00 46.59  ? 2621 HOH A O   1 
HETATM 5044 O O   . HOH I 6 .   ? 25.422  55.535 47.749 1.00 77.77  ? 2622 HOH A O   1 
HETATM 5045 O O   . HOH I 6 .   ? 22.609  54.169 52.891 1.00 60.83  ? 2623 HOH A O   1 
HETATM 5046 O O   . HOH I 6 .   ? 21.813  49.694 47.734 1.00 81.57  ? 2624 HOH A O   1 
HETATM 5047 O O   . HOH I 6 .   ? 17.993  50.756 44.727 1.00 36.25  ? 2625 HOH A O   1 
HETATM 5048 O O   . HOH I 6 .   ? 19.947  45.644 50.244 1.00 75.30  ? 2626 HOH A O   1 
HETATM 5049 O O   . HOH I 6 .   ? 20.889  59.288 40.594 1.00 49.35  ? 2627 HOH A O   1 
HETATM 5050 O O   . HOH I 6 .   ? 23.942  51.723 46.368 1.00 81.34  ? 2628 HOH A O   1 
HETATM 5051 O O   . HOH I 6 .   ? 20.996  48.268 42.006 1.00 69.51  ? 2629 HOH A O   1 
HETATM 5052 O O   . HOH I 6 .   ? 19.745  48.528 44.832 1.00 64.69  ? 2630 HOH A O   1 
HETATM 5053 O O   . HOH I 6 .   ? 16.935  57.715 35.382 1.00 39.36  ? 2631 HOH A O   1 
HETATM 5054 O O   . HOH I 6 .   ? 20.689  56.558 37.584 1.00 67.02  ? 2632 HOH A O   1 
HETATM 5055 O O   . HOH I 6 .   ? 16.201  64.625 31.829 1.00 86.87  ? 2633 HOH A O   1 
HETATM 5056 O O   . HOH I 6 .   ? 13.983  62.441 33.349 1.00 65.85  ? 2634 HOH A O   1 
HETATM 5057 O O   . HOH I 6 .   ? 19.398  65.820 36.641 1.00 55.70  ? 2635 HOH A O   1 
HETATM 5058 O O   . HOH I 6 .   ? 18.612  60.219 41.474 1.00 31.08  ? 2636 HOH A O   1 
HETATM 5059 O O   . HOH I 6 .   ? 24.167  69.866 39.842 1.00 57.14  ? 2637 HOH A O   1 
HETATM 5060 O O   . HOH I 6 .   ? 13.796  69.113 56.551 1.00 33.95  ? 2638 HOH A O   1 
HETATM 5061 O O   . HOH I 6 .   ? 23.888  76.922 63.171 1.00 59.90  ? 2639 HOH A O   1 
HETATM 5062 O O   . HOH I 6 .   ? 24.965  70.517 62.560 1.00 46.55  ? 2640 HOH A O   1 
HETATM 5063 O O   . HOH I 6 .   ? 22.624  73.556 65.452 1.00 49.34  ? 2641 HOH A O   1 
HETATM 5064 O O   . HOH I 6 .   ? 23.022  79.125 61.250 1.00 57.29  ? 2642 HOH A O   1 
HETATM 5065 O O   . HOH I 6 .   ? 14.600  76.640 63.067 1.00 48.18  ? 2643 HOH A O   1 
HETATM 5066 O O   . HOH I 6 .   ? 20.362  80.728 65.734 1.00 60.78  ? 2644 HOH A O   1 
HETATM 5067 O O   . HOH I 6 .   ? 16.473  80.341 69.440 1.00 58.13  ? 2645 HOH A O   1 
HETATM 5068 O O   . HOH I 6 .   ? 21.658  77.984 64.387 1.00 61.64  ? 2646 HOH A O   1 
HETATM 5069 O O   . HOH I 6 .   ? 12.978  86.220 69.640 1.00 70.92  ? 2647 HOH A O   1 
HETATM 5070 O O   . HOH I 6 .   ? 10.594  83.441 72.058 1.00 70.55  ? 2648 HOH A O   1 
HETATM 5071 O O   . HOH I 6 .   ? 14.554  80.837 71.002 1.00 74.14  ? 2649 HOH A O   1 
HETATM 5072 O O   . HOH I 6 .   ? 8.562   80.881 74.545 1.00 67.52  ? 2650 HOH A O   1 
HETATM 5073 O O   . HOH I 6 .   ? 8.447   76.930 75.481 1.00 40.10  ? 2651 HOH A O   1 
HETATM 5074 O O   . HOH I 6 .   ? 8.645   79.363 67.187 1.00 58.12  ? 2652 HOH A O   1 
HETATM 5075 O O   . HOH I 6 .   ? 12.758  79.695 74.677 1.00 46.14  ? 2653 HOH A O   1 
HETATM 5076 O O   . HOH I 6 .   ? 20.405  78.027 75.151 1.00 67.31  ? 2654 HOH A O   1 
HETATM 5077 O O   . HOH I 6 .   ? 14.911  80.002 73.481 1.00 86.84  ? 2655 HOH A O   1 
HETATM 5078 O O   . HOH I 6 .   ? 19.796  79.449 70.052 1.00 69.55  ? 2656 HOH A O   1 
HETATM 5079 O O   . HOH I 6 .   ? 19.120  75.036 70.518 1.00 52.93  ? 2657 HOH A O   1 
HETATM 5080 O O   . HOH I 6 .   ? 15.216  77.779 76.341 1.00 34.03  ? 2658 HOH A O   1 
HETATM 5081 O O   . HOH I 6 .   ? 16.642  74.314 77.316 1.00 39.13  ? 2659 HOH A O   1 
HETATM 5082 O O   . HOH I 6 .   ? 14.143  74.468 65.668 1.00 51.77  ? 2660 HOH A O   1 
HETATM 5083 O O   . HOH I 6 .   ? 7.497   68.052 64.896 1.00 69.77  ? 2661 HOH A O   1 
HETATM 5084 O O   . HOH I 6 .   ? 10.960  68.705 59.267 1.00 37.78  ? 2662 HOH A O   1 
HETATM 5085 O O   . HOH I 6 .   ? 12.491  77.857 62.183 1.00 54.00  ? 2663 HOH A O   1 
HETATM 5086 O O   . HOH I 6 .   ? 8.173   75.914 60.357 1.00 39.33  ? 2664 HOH A O   1 
HETATM 5087 O O   . HOH I 6 .   ? 10.313  80.344 64.640 1.00 45.08  ? 2665 HOH A O   1 
HETATM 5088 O O   . HOH I 6 .   ? 6.920   79.470 63.909 1.00 55.36  ? 2666 HOH A O   1 
HETATM 5089 O O   . HOH I 6 .   ? 11.648  88.755 59.021 1.00 74.39  ? 2667 HOH A O   1 
HETATM 5090 O O   . HOH I 6 .   ? 7.280   92.873 55.120 1.00 73.19  ? 2668 HOH A O   1 
HETATM 5091 O O   . HOH I 6 .   ? 10.570  91.115 53.227 1.00 66.52  ? 2669 HOH A O   1 
HETATM 5092 O O   . HOH I 6 .   ? 11.616  91.495 61.893 1.00 77.61  ? 2670 HOH A O   1 
HETATM 5093 O O   . HOH I 6 .   ? 3.955   92.072 55.345 1.00 72.80  ? 2671 HOH A O   1 
HETATM 5094 O O   . HOH I 6 .   ? 1.733   90.581 58.655 1.00 88.08  ? 2672 HOH A O   1 
HETATM 5095 O O   . HOH I 6 .   ? 10.126  88.908 61.036 1.00 62.31  ? 2673 HOH A O   1 
HETATM 5096 O O   . HOH I 6 .   ? 7.418   90.818 69.184 1.00 81.66  ? 2674 HOH A O   1 
HETATM 5097 O O   . HOH I 6 .   ? 14.118  87.235 66.576 1.00 54.42  ? 2675 HOH A O   1 
HETATM 5098 O O   . HOH I 6 .   ? 5.674   89.333 67.741 1.00 69.70  ? 2676 HOH A O   1 
HETATM 5099 O O   . HOH I 6 .   ? 8.535   94.625 64.132 1.00 77.29  ? 2677 HOH A O   1 
HETATM 5100 O O   . HOH I 6 .   ? 6.609   81.763 62.498 1.00 75.50  ? 2678 HOH A O   1 
HETATM 5101 O O   . HOH I 6 .   ? 15.191  91.174 64.484 1.00 79.13  ? 2679 HOH A O   1 
HETATM 5102 O O   . HOH I 6 .   ? 19.876  84.712 62.033 1.00 33.93  ? 2680 HOH A O   1 
HETATM 5103 O O   . HOH I 6 .   ? 18.232  89.835 54.428 1.00 59.45  ? 2681 HOH A O   1 
HETATM 5104 O O   . HOH I 6 .   ? 19.081  91.213 61.636 1.00 61.45  ? 2682 HOH A O   1 
HETATM 5105 O O   . HOH I 6 .   ? 21.499  89.004 55.580 1.00 59.40  ? 2683 HOH A O   1 
HETATM 5106 O O   . HOH I 6 .   ? 21.803  84.058 55.752 1.00 48.62  ? 2684 HOH A O   1 
HETATM 5107 O O   . HOH I 6 .   ? 21.728  92.660 59.646 1.00 73.71  ? 2685 HOH A O   1 
HETATM 5108 O O   . HOH I 6 .   ? 15.389  91.953 58.004 1.00 82.31  ? 2686 HOH A O   1 
HETATM 5109 O O   . HOH I 6 .   ? 19.244  84.917 49.823 1.00 49.51  ? 2687 HOH A O   1 
HETATM 5110 O O   . HOH I 6 .   ? 16.585  89.071 52.207 1.00 51.77  ? 2688 HOH A O   1 
HETATM 5111 O O   . HOH I 6 .   ? 14.152  86.367 46.578 1.00 44.79  ? 2689 HOH A O   1 
HETATM 5112 O O   . HOH I 6 .   ? 9.784   88.614 47.740 1.00 67.20  ? 2690 HOH A O   1 
HETATM 5113 O O   . HOH I 6 .   ? 9.440   90.825 49.309 1.00 64.77  ? 2691 HOH A O   1 
HETATM 5114 O O   . HOH I 6 .   ? 21.438  83.875 50.892 1.00 90.67  ? 2692 HOH A O   1 
HETATM 5115 O O   . HOH I 6 .   ? 21.383  82.368 53.154 1.00 55.43  ? 2693 HOH A O   1 
HETATM 5116 O O   . HOH I 6 .   ? 18.683  79.591 45.901 1.00 59.26  ? 2694 HOH A O   1 
HETATM 5117 O O   . HOH I 6 .   ? 7.693   70.925 38.720 1.00 43.29  ? 2695 HOH A O   1 
HETATM 5118 O O   . HOH I 6 .   ? 12.111  74.368 32.146 1.00 82.38  ? 2696 HOH A O   1 
HETATM 5119 O O   . HOH I 6 .   ? 10.948  81.639 36.346 1.00 70.08  ? 2697 HOH A O   1 
HETATM 5120 O O   . HOH I 6 .   ? 10.023  74.808 33.486 1.00 52.30  ? 2698 HOH A O   1 
HETATM 5121 O O   . HOH I 6 .   ? 14.784  79.305 37.158 1.00 79.51  ? 2699 HOH A O   1 
HETATM 5122 O O   . HOH I 6 .   ? 19.657  67.894 38.385 1.00 49.66  ? 2700 HOH A O   1 
HETATM 5123 O O   . HOH I 6 .   ? 24.375  73.084 38.594 1.00 56.89  ? 2701 HOH A O   1 
HETATM 5124 O O   . HOH I 6 .   ? 20.540  70.289 35.514 1.00 88.64  ? 2702 HOH A O   1 
HETATM 5125 O O   . HOH I 6 .   ? 19.301  78.926 43.339 1.00 52.54  ? 2703 HOH A O   1 
HETATM 5126 O O   . HOH I 6 .   ? 18.734  75.122 36.991 1.00 47.30  ? 2704 HOH A O   1 
HETATM 5127 O O   . HOH I 6 .   ? 23.204  77.664 43.656 1.00 61.85  ? 2705 HOH A O   1 
HETATM 5128 O O   . HOH I 6 .   ? 21.606  79.419 42.435 1.00 62.71  ? 2706 HOH A O   1 
HETATM 5129 O O   . HOH I 6 .   ? 18.367  85.282 37.714 1.00 72.43  ? 2707 HOH A O   1 
HETATM 5130 O O   . HOH I 6 .   ? 15.371  84.108 38.708 1.00 63.26  ? 2708 HOH A O   1 
HETATM 5131 O O   . HOH I 6 .   ? 23.709  75.562 37.084 1.00 69.87  ? 2709 HOH A O   1 
HETATM 5132 O O   . HOH I 6 .   ? 22.748  82.778 37.300 1.00 76.62  ? 2710 HOH A O   1 
HETATM 5133 O O   . HOH I 6 .   ? 21.916  80.876 35.286 1.00 57.76  ? 2711 HOH A O   1 
HETATM 5134 O O   . HOH I 6 .   ? 28.512  87.729 40.204 1.00 99.49  ? 2712 HOH A O   1 
HETATM 5135 O O   . HOH I 6 .   ? 23.580  86.274 47.006 1.00 83.20  ? 2713 HOH A O   1 
HETATM 5136 O O   . HOH I 6 .   ? 21.109  86.596 45.869 1.00 53.75  ? 2714 HOH A O   1 
HETATM 5137 O O   . HOH I 6 .   ? 20.742  82.288 42.270 1.00 72.29  ? 2715 HOH A O   1 
HETATM 5138 O O   . HOH I 6 .   ? 24.078  79.103 46.720 1.00 57.57  ? 2716 HOH A O   1 
HETATM 5139 O O   . HOH I 6 .   ? 29.977  76.838 44.972 1.00 70.04  ? 2717 HOH A O   1 
HETATM 5140 O O   . HOH I 6 .   ? 24.224  78.990 41.792 1.00 82.57  ? 2718 HOH A O   1 
HETATM 5141 O O   . HOH I 6 .   ? 30.244  74.582 46.214 1.00 61.77  ? 2719 HOH A O   1 
HETATM 5142 O O   . HOH I 6 .   ? 28.308  65.928 42.234 1.00 47.29  ? 2720 HOH A O   1 
HETATM 5143 O O   . HOH I 6 .   ? 22.159  62.006 41.344 1.00 50.12  ? 2721 HOH A O   1 
HETATM 5144 O O   . HOH I 6 .   ? 27.827  63.361 45.383 1.00 44.87  ? 2722 HOH A O   1 
HETATM 5145 O O   . HOH I 6 .   ? 30.700  60.884 41.905 1.00 64.97  ? 2723 HOH A O   1 
HETATM 5146 O O   . HOH I 6 .   ? 23.505  55.433 45.692 1.00 58.35  ? 2724 HOH A O   1 
HETATM 5147 O O   . HOH I 6 .   ? 24.172  53.051 43.141 1.00 87.18  ? 2725 HOH A O   1 
HETATM 5148 O O   . HOH I 6 .   ? 25.124  58.223 41.476 1.00 53.37  ? 2726 HOH A O   1 
HETATM 5149 O O   . HOH I 6 .   ? 24.351  55.071 40.721 1.00 65.01  ? 2727 HOH A O   1 
HETATM 5150 O O   . HOH I 6 .   ? 29.265  53.446 46.952 1.00 76.07  ? 2728 HOH A O   1 
HETATM 5151 O O   . HOH I 6 .   ? 31.102  55.448 47.843 1.00 66.42  ? 2729 HOH A O   1 
HETATM 5152 O O   . HOH I 6 .   ? 33.732  61.336 40.076 1.00 92.48  ? 2730 HOH A O   1 
HETATM 5153 O O   . HOH I 6 .   ? 38.188  57.799 43.053 1.00 71.73  ? 2731 HOH A O   1 
HETATM 5154 O O   . HOH I 6 .   ? 27.977  57.631 41.714 1.00 54.56  ? 2732 HOH A O   1 
HETATM 5155 O O   . HOH I 6 .   ? 34.796  64.864 44.727 1.00 54.80  ? 2733 HOH A O   1 
HETATM 5156 O O   . HOH I 6 .   ? 26.554  55.280 52.782 1.00 71.13  ? 2734 HOH A O   1 
HETATM 5157 O O   . HOH I 6 .   ? 28.947  53.821 49.767 1.00 64.45  ? 2735 HOH A O   1 
HETATM 5158 O O   . HOH I 6 .   ? 25.281  58.714 51.904 1.00 52.04  ? 2736 HOH A O   1 
HETATM 5159 O O   . HOH I 6 .   ? 33.490  69.360 47.509 1.00 49.77  ? 2737 HOH A O   1 
HETATM 5160 O O   . HOH I 6 .   ? 31.917  69.789 45.703 1.00 61.73  ? 2738 HOH A O   1 
HETATM 5161 O O   . HOH I 6 .   ? 23.383  66.824 47.594 1.00 40.70  ? 2739 HOH A O   1 
HETATM 5162 O O   . HOH I 6 .   ? 27.126  73.092 60.013 1.00 66.10  ? 2740 HOH A O   1 
HETATM 5163 O O   . HOH I 6 .   ? 26.782  68.883 58.967 1.00 49.08  ? 2741 HOH A O   1 
HETATM 5164 O O   . HOH I 6 .   ? 27.610  74.881 57.716 1.00 58.00  ? 2742 HOH A O   1 
HETATM 5165 O O   . HOH I 6 .   ? 26.521  76.423 55.792 1.00 57.41  ? 2743 HOH A O   1 
HETATM 5166 O O   . HOH I 6 .   ? 22.401  84.306 61.917 1.00 71.31  ? 2744 HOH A O   1 
HETATM 5167 O O   . HOH I 6 .   ? 30.459  77.819 56.272 1.00 63.25  ? 2745 HOH A O   1 
HETATM 5168 O O   . HOH I 6 .   ? 26.673  83.477 54.350 1.00 62.81  ? 2746 HOH A O   1 
HETATM 5169 O O   . HOH I 6 .   ? 27.317  80.483 50.191 1.00 57.84  ? 2747 HOH A O   1 
HETATM 5170 O O   . HOH I 6 .   ? 34.788  75.281 54.966 1.00 81.02  ? 2748 HOH A O   1 
HETATM 5171 O O   . HOH I 6 .   ? 32.398  73.627 50.766 1.00 67.19  ? 2749 HOH A O   1 
HETATM 5172 O O   . HOH I 6 .   ? 32.926  71.876 54.985 1.00 75.06  ? 2750 HOH A O   1 
HETATM 5173 O O   . HOH I 6 .   ? 33.303  67.509 51.450 1.00 69.40  ? 2751 HOH A O   1 
HETATM 5174 O O   . HOH I 6 .   ? 32.924  68.459 55.917 1.00 87.81  ? 2752 HOH A O   1 
HETATM 5175 O O   . HOH I 6 .   ? 29.081  67.726 58.738 1.00 82.83  ? 2753 HOH A O   1 
HETATM 5176 O O   . HOH I 6 .   ? 29.009  64.459 56.800 1.00 53.10  ? 2754 HOH A O   1 
HETATM 5177 O O   . HOH I 6 .   ? 35.143  65.661 47.453 1.00 62.37  ? 2755 HOH A O   1 
HETATM 5178 O O   . HOH I 6 .   ? 33.695  67.197 48.862 1.00 65.34  ? 2756 HOH A O   1 
HETATM 5179 O O   . HOH I 6 .   ? 31.903  65.176 55.045 1.00 44.93  ? 2757 HOH A O   1 
HETATM 5180 O O   . HOH I 6 .   ? 29.018  54.226 52.470 1.00 75.92  ? 2758 HOH A O   1 
HETATM 5181 O O   . HOH I 6 .   ? 29.896  61.680 58.436 1.00 53.60  ? 2759 HOH A O   1 
HETATM 5182 O O   . HOH I 6 .   ? 25.472  61.468 52.234 1.00 40.11  ? 2760 HOH A O   1 
HETATM 5183 O O   . HOH I 6 .   ? 25.341  58.293 54.663 1.00 46.07  ? 2761 HOH A O   1 
HETATM 5184 O O   . HOH I 6 .   ? 25.232  60.989 68.025 1.00 59.83  ? 2762 HOH A O   1 
HETATM 5185 O O   . HOH I 6 .   ? 26.639  59.204 62.479 1.00 37.76  ? 2763 HOH A O   1 
HETATM 5186 O O   . HOH I 6 .   ? 27.488  60.036 64.968 1.00 54.81  ? 2764 HOH A O   1 
HETATM 5187 O O   . HOH I 6 .   ? 27.098  63.843 59.062 1.00 40.71  ? 2765 HOH A O   1 
HETATM 5188 O O   . HOH I 6 .   ? 25.001  54.201 56.620 1.00 70.65  ? 2766 HOH A O   1 
HETATM 5189 O O   . HOH I 6 .   ? 30.451  52.748 65.443 1.00 42.82  ? 2767 HOH A O   1 
HETATM 5190 O O   . HOH I 6 .   ? 28.969  59.669 60.828 1.00 37.23  ? 2768 HOH A O   1 
HETATM 5191 O O   . HOH I 6 .   ? 32.457  57.953 61.162 1.00 52.06  ? 2769 HOH A O   1 
HETATM 5192 O O   . HOH I 6 .   ? 16.114  49.262 58.952 1.00 61.64  ? 2770 HOH A O   1 
HETATM 5193 O O   . HOH I 6 .   ? 16.410  50.378 62.464 1.00 42.84  ? 2771 HOH A O   1 
HETATM 5194 O O   . HOH I 6 .   ? 17.510  48.520 55.752 1.00 69.51  ? 2772 HOH A O   1 
HETATM 5195 O O   . HOH I 6 .   ? 22.822  53.320 55.509 1.00 51.91  ? 2773 HOH A O   1 
HETATM 5196 O O   . HOH I 6 .   ? 15.973  53.011 58.909 1.00 46.86  ? 2774 HOH A O   1 
HETATM 5197 O O   . HOH I 6 .   ? 16.778  50.649 56.742 1.00 70.55  ? 2775 HOH A O   1 
HETATM 5198 O O   . HOH I 6 .   ? 24.530  47.927 52.296 1.00 66.15  ? 2776 HOH A O   1 
HETATM 5199 O O   . HOH I 6 .   ? 26.437  48.709 55.392 1.00 58.49  ? 2777 HOH A O   1 
HETATM 5200 O O   . HOH I 6 .   ? 14.940  42.791 61.754 1.00 58.81  ? 2778 HOH A O   1 
HETATM 5201 O O   . HOH I 6 .   ? 24.929  36.263 59.659 1.00 81.60  ? 2779 HOH A O   1 
HETATM 5202 O O   . HOH I 6 .   ? 20.336  37.852 60.638 1.00 60.15  ? 2780 HOH A O   1 
HETATM 5203 O O   . HOH I 6 .   ? 13.419  40.248 62.215 1.00 61.71  ? 2781 HOH A O   1 
HETATM 5204 O O   . HOH I 6 .   ? 17.088  35.588 58.917 1.00 67.09  ? 2782 HOH A O   1 
HETATM 5205 O O   . HOH I 6 .   ? 23.822  61.109 26.535 1.00 80.71  ? 2783 HOH A O   1 
HETATM 5206 O O   . HOH I 6 .   ? 24.400  59.069 34.589 1.00 51.43  ? 2784 HOH A O   1 
HETATM 5207 O O   . HOH I 6 .   ? 25.117  64.084 35.063 1.00 55.86  ? 2785 HOH A O   1 
HETATM 5208 O O   . HOH I 6 .   ? 27.506  62.520 35.014 1.00 79.28  ? 2786 HOH A O   1 
HETATM 5209 O O   . HOH I 6 .   ? 24.130  68.656 36.368 1.00 61.70  ? 2787 HOH A O   1 
HETATM 5210 O O   . HOH I 6 .   ? 24.999  58.069 36.735 1.00 74.95  ? 2788 HOH A O   1 
HETATM 5211 O O   . HOH I 6 .   ? 20.827  65.670 23.472 1.00 66.16  ? 2789 HOH A O   1 
HETATM 5212 O O   . HOH I 6 .   ? 22.789  67.175 24.127 1.00 81.21  ? 2790 HOH A O   1 
HETATM 5213 O O   . HOH I 6 .   ? 18.214  32.233 66.145 1.00 78.29  ? 2791 HOH A O   1 
HETATM 5214 O O   . HOH I 6 .   ? 13.792  38.722 68.728 1.00 71.05  ? 2792 HOH A O   1 
HETATM 5215 O O   . HOH I 6 .   ? 14.658  33.600 68.800 1.00 69.22  ? 2793 HOH A O   1 
HETATM 5216 O O   . HOH I 6 .   ? 15.825  33.443 66.497 1.00 69.60  ? 2794 HOH A O   1 
HETATM 5217 O O   . HOH I 6 .   ? 15.047  62.470 30.834 1.00 70.65  ? 2795 HOH A O   1 
HETATM 5218 O O   . HOH I 6 .   ? 22.495  58.692 32.758 1.00 71.29  ? 2796 HOH A O   1 
HETATM 5219 O O   . HOH I 6 .   ? 24.357  63.096 29.920 1.00 79.03  ? 2797 HOH A O   1 
HETATM 5220 O O   . HOH I 6 .   ? 17.464  59.913 27.683 1.00 94.80  ? 2798 HOH A O   1 
HETATM 5221 O O   . HOH I 6 .   ? 15.203  59.894 32.815 1.00 63.02  ? 2799 HOH A O   1 
HETATM 5222 O O   . HOH I 6 .   ? 21.737  59.032 37.898 1.00 52.97  ? 2800 HOH A O   1 
HETATM 5223 O O   . HOH I 6 .   ? 19.383  58.427 34.794 1.00 49.96  ? 2801 HOH A O   1 
HETATM 5224 O O   . HOH I 6 .   ? 16.840  58.253 31.355 1.00 61.18  ? 2802 HOH A O   1 
HETATM 5225 O O   . HOH I 6 .   ? 20.077  58.469 32.139 1.00 60.36  ? 2803 HOH A O   1 
HETATM 5226 O O   . HOH I 6 .   ? 22.142  66.033 34.807 1.00 68.39  ? 2804 HOH A O   1 
HETATM 5227 O O   . HOH I 6 .   ? 25.215  61.469 34.540 1.00 53.26  ? 2805 HOH A O   1 
HETATM 5228 O O   . HOH I 6 .   ? 23.385  60.854 29.019 1.00 66.87  ? 2806 HOH A O   1 
HETATM 5229 O O   . HOH I 6 .   ? 20.468  64.475 27.516 1.00 49.98  ? 2807 HOH A O   1 
HETATM 5230 O O   . HOH I 6 .   ? 22.119  62.605 27.682 1.00 61.67  ? 2808 HOH A O   1 
HETATM 5231 O O   . HOH I 6 .   ? -19.169 85.681 55.092 1.00 82.90  ? 2809 HOH A O   1 
HETATM 5232 O O   . HOH I 6 .   ? -16.890 87.990 53.867 1.00 75.52  ? 2810 HOH A O   1 
HETATM 5233 O O   . HOH I 6 .   ? -20.644 83.239 55.045 1.00 67.34  ? 2811 HOH A O   1 
HETATM 5234 O O   . HOH I 6 .   ? -18.359 82.306 54.715 1.00 54.74  ? 2812 HOH A O   1 
HETATM 5235 O O   . HOH I 6 .   ? -21.265 82.615 47.698 1.00 66.54  ? 2813 HOH A O   1 
HETATM 5236 O O   . HOH I 6 .   ? -19.121 89.267 52.809 1.00 63.58  ? 2814 HOH A O   1 
HETATM 5237 O O   . HOH I 6 .   ? 24.310  65.877 69.921 1.00 68.87  ? 2815 HOH A O   1 
HETATM 5238 O O   . HOH I 6 .   ? 21.815  76.166 66.665 1.00 63.69  ? 2816 HOH A O   1 
HETATM 5239 O O   . HOH I 6 .   ? 20.663  73.932 74.856 1.00 68.47  ? 2817 HOH A O   1 
HETATM 5240 O O   . HOH I 6 .   ? 20.141  74.304 68.059 1.00 49.30  ? 2818 HOH A O   1 
HETATM 5241 O O   . HOH I 6 .   ? 27.401  61.064 74.233 1.00 65.31  ? 2819 HOH A O   1 
HETATM 5242 O O   . HOH I 6 .   ? 28.812  61.629 67.920 1.00 87.21  ? 2820 HOH A O   1 
HETATM 5243 O O   . HOH I 6 .   ? 31.195  61.173 71.464 1.00 63.25  ? 2821 HOH A O   1 
HETATM 5244 O O   . HOH I 6 .   ? -13.515 44.983 75.463 1.00 62.81  ? 2822 HOH A O   1 
HETATM 5245 O O   . HOH I 6 .   ? 4.253   69.025 65.429 1.00 76.00  ? 2823 HOH A O   1 
HETATM 5246 O O   . HOH I 6 .   ? 1.245   66.583 69.348 1.00 64.34  ? 2824 HOH A O   1 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'NAG A 1537 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 536 ALA ALA A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   1536 1536 NAG NAG A . 
C 2 NAG 1   1537 1537 NAG NDG A . 
D 3 PGE 1   1538 1538 PGE PGE A . 
E 3 PGE 1   1539 1539 PGE PGE A . 
F 3 PGE 1   1540 1540 PGE PGE A . 
G 4 NWA 1   1541 1541 NWA NWA A . 
H 5 CHH 1   1542 1542 CHH CHH A . 
I 6 HOH 1   2001 2001 HOH HOH A . 
I 6 HOH 2   2002 2002 HOH HOH A . 
I 6 HOH 3   2003 2003 HOH HOH A . 
I 6 HOH 4   2004 2004 HOH HOH A . 
I 6 HOH 5   2005 2005 HOH HOH A . 
I 6 HOH 6   2006 2006 HOH HOH A . 
I 6 HOH 7   2007 2007 HOH HOH A . 
I 6 HOH 8   2008 2008 HOH HOH A . 
I 6 HOH 9   2009 2009 HOH HOH A . 
I 6 HOH 10  2010 2010 HOH HOH A . 
I 6 HOH 11  2011 2011 HOH HOH A . 
I 6 HOH 12  2012 2012 HOH HOH A . 
I 6 HOH 13  2013 2013 HOH HOH A . 
I 6 HOH 14  2014 2014 HOH HOH A . 
I 6 HOH 15  2015 2015 HOH HOH A . 
I 6 HOH 16  2016 2016 HOH HOH A . 
I 6 HOH 17  2017 2017 HOH HOH A . 
I 6 HOH 18  2018 2018 HOH HOH A . 
I 6 HOH 19  2019 2019 HOH HOH A . 
I 6 HOH 20  2020 2020 HOH HOH A . 
I 6 HOH 21  2021 2021 HOH HOH A . 
I 6 HOH 22  2022 2022 HOH HOH A . 
I 6 HOH 23  2023 2023 HOH HOH A . 
I 6 HOH 24  2024 2024 HOH HOH A . 
I 6 HOH 25  2025 2025 HOH HOH A . 
I 6 HOH 26  2026 2026 HOH HOH A . 
I 6 HOH 27  2027 2027 HOH HOH A . 
I 6 HOH 28  2028 2028 HOH HOH A . 
I 6 HOH 29  2029 2029 HOH HOH A . 
I 6 HOH 30  2030 2030 HOH HOH A . 
I 6 HOH 31  2031 2031 HOH HOH A . 
I 6 HOH 32  2032 2032 HOH HOH A . 
I 6 HOH 33  2033 2033 HOH HOH A . 
I 6 HOH 34  2034 2034 HOH HOH A . 
I 6 HOH 35  2035 2035 HOH HOH A . 
I 6 HOH 36  2036 2036 HOH HOH A . 
I 6 HOH 37  2037 2037 HOH HOH A . 
I 6 HOH 38  2038 2038 HOH HOH A . 
I 6 HOH 39  2039 2039 HOH HOH A . 
I 6 HOH 40  2040 2040 HOH HOH A . 
I 6 HOH 41  2041 2041 HOH HOH A . 
I 6 HOH 42  2042 2042 HOH HOH A . 
I 6 HOH 43  2043 2043 HOH HOH A . 
I 6 HOH 44  2044 2044 HOH HOH A . 
I 6 HOH 45  2045 2045 HOH HOH A . 
I 6 HOH 46  2046 2046 HOH HOH A . 
I 6 HOH 47  2047 2047 HOH HOH A . 
I 6 HOH 48  2048 2048 HOH HOH A . 
I 6 HOH 49  2049 2049 HOH HOH A . 
I 6 HOH 50  2050 2050 HOH HOH A . 
I 6 HOH 51  2051 2051 HOH HOH A . 
I 6 HOH 52  2052 2052 HOH HOH A . 
I 6 HOH 53  2053 2053 HOH HOH A . 
I 6 HOH 54  2054 2054 HOH HOH A . 
I 6 HOH 55  2055 2055 HOH HOH A . 
I 6 HOH 56  2056 2056 HOH HOH A . 
I 6 HOH 57  2057 2057 HOH HOH A . 
I 6 HOH 58  2058 2058 HOH HOH A . 
I 6 HOH 59  2059 2059 HOH HOH A . 
I 6 HOH 60  2060 2060 HOH HOH A . 
I 6 HOH 61  2061 2061 HOH HOH A . 
I 6 HOH 62  2062 2062 HOH HOH A . 
I 6 HOH 63  2063 2063 HOH HOH A . 
I 6 HOH 64  2064 2064 HOH HOH A . 
I 6 HOH 65  2065 2065 HOH HOH A . 
I 6 HOH 66  2066 2066 HOH HOH A . 
I 6 HOH 67  2067 2067 HOH HOH A . 
I 6 HOH 68  2068 2068 HOH HOH A . 
I 6 HOH 69  2069 2069 HOH HOH A . 
I 6 HOH 70  2070 2070 HOH HOH A . 
I 6 HOH 71  2071 2071 HOH HOH A . 
I 6 HOH 72  2072 2072 HOH HOH A . 
I 6 HOH 73  2073 2073 HOH HOH A . 
I 6 HOH 74  2074 2074 HOH HOH A . 
I 6 HOH 75  2075 2075 HOH HOH A . 
I 6 HOH 76  2076 2076 HOH HOH A . 
I 6 HOH 77  2077 2077 HOH HOH A . 
I 6 HOH 78  2078 2078 HOH HOH A . 
I 6 HOH 79  2079 2079 HOH HOH A . 
I 6 HOH 80  2080 2080 HOH HOH A . 
I 6 HOH 81  2081 2081 HOH HOH A . 
I 6 HOH 82  2082 2082 HOH HOH A . 
I 6 HOH 83  2083 2083 HOH HOH A . 
I 6 HOH 84  2084 2084 HOH HOH A . 
I 6 HOH 85  2085 2085 HOH HOH A . 
I 6 HOH 86  2086 2086 HOH HOH A . 
I 6 HOH 87  2087 2087 HOH HOH A . 
I 6 HOH 88  2088 2088 HOH HOH A . 
I 6 HOH 89  2089 2089 HOH HOH A . 
I 6 HOH 90  2090 2090 HOH HOH A . 
I 6 HOH 91  2091 2091 HOH HOH A . 
I 6 HOH 92  2092 2092 HOH HOH A . 
I 6 HOH 93  2093 2093 HOH HOH A . 
I 6 HOH 94  2094 2094 HOH HOH A . 
I 6 HOH 95  2095 2095 HOH HOH A . 
I 6 HOH 96  2096 2096 HOH HOH A . 
I 6 HOH 97  2097 2097 HOH HOH A . 
I 6 HOH 98  2098 2098 HOH HOH A . 
I 6 HOH 99  2099 2099 HOH HOH A . 
I 6 HOH 100 2100 2100 HOH HOH A . 
I 6 HOH 101 2101 2101 HOH HOH A . 
I 6 HOH 102 2102 2102 HOH HOH A . 
I 6 HOH 103 2103 2103 HOH HOH A . 
I 6 HOH 104 2104 2104 HOH HOH A . 
I 6 HOH 105 2105 2105 HOH HOH A . 
I 6 HOH 106 2106 2106 HOH HOH A . 
I 6 HOH 107 2107 2107 HOH HOH A . 
I 6 HOH 108 2108 2108 HOH HOH A . 
I 6 HOH 109 2109 2109 HOH HOH A . 
I 6 HOH 110 2110 2110 HOH HOH A . 
I 6 HOH 111 2111 2111 HOH HOH A . 
I 6 HOH 112 2112 2112 HOH HOH A . 
I 6 HOH 113 2113 2113 HOH HOH A . 
I 6 HOH 114 2114 2114 HOH HOH A . 
I 6 HOH 115 2115 2115 HOH HOH A . 
I 6 HOH 116 2116 2116 HOH HOH A . 
I 6 HOH 117 2117 2117 HOH HOH A . 
I 6 HOH 118 2118 2118 HOH HOH A . 
I 6 HOH 119 2119 2119 HOH HOH A . 
I 6 HOH 120 2120 2120 HOH HOH A . 
I 6 HOH 121 2121 2121 HOH HOH A . 
I 6 HOH 122 2122 2122 HOH HOH A . 
I 6 HOH 123 2123 2123 HOH HOH A . 
I 6 HOH 124 2124 2124 HOH HOH A . 
I 6 HOH 125 2125 2125 HOH HOH A . 
I 6 HOH 126 2126 2126 HOH HOH A . 
I 6 HOH 127 2127 2127 HOH HOH A . 
I 6 HOH 128 2128 2128 HOH HOH A . 
I 6 HOH 129 2129 2129 HOH HOH A . 
I 6 HOH 130 2130 2130 HOH HOH A . 
I 6 HOH 131 2131 2131 HOH HOH A . 
I 6 HOH 132 2132 2132 HOH HOH A . 
I 6 HOH 133 2133 2133 HOH HOH A . 
I 6 HOH 134 2134 2134 HOH HOH A . 
I 6 HOH 135 2135 2135 HOH HOH A . 
I 6 HOH 136 2136 2136 HOH HOH A . 
I 6 HOH 137 2137 2137 HOH HOH A . 
I 6 HOH 138 2138 2138 HOH HOH A . 
I 6 HOH 139 2139 2139 HOH HOH A . 
I 6 HOH 140 2140 2140 HOH HOH A . 
I 6 HOH 141 2141 2141 HOH HOH A . 
I 6 HOH 142 2142 2142 HOH HOH A . 
I 6 HOH 143 2143 2143 HOH HOH A . 
I 6 HOH 144 2144 2144 HOH HOH A . 
I 6 HOH 145 2145 2145 HOH HOH A . 
I 6 HOH 146 2146 2146 HOH HOH A . 
I 6 HOH 147 2147 2147 HOH HOH A . 
I 6 HOH 148 2148 2148 HOH HOH A . 
I 6 HOH 149 2149 2149 HOH HOH A . 
I 6 HOH 150 2150 2150 HOH HOH A . 
I 6 HOH 151 2151 2151 HOH HOH A . 
I 6 HOH 152 2152 2152 HOH HOH A . 
I 6 HOH 153 2153 2153 HOH HOH A . 
I 6 HOH 154 2154 2154 HOH HOH A . 
I 6 HOH 155 2155 2155 HOH HOH A . 
I 6 HOH 156 2156 2156 HOH HOH A . 
I 6 HOH 157 2157 2157 HOH HOH A . 
I 6 HOH 158 2158 2158 HOH HOH A . 
I 6 HOH 159 2159 2159 HOH HOH A . 
I 6 HOH 160 2160 2160 HOH HOH A . 
I 6 HOH 161 2161 2161 HOH HOH A . 
I 6 HOH 162 2162 2162 HOH HOH A . 
I 6 HOH 163 2163 2163 HOH HOH A . 
I 6 HOH 164 2164 2164 HOH HOH A . 
I 6 HOH 165 2165 2165 HOH HOH A . 
I 6 HOH 166 2166 2166 HOH HOH A . 
I 6 HOH 167 2167 2167 HOH HOH A . 
I 6 HOH 168 2168 2168 HOH HOH A . 
I 6 HOH 169 2169 2169 HOH HOH A . 
I 6 HOH 170 2170 2170 HOH HOH A . 
I 6 HOH 171 2171 2171 HOH HOH A . 
I 6 HOH 172 2172 2172 HOH HOH A . 
I 6 HOH 173 2173 2173 HOH HOH A . 
I 6 HOH 174 2174 2174 HOH HOH A . 
I 6 HOH 175 2175 2175 HOH HOH A . 
I 6 HOH 176 2176 2176 HOH HOH A . 
I 6 HOH 177 2177 2177 HOH HOH A . 
I 6 HOH 178 2178 2178 HOH HOH A . 
I 6 HOH 179 2179 2179 HOH HOH A . 
I 6 HOH 180 2180 2180 HOH HOH A . 
I 6 HOH 181 2181 2181 HOH HOH A . 
I 6 HOH 182 2182 2182 HOH HOH A . 
I 6 HOH 183 2183 2183 HOH HOH A . 
I 6 HOH 184 2184 2184 HOH HOH A . 
I 6 HOH 185 2185 2185 HOH HOH A . 
I 6 HOH 186 2186 2186 HOH HOH A . 
I 6 HOH 187 2187 2187 HOH HOH A . 
I 6 HOH 188 2188 2188 HOH HOH A . 
I 6 HOH 189 2189 2189 HOH HOH A . 
I 6 HOH 190 2190 2190 HOH HOH A . 
I 6 HOH 191 2191 2191 HOH HOH A . 
I 6 HOH 192 2192 2192 HOH HOH A . 
I 6 HOH 193 2193 2193 HOH HOH A . 
I 6 HOH 194 2194 2194 HOH HOH A . 
I 6 HOH 195 2195 2195 HOH HOH A . 
I 6 HOH 196 2196 2196 HOH HOH A . 
I 6 HOH 197 2197 2197 HOH HOH A . 
I 6 HOH 198 2198 2198 HOH HOH A . 
I 6 HOH 199 2199 2199 HOH HOH A . 
I 6 HOH 200 2200 2200 HOH HOH A . 
I 6 HOH 201 2201 2201 HOH HOH A . 
I 6 HOH 202 2202 2202 HOH HOH A . 
I 6 HOH 203 2203 2203 HOH HOH A . 
I 6 HOH 204 2204 2204 HOH HOH A . 
I 6 HOH 205 2205 2205 HOH HOH A . 
I 6 HOH 206 2206 2206 HOH HOH A . 
I 6 HOH 207 2207 2207 HOH HOH A . 
I 6 HOH 208 2208 2208 HOH HOH A . 
I 6 HOH 209 2209 2209 HOH HOH A . 
I 6 HOH 210 2210 2210 HOH HOH A . 
I 6 HOH 211 2211 2211 HOH HOH A . 
I 6 HOH 212 2212 2212 HOH HOH A . 
I 6 HOH 213 2213 2213 HOH HOH A . 
I 6 HOH 214 2214 2214 HOH HOH A . 
I 6 HOH 215 2215 2215 HOH HOH A . 
I 6 HOH 216 2216 2216 HOH HOH A . 
I 6 HOH 217 2217 2217 HOH HOH A . 
I 6 HOH 218 2218 2218 HOH HOH A . 
I 6 HOH 219 2219 2219 HOH HOH A . 
I 6 HOH 220 2220 2220 HOH HOH A . 
I 6 HOH 221 2221 2221 HOH HOH A . 
I 6 HOH 222 2222 2222 HOH HOH A . 
I 6 HOH 223 2223 2223 HOH HOH A . 
I 6 HOH 224 2224 2224 HOH HOH A . 
I 6 HOH 225 2225 2225 HOH HOH A . 
I 6 HOH 226 2226 2226 HOH HOH A . 
I 6 HOH 227 2227 2227 HOH HOH A . 
I 6 HOH 228 2228 2228 HOH HOH A . 
I 6 HOH 229 2229 2229 HOH HOH A . 
I 6 HOH 230 2230 2230 HOH HOH A . 
I 6 HOH 231 2231 2231 HOH HOH A . 
I 6 HOH 232 2232 2232 HOH HOH A . 
I 6 HOH 233 2233 2233 HOH HOH A . 
I 6 HOH 234 2234 2234 HOH HOH A . 
I 6 HOH 235 2235 2235 HOH HOH A . 
I 6 HOH 236 2236 2236 HOH HOH A . 
I 6 HOH 237 2237 2237 HOH HOH A . 
I 6 HOH 238 2238 2238 HOH HOH A . 
I 6 HOH 239 2239 2239 HOH HOH A . 
I 6 HOH 240 2240 2240 HOH HOH A . 
I 6 HOH 241 2241 2241 HOH HOH A . 
I 6 HOH 242 2242 2242 HOH HOH A . 
I 6 HOH 243 2243 2243 HOH HOH A . 
I 6 HOH 244 2244 2244 HOH HOH A . 
I 6 HOH 245 2245 2245 HOH HOH A . 
I 6 HOH 246 2246 2246 HOH HOH A . 
I 6 HOH 247 2247 2247 HOH HOH A . 
I 6 HOH 248 2248 2248 HOH HOH A . 
I 6 HOH 249 2249 2249 HOH HOH A . 
I 6 HOH 250 2250 2250 HOH HOH A . 
I 6 HOH 251 2251 2251 HOH HOH A . 
I 6 HOH 252 2252 2252 HOH HOH A . 
I 6 HOH 253 2253 2253 HOH HOH A . 
I 6 HOH 254 2254 2254 HOH HOH A . 
I 6 HOH 255 2255 2255 HOH HOH A . 
I 6 HOH 256 2256 2256 HOH HOH A . 
I 6 HOH 257 2257 2257 HOH HOH A . 
I 6 HOH 258 2258 2258 HOH HOH A . 
I 6 HOH 259 2259 2259 HOH HOH A . 
I 6 HOH 260 2260 2260 HOH HOH A . 
I 6 HOH 261 2261 2261 HOH HOH A . 
I 6 HOH 262 2262 2262 HOH HOH A . 
I 6 HOH 263 2263 2263 HOH HOH A . 
I 6 HOH 264 2264 2264 HOH HOH A . 
I 6 HOH 265 2265 2265 HOH HOH A . 
I 6 HOH 266 2266 2266 HOH HOH A . 
I 6 HOH 267 2267 2267 HOH HOH A . 
I 6 HOH 268 2268 2268 HOH HOH A . 
I 6 HOH 269 2269 2269 HOH HOH A . 
I 6 HOH 270 2270 2270 HOH HOH A . 
I 6 HOH 271 2271 2271 HOH HOH A . 
I 6 HOH 272 2272 2272 HOH HOH A . 
I 6 HOH 273 2273 2273 HOH HOH A . 
I 6 HOH 274 2274 2274 HOH HOH A . 
I 6 HOH 275 2275 2275 HOH HOH A . 
I 6 HOH 276 2276 2276 HOH HOH A . 
I 6 HOH 277 2277 2277 HOH HOH A . 
I 6 HOH 278 2278 2278 HOH HOH A . 
I 6 HOH 279 2279 2279 HOH HOH A . 
I 6 HOH 280 2280 2280 HOH HOH A . 
I 6 HOH 281 2281 2281 HOH HOH A . 
I 6 HOH 282 2282 2282 HOH HOH A . 
I 6 HOH 283 2283 2283 HOH HOH A . 
I 6 HOH 284 2284 2284 HOH HOH A . 
I 6 HOH 285 2285 2285 HOH HOH A . 
I 6 HOH 286 2286 2286 HOH HOH A . 
I 6 HOH 287 2287 2287 HOH HOH A . 
I 6 HOH 288 2288 2288 HOH HOH A . 
I 6 HOH 289 2289 2289 HOH HOH A . 
I 6 HOH 290 2290 2290 HOH HOH A . 
I 6 HOH 291 2291 2291 HOH HOH A . 
I 6 HOH 292 2292 2292 HOH HOH A . 
I 6 HOH 293 2293 2293 HOH HOH A . 
I 6 HOH 294 2294 2294 HOH HOH A . 
I 6 HOH 295 2295 2295 HOH HOH A . 
I 6 HOH 296 2296 2296 HOH HOH A . 
I 6 HOH 297 2297 2297 HOH HOH A . 
I 6 HOH 298 2298 2298 HOH HOH A . 
I 6 HOH 299 2299 2299 HOH HOH A . 
I 6 HOH 300 2300 2300 HOH HOH A . 
I 6 HOH 301 2301 2301 HOH HOH A . 
I 6 HOH 302 2302 2302 HOH HOH A . 
I 6 HOH 303 2303 2303 HOH HOH A . 
I 6 HOH 304 2304 2304 HOH HOH A . 
I 6 HOH 305 2305 2305 HOH HOH A . 
I 6 HOH 306 2306 2306 HOH HOH A . 
I 6 HOH 307 2307 2307 HOH HOH A . 
I 6 HOH 308 2308 2308 HOH HOH A . 
I 6 HOH 309 2309 2309 HOH HOH A . 
I 6 HOH 310 2310 2310 HOH HOH A . 
I 6 HOH 311 2311 2311 HOH HOH A . 
I 6 HOH 312 2312 2312 HOH HOH A . 
I 6 HOH 313 2313 2313 HOH HOH A . 
I 6 HOH 314 2314 2314 HOH HOH A . 
I 6 HOH 315 2315 2315 HOH HOH A . 
I 6 HOH 316 2316 2316 HOH HOH A . 
I 6 HOH 317 2317 2317 HOH HOH A . 
I 6 HOH 318 2318 2318 HOH HOH A . 
I 6 HOH 319 2319 2319 HOH HOH A . 
I 6 HOH 320 2320 2320 HOH HOH A . 
I 6 HOH 321 2321 2321 HOH HOH A . 
I 6 HOH 322 2322 2322 HOH HOH A . 
I 6 HOH 323 2323 2323 HOH HOH A . 
I 6 HOH 324 2324 2324 HOH HOH A . 
I 6 HOH 325 2325 2325 HOH HOH A . 
I 6 HOH 326 2326 2326 HOH HOH A . 
I 6 HOH 327 2327 2327 HOH HOH A . 
I 6 HOH 328 2328 2328 HOH HOH A . 
I 6 HOH 329 2329 2329 HOH HOH A . 
I 6 HOH 330 2330 2330 HOH HOH A . 
I 6 HOH 331 2331 2331 HOH HOH A . 
I 6 HOH 332 2332 2332 HOH HOH A . 
I 6 HOH 333 2333 2333 HOH HOH A . 
I 6 HOH 334 2334 2334 HOH HOH A . 
I 6 HOH 335 2335 2335 HOH HOH A . 
I 6 HOH 336 2336 2336 HOH HOH A . 
I 6 HOH 337 2337 2337 HOH HOH A . 
I 6 HOH 338 2338 2338 HOH HOH A . 
I 6 HOH 339 2339 2339 HOH HOH A . 
I 6 HOH 340 2340 2340 HOH HOH A . 
I 6 HOH 341 2341 2341 HOH HOH A . 
I 6 HOH 342 2342 2342 HOH HOH A . 
I 6 HOH 343 2343 2343 HOH HOH A . 
I 6 HOH 344 2344 2344 HOH HOH A . 
I 6 HOH 345 2345 2345 HOH HOH A . 
I 6 HOH 346 2346 2346 HOH HOH A . 
I 6 HOH 347 2347 2347 HOH HOH A . 
I 6 HOH 348 2348 2348 HOH HOH A . 
I 6 HOH 349 2349 2349 HOH HOH A . 
I 6 HOH 350 2350 2350 HOH HOH A . 
I 6 HOH 351 2351 2351 HOH HOH A . 
I 6 HOH 352 2352 2352 HOH HOH A . 
I 6 HOH 353 2353 2353 HOH HOH A . 
I 6 HOH 354 2354 2354 HOH HOH A . 
I 6 HOH 355 2355 2355 HOH HOH A . 
I 6 HOH 356 2356 2356 HOH HOH A . 
I 6 HOH 357 2357 2357 HOH HOH A . 
I 6 HOH 358 2358 2358 HOH HOH A . 
I 6 HOH 359 2359 2359 HOH HOH A . 
I 6 HOH 360 2360 2360 HOH HOH A . 
I 6 HOH 361 2361 2361 HOH HOH A . 
I 6 HOH 362 2362 2362 HOH HOH A . 
I 6 HOH 363 2363 2363 HOH HOH A . 
I 6 HOH 364 2364 2364 HOH HOH A . 
I 6 HOH 365 2365 2365 HOH HOH A . 
I 6 HOH 366 2366 2366 HOH HOH A . 
I 6 HOH 367 2367 2367 HOH HOH A . 
I 6 HOH 368 2368 2368 HOH HOH A . 
I 6 HOH 369 2369 2369 HOH HOH A . 
I 6 HOH 370 2370 2370 HOH HOH A . 
I 6 HOH 371 2371 2371 HOH HOH A . 
I 6 HOH 372 2372 2372 HOH HOH A . 
I 6 HOH 373 2373 2373 HOH HOH A . 
I 6 HOH 374 2374 2374 HOH HOH A . 
I 6 HOH 375 2375 2375 HOH HOH A . 
I 6 HOH 376 2376 2376 HOH HOH A . 
I 6 HOH 377 2377 2377 HOH HOH A . 
I 6 HOH 378 2378 2378 HOH HOH A . 
I 6 HOH 379 2379 2379 HOH HOH A . 
I 6 HOH 380 2380 2380 HOH HOH A . 
I 6 HOH 381 2381 2381 HOH HOH A . 
I 6 HOH 382 2382 2382 HOH HOH A . 
I 6 HOH 383 2383 2383 HOH HOH A . 
I 6 HOH 384 2384 2384 HOH HOH A . 
I 6 HOH 385 2385 2385 HOH HOH A . 
I 6 HOH 386 2386 2386 HOH HOH A . 
I 6 HOH 387 2387 2387 HOH HOH A . 
I 6 HOH 388 2388 2388 HOH HOH A . 
I 6 HOH 389 2389 2389 HOH HOH A . 
I 6 HOH 390 2390 2390 HOH HOH A . 
I 6 HOH 391 2391 2391 HOH HOH A . 
I 6 HOH 392 2392 2392 HOH HOH A . 
I 6 HOH 393 2393 2393 HOH HOH A . 
I 6 HOH 394 2394 2394 HOH HOH A . 
I 6 HOH 395 2395 2395 HOH HOH A . 
I 6 HOH 396 2396 2396 HOH HOH A . 
I 6 HOH 397 2397 2397 HOH HOH A . 
I 6 HOH 398 2398 2398 HOH HOH A . 
I 6 HOH 399 2399 2399 HOH HOH A . 
I 6 HOH 400 2400 2400 HOH HOH A . 
I 6 HOH 401 2401 2401 HOH HOH A . 
I 6 HOH 402 2402 2402 HOH HOH A . 
I 6 HOH 403 2403 2403 HOH HOH A . 
I 6 HOH 404 2404 2404 HOH HOH A . 
I 6 HOH 405 2405 2405 HOH HOH A . 
I 6 HOH 406 2406 2406 HOH HOH A . 
I 6 HOH 407 2407 2407 HOH HOH A . 
I 6 HOH 408 2408 2408 HOH HOH A . 
I 6 HOH 409 2409 2409 HOH HOH A . 
I 6 HOH 410 2410 2410 HOH HOH A . 
I 6 HOH 411 2411 2411 HOH HOH A . 
I 6 HOH 412 2412 2412 HOH HOH A . 
I 6 HOH 413 2413 2413 HOH HOH A . 
I 6 HOH 414 2414 2414 HOH HOH A . 
I 6 HOH 415 2415 2415 HOH HOH A . 
I 6 HOH 416 2416 2416 HOH HOH A . 
I 6 HOH 417 2417 2417 HOH HOH A . 
I 6 HOH 418 2418 2418 HOH HOH A . 
I 6 HOH 419 2419 2419 HOH HOH A . 
I 6 HOH 420 2420 2420 HOH HOH A . 
I 6 HOH 421 2421 2421 HOH HOH A . 
I 6 HOH 422 2422 2422 HOH HOH A . 
I 6 HOH 423 2423 2423 HOH HOH A . 
I 6 HOH 424 2424 2424 HOH HOH A . 
I 6 HOH 425 2425 2425 HOH HOH A . 
I 6 HOH 426 2426 2426 HOH HOH A . 
I 6 HOH 427 2427 2427 HOH HOH A . 
I 6 HOH 428 2428 2428 HOH HOH A . 
I 6 HOH 429 2429 2429 HOH HOH A . 
I 6 HOH 430 2430 2430 HOH HOH A . 
I 6 HOH 431 2431 2431 HOH HOH A . 
I 6 HOH 432 2432 2432 HOH HOH A . 
I 6 HOH 433 2433 2433 HOH HOH A . 
I 6 HOH 434 2434 2434 HOH HOH A . 
I 6 HOH 435 2435 2435 HOH HOH A . 
I 6 HOH 436 2436 2436 HOH HOH A . 
I 6 HOH 437 2437 2437 HOH HOH A . 
I 6 HOH 438 2438 2438 HOH HOH A . 
I 6 HOH 439 2439 2439 HOH HOH A . 
I 6 HOH 440 2440 2440 HOH HOH A . 
I 6 HOH 441 2441 2441 HOH HOH A . 
I 6 HOH 442 2442 2442 HOH HOH A . 
I 6 HOH 443 2443 2443 HOH HOH A . 
I 6 HOH 444 2444 2444 HOH HOH A . 
I 6 HOH 445 2445 2445 HOH HOH A . 
I 6 HOH 446 2446 2446 HOH HOH A . 
I 6 HOH 447 2447 2447 HOH HOH A . 
I 6 HOH 448 2448 2448 HOH HOH A . 
I 6 HOH 449 2449 2449 HOH HOH A . 
I 6 HOH 450 2450 2450 HOH HOH A . 
I 6 HOH 451 2451 2451 HOH HOH A . 
I 6 HOH 452 2452 2452 HOH HOH A . 
I 6 HOH 453 2453 2453 HOH HOH A . 
I 6 HOH 454 2454 2454 HOH HOH A . 
I 6 HOH 455 2455 2455 HOH HOH A . 
I 6 HOH 456 2456 2456 HOH HOH A . 
I 6 HOH 457 2457 2457 HOH HOH A . 
I 6 HOH 458 2458 2458 HOH HOH A . 
I 6 HOH 459 2459 2459 HOH HOH A . 
I 6 HOH 460 2460 2460 HOH HOH A . 
I 6 HOH 461 2461 2461 HOH HOH A . 
I 6 HOH 462 2462 2462 HOH HOH A . 
I 6 HOH 463 2463 2463 HOH HOH A . 
I 6 HOH 464 2464 2464 HOH HOH A . 
I 6 HOH 465 2465 2465 HOH HOH A . 
I 6 HOH 466 2466 2466 HOH HOH A . 
I 6 HOH 467 2467 2467 HOH HOH A . 
I 6 HOH 468 2468 2468 HOH HOH A . 
I 6 HOH 469 2469 2469 HOH HOH A . 
I 6 HOH 470 2470 2470 HOH HOH A . 
I 6 HOH 471 2471 2471 HOH HOH A . 
I 6 HOH 472 2472 2472 HOH HOH A . 
I 6 HOH 473 2473 2473 HOH HOH A . 
I 6 HOH 474 2474 2474 HOH HOH A . 
I 6 HOH 475 2475 2475 HOH HOH A . 
I 6 HOH 476 2476 2476 HOH HOH A . 
I 6 HOH 477 2477 2477 HOH HOH A . 
I 6 HOH 478 2478 2478 HOH HOH A . 
I 6 HOH 479 2479 2479 HOH HOH A . 
I 6 HOH 480 2480 2480 HOH HOH A . 
I 6 HOH 481 2481 2481 HOH HOH A . 
I 6 HOH 482 2482 2482 HOH HOH A . 
I 6 HOH 483 2483 2483 HOH HOH A . 
I 6 HOH 484 2484 2484 HOH HOH A . 
I 6 HOH 485 2485 2485 HOH HOH A . 
I 6 HOH 486 2486 2486 HOH HOH A . 
I 6 HOH 487 2487 2487 HOH HOH A . 
I 6 HOH 488 2488 2488 HOH HOH A . 
I 6 HOH 489 2489 2489 HOH HOH A . 
I 6 HOH 490 2490 2490 HOH HOH A . 
I 6 HOH 491 2491 2491 HOH HOH A . 
I 6 HOH 492 2492 2492 HOH HOH A . 
I 6 HOH 493 2493 2493 HOH HOH A . 
I 6 HOH 494 2494 2494 HOH HOH A . 
I 6 HOH 495 2495 2495 HOH HOH A . 
I 6 HOH 496 2496 2496 HOH HOH A . 
I 6 HOH 497 2497 2497 HOH HOH A . 
I 6 HOH 498 2498 2498 HOH HOH A . 
I 6 HOH 499 2499 2499 HOH HOH A . 
I 6 HOH 500 2500 2500 HOH HOH A . 
I 6 HOH 501 2501 2501 HOH HOH A . 
I 6 HOH 502 2502 2502 HOH HOH A . 
I 6 HOH 503 2503 2503 HOH HOH A . 
I 6 HOH 504 2504 2504 HOH HOH A . 
I 6 HOH 505 2505 2505 HOH HOH A . 
I 6 HOH 506 2506 2506 HOH HOH A . 
I 6 HOH 507 2507 2507 HOH HOH A . 
I 6 HOH 508 2508 2508 HOH HOH A . 
I 6 HOH 509 2509 2509 HOH HOH A . 
I 6 HOH 510 2510 2510 HOH HOH A . 
I 6 HOH 511 2511 2511 HOH HOH A . 
I 6 HOH 512 2512 2512 HOH HOH A . 
I 6 HOH 513 2513 2513 HOH HOH A . 
I 6 HOH 514 2514 2514 HOH HOH A . 
I 6 HOH 515 2515 2515 HOH HOH A . 
I 6 HOH 516 2516 2516 HOH HOH A . 
I 6 HOH 517 2517 2517 HOH HOH A . 
I 6 HOH 518 2518 2518 HOH HOH A . 
I 6 HOH 519 2519 2519 HOH HOH A . 
I 6 HOH 520 2520 2520 HOH HOH A . 
I 6 HOH 521 2521 2521 HOH HOH A . 
I 6 HOH 522 2522 2522 HOH HOH A . 
I 6 HOH 523 2523 2523 HOH HOH A . 
I 6 HOH 524 2524 2524 HOH HOH A . 
I 6 HOH 525 2525 2525 HOH HOH A . 
I 6 HOH 526 2526 2526 HOH HOH A . 
I 6 HOH 527 2527 2527 HOH HOH A . 
I 6 HOH 528 2528 2528 HOH HOH A . 
I 6 HOH 529 2529 2529 HOH HOH A . 
I 6 HOH 530 2530 2530 HOH HOH A . 
I 6 HOH 531 2531 2531 HOH HOH A . 
I 6 HOH 532 2532 2532 HOH HOH A . 
I 6 HOH 533 2533 2533 HOH HOH A . 
I 6 HOH 534 2534 2534 HOH HOH A . 
I 6 HOH 535 2535 2535 HOH HOH A . 
I 6 HOH 536 2536 2536 HOH HOH A . 
I 6 HOH 537 2537 2537 HOH HOH A . 
I 6 HOH 538 2538 2538 HOH HOH A . 
I 6 HOH 539 2539 2539 HOH HOH A . 
I 6 HOH 540 2540 2540 HOH HOH A . 
I 6 HOH 541 2541 2541 HOH HOH A . 
I 6 HOH 542 2542 2542 HOH HOH A . 
I 6 HOH 543 2543 2543 HOH HOH A . 
I 6 HOH 544 2544 2544 HOH HOH A . 
I 6 HOH 545 2545 2545 HOH HOH A . 
I 6 HOH 546 2546 2546 HOH HOH A . 
I 6 HOH 547 2547 2547 HOH HOH A . 
I 6 HOH 548 2548 2548 HOH HOH A . 
I 6 HOH 549 2549 2549 HOH HOH A . 
I 6 HOH 550 2550 2550 HOH HOH A . 
I 6 HOH 551 2551 2551 HOH HOH A . 
I 6 HOH 552 2552 2552 HOH HOH A . 
I 6 HOH 553 2553 2553 HOH HOH A . 
I 6 HOH 554 2554 2554 HOH HOH A . 
I 6 HOH 555 2555 2555 HOH HOH A . 
I 6 HOH 556 2556 2556 HOH HOH A . 
I 6 HOH 557 2557 2557 HOH HOH A . 
I 6 HOH 558 2558 2558 HOH HOH A . 
I 6 HOH 559 2559 2559 HOH HOH A . 
I 6 HOH 560 2560 2560 HOH HOH A . 
I 6 HOH 561 2561 2561 HOH HOH A . 
I 6 HOH 562 2562 2562 HOH HOH A . 
I 6 HOH 563 2563 2563 HOH HOH A . 
I 6 HOH 564 2564 2564 HOH HOH A . 
I 6 HOH 565 2565 2565 HOH HOH A . 
I 6 HOH 566 2566 2566 HOH HOH A . 
I 6 HOH 567 2567 2567 HOH HOH A . 
I 6 HOH 568 2568 2568 HOH HOH A . 
I 6 HOH 569 2569 2569 HOH HOH A . 
I 6 HOH 570 2570 2570 HOH HOH A . 
I 6 HOH 571 2571 2571 HOH HOH A . 
I 6 HOH 572 2572 2572 HOH HOH A . 
I 6 HOH 573 2573 2573 HOH HOH A . 
I 6 HOH 574 2574 2574 HOH HOH A . 
I 6 HOH 575 2575 2575 HOH HOH A . 
I 6 HOH 576 2576 2576 HOH HOH A . 
I 6 HOH 577 2577 2577 HOH HOH A . 
I 6 HOH 578 2578 2578 HOH HOH A . 
I 6 HOH 579 2579 2579 HOH HOH A . 
I 6 HOH 580 2580 2580 HOH HOH A . 
I 6 HOH 581 2581 2581 HOH HOH A . 
I 6 HOH 582 2582 2582 HOH HOH A . 
I 6 HOH 583 2583 2583 HOH HOH A . 
I 6 HOH 584 2584 2584 HOH HOH A . 
I 6 HOH 585 2585 2585 HOH HOH A . 
I 6 HOH 586 2586 2586 HOH HOH A . 
I 6 HOH 587 2587 2587 HOH HOH A . 
I 6 HOH 588 2588 2588 HOH HOH A . 
I 6 HOH 589 2589 2589 HOH HOH A . 
I 6 HOH 590 2590 2590 HOH HOH A . 
I 6 HOH 591 2591 2591 HOH HOH A . 
I 6 HOH 592 2592 2592 HOH HOH A . 
I 6 HOH 593 2593 2593 HOH HOH A . 
I 6 HOH 594 2594 2594 HOH HOH A . 
I 6 HOH 595 2595 2595 HOH HOH A . 
I 6 HOH 596 2596 2596 HOH HOH A . 
I 6 HOH 597 2597 2597 HOH HOH A . 
I 6 HOH 598 2598 2598 HOH HOH A . 
I 6 HOH 599 2599 2599 HOH HOH A . 
I 6 HOH 600 2600 2600 HOH HOH A . 
I 6 HOH 601 2601 2601 HOH HOH A . 
I 6 HOH 602 2602 2602 HOH HOH A . 
I 6 HOH 603 2603 2603 HOH HOH A . 
I 6 HOH 604 2604 2604 HOH HOH A . 
I 6 HOH 605 2605 2605 HOH HOH A . 
I 6 HOH 606 2606 2606 HOH HOH A . 
I 6 HOH 607 2607 2607 HOH HOH A . 
I 6 HOH 608 2608 2608 HOH HOH A . 
I 6 HOH 609 2609 2609 HOH HOH A . 
I 6 HOH 610 2610 2610 HOH HOH A . 
I 6 HOH 611 2611 2611 HOH HOH A . 
I 6 HOH 612 2612 2612 HOH HOH A . 
I 6 HOH 613 2613 2613 HOH HOH A . 
I 6 HOH 614 2614 2614 HOH HOH A . 
I 6 HOH 615 2615 2615 HOH HOH A . 
I 6 HOH 616 2616 2616 HOH HOH A . 
I 6 HOH 617 2617 2617 HOH HOH A . 
I 6 HOH 618 2618 2618 HOH HOH A . 
I 6 HOH 619 2619 2619 HOH HOH A . 
I 6 HOH 620 2620 2620 HOH HOH A . 
I 6 HOH 621 2621 2621 HOH HOH A . 
I 6 HOH 622 2622 2622 HOH HOH A . 
I 6 HOH 623 2623 2623 HOH HOH A . 
I 6 HOH 624 2624 2624 HOH HOH A . 
I 6 HOH 625 2625 2625 HOH HOH A . 
I 6 HOH 626 2626 2626 HOH HOH A . 
I 6 HOH 627 2627 2627 HOH HOH A . 
I 6 HOH 628 2628 2628 HOH HOH A . 
I 6 HOH 629 2629 2629 HOH HOH A . 
I 6 HOH 630 2630 2630 HOH HOH A . 
I 6 HOH 631 2631 2631 HOH HOH A . 
I 6 HOH 632 2632 2632 HOH HOH A . 
I 6 HOH 633 2633 2633 HOH HOH A . 
I 6 HOH 634 2634 2634 HOH HOH A . 
I 6 HOH 635 2635 2635 HOH HOH A . 
I 6 HOH 636 2636 2636 HOH HOH A . 
I 6 HOH 637 2637 2637 HOH HOH A . 
I 6 HOH 638 2638 2638 HOH HOH A . 
I 6 HOH 639 2639 2639 HOH HOH A . 
I 6 HOH 640 2640 2640 HOH HOH A . 
I 6 HOH 641 2641 2641 HOH HOH A . 
I 6 HOH 642 2642 2642 HOH HOH A . 
I 6 HOH 643 2643 2643 HOH HOH A . 
I 6 HOH 644 2644 2644 HOH HOH A . 
I 6 HOH 645 2645 2645 HOH HOH A . 
I 6 HOH 646 2646 2646 HOH HOH A . 
I 6 HOH 647 2647 2647 HOH HOH A . 
I 6 HOH 648 2648 2648 HOH HOH A . 
I 6 HOH 649 2649 2649 HOH HOH A . 
I 6 HOH 650 2650 2650 HOH HOH A . 
I 6 HOH 651 2651 2651 HOH HOH A . 
I 6 HOH 652 2652 2652 HOH HOH A . 
I 6 HOH 653 2653 2653 HOH HOH A . 
I 6 HOH 654 2654 2654 HOH HOH A . 
I 6 HOH 655 2655 2655 HOH HOH A . 
I 6 HOH 656 2656 2656 HOH HOH A . 
I 6 HOH 657 2657 2657 HOH HOH A . 
I 6 HOH 658 2658 2658 HOH HOH A . 
I 6 HOH 659 2659 2659 HOH HOH A . 
I 6 HOH 660 2660 2660 HOH HOH A . 
I 6 HOH 661 2661 2661 HOH HOH A . 
I 6 HOH 662 2662 2662 HOH HOH A . 
I 6 HOH 663 2663 2663 HOH HOH A . 
I 6 HOH 664 2664 2664 HOH HOH A . 
I 6 HOH 665 2665 2665 HOH HOH A . 
I 6 HOH 666 2666 2666 HOH HOH A . 
I 6 HOH 667 2667 2667 HOH HOH A . 
I 6 HOH 668 2668 2668 HOH HOH A . 
I 6 HOH 669 2669 2669 HOH HOH A . 
I 6 HOH 670 2670 2670 HOH HOH A . 
I 6 HOH 671 2671 2671 HOH HOH A . 
I 6 HOH 672 2672 2672 HOH HOH A . 
I 6 HOH 673 2673 2673 HOH HOH A . 
I 6 HOH 674 2674 2674 HOH HOH A . 
I 6 HOH 675 2675 2675 HOH HOH A . 
I 6 HOH 676 2676 2676 HOH HOH A . 
I 6 HOH 677 2677 2677 HOH HOH A . 
I 6 HOH 678 2678 2678 HOH HOH A . 
I 6 HOH 679 2679 2679 HOH HOH A . 
I 6 HOH 680 2680 2680 HOH HOH A . 
I 6 HOH 681 2681 2681 HOH HOH A . 
I 6 HOH 682 2682 2682 HOH HOH A . 
I 6 HOH 683 2683 2683 HOH HOH A . 
I 6 HOH 684 2684 2684 HOH HOH A . 
I 6 HOH 685 2685 2685 HOH HOH A . 
I 6 HOH 686 2686 2686 HOH HOH A . 
I 6 HOH 687 2687 2687 HOH HOH A . 
I 6 HOH 688 2688 2688 HOH HOH A . 
I 6 HOH 689 2689 2689 HOH HOH A . 
I 6 HOH 690 2690 2690 HOH HOH A . 
I 6 HOH 691 2691 2691 HOH HOH A . 
I 6 HOH 692 2692 2692 HOH HOH A . 
I 6 HOH 693 2693 2693 HOH HOH A . 
I 6 HOH 694 2694 2694 HOH HOH A . 
I 6 HOH 695 2695 2695 HOH HOH A . 
I 6 HOH 696 2696 2696 HOH HOH A . 
I 6 HOH 697 2697 2697 HOH HOH A . 
I 6 HOH 698 2698 2698 HOH HOH A . 
I 6 HOH 699 2699 2699 HOH HOH A . 
I 6 HOH 700 2700 2700 HOH HOH A . 
I 6 HOH 701 2701 2701 HOH HOH A . 
I 6 HOH 702 2702 2702 HOH HOH A . 
I 6 HOH 703 2703 2703 HOH HOH A . 
I 6 HOH 704 2704 2704 HOH HOH A . 
I 6 HOH 705 2705 2705 HOH HOH A . 
I 6 HOH 706 2706 2706 HOH HOH A . 
I 6 HOH 707 2707 2707 HOH HOH A . 
I 6 HOH 708 2708 2708 HOH HOH A . 
I 6 HOH 709 2709 2709 HOH HOH A . 
I 6 HOH 710 2710 2710 HOH HOH A . 
I 6 HOH 711 2711 2711 HOH HOH A . 
I 6 HOH 712 2712 2712 HOH HOH A . 
I 6 HOH 713 2713 2713 HOH HOH A . 
I 6 HOH 714 2714 2714 HOH HOH A . 
I 6 HOH 715 2715 2715 HOH HOH A . 
I 6 HOH 716 2716 2716 HOH HOH A . 
I 6 HOH 717 2717 2717 HOH HOH A . 
I 6 HOH 718 2718 2718 HOH HOH A . 
I 6 HOH 719 2719 2719 HOH HOH A . 
I 6 HOH 720 2720 2720 HOH HOH A . 
I 6 HOH 721 2721 2721 HOH HOH A . 
I 6 HOH 722 2722 2722 HOH HOH A . 
I 6 HOH 723 2723 2723 HOH HOH A . 
I 6 HOH 724 2724 2724 HOH HOH A . 
I 6 HOH 725 2725 2725 HOH HOH A . 
I 6 HOH 726 2726 2726 HOH HOH A . 
I 6 HOH 727 2727 2727 HOH HOH A . 
I 6 HOH 728 2728 2728 HOH HOH A . 
I 6 HOH 729 2729 2729 HOH HOH A . 
I 6 HOH 730 2730 2730 HOH HOH A . 
I 6 HOH 731 2731 2731 HOH HOH A . 
I 6 HOH 732 2732 2732 HOH HOH A . 
I 6 HOH 733 2733 2733 HOH HOH A . 
I 6 HOH 734 2734 2734 HOH HOH A . 
I 6 HOH 735 2735 2735 HOH HOH A . 
I 6 HOH 736 2736 2736 HOH HOH A . 
I 6 HOH 737 2737 2737 HOH HOH A . 
I 6 HOH 738 2738 2738 HOH HOH A . 
I 6 HOH 739 2739 2739 HOH HOH A . 
I 6 HOH 740 2740 2740 HOH HOH A . 
I 6 HOH 741 2741 2741 HOH HOH A . 
I 6 HOH 742 2742 2742 HOH HOH A . 
I 6 HOH 743 2743 2743 HOH HOH A . 
I 6 HOH 744 2744 2744 HOH HOH A . 
I 6 HOH 745 2745 2745 HOH HOH A . 
I 6 HOH 746 2746 2746 HOH HOH A . 
I 6 HOH 747 2747 2747 HOH HOH A . 
I 6 HOH 748 2748 2748 HOH HOH A . 
I 6 HOH 749 2749 2749 HOH HOH A . 
I 6 HOH 750 2750 2750 HOH HOH A . 
I 6 HOH 751 2751 2751 HOH HOH A . 
I 6 HOH 752 2752 2752 HOH HOH A . 
I 6 HOH 753 2753 2753 HOH HOH A . 
I 6 HOH 754 2754 2754 HOH HOH A . 
I 6 HOH 755 2755 2755 HOH HOH A . 
I 6 HOH 756 2756 2756 HOH HOH A . 
I 6 HOH 757 2757 2757 HOH HOH A . 
I 6 HOH 758 2758 2758 HOH HOH A . 
I 6 HOH 759 2759 2759 HOH HOH A . 
I 6 HOH 760 2760 2760 HOH HOH A . 
I 6 HOH 761 2761 2761 HOH HOH A . 
I 6 HOH 762 2762 2762 HOH HOH A . 
I 6 HOH 763 2763 2763 HOH HOH A . 
I 6 HOH 764 2764 2764 HOH HOH A . 
I 6 HOH 765 2765 2765 HOH HOH A . 
I 6 HOH 766 2766 2766 HOH HOH A . 
I 6 HOH 767 2767 2767 HOH HOH A . 
I 6 HOH 768 2768 2768 HOH HOH A . 
I 6 HOH 769 2769 2769 HOH HOH A . 
I 6 HOH 770 2770 2770 HOH HOH A . 
I 6 HOH 771 2771 2771 HOH HOH A . 
I 6 HOH 772 2772 2772 HOH HOH A . 
I 6 HOH 773 2773 2773 HOH HOH A . 
I 6 HOH 774 2774 2774 HOH HOH A . 
I 6 HOH 775 2775 2775 HOH HOH A . 
I 6 HOH 776 2776 2776 HOH HOH A . 
I 6 HOH 777 2777 2777 HOH HOH A . 
I 6 HOH 778 2778 2778 HOH HOH A . 
I 6 HOH 779 2779 2779 HOH HOH A . 
I 6 HOH 780 2780 2780 HOH HOH A . 
I 6 HOH 781 2781 2781 HOH HOH A . 
I 6 HOH 782 2782 2782 HOH HOH A . 
I 6 HOH 783 2783 2783 HOH HOH A . 
I 6 HOH 784 2784 2784 HOH HOH A . 
I 6 HOH 785 2785 2785 HOH HOH A . 
I 6 HOH 786 2786 2786 HOH HOH A . 
I 6 HOH 787 2787 2787 HOH HOH A . 
I 6 HOH 788 2788 2788 HOH HOH A . 
I 6 HOH 789 2789 2789 HOH HOH A . 
I 6 HOH 790 2790 2790 HOH HOH A . 
I 6 HOH 791 2791 2791 HOH HOH A . 
I 6 HOH 792 2792 2792 HOH HOH A . 
I 6 HOH 793 2793 2793 HOH HOH A . 
I 6 HOH 794 2794 2794 HOH HOH A . 
I 6 HOH 795 2795 2795 HOH HOH A . 
I 6 HOH 796 2796 2796 HOH HOH A . 
I 6 HOH 797 2797 2797 HOH HOH A . 
I 6 HOH 798 2798 2798 HOH HOH A . 
I 6 HOH 799 2799 2799 HOH HOH A . 
I 6 HOH 800 2800 2800 HOH HOH A . 
I 6 HOH 801 2801 2801 HOH HOH A . 
I 6 HOH 802 2802 2802 HOH HOH A . 
I 6 HOH 803 2803 2803 HOH HOH A . 
I 6 HOH 804 2804 2804 HOH HOH A . 
I 6 HOH 805 2805 2805 HOH HOH A . 
I 6 HOH 806 2806 2806 HOH HOH A . 
I 6 HOH 807 2807 2807 HOH HOH A . 
I 6 HOH 808 2808 2808 HOH HOH A . 
I 6 HOH 809 2809 2809 HOH HOH A . 
I 6 HOH 810 2810 2810 HOH HOH A . 
I 6 HOH 811 2811 2811 HOH HOH A . 
I 6 HOH 812 2812 2812 HOH HOH A . 
I 6 HOH 813 2813 2813 HOH HOH A . 
I 6 HOH 814 2814 2814 HOH HOH A . 
I 6 HOH 815 2815 2815 HOH HOH A . 
I 6 HOH 816 2816 2816 HOH HOH A . 
I 6 HOH 817 2817 2817 HOH HOH A . 
I 6 HOH 818 2818 2818 HOH HOH A . 
I 6 HOH 819 2819 2819 HOH HOH A . 
I 6 HOH 820 2820 2820 HOH HOH A . 
I 6 HOH 821 2821 2821 HOH HOH A . 
I 6 HOH 822 2822 2822 HOH HOH A . 
I 6 HOH 823 2823 2823 HOH HOH A . 
I 6 HOH 824 2824 2824 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I 
1 2 A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-14 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2018-07-25 
5 'Structure model' 2 1 2019-04-03 
6 'Structure model' 2 2 2020-07-29 
7 'Structure model' 2 3 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 6 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' Advisory                    
4  4 'Structure model' 'Atomic model'              
5  4 'Structure model' 'Data collection'           
6  4 'Structure model' 'Derived calculations'      
7  4 'Structure model' 'Non-polymer description'   
8  4 'Structure model' 'Structure summary'         
9  5 'Structure model' 'Data collection'           
10 5 'Structure model' 'Derived calculations'      
11 5 'Structure model' 'Experimental preparation'  
12 6 'Structure model' 'Data collection'           
13 6 'Structure model' 'Derived calculations'      
14 6 'Structure model' Other                       
15 6 'Structure model' 'Structure summary'         
16 7 'Structure model' 'Derived calculations'      
17 7 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                 
2  4 'Structure model' chem_comp                 
3  4 'Structure model' database_PDB_caveat       
4  4 'Structure model' entity                    
5  4 'Structure model' pdbx_entity_nonpoly       
6  4 'Structure model' pdbx_nonpoly_scheme       
7  4 'Structure model' pdbx_validate_chiral      
8  4 'Structure model' struct_asym               
9  4 'Structure model' struct_conn               
10 5 'Structure model' exptl_crystal_grow        
11 5 'Structure model' struct_conn               
12 6 'Structure model' chem_comp                 
13 6 'Structure model' entity                    
14 6 'Structure model' pdbx_chem_comp_identifier 
15 6 'Structure model' pdbx_database_status      
16 6 'Structure model' pdbx_entity_nonpoly       
17 6 'Structure model' struct_conn               
18 6 'Structure model' struct_site               
19 6 'Structure model' struct_site_gen           
20 7 'Structure model' chem_comp                 
21 7 'Structure model' pdbx_struct_assembly      
22 7 'Structure model' pdbx_struct_assembly_gen  
23 7 'Structure model' pdbx_struct_oper_list     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                
2  4 'Structure model' '_atom_site.Cartn_x'                       
3  4 'Structure model' '_atom_site.Cartn_y'                       
4  4 'Structure model' '_atom_site.Cartn_z'                       
5  4 'Structure model' '_atom_site.auth_atom_id'                  
6  4 'Structure model' '_atom_site.auth_comp_id'                  
7  4 'Structure model' '_atom_site.label_atom_id'                 
8  4 'Structure model' '_atom_site.label_comp_id'                 
9  4 'Structure model' '_atom_site.label_entity_id'               
10 4 'Structure model' '_atom_site.type_symbol'                   
11 4 'Structure model' '_chem_comp.formula'                       
12 4 'Structure model' '_chem_comp.formula_weight'                
13 4 'Structure model' '_chem_comp.id'                            
14 4 'Structure model' '_chem_comp.mon_nstd_flag'                 
15 4 'Structure model' '_chem_comp.name'                          
16 4 'Structure model' '_chem_comp.type'                          
17 4 'Structure model' '_pdbx_nonpoly_scheme.entity_id'           
18 4 'Structure model' '_pdbx_nonpoly_scheme.mon_id'              
19 4 'Structure model' '_pdbx_nonpoly_scheme.pdb_mon_id'          
20 4 'Structure model' '_struct_asym.entity_id'                   
21 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'          
22 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'         
23 5 'Structure model' '_exptl_crystal_grow.temp'                 
24 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'      
25 6 'Structure model' '_chem_comp.name'                          
26 6 'Structure model' '_chem_comp.type'                          
27 6 'Structure model' '_entity.pdbx_description'                 
28 6 'Structure model' '_pdbx_database_status.status_code_sf'     
29 6 'Structure model' '_pdbx_entity_nonpoly.name'                
30 6 'Structure model' '_struct_conn.pdbx_role'                   
31 7 'Structure model' '_chem_comp.pdbx_synonyms'                 
32 7 'Structure model' '_pdbx_struct_assembly.details'            
33 7 'Structure model' '_pdbx_struct_assembly.method_details'     
34 7 'Structure model' '_pdbx_struct_assembly.oligomeric_count'   
35 7 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
XDS    'data reduction' .   ? 2 
XSCALE 'data scaling'   .   ? 3 
CNS    phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id                 2C5F 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         'RESIDUES 1, 2, 3, 536 AND 537 MISSING' 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2051 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2051 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_675 
_pdbx_validate_symm_contact.dist              1.96 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 25  ? ? -161.29 -167.11 
2  1 PRO A 38  ? ? -53.73  109.79  
3  1 PRO A 39  ? ? -65.78  52.98   
4  1 PHE A 45  ? ? 85.24   -7.95   
5  1 ALA A 60  ? ? -107.38 50.61   
6  1 SER A 91  ? ? -171.91 145.89  
7  1 SER A 108 ? ? -159.27 65.20   
8  1 ALA A 164 ? ? -154.33 65.33   
9  1 THR A 193 ? ? -140.10 59.27   
10 1 SER A 200 ? ? 59.54   -118.18 
11 1 GLU A 299 ? ? -118.79 -81.28  
12 1 THR A 317 ? ? -153.31 -158.71 
13 1 ASP A 326 ? ? -114.24 67.02   
14 1 ASP A 380 ? ? -161.62 52.53   
15 1 VAL A 400 ? ? -126.85 -64.95  
16 1 THR A 412 ? ? -47.51  -19.63  
17 1 LYS A 454 ? ? -39.09  -39.32  
18 1 PRO A 485 ? ? -27.49  -82.33  
19 1 HIS A 486 ? ? -103.85 69.78   
20 1 THR A 535 ? ? -103.51 48.06   
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    NAG 
_pdbx_validate_chiral.auth_seq_id     1537 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 2010 ? 6.93 .    
2  1 O ? A HOH 2020 ? 7.72 .    
3  1 O ? A HOH 2031 ? 6.17 .    
4  1 O ? A HOH 2076 ? 6.46 .    
5  1 O ? A HOH 2077 ? 6.70 .    
6  1 O ? A HOH 2078 ? 7.60 .    
7  1 O ? A HOH 2079 ? 6.65 .    
8  1 O ? A HOH 2081 ? 6.83 .    
9  1 O ? A HOH 2083 ? 6.13 .    
10 1 O ? A HOH 2085 ? 7.17 .    
11 1 O ? A HOH 2113 ? 6.12 .    
12 1 O ? A HOH 2114 ? 7.20 .    
13 1 O ? A HOH 2127 ? 6.29 .    
14 1 O ? A HOH 2128 ? 6.76 .    
15 1 O ? A HOH 2132 ? 7.35 .    
16 1 O ? A HOH 2142 ? 6.74 .    
17 1 O ? A HOH 2144 ? 6.70 .    
18 1 O ? A HOH 2255 ? 6.93 .    
19 1 O ? A HOH 2399 ? .    8.44 
20 1 O ? A HOH 2789 ? .    7.19 
21 1 O ? A HOH 2790 ? .    7.65 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ALA 536 ? CA ? A ALA 536 CA 
2 1 Y 1 A ALA 536 ? C  ? A ALA 536 C  
3 1 Y 1 A ALA 536 ? O  ? A ALA 536 O  
4 1 Y 1 A ALA 536 ? CB ? A ALA 536 CB 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A CYS 537 ? A CYS 537 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose      NAG 
3 'TRIETHYLENE GLYCOL'                          PGE 
4 4,4-DIHYDROXY-N,N,N-TRIMETHYLPENTAN-1-AMINIUM NWA 
5 N,N,N-TRIMETHYL-4-OXOPENTAN-1-AMINIUM         CHH 
6 water                                         HOH 
#