data_2C5G
# 
_entry.id   2C5G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.342 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2C5G         
PDBE  EBI-26170    
WWPDB D_1290026170 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1ACJ unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH TACRINE' 
PDB 1ACL unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH DECAMETHONIUM' 
PDB 1AMN unspecified 
'TRANSITION STATE ANALOG: ACETYLCHOLINESTERASE COMPLEXED WITH M-(N,N,N-TRIMETHYLAMMONIO) TRIFLUOROACETOPHENONE' 
PDB 1AX9 unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, LAUE DATA' 
PDB 1CFJ unspecified 
'METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O- ISOPROPYLMETHYLPHOSPHONOFLUORIDATE (GB, SARIN)' 
PDB 1DX6 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-GALANTHAMINE AT 2.3A RESOLUTION' 
PDB 1E3Q unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH BW284C51' 
PDB 1E66 unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH (-)-HUPRINE X AT 2.1A RESOLUTION' 
PDB 1EA5 unspecified 'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7 ) FROM TORPEDO CALIFORNICA AT 1.8A RESOLUTION' 
PDB 1EEA unspecified ACETYLCHOLINESTERASE 
PDB 1EVE unspecified 
'THREE DIMENSIONAL STRUCTURE OF THE ANTI- ALZHEIMER DRUG, E2020 (ARICEPT), COMPLEXED WITH ITS TARGET ACETYLCHOLINESTERASE' 
PDB 1FSS unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH FASCICULIN- II' 
PDB 1GPK unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXE WITH (+)-HUPERZINE A AT 2.1A RESOLUTION' 
PDB 1GPN unspecified 'STRUCTURE OF ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE B AT 2.35A RESOLUTION' 
PDB 1GQR unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH RIVASTIGMINE' 
PDB 1GQS unspecified 'ACETYLCHOLINESTERASE (E.C. 3.1.1.7) COMPLEXED WITH NAP' 
PDB 1H22 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(10)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1H23 unspecified 
'STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH (S,S)-(-)-BIS(12)- HUPERZINE A-LIKE INHIBITOR AT 2.15A RESOLUTION' 
PDB 1HBJ unspecified 
;X-RAY CRYSTAL STRUCTURE OF COMPLEX BETWEEN TORPEDO CALIFORNICA ACHE AND A REVERSIBLE INHIBITOR, 4-AMINO-5-FLUORO-2-METHYL-3-( 3-TRIFLUOROACETYLBENZYLTHIOMETHYL)QUINOLINE
;
PDB 1JGA unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,7- HEPTYLENE-BIS-N,N'-SYN-2-PYRIDINIUMALDOXIME
;
PDB 1JGB unspecified 
;THEORETICAL MODEL OF THE DIISOPROPYLPHOSPHORYL- ACETYLCHOLINESTERASE COMPLEXED WITH 1,3- PROPYLENE-BIS-N,N'-SYN-4-PYRIDINIUMALDOXIME
;
PDB 1JJB unspecified 
'A NEUTRAL MOLECULE IN CATION-BINDING SITE: SPECIFIC BINDINGOF PEG-SH TO ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 1OCE unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH MF268' 
PDB 1ODC unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-4'-QUINOLYL-N'-9 "-(1",2",3",4"-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.2A RESOLUTION
;
PDB 1QID unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT A) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIE unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT B) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIF unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT C) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIG unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT D) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIH unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT E) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QII unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT F) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIJ unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT G) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIK unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT H) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QIM unspecified 
;SPECIFIC CHEMICAL AND STRUCTURAL DAMAGE AT NINE TIME POINTS (POINT I) CAUSED BY INTENSE SYNCHROTRON RADIATION TO TORPEDO CALIFORNICA ACETYLCHOLINESTERASE
;
PDB 1QTI unspecified ACETYLCHOLINESTERASE 
PDB 1SOM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE INHIBITED BY NERVE AGENT GD (SOMAN).' 
PDB 1U65 unspecified 'ACHE W. CPT-11' 
PDB 1UT6 unspecified 
;STRUCTURE OF ACETYLCHOLINESTERASE (E.C. 3.1 .1.7) COMPLEXED WITH N-9-(1',2',3',4 '-TETRAHYDROACRIDINYL)-1,8- DIAMINOOCTANE AT 2.4 ANGSTROMS RESOLUTION.
;
PDB 1VOT unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH HUPERZINE A' 
PDB 1VXO unspecified 
;METHYLPHOSPHONYLATED ACETYLCHOLINESTERASE (AGED) OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1VXR unspecified 
;O-ETHYLMETHYLPHOSPHONYLATED ACETYLCHOLINESTERASE OBTAINED BY REACTION WITH O-ETHYL-S-[2-[ BIS(1-METHYLETHYL) AMINO]ETHYL] METHYLPHOSPHONOTHIOATE (VX)
;
PDB 1W4L unspecified 'COMPLEX OF TCACHE WITH BIS-ACTING GALANTHAMINE DERIVATIVE' 
PDB 1W6R unspecified 'COMPLEX OF TCACHE WITH GALANTHAMINE DERIVATIVE' 
PDB 1W75 unspecified 'NATIVE ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE)' 
PDB 1W76 unspecified 
'ORTHORHOMBIC FORM OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE (ACHE) COMPLEXED WITH BIS- ACTING GALANTHAMINE DERIVATIVE' 
PDB 1ZGB unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (R)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 1ZGC unspecified 
'CRYSTAL STRUCTURE OF TORPEDO CALIFORNICAACETYLCHOLINESTERASE IN COMPLEX WITH AN (RS)-TACRINE(10)-HUPYRIDONE INHIBITOR.' 
PDB 2ACE unspecified 'NATIVE ACETYLCHOLINESTERASE FROM TORPEDO CALIFORNICA' 
PDB 2ACK unspecified 'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
PDB 2C4H unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 500MM ACETYLTHIOCHOLINE' 
PDB 2C58 unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH 20MM ACETYLTHIOCHOLINE' 
PDB 2C5F unspecified 
'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE IN COMPLEX WITH A NON HYDROLYSABLE SUBSTRATE ANALOGUE, 4-OXO-N,N,N-TRIMETHYLAMMONIUM' 
PDB 2CEK unspecified 
;CONFORMATIONAL FLEXIBILITY IN THE PERIPHERAL SITE OF TORPEDO CALIFORNICA ACETYLCHOLINESTERASE REVEALED BY THE COMPLEX STRUCTURE WITH A BIFUNCTIONAL INHIBITOR
;
PDB 2CKM unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (7 CARBON LINKER)' 
PDB 2CMF unspecified 'TORPEDO CALIFORNICA ACETYLCHOLINESTERASE COMPLEXED WITH ALKYLENE-LINKED BIS-TACRINE DIMER (5 CARBON LINKER)' 
PDB 2DFP unspecified 'X-RAY STRUCTURE OF AGED DI-ISOPROPYL- PHOSPHORO-FLUORIDATE (DFP) BOUND TO ACETYLCHOLINESTERASE' 
PDB 3ACE unspecified 'THEORETICAL MODEL OF (R)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
PDB 4ACE unspecified 'THEORETICAL MODEL OF (S)-E2020 BOUND ACETYLCHOLINESTERASE COMPLEX, 3 STRUCTURES' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2C5G 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-10-27 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Colletier, J.P.'  1 
'Fournier, D.'     2 
'Greenblatt, H.M.' 3 
'Sussman, J.L.'    4 
'Zaccai, G.'       5 
'Silman, I.'       6 
'Weik, M.'         7 
# 
_citation.id                        primary 
_citation.title                     'Structural Insights Into Substrate Traffic and Inhibition in Acetylcholinesterase.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            25 
_citation.page_first                2746 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16763558 
_citation.pdbx_database_id_DOI      10.1038/SJ.EMBOJ.7601175 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Colletier, J.P.'  1 ? 
primary 'Fournier, D.'     2 ? 
primary 'Greenblatt, H.M.' 3 ? 
primary 'Stojan, J.'       4 ? 
primary 'Sussman, J.L.'    5 ? 
primary 'Zaccai, G.'       6 ? 
primary 'Silman, I.'       7 ? 
primary 'Weik, M.'         8 ? 
# 
_cell.entry_id           2C5G 
_cell.length_a           112.520 
_cell.length_b           112.520 
_cell.length_c           137.370 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2C5G 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE                     60736.516 1    3.1.1.7 ? ? ? 
2 non-polymer syn '2-(TRIMETHYLAMMONIUM)ETHYL THIOL'       120.236   2    ?       ? ? ? 
3 non-polymer syn 'CHLORIDE ION'                           35.453    7    ?       ? ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2    ?       ? ? ? 
5 non-polymer syn 'TRIETHYLENE GLYCOL'                     150.173   2    ?       ? ? ? 
6 water       nat water                                    18.015    1408 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        ACHE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'PACIFIC ELECTRIC RAY' 
_entity_src_nat.pdbx_organism_scientific   'TORPEDO CALIFORNICA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2C5G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CL  non-polymer                  . 'CHLORIDE ION'                           ? 'Cl -1'          35.453  
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
ETM non-polymer                  . '2-(TRIMETHYLAMMONIUM)ETHYL THIOL'       ? 'C5 H14 N S 1'   120.236 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PGE non-polymer                  . 'TRIETHYLENE GLYCOL'                     ? 'C6 H14 O4'      150.173 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2C5G 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_percent_sol   68.00 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.00 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '32% PEG200, 150MM MES, PH6, 4 DEG. C, pH 6.00' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2005-02-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.93300 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.93300 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2C5G 
_reflns.observed_criterion_sigma_I   3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            1.950 
_reflns.number_obs                   72945 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.2600 
_reflns.B_iso_Wilson_estimate        20.7 
_reflns.pdbx_redundancy              7.390 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   95.6 
_reflns_shell.Rmerge_I_obs           0.49000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.700 
_reflns_shell.pdbx_redundancy        7.31 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2C5G 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     72945 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               3462644.35 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.87 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    99.2 
_refine.ls_R_factor_obs                          0.160 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.160 
_refine.ls_R_factor_R_free                       0.186 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3700 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               36.5 
_refine.aniso_B[1][1]                            5.57 
_refine.aniso_B[2][2]                            5.57 
_refine.aniso_B[3][3]                            -11.15 
_refine.aniso_B[1][2]                            0.68 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.351079 
_refine.solvent_model_param_bsol                 100.204 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1EA5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2C5G 
_refine_analyze.Luzzati_coordinate_error_obs    0.18 
_refine_analyze.Luzzati_sigma_a_obs             0.20 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.22 
_refine_analyze.Luzzati_sigma_a_free            0.23 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4245 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         69 
_refine_hist.number_atoms_solvent             1408 
_refine_hist.number_atoms_total               5722 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        19.87 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      22.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.00  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.11  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.67  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.92  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.79  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.95 
_refine_ls_shell.d_res_low                        1.98 
_refine_ls_shell.number_reflns_R_work             3272 
_refine_ls_shell.R_factor_R_work                  0.250 
_refine_ls_shell.percent_reflns_obs               94.0 
_refine_ls_shell.R_factor_R_free                  0.281 
_refine_ls_shell.R_factor_R_free_error            0.023 
_refine_ls_shell.percent_reflns_R_free            4.3 
_refine_ls_shell.number_reflns_R_free             147 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM  PROTEIN.TOP      
'X-RAY DIFFRACTION' 2 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 
'X-RAY DIFFRACTION' 3 WATER_REP.PARAM    WATER.TOP        
'X-RAY DIFFRACTION' 4 ION.PARAM          ION.TOP          
'X-RAY DIFFRACTION' 5 ATCH.PARAM         ATCH.TOP         
# 
_struct.entry_id                  2C5G 
_struct.title                     'Torpedo californica acetylcholinesterase in complex with 20mM thiocholine' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2C5G 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HYDROLASE, SERINE ESTERASE, SYNAPSE, MEMBRANE, NEUROTRANSMITTER CLEAVAGE, ALPHA/BETA HYDROLASE, SUBSTRATE HYDROLYSIS, MICHAELIS-MENTEN COMPLEX, SUBSTRATE INHIBITION, ALTERNATIVE SPLICING, GLYCOPROTEIN, ANCHOR, LIPOPROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 5 ? 
O N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 40  ? ARG A 44  ? VAL A 40  ARG A 44  5 ? 5  
HELX_P HELX_P2  2  PHE A 78  ? MET A 83  ? PHE A 78  MET A 83  1 ? 6  
HELX_P HELX_P3  3  LEU A 127 ? ASN A 131 ? LEU A 127 ASN A 131 5 ? 5  
HELX_P HELX_P4  4  GLY A 132 ? GLU A 140 ? GLY A 132 GLU A 140 1 ? 9  
HELX_P HELX_P5  5  VAL A 150 ? LEU A 156 ? VAL A 150 LEU A 156 1 ? 7  
HELX_P HELX_P6  6  ASN A 167 ? ILE A 184 ? ASN A 167 ILE A 184 1 ? 18 
HELX_P HELX_P7  7  GLN A 185 ? PHE A 187 ? GLN A 185 PHE A 187 5 ? 3  
HELX_P HELX_P8  8  SER A 200 ? SER A 212 ? SER A 200 SER A 212 1 ? 13 
HELX_P HELX_P9  9  SER A 212 ? ASP A 217 ? SER A 212 ASP A 217 1 ? 6  
HELX_P HELX_P10 10 VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P11 11 SER A 258 ? LYS A 269 ? SER A 258 LYS A 269 1 ? 12 
HELX_P HELX_P12 12 LYS A 270 ? GLU A 278 ? LYS A 270 GLU A 278 1 ? 9  
HELX_P HELX_P13 13 TRP A 279 ? LEU A 282 ? TRP A 279 LEU A 282 5 ? 4  
HELX_P HELX_P14 14 SER A 304 ? GLY A 312 ? SER A 304 GLY A 312 1 ? 9  
HELX_P HELX_P15 15 GLY A 328 ? ALA A 336 ? GLY A 328 ALA A 336 1 ? 9  
HELX_P HELX_P16 16 SER A 348 ? VAL A 360 ? SER A 348 VAL A 360 1 ? 13 
HELX_P HELX_P17 17 ASN A 364 ? TYR A 375 ? ASN A 364 TYR A 375 1 ? 12 
HELX_P HELX_P18 18 ASN A 383 ? VAL A 400 ? ASN A 383 VAL A 400 1 ? 18 
HELX_P HELX_P19 19 VAL A 400 ? GLY A 415 ? VAL A 400 GLY A 415 1 ? 16 
HELX_P HELX_P20 20 PRO A 433 ? GLY A 437 ? PRO A 433 GLY A 437 5 ? 5  
HELX_P HELX_P21 21 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P22 22 GLY A 449 ? VAL A 453 ? GLY A 449 VAL A 453 5 ? 5  
HELX_P HELX_P23 23 VAL A 453 ? ASN A 457 ? VAL A 453 ASN A 457 5 ? 5  
HELX_P HELX_P24 24 THR A 459 ? GLY A 480 ? THR A 459 GLY A 480 1 ? 22 
HELX_P HELX_P25 25 ARG A 517 ? GLN A 526 ? ARG A 517 GLN A 526 1 ? 10 
HELX_P HELX_P26 26 GLN A 526 ? THR A 535 ? GLN A 526 THR A 535 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 67  SG  ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94   1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf2 disulf ?   ? A CYS 254 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf3 disulf ?   ? A CYS 402 SG  ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
covale1 covale one ? A ASN 59  ND2 ? ? ? 1_555 L NAG .   C1 ? ? A ASN 59  A NAG 1546 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale2 covale one ? A ASN 416 ND2 ? ? ? 1_555 K NAG .   C1 ? ? A ASN 416 A NAG 1545 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 11 ? 
AC ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1  2  ? anti-parallel 
AA 2  3  ? parallel      
AB 1  2  ? anti-parallel 
AB 2  3  ? anti-parallel 
AB 3  4  ? anti-parallel 
AB 4  5  ? parallel      
AB 5  6  ? parallel      
AB 6  7  ? parallel      
AB 7  8  ? parallel      
AB 8  9  ? parallel      
AB 9  10 ? parallel      
AB 10 11 ? anti-parallel 
AC 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1  LEU A 7   ? THR A 10  ? LEU A 7   THR A 10  
AA 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
AA 3  VAL A 57  ? ASN A 59  ? VAL A 57  ASN A 59  
AB 1  THR A 18  ? VAL A 22  ? THR A 18  VAL A 22  
AB 2  SER A 25  ? PRO A 34  ? SER A 25  PRO A 34  
AB 3  TYR A 96  ? VAL A 101 ? TYR A 96  VAL A 101 
AB 4  VAL A 142 ? SER A 145 ? VAL A 142 SER A 145 
AB 5  THR A 109 ? ILE A 115 ? THR A 109 ILE A 115 
AB 6  GLY A 189 ? GLU A 199 ? GLY A 189 GLU A 199 
AB 7  ARG A 221 ? GLN A 225 ? ARG A 221 GLN A 225 
AB 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
AB 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
AB 10 LYS A 501 ? LEU A 505 ? LYS A 501 LEU A 505 
AB 11 VAL A 512 ? GLN A 514 ? VAL A 512 GLN A 514 
AC 1  VAL A 236 ? SER A 237 ? VAL A 236 SER A 237 
AC 2  VAL A 295 ? ILE A 296 ? VAL A 295 ILE A 296 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1  2  N THR A 10  ? N THR A 10  O GLY A 13  ? O GLY A 13  
AA 2  3  N MET A 16  ? N MET A 16  O TRP A 58  ? O TRP A 58  
AB 1  2  N VAL A 22  ? N VAL A 22  O SER A 25  ? O SER A 25  
AB 2  3  N ILE A 33  ? N ILE A 33  O LEU A 97  ? O LEU A 97  
AB 3  4  N TRP A 100 ? N TRP A 100 O LEU A 143 ? O LEU A 143 
AB 4  5  N VAL A 142 ? N VAL A 142 O THR A 110 ? O THR A 110 
AB 5  6  O THR A 109 ? O THR A 109 N ASP A 190 ? N ASP A 190 
AB 6  7  N ILE A 196 ? N ILE A 196 O ARG A 221 ? O ARG A 221 
AB 7  8  N ALA A 222 ? N ALA A 222 O GLN A 318 ? O GLN A 318 
AB 8  9  N ILE A 319 ? N ILE A 319 O GLY A 417 ? O GLY A 417 
AB 9  10 N PHE A 422 ? N PHE A 422 O ILE A 503 ? O ILE A 503 
AB 10 11 N PHE A 502 ? N PHE A 502 O HIS A 513 ? O HIS A 513 
AC 1  2  O VAL A 236 ? O VAL A 236 N ILE A 296 ? N ILE A 296 
# 
_database_PDB_matrix.entry_id          2C5G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2C5G 
_atom_sites.fract_transf_matrix[1][1]   0.008887 
_atom_sites.fract_transf_matrix[1][2]   0.005131 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010262 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007280 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 4   ? -13.117 87.603 34.782 1.00 45.81  ? 4    SER A N   1 
ATOM   2    C  CA  . SER A 1 4   ? -12.497 88.223 35.991 1.00 45.76  ? 4    SER A CA  1 
ATOM   3    C  C   . SER A 1 4   ? -11.323 87.383 36.484 1.00 44.03  ? 4    SER A C   1 
ATOM   4    O  O   . SER A 1 4   ? -11.344 86.155 36.392 1.00 43.60  ? 4    SER A O   1 
ATOM   5    C  CB  . SER A 1 4   ? -13.538 88.354 37.105 1.00 47.37  ? 4    SER A CB  1 
ATOM   6    O  OG  . SER A 1 4   ? -12.954 88.858 38.292 1.00 50.22  ? 4    SER A OG  1 
ATOM   7    N  N   . GLU A 1 5   ? -10.303 88.054 37.009 1.00 41.58  ? 5    GLU A N   1 
ATOM   8    C  CA  . GLU A 1 5   ? -9.113  87.377 37.508 1.00 40.56  ? 5    GLU A CA  1 
ATOM   9    C  C   . GLU A 1 5   ? -9.424  86.414 38.655 1.00 38.97  ? 5    GLU A C   1 
ATOM   10   O  O   . GLU A 1 5   ? -8.717  85.426 38.851 1.00 38.81  ? 5    GLU A O   1 
ATOM   11   C  CB  . GLU A 1 5   ? -8.085  88.411 37.968 1.00 42.35  ? 5    GLU A CB  1 
ATOM   12   C  CG  . GLU A 1 5   ? -6.737  87.828 38.345 1.00 44.49  ? 5    GLU A CG  1 
ATOM   13   C  CD  . GLU A 1 5   ? -5.722  88.898 38.692 1.00 47.38  ? 5    GLU A CD  1 
ATOM   14   O  OE1 . GLU A 1 5   ? -4.555  88.549 38.968 1.00 47.04  ? 5    GLU A OE1 1 
ATOM   15   O  OE2 . GLU A 1 5   ? -6.091  90.093 38.687 1.00 49.00  ? 5    GLU A OE2 1 
ATOM   16   N  N   . LEU A 1 6   ? -10.482 86.699 39.407 1.00 35.52  ? 6    LEU A N   1 
ATOM   17   C  CA  . LEU A 1 6   ? -10.862 85.853 40.531 1.00 33.30  ? 6    LEU A CA  1 
ATOM   18   C  C   . LEU A 1 6   ? -11.862 84.768 40.144 1.00 32.64  ? 6    LEU A C   1 
ATOM   19   O  O   . LEU A 1 6   ? -12.238 83.941 40.975 1.00 33.20  ? 6    LEU A O   1 
ATOM   20   C  CB  . LEU A 1 6   ? -11.442 86.710 41.662 1.00 32.48  ? 6    LEU A CB  1 
ATOM   21   C  CG  . LEU A 1 6   ? -10.484 87.707 42.323 1.00 32.04  ? 6    LEU A CG  1 
ATOM   22   C  CD1 . LEU A 1 6   ? -11.232 88.499 43.390 1.00 32.08  ? 6    LEU A CD1 1 
ATOM   23   C  CD2 . LEU A 1 6   ? -9.304  86.964 42.943 1.00 32.76  ? 6    LEU A CD2 1 
ATOM   24   N  N   . LEU A 1 7   ? -12.292 84.769 38.886 1.00 31.60  ? 7    LEU A N   1 
ATOM   25   C  CA  . LEU A 1 7   ? -13.247 83.772 38.413 1.00 32.51  ? 7    LEU A CA  1 
ATOM   26   C  C   . LEU A 1 7   ? -12.530 82.780 37.508 1.00 32.39  ? 7    LEU A C   1 
ATOM   27   O  O   . LEU A 1 7   ? -11.890 83.166 36.528 1.00 33.51  ? 7    LEU A O   1 
ATOM   28   C  CB  . LEU A 1 7   ? -14.396 84.444 37.650 1.00 35.03  ? 7    LEU A CB  1 
ATOM   29   C  CG  . LEU A 1 7   ? -15.623 83.600 37.265 1.00 37.66  ? 7    LEU A CG  1 
ATOM   30   C  CD1 . LEU A 1 7   ? -15.249 82.547 36.236 1.00 41.21  ? 7    LEU A CD1 1 
ATOM   31   C  CD2 . LEU A 1 7   ? -16.203 82.941 38.509 1.00 38.49  ? 7    LEU A CD2 1 
ATOM   32   N  N   . VAL A 1 8   ? -12.641 81.501 37.847 1.00 31.24  ? 8    VAL A N   1 
ATOM   33   C  CA  . VAL A 1 8   ? -12.002 80.444 37.075 1.00 30.32  ? 8    VAL A CA  1 
ATOM   34   C  C   . VAL A 1 8   ? -12.987 79.316 36.824 1.00 30.06  ? 8    VAL A C   1 
ATOM   35   O  O   . VAL A 1 8   ? -13.664 78.855 37.744 1.00 30.20  ? 8    VAL A O   1 
ATOM   36   C  CB  . VAL A 1 8   ? -10.779 79.868 37.825 1.00 29.84  ? 8    VAL A CB  1 
ATOM   37   C  CG1 . VAL A 1 8   ? -10.200 78.688 37.054 1.00 29.16  ? 8    VAL A CG1 1 
ATOM   38   C  CG2 . VAL A 1 8   ? -9.723  80.950 38.011 1.00 29.84  ? 8    VAL A CG2 1 
ATOM   39   N  N   . ASN A 1 9   ? -13.075 78.873 35.575 1.00 30.14  ? 9    ASN A N   1 
ATOM   40   C  CA  . ASN A 1 9   ? -13.978 77.784 35.243 1.00 31.58  ? 9    ASN A CA  1 
ATOM   41   C  C   . ASN A 1 9   ? -13.183 76.488 35.146 1.00 30.66  ? 9    ASN A C   1 
ATOM   42   O  O   . ASN A 1 9   ? -12.277 76.363 34.324 1.00 30.91  ? 9    ASN A O   1 
ATOM   43   C  CB  . ASN A 1 9   ? -14.700 78.064 33.922 1.00 33.98  ? 9    ASN A CB  1 
ATOM   44   C  CG  . ASN A 1 9   ? -15.788 77.046 33.631 1.00 39.59  ? 9    ASN A CG  1 
ATOM   45   O  OD1 . ASN A 1 9   ? -16.481 76.583 34.542 1.00 40.76  ? 9    ASN A OD1 1 
ATOM   46   N  ND2 . ASN A 1 9   ? -15.955 76.701 32.357 1.00 42.26  ? 9    ASN A ND2 1 
ATOM   47   N  N   . THR A 1 10  ? -13.524 75.527 35.996 1.00 29.82  ? 10   THR A N   1 
ATOM   48   C  CA  . THR A 1 10  ? -12.833 74.243 36.010 1.00 28.34  ? 10   THR A CA  1 
ATOM   49   C  C   . THR A 1 10  ? -13.761 73.159 35.477 1.00 29.74  ? 10   THR A C   1 
ATOM   50   O  O   . THR A 1 10  ? -14.941 73.407 35.235 1.00 27.72  ? 10   THR A O   1 
ATOM   51   C  CB  . THR A 1 10  ? -12.419 73.844 37.436 1.00 25.34  ? 10   THR A CB  1 
ATOM   52   O  OG1 . THR A 1 10  ? -13.574 73.406 38.162 1.00 25.28  ? 10   THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 10  ? -11.801 75.030 38.161 1.00 25.41  ? 10   THR A CG2 1 
ATOM   54   N  N   . LYS A 1 11  ? -13.224 71.954 35.312 1.00 29.08  ? 11   LYS A N   1 
ATOM   55   C  CA  . LYS A 1 11  ? -14.008 70.832 34.816 1.00 28.51  ? 11   LYS A CA  1 
ATOM   56   C  C   . LYS A 1 11  ? -15.071 70.410 35.827 1.00 29.14  ? 11   LYS A C   1 
ATOM   57   O  O   . LYS A 1 11  ? -16.008 69.686 35.486 1.00 30.98  ? 11   LYS A O   1 
ATOM   58   C  CB  . LYS A 1 11  ? -13.082 69.656 34.492 1.00 27.44  ? 11   LYS A CB  1 
ATOM   59   C  CG  . LYS A 1 11  ? -12.099 69.952 33.365 1.00 26.24  ? 11   LYS A CG  1 
ATOM   60   C  CD  . LYS A 1 11  ? -11.039 68.867 33.254 1.00 26.33  ? 11   LYS A CD  1 
ATOM   61   C  CE  . LYS A 1 11  ? -10.128 69.104 32.065 1.00 25.93  ? 11   LYS A CE  1 
ATOM   62   N  NZ  . LYS A 1 11  ? -8.982  68.157 32.061 1.00 27.62  ? 11   LYS A NZ  1 
ATOM   63   N  N   . SER A 1 12  ? -14.928 70.865 37.069 1.00 27.46  ? 12   SER A N   1 
ATOM   64   C  CA  . SER A 1 12  ? -15.890 70.532 38.118 1.00 28.97  ? 12   SER A CA  1 
ATOM   65   C  C   . SER A 1 12  ? -16.914 71.655 38.294 1.00 29.74  ? 12   SER A C   1 
ATOM   66   O  O   . SER A 1 12  ? -17.935 71.479 38.961 1.00 30.50  ? 12   SER A O   1 
ATOM   67   C  CB  . SER A 1 12  ? -15.171 70.299 39.453 1.00 30.79  ? 12   SER A CB  1 
ATOM   68   O  OG  . SER A 1 12  ? -14.201 69.271 39.348 1.00 34.22  ? 12   SER A OG  1 
ATOM   69   N  N   . GLY A 1 13  ? -16.629 72.807 37.696 1.00 30.17  ? 13   GLY A N   1 
ATOM   70   C  CA  . GLY A 1 13  ? -17.523 73.945 37.809 1.00 29.34  ? 13   GLY A CA  1 
ATOM   71   C  C   . GLY A 1 13  ? -16.750 75.232 38.030 1.00 30.36  ? 13   GLY A C   1 
ATOM   72   O  O   . GLY A 1 13  ? -15.517 75.224 38.076 1.00 28.62  ? 13   GLY A O   1 
ATOM   73   N  N   . LYS A 1 14  ? -17.469 76.340 38.176 1.00 30.43  ? 14   LYS A N   1 
ATOM   74   C  CA  . LYS A 1 14  ? -16.835 77.638 38.378 1.00 30.86  ? 14   LYS A CA  1 
ATOM   75   C  C   . LYS A 1 14  ? -16.471 77.899 39.835 1.00 29.96  ? 14   LYS A C   1 
ATOM   76   O  O   . LYS A 1 14  ? -17.168 77.460 40.754 1.00 28.71  ? 14   LYS A O   1 
ATOM   77   C  CB  . LYS A 1 14  ? -17.754 78.758 37.882 1.00 33.86  ? 14   LYS A CB  1 
ATOM   78   C  CG  . LYS A 1 14  ? -18.127 78.641 36.413 1.00 36.92  ? 14   LYS A CG  1 
ATOM   79   C  CD  . LYS A 1 14  ? -19.137 79.700 36.005 1.00 41.42  ? 14   LYS A CD  1 
ATOM   80   C  CE  . LYS A 1 14  ? -19.583 79.503 34.561 1.00 44.67  ? 14   LYS A CE  1 
ATOM   81   N  NZ  . LYS A 1 14  ? -20.643 80.472 34.165 1.00 47.69  ? 14   LYS A NZ  1 
ATOM   82   N  N   A VAL A 1 15  ? -15.370 78.614 40.042 0.50 29.28  ? 15   VAL A N   1 
ATOM   83   N  N   B VAL A 1 15  ? -15.376 78.623 40.033 0.50 29.79  ? 15   VAL A N   1 
ATOM   84   C  CA  A VAL A 1 15  ? -14.919 78.957 41.386 0.50 29.62  ? 15   VAL A CA  1 
ATOM   85   C  CA  B VAL A 1 15  ? -14.904 78.957 41.369 0.50 30.61  ? 15   VAL A CA  1 
ATOM   86   C  C   A VAL A 1 15  ? -14.558 80.436 41.433 0.50 30.03  ? 15   VAL A C   1 
ATOM   87   C  C   B VAL A 1 15  ? -14.557 80.441 41.429 0.50 30.60  ? 15   VAL A C   1 
ATOM   88   O  O   A VAL A 1 15  ? -13.987 80.975 40.487 0.50 29.57  ? 15   VAL A O   1 
ATOM   89   O  O   B VAL A 1 15  ? -13.989 80.989 40.485 0.50 30.16  ? 15   VAL A O   1 
ATOM   90   C  CB  A VAL A 1 15  ? -13.681 78.128 41.812 0.50 28.98  ? 15   VAL A CB  1 
ATOM   91   C  CB  B VAL A 1 15  ? -13.646 78.141 41.735 0.50 30.67  ? 15   VAL A CB  1 
ATOM   92   C  CG1 A VAL A 1 15  ? -14.042 76.652 41.886 0.50 29.54  ? 15   VAL A CG1 1 
ATOM   93   C  CG1 B VAL A 1 15  ? -13.278 78.384 43.180 0.50 31.05  ? 15   VAL A CG1 1 
ATOM   94   C  CG2 A VAL A 1 15  ? -12.539 78.350 40.835 0.50 27.60  ? 15   VAL A CG2 1 
ATOM   95   C  CG2 B VAL A 1 15  ? -13.892 76.661 41.488 0.50 31.82  ? 15   VAL A CG2 1 
ATOM   96   N  N   . MET A 1 16  ? -14.903 81.087 42.537 1.00 31.03  ? 16   MET A N   1 
ATOM   97   C  CA  . MET A 1 16  ? -14.620 82.507 42.715 1.00 31.63  ? 16   MET A CA  1 
ATOM   98   C  C   . MET A 1 16  ? -13.668 82.670 43.889 1.00 30.74  ? 16   MET A C   1 
ATOM   99   O  O   . MET A 1 16  ? -14.030 82.389 45.031 1.00 29.39  ? 16   MET A O   1 
ATOM   100  C  CB  . MET A 1 16  ? -15.915 83.279 42.992 1.00 33.98  ? 16   MET A CB  1 
ATOM   101  C  CG  . MET A 1 16  ? -15.730 84.780 43.174 1.00 37.96  ? 16   MET A CG  1 
ATOM   102  S  SD  . MET A 1 16  ? -15.180 85.611 41.670 1.00 45.61  ? 16   MET A SD  1 
ATOM   103  C  CE  . MET A 1 16  ? -16.761 85.880 40.844 1.00 43.81  ? 16   MET A CE  1 
ATOM   104  N  N   . GLY A 1 17  ? -12.452 83.121 43.600 1.00 30.38  ? 17   GLY A N   1 
ATOM   105  C  CA  . GLY A 1 17  ? -11.469 83.307 44.648 1.00 32.50  ? 17   GLY A CA  1 
ATOM   106  C  C   . GLY A 1 17  ? -11.572 84.664 45.317 1.00 33.89  ? 17   GLY A C   1 
ATOM   107  O  O   . GLY A 1 17  ? -12.590 85.347 45.205 1.00 33.06  ? 17   GLY A O   1 
ATOM   108  N  N   . THR A 1 18  ? -10.511 85.051 46.015 1.00 34.15  ? 18   THR A N   1 
ATOM   109  C  CA  . THR A 1 18  ? -10.467 86.329 46.710 1.00 36.32  ? 18   THR A CA  1 
ATOM   110  C  C   . THR A 1 18  ? -9.073  86.928 46.582 1.00 36.56  ? 18   THR A C   1 
ATOM   111  O  O   . THR A 1 18  ? -8.077  86.203 46.565 1.00 36.54  ? 18   THR A O   1 
ATOM   112  C  CB  . THR A 1 18  ? -10.808 86.160 48.209 1.00 37.69  ? 18   THR A CB  1 
ATOM   113  O  OG1 . THR A 1 18  ? -10.773 87.437 48.856 1.00 39.99  ? 18   THR A OG1 1 
ATOM   114  C  CG2 . THR A 1 18  ? -9.804  85.227 48.885 1.00 38.37  ? 18   THR A CG2 1 
ATOM   115  N  N   A ARG A 1 19  ? -9.009  88.252 46.493 0.50 36.66  ? 19   ARG A N   1 
ATOM   116  N  N   B ARG A 1 19  ? -9.002  88.251 46.475 0.50 36.52  ? 19   ARG A N   1 
ATOM   117  C  CA  A ARG A 1 19  ? -7.740  88.961 46.366 0.50 37.37  ? 19   ARG A CA  1 
ATOM   118  C  CA  B ARG A 1 19  ? -7.718  88.928 46.354 0.50 37.10  ? 19   ARG A CA  1 
ATOM   119  C  C   A ARG A 1 19  ? -7.144  89.166 47.755 0.50 37.31  ? 19   ARG A C   1 
ATOM   120  C  C   B ARG A 1 19  ? -7.149  89.145 47.749 0.50 37.14  ? 19   ARG A C   1 
ATOM   121  O  O   A ARG A 1 19  ? -7.748  89.821 48.604 0.50 38.30  ? 19   ARG A O   1 
ATOM   122  O  O   B ARG A 1 19  ? -7.775  89.787 48.592 0.50 38.13  ? 19   ARG A O   1 
ATOM   123  C  CB  A ARG A 1 19  ? -7.976  90.309 45.676 0.50 38.86  ? 19   ARG A CB  1 
ATOM   124  C  CB  B ARG A 1 19  ? -7.881  90.272 45.638 0.50 38.35  ? 19   ARG A CB  1 
ATOM   125  C  CG  A ARG A 1 19  ? -6.718  91.062 45.268 0.50 40.82  ? 19   ARG A CG  1 
ATOM   126  C  CG  B ARG A 1 19  ? -6.562  90.942 45.265 0.50 39.66  ? 19   ARG A CG  1 
ATOM   127  C  CD  A ARG A 1 19  ? -7.042  92.032 44.134 0.50 42.58  ? 19   ARG A CD  1 
ATOM   128  C  CD  B ARG A 1 19  ? -6.799  92.196 44.433 0.50 41.00  ? 19   ARG A CD  1 
ATOM   129  N  NE  A ARG A 1 19  ? -5.877  92.776 43.661 0.50 42.88  ? 19   ARG A NE  1 
ATOM   130  N  NE  B ARG A 1 19  ? -5.558  92.818 43.974 0.50 41.16  ? 19   ARG A NE  1 
ATOM   131  C  CZ  A ARG A 1 19  ? -5.367  93.842 44.270 0.50 44.15  ? 19   ARG A CZ  1 
ATOM   132  C  CZ  B ARG A 1 19  ? -4.701  92.261 43.123 0.50 41.43  ? 19   ARG A CZ  1 
ATOM   133  N  NH1 A ARG A 1 19  ? -5.917  94.302 45.385 0.50 42.98  ? 19   ARG A NH1 1 
ATOM   134  N  NH1 B ARG A 1 19  ? -4.938  91.055 42.626 0.50 41.87  ? 19   ARG A NH1 1 
ATOM   135  N  NH2 A ARG A 1 19  ? -4.306  94.453 43.759 0.50 44.11  ? 19   ARG A NH2 1 
ATOM   136  N  NH2 B ARG A 1 19  ? -3.604  92.914 42.763 0.50 41.30  ? 19   ARG A NH2 1 
ATOM   137  N  N   . VAL A 1 20  ? -5.962  88.600 47.988 1.00 36.27  ? 20   VAL A N   1 
ATOM   138  C  CA  . VAL A 1 20  ? -5.314  88.724 49.287 1.00 35.31  ? 20   VAL A CA  1 
ATOM   139  C  C   . VAL A 1 20  ? -4.033  89.542 49.244 1.00 34.09  ? 20   VAL A C   1 
ATOM   140  O  O   . VAL A 1 20  ? -3.252  89.459 48.297 1.00 32.95  ? 20   VAL A O   1 
ATOM   141  C  CB  . VAL A 1 20  ? -4.983  87.333 49.883 1.00 35.79  ? 20   VAL A CB  1 
ATOM   142  C  CG1 . VAL A 1 20  ? -6.239  86.483 49.945 1.00 35.99  ? 20   VAL A CG1 1 
ATOM   143  C  CG2 . VAL A 1 20  ? -3.916  86.647 49.049 1.00 37.09  ? 20   VAL A CG2 1 
ATOM   144  N  N   . PRO A 1 21  ? -3.806  90.360 50.280 1.00 34.67  ? 21   PRO A N   1 
ATOM   145  C  CA  . PRO A 1 21  ? -2.599  91.184 50.333 1.00 34.62  ? 21   PRO A CA  1 
ATOM   146  C  C   . PRO A 1 21  ? -1.399  90.340 50.745 1.00 34.76  ? 21   PRO A C   1 
ATOM   147  O  O   . PRO A 1 21  ? -1.533  89.383 51.511 1.00 34.76  ? 21   PRO A O   1 
ATOM   148  C  CB  . PRO A 1 21  ? -2.954  92.237 51.378 1.00 35.52  ? 21   PRO A CB  1 
ATOM   149  C  CG  . PRO A 1 21  ? -3.805  91.455 52.337 1.00 36.69  ? 21   PRO A CG  1 
ATOM   150  C  CD  . PRO A 1 21  ? -4.705  90.663 51.408 1.00 34.06  ? 21   PRO A CD  1 
ATOM   151  N  N   . VAL A 1 22  ? -0.231  90.693 50.224 1.00 34.62  ? 22   VAL A N   1 
ATOM   152  C  CA  . VAL A 1 22  ? 0.997   89.982 50.544 1.00 34.01  ? 22   VAL A CA  1 
ATOM   153  C  C   . VAL A 1 22  ? 2.202   90.868 50.247 1.00 34.63  ? 22   VAL A C   1 
ATOM   154  O  O   . VAL A 1 22  ? 2.426   91.274 49.106 1.00 34.33  ? 22   VAL A O   1 
ATOM   155  C  CB  . VAL A 1 22  ? 1.108   88.647 49.740 1.00 33.26  ? 22   VAL A CB  1 
ATOM   156  C  CG1 . VAL A 1 22  ? 0.915   88.908 48.253 1.00 32.44  ? 22   VAL A CG1 1 
ATOM   157  C  CG2 . VAL A 1 22  ? 2.461   87.996 49.991 1.00 30.47  ? 22   VAL A CG2 1 
ATOM   158  N  N   . LEU A 1 23  ? 2.959   91.182 51.294 1.00 36.14  ? 23   LEU A N   1 
ATOM   159  C  CA  . LEU A 1 23  ? 4.158   92.008 51.184 1.00 38.05  ? 23   LEU A CA  1 
ATOM   160  C  C   . LEU A 1 23  ? 3.996   93.258 50.305 1.00 38.86  ? 23   LEU A C   1 
ATOM   161  O  O   . LEU A 1 23  ? 4.721   93.439 49.326 1.00 39.17  ? 23   LEU A O   1 
ATOM   162  C  CB  . LEU A 1 23  ? 5.317   91.149 50.667 1.00 37.35  ? 23   LEU A CB  1 
ATOM   163  C  CG  . LEU A 1 23  ? 5.594   89.881 51.483 1.00 37.92  ? 23   LEU A CG  1 
ATOM   164  C  CD1 . LEU A 1 23  ? 6.717   89.089 50.838 1.00 36.98  ? 23   LEU A CD1 1 
ATOM   165  C  CD2 . LEU A 1 23  ? 5.954   90.257 52.915 1.00 39.15  ? 23   LEU A CD2 1 
ATOM   166  N  N   A SER A 1 24  ? 3.041   94.109 50.668 0.50 39.94  ? 24   SER A N   1 
ATOM   167  N  N   B SER A 1 24  ? 3.040   94.107 50.668 0.50 39.98  ? 24   SER A N   1 
ATOM   168  C  CA  A SER A 1 24  ? 2.756   95.353 49.947 0.50 40.92  ? 24   SER A CA  1 
ATOM   169  C  CA  B SER A 1 24  ? 2.773   95.347 49.941 0.50 41.02  ? 24   SER A CA  1 
ATOM   170  C  C   A SER A 1 24  ? 2.246   95.135 48.525 0.50 41.34  ? 24   SER A C   1 
ATOM   171  C  C   B SER A 1 24  ? 2.272   95.127 48.516 0.50 41.39  ? 24   SER A C   1 
ATOM   172  O  O   A SER A 1 24  ? 2.282   96.049 47.700 0.50 41.92  ? 24   SER A O   1 
ATOM   173  O  O   B SER A 1 24  ? 2.337   96.031 47.682 0.50 42.00  ? 24   SER A O   1 
ATOM   174  C  CB  A SER A 1 24  ? 3.998   96.253 49.900 0.50 41.28  ? 24   SER A CB  1 
ATOM   175  C  CB  B SER A 1 24  ? 4.030   96.222 49.912 0.50 41.48  ? 24   SER A CB  1 
ATOM   176  O  OG  A SER A 1 24  ? 4.916   95.826 48.907 0.50 41.74  ? 24   SER A OG  1 
ATOM   177  O  OG  B SER A 1 24  ? 4.447   96.555 51.225 0.50 42.17  ? 24   SER A OG  1 
ATOM   178  N  N   . SER A 1 25  ? 1.772   93.927 48.239 1.00 40.94  ? 25   SER A N   1 
ATOM   179  C  CA  . SER A 1 25  ? 1.246   93.608 46.916 1.00 38.91  ? 25   SER A CA  1 
ATOM   180  C  C   . SER A 1 25  ? 0.008   92.739 47.098 1.00 37.88  ? 25   SER A C   1 
ATOM   181  O  O   . SER A 1 25  ? -0.554  92.684 48.191 1.00 37.13  ? 25   SER A O   1 
ATOM   182  C  CB  . SER A 1 25  ? 2.298   92.872 46.081 1.00 40.15  ? 25   SER A CB  1 
ATOM   183  O  OG  . SER A 1 25  ? 1.864   92.718 44.740 1.00 40.78  ? 25   SER A OG  1 
ATOM   184  N  N   . HIS A 1 26  ? -0.426  92.071 46.034 1.00 37.47  ? 26   HIS A N   1 
ATOM   185  C  CA  . HIS A 1 26  ? -1.602  91.210 46.112 1.00 37.75  ? 26   HIS A CA  1 
ATOM   186  C  C   . HIS A 1 26  ? -1.493  90.001 45.191 1.00 37.25  ? 26   HIS A C   1 
ATOM   187  O  O   . HIS A 1 26  ? -0.770  90.025 44.196 1.00 38.22  ? 26   HIS A O   1 
ATOM   188  C  CB  . HIS A 1 26  ? -2.875  91.975 45.730 1.00 40.84  ? 26   HIS A CB  1 
ATOM   189  C  CG  . HIS A 1 26  ? -3.266  93.045 46.702 1.00 45.50  ? 26   HIS A CG  1 
ATOM   190  N  ND1 . HIS A 1 26  ? -2.594  94.244 46.803 1.00 46.81  ? 26   HIS A ND1 1 
ATOM   191  C  CD2 . HIS A 1 26  ? -4.276  93.102 47.603 1.00 46.17  ? 26   HIS A CD2 1 
ATOM   192  C  CE1 . HIS A 1 26  ? -3.175  94.995 47.723 1.00 48.01  ? 26   HIS A CE1 1 
ATOM   193  N  NE2 . HIS A 1 26  ? -4.198  94.326 48.223 1.00 47.59  ? 26   HIS A NE2 1 
ATOM   194  N  N   . ILE A 1 27  ? -2.221  88.944 45.535 1.00 34.41  ? 27   ILE A N   1 
ATOM   195  C  CA  . ILE A 1 27  ? -2.255  87.731 44.729 1.00 34.14  ? 27   ILE A CA  1 
ATOM   196  C  C   . ILE A 1 27  ? -3.659  87.168 44.869 1.00 31.89  ? 27   ILE A C   1 
ATOM   197  O  O   . ILE A 1 27  ? -4.431  87.634 45.706 1.00 32.52  ? 27   ILE A O   1 
ATOM   198  C  CB  . ILE A 1 27  ? -1.242  86.673 45.217 1.00 35.30  ? 27   ILE A CB  1 
ATOM   199  C  CG1 . ILE A 1 27  ? -1.641  86.162 46.599 1.00 36.79  ? 27   ILE A CG1 1 
ATOM   200  C  CG2 . ILE A 1 27  ? 0.151   87.275 45.275 1.00 36.87  ? 27   ILE A CG2 1 
ATOM   201  C  CD1 . ILE A 1 27  ? -0.785  85.016 47.083 1.00 41.70  ? 27   ILE A CD1 1 
ATOM   202  N  N   . SER A 1 28  ? -3.993  86.174 44.055 1.00 28.60  ? 28   SER A N   1 
ATOM   203  C  CA  . SER A 1 28  ? -5.313  85.568 44.118 1.00 28.61  ? 28   SER A CA  1 
ATOM   204  C  C   . SER A 1 28  ? -5.279  84.295 44.953 1.00 29.74  ? 28   SER A C   1 
ATOM   205  O  O   . SER A 1 28  ? -4.324  83.519 44.886 1.00 31.21  ? 28   SER A O   1 
ATOM   206  C  CB  . SER A 1 28  ? -5.816  85.232 42.712 1.00 28.97  ? 28   SER A CB  1 
ATOM   207  O  OG  . SER A 1 28  ? -5.812  86.376 41.874 1.00 33.01  ? 28   SER A OG  1 
ATOM   208  N  N   . ALA A 1 29  ? -6.328  84.084 45.736 1.00 29.25  ? 29   ALA A N   1 
ATOM   209  C  CA  . ALA A 1 29  ? -6.423  82.898 46.564 1.00 30.89  ? 29   ALA A CA  1 
ATOM   210  C  C   . ALA A 1 29  ? -7.770  82.227 46.348 1.00 30.99  ? 29   ALA A C   1 
ATOM   211  O  O   . ALA A 1 29  ? -8.815  82.876 46.402 1.00 31.66  ? 29   ALA A O   1 
ATOM   212  C  CB  . ALA A 1 29  ? -6.256  83.266 48.034 1.00 30.01  ? 29   ALA A CB  1 
ATOM   213  N  N   . PHE A 1 30  ? -7.735  80.927 46.082 1.00 28.24  ? 30   PHE A N   1 
ATOM   214  C  CA  . PHE A 1 30  ? -8.950  80.150 45.892 1.00 27.76  ? 30   PHE A CA  1 
ATOM   215  C  C   . PHE A 1 30  ? -8.913  79.130 47.020 1.00 28.19  ? 30   PHE A C   1 
ATOM   216  O  O   . PHE A 1 30  ? -8.231  78.106 46.934 1.00 27.26  ? 30   PHE A O   1 
ATOM   217  C  CB  . PHE A 1 30  ? -8.942  79.472 44.521 1.00 25.68  ? 30   PHE A CB  1 
ATOM   218  C  CG  . PHE A 1 30  ? -8.867  80.440 43.368 1.00 25.96  ? 30   PHE A CG  1 
ATOM   219  C  CD1 . PHE A 1 30  ? -7.650  80.990 42.981 1.00 24.41  ? 30   PHE A CD1 1 
ATOM   220  C  CD2 . PHE A 1 30  ? -10.019 80.809 42.676 1.00 26.41  ? 30   PHE A CD2 1 
ATOM   221  C  CE1 . PHE A 1 30  ? -7.576  81.894 41.918 1.00 26.47  ? 30   PHE A CE1 1 
ATOM   222  C  CE2 . PHE A 1 30  ? -9.958  81.713 41.612 1.00 25.69  ? 30   PHE A CE2 1 
ATOM   223  C  CZ  . PHE A 1 30  ? -8.733  82.255 41.232 1.00 24.67  ? 30   PHE A CZ  1 
ATOM   224  N  N   . LEU A 1 31  ? -9.644  79.430 48.088 1.00 26.98  ? 31   LEU A N   1 
ATOM   225  C  CA  . LEU A 1 31  ? -9.653  78.580 49.265 1.00 28.16  ? 31   LEU A CA  1 
ATOM   226  C  C   . LEU A 1 31  ? -10.872 77.688 49.407 1.00 27.37  ? 31   LEU A C   1 
ATOM   227  O  O   . LEU A 1 31  ? -11.990 78.089 49.095 1.00 28.04  ? 31   LEU A O   1 
ATOM   228  C  CB  . LEU A 1 31  ? -9.525  79.454 50.517 1.00 26.93  ? 31   LEU A CB  1 
ATOM   229  C  CG  . LEU A 1 31  ? -8.469  80.564 50.454 1.00 28.39  ? 31   LEU A CG  1 
ATOM   230  C  CD1 . LEU A 1 31  ? -8.537  81.406 51.724 1.00 27.80  ? 31   LEU A CD1 1 
ATOM   231  C  CD2 . LEU A 1 31  ? -7.082  79.956 50.280 1.00 27.04  ? 31   LEU A CD2 1 
ATOM   232  N  N   . GLY A 1 32  ? -10.636 76.471 49.887 1.00 26.46  ? 32   GLY A N   1 
ATOM   233  C  CA  . GLY A 1 32  ? -11.716 75.532 50.117 1.00 26.06  ? 32   GLY A CA  1 
ATOM   234  C  C   . GLY A 1 32  ? -12.416 74.936 48.911 1.00 26.27  ? 32   GLY A C   1 
ATOM   235  O  O   . GLY A 1 32  ? -13.639 74.798 48.920 1.00 25.39  ? 32   GLY A O   1 
ATOM   236  N  N   . ILE A 1 33  ? -11.656 74.582 47.878 1.00 24.62  ? 33   ILE A N   1 
ATOM   237  C  CA  . ILE A 1 33  ? -12.234 73.969 46.686 1.00 25.64  ? 33   ILE A CA  1 
ATOM   238  C  C   . ILE A 1 33  ? -12.395 72.475 46.964 1.00 25.46  ? 33   ILE A C   1 
ATOM   239  O  O   . ILE A 1 33  ? -11.430 71.798 47.315 1.00 26.77  ? 33   ILE A O   1 
ATOM   240  C  CB  . ILE A 1 33  ? -11.314 74.137 45.456 1.00 25.25  ? 33   ILE A CB  1 
ATOM   241  C  CG1 . ILE A 1 33  ? -11.103 75.623 45.155 1.00 25.16  ? 33   ILE A CG1 1 
ATOM   242  C  CG2 . ILE A 1 33  ? -11.922 73.427 44.253 1.00 24.37  ? 33   ILE A CG2 1 
ATOM   243  C  CD1 . ILE A 1 33  ? -10.173 75.880 43.984 1.00 26.47  ? 33   ILE A CD1 1 
ATOM   244  N  N   . PRO A 1 34  ? -13.616 71.941 46.811 1.00 25.72  ? 34   PRO A N   1 
ATOM   245  C  CA  . PRO A 1 34  ? -13.835 70.512 47.064 1.00 25.56  ? 34   PRO A CA  1 
ATOM   246  C  C   . PRO A 1 34  ? -13.273 69.651 45.936 1.00 26.48  ? 34   PRO A C   1 
ATOM   247  O  O   . PRO A 1 34  ? -13.433 69.985 44.761 1.00 26.74  ? 34   PRO A O   1 
ATOM   248  C  CB  . PRO A 1 34  ? -15.355 70.415 47.167 1.00 25.63  ? 34   PRO A CB  1 
ATOM   249  C  CG  . PRO A 1 34  ? -15.814 71.445 46.164 1.00 26.19  ? 34   PRO A CG  1 
ATOM   250  C  CD  . PRO A 1 34  ? -14.870 72.613 46.409 1.00 25.14  ? 34   PRO A CD  1 
ATOM   251  N  N   . PHE A 1 35  ? -12.609 68.549 46.282 1.00 25.47  ? 35   PHE A N   1 
ATOM   252  C  CA  . PHE A 1 35  ? -12.058 67.673 45.249 1.00 25.24  ? 35   PHE A CA  1 
ATOM   253  C  C   . PHE A 1 35  ? -12.594 66.251 45.373 1.00 25.46  ? 35   PHE A C   1 
ATOM   254  O  O   . PHE A 1 35  ? -12.268 65.378 44.571 1.00 26.48  ? 35   PHE A O   1 
ATOM   255  C  CB  . PHE A 1 35  ? -10.518 67.692 45.283 1.00 24.72  ? 35   PHE A CB  1 
ATOM   256  C  CG  . PHE A 1 35  ? -9.917  67.139 46.548 1.00 24.36  ? 35   PHE A CG  1 
ATOM   257  C  CD1 . PHE A 1 35  ? -9.856  65.766 46.766 1.00 24.69  ? 35   PHE A CD1 1 
ATOM   258  C  CD2 . PHE A 1 35  ? -9.399  67.995 47.519 1.00 23.44  ? 35   PHE A CD2 1 
ATOM   259  C  CE1 . PHE A 1 35  ? -9.285  65.249 47.934 1.00 23.60  ? 35   PHE A CE1 1 
ATOM   260  C  CE2 . PHE A 1 35  ? -8.827  67.488 48.689 1.00 24.61  ? 35   PHE A CE2 1 
ATOM   261  C  CZ  . PHE A 1 35  ? -8.771  66.111 48.893 1.00 23.05  ? 35   PHE A CZ  1 
ATOM   262  N  N   . ALA A 1 36  ? -13.435 66.029 46.378 1.00 25.32  ? 36   ALA A N   1 
ATOM   263  C  CA  . ALA A 1 36  ? -14.038 64.721 46.596 1.00 26.23  ? 36   ALA A CA  1 
ATOM   264  C  C   . ALA A 1 36  ? -15.389 64.885 47.269 1.00 27.44  ? 36   ALA A C   1 
ATOM   265  O  O   . ALA A 1 36  ? -15.692 65.941 47.825 1.00 26.76  ? 36   ALA A O   1 
ATOM   266  C  CB  . ALA A 1 36  ? -13.130 63.851 47.472 1.00 24.13  ? 36   ALA A CB  1 
ATOM   267  N  N   . GLU A 1 37  ? -16.210 63.843 47.201 1.00 27.04  ? 37   GLU A N   1 
ATOM   268  C  CA  . GLU A 1 37  ? -17.509 63.871 47.858 1.00 28.10  ? 37   GLU A CA  1 
ATOM   269  C  C   . GLU A 1 37  ? -17.240 63.749 49.358 1.00 28.09  ? 37   GLU A C   1 
ATOM   270  O  O   . GLU A 1 37  ? -16.306 63.055 49.769 1.00 26.32  ? 37   GLU A O   1 
ATOM   271  C  CB  . GLU A 1 37  ? -18.361 62.690 47.395 1.00 28.26  ? 37   GLU A CB  1 
ATOM   272  C  CG  . GLU A 1 37  ? -18.912 62.836 45.988 1.00 32.09  ? 37   GLU A CG  1 
ATOM   273  C  CD  . GLU A 1 37  ? -19.935 63.949 45.900 1.00 32.76  ? 37   GLU A CD  1 
ATOM   274  O  OE1 . GLU A 1 37  ? -20.923 63.900 46.658 1.00 35.69  ? 37   GLU A OE1 1 
ATOM   275  O  OE2 . GLU A 1 37  ? -19.751 64.872 45.084 1.00 36.10  ? 37   GLU A OE2 1 
ATOM   276  N  N   . PRO A 1 38  ? -18.040 64.430 50.197 1.00 28.36  ? 38   PRO A N   1 
ATOM   277  C  CA  . PRO A 1 38  ? -17.817 64.335 51.644 1.00 28.56  ? 38   PRO A CA  1 
ATOM   278  C  C   . PRO A 1 38  ? -17.840 62.873 52.089 1.00 29.64  ? 38   PRO A C   1 
ATOM   279  O  O   . PRO A 1 38  ? -18.838 62.175 51.909 1.00 29.28  ? 38   PRO A O   1 
ATOM   280  C  CB  . PRO A 1 38  ? -18.974 65.143 52.221 1.00 28.37  ? 38   PRO A CB  1 
ATOM   281  C  CG  . PRO A 1 38  ? -19.165 66.214 51.185 1.00 28.91  ? 38   PRO A CG  1 
ATOM   282  C  CD  . PRO A 1 38  ? -19.087 65.423 49.892 1.00 28.56  ? 38   PRO A CD  1 
ATOM   283  N  N   . PRO A 1 39  ? -16.732 62.389 52.671 1.00 29.60  ? 39   PRO A N   1 
ATOM   284  C  CA  . PRO A 1 39  ? -16.637 61.000 53.134 1.00 29.49  ? 39   PRO A CA  1 
ATOM   285  C  C   . PRO A 1 39  ? -17.379 60.787 54.453 1.00 30.70  ? 39   PRO A C   1 
ATOM   286  O  O   . PRO A 1 39  ? -16.796 60.349 55.447 1.00 29.37  ? 39   PRO A O   1 
ATOM   287  C  CB  . PRO A 1 39  ? -15.133 60.801 53.267 1.00 30.09  ? 39   PRO A CB  1 
ATOM   288  C  CG  . PRO A 1 39  ? -14.684 62.144 53.768 1.00 29.53  ? 39   PRO A CG  1 
ATOM   289  C  CD  . PRO A 1 39  ? -15.462 63.108 52.890 1.00 29.47  ? 39   PRO A CD  1 
ATOM   290  N  N   . VAL A 1 40  ? -18.673 61.091 54.447 1.00 31.20  ? 40   VAL A N   1 
ATOM   291  C  CA  . VAL A 1 40  ? -19.497 60.975 55.642 1.00 32.23  ? 40   VAL A CA  1 
ATOM   292  C  C   . VAL A 1 40  ? -20.469 59.800 55.604 1.00 33.43  ? 40   VAL A C   1 
ATOM   293  O  O   . VAL A 1 40  ? -20.708 59.206 54.550 1.00 33.27  ? 40   VAL A O   1 
ATOM   294  C  CB  . VAL A 1 40  ? -20.303 62.269 55.861 1.00 34.13  ? 40   VAL A CB  1 
ATOM   295  C  CG1 . VAL A 1 40  ? -19.354 63.464 55.931 1.00 33.12  ? 40   VAL A CG1 1 
ATOM   296  C  CG2 . VAL A 1 40  ? -21.307 62.453 54.721 1.00 32.86  ? 40   VAL A CG2 1 
ATOM   297  N  N   . GLY A 1 41  ? -21.023 59.475 56.769 1.00 32.64  ? 41   GLY A N   1 
ATOM   298  C  CA  . GLY A 1 41  ? -21.976 58.385 56.873 1.00 33.05  ? 41   GLY A CA  1 
ATOM   299  C  C   . GLY A 1 41  ? -21.414 57.036 56.477 1.00 33.99  ? 41   GLY A C   1 
ATOM   300  O  O   . GLY A 1 41  ? -20.410 56.583 57.033 1.00 32.40  ? 41   GLY A O   1 
ATOM   301  N  N   A ASN A 1 42  ? -22.051 56.395 55.502 0.50 32.69  ? 42   ASN A N   1 
ATOM   302  N  N   B ASN A 1 42  ? -22.071 56.382 55.523 0.50 33.27  ? 42   ASN A N   1 
ATOM   303  C  CA  A ASN A 1 42  ? -21.593 55.097 55.029 0.50 32.59  ? 42   ASN A CA  1 
ATOM   304  C  CA  B ASN A 1 42  ? -21.645 55.067 55.062 0.50 33.64  ? 42   ASN A CA  1 
ATOM   305  C  C   A ASN A 1 42  ? -20.319 55.243 54.202 0.50 31.20  ? 42   ASN A C   1 
ATOM   306  C  C   B ASN A 1 42  ? -20.323 55.105 54.303 0.50 32.44  ? 42   ASN A C   1 
ATOM   307  O  O   A ASN A 1 42  ? -19.759 54.252 53.739 0.50 31.10  ? 42   ASN A O   1 
ATOM   308  O  O   B ASN A 1 42  ? -19.734 54.061 54.026 0.50 32.39  ? 42   ASN A O   1 
ATOM   309  C  CB  A ASN A 1 42  ? -22.677 54.420 54.188 0.50 34.28  ? 42   ASN A CB  1 
ATOM   310  C  CB  B ASN A 1 42  ? -22.725 54.444 54.172 0.50 35.89  ? 42   ASN A CB  1 
ATOM   311  C  CG  A ASN A 1 42  ? -23.929 54.123 54.985 0.50 36.35  ? 42   ASN A CG  1 
ATOM   312  C  CG  B ASN A 1 42  ? -22.955 55.231 52.897 0.50 37.98  ? 42   ASN A CG  1 
ATOM   313  O  OD1 A ASN A 1 42  ? -23.867 53.522 56.057 0.50 36.82  ? 42   ASN A OD1 1 
ATOM   314  O  OD1 B ASN A 1 42  ? -22.041 55.417 52.094 0.50 40.64  ? 42   ASN A OD1 1 
ATOM   315  N  ND2 A ASN A 1 42  ? -25.078 54.536 54.461 0.50 38.40  ? 42   ASN A ND2 1 
ATOM   316  N  ND2 B ASN A 1 42  ? -24.183 55.696 52.703 0.50 40.72  ? 42   ASN A ND2 1 
ATOM   317  N  N   A MET A 1 43  ? -19.865 56.479 54.020 0.50 29.84  ? 43   MET A N   1 
ATOM   318  N  N   B MET A 1 43  ? -19.858 56.303 53.967 0.50 31.19  ? 43   MET A N   1 
ATOM   319  C  CA  A MET A 1 43  ? -18.650 56.739 53.253 0.50 29.90  ? 43   MET A CA  1 
ATOM   320  C  CA  B MET A 1 43  ? -18.600 56.440 53.240 0.50 30.92  ? 43   MET A CA  1 
ATOM   321  C  C   A MET A 1 43  ? -17.427 56.854 54.164 0.50 28.56  ? 43   MET A C   1 
ATOM   322  C  C   B MET A 1 43  ? -17.389 56.564 54.160 0.50 29.53  ? 43   MET A C   1 
ATOM   323  O  O   A MET A 1 43  ? -16.317 57.107 53.694 0.50 27.91  ? 43   MET A O   1 
ATOM   324  O  O   B MET A 1 43  ? -16.248 56.572 53.694 0.50 28.83  ? 43   MET A O   1 
ATOM   325  C  CB  A MET A 1 43  ? -18.797 58.028 52.437 0.50 29.76  ? 43   MET A CB  1 
ATOM   326  C  CB  B MET A 1 43  ? -18.665 57.634 52.285 0.50 31.88  ? 43   MET A CB  1 
ATOM   327  C  CG  A MET A 1 43  ? -19.898 57.985 51.390 0.50 32.48  ? 43   MET A CG  1 
ATOM   328  C  CG  B MET A 1 43  ? -19.585 57.395 51.097 0.50 36.28  ? 43   MET A CG  1 
ATOM   329  S  SD  A MET A 1 43  ? -19.679 56.624 50.230 0.50 35.61  ? 43   MET A SD  1 
ATOM   330  S  SD  B MET A 1 43  ? -19.587 58.737 49.900 0.50 39.02  ? 43   MET A SD  1 
ATOM   331  C  CE  A MET A 1 43  ? -20.867 55.454 50.871 0.50 34.21  ? 43   MET A CE  1 
ATOM   332  C  CE  B MET A 1 43  ? -21.170 59.427 50.191 0.50 40.02  ? 43   MET A CE  1 
ATOM   333  N  N   . ARG A 1 44  ? -17.633 56.668 55.464 1.00 28.32  ? 44   ARG A N   1 
ATOM   334  C  CA  . ARG A 1 44  ? -16.535 56.754 56.423 1.00 26.38  ? 44   ARG A CA  1 
ATOM   335  C  C   . ARG A 1 44  ? -15.695 55.489 56.241 1.00 26.52  ? 44   ARG A C   1 
ATOM   336  O  O   . ARG A 1 44  ? -16.240 54.386 56.156 1.00 26.04  ? 44   ARG A O   1 
ATOM   337  C  CB  . ARG A 1 44  ? -17.062 56.831 57.865 1.00 26.68  ? 44   ARG A CB  1 
ATOM   338  C  CG  . ARG A 1 44  ? -15.950 56.906 58.926 1.00 23.67  ? 44   ARG A CG  1 
ATOM   339  C  CD  . ARG A 1 44  ? -16.486 56.849 60.357 1.00 24.43  ? 44   ARG A CD  1 
ATOM   340  N  NE  . ARG A 1 44  ? -17.124 58.093 60.782 1.00 23.53  ? 44   ARG A NE  1 
ATOM   341  C  CZ  . ARG A 1 44  ? -17.759 58.245 61.941 1.00 24.85  ? 44   ARG A CZ  1 
ATOM   342  N  NH1 . ARG A 1 44  ? -17.843 57.229 62.789 1.00 26.49  ? 44   ARG A NH1 1 
ATOM   343  N  NH2 . ARG A 1 44  ? -18.306 59.413 62.258 1.00 24.55  ? 44   ARG A NH2 1 
ATOM   344  N  N   . PHE A 1 45  ? -14.376 55.666 56.163 1.00 24.66  ? 45   PHE A N   1 
ATOM   345  C  CA  . PHE A 1 45  ? -13.409 54.579 55.979 1.00 23.98  ? 45   PHE A CA  1 
ATOM   346  C  C   . PHE A 1 45  ? -13.273 54.127 54.523 1.00 25.48  ? 45   PHE A C   1 
ATOM   347  O  O   . PHE A 1 45  ? -12.307 53.455 54.162 1.00 24.38  ? 45   PHE A O   1 
ATOM   348  C  CB  . PHE A 1 45  ? -13.763 53.353 56.836 1.00 25.11  ? 45   PHE A CB  1 
ATOM   349  C  CG  . PHE A 1 45  ? -13.930 53.649 58.303 1.00 26.16  ? 45   PHE A CG  1 
ATOM   350  C  CD1 . PHE A 1 45  ? -12.979 54.398 58.996 1.00 25.89  ? 45   PHE A CD1 1 
ATOM   351  C  CD2 . PHE A 1 45  ? -15.035 53.164 58.996 1.00 26.07  ? 45   PHE A CD2 1 
ATOM   352  C  CE1 . PHE A 1 45  ? -13.131 54.661 60.364 1.00 24.94  ? 45   PHE A CE1 1 
ATOM   353  C  CE2 . PHE A 1 45  ? -15.198 53.420 60.364 1.00 25.96  ? 45   PHE A CE2 1 
ATOM   354  C  CZ  . PHE A 1 45  ? -14.245 54.171 61.048 1.00 26.49  ? 45   PHE A CZ  1 
ATOM   355  N  N   A ARG A 1 46  ? -14.239 54.491 53.688 0.50 26.24  ? 46   ARG A N   1 
ATOM   356  N  N   B ARG A 1 46  ? -14.238 54.507 53.691 0.50 25.53  ? 46   ARG A N   1 
ATOM   357  C  CA  A ARG A 1 46  ? -14.204 54.090 52.287 0.50 28.65  ? 46   ARG A CA  1 
ATOM   358  C  CA  B ARG A 1 46  ? -14.221 54.133 52.280 0.50 27.47  ? 46   ARG A CA  1 
ATOM   359  C  C   A ARG A 1 46  ? -13.373 55.005 51.401 0.50 28.43  ? 46   ARG A C   1 
ATOM   360  C  C   B ARG A 1 46  ? -13.264 54.981 51.458 0.50 27.20  ? 46   ARG A C   1 
ATOM   361  O  O   A ARG A 1 46  ? -13.168 56.181 51.711 0.50 27.54  ? 46   ARG A O   1 
ATOM   362  O  O   B ARG A 1 46  ? -12.871 56.074 51.869 0.50 26.06  ? 46   ARG A O   1 
ATOM   363  C  CB  A ARG A 1 46  ? -15.633 53.981 51.740 0.50 31.68  ? 46   ARG A CB  1 
ATOM   364  C  CB  B ARG A 1 46  ? -15.618 54.268 51.667 0.50 29.52  ? 46   ARG A CB  1 
ATOM   365  C  CG  A ARG A 1 46  ? -16.365 52.755 52.268 0.50 35.13  ? 46   ARG A CG  1 
ATOM   366  C  CG  B ARG A 1 46  ? -16.635 53.259 52.157 0.50 33.10  ? 46   ARG A CG  1 
ATOM   367  C  CD  A ARG A 1 46  ? -17.876 52.851 52.133 0.50 38.42  ? 46   ARG A CD  1 
ATOM   368  C  CD  B ARG A 1 46  ? -17.922 53.386 51.360 0.50 35.81  ? 46   ARG A CD  1 
ATOM   369  N  NE  A ARG A 1 46  ? -18.349 52.779 50.756 0.50 40.77  ? 46   ARG A NE  1 
ATOM   370  N  NE  B ARG A 1 46  ? -17.684 53.233 49.927 0.50 38.74  ? 46   ARG A NE  1 
ATOM   371  C  CZ  A ARG A 1 46  ? -19.625 52.608 50.423 0.50 41.62  ? 46   ARG A CZ  1 
ATOM   372  C  CZ  B ARG A 1 46  ? -17.240 52.117 49.356 0.50 40.45  ? 46   ARG A CZ  1 
ATOM   373  N  NH1 A ARG A 1 46  ? -20.549 52.489 51.370 0.50 40.56  ? 46   ARG A NH1 1 
ATOM   374  N  NH1 B ARG A 1 46  ? -16.986 51.047 50.096 0.50 42.35  ? 46   ARG A NH1 1 
ATOM   375  N  NH2 A ARG A 1 46  ? -19.981 52.559 49.146 0.50 41.82  ? 46   ARG A NH2 1 
ATOM   376  N  NH2 B ARG A 1 46  ? -17.045 52.072 48.045 0.50 40.37  ? 46   ARG A NH2 1 
ATOM   377  N  N   A ARG A 1 47  ? -12.882 54.440 50.302 0.50 27.75  ? 47   ARG A N   1 
ATOM   378  N  N   B ARG A 1 47  ? -12.893 54.466 50.290 0.50 26.78  ? 47   ARG A N   1 
ATOM   379  C  CA  A ARG A 1 47  ? -12.079 55.177 49.336 0.50 28.85  ? 47   ARG A CA  1 
ATOM   380  C  CA  B ARG A 1 47  ? -12.017 55.197 49.391 0.50 28.05  ? 47   ARG A CA  1 
ATOM   381  C  C   A ARG A 1 47  ? -12.832 56.443 48.939 0.50 27.68  ? 47   ARG A C   1 
ATOM   382  C  C   B ARG A 1 47  ? -12.803 56.442 48.990 0.50 27.25  ? 47   ARG A C   1 
ATOM   383  O  O   A ARG A 1 47  ? -14.063 56.457 48.911 0.50 26.22  ? 47   ARG A O   1 
ATOM   384  O  O   B ARG A 1 47  ? -14.034 56.437 49.002 0.50 25.70  ? 47   ARG A O   1 
ATOM   385  C  CB  A ARG A 1 47  ? -11.842 54.314 48.093 0.50 31.05  ? 47   ARG A CB  1 
ATOM   386  C  CB  B ARG A 1 47  ? -11.692 54.354 48.154 0.50 30.38  ? 47   ARG A CB  1 
ATOM   387  C  CG  A ARG A 1 47  ? -11.236 52.946 48.386 0.50 36.14  ? 47   ARG A CG  1 
ATOM   388  C  CG  B ARG A 1 47  ? -11.058 53.006 48.477 0.50 34.57  ? 47   ARG A CG  1 
ATOM   389  C  CD  A ARG A 1 47  ? -11.274 52.050 47.153 0.50 38.85  ? 47   ARG A CD  1 
ATOM   390  C  CD  B ARG A 1 47  ? -10.572 52.303 47.218 0.50 36.92  ? 47   ARG A CD  1 
ATOM   391  N  NE  A ARG A 1 47  ? -10.730 50.716 47.408 0.50 41.97  ? 47   ARG A NE  1 
ATOM   392  N  NE  B ARG A 1 47  ? -10.082 50.953 47.490 0.50 40.02  ? 47   ARG A NE  1 
ATOM   393  C  CZ  A ARG A 1 47  ? -9.460  50.471 47.716 0.50 41.64  ? 47   ARG A CZ  1 
ATOM   394  C  CZ  B ARG A 1 47  ? -10.854 49.931 47.852 0.50 40.00  ? 47   ARG A CZ  1 
ATOM   395  N  NH1 A ARG A 1 47  ? -8.595  51.469 47.810 0.50 42.32  ? 47   ARG A NH1 1 
ATOM   396  N  NH1 B ARG A 1 47  ? -12.162 50.098 47.990 0.50 38.80  ? 47   ARG A NH1 1 
ATOM   397  N  NH2 A ARG A 1 47  ? -9.051  49.226 47.922 0.50 42.19  ? 47   ARG A NH2 1 
ATOM   398  N  NH2 B ARG A 1 47  ? -10.316 48.740 48.075 0.50 41.36  ? 47   ARG A NH2 1 
ATOM   399  N  N   . PRO A 1 48  ? -12.106 57.526 48.633 1.00 26.27  ? 48   PRO A N   1 
ATOM   400  C  CA  . PRO A 1 48  ? -12.812 58.745 48.247 1.00 26.70  ? 48   PRO A CA  1 
ATOM   401  C  C   . PRO A 1 48  ? -13.422 58.639 46.852 1.00 28.52  ? 48   PRO A C   1 
ATOM   402  O  O   . PRO A 1 48  ? -12.959 57.860 46.019 1.00 27.49  ? 48   PRO A O   1 
ATOM   403  C  CB  . PRO A 1 48  ? -11.718 59.802 48.308 1.00 26.08  ? 48   PRO A CB  1 
ATOM   404  C  CG  . PRO A 1 48  ? -10.508 59.028 47.819 1.00 24.94  ? 48   PRO A CG  1 
ATOM   405  C  CD  . PRO A 1 48  ? -10.643 57.713 48.576 1.00 26.56  ? 48   PRO A CD  1 
ATOM   406  N  N   A GLU A 1 49  ? -14.473 59.415 46.613 0.50 28.52  ? 49   GLU A N   1 
ATOM   407  N  N   B GLU A 1 49  ? -14.471 59.417 46.611 0.50 29.35  ? 49   GLU A N   1 
ATOM   408  C  CA  A GLU A 1 49  ? -15.134 59.442 45.313 0.50 30.02  ? 49   GLU A CA  1 
ATOM   409  C  CA  B GLU A 1 49  ? -15.125 59.441 45.309 0.50 31.48  ? 49   GLU A CA  1 
ATOM   410  C  C   A GLU A 1 49  ? -15.032 60.865 44.776 0.50 30.21  ? 49   GLU A C   1 
ATOM   411  C  C   B GLU A 1 49  ? -15.026 60.865 44.776 0.50 31.03  ? 49   GLU A C   1 
ATOM   412  O  O   A GLU A 1 49  ? -15.160 61.829 45.532 0.50 30.00  ? 49   GLU A O   1 
ATOM   413  O  O   B GLU A 1 49  ? -15.153 61.828 45.533 0.50 30.78  ? 49   GLU A O   1 
ATOM   414  C  CB  A GLU A 1 49  ? -16.608 59.044 45.439 0.50 30.12  ? 49   GLU A CB  1 
ATOM   415  C  CB  B GLU A 1 49  ? -16.593 59.024 45.423 0.50 33.36  ? 49   GLU A CB  1 
ATOM   416  C  CG  A GLU A 1 49  ? -16.848 57.579 45.785 0.50 31.57  ? 49   GLU A CG  1 
ATOM   417  C  CG  B GLU A 1 49  ? -16.792 57.591 45.885 0.50 37.58  ? 49   GLU A CG  1 
ATOM   418  C  CD  A GLU A 1 49  ? -16.249 56.628 44.764 0.50 31.62  ? 49   GLU A CD  1 
ATOM   419  C  CD  B GLU A 1 49  ? -18.215 57.108 45.691 0.50 39.76  ? 49   GLU A CD  1 
ATOM   420  O  OE1 A GLU A 1 49  ? -16.414 56.872 43.550 0.50 32.01  ? 49   GLU A OE1 1 
ATOM   421  O  OE1 B GLU A 1 49  ? -19.141 57.742 46.238 0.50 40.72  ? 49   GLU A OE1 1 
ATOM   422  O  OE2 A GLU A 1 49  ? -15.621 55.629 45.175 0.50 33.31  ? 49   GLU A OE2 1 
ATOM   423  O  OE2 B GLU A 1 49  ? -18.405 56.092 44.990 0.50 43.32  ? 49   GLU A OE2 1 
ATOM   424  N  N   . PRO A 1 50  ? -14.794 61.016 43.465 1.00 30.99  ? 50   PRO A N   1 
ATOM   425  C  CA  . PRO A 1 50  ? -14.676 62.341 42.848 1.00 30.87  ? 50   PRO A CA  1 
ATOM   426  C  C   . PRO A 1 50  ? -15.840 63.248 43.218 1.00 30.73  ? 50   PRO A C   1 
ATOM   427  O  O   . PRO A 1 50  ? -16.972 62.789 43.357 1.00 30.63  ? 50   PRO A O   1 
ATOM   428  C  CB  . PRO A 1 50  ? -14.652 62.028 41.354 1.00 31.02  ? 50   PRO A CB  1 
ATOM   429  C  CG  . PRO A 1 50  ? -14.025 60.666 41.305 1.00 33.11  ? 50   PRO A CG  1 
ATOM   430  C  CD  . PRO A 1 50  ? -14.708 59.954 42.446 1.00 31.50  ? 50   PRO A CD  1 
ATOM   431  N  N   . LYS A 1 51  ? -15.554 64.534 43.386 1.00 30.39  ? 51   LYS A N   1 
ATOM   432  C  CA  . LYS A 1 51  ? -16.586 65.504 43.721 1.00 32.44  ? 51   LYS A CA  1 
ATOM   433  C  C   . LYS A 1 51  ? -17.472 65.687 42.494 1.00 32.70  ? 51   LYS A C   1 
ATOM   434  O  O   . LYS A 1 51  ? -16.978 65.943 41.398 1.00 32.87  ? 51   LYS A O   1 
ATOM   435  C  CB  . LYS A 1 51  ? -15.949 66.846 44.095 1.00 31.50  ? 51   LYS A CB  1 
ATOM   436  C  CG  . LYS A 1 51  ? -16.938 67.988 44.296 1.00 30.30  ? 51   LYS A CG  1 
ATOM   437  C  CD  . LYS A 1 51  ? -17.851 67.744 45.491 1.00 31.73  ? 51   LYS A CD  1 
ATOM   438  C  CE  . LYS A 1 51  ? -18.728 68.961 45.773 1.00 31.81  ? 51   LYS A CE  1 
ATOM   439  N  NZ  . LYS A 1 51  ? -19.617 68.751 46.953 1.00 35.09  ? 51   LYS A NZ  1 
ATOM   440  N  N   A LYS A 1 52  ? -18.779 65.549 42.678 0.50 33.44  ? 52   LYS A N   1 
ATOM   441  N  N   B LYS A 1 52  ? -18.780 65.548 42.678 0.50 33.41  ? 52   LYS A N   1 
ATOM   442  C  CA  A LYS A 1 52  ? -19.715 65.710 41.572 0.50 34.41  ? 52   LYS A CA  1 
ATOM   443  C  CA  B LYS A 1 52  ? -19.711 65.713 41.569 0.50 34.37  ? 52   LYS A CA  1 
ATOM   444  C  C   A LYS A 1 52  ? -19.729 67.167 41.120 0.50 34.17  ? 52   LYS A C   1 
ATOM   445  C  C   B LYS A 1 52  ? -19.721 67.168 41.119 0.50 34.14  ? 52   LYS A C   1 
ATOM   446  O  O   A LYS A 1 52  ? -19.888 68.075 41.935 0.50 33.78  ? 52   LYS A O   1 
ATOM   447  O  O   B LYS A 1 52  ? -19.871 68.077 41.936 0.50 33.73  ? 52   LYS A O   1 
ATOM   448  C  CB  A LYS A 1 52  ? -21.115 65.273 42.009 0.50 35.42  ? 52   LYS A CB  1 
ATOM   449  C  CB  B LYS A 1 52  ? -21.126 65.296 41.982 0.50 35.33  ? 52   LYS A CB  1 
ATOM   450  C  CG  A LYS A 1 52  ? -21.171 63.817 42.449 0.50 38.47  ? 52   LYS A CG  1 
ATOM   451  C  CG  B LYS A 1 52  ? -21.254 63.828 42.364 0.50 38.34  ? 52   LYS A CG  1 
ATOM   452  C  CD  A LYS A 1 52  ? -22.544 63.419 42.957 0.50 40.48  ? 52   LYS A CD  1 
ATOM   453  C  CD  B LYS A 1 52  ? -22.712 63.399 42.462 0.50 40.44  ? 52   LYS A CD  1 
ATOM   454  C  CE  A LYS A 1 52  ? -22.562 61.957 43.384 0.50 41.52  ? 52   LYS A CE  1 
ATOM   455  C  CE  B LYS A 1 52  ? -23.460 64.151 43.556 0.50 41.52  ? 52   LYS A CE  1 
ATOM   456  N  NZ  A LYS A 1 52  ? -23.885 61.545 43.929 0.50 42.78  ? 52   LYS A NZ  1 
ATOM   457  N  NZ  B LYS A 1 52  ? -22.914 63.860 44.910 0.50 42.60  ? 52   LYS A NZ  1 
ATOM   458  N  N   . PRO A 1 53  ? -19.548 67.408 39.810 1.00 35.07  ? 53   PRO A N   1 
ATOM   459  C  CA  . PRO A 1 53  ? -19.543 68.773 39.277 1.00 35.69  ? 53   PRO A CA  1 
ATOM   460  C  C   . PRO A 1 53  ? -20.745 69.546 39.805 1.00 36.20  ? 53   PRO A C   1 
ATOM   461  O  O   . PRO A 1 53  ? -21.807 68.972 40.047 1.00 35.15  ? 53   PRO A O   1 
ATOM   462  C  CB  . PRO A 1 53  ? -19.598 68.551 37.771 1.00 36.33  ? 53   PRO A CB  1 
ATOM   463  C  CG  . PRO A 1 53  ? -18.818 67.280 37.605 1.00 37.24  ? 53   PRO A CG  1 
ATOM   464  C  CD  . PRO A 1 53  ? -19.367 66.424 38.728 1.00 35.12  ? 53   PRO A CD  1 
ATOM   465  N  N   . TRP A 1 54  ? -20.570 70.847 39.992 1.00 37.14  ? 54   TRP A N   1 
ATOM   466  C  CA  . TRP A 1 54  ? -21.640 71.679 40.518 1.00 38.50  ? 54   TRP A CA  1 
ATOM   467  C  C   . TRP A 1 54  ? -22.014 72.804 39.572 1.00 39.61  ? 54   TRP A C   1 
ATOM   468  O  O   . TRP A 1 54  ? -21.208 73.238 38.748 1.00 39.19  ? 54   TRP A O   1 
ATOM   469  C  CB  . TRP A 1 54  ? -21.209 72.281 41.857 1.00 37.49  ? 54   TRP A CB  1 
ATOM   470  C  CG  . TRP A 1 54  ? -19.987 73.145 41.734 1.00 35.76  ? 54   TRP A CG  1 
ATOM   471  C  CD1 . TRP A 1 54  ? -19.936 74.442 41.301 1.00 34.68  ? 54   TRP A CD1 1 
ATOM   472  C  CD2 . TRP A 1 54  ? -18.629 72.748 41.971 1.00 34.77  ? 54   TRP A CD2 1 
ATOM   473  N  NE1 . TRP A 1 54  ? -18.631 74.875 41.250 1.00 35.26  ? 54   TRP A NE1 1 
ATOM   474  C  CE2 . TRP A 1 54  ? -17.809 73.856 41.656 1.00 34.89  ? 54   TRP A CE2 1 
ATOM   475  C  CE3 . TRP A 1 54  ? -18.026 71.563 42.415 1.00 35.14  ? 54   TRP A CE3 1 
ATOM   476  C  CZ2 . TRP A 1 54  ? -16.415 73.813 41.772 1.00 35.08  ? 54   TRP A CZ2 1 
ATOM   477  C  CZ3 . TRP A 1 54  ? -16.637 71.521 42.529 1.00 33.74  ? 54   TRP A CZ3 1 
ATOM   478  C  CH2 . TRP A 1 54  ? -15.849 72.640 42.209 1.00 34.46  ? 54   TRP A CH2 1 
ATOM   479  N  N   A SER A 1 55  ? -23.252 73.271 39.688 0.50 40.23  ? 55   SER A N   1 
ATOM   480  N  N   B SER A 1 55  ? -23.251 73.272 39.691 0.50 40.50  ? 55   SER A N   1 
ATOM   481  C  CA  A SER A 1 55  ? -23.725 74.369 38.860 0.50 41.07  ? 55   SER A CA  1 
ATOM   482  C  CA  B SER A 1 55  ? -23.730 74.368 38.866 0.50 41.60  ? 55   SER A CA  1 
ATOM   483  C  C   A SER A 1 55  ? -23.495 75.643 39.663 0.50 41.11  ? 55   SER A C   1 
ATOM   484  C  C   B SER A 1 55  ? -23.499 75.644 39.666 0.50 41.41  ? 55   SER A C   1 
ATOM   485  O  O   A SER A 1 55  ? -23.342 75.590 40.883 0.50 42.04  ? 55   SER A O   1 
ATOM   486  O  O   B SER A 1 55  ? -23.351 75.594 40.887 0.50 42.31  ? 55   SER A O   1 
ATOM   487  C  CB  A SER A 1 55  ? -25.215 74.204 38.550 0.50 41.25  ? 55   SER A CB  1 
ATOM   488  C  CB  B SER A 1 55  ? -25.221 74.197 38.566 0.50 42.17  ? 55   SER A CB  1 
ATOM   489  O  OG  A SER A 1 55  ? -25.990 74.219 39.737 0.50 41.42  ? 55   SER A OG  1 
ATOM   490  O  OG  B SER A 1 55  ? -25.700 75.251 37.751 0.50 44.02  ? 55   SER A OG  1 
ATOM   491  N  N   . GLY A 1 56  ? -23.458 76.783 38.983 1.00 41.57  ? 56   GLY A N   1 
ATOM   492  C  CA  . GLY A 1 56  ? -23.243 78.039 39.678 1.00 40.55  ? 56   GLY A CA  1 
ATOM   493  C  C   . GLY A 1 56  ? -21.787 78.283 40.026 1.00 39.52  ? 56   GLY A C   1 
ATOM   494  O  O   . GLY A 1 56  ? -20.895 77.613 39.508 1.00 38.39  ? 56   GLY A O   1 
ATOM   495  N  N   . VAL A 1 57  ? -21.546 79.244 40.913 1.00 37.89  ? 57   VAL A N   1 
ATOM   496  C  CA  . VAL A 1 57  ? -20.191 79.598 41.316 1.00 36.17  ? 57   VAL A CA  1 
ATOM   497  C  C   . VAL A 1 57  ? -19.887 79.180 42.749 1.00 36.15  ? 57   VAL A C   1 
ATOM   498  O  O   . VAL A 1 57  ? -20.624 79.518 43.677 1.00 35.59  ? 57   VAL A O   1 
ATOM   499  C  CB  . VAL A 1 57  ? -19.962 81.120 41.196 1.00 36.33  ? 57   VAL A CB  1 
ATOM   500  C  CG1 . VAL A 1 57  ? -18.528 81.467 41.571 1.00 35.60  ? 57   VAL A CG1 1 
ATOM   501  C  CG2 . VAL A 1 57  ? -20.274 81.581 39.782 1.00 35.87  ? 57   VAL A CG2 1 
ATOM   502  N  N   . TRP A 1 58  ? -18.796 78.440 42.922 1.00 34.32  ? 58   TRP A N   1 
ATOM   503  C  CA  . TRP A 1 58  ? -18.395 77.994 44.247 1.00 33.15  ? 58   TRP A CA  1 
ATOM   504  C  C   . TRP A 1 58  ? -17.591 79.111 44.899 1.00 32.64  ? 58   TRP A C   1 
ATOM   505  O  O   . TRP A 1 58  ? -16.618 79.598 44.326 1.00 31.46  ? 58   TRP A O   1 
ATOM   506  C  CB  . TRP A 1 58  ? -17.547 76.719 44.153 1.00 32.79  ? 58   TRP A CB  1 
ATOM   507  C  CG  . TRP A 1 58  ? -17.197 76.141 45.498 1.00 31.72  ? 58   TRP A CG  1 
ATOM   508  C  CD1 . TRP A 1 58  ? -16.236 76.588 46.363 1.00 30.95  ? 58   TRP A CD1 1 
ATOM   509  C  CD2 . TRP A 1 58  ? -17.853 75.050 46.156 1.00 30.16  ? 58   TRP A CD2 1 
ATOM   510  N  NE1 . TRP A 1 58  ? -16.257 75.844 47.522 1.00 29.46  ? 58   TRP A NE1 1 
ATOM   511  C  CE2 . TRP A 1 58  ? -17.240 74.894 47.421 1.00 29.80  ? 58   TRP A CE2 1 
ATOM   512  C  CE3 . TRP A 1 58  ? -18.902 74.190 45.801 1.00 32.03  ? 58   TRP A CE3 1 
ATOM   513  C  CZ2 . TRP A 1 58  ? -17.642 73.912 48.332 1.00 28.95  ? 58   TRP A CZ2 1 
ATOM   514  C  CZ3 . TRP A 1 58  ? -19.303 73.211 46.710 1.00 31.84  ? 58   TRP A CZ3 1 
ATOM   515  C  CH2 . TRP A 1 58  ? -18.672 73.083 47.960 1.00 30.71  ? 58   TRP A CH2 1 
ATOM   516  N  N   . ASN A 1 59  ? -18.011 79.526 46.089 1.00 33.75  ? 59   ASN A N   1 
ATOM   517  C  CA  . ASN A 1 59  ? -17.314 80.586 46.804 1.00 36.45  ? 59   ASN A CA  1 
ATOM   518  C  C   . ASN A 1 59  ? -16.042 80.039 47.437 1.00 34.61  ? 59   ASN A C   1 
ATOM   519  O  O   . ASN A 1 59  ? -16.093 79.293 48.414 1.00 35.30  ? 59   ASN A O   1 
ATOM   520  C  CB  . ASN A 1 59  ? -18.223 81.191 47.880 1.00 41.53  ? 59   ASN A CB  1 
ATOM   521  C  CG  . ASN A 1 59  ? -17.514 82.238 48.722 1.00 47.77  ? 59   ASN A CG  1 
ATOM   522  O  OD1 . ASN A 1 59  ? -16.503 82.801 48.306 1.00 47.57  ? 59   ASN A OD1 1 
ATOM   523  N  ND2 . ASN A 1 59  ? -18.054 82.512 49.906 1.00 56.95  ? 59   ASN A ND2 1 
ATOM   524  N  N   . ALA A 1 60  ? -14.902 80.412 46.864 1.00 32.03  ? 60   ALA A N   1 
ATOM   525  C  CA  . ALA A 1 60  ? -13.601 79.965 47.355 1.00 31.31  ? 60   ALA A CA  1 
ATOM   526  C  C   . ALA A 1 60  ? -12.869 81.125 48.015 1.00 30.57  ? 60   ALA A C   1 
ATOM   527  O  O   . ALA A 1 60  ? -11.687 81.348 47.755 1.00 30.36  ? 60   ALA A O   1 
ATOM   528  C  CB  . ALA A 1 60  ? -12.770 79.427 46.201 1.00 28.86  ? 60   ALA A CB  1 
ATOM   529  N  N   . SER A 1 61  ? -13.568 81.860 48.871 1.00 30.92  ? 61   SER A N   1 
ATOM   530  C  CA  . SER A 1 61  ? -12.967 83.009 49.534 1.00 31.61  ? 61   SER A CA  1 
ATOM   531  C  C   . SER A 1 61  ? -12.502 82.716 50.953 1.00 31.80  ? 61   SER A C   1 
ATOM   532  O  O   . SER A 1 61  ? -11.791 83.526 51.547 1.00 31.46  ? 61   SER A O   1 
ATOM   533  C  CB  . SER A 1 61  ? -13.960 84.174 49.563 1.00 32.18  ? 61   SER A CB  1 
ATOM   534  O  OG  . SER A 1 61  ? -15.077 83.857 50.374 1.00 33.53  ? 61   SER A OG  1 
ATOM   535  N  N   . THR A 1 62  ? -12.894 81.568 51.498 1.00 31.47  ? 62   THR A N   1 
ATOM   536  C  CA  . THR A 1 62  ? -12.508 81.231 52.865 1.00 32.93  ? 62   THR A CA  1 
ATOM   537  C  C   . THR A 1 62  ? -12.017 79.794 53.044 1.00 31.93  ? 62   THR A C   1 
ATOM   538  O  O   . THR A 1 62  ? -12.436 78.886 52.325 1.00 30.40  ? 62   THR A O   1 
ATOM   539  C  CB  . THR A 1 62  ? -13.685 81.464 53.834 1.00 34.57  ? 62   THR A CB  1 
ATOM   540  O  OG1 . THR A 1 62  ? -14.750 80.558 53.519 1.00 38.47  ? 62   THR A OG1 1 
ATOM   541  C  CG2 . THR A 1 62  ? -14.203 82.889 53.710 1.00 36.53  ? 62   THR A CG2 1 
ATOM   542  N  N   . TYR A 1 63  ? -11.128 79.599 54.015 1.00 30.93  ? 63   TYR A N   1 
ATOM   543  C  CA  . TYR A 1 63  ? -10.586 78.274 54.308 1.00 28.93  ? 63   TYR A CA  1 
ATOM   544  C  C   . TYR A 1 63  ? -11.688 77.274 54.650 1.00 27.94  ? 63   TYR A C   1 
ATOM   545  O  O   . TYR A 1 63  ? -12.717 77.636 55.217 1.00 27.59  ? 63   TYR A O   1 
ATOM   546  C  CB  . TYR A 1 63  ? -9.612  78.331 55.490 1.00 27.30  ? 63   TYR A CB  1 
ATOM   547  C  CG  . TYR A 1 63  ? -8.192  78.720 55.149 1.00 27.68  ? 63   TYR A CG  1 
ATOM   548  C  CD1 . TYR A 1 63  ? -7.563  78.230 54.005 1.00 26.31  ? 63   TYR A CD1 1 
ATOM   549  C  CD2 . TYR A 1 63  ? -7.444  79.514 56.021 1.00 28.38  ? 63   TYR A CD2 1 
ATOM   550  C  CE1 . TYR A 1 63  ? -6.220  78.517 53.740 1.00 28.19  ? 63   TYR A CE1 1 
ATOM   551  C  CE2 . TYR A 1 63  ? -6.105  79.803 55.768 1.00 26.68  ? 63   TYR A CE2 1 
ATOM   552  C  CZ  . TYR A 1 63  ? -5.500  79.300 54.630 1.00 27.68  ? 63   TYR A CZ  1 
ATOM   553  O  OH  . TYR A 1 63  ? -4.170  79.563 54.397 1.00 29.39  ? 63   TYR A OH  1 
ATOM   554  N  N   . PRO A 1 64  ? -11.473 75.990 54.322 1.00 26.63  ? 64   PRO A N   1 
ATOM   555  C  CA  . PRO A 1 64  ? -12.445 74.930 54.596 1.00 25.04  ? 64   PRO A CA  1 
ATOM   556  C  C   . PRO A 1 64  ? -12.298 74.411 56.026 1.00 25.27  ? 64   PRO A C   1 
ATOM   557  O  O   . PRO A 1 64  ? -11.432 74.868 56.778 1.00 25.18  ? 64   PRO A O   1 
ATOM   558  C  CB  . PRO A 1 64  ? -12.060 73.863 53.583 1.00 25.25  ? 64   PRO A CB  1 
ATOM   559  C  CG  . PRO A 1 64  ? -10.557 73.942 53.632 1.00 23.65  ? 64   PRO A CG  1 
ATOM   560  C  CD  . PRO A 1 64  ? -10.305 75.451 53.599 1.00 24.72  ? 64   PRO A CD  1 
ATOM   561  N  N   . ASN A 1 65  ? -13.149 73.458 56.396 1.00 24.38  ? 65   ASN A N   1 
ATOM   562  C  CA  . ASN A 1 65  ? -13.073 72.842 57.716 1.00 25.51  ? 65   ASN A CA  1 
ATOM   563  C  C   . ASN A 1 65  ? -11.835 71.943 57.714 1.00 25.97  ? 65   ASN A C   1 
ATOM   564  O  O   . ASN A 1 65  ? -11.329 71.581 56.649 1.00 26.34  ? 65   ASN A O   1 
ATOM   565  C  CB  . ASN A 1 65  ? -14.297 71.961 57.990 1.00 27.96  ? 65   ASN A CB  1 
ATOM   566  C  CG  . ASN A 1 65  ? -15.597 72.743 58.032 1.00 32.53  ? 65   ASN A CG  1 
ATOM   567  O  OD1 . ASN A 1 65  ? -15.705 73.757 58.715 1.00 34.40  ? 65   ASN A OD1 1 
ATOM   568  N  ND2 . ASN A 1 65  ? -16.598 72.258 57.309 1.00 35.29  ? 65   ASN A ND2 1 
ATOM   569  N  N   . ASN A 1 66  ? -11.361 71.584 58.903 1.00 24.99  ? 66   ASN A N   1 
ATOM   570  C  CA  . ASN A 1 66  ? -10.204 70.701 59.054 1.00 24.30  ? 66   ASN A CA  1 
ATOM   571  C  C   . ASN A 1 66  ? -10.758 69.302 59.338 1.00 23.71  ? 66   ASN A C   1 
ATOM   572  O  O   . ASN A 1 66  ? -11.839 69.169 59.908 1.00 23.27  ? 66   ASN A O   1 
ATOM   573  C  CB  . ASN A 1 66  ? -9.345  71.141 60.244 1.00 22.66  ? 66   ASN A CB  1 
ATOM   574  C  CG  . ASN A 1 66  ? -8.724  72.515 60.052 1.00 25.25  ? 66   ASN A CG  1 
ATOM   575  O  OD1 . ASN A 1 66  ? -8.572  73.273 61.013 1.00 24.66  ? 66   ASN A OD1 1 
ATOM   576  N  ND2 . ASN A 1 66  ? -8.342  72.834 58.817 1.00 24.74  ? 66   ASN A ND2 1 
ATOM   577  N  N   . CYS A 1 67  ? -10.027 68.262 58.949 1.00 22.17  ? 67   CYS A N   1 
ATOM   578  C  CA  . CYS A 1 67  ? -10.491 66.903 59.199 1.00 22.84  ? 67   CYS A CA  1 
ATOM   579  C  C   . CYS A 1 67  ? -10.518 66.594 60.701 1.00 24.20  ? 67   CYS A C   1 
ATOM   580  O  O   . CYS A 1 67  ? -9.787  67.207 61.484 1.00 24.49  ? 67   CYS A O   1 
ATOM   581  C  CB  . CYS A 1 67  ? -9.601  65.893 58.463 1.00 22.65  ? 67   CYS A CB  1 
ATOM   582  S  SG  . CYS A 1 67  ? -9.678  66.023 56.644 1.00 26.28  ? 67   CYS A SG  1 
ATOM   583  N  N   . GLN A 1 68  ? -11.375 65.656 61.097 1.00 23.65  ? 68   GLN A N   1 
ATOM   584  C  CA  . GLN A 1 68  ? -11.497 65.272 62.502 1.00 25.05  ? 68   GLN A CA  1 
ATOM   585  C  C   . GLN A 1 68  ? -10.178 64.692 62.980 1.00 25.85  ? 68   GLN A C   1 
ATOM   586  O  O   . GLN A 1 68  ? -9.593  63.833 62.317 1.00 24.49  ? 68   GLN A O   1 
ATOM   587  C  CB  . GLN A 1 68  ? -12.615 64.243 62.679 1.00 24.79  ? 68   GLN A CB  1 
ATOM   588  C  CG  . GLN A 1 68  ? -14.014 64.812 62.480 1.00 24.92  ? 68   GLN A CG  1 
ATOM   589  C  CD  . GLN A 1 68  ? -14.490 65.648 63.659 1.00 28.96  ? 68   GLN A CD  1 
ATOM   590  O  OE1 . GLN A 1 68  ? -15.621 66.144 63.665 1.00 30.46  ? 68   GLN A OE1 1 
ATOM   591  N  NE2 . GLN A 1 68  ? -13.632 65.807 64.662 1.00 23.61  ? 68   GLN A NE2 1 
ATOM   592  N  N   . GLN A 1 69  ? -9.716  65.151 64.139 1.00 24.66  ? 69   GLN A N   1 
ATOM   593  C  CA  . GLN A 1 69  ? -8.442  64.686 64.658 1.00 23.78  ? 69   GLN A CA  1 
ATOM   594  C  C   . GLN A 1 69  ? -8.219  64.984 66.132 1.00 23.92  ? 69   GLN A C   1 
ATOM   595  O  O   . GLN A 1 69  ? -8.881  65.835 66.730 1.00 21.57  ? 69   GLN A O   1 
ATOM   596  C  CB  . GLN A 1 69  ? -7.314  65.346 63.865 1.00 23.74  ? 69   GLN A CB  1 
ATOM   597  C  CG  . GLN A 1 69  ? -7.380  66.875 63.930 1.00 23.17  ? 69   GLN A CG  1 
ATOM   598  C  CD  . GLN A 1 69  ? -6.451  67.556 62.946 1.00 24.02  ? 69   GLN A CD  1 
ATOM   599  O  OE1 . GLN A 1 69  ? -5.283  67.831 63.249 1.00 23.82  ? 69   GLN A OE1 1 
ATOM   600  N  NE2 . GLN A 1 69  ? -6.962  67.823 61.751 1.00 21.11  ? 69   GLN A NE2 1 
ATOM   601  N  N   . TYR A 1 70  ? -7.259  64.263 66.695 1.00 23.39  ? 70   TYR A N   1 
ATOM   602  C  CA  . TYR A 1 70  ? -6.840  64.440 68.074 1.00 24.46  ? 70   TYR A CA  1 
ATOM   603  C  C   . TYR A 1 70  ? -6.294  65.865 68.134 1.00 25.94  ? 70   TYR A C   1 
ATOM   604  O  O   . TYR A 1 70  ? -5.643  66.311 67.190 1.00 26.39  ? 70   TYR A O   1 
ATOM   605  C  CB  . TYR A 1 70  ? -5.715  63.451 68.381 1.00 26.54  ? 70   TYR A CB  1 
ATOM   606  C  CG  . TYR A 1 70  ? -5.002  63.691 69.690 1.00 28.92  ? 70   TYR A CG  1 
ATOM   607  C  CD1 . TYR A 1 70  ? -5.533  63.225 70.892 1.00 28.16  ? 70   TYR A CD1 1 
ATOM   608  C  CD2 . TYR A 1 70  ? -3.788  64.380 69.725 1.00 29.34  ? 70   TYR A CD2 1 
ATOM   609  C  CE1 . TYR A 1 70  ? -4.867  63.437 72.100 1.00 30.42  ? 70   TYR A CE1 1 
ATOM   610  C  CE2 . TYR A 1 70  ? -3.117  64.598 70.925 1.00 30.30  ? 70   TYR A CE2 1 
ATOM   611  C  CZ  . TYR A 1 70  ? -3.661  64.125 72.106 1.00 30.08  ? 70   TYR A CZ  1 
ATOM   612  O  OH  . TYR A 1 70  ? -2.999  64.339 73.294 1.00 30.76  ? 70   TYR A OH  1 
ATOM   613  N  N   . VAL A 1 71  ? -6.562  66.579 69.224 1.00 25.51  ? 71   VAL A N   1 
ATOM   614  C  CA  . VAL A 1 71  ? -6.077  67.950 69.380 1.00 25.45  ? 71   VAL A CA  1 
ATOM   615  C  C   . VAL A 1 71  ? -5.110  68.032 70.560 1.00 26.68  ? 71   VAL A C   1 
ATOM   616  O  O   . VAL A 1 71  ? -5.416  67.563 71.655 1.00 26.87  ? 71   VAL A O   1 
ATOM   617  C  CB  . VAL A 1 71  ? -7.255  68.940 69.609 1.00 25.59  ? 71   VAL A CB  1 
ATOM   618  C  CG1 . VAL A 1 71  ? -6.726  70.321 69.982 1.00 25.54  ? 71   VAL A CG1 1 
ATOM   619  C  CG2 . VAL A 1 71  ? -8.108  69.033 68.343 1.00 23.84  ? 71   VAL A CG2 1 
ATOM   620  N  N   . ASP A 1 72  ? -3.942  68.627 70.326 1.00 26.28  ? 72   ASP A N   1 
ATOM   621  C  CA  . ASP A 1 72  ? -2.914  68.770 71.358 1.00 26.78  ? 72   ASP A CA  1 
ATOM   622  C  C   . ASP A 1 72  ? -3.310  69.807 72.411 1.00 27.22  ? 72   ASP A C   1 
ATOM   623  O  O   . ASP A 1 72  ? -3.387  71.002 72.121 1.00 27.95  ? 72   ASP A O   1 
ATOM   624  C  CB  . ASP A 1 72  ? -1.583  69.169 70.704 1.00 26.60  ? 72   ASP A CB  1 
ATOM   625  C  CG  . ASP A 1 72  ? -0.437  69.286 71.704 1.00 27.43  ? 72   ASP A CG  1 
ATOM   626  O  OD1 . ASP A 1 72  ? 0.699   69.549 71.267 1.00 27.34  ? 72   ASP A OD1 1 
ATOM   627  O  OD2 . ASP A 1 72  ? -0.663  69.115 72.920 1.00 30.27  ? 72   ASP A OD2 1 
ATOM   628  N  N   . GLU A 1 73  ? -3.560  69.342 73.632 1.00 27.31  ? 73   GLU A N   1 
ATOM   629  C  CA  . GLU A 1 73  ? -3.940  70.222 74.740 1.00 28.53  ? 73   GLU A CA  1 
ATOM   630  C  C   . GLU A 1 73  ? -2.921  70.127 75.873 1.00 29.44  ? 73   GLU A C   1 
ATOM   631  O  O   . GLU A 1 73  ? -3.207  70.499 77.011 1.00 29.71  ? 73   GLU A O   1 
ATOM   632  C  CB  . GLU A 1 73  ? -5.323  69.834 75.280 1.00 28.84  ? 73   GLU A CB  1 
ATOM   633  C  CG  . GLU A 1 73  ? -6.491  70.273 74.419 1.00 31.99  ? 73   GLU A CG  1 
ATOM   634  C  CD  . GLU A 1 73  ? -7.832  69.834 74.994 1.00 37.37  ? 73   GLU A CD  1 
ATOM   635  O  OE1 . GLU A 1 73  ? -8.029  69.949 76.226 1.00 38.06  ? 73   GLU A OE1 1 
ATOM   636  O  OE2 . GLU A 1 73  ? -8.693  69.382 74.212 1.00 37.46  ? 73   GLU A OE2 1 
ATOM   637  N  N   . GLN A 1 74  ? -1.733  69.628 75.554 1.00 30.08  ? 74   GLN A N   1 
ATOM   638  C  CA  . GLN A 1 74  ? -0.678  69.456 76.545 1.00 31.09  ? 74   GLN A CA  1 
ATOM   639  C  C   . GLN A 1 74  ? -0.189  70.770 77.165 1.00 31.36  ? 74   GLN A C   1 
ATOM   640  O  O   . GLN A 1 74  ? 0.174   70.803 78.342 1.00 29.23  ? 74   GLN A O   1 
ATOM   641  C  CB  . GLN A 1 74  ? 0.488   68.686 75.914 1.00 31.40  ? 74   GLN A CB  1 
ATOM   642  C  CG  . GLN A 1 74  ? 1.569   68.244 76.886 1.00 37.26  ? 74   GLN A CG  1 
ATOM   643  C  CD  . GLN A 1 74  ? 1.009   67.537 78.112 1.00 41.90  ? 74   GLN A CD  1 
ATOM   644  O  OE1 . GLN A 1 74  ? 0.833   68.147 79.169 1.00 44.80  ? 74   GLN A OE1 1 
ATOM   645  N  NE2 . GLN A 1 74  ? 0.715   66.249 77.972 1.00 42.10  ? 74   GLN A NE2 1 
ATOM   646  N  N   . PHE A 1 75  ? -0.186  71.848 76.381 1.00 29.28  ? 75   PHE A N   1 
ATOM   647  C  CA  . PHE A 1 75  ? 0.256   73.157 76.869 1.00 31.05  ? 75   PHE A CA  1 
ATOM   648  C  C   . PHE A 1 75  ? -0.744  74.241 76.457 1.00 34.08  ? 75   PHE A C   1 
ATOM   649  O  O   . PHE A 1 75  ? -0.485  75.028 75.546 1.00 32.11  ? 75   PHE A O   1 
ATOM   650  C  CB  . PHE A 1 75  ? 1.642   73.490 76.303 1.00 27.58  ? 75   PHE A CB  1 
ATOM   651  C  CG  . PHE A 1 75  ? 2.685   72.452 76.610 1.00 26.68  ? 75   PHE A CG  1 
ATOM   652  C  CD1 . PHE A 1 75  ? 3.166   72.290 77.908 1.00 25.59  ? 75   PHE A CD1 1 
ATOM   653  C  CD2 . PHE A 1 75  ? 3.166   71.616 75.608 1.00 25.43  ? 75   PHE A CD2 1 
ATOM   654  C  CE1 . PHE A 1 75  ? 4.113   71.308 78.203 1.00 24.44  ? 75   PHE A CE1 1 
ATOM   655  C  CE2 . PHE A 1 75  ? 4.114   70.628 75.891 1.00 26.16  ? 75   PHE A CE2 1 
ATOM   656  C  CZ  . PHE A 1 75  ? 4.588   70.473 77.189 1.00 25.36  ? 75   PHE A CZ  1 
ATOM   657  N  N   . PRO A 1 76  ? -1.906  74.291 77.128 1.00 38.01  ? 76   PRO A N   1 
ATOM   658  C  CA  . PRO A 1 76  ? -2.943  75.284 76.822 1.00 38.87  ? 76   PRO A CA  1 
ATOM   659  C  C   . PRO A 1 76  ? -2.424  76.721 76.823 1.00 38.94  ? 76   PRO A C   1 
ATOM   660  O  O   . PRO A 1 76  ? -1.744  77.145 77.756 1.00 38.56  ? 76   PRO A O   1 
ATOM   661  C  CB  . PRO A 1 76  ? -3.982  75.040 77.914 1.00 39.58  ? 76   PRO A CB  1 
ATOM   662  C  CG  . PRO A 1 76  ? -3.854  73.562 78.162 1.00 40.03  ? 76   PRO A CG  1 
ATOM   663  C  CD  . PRO A 1 76  ? -2.352  73.384 78.202 1.00 39.73  ? 76   PRO A CD  1 
ATOM   664  N  N   . GLY A 1 77  ? -2.748  77.458 75.765 1.00 39.74  ? 77   GLY A N   1 
ATOM   665  C  CA  . GLY A 1 77  ? -2.316  78.841 75.660 1.00 39.60  ? 77   GLY A CA  1 
ATOM   666  C  C   . GLY A 1 77  ? -0.907  79.022 75.120 1.00 39.53  ? 77   GLY A C   1 
ATOM   667  O  O   . GLY A 1 77  ? -0.469  80.150 74.893 1.00 41.87  ? 77   GLY A O   1 
ATOM   668  N  N   . PHE A 1 78  ? -0.198  77.916 74.913 1.00 35.57  ? 78   PHE A N   1 
ATOM   669  C  CA  . PHE A 1 78  ? 1.170   77.953 74.402 1.00 31.86  ? 78   PHE A CA  1 
ATOM   670  C  C   . PHE A 1 78  ? 1.157   77.851 72.877 1.00 30.88  ? 78   PHE A C   1 
ATOM   671  O  O   . PHE A 1 78  ? 0.700   76.853 72.319 1.00 29.93  ? 78   PHE A O   1 
ATOM   672  C  CB  . PHE A 1 78  ? 1.971   76.794 75.007 1.00 29.63  ? 78   PHE A CB  1 
ATOM   673  C  CG  . PHE A 1 78  ? 3.411   76.758 74.584 1.00 29.55  ? 78   PHE A CG  1 
ATOM   674  C  CD1 . PHE A 1 78  ? 4.260   77.830 74.854 1.00 29.27  ? 78   PHE A CD1 1 
ATOM   675  C  CD2 . PHE A 1 78  ? 3.925   75.645 73.930 1.00 26.09  ? 78   PHE A CD2 1 
ATOM   676  C  CE1 . PHE A 1 78  ? 5.603   77.790 74.478 1.00 28.25  ? 78   PHE A CE1 1 
ATOM   677  C  CE2 . PHE A 1 78  ? 5.264   75.594 73.550 1.00 26.83  ? 78   PHE A CE2 1 
ATOM   678  C  CZ  . PHE A 1 78  ? 6.105   76.669 73.824 1.00 27.02  ? 78   PHE A CZ  1 
ATOM   679  N  N   . SER A 1 79  ? 1.669   78.881 72.211 1.00 29.09  ? 79   SER A N   1 
ATOM   680  C  CA  . SER A 1 79  ? 1.695   78.928 70.751 1.00 28.73  ? 79   SER A CA  1 
ATOM   681  C  C   . SER A 1 79  ? 2.545   77.841 70.092 1.00 27.73  ? 79   SER A C   1 
ATOM   682  O  O   . SER A 1 79  ? 2.239   77.400 68.982 1.00 28.02  ? 79   SER A O   1 
ATOM   683  C  CB  . SER A 1 79  ? 2.190   80.300 70.282 1.00 27.97  ? 79   SER A CB  1 
ATOM   684  O  OG  . SER A 1 79  ? 3.555   80.484 70.613 1.00 29.33  ? 79   SER A OG  1 
ATOM   685  N  N   . GLY A 1 80  ? 3.613   77.422 70.767 1.00 26.40  ? 80   GLY A N   1 
ATOM   686  C  CA  . GLY A 1 80  ? 4.486   76.397 70.218 1.00 25.98  ? 80   GLY A CA  1 
ATOM   687  C  C   . GLY A 1 80  ? 3.763   75.115 69.835 1.00 25.96  ? 80   GLY A C   1 
ATOM   688  O  O   . GLY A 1 80  ? 4.097   74.477 68.836 1.00 24.37  ? 80   GLY A O   1 
ATOM   689  N  N   . SER A 1 81  ? 2.773   74.734 70.635 1.00 26.17  ? 81   SER A N   1 
ATOM   690  C  CA  . SER A 1 81  ? 2.002   73.526 70.375 1.00 26.92  ? 81   SER A CA  1 
ATOM   691  C  C   . SER A 1 81  ? 0.697   73.836 69.655 1.00 27.29  ? 81   SER A C   1 
ATOM   692  O  O   . SER A 1 81  ? 0.311   73.136 68.721 1.00 24.68  ? 81   SER A O   1 
ATOM   693  C  CB  . SER A 1 81  ? 1.701   72.799 71.689 1.00 28.24  ? 81   SER A CB  1 
ATOM   694  O  OG  . SER A 1 81  ? 1.050   73.654 72.615 1.00 28.97  ? 81   SER A OG  1 
ATOM   695  N  N   . GLU A 1 82  ? 0.024   74.899 70.080 1.00 27.50  ? 82   GLU A N   1 
ATOM   696  C  CA  . GLU A 1 82  ? -1.249  75.262 69.478 1.00 28.35  ? 82   GLU A CA  1 
ATOM   697  C  C   . GLU A 1 82  ? -1.190  75.711 68.021 1.00 27.06  ? 82   GLU A C   1 
ATOM   698  O  O   . GLU A 1 82  ? -2.204  75.674 67.326 1.00 27.48  ? 82   GLU A O   1 
ATOM   699  C  CB  . GLU A 1 82  ? -1.944  76.319 70.344 1.00 31.30  ? 82   GLU A CB  1 
ATOM   700  C  CG  . GLU A 1 82  ? -2.402  75.742 71.680 1.00 33.81  ? 82   GLU A CG  1 
ATOM   701  C  CD  . GLU A 1 82  ? -3.147  76.734 72.550 1.00 35.50  ? 82   GLU A CD  1 
ATOM   702  O  OE1 . GLU A 1 82  ? -3.787  76.289 73.527 1.00 34.08  ? 82   GLU A OE1 1 
ATOM   703  O  OE2 . GLU A 1 82  ? -3.087  77.949 72.268 1.00 37.21  ? 82   GLU A OE2 1 
ATOM   704  N  N   . MET A 1 83  ? -0.013  76.108 67.544 1.00 26.08  ? 83   MET A N   1 
ATOM   705  C  CA  . MET A 1 83  ? 0.111   76.550 66.157 1.00 26.34  ? 83   MET A CA  1 
ATOM   706  C  C   . MET A 1 83  ? -0.076  75.374 65.194 1.00 27.38  ? 83   MET A C   1 
ATOM   707  O  O   . MET A 1 83  ? -0.235  75.571 63.990 1.00 25.73  ? 83   MET A O   1 
ATOM   708  C  CB  . MET A 1 83  ? 1.479   77.195 65.912 1.00 28.02  ? 83   MET A CB  1 
ATOM   709  C  CG  . MET A 1 83  ? 2.648   76.218 65.959 1.00 29.75  ? 83   MET A CG  1 
ATOM   710  S  SD  . MET A 1 83  ? 4.217   76.960 65.475 1.00 33.44  ? 83   MET A SD  1 
ATOM   711  C  CE  . MET A 1 83  ? 4.082   76.897 63.689 1.00 31.24  ? 83   MET A CE  1 
ATOM   712  N  N   . TRP A 1 84  ? -0.064  74.157 65.738 1.00 24.36  ? 84   TRP A N   1 
ATOM   713  C  CA  . TRP A 1 84  ? -0.220  72.949 64.941 1.00 24.91  ? 84   TRP A CA  1 
ATOM   714  C  C   . TRP A 1 84  ? -1.628  72.372 64.989 1.00 24.66  ? 84   TRP A C   1 
ATOM   715  O  O   . TRP A 1 84  ? -1.967  71.497 64.194 1.00 23.88  ? 84   TRP A O   1 
ATOM   716  C  CB  . TRP A 1 84  ? 0.788   71.890 65.399 1.00 23.20  ? 84   TRP A CB  1 
ATOM   717  C  CG  . TRP A 1 84  ? 2.196   72.386 65.335 1.00 23.63  ? 84   TRP A CG  1 
ATOM   718  C  CD1 . TRP A 1 84  ? 2.956   72.852 66.373 1.00 24.63  ? 84   TRP A CD1 1 
ATOM   719  C  CD2 . TRP A 1 84  ? 2.996   72.531 64.156 1.00 23.69  ? 84   TRP A CD2 1 
ATOM   720  N  NE1 . TRP A 1 84  ? 4.180   73.282 65.910 1.00 24.23  ? 84   TRP A NE1 1 
ATOM   721  C  CE2 . TRP A 1 84  ? 4.230   73.095 64.553 1.00 24.68  ? 84   TRP A CE2 1 
ATOM   722  C  CE3 . TRP A 1 84  ? 2.788   72.241 62.799 1.00 24.36  ? 84   TRP A CE3 1 
ATOM   723  C  CZ2 . TRP A 1 84  ? 5.255   73.374 63.640 1.00 24.65  ? 84   TRP A CZ2 1 
ATOM   724  C  CZ3 . TRP A 1 84  ? 3.808   72.519 61.892 1.00 24.70  ? 84   TRP A CZ3 1 
ATOM   725  C  CH2 . TRP A 1 84  ? 5.026   73.080 62.319 1.00 24.31  ? 84   TRP A CH2 1 
ATOM   726  N  N   . ASN A 1 85  ? -2.444  72.864 65.918 1.00 24.87  ? 85   ASN A N   1 
ATOM   727  C  CA  . ASN A 1 85  ? -3.815  72.388 66.061 1.00 25.02  ? 85   ASN A CA  1 
ATOM   728  C  C   . ASN A 1 85  ? -4.725  72.973 64.987 1.00 25.73  ? 85   ASN A C   1 
ATOM   729  O  O   . ASN A 1 85  ? -4.397  73.973 64.355 1.00 25.22  ? 85   ASN A O   1 
ATOM   730  C  CB  . ASN A 1 85  ? -4.387  72.767 67.434 1.00 25.41  ? 85   ASN A CB  1 
ATOM   731  C  CG  . ASN A 1 85  ? -3.780  71.966 68.576 1.00 28.46  ? 85   ASN A CG  1 
ATOM   732  O  OD1 . ASN A 1 85  ? -3.395  70.808 68.406 1.00 28.86  ? 85   ASN A OD1 1 
ATOM   733  N  ND2 . ASN A 1 85  ? -3.725  72.574 69.758 1.00 24.26  ? 85   ASN A ND2 1 
ATOM   734  N  N   . PRO A 1 86  ? -5.890  72.347 64.770 1.00 26.19  ? 86   PRO A N   1 
ATOM   735  C  CA  . PRO A 1 86  ? -6.835  72.841 63.765 1.00 26.41  ? 86   PRO A CA  1 
ATOM   736  C  C   . PRO A 1 86  ? -7.228  74.278 64.112 1.00 26.61  ? 86   PRO A C   1 
ATOM   737  O  O   . PRO A 1 86  ? -7.557  74.562 65.265 1.00 24.30  ? 86   PRO A O   1 
ATOM   738  C  CB  . PRO A 1 86  ? -8.025  71.892 63.915 1.00 25.60  ? 86   PRO A CB  1 
ATOM   739  C  CG  . PRO A 1 86  ? -7.396  70.623 64.370 1.00 25.39  ? 86   PRO A CG  1 
ATOM   740  C  CD  . PRO A 1 86  ? -6.378  71.097 65.381 1.00 25.21  ? 86   PRO A CD  1 
ATOM   741  N  N   . ASN A 1 87  ? -7.182  75.182 63.136 1.00 26.55  ? 87   ASN A N   1 
ATOM   742  C  CA  . ASN A 1 87  ? -7.578  76.561 63.399 1.00 28.12  ? 87   ASN A CA  1 
ATOM   743  C  C   . ASN A 1 87  ? -8.945  76.853 62.781 1.00 29.81  ? 87   ASN A C   1 
ATOM   744  O  O   . ASN A 1 87  ? -9.368  78.004 62.680 1.00 29.90  ? 87   ASN A O   1 
ATOM   745  C  CB  . ASN A 1 87  ? -6.516  77.562 62.909 1.00 28.38  ? 87   ASN A CB  1 
ATOM   746  C  CG  . ASN A 1 87  ? -6.227  77.457 61.423 1.00 29.40  ? 87   ASN A CG  1 
ATOM   747  O  OD1 . ASN A 1 87  ? -5.535  78.311 60.866 1.00 32.78  ? 87   ASN A OD1 1 
ATOM   748  N  ND2 . ASN A 1 87  ? -6.739  76.419 60.776 1.00 25.27  ? 87   ASN A ND2 1 
ATOM   749  N  N   A ARG A 1 88  ? -9.608  75.789 62.339 0.50 29.09  ? 88   ARG A N   1 
ATOM   750  N  N   B ARG A 1 88  ? -9.643  75.789 62.393 0.50 28.85  ? 88   ARG A N   1 
ATOM   751  C  CA  A ARG A 1 88  ? -10.935 75.877 61.743 0.50 29.25  ? 88   ARG A CA  1 
ATOM   752  C  CA  B ARG A 1 88  ? -10.984 75.895 61.826 0.50 28.76  ? 88   ARG A CA  1 
ATOM   753  C  C   A ARG A 1 88  ? -11.777 74.846 62.479 0.50 29.59  ? 88   ARG A C   1 
ATOM   754  C  C   B ARG A 1 88  ? -11.822 74.757 62.400 0.50 29.19  ? 88   ARG A C   1 
ATOM   755  O  O   A ARG A 1 88  ? -11.255 74.085 63.297 0.50 28.79  ? 88   ARG A O   1 
ATOM   756  O  O   B ARG A 1 88  ? -11.281 73.809 62.970 0.50 29.02  ? 88   ARG A O   1 
ATOM   757  C  CB  A ARG A 1 88  ? -10.889 75.518 60.253 0.50 29.73  ? 88   ARG A CB  1 
ATOM   758  C  CB  B ARG A 1 88  ? -10.944 75.795 60.297 0.50 28.39  ? 88   ARG A CB  1 
ATOM   759  C  CG  A ARG A 1 88  ? -9.870  76.297 59.432 0.50 30.90  ? 88   ARG A CG  1 
ATOM   760  C  CG  B ARG A 1 88  ? -10.398 77.035 59.598 0.50 29.31  ? 88   ARG A CG  1 
ATOM   761  C  CD  A ARG A 1 88  ? -10.225 77.768 59.355 0.50 32.43  ? 88   ARG A CD  1 
ATOM   762  C  CD  B ARG A 1 88  ? -11.310 78.236 59.821 0.50 29.35  ? 88   ARG A CD  1 
ATOM   763  N  NE  A ARG A 1 88  ? -11.530 77.977 58.735 0.50 34.62  ? 88   ARG A NE  1 
ATOM   764  N  NE  B ARG A 1 88  ? -10.867 79.419 59.087 0.50 29.34  ? 88   ARG A NE  1 
ATOM   765  C  CZ  A ARG A 1 88  ? -12.107 79.166 58.598 0.50 36.08  ? 88   ARG A CZ  1 
ATOM   766  C  CZ  B ARG A 1 88  ? -9.772  80.118 59.370 0.50 29.44  ? 88   ARG A CZ  1 
ATOM   767  N  NH1 A ARG A 1 88  ? -11.494 80.256 59.037 0.50 36.39  ? 88   ARG A NH1 1 
ATOM   768  N  NH1 B ARG A 1 88  ? -8.990  79.762 60.381 0.50 30.57  ? 88   ARG A NH1 1 
ATOM   769  N  NH2 A ARG A 1 88  ? -13.296 79.265 58.020 0.50 36.47  ? 88   ARG A NH2 1 
ATOM   770  N  NH2 B ARG A 1 88  ? -9.458  81.177 58.639 0.50 30.21  ? 88   ARG A NH2 1 
ATOM   771  N  N   A GLU A 1 89  ? -13.073 74.817 62.200 0.50 29.26  ? 89   GLU A N   1 
ATOM   772  N  N   B GLU A 1 89  ? -13.139 74.858 62.262 0.50 28.56  ? 89   GLU A N   1 
ATOM   773  C  CA  A GLU A 1 89  ? -13.945 73.846 62.841 0.50 30.33  ? 89   GLU A CA  1 
ATOM   774  C  CA  B GLU A 1 89  ? -14.039 73.826 62.765 0.50 29.44  ? 89   GLU A CA  1 
ATOM   775  C  C   A GLU A 1 89  ? -13.623 72.494 62.203 0.50 29.37  ? 89   GLU A C   1 
ATOM   776  C  C   B GLU A 1 89  ? -13.662 72.472 62.172 0.50 28.78  ? 89   GLU A C   1 
ATOM   777  O  O   A GLU A 1 89  ? -13.330 72.424 61.010 0.50 28.71  ? 89   GLU A O   1 
ATOM   778  O  O   B GLU A 1 89  ? -13.360 72.378 60.982 0.50 28.33  ? 89   GLU A O   1 
ATOM   779  C  CB  A GLU A 1 89  ? -15.410 74.229 62.611 0.50 33.65  ? 89   GLU A CB  1 
ATOM   780  C  CB  B GLU A 1 89  ? -15.488 74.160 62.381 0.50 31.70  ? 89   GLU A CB  1 
ATOM   781  C  CG  A GLU A 1 89  ? -16.403 73.462 63.468 0.50 38.79  ? 89   GLU A CG  1 
ATOM   782  C  CG  B GLU A 1 89  ? -16.507 73.089 62.764 0.50 35.42  ? 89   GLU A CG  1 
ATOM   783  C  CD  A GLU A 1 89  ? -17.814 74.015 63.363 0.50 41.05  ? 89   GLU A CD  1 
ATOM   784  C  CD  B GLU A 1 89  ? -17.902 73.371 62.219 0.50 37.13  ? 89   GLU A CD  1 
ATOM   785  O  OE1 A GLU A 1 89  ? -18.739 73.397 63.930 0.50 43.15  ? 89   GLU A OE1 1 
ATOM   786  O  OE1 B GLU A 1 89  ? -18.837 72.612 62.553 0.50 38.51  ? 89   GLU A OE1 1 
ATOM   787  O  OE2 A GLU A 1 89  ? -18.000 75.068 62.716 0.50 42.84  ? 89   GLU A OE2 1 
ATOM   788  O  OE2 B GLU A 1 89  ? -18.066 74.347 61.455 0.50 38.91  ? 89   GLU A OE2 1 
ATOM   789  N  N   . MET A 1 90  ? -13.658 71.430 62.999 1.00 28.06  ? 90   MET A N   1 
ATOM   790  C  CA  . MET A 1 90  ? -13.348 70.089 62.501 1.00 28.33  ? 90   MET A CA  1 
ATOM   791  C  C   . MET A 1 90  ? -14.627 69.443 61.984 1.00 28.11  ? 90   MET A C   1 
ATOM   792  O  O   . MET A 1 90  ? -15.702 69.645 62.547 1.00 27.20  ? 90   MET A O   1 
ATOM   793  C  CB  . MET A 1 90  ? -12.749 69.205 63.601 1.00 27.45  ? 90   MET A CB  1 
ATOM   794  C  CG  . MET A 1 90  ? -11.348 69.601 64.054 1.00 27.50  ? 90   MET A CG  1 
ATOM   795  S  SD  . MET A 1 90  ? -10.609 68.361 65.157 1.00 27.38  ? 90   MET A SD  1 
ATOM   796  C  CE  . MET A 1 90  ? -11.574 68.622 66.661 1.00 28.13  ? 90   MET A CE  1 
ATOM   797  N  N   . SER A 1 91  ? -14.501 68.668 60.913 1.00 27.17  ? 91   SER A N   1 
ATOM   798  C  CA  . SER A 1 91  ? -15.643 67.987 60.307 1.00 26.48  ? 91   SER A CA  1 
ATOM   799  C  C   . SER A 1 91  ? -15.141 66.856 59.423 1.00 26.63  ? 91   SER A C   1 
ATOM   800  O  O   . SER A 1 91  ? -14.027 66.930 58.907 1.00 25.94  ? 91   SER A O   1 
ATOM   801  C  CB  . SER A 1 91  ? -16.440 68.973 59.449 1.00 26.21  ? 91   SER A CB  1 
ATOM   802  O  OG  . SER A 1 91  ? -17.477 68.320 58.739 1.00 27.17  ? 91   SER A OG  1 
ATOM   803  N  N   . GLU A 1 92  ? -15.945 65.808 59.256 1.00 27.32  ? 92   GLU A N   1 
ATOM   804  C  CA  . GLU A 1 92  ? -15.552 64.708 58.376 1.00 27.46  ? 92   GLU A CA  1 
ATOM   805  C  C   . GLU A 1 92  ? -15.648 65.205 56.937 1.00 26.29  ? 92   GLU A C   1 
ATOM   806  O  O   . GLU A 1 92  ? -15.046 64.630 56.027 1.00 27.03  ? 92   GLU A O   1 
ATOM   807  C  CB  . GLU A 1 92  ? -16.448 63.483 58.569 1.00 26.31  ? 92   GLU A CB  1 
ATOM   808  C  CG  . GLU A 1 92  ? -16.240 62.786 59.901 1.00 26.89  ? 92   GLU A CG  1 
ATOM   809  C  CD  . GLU A 1 92  ? -16.974 61.469 59.987 1.00 29.35  ? 92   GLU A CD  1 
ATOM   810  O  OE1 . GLU A 1 92  ? -16.461 60.458 59.454 1.00 27.68  ? 92   GLU A OE1 1 
ATOM   811  O  OE2 . GLU A 1 92  ? -18.072 61.449 60.579 1.00 29.66  ? 92   GLU A OE2 1 
ATOM   812  N  N   . ASP A 1 93  ? -16.422 66.269 56.736 1.00 25.61  ? 93   ASP A N   1 
ATOM   813  C  CA  . ASP A 1 93  ? -16.567 66.884 55.416 1.00 26.48  ? 93   ASP A CA  1 
ATOM   814  C  C   . ASP A 1 93  ? -15.366 67.823 55.366 1.00 26.41  ? 93   ASP A C   1 
ATOM   815  O  O   . ASP A 1 93  ? -15.480 69.009 55.676 1.00 24.51  ? 93   ASP A O   1 
ATOM   816  C  CB  . ASP A 1 93  ? -17.878 67.675 55.345 1.00 27.82  ? 93   ASP A CB  1 
ATOM   817  C  CG  . ASP A 1 93  ? -18.073 68.373 54.012 1.00 28.95  ? 93   ASP A CG  1 
ATOM   818  O  OD1 . ASP A 1 93  ? -19.158 68.958 53.799 1.00 31.30  ? 93   ASP A OD1 1 
ATOM   819  O  OD2 . ASP A 1 93  ? -17.148 68.346 53.177 1.00 28.52  ? 93   ASP A OD2 1 
ATOM   820  N  N   . CYS A 1 94  ? -14.214 67.287 54.972 1.00 25.35  ? 94   CYS A N   1 
ATOM   821  C  CA  . CYS A 1 94  ? -12.986 68.072 54.977 1.00 25.06  ? 94   CYS A CA  1 
ATOM   822  C  C   . CYS A 1 94  ? -12.069 67.924 53.769 1.00 25.45  ? 94   CYS A C   1 
ATOM   823  O  O   . CYS A 1 94  ? -10.945 68.430 53.790 1.00 24.16  ? 94   CYS A O   1 
ATOM   824  C  CB  . CYS A 1 94  ? -12.189 67.703 56.230 1.00 23.92  ? 94   CYS A CB  1 
ATOM   825  S  SG  . CYS A 1 94  ? -11.675 65.949 56.242 1.00 24.14  ? 94   CYS A SG  1 
ATOM   826  N  N   . LEU A 1 95  ? -12.523 67.240 52.724 1.00 25.08  ? 95   LEU A N   1 
ATOM   827  C  CA  . LEU A 1 95  ? -11.669 67.054 51.557 1.00 24.30  ? 95   LEU A CA  1 
ATOM   828  C  C   . LEU A 1 95  ? -11.704 68.231 50.587 1.00 24.38  ? 95   LEU A C   1 
ATOM   829  O  O   . LEU A 1 95  ? -12.469 68.250 49.620 1.00 25.30  ? 95   LEU A O   1 
ATOM   830  C  CB  . LEU A 1 95  ? -12.026 65.744 50.852 1.00 22.58  ? 95   LEU A CB  1 
ATOM   831  C  CG  . LEU A 1 95  ? -11.817 64.519 51.751 1.00 25.39  ? 95   LEU A CG  1 
ATOM   832  C  CD1 . LEU A 1 95  ? -12.050 63.240 50.954 1.00 25.92  ? 95   LEU A CD1 1 
ATOM   833  C  CD2 . LEU A 1 95  ? -10.390 64.532 52.319 1.00 23.45  ? 95   LEU A CD2 1 
ATOM   834  N  N   . TYR A 1 96  ? -10.853 69.215 50.866 1.00 23.68  ? 96   TYR A N   1 
ATOM   835  C  CA  . TYR A 1 96  ? -10.755 70.416 50.052 1.00 24.38  ? 96   TYR A CA  1 
ATOM   836  C  C   . TYR A 1 96  ? -9.296  70.770 49.821 1.00 24.46  ? 96   TYR A C   1 
ATOM   837  O  O   . TYR A 1 96  ? -8.406  70.283 50.524 1.00 25.35  ? 96   TYR A O   1 
ATOM   838  C  CB  . TYR A 1 96  ? -11.446 71.594 50.753 1.00 23.90  ? 96   TYR A CB  1 
ATOM   839  C  CG  . TYR A 1 96  ? -12.906 71.367 51.048 1.00 22.87  ? 96   TYR A CG  1 
ATOM   840  C  CD1 . TYR A 1 96  ? -13.304 70.619 52.156 1.00 22.53  ? 96   TYR A CD1 1 
ATOM   841  C  CD2 . TYR A 1 96  ? -13.894 71.850 50.187 1.00 22.64  ? 96   TYR A CD2 1 
ATOM   842  C  CE1 . TYR A 1 96  ? -14.649 70.349 52.397 1.00 22.36  ? 96   TYR A CE1 1 
ATOM   843  C  CE2 . TYR A 1 96  ? -15.243 71.584 50.419 1.00 23.19  ? 96   TYR A CE2 1 
ATOM   844  C  CZ  . TYR A 1 96  ? -15.614 70.831 51.522 1.00 23.07  ? 96   TYR A CZ  1 
ATOM   845  O  OH  . TYR A 1 96  ? -16.942 70.534 51.743 1.00 22.43  ? 96   TYR A OH  1 
ATOM   846  N  N   . LEU A 1 97  ? -9.055  71.621 48.832 1.00 23.13  ? 97   LEU A N   1 
ATOM   847  C  CA  . LEU A 1 97  ? -7.705  72.068 48.530 1.00 23.57  ? 97   LEU A CA  1 
ATOM   848  C  C   . LEU A 1 97  ? -7.709  73.587 48.360 1.00 25.28  ? 97   LEU A C   1 
ATOM   849  O  O   . LEU A 1 97  ? -8.751  74.188 48.078 1.00 26.78  ? 97   LEU A O   1 
ATOM   850  C  CB  . LEU A 1 97  ? -7.166  71.355 47.277 1.00 22.51  ? 97   LEU A CB  1 
ATOM   851  C  CG  . LEU A 1 97  ? -7.923  71.387 45.944 1.00 22.81  ? 97   LEU A CG  1 
ATOM   852  C  CD1 . LEU A 1 97  ? -7.706  72.731 45.255 1.00 21.16  ? 97   LEU A CD1 1 
ATOM   853  C  CD2 . LEU A 1 97  ? -7.406  70.261 45.041 1.00 22.32  ? 97   LEU A CD2 1 
ATOM   854  N  N   . ASN A 1 98  ? -6.550  74.204 48.563 1.00 25.59  ? 98   ASN A N   1 
ATOM   855  C  CA  . ASN A 1 98  ? -6.413  75.652 48.457 1.00 25.27  ? 98   ASN A CA  1 
ATOM   856  C  C   . ASN A 1 98  ? -5.389  75.987 47.386 1.00 24.64  ? 98   ASN A C   1 
ATOM   857  O  O   . ASN A 1 98  ? -4.405  75.268 47.221 1.00 25.27  ? 98   ASN A O   1 
ATOM   858  C  CB  . ASN A 1 98  ? -5.949  76.240 49.795 1.00 24.57  ? 98   ASN A CB  1 
ATOM   859  C  CG  . ASN A 1 98  ? -6.720  75.687 50.975 1.00 25.96  ? 98   ASN A CG  1 
ATOM   860  O  OD1 . ASN A 1 98  ? -6.168  74.957 51.810 1.00 29.04  ? 98   ASN A OD1 1 
ATOM   861  N  ND2 . ASN A 1 98  ? -8.001  76.020 51.051 1.00 21.69  ? 98   ASN A ND2 1 
ATOM   862  N  N   . ILE A 1 99  ? -5.608  77.088 46.673 1.00 23.35  ? 99   ILE A N   1 
ATOM   863  C  CA  . ILE A 1 99  ? -4.697  77.492 45.614 1.00 24.12  ? 99   ILE A CA  1 
ATOM   864  C  C   . ILE A 1 99  ? -4.331  78.979 45.673 1.00 26.18  ? 99   ILE A C   1 
ATOM   865  O  O   . ILE A 1 99  ? -5.210  79.839 45.748 1.00 26.12  ? 99   ILE A O   1 
ATOM   866  C  CB  . ILE A 1 99  ? -5.314  77.218 44.220 1.00 24.44  ? 99   ILE A CB  1 
ATOM   867  C  CG1 . ILE A 1 99  ? -5.886  75.796 44.158 1.00 24.42  ? 99   ILE A CG1 1 
ATOM   868  C  CG2 . ILE A 1 99  ? -4.262  77.402 43.145 1.00 22.15  ? 99   ILE A CG2 1 
ATOM   869  C  CD1 . ILE A 1 99  ? -6.529  75.453 42.808 1.00 24.33  ? 99   ILE A CD1 1 
ATOM   870  N  N   . TRP A 1 100 ? -3.034  79.272 45.647 1.00 24.39  ? 100  TRP A N   1 
ATOM   871  C  CA  . TRP A 1 100 ? -2.558  80.654 45.639 1.00 27.01  ? 100  TRP A CA  1 
ATOM   872  C  C   . TRP A 1 100 ? -1.987  80.873 44.247 1.00 28.31  ? 100  TRP A C   1 
ATOM   873  O  O   . TRP A 1 100 ? -1.111  80.129 43.797 1.00 27.11  ? 100  TRP A O   1 
ATOM   874  C  CB  . TRP A 1 100 ? -1.488  80.879 46.710 1.00 25.76  ? 100  TRP A CB  1 
ATOM   875  C  CG  . TRP A 1 100 ? -2.066  81.013 48.094 1.00 27.33  ? 100  TRP A CG  1 
ATOM   876  C  CD1 . TRP A 1 100 ? -2.529  82.157 48.689 1.00 28.08  ? 100  TRP A CD1 1 
ATOM   877  C  CD2 . TRP A 1 100 ? -2.270  79.959 49.042 1.00 28.34  ? 100  TRP A CD2 1 
ATOM   878  N  NE1 . TRP A 1 100 ? -3.008  81.877 49.949 1.00 26.44  ? 100  TRP A NE1 1 
ATOM   879  C  CE2 . TRP A 1 100 ? -2.860  80.536 50.190 1.00 28.04  ? 100  TRP A CE2 1 
ATOM   880  C  CE3 . TRP A 1 100 ? -2.010  78.580 49.033 1.00 27.76  ? 100  TRP A CE3 1 
ATOM   881  C  CZ2 . TRP A 1 100 ? -3.195  79.779 51.321 1.00 27.98  ? 100  TRP A CZ2 1 
ATOM   882  C  CZ3 . TRP A 1 100 ? -2.344  77.828 50.158 1.00 26.31  ? 100  TRP A CZ3 1 
ATOM   883  C  CH2 . TRP A 1 100 ? -2.929  78.431 51.286 1.00 26.70  ? 100  TRP A CH2 1 
ATOM   884  N  N   . VAL A 1 101 ? -2.498  81.892 43.565 1.00 27.95  ? 101  VAL A N   1 
ATOM   885  C  CA  . VAL A 1 101 ? -2.087  82.184 42.201 1.00 27.84  ? 101  VAL A CA  1 
ATOM   886  C  C   . VAL A 1 101 ? -1.526  83.593 42.042 1.00 28.67  ? 101  VAL A C   1 
ATOM   887  O  O   . VAL A 1 101 ? -2.124  84.564 42.505 1.00 28.58  ? 101  VAL A O   1 
ATOM   888  C  CB  . VAL A 1 101 ? -3.293  82.029 41.240 1.00 27.89  ? 101  VAL A CB  1 
ATOM   889  C  CG1 . VAL A 1 101 ? -2.854  82.241 39.800 1.00 25.64  ? 101  VAL A CG1 1 
ATOM   890  C  CG2 . VAL A 1 101 ? -3.929  80.657 41.423 1.00 28.03  ? 101  VAL A CG2 1 
ATOM   891  N  N   . PRO A 1 102 ? -0.361  83.717 41.386 1.00 29.21  ? 102  PRO A N   1 
ATOM   892  C  CA  . PRO A 1 102 ? 0.258   85.027 41.172 1.00 30.02  ? 102  PRO A CA  1 
ATOM   893  C  C   . PRO A 1 102 ? -0.687  85.936 40.387 1.00 32.08  ? 102  PRO A C   1 
ATOM   894  O  O   . PRO A 1 102 ? -1.550  85.459 39.648 1.00 31.75  ? 102  PRO A O   1 
ATOM   895  C  CB  . PRO A 1 102 ? 1.514   84.688 40.374 1.00 29.63  ? 102  PRO A CB  1 
ATOM   896  C  CG  . PRO A 1 102 ? 1.873   83.322 40.880 1.00 29.16  ? 102  PRO A CG  1 
ATOM   897  C  CD  . PRO A 1 102 ? 0.530   82.633 40.933 1.00 29.17  ? 102  PRO A CD  1 
ATOM   898  N  N   . SER A 1 103 ? -0.520  87.244 40.554 1.00 34.16  ? 103  SER A N   1 
ATOM   899  C  CA  . SER A 1 103 ? -1.349  88.223 39.858 1.00 34.29  ? 103  SER A CA  1 
ATOM   900  C  C   . SER A 1 103 ? -0.454  89.168 39.067 1.00 34.48  ? 103  SER A C   1 
ATOM   901  O  O   . SER A 1 103 ? 0.476   89.756 39.618 1.00 35.14  ? 103  SER A O   1 
ATOM   902  C  CB  . SER A 1 103 ? -2.181  89.017 40.865 1.00 34.58  ? 103  SER A CB  1 
ATOM   903  O  OG  . SER A 1 103 ? -2.946  90.015 40.214 1.00 35.69  ? 103  SER A OG  1 
ATOM   904  N  N   . PRO A 1 104 ? -0.720  89.329 37.760 1.00 35.27  ? 104  PRO A N   1 
ATOM   905  C  CA  . PRO A 1 104 ? -1.792  88.692 36.984 1.00 34.68  ? 104  PRO A CA  1 
ATOM   906  C  C   . PRO A 1 104 ? -1.640  87.177 36.846 1.00 33.62  ? 104  PRO A C   1 
ATOM   907  O  O   . PRO A 1 104 ? -0.541  86.636 36.975 1.00 32.65  ? 104  PRO A O   1 
ATOM   908  C  CB  . PRO A 1 104 ? -1.709  89.409 35.638 1.00 36.42  ? 104  PRO A CB  1 
ATOM   909  C  CG  . PRO A 1 104 ? -0.244  89.678 35.505 1.00 36.87  ? 104  PRO A CG  1 
ATOM   910  C  CD  . PRO A 1 104 ? 0.122   90.171 36.891 1.00 35.91  ? 104  PRO A CD  1 
ATOM   911  N  N   . ARG A 1 105 ? -2.754  86.501 36.579 1.00 33.40  ? 105  ARG A N   1 
ATOM   912  C  CA  . ARG A 1 105 ? -2.764  85.049 36.437 1.00 32.76  ? 105  ARG A CA  1 
ATOM   913  C  C   . ARG A 1 105 ? -1.746  84.567 35.411 1.00 33.31  ? 105  ARG A C   1 
ATOM   914  O  O   . ARG A 1 105 ? -1.711  85.058 34.283 1.00 32.43  ? 105  ARG A O   1 
ATOM   915  C  CB  . ARG A 1 105 ? -4.158  84.570 36.027 1.00 31.79  ? 105  ARG A CB  1 
ATOM   916  C  CG  . ARG A 1 105 ? -4.300  83.054 35.955 1.00 32.13  ? 105  ARG A CG  1 
ATOM   917  C  CD  . ARG A 1 105 ? -5.647  82.665 35.381 1.00 29.72  ? 105  ARG A CD  1 
ATOM   918  N  NE  . ARG A 1 105 ? -6.754  83.251 36.131 1.00 30.18  ? 105  ARG A NE  1 
ATOM   919  C  CZ  . ARG A 1 105 ? -8.020  83.222 35.728 1.00 31.33  ? 105  ARG A CZ  1 
ATOM   920  N  NH1 . ARG A 1 105 ? -8.335  82.634 34.580 1.00 29.24  ? 105  ARG A NH1 1 
ATOM   921  N  NH2 . ARG A 1 105 ? -8.970  83.788 36.464 1.00 29.73  ? 105  ARG A NH2 1 
ATOM   922  N  N   . PRO A 1 106 ? -0.897  83.598 35.795 1.00 32.76  ? 106  PRO A N   1 
ATOM   923  C  CA  . PRO A 1 106 ? 0.123   83.050 34.894 1.00 32.04  ? 106  PRO A CA  1 
ATOM   924  C  C   . PRO A 1 106 ? -0.558  82.275 33.771 1.00 31.15  ? 106  PRO A C   1 
ATOM   925  O  O   . PRO A 1 106 ? -1.770  82.060 33.804 1.00 29.56  ? 106  PRO A O   1 
ATOM   926  C  CB  . PRO A 1 106 ? 0.933   82.123 35.803 1.00 32.41  ? 106  PRO A CB  1 
ATOM   927  C  CG  . PRO A 1 106 ? 0.712   82.687 37.176 1.00 33.80  ? 106  PRO A CG  1 
ATOM   928  C  CD  . PRO A 1 106 ? -0.748  83.038 37.148 1.00 33.32  ? 106  PRO A CD  1 
ATOM   929  N  N   . LYS A 1 107 ? 0.220   81.849 32.785 1.00 30.93  ? 107  LYS A N   1 
ATOM   930  C  CA  . LYS A 1 107 ? -0.328  81.091 31.669 1.00 32.66  ? 107  LYS A CA  1 
ATOM   931  C  C   . LYS A 1 107 ? -0.038  79.600 31.840 1.00 32.63  ? 107  LYS A C   1 
ATOM   932  O  O   . LYS A 1 107 ? -0.927  78.760 31.693 1.00 31.92  ? 107  LYS A O   1 
ATOM   933  C  CB  . LYS A 1 107 ? 0.269   81.592 30.350 1.00 31.66  ? 107  LYS A CB  1 
ATOM   934  C  CG  . LYS A 1 107 ? 0.021   83.073 30.096 1.00 33.32  ? 107  LYS A CG  1 
ATOM   935  C  CD  . LYS A 1 107 ? -1.468  83.388 30.149 1.00 33.60  ? 107  LYS A CD  1 
ATOM   936  C  CE  . LYS A 1 107 ? -1.723  84.882 30.114 1.00 35.50  ? 107  LYS A CE  1 
ATOM   937  N  NZ  . LYS A 1 107 ? -3.171  85.172 30.281 1.00 35.66  ? 107  LYS A NZ  1 
ATOM   938  N  N   . SER A 1 108 ? 1.213   79.285 32.154 1.00 32.54  ? 108  SER A N   1 
ATOM   939  C  CA  . SER A 1 108 ? 1.633   77.903 32.342 1.00 34.07  ? 108  SER A CA  1 
ATOM   940  C  C   . SER A 1 108 ? 2.880   77.888 33.213 1.00 33.57  ? 108  SER A C   1 
ATOM   941  O  O   . SER A 1 108 ? 3.989   77.680 32.719 1.00 33.83  ? 108  SER A O   1 
ATOM   942  C  CB  . SER A 1 108 ? 1.938   77.262 30.985 1.00 35.81  ? 108  SER A CB  1 
ATOM   943  O  OG  . SER A 1 108 ? 2.293   75.898 31.132 1.00 37.62  ? 108  SER A OG  1 
ATOM   944  N  N   . THR A 1 109 ? 2.697   78.098 34.512 1.00 31.53  ? 109  THR A N   1 
ATOM   945  C  CA  . THR A 1 109 ? 3.830   78.146 35.421 1.00 31.74  ? 109  THR A CA  1 
ATOM   946  C  C   . THR A 1 109 ? 3.960   76.950 36.363 1.00 30.31  ? 109  THR A C   1 
ATOM   947  O  O   . THR A 1 109 ? 3.026   76.163 36.543 1.00 29.54  ? 109  THR A O   1 
ATOM   948  C  CB  . THR A 1 109 ? 3.797   79.447 36.264 1.00 33.06  ? 109  THR A CB  1 
ATOM   949  O  OG1 . THR A 1 109 ? 5.054   79.621 36.929 1.00 37.86  ? 109  THR A OG1 1 
ATOM   950  C  CG2 . THR A 1 109 ? 2.698   79.382 37.308 1.00 33.40  ? 109  THR A CG2 1 
ATOM   951  N  N   . THR A 1 110 ? 5.142   76.831 36.953 1.00 28.67  ? 110  THR A N   1 
ATOM   952  C  CA  . THR A 1 110 ? 5.459   75.762 37.889 1.00 27.66  ? 110  THR A CA  1 
ATOM   953  C  C   . THR A 1 110 ? 4.423   75.655 39.004 1.00 26.72  ? 110  THR A C   1 
ATOM   954  O  O   . THR A 1 110 ? 3.978   76.666 39.557 1.00 25.08  ? 110  THR A O   1 
ATOM   955  C  CB  . THR A 1 110 ? 6.834   76.003 38.519 1.00 29.61  ? 110  THR A CB  1 
ATOM   956  O  OG1 . THR A 1 110 ? 7.814   76.096 37.478 1.00 31.92  ? 110  THR A OG1 1 
ATOM   957  C  CG2 . THR A 1 110 ? 7.201   74.864 39.475 1.00 28.13  ? 110  THR A CG2 1 
ATOM   958  N  N   . VAL A 1 111 ? 4.051   74.419 39.329 1.00 25.22  ? 111  VAL A N   1 
ATOM   959  C  CA  . VAL A 1 111 ? 3.070   74.145 40.375 1.00 23.27  ? 111  VAL A CA  1 
ATOM   960  C  C   . VAL A 1 111 ? 3.709   73.355 41.522 1.00 23.69  ? 111  VAL A C   1 
ATOM   961  O  O   . VAL A 1 111 ? 4.492   72.433 41.291 1.00 23.07  ? 111  VAL A O   1 
ATOM   962  C  CB  . VAL A 1 111 ? 1.881   73.316 39.816 1.00 24.61  ? 111  VAL A CB  1 
ATOM   963  C  CG1 . VAL A 1 111 ? 0.864   73.031 40.923 1.00 22.36  ? 111  VAL A CG1 1 
ATOM   964  C  CG2 . VAL A 1 111 ? 1.220   74.062 38.658 1.00 23.88  ? 111  VAL A CG2 1 
ATOM   965  N  N   . MET A 1 112 ? 3.384   73.734 42.755 1.00 22.06  ? 112  MET A N   1 
ATOM   966  C  CA  . MET A 1 112 ? 3.892   73.042 43.936 1.00 21.48  ? 112  MET A CA  1 
ATOM   967  C  C   . MET A 1 112 ? 2.688   72.680 44.794 1.00 22.38  ? 112  MET A C   1 
ATOM   968  O  O   . MET A 1 112 ? 1.856   73.540 45.100 1.00 24.69  ? 112  MET A O   1 
ATOM   969  C  CB  . MET A 1 112 ? 4.856   73.940 44.724 1.00 21.05  ? 112  MET A CB  1 
ATOM   970  C  CG  . MET A 1 112 ? 6.169   74.218 43.998 1.00 22.69  ? 112  MET A CG  1 
ATOM   971  S  SD  . MET A 1 112 ? 7.333   75.258 44.931 1.00 25.77  ? 112  MET A SD  1 
ATOM   972  C  CE  . MET A 1 112 ? 7.904   74.084 46.184 1.00 24.10  ? 112  MET A CE  1 
ATOM   973  N  N   . VAL A 1 113 ? 2.584   71.405 45.163 1.00 21.28  ? 113  VAL A N   1 
ATOM   974  C  CA  . VAL A 1 113 ? 1.472   70.927 45.975 1.00 20.54  ? 113  VAL A CA  1 
ATOM   975  C  C   . VAL A 1 113 ? 1.970   70.458 47.339 1.00 21.48  ? 113  VAL A C   1 
ATOM   976  O  O   . VAL A 1 113 ? 2.724   69.492 47.434 1.00 20.67  ? 113  VAL A O   1 
ATOM   977  C  CB  . VAL A 1 113 ? 0.735   69.744 45.296 1.00 19.99  ? 113  VAL A CB  1 
ATOM   978  C  CG1 . VAL A 1 113 ? -0.456  69.317 46.153 1.00 20.20  ? 113  VAL A CG1 1 
ATOM   979  C  CG2 . VAL A 1 113 ? 0.278   70.135 43.904 1.00 20.75  ? 113  VAL A CG2 1 
ATOM   980  N  N   . TRP A 1 114 ? 1.524   71.146 48.385 1.00 19.45  ? 114  TRP A N   1 
ATOM   981  C  CA  . TRP A 1 114 ? 1.910   70.847 49.761 1.00 20.94  ? 114  TRP A CA  1 
ATOM   982  C  C   . TRP A 1 114 ? 1.062   69.764 50.419 1.00 20.16  ? 114  TRP A C   1 
ATOM   983  O  O   . TRP A 1 114 ? -0.166  69.796 50.345 1.00 21.26  ? 114  TRP A O   1 
ATOM   984  C  CB  . TRP A 1 114 ? 1.822   72.126 50.602 1.00 20.20  ? 114  TRP A CB  1 
ATOM   985  C  CG  . TRP A 1 114 ? 2.087   71.925 52.073 1.00 19.62  ? 114  TRP A CG  1 
ATOM   986  C  CD1 . TRP A 1 114 ? 1.183   72.029 53.091 1.00 20.83  ? 114  TRP A CD1 1 
ATOM   987  C  CD2 . TRP A 1 114 ? 3.346   71.620 52.684 1.00 19.32  ? 114  TRP A CD2 1 
ATOM   988  N  NE1 . TRP A 1 114 ? 1.803   71.811 54.302 1.00 19.55  ? 114  TRP A NE1 1 
ATOM   989  C  CE2 . TRP A 1 114 ? 3.131   71.558 54.079 1.00 20.38  ? 114  TRP A CE2 1 
ATOM   990  C  CE3 . TRP A 1 114 ? 4.636   71.395 52.187 1.00 20.95  ? 114  TRP A CE3 1 
ATOM   991  C  CZ2 . TRP A 1 114 ? 4.162   71.282 54.987 1.00 22.46  ? 114  TRP A CZ2 1 
ATOM   992  C  CZ3 . TRP A 1 114 ? 5.665   71.122 53.090 1.00 22.17  ? 114  TRP A CZ3 1 
ATOM   993  C  CH2 . TRP A 1 114 ? 5.419   71.069 54.475 1.00 21.80  ? 114  TRP A CH2 1 
ATOM   994  N  N   . ILE A 1 115 ? 1.728   68.816 51.074 1.00 19.68  ? 115  ILE A N   1 
ATOM   995  C  CA  . ILE A 1 115 ? 1.048   67.730 51.781 1.00 20.07  ? 115  ILE A CA  1 
ATOM   996  C  C   . ILE A 1 115 ? 1.458   67.833 53.250 1.00 19.81  ? 115  ILE A C   1 
ATOM   997  O  O   . ILE A 1 115 ? 2.588   67.498 53.603 1.00 18.51  ? 115  ILE A O   1 
ATOM   998  C  CB  . ILE A 1 115 ? 1.481   66.343 51.249 1.00 20.60  ? 115  ILE A CB  1 
ATOM   999  C  CG1 . ILE A 1 115 ? 1.233   66.268 49.738 1.00 20.59  ? 115  ILE A CG1 1 
ATOM   1000 C  CG2 . ILE A 1 115 ? 0.722   65.240 52.005 1.00 18.20  ? 115  ILE A CG2 1 
ATOM   1001 C  CD1 . ILE A 1 115 ? 1.640   64.940 49.096 1.00 21.27  ? 115  ILE A CD1 1 
ATOM   1002 N  N   . TYR A 1 116 ? 0.546   68.297 54.101 1.00 18.81  ? 116  TYR A N   1 
ATOM   1003 C  CA  . TYR A 1 116 ? 0.863   68.466 55.513 1.00 19.52  ? 116  TYR A CA  1 
ATOM   1004 C  C   . TYR A 1 116 ? 1.209   67.178 56.242 1.00 20.33  ? 116  TYR A C   1 
ATOM   1005 O  O   . TYR A 1 116 ? 0.800   66.084 55.842 1.00 18.72  ? 116  TYR A O   1 
ATOM   1006 C  CB  . TYR A 1 116 ? -0.277  69.201 56.248 1.00 19.32  ? 116  TYR A CB  1 
ATOM   1007 C  CG  . TYR A 1 116 ? -1.639  68.522 56.247 1.00 20.12  ? 116  TYR A CG  1 
ATOM   1008 C  CD1 . TYR A 1 116 ? -1.865  67.347 56.969 1.00 20.46  ? 116  TYR A CD1 1 
ATOM   1009 C  CD2 . TYR A 1 116 ? -2.711  69.076 55.544 1.00 20.26  ? 116  TYR A CD2 1 
ATOM   1010 C  CE1 . TYR A 1 116 ? -3.128  66.740 56.989 1.00 19.14  ? 116  TYR A CE1 1 
ATOM   1011 C  CE2 . TYR A 1 116 ? -3.976  68.479 55.559 1.00 19.59  ? 116  TYR A CE2 1 
ATOM   1012 C  CZ  . TYR A 1 116 ? -4.178  67.313 56.280 1.00 21.37  ? 116  TYR A CZ  1 
ATOM   1013 O  OH  . TYR A 1 116 ? -5.428  66.723 56.285 1.00 19.71  ? 116  TYR A OH  1 
ATOM   1014 N  N   . GLY A 1 117 ? 1.994   67.326 57.305 1.00 20.11  ? 117  GLY A N   1 
ATOM   1015 C  CA  . GLY A 1 117 ? 2.384   66.188 58.116 1.00 20.44  ? 117  GLY A CA  1 
ATOM   1016 C  C   . GLY A 1 117 ? 1.545   66.150 59.378 1.00 21.85  ? 117  GLY A C   1 
ATOM   1017 O  O   . GLY A 1 117 ? 0.501   66.807 59.462 1.00 20.68  ? 117  GLY A O   1 
ATOM   1018 N  N   . GLY A 1 118 ? 2.001   65.389 60.367 1.00 21.20  ? 118  GLY A N   1 
ATOM   1019 C  CA  . GLY A 1 118 ? 1.260   65.267 61.610 1.00 20.17  ? 118  GLY A CA  1 
ATOM   1020 C  C   . GLY A 1 118 ? 1.122   63.815 62.034 1.00 20.31  ? 118  GLY A C   1 
ATOM   1021 O  O   . GLY A 1 118 ? 0.145   63.441 62.677 1.00 20.32  ? 118  GLY A O   1 
ATOM   1022 N  N   . GLY A 1 119 ? 2.098   62.994 61.650 1.00 19.76  ? 119  GLY A N   1 
ATOM   1023 C  CA  . GLY A 1 119 ? 2.100   61.586 62.015 1.00 20.37  ? 119  GLY A CA  1 
ATOM   1024 C  C   . GLY A 1 119 ? 0.908   60.773 61.544 1.00 21.09  ? 119  GLY A C   1 
ATOM   1025 O  O   . GLY A 1 119 ? 0.644   59.689 62.078 1.00 20.46  ? 119  GLY A O   1 
ATOM   1026 N  N   . PHE A 1 120 ? 0.200   61.283 60.538 1.00 19.41  ? 120  PHE A N   1 
ATOM   1027 C  CA  . PHE A 1 120 ? -0.988  60.619 59.997 1.00 20.28  ? 120  PHE A CA  1 
ATOM   1028 C  C   . PHE A 1 120 ? -2.159  60.632 60.987 1.00 20.49  ? 120  PHE A C   1 
ATOM   1029 O  O   . PHE A 1 120 ? -3.207  60.049 60.713 1.00 21.37  ? 120  PHE A O   1 
ATOM   1030 C  CB  . PHE A 1 120 ? -0.674  59.165 59.593 1.00 19.77  ? 120  PHE A CB  1 
ATOM   1031 C  CG  . PHE A 1 120 ? 0.233   59.040 58.392 1.00 18.91  ? 120  PHE A CG  1 
ATOM   1032 C  CD1 . PHE A 1 120 ? -0.183  59.484 57.138 1.00 20.04  ? 120  PHE A CD1 1 
ATOM   1033 C  CD2 . PHE A 1 120 ? 1.495   58.462 58.512 1.00 18.34  ? 120  PHE A CD2 1 
ATOM   1034 C  CE1 . PHE A 1 120 ? 0.644   59.354 56.019 1.00 19.79  ? 120  PHE A CE1 1 
ATOM   1035 C  CE2 . PHE A 1 120 ? 2.335   58.326 57.394 1.00 19.04  ? 120  PHE A CE2 1 
ATOM   1036 C  CZ  . PHE A 1 120 ? 1.907   58.773 56.147 1.00 18.30  ? 120  PHE A CZ  1 
ATOM   1037 N  N   . TYR A 1 121 ? -1.988  61.288 62.134 1.00 20.22  ? 121  TYR A N   1 
ATOM   1038 C  CA  . TYR A 1 121 ? -3.065  61.360 63.126 1.00 21.95  ? 121  TYR A CA  1 
ATOM   1039 C  C   . TYR A 1 121 ? -3.571  62.796 63.301 1.00 22.59  ? 121  TYR A C   1 
ATOM   1040 O  O   . TYR A 1 121 ? -4.540  63.041 64.021 1.00 23.05  ? 121  TYR A O   1 
ATOM   1041 C  CB  . TYR A 1 121 ? -2.589  60.812 64.484 1.00 22.18  ? 121  TYR A CB  1 
ATOM   1042 C  CG  . TYR A 1 121 ? -1.556  61.670 65.190 1.00 23.55  ? 121  TYR A CG  1 
ATOM   1043 C  CD1 . TYR A 1 121 ? -1.936  62.778 65.952 1.00 23.47  ? 121  TYR A CD1 1 
ATOM   1044 C  CD2 . TYR A 1 121 ? -0.195  61.381 65.083 1.00 22.02  ? 121  TYR A CD2 1 
ATOM   1045 C  CE1 . TYR A 1 121 ? -0.983  63.578 66.590 1.00 23.47  ? 121  TYR A CE1 1 
ATOM   1046 C  CE2 . TYR A 1 121 ? 0.764   62.171 65.714 1.00 24.32  ? 121  TYR A CE2 1 
ATOM   1047 C  CZ  . TYR A 1 121 ? 0.362   63.268 66.465 1.00 25.53  ? 121  TYR A CZ  1 
ATOM   1048 O  OH  . TYR A 1 121 ? 1.315   64.052 67.076 1.00 28.04  ? 121  TYR A OH  1 
ATOM   1049 N  N   . SER A 1 122 ? -2.917  63.739 62.631 1.00 20.27  ? 122  SER A N   1 
ATOM   1050 C  CA  . SER A 1 122 ? -3.291  65.143 62.740 1.00 20.48  ? 122  SER A CA  1 
ATOM   1051 C  C   . SER A 1 122 ? -2.825  65.907 61.512 1.00 19.67  ? 122  SER A C   1 
ATOM   1052 O  O   . SER A 1 122 ? -2.184  65.340 60.626 1.00 18.98  ? 122  SER A O   1 
ATOM   1053 C  CB  . SER A 1 122 ? -2.640  65.753 63.982 1.00 19.74  ? 122  SER A CB  1 
ATOM   1054 O  OG  . SER A 1 122 ? -1.225  65.705 63.862 1.00 20.52  ? 122  SER A OG  1 
ATOM   1055 N  N   . GLY A 1 123 ? -3.147  67.197 61.469 1.00 19.76  ? 123  GLY A N   1 
ATOM   1056 C  CA  . GLY A 1 123 ? -2.736  68.019 60.347 1.00 19.28  ? 123  GLY A CA  1 
ATOM   1057 C  C   . GLY A 1 123 ? -3.884  68.783 59.719 1.00 20.97  ? 123  GLY A C   1 
ATOM   1058 O  O   . GLY A 1 123 ? -5.022  68.307 59.700 1.00 21.06  ? 123  GLY A O   1 
ATOM   1059 N  N   . SER A 1 124 ? -3.576  69.973 59.210 1.00 21.03  ? 124  SER A N   1 
ATOM   1060 C  CA  . SER A 1 124 ? -4.560  70.841 58.570 1.00 22.09  ? 124  SER A CA  1 
ATOM   1061 C  C   . SER A 1 124 ? -3.845  71.623 57.471 1.00 22.09  ? 124  SER A C   1 
ATOM   1062 O  O   . SER A 1 124 ? -2.668  71.945 57.597 1.00 22.98  ? 124  SER A O   1 
ATOM   1063 C  CB  . SER A 1 124 ? -5.149  71.828 59.587 1.00 21.51  ? 124  SER A CB  1 
ATOM   1064 O  OG  . SER A 1 124 ? -5.755  71.158 60.679 1.00 23.22  ? 124  SER A OG  1 
ATOM   1065 N  N   . SER A 1 125 ? -4.551  71.937 56.394 1.00 23.58  ? 125  SER A N   1 
ATOM   1066 C  CA  . SER A 1 125 ? -3.932  72.683 55.302 1.00 24.87  ? 125  SER A CA  1 
ATOM   1067 C  C   . SER A 1 125 ? -4.028  74.178 55.578 1.00 25.43  ? 125  SER A C   1 
ATOM   1068 O  O   . SER A 1 125 ? -3.394  74.993 54.906 1.00 26.16  ? 125  SER A O   1 
ATOM   1069 C  CB  . SER A 1 125 ? -4.660  72.386 53.994 1.00 25.05  ? 125  SER A CB  1 
ATOM   1070 O  OG  . SER A 1 125 ? -5.998  72.857 54.060 1.00 25.64  ? 125  SER A OG  1 
ATOM   1071 N  N   . THR A 1 126 ? -4.807  74.518 56.596 1.00 25.11  ? 126  THR A N   1 
ATOM   1072 C  CA  . THR A 1 126 ? -5.085  75.904 56.939 1.00 25.44  ? 126  THR A CA  1 
ATOM   1073 C  C   . THR A 1 126 ? -4.235  76.595 58.002 1.00 26.99  ? 126  THR A C   1 
ATOM   1074 O  O   . THR A 1 126 ? -4.505  77.748 58.342 1.00 25.70  ? 126  THR A O   1 
ATOM   1075 C  CB  . THR A 1 126 ? -6.556  76.019 57.346 1.00 25.67  ? 126  THR A CB  1 
ATOM   1076 O  OG1 . THR A 1 126 ? -6.785  75.218 58.511 1.00 24.01  ? 126  THR A OG1 1 
ATOM   1077 C  CG2 . THR A 1 126 ? -7.452  75.494 56.221 1.00 22.36  ? 126  THR A CG2 1 
ATOM   1078 N  N   . LEU A 1 127 ? -3.218  75.915 58.524 1.00 25.03  ? 127  LEU A N   1 
ATOM   1079 C  CA  . LEU A 1 127 ? -2.367  76.517 59.548 1.00 26.68  ? 127  LEU A CA  1 
ATOM   1080 C  C   . LEU A 1 127 ? -1.679  77.777 59.031 1.00 27.43  ? 127  LEU A C   1 
ATOM   1081 O  O   . LEU A 1 127 ? -1.341  77.870 57.850 1.00 27.06  ? 127  LEU A O   1 
ATOM   1082 C  CB  . LEU A 1 127 ? -1.304  75.522 60.014 1.00 24.79  ? 127  LEU A CB  1 
ATOM   1083 C  CG  . LEU A 1 127 ? -1.811  74.159 60.492 1.00 26.89  ? 127  LEU A CG  1 
ATOM   1084 C  CD1 . LEU A 1 127 ? -0.636  73.336 61.011 1.00 23.50  ? 127  LEU A CD1 1 
ATOM   1085 C  CD2 . LEU A 1 127 ? -2.855  74.344 61.581 1.00 25.61  ? 127  LEU A CD2 1 
ATOM   1086 N  N   . ASP A 1 128 ? -1.463  78.744 59.916 1.00 27.80  ? 128  ASP A N   1 
ATOM   1087 C  CA  . ASP A 1 128 ? -0.804  79.985 59.520 1.00 28.42  ? 128  ASP A CA  1 
ATOM   1088 C  C   . ASP A 1 128 ? 0.564   79.696 58.923 1.00 26.99  ? 128  ASP A C   1 
ATOM   1089 O  O   . ASP A 1 128 ? 1.002   80.367 57.989 1.00 26.11  ? 128  ASP A O   1 
ATOM   1090 C  CB  . ASP A 1 128 ? -0.632  80.924 60.718 1.00 30.50  ? 128  ASP A CB  1 
ATOM   1091 C  CG  . ASP A 1 128 ? -1.953  81.334 61.335 1.00 33.80  ? 128  ASP A CG  1 
ATOM   1092 O  OD1 . ASP A 1 128 ? -2.951  81.443 60.597 1.00 35.90  ? 128  ASP A OD1 1 
ATOM   1093 O  OD2 . ASP A 1 128 ? -1.989  81.563 62.561 1.00 40.59  ? 128  ASP A OD2 1 
ATOM   1094 N  N   . VAL A 1 129 ? 1.239   78.689 59.465 1.00 25.75  ? 129  VAL A N   1 
ATOM   1095 C  CA  . VAL A 1 129 ? 2.564   78.339 58.984 1.00 24.74  ? 129  VAL A CA  1 
ATOM   1096 C  C   . VAL A 1 129 ? 2.544   77.745 57.569 1.00 25.21  ? 129  VAL A C   1 
ATOM   1097 O  O   . VAL A 1 129 ? 3.594   77.623 56.933 1.00 26.06  ? 129  VAL A O   1 
ATOM   1098 C  CB  . VAL A 1 129 ? 3.268   77.369 59.974 1.00 26.27  ? 129  VAL A CB  1 
ATOM   1099 C  CG1 . VAL A 1 129 ? 2.591   76.007 59.960 1.00 25.89  ? 129  VAL A CG1 1 
ATOM   1100 C  CG2 . VAL A 1 129 ? 4.727   77.261 59.637 1.00 25.04  ? 129  VAL A CG2 1 
ATOM   1101 N  N   . TYR A 1 130 ? 1.359   77.384 57.073 1.00 23.38  ? 130  TYR A N   1 
ATOM   1102 C  CA  . TYR A 1 130 ? 1.248   76.838 55.716 1.00 23.94  ? 130  TYR A CA  1 
ATOM   1103 C  C   . TYR A 1 130 ? 0.632   77.845 54.741 1.00 25.07  ? 130  TYR A C   1 
ATOM   1104 O  O   . TYR A 1 130 ? 0.241   77.475 53.634 1.00 24.77  ? 130  TYR A O   1 
ATOM   1105 C  CB  . TYR A 1 130 ? 0.392   75.560 55.675 1.00 22.71  ? 130  TYR A CB  1 
ATOM   1106 C  CG  . TYR A 1 130 ? 0.860   74.423 56.560 1.00 20.85  ? 130  TYR A CG  1 
ATOM   1107 C  CD1 . TYR A 1 130 ? 2.210   74.260 56.884 1.00 20.18  ? 130  TYR A CD1 1 
ATOM   1108 C  CD2 . TYR A 1 130 ? -0.054  73.491 57.056 1.00 21.03  ? 130  TYR A CD2 1 
ATOM   1109 C  CE1 . TYR A 1 130 ? 2.637   73.191 57.689 1.00 21.11  ? 130  TYR A CE1 1 
ATOM   1110 C  CE2 . TYR A 1 130 ? 0.360   72.422 57.853 1.00 20.94  ? 130  TYR A CE2 1 
ATOM   1111 C  CZ  . TYR A 1 130 ? 1.702   72.279 58.167 1.00 20.54  ? 130  TYR A CZ  1 
ATOM   1112 O  OH  . TYR A 1 130 ? 2.099   71.227 58.965 1.00 22.28  ? 130  TYR A OH  1 
ATOM   1113 N  N   . ASN A 1 131 ? 0.526   79.107 55.150 1.00 24.97  ? 131  ASN A N   1 
ATOM   1114 C  CA  . ASN A 1 131 ? -0.043  80.127 54.269 1.00 27.99  ? 131  ASN A CA  1 
ATOM   1115 C  C   . ASN A 1 131 ? 0.842   80.209 53.025 1.00 25.98  ? 131  ASN A C   1 
ATOM   1116 O  O   . ASN A 1 131 ? 1.967   80.702 53.089 1.00 25.91  ? 131  ASN A O   1 
ATOM   1117 C  CB  . ASN A 1 131 ? -0.070  81.486 54.968 1.00 29.25  ? 131  ASN A CB  1 
ATOM   1118 C  CG  . ASN A 1 131 ? -0.954  82.488 54.250 1.00 32.62  ? 131  ASN A CG  1 
ATOM   1119 O  OD1 . ASN A 1 131 ? -1.069  82.469 53.024 1.00 32.28  ? 131  ASN A OD1 1 
ATOM   1120 N  ND2 . ASN A 1 131 ? -1.575  83.379 55.015 1.00 35.72  ? 131  ASN A ND2 1 
ATOM   1121 N  N   . GLY A 1 132 ? 0.328   79.740 51.893 1.00 25.47  ? 132  GLY A N   1 
ATOM   1122 C  CA  . GLY A 1 132 ? 1.125   79.737 50.679 1.00 25.11  ? 132  GLY A CA  1 
ATOM   1123 C  C   . GLY A 1 132 ? 1.275   81.030 49.896 1.00 25.60  ? 132  GLY A C   1 
ATOM   1124 O  O   . GLY A 1 132 ? 1.908   81.032 48.844 1.00 23.78  ? 132  GLY A O   1 
ATOM   1125 N  N   . LYS A 1 133 ? 0.728   82.132 50.397 1.00 26.68  ? 133  LYS A N   1 
ATOM   1126 C  CA  . LYS A 1 133 ? 0.811   83.387 49.655 1.00 27.78  ? 133  LYS A CA  1 
ATOM   1127 C  C   . LYS A 1 133 ? 2.217   83.962 49.503 1.00 27.65  ? 133  LYS A C   1 
ATOM   1128 O  O   . LYS A 1 133 ? 2.524   84.574 48.481 1.00 28.28  ? 133  LYS A O   1 
ATOM   1129 C  CB  . LYS A 1 133 ? -0.120  84.439 50.274 1.00 26.41  ? 133  LYS A CB  1 
ATOM   1130 C  CG  . LYS A 1 133 ? 0.352   85.041 51.586 1.00 28.55  ? 133  LYS A CG  1 
ATOM   1131 C  CD  . LYS A 1 133 ? -0.665  86.057 52.083 1.00 28.73  ? 133  LYS A CD  1 
ATOM   1132 C  CE  . LYS A 1 133 ? -0.194  86.756 53.342 1.00 31.69  ? 133  LYS A CE  1 
ATOM   1133 N  NZ  . LYS A 1 133 ? -1.209  87.733 53.832 1.00 31.58  ? 133  LYS A NZ  1 
ATOM   1134 N  N   . TYR A 1 134 ? 3.075   83.759 50.499 1.00 27.47  ? 134  TYR A N   1 
ATOM   1135 C  CA  . TYR A 1 134 ? 4.434   84.287 50.430 1.00 28.21  ? 134  TYR A CA  1 
ATOM   1136 C  C   . TYR A 1 134 ? 5.267   83.569 49.375 1.00 29.91  ? 134  TYR A C   1 
ATOM   1137 O  O   . TYR A 1 134 ? 5.991   84.203 48.606 1.00 28.99  ? 134  TYR A O   1 
ATOM   1138 C  CB  . TYR A 1 134 ? 5.119   84.164 51.793 1.00 29.82  ? 134  TYR A CB  1 
ATOM   1139 C  CG  . TYR A 1 134 ? 4.306   84.744 52.922 1.00 32.69  ? 134  TYR A CG  1 
ATOM   1140 C  CD1 . TYR A 1 134 ? 4.097   86.123 53.023 1.00 33.45  ? 134  TYR A CD1 1 
ATOM   1141 C  CD2 . TYR A 1 134 ? 3.706   83.915 53.868 1.00 33.61  ? 134  TYR A CD2 1 
ATOM   1142 C  CE1 . TYR A 1 134 ? 3.307   86.657 54.038 1.00 33.51  ? 134  TYR A CE1 1 
ATOM   1143 C  CE2 . TYR A 1 134 ? 2.915   84.438 54.887 1.00 34.70  ? 134  TYR A CE2 1 
ATOM   1144 C  CZ  . TYR A 1 134 ? 2.720   85.807 54.964 1.00 35.00  ? 134  TYR A CZ  1 
ATOM   1145 O  OH  . TYR A 1 134 ? 1.932   86.321 55.964 1.00 39.36  ? 134  TYR A OH  1 
ATOM   1146 N  N   . LEU A 1 135 ? 5.162   82.243 49.341 1.00 29.23  ? 135  LEU A N   1 
ATOM   1147 C  CA  . LEU A 1 135 ? 5.916   81.435 48.387 1.00 28.50  ? 135  LEU A CA  1 
ATOM   1148 C  C   . LEU A 1 135 ? 5.412   81.644 46.960 1.00 27.52  ? 135  LEU A C   1 
ATOM   1149 O  O   . LEU A 1 135 ? 6.202   81.805 46.033 1.00 27.40  ? 135  LEU A O   1 
ATOM   1150 C  CB  . LEU A 1 135 ? 5.822   79.953 48.779 1.00 29.96  ? 135  LEU A CB  1 
ATOM   1151 C  CG  . LEU A 1 135 ? 6.636   78.920 47.997 1.00 31.94  ? 135  LEU A CG  1 
ATOM   1152 C  CD1 . LEU A 1 135 ? 8.110   79.318 47.962 1.00 29.23  ? 135  LEU A CD1 1 
ATOM   1153 C  CD2 . LEU A 1 135 ? 6.465   77.553 48.661 1.00 30.39  ? 135  LEU A CD2 1 
ATOM   1154 N  N   . ALA A 1 136 ? 4.094   81.645 46.790 1.00 28.30  ? 136  ALA A N   1 
ATOM   1155 C  CA  . ALA A 1 136 ? 3.493   81.846 45.476 1.00 28.87  ? 136  ALA A CA  1 
ATOM   1156 C  C   . ALA A 1 136 ? 3.889   83.217 44.926 1.00 30.02  ? 136  ALA A C   1 
ATOM   1157 O  O   . ALA A 1 136 ? 4.303   83.347 43.772 1.00 30.29  ? 136  ALA A O   1 
ATOM   1158 C  CB  . ALA A 1 136 ? 1.974   81.741 45.578 1.00 27.37  ? 136  ALA A CB  1 
ATOM   1159 N  N   . TYR A 1 137 ? 3.761   84.236 45.767 1.00 31.52  ? 137  TYR A N   1 
ATOM   1160 C  CA  . TYR A 1 137 ? 4.100   85.599 45.378 1.00 31.21  ? 137  TYR A CA  1 
ATOM   1161 C  C   . TYR A 1 137 ? 5.582   85.768 45.064 1.00 30.42  ? 137  TYR A C   1 
ATOM   1162 O  O   . TYR A 1 137 ? 5.950   86.198 43.971 1.00 29.88  ? 137  TYR A O   1 
ATOM   1163 C  CB  . TYR A 1 137 ? 3.717   86.575 46.496 1.00 32.12  ? 137  TYR A CB  1 
ATOM   1164 C  CG  . TYR A 1 137 ? 4.208   87.987 46.263 1.00 33.06  ? 137  TYR A CG  1 
ATOM   1165 C  CD1 . TYR A 1 137 ? 3.662   88.779 45.252 1.00 34.89  ? 137  TYR A CD1 1 
ATOM   1166 C  CD2 . TYR A 1 137 ? 5.234   88.525 47.040 1.00 34.81  ? 137  TYR A CD2 1 
ATOM   1167 C  CE1 . TYR A 1 137 ? 4.125   90.072 45.020 1.00 36.97  ? 137  TYR A CE1 1 
ATOM   1168 C  CE2 . TYR A 1 137 ? 5.708   89.819 46.816 1.00 37.84  ? 137  TYR A CE2 1 
ATOM   1169 C  CZ  . TYR A 1 137 ? 5.147   90.585 45.804 1.00 38.59  ? 137  TYR A CZ  1 
ATOM   1170 O  OH  . TYR A 1 137 ? 5.607   91.860 45.574 1.00 41.26  ? 137  TYR A OH  1 
ATOM   1171 N  N   . THR A 1 138 ? 6.429   85.423 46.028 1.00 29.58  ? 138  THR A N   1 
ATOM   1172 C  CA  . THR A 1 138 ? 7.872   85.576 45.879 1.00 30.05  ? 138  THR A CA  1 
ATOM   1173 C  C   . THR A 1 138 ? 8.510   84.776 44.751 1.00 30.33  ? 138  THR A C   1 
ATOM   1174 O  O   . THR A 1 138 ? 9.330   85.306 44.002 1.00 30.71  ? 138  THR A O   1 
ATOM   1175 C  CB  . THR A 1 138 ? 8.602   85.220 47.192 1.00 30.35  ? 138  THR A CB  1 
ATOM   1176 O  OG1 . THR A 1 138 ? 8.093   86.029 48.258 1.00 28.55  ? 138  THR A OG1 1 
ATOM   1177 C  CG2 . THR A 1 138 ? 10.093  85.461 47.054 1.00 30.96  ? 138  THR A CG2 1 
ATOM   1178 N  N   . GLU A 1 139 ? 8.150   83.503 44.627 1.00 30.04  ? 139  GLU A N   1 
ATOM   1179 C  CA  . GLU A 1 139 ? 8.743   82.665 43.590 1.00 29.83  ? 139  GLU A CA  1 
ATOM   1180 C  C   . GLU A 1 139 ? 7.901   82.548 42.323 1.00 29.84  ? 139  GLU A C   1 
ATOM   1181 O  O   . GLU A 1 139 ? 8.303   81.898 41.358 1.00 29.71  ? 139  GLU A O   1 
ATOM   1182 C  CB  . GLU A 1 139 ? 9.041   81.275 44.157 1.00 30.40  ? 139  GLU A CB  1 
ATOM   1183 C  CG  . GLU A 1 139 ? 10.136  81.274 45.221 1.00 29.13  ? 139  GLU A CG  1 
ATOM   1184 C  CD  . GLU A 1 139 ? 11.448  81.847 44.710 1.00 29.55  ? 139  GLU A CD  1 
ATOM   1185 O  OE1 . GLU A 1 139 ? 11.903  81.421 43.629 1.00 30.32  ? 139  GLU A OE1 1 
ATOM   1186 O  OE2 . GLU A 1 139 ? 12.033  82.717 45.389 1.00 29.88  ? 139  GLU A OE2 1 
ATOM   1187 N  N   . GLU A 1 140 ? 6.736   83.185 42.331 1.00 30.98  ? 140  GLU A N   1 
ATOM   1188 C  CA  . GLU A 1 140 ? 5.838   83.171 41.182 1.00 32.99  ? 140  GLU A CA  1 
ATOM   1189 C  C   . GLU A 1 140 ? 5.455   81.764 40.739 1.00 31.64  ? 140  GLU A C   1 
ATOM   1190 O  O   . GLU A 1 140 ? 5.613   81.399 39.573 1.00 31.83  ? 140  GLU A O   1 
ATOM   1191 C  CB  . GLU A 1 140 ? 6.473   83.923 40.010 1.00 36.55  ? 140  GLU A CB  1 
ATOM   1192 C  CG  . GLU A 1 140 ? 7.012   85.293 40.388 1.00 43.73  ? 140  GLU A CG  1 
ATOM   1193 C  CD  . GLU A 1 140 ? 7.362   86.132 39.178 1.00 46.42  ? 140  GLU A CD  1 
ATOM   1194 O  OE1 . GLU A 1 140 ? 6.427   86.591 38.486 1.00 48.60  ? 140  GLU A OE1 1 
ATOM   1195 O  OE2 . GLU A 1 140 ? 8.568   86.324 38.915 1.00 48.73  ? 140  GLU A OE2 1 
ATOM   1196 N  N   . VAL A 1 141 ? 4.962   80.970 41.681 1.00 30.06  ? 141  VAL A N   1 
ATOM   1197 C  CA  . VAL A 1 141 ? 4.522   79.620 41.373 1.00 26.83  ? 141  VAL A CA  1 
ATOM   1198 C  C   . VAL A 1 141 ? 3.072   79.521 41.803 1.00 26.48  ? 141  VAL A C   1 
ATOM   1199 O  O   . VAL A 1 141 ? 2.588   80.349 42.581 1.00 26.20  ? 141  VAL A O   1 
ATOM   1200 C  CB  . VAL A 1 141 ? 5.327   78.538 42.152 1.00 26.83  ? 141  VAL A CB  1 
ATOM   1201 C  CG1 . VAL A 1 141 ? 6.805   78.636 41.814 1.00 26.25  ? 141  VAL A CG1 1 
ATOM   1202 C  CG2 . VAL A 1 141 ? 5.097   78.687 43.654 1.00 24.32  ? 141  VAL A CG2 1 
ATOM   1203 N  N   . VAL A 1 142 ? 2.372   78.529 41.271 1.00 25.98  ? 142  VAL A N   1 
ATOM   1204 C  CA  . VAL A 1 142 ? 0.991   78.289 41.657 1.00 25.12  ? 142  VAL A CA  1 
ATOM   1205 C  C   . VAL A 1 142 ? 1.172   77.309 42.819 1.00 25.76  ? 142  VAL A C   1 
ATOM   1206 O  O   . VAL A 1 142 ? 1.676   76.199 42.636 1.00 24.09  ? 142  VAL A O   1 
ATOM   1207 C  CB  . VAL A 1 142 ? 0.197   77.671 40.485 1.00 25.52  ? 142  VAL A CB  1 
ATOM   1208 C  CG1 . VAL A 1 142 ? -1.160  77.196 40.949 1.00 24.28  ? 142  VAL A CG1 1 
ATOM   1209 C  CG2 . VAL A 1 142 ? 0.012   78.727 39.387 1.00 23.98  ? 142  VAL A CG2 1 
ATOM   1210 N  N   A LEU A 1 143 ? 0.785   77.731 44.017 0.50 25.81  ? 143  LEU A N   1 
ATOM   1211 N  N   B LEU A 1 143 ? 0.769   77.736 44.012 0.50 25.09  ? 143  LEU A N   1 
ATOM   1212 C  CA  A LEU A 1 143 ? 0.938   76.885 45.196 0.50 25.56  ? 143  LEU A CA  1 
ATOM   1213 C  CA  B LEU A 1 143 ? 0.917   76.930 45.222 0.50 24.39  ? 143  LEU A CA  1 
ATOM   1214 C  C   A LEU A 1 143 ? -0.379  76.300 45.681 0.50 25.29  ? 143  LEU A C   1 
ATOM   1215 C  C   B LEU A 1 143 ? -0.397  76.303 45.680 0.50 24.50  ? 143  LEU A C   1 
ATOM   1216 O  O   A LEU A 1 143 ? -1.320  77.027 46.003 0.50 25.96  ? 143  LEU A O   1 
ATOM   1217 O  O   B LEU A 1 143 ? -1.361  77.009 45.982 0.50 25.21  ? 143  LEU A O   1 
ATOM   1218 C  CB  A LEU A 1 143 ? 1.603   77.678 46.324 0.50 26.05  ? 143  LEU A CB  1 
ATOM   1219 C  CB  B LEU A 1 143 ? 1.487   77.810 46.343 0.50 23.09  ? 143  LEU A CB  1 
ATOM   1220 C  CG  A LEU A 1 143 ? 1.881   76.929 47.630 0.50 28.22  ? 143  LEU A CG  1 
ATOM   1221 C  CG  B LEU A 1 143 ? 2.110   77.193 47.601 0.50 24.14  ? 143  LEU A CG  1 
ATOM   1222 C  CD1 A LEU A 1 143 ? 2.600   75.616 47.345 0.50 27.58  ? 143  LEU A CD1 1 
ATOM   1223 C  CD1 B LEU A 1 143 ? 1.082   76.359 48.353 0.50 19.79  ? 143  LEU A CD1 1 
ATOM   1224 C  CD2 A LEU A 1 143 ? 2.718   77.811 48.539 0.50 27.04  ? 143  LEU A CD2 1 
ATOM   1225 C  CD2 B LEU A 1 143 ? 3.314   76.350 47.204 0.50 22.45  ? 143  LEU A CD2 1 
ATOM   1226 N  N   . VAL A 1 144 ? -0.432  74.975 45.731 1.00 24.82  ? 144  VAL A N   1 
ATOM   1227 C  CA  . VAL A 1 144 ? -1.625  74.262 46.168 1.00 22.88  ? 144  VAL A CA  1 
ATOM   1228 C  C   . VAL A 1 144 ? -1.355  73.519 47.478 1.00 23.16  ? 144  VAL A C   1 
ATOM   1229 O  O   . VAL A 1 144 ? -0.268  72.977 47.680 1.00 22.89  ? 144  VAL A O   1 
ATOM   1230 C  CB  . VAL A 1 144 ? -2.070  73.194 45.121 1.00 23.88  ? 144  VAL A CB  1 
ATOM   1231 C  CG1 . VAL A 1 144 ? -3.323  72.467 45.613 1.00 22.42  ? 144  VAL A CG1 1 
ATOM   1232 C  CG2 . VAL A 1 144 ? -2.329  73.845 43.763 1.00 22.14  ? 144  VAL A CG2 1 
ATOM   1233 N  N   . SER A 1 145 ? -2.335  73.521 48.373 1.00 23.02  ? 145  SER A N   1 
ATOM   1234 C  CA  . SER A 1 145 ? -2.223  72.761 49.611 1.00 22.96  ? 145  SER A CA  1 
ATOM   1235 C  C   . SER A 1 145 ? -3.479  71.898 49.618 1.00 23.90  ? 145  SER A C   1 
ATOM   1236 O  O   . SER A 1 145 ? -4.595  72.398 49.453 1.00 21.51  ? 145  SER A O   1 
ATOM   1237 C  CB  . SER A 1 145 ? -2.167  73.668 50.852 1.00 23.09  ? 145  SER A CB  1 
ATOM   1238 O  OG  . SER A 1 145 ? -3.352  74.424 51.033 1.00 25.25  ? 145  SER A OG  1 
ATOM   1239 N  N   . LEU A 1 146 ? -3.293  70.591 49.757 1.00 23.96  ? 146  LEU A N   1 
ATOM   1240 C  CA  . LEU A 1 146 ? -4.422  69.674 49.771 1.00 23.69  ? 146  LEU A CA  1 
ATOM   1241 C  C   . LEU A 1 146 ? -4.719  69.231 51.192 1.00 24.06  ? 146  LEU A C   1 
ATOM   1242 O  O   . LEU A 1 146 ? -4.097  69.702 52.143 1.00 23.90  ? 146  LEU A O   1 
ATOM   1243 C  CB  . LEU A 1 146 ? -4.120  68.456 48.881 1.00 22.88  ? 146  LEU A CB  1 
ATOM   1244 C  CG  . LEU A 1 146 ? -2.837  67.645 49.120 1.00 23.34  ? 146  LEU A CG  1 
ATOM   1245 C  CD1 . LEU A 1 146 ? -2.944  66.861 50.432 1.00 22.61  ? 146  LEU A CD1 1 
ATOM   1246 C  CD2 . LEU A 1 146 ? -2.620  66.680 47.948 1.00 23.17  ? 146  LEU A CD2 1 
ATOM   1247 N  N   . SER A 1 147 ? -5.690  68.338 51.335 1.00 23.79  ? 147  SER A N   1 
ATOM   1248 C  CA  . SER A 1 147 ? -6.041  67.805 52.640 1.00 24.63  ? 147  SER A CA  1 
ATOM   1249 C  C   . SER A 1 147 ? -6.340  66.325 52.458 1.00 23.67  ? 147  SER A C   1 
ATOM   1250 O  O   . SER A 1 147 ? -6.532  65.858 51.335 1.00 22.76  ? 147  SER A O   1 
ATOM   1251 C  CB  . SER A 1 147 ? -7.266  68.524 53.219 1.00 25.17  ? 147  SER A CB  1 
ATOM   1252 O  OG  . SER A 1 147 ? -8.436  68.232 52.478 1.00 29.50  ? 147  SER A OG  1 
ATOM   1253 N  N   . TYR A 1 148 ? -6.355  65.589 53.561 1.00 22.22  ? 148  TYR A N   1 
ATOM   1254 C  CA  . TYR A 1 148 ? -6.634  64.161 53.526 1.00 21.51  ? 148  TYR A CA  1 
ATOM   1255 C  C   . TYR A 1 148 ? -7.029  63.709 54.921 1.00 21.21  ? 148  TYR A C   1 
ATOM   1256 O  O   . TYR A 1 148 ? -6.597  64.291 55.920 1.00 20.90  ? 148  TYR A O   1 
ATOM   1257 C  CB  . TYR A 1 148 ? -5.407  63.364 53.042 1.00 18.19  ? 148  TYR A CB  1 
ATOM   1258 C  CG  . TYR A 1 148 ? -4.158  63.507 53.897 1.00 21.13  ? 148  TYR A CG  1 
ATOM   1259 C  CD1 . TYR A 1 148 ? -3.304  64.605 53.751 1.00 19.39  ? 148  TYR A CD1 1 
ATOM   1260 C  CD2 . TYR A 1 148 ? -3.830  62.543 54.854 1.00 20.39  ? 148  TYR A CD2 1 
ATOM   1261 C  CE1 . TYR A 1 148 ? -2.152  64.737 54.543 1.00 20.48  ? 148  TYR A CE1 1 
ATOM   1262 C  CE2 . TYR A 1 148 ? -2.681  62.668 55.649 1.00 20.87  ? 148  TYR A CE2 1 
ATOM   1263 C  CZ  . TYR A 1 148 ? -1.851  63.765 55.488 1.00 21.61  ? 148  TYR A CZ  1 
ATOM   1264 O  OH  . TYR A 1 148 ? -0.724  63.889 56.275 1.00 22.32  ? 148  TYR A OH  1 
ATOM   1265 N  N   . ARG A 1 149 ? -7.864  62.679 54.986 1.00 20.99  ? 149  ARG A N   1 
ATOM   1266 C  CA  . ARG A 1 149 ? -8.320  62.156 56.265 1.00 22.38  ? 149  ARG A CA  1 
ATOM   1267 C  C   . ARG A 1 149 ? -7.151  61.581 57.050 1.00 21.56  ? 149  ARG A C   1 
ATOM   1268 O  O   . ARG A 1 149 ? -6.272  60.930 56.485 1.00 21.65  ? 149  ARG A O   1 
ATOM   1269 C  CB  . ARG A 1 149 ? -9.377  61.071 56.047 1.00 19.91  ? 149  ARG A CB  1 
ATOM   1270 C  CG  . ARG A 1 149 ? -10.729 61.593 55.564 1.00 22.25  ? 149  ARG A CG  1 
ATOM   1271 C  CD  . ARG A 1 149 ? -11.634 60.443 55.105 1.00 21.93  ? 149  ARG A CD  1 
ATOM   1272 N  NE  . ARG A 1 149 ? -11.308 60.000 53.750 1.00 21.62  ? 149  ARG A NE  1 
ATOM   1273 C  CZ  . ARG A 1 149 ? -11.860 58.948 53.147 1.00 22.26  ? 149  ARG A CZ  1 
ATOM   1274 N  NH1 . ARG A 1 149 ? -12.768 58.215 53.781 1.00 19.54  ? 149  ARG A NH1 1 
ATOM   1275 N  NH2 . ARG A 1 149 ? -11.513 58.635 51.902 1.00 20.54  ? 149  ARG A NH2 1 
ATOM   1276 N  N   . VAL A 1 150 ? -7.147  61.832 58.355 1.00 21.65  ? 150  VAL A N   1 
ATOM   1277 C  CA  . VAL A 1 150 ? -6.101  61.326 59.231 1.00 21.11  ? 150  VAL A CA  1 
ATOM   1278 C  C   . VAL A 1 150 ? -6.739  60.428 60.288 1.00 21.58  ? 150  VAL A C   1 
ATOM   1279 O  O   . VAL A 1 150 ? -7.964  60.298 60.344 1.00 21.44  ? 150  VAL A O   1 
ATOM   1280 C  CB  . VAL A 1 150 ? -5.332  62.489 59.921 1.00 22.50  ? 150  VAL A CB  1 
ATOM   1281 C  CG1 . VAL A 1 150 ? -4.608  63.319 58.871 1.00 20.61  ? 150  VAL A CG1 1 
ATOM   1282 C  CG2 . VAL A 1 150 ? -6.297  63.372 60.713 1.00 20.85  ? 150  VAL A CG2 1 
ATOM   1283 N  N   . GLY A 1 151 ? -5.908  59.805 61.120 1.00 21.00  ? 151  GLY A N   1 
ATOM   1284 C  CA  . GLY A 1 151 ? -6.421  58.928 62.160 1.00 20.50  ? 151  GLY A CA  1 
ATOM   1285 C  C   . GLY A 1 151 ? -7.190  57.741 61.605 1.00 20.96  ? 151  GLY A C   1 
ATOM   1286 O  O   . GLY A 1 151 ? -6.957  57.312 60.475 1.00 20.63  ? 151  GLY A O   1 
ATOM   1287 N  N   . ALA A 1 152 ? -8.115  57.207 62.398 1.00 21.17  ? 152  ALA A N   1 
ATOM   1288 C  CA  . ALA A 1 152 ? -8.907  56.057 61.969 1.00 22.08  ? 152  ALA A CA  1 
ATOM   1289 C  C   . ALA A 1 152 ? -9.719  56.387 60.714 1.00 22.30  ? 152  ALA A C   1 
ATOM   1290 O  O   . ALA A 1 152 ? -9.920  55.533 59.847 1.00 22.83  ? 152  ALA A O   1 
ATOM   1291 C  CB  . ALA A 1 152 ? -9.838  55.605 63.108 1.00 22.67  ? 152  ALA A CB  1 
ATOM   1292 N  N   . PHE A 1 153 ? -10.169 57.633 60.618 1.00 21.86  ? 153  PHE A N   1 
ATOM   1293 C  CA  . PHE A 1 153 ? -10.968 58.087 59.480 1.00 22.68  ? 153  PHE A CA  1 
ATOM   1294 C  C   . PHE A 1 153 ? -10.237 57.903 58.156 1.00 22.77  ? 153  PHE A C   1 
ATOM   1295 O  O   . PHE A 1 153 ? -10.852 57.586 57.135 1.00 21.42  ? 153  PHE A O   1 
ATOM   1296 C  CB  . PHE A 1 153 ? -11.338 59.560 59.664 1.00 22.89  ? 153  PHE A CB  1 
ATOM   1297 C  CG  . PHE A 1 153 ? -12.043 59.841 60.959 1.00 25.14  ? 153  PHE A CG  1 
ATOM   1298 C  CD1 . PHE A 1 153 ? -13.418 59.641 61.078 1.00 24.76  ? 153  PHE A CD1 1 
ATOM   1299 C  CD2 . PHE A 1 153 ? -11.322 60.255 62.079 1.00 23.66  ? 153  PHE A CD2 1 
ATOM   1300 C  CE1 . PHE A 1 153 ? -14.067 59.847 62.295 1.00 24.73  ? 153  PHE A CE1 1 
ATOM   1301 C  CE2 . PHE A 1 153 ? -11.956 60.461 63.300 1.00 24.04  ? 153  PHE A CE2 1 
ATOM   1302 C  CZ  . PHE A 1 153 ? -13.332 60.257 63.411 1.00 27.78  ? 153  PHE A CZ  1 
ATOM   1303 N  N   . GLY A 1 154 ? -8.922  58.094 58.170 1.00 20.85  ? 154  GLY A N   1 
ATOM   1304 C  CA  . GLY A 1 154 ? -8.170  57.941 56.941 1.00 22.03  ? 154  GLY A CA  1 
ATOM   1305 C  C   . GLY A 1 154 ? -7.328  56.684 56.825 1.00 21.80  ? 154  GLY A C   1 
ATOM   1306 O  O   . GLY A 1 154 ? -6.903  56.333 55.724 1.00 22.45  ? 154  GLY A O   1 
ATOM   1307 N  N   . PHE A 1 155 ? -7.100  55.981 57.931 1.00 20.54  ? 155  PHE A N   1 
ATOM   1308 C  CA  . PHE A 1 155 ? -6.243  54.808 57.864 1.00 20.98  ? 155  PHE A CA  1 
ATOM   1309 C  C   . PHE A 1 155 ? -6.672  53.525 58.579 1.00 21.37  ? 155  PHE A C   1 
ATOM   1310 O  O   . PHE A 1 155 ? -5.892  52.573 58.661 1.00 21.37  ? 155  PHE A O   1 
ATOM   1311 C  CB  . PHE A 1 155 ? -4.828  55.229 58.284 1.00 19.98  ? 155  PHE A CB  1 
ATOM   1312 C  CG  . PHE A 1 155 ? -4.224  56.263 57.364 1.00 22.23  ? 155  PHE A CG  1 
ATOM   1313 C  CD1 . PHE A 1 155 ? -3.658  55.885 56.148 1.00 18.80  ? 155  PHE A CD1 1 
ATOM   1314 C  CD2 . PHE A 1 155 ? -4.309  57.620 57.668 1.00 22.41  ? 155  PHE A CD2 1 
ATOM   1315 C  CE1 . PHE A 1 155 ? -3.191  56.843 55.244 1.00 21.23  ? 155  PHE A CE1 1 
ATOM   1316 C  CE2 . PHE A 1 155 ? -3.847  58.587 56.770 1.00 22.34  ? 155  PHE A CE2 1 
ATOM   1317 C  CZ  . PHE A 1 155 ? -3.287  58.196 55.554 1.00 20.86  ? 155  PHE A CZ  1 
ATOM   1318 N  N   . LEU A 1 156 ? -7.898  53.483 59.094 1.00 22.85  ? 156  LEU A N   1 
ATOM   1319 C  CA  . LEU A 1 156 ? -8.377  52.260 59.737 1.00 23.90  ? 156  LEU A CA  1 
ATOM   1320 C  C   . LEU A 1 156 ? -8.226  51.208 58.638 1.00 26.00  ? 156  LEU A C   1 
ATOM   1321 O  O   . LEU A 1 156 ? -8.666  51.435 57.509 1.00 26.69  ? 156  LEU A O   1 
ATOM   1322 C  CB  . LEU A 1 156 ? -9.853  52.381 60.115 1.00 25.59  ? 156  LEU A CB  1 
ATOM   1323 C  CG  . LEU A 1 156 ? -10.440 51.122 60.761 1.00 27.41  ? 156  LEU A CG  1 
ATOM   1324 C  CD1 . LEU A 1 156 ? -10.233 51.183 62.268 1.00 26.58  ? 156  LEU A CD1 1 
ATOM   1325 C  CD2 . LEU A 1 156 ? -11.925 51.019 60.441 1.00 28.32  ? 156  LEU A CD2 1 
ATOM   1326 N  N   . ALA A 1 157 ? -7.611  50.070 58.948 1.00 25.30  ? 157  ALA A N   1 
ATOM   1327 C  CA  . ALA A 1 157 ? -7.399  49.053 57.925 1.00 25.91  ? 157  ALA A CA  1 
ATOM   1328 C  C   . ALA A 1 157 ? -7.832  47.633 58.279 1.00 27.11  ? 157  ALA A C   1 
ATOM   1329 O  O   . ALA A 1 157 ? -7.287  47.009 59.189 1.00 26.48  ? 157  ALA A O   1 
ATOM   1330 C  CB  . ALA A 1 157 ? -5.927  49.047 57.509 1.00 23.00  ? 157  ALA A CB  1 
ATOM   1331 N  N   . LEU A 1 158 ? -8.819  47.137 57.541 1.00 28.36  ? 158  LEU A N   1 
ATOM   1332 C  CA  . LEU A 1 158 ? -9.322  45.778 57.709 1.00 29.34  ? 158  LEU A CA  1 
ATOM   1333 C  C   . LEU A 1 158 ? -9.169  45.151 56.327 1.00 30.99  ? 158  LEU A C   1 
ATOM   1334 O  O   . LEU A 1 158 ? -10.139 45.008 55.579 1.00 30.08  ? 158  LEU A O   1 
ATOM   1335 C  CB  . LEU A 1 158 ? -10.790 45.794 58.151 1.00 29.10  ? 158  LEU A CB  1 
ATOM   1336 C  CG  . LEU A 1 158 ? -11.002 46.197 59.617 1.00 30.67  ? 158  LEU A CG  1 
ATOM   1337 C  CD1 . LEU A 1 158 ? -12.464 46.520 59.875 1.00 30.13  ? 158  LEU A CD1 1 
ATOM   1338 C  CD2 . LEU A 1 158 ? -10.524 45.068 60.530 1.00 30.07  ? 158  LEU A CD2 1 
ATOM   1339 N  N   . HIS A 1 159 ? -7.927  44.807 55.991 1.00 31.40  ? 159  HIS A N   1 
ATOM   1340 C  CA  . HIS A 1 159 ? -7.601  44.226 54.694 1.00 33.75  ? 159  HIS A CA  1 
ATOM   1341 C  C   . HIS A 1 159 ? -8.532  43.084 54.316 1.00 34.73  ? 159  HIS A C   1 
ATOM   1342 O  O   . HIS A 1 159 ? -8.778  42.177 55.111 1.00 34.47  ? 159  HIS A O   1 
ATOM   1343 C  CB  . HIS A 1 159 ? -6.151  43.736 54.677 1.00 33.04  ? 159  HIS A CB  1 
ATOM   1344 C  CG  . HIS A 1 159 ? -5.672  43.327 53.319 1.00 35.60  ? 159  HIS A CG  1 
ATOM   1345 N  ND1 . HIS A 1 159 ? -5.633  44.199 52.252 1.00 34.24  ? 159  HIS A ND1 1 
ATOM   1346 C  CD2 . HIS A 1 159 ? -5.221  42.139 52.850 1.00 35.23  ? 159  HIS A CD2 1 
ATOM   1347 C  CE1 . HIS A 1 159 ? -5.179  43.566 51.185 1.00 34.60  ? 159  HIS A CE1 1 
ATOM   1348 N  NE2 . HIS A 1 159 ? -4.921  42.315 51.521 1.00 35.13  ? 159  HIS A NE2 1 
ATOM   1349 N  N   . GLY A 1 160 ? -9.037  43.137 53.088 1.00 35.75  ? 160  GLY A N   1 
ATOM   1350 C  CA  . GLY A 1 160 ? -9.953  42.118 52.613 1.00 36.60  ? 160  GLY A CA  1 
ATOM   1351 C  C   . GLY A 1 160 ? -11.320 42.748 52.451 1.00 38.36  ? 160  GLY A C   1 
ATOM   1352 O  O   . GLY A 1 160 ? -12.119 42.334 51.614 1.00 38.39  ? 160  GLY A O   1 
ATOM   1353 N  N   . SER A 1 161 ? -11.580 43.766 53.264 1.00 37.97  ? 161  SER A N   1 
ATOM   1354 C  CA  . SER A 1 161 ? -12.843 44.484 53.224 1.00 38.52  ? 161  SER A CA  1 
ATOM   1355 C  C   . SER A 1 161 ? -12.750 45.641 52.240 1.00 39.61  ? 161  SER A C   1 
ATOM   1356 O  O   . SER A 1 161 ? -11.686 46.239 52.076 1.00 41.16  ? 161  SER A O   1 
ATOM   1357 C  CB  . SER A 1 161 ? -13.176 45.027 54.614 1.00 39.76  ? 161  SER A CB  1 
ATOM   1358 O  OG  . SER A 1 161 ? -14.253 45.942 54.554 1.00 41.04  ? 161  SER A OG  1 
ATOM   1359 N  N   . GLN A 1 162 ? -13.859 45.954 51.582 1.00 38.67  ? 162  GLN A N   1 
ATOM   1360 C  CA  . GLN A 1 162 ? -13.884 47.058 50.634 1.00 39.23  ? 162  GLN A CA  1 
ATOM   1361 C  C   . GLN A 1 162 ? -14.527 48.281 51.280 1.00 37.22  ? 162  GLN A C   1 
ATOM   1362 O  O   . GLN A 1 162 ? -14.565 49.362 50.692 1.00 37.72  ? 162  GLN A O   1 
ATOM   1363 C  CB  . GLN A 1 162 ? -14.653 46.666 49.370 1.00 43.28  ? 162  GLN A CB  1 
ATOM   1364 C  CG  . GLN A 1 162 ? -13.912 45.674 48.485 1.00 49.70  ? 162  GLN A CG  1 
ATOM   1365 C  CD  . GLN A 1 162 ? -12.531 46.171 48.085 1.00 53.74  ? 162  GLN A CD  1 
ATOM   1366 O  OE1 . GLN A 1 162 ? -12.384 47.280 47.564 1.00 55.91  ? 162  GLN A OE1 1 
ATOM   1367 N  NE2 . GLN A 1 162 ? -11.512 45.351 48.325 1.00 55.24  ? 162  GLN A NE2 1 
ATOM   1368 N  N   . GLU A 1 163 ? -15.029 48.099 52.497 1.00 35.03  ? 163  GLU A N   1 
ATOM   1369 C  CA  . GLU A 1 163 ? -15.665 49.181 53.237 1.00 34.87  ? 163  GLU A CA  1 
ATOM   1370 C  C   . GLU A 1 163 ? -14.630 49.966 54.050 1.00 33.26  ? 163  GLU A C   1 
ATOM   1371 O  O   . GLU A 1 163 ? -14.790 51.162 54.279 1.00 33.81  ? 163  GLU A O   1 
ATOM   1372 C  CB  . GLU A 1 163 ? -16.752 48.613 54.157 1.00 37.16  ? 163  GLU A CB  1 
ATOM   1373 C  CG  . GLU A 1 163 ? -17.894 47.946 53.401 1.00 38.76  ? 163  GLU A CG  1 
ATOM   1374 C  CD  . GLU A 1 163 ? -18.681 48.927 52.551 1.00 42.26  ? 163  GLU A CD  1 
ATOM   1375 O  OE1 . GLU A 1 163 ? -19.355 48.484 51.595 1.00 44.32  ? 163  GLU A OE1 1 
ATOM   1376 O  OE2 . GLU A 1 163 ? -18.636 50.142 52.841 1.00 41.64  ? 163  GLU A OE2 1 
ATOM   1377 N  N   . ALA A 1 164 ? -13.574 49.279 54.482 1.00 30.50  ? 164  ALA A N   1 
ATOM   1378 C  CA  . ALA A 1 164 ? -12.483 49.893 55.246 1.00 29.17  ? 164  ALA A CA  1 
ATOM   1379 C  C   . ALA A 1 164 ? -11.198 49.171 54.845 1.00 27.13  ? 164  ALA A C   1 
ATOM   1380 O  O   . ALA A 1 164 ? -10.602 48.447 55.643 1.00 28.91  ? 164  ALA A O   1 
ATOM   1381 C  CB  . ALA A 1 164 ? -12.731 49.742 56.746 1.00 27.55  ? 164  ALA A CB  1 
ATOM   1382 N  N   . PRO A 1 165 ? -10.755 49.365 53.591 1.00 26.67  ? 165  PRO A N   1 
ATOM   1383 C  CA  . PRO A 1 165 ? -9.547  48.738 53.049 1.00 26.30  ? 165  PRO A CA  1 
ATOM   1384 C  C   . PRO A 1 165 ? -8.222  49.279 53.565 1.00 27.21  ? 165  PRO A C   1 
ATOM   1385 O  O   . PRO A 1 165 ? -7.194  48.612 53.451 1.00 28.23  ? 165  PRO A O   1 
ATOM   1386 C  CB  . PRO A 1 165 ? -9.696  48.968 51.554 1.00 27.33  ? 165  PRO A CB  1 
ATOM   1387 C  CG  . PRO A 1 165 ? -10.304 50.345 51.515 1.00 26.13  ? 165  PRO A CG  1 
ATOM   1388 C  CD  . PRO A 1 165 ? -11.384 50.239 52.580 1.00 26.75  ? 165  PRO A CD  1 
ATOM   1389 N  N   . GLY A 1 166 ? -8.247  50.483 54.130 1.00 26.91  ? 166  GLY A N   1 
ATOM   1390 C  CA  . GLY A 1 166 ? -7.020  51.091 54.611 1.00 24.12  ? 166  GLY A CA  1 
ATOM   1391 C  C   . GLY A 1 166 ? -6.470  52.017 53.535 1.00 24.80  ? 166  GLY A C   1 
ATOM   1392 O  O   . GLY A 1 166 ? -6.937  51.986 52.390 1.00 23.41  ? 166  GLY A O   1 
ATOM   1393 N  N   . ASN A 1 167 ? -5.496  52.847 53.901 1.00 22.23  ? 167  ASN A N   1 
ATOM   1394 C  CA  . ASN A 1 167 ? -4.861  53.786 52.973 1.00 21.91  ? 167  ASN A CA  1 
ATOM   1395 C  C   . ASN A 1 167 ? -5.772  54.816 52.314 1.00 20.84  ? 167  ASN A C   1 
ATOM   1396 O  O   . ASN A 1 167 ? -5.344  55.483 51.376 1.00 20.65  ? 167  ASN A O   1 
ATOM   1397 C  CB  . ASN A 1 167 ? -4.132  53.029 51.851 1.00 22.52  ? 167  ASN A CB  1 
ATOM   1398 C  CG  . ASN A 1 167 ? -2.962  52.217 52.362 1.00 24.32  ? 167  ASN A CG  1 
ATOM   1399 O  OD1 . ASN A 1 167 ? -2.356  52.565 53.373 1.00 23.20  ? 167  ASN A OD1 1 
ATOM   1400 N  ND2 . ASN A 1 167 ? -2.626  51.137 51.656 1.00 20.74  ? 167  ASN A ND2 1 
ATOM   1401 N  N   . VAL A 1 168 ? -7.004  54.980 52.787 1.00 20.40  ? 168  VAL A N   1 
ATOM   1402 C  CA  . VAL A 1 168 ? -7.879  55.937 52.114 1.00 22.35  ? 168  VAL A CA  1 
ATOM   1403 C  C   . VAL A 1 168 ? -7.405  57.383 52.222 1.00 22.07  ? 168  VAL A C   1 
ATOM   1404 O  O   . VAL A 1 168 ? -7.718  58.208 51.358 1.00 21.92  ? 168  VAL A O   1 
ATOM   1405 C  CB  . VAL A 1 168 ? -9.361  55.784 52.565 1.00 22.90  ? 168  VAL A CB  1 
ATOM   1406 C  CG1 . VAL A 1 168 ? -9.822  54.349 52.275 1.00 21.84  ? 168  VAL A CG1 1 
ATOM   1407 C  CG2 . VAL A 1 168 ? -9.530  56.117 54.035 1.00 20.79  ? 168  VAL A CG2 1 
ATOM   1408 N  N   . GLY A 1 169 ? -6.631  57.686 53.262 1.00 20.91  ? 169  GLY A N   1 
ATOM   1409 C  CA  . GLY A 1 169 ? -6.092  59.028 53.404 1.00 19.99  ? 169  GLY A CA  1 
ATOM   1410 C  C   . GLY A 1 169 ? -5.115  59.274 52.262 1.00 20.65  ? 169  GLY A C   1 
ATOM   1411 O  O   . GLY A 1 169 ? -5.033  60.381 51.721 1.00 20.24  ? 169  GLY A O   1 
ATOM   1412 N  N   . LEU A 1 170 ? -4.359  58.242 51.890 1.00 19.60  ? 170  LEU A N   1 
ATOM   1413 C  CA  . LEU A 1 170 ? -3.410  58.376 50.782 1.00 19.86  ? 170  LEU A CA  1 
ATOM   1414 C  C   . LEU A 1 170 ? -4.180  58.526 49.474 1.00 20.06  ? 170  LEU A C   1 
ATOM   1415 O  O   . LEU A 1 170 ? -3.746  59.234 48.562 1.00 19.91  ? 170  LEU A O   1 
ATOM   1416 C  CB  . LEU A 1 170 ? -2.480  57.161 50.707 1.00 17.96  ? 170  LEU A CB  1 
ATOM   1417 C  CG  . LEU A 1 170 ? -1.363  57.139 51.762 1.00 18.82  ? 170  LEU A CG  1 
ATOM   1418 C  CD1 . LEU A 1 170 ? -0.689  55.777 51.786 1.00 18.35  ? 170  LEU A CD1 1 
ATOM   1419 C  CD2 . LEU A 1 170 ? -0.340  58.233 51.441 1.00 18.96  ? 170  LEU A CD2 1 
ATOM   1420 N  N   . LEU A 1 171 ? -5.324  57.858 49.381 1.00 19.91  ? 171  LEU A N   1 
ATOM   1421 C  CA  . LEU A 1 171 ? -6.144  57.961 48.181 1.00 20.89  ? 171  LEU A CA  1 
ATOM   1422 C  C   . LEU A 1 171 ? -6.760  59.362 48.096 1.00 20.84  ? 171  LEU A C   1 
ATOM   1423 O  O   . LEU A 1 171 ? -7.003  59.872 47.001 1.00 21.34  ? 171  LEU A O   1 
ATOM   1424 C  CB  . LEU A 1 171 ? -7.219  56.870 48.179 1.00 21.25  ? 171  LEU A CB  1 
ATOM   1425 C  CG  . LEU A 1 171 ? -6.642  55.450 48.055 1.00 22.08  ? 171  LEU A CG  1 
ATOM   1426 C  CD1 . LEU A 1 171 ? -7.767  54.422 48.115 1.00 21.50  ? 171  LEU A CD1 1 
ATOM   1427 C  CD2 . LEU A 1 171 ? -5.864  55.317 46.741 1.00 23.16  ? 171  LEU A CD2 1 
ATOM   1428 N  N   . ASP A 1 172 ? -7.008  59.985 49.249 1.00 22.28  ? 172  ASP A N   1 
ATOM   1429 C  CA  . ASP A 1 172 ? -7.542  61.351 49.274 1.00 22.08  ? 172  ASP A CA  1 
ATOM   1430 C  C   . ASP A 1 172 ? -6.489  62.245 48.620 1.00 22.47  ? 172  ASP A C   1 
ATOM   1431 O  O   . ASP A 1 172 ? -6.797  63.085 47.769 1.00 21.12  ? 172  ASP A O   1 
ATOM   1432 C  CB  . ASP A 1 172 ? -7.748  61.838 50.713 1.00 22.09  ? 172  ASP A CB  1 
ATOM   1433 C  CG  . ASP A 1 172 ? -8.929  61.188 51.397 1.00 22.77  ? 172  ASP A CG  1 
ATOM   1434 O  OD1 . ASP A 1 172 ? -9.029  61.319 52.638 1.00 21.42  ? 172  ASP A OD1 1 
ATOM   1435 O  OD2 . ASP A 1 172 ? -9.755  60.556 50.706 1.00 22.79  ? 172  ASP A OD2 1 
ATOM   1436 N  N   . GLN A 1 173 ? -5.240  62.065 49.044 1.00 20.63  ? 173  GLN A N   1 
ATOM   1437 C  CA  . GLN A 1 173 ? -4.127  62.844 48.509 1.00 20.51  ? 173  GLN A CA  1 
ATOM   1438 C  C   . GLN A 1 173 ? -4.048  62.675 46.999 1.00 21.16  ? 173  GLN A C   1 
ATOM   1439 O  O   . GLN A 1 173 ? -3.909  63.647 46.255 1.00 20.54  ? 173  GLN A O   1 
ATOM   1440 C  CB  . GLN A 1 173 ? -2.808  62.385 49.136 1.00 19.01  ? 173  GLN A CB  1 
ATOM   1441 C  CG  . GLN A 1 173 ? -2.700  62.634 50.641 1.00 17.51  ? 173  GLN A CG  1 
ATOM   1442 C  CD  . GLN A 1 173 ? -1.391  62.121 51.219 1.00 21.80  ? 173  GLN A CD  1 
ATOM   1443 O  OE1 . GLN A 1 173 ? -0.440  61.848 50.482 1.00 19.03  ? 173  GLN A OE1 1 
ATOM   1444 N  NE2 . GLN A 1 173 ? -1.331  61.998 52.545 1.00 20.13  ? 173  GLN A NE2 1 
ATOM   1445 N  N   . ARG A 1 174 ? -4.133  61.426 46.551 1.00 21.09  ? 174  ARG A N   1 
ATOM   1446 C  CA  . ARG A 1 174 ? -4.063  61.123 45.129 1.00 22.39  ? 174  ARG A CA  1 
ATOM   1447 C  C   . ARG A 1 174 ? -5.186  61.809 44.357 1.00 23.00  ? 174  ARG A C   1 
ATOM   1448 O  O   . ARG A 1 174 ? -4.964  62.339 43.271 1.00 24.16  ? 174  ARG A O   1 
ATOM   1449 C  CB  . ARG A 1 174 ? -4.140  59.609 44.906 1.00 22.10  ? 174  ARG A CB  1 
ATOM   1450 C  CG  . ARG A 1 174 ? -4.113  59.197 43.440 1.00 23.56  ? 174  ARG A CG  1 
ATOM   1451 C  CD  . ARG A 1 174 ? -4.296  57.695 43.289 1.00 24.54  ? 174  ARG A CD  1 
ATOM   1452 N  NE  . ARG A 1 174 ? -3.130  56.936 43.734 1.00 23.77  ? 174  ARG A NE  1 
ATOM   1453 C  CZ  . ARG A 1 174 ? -3.111  55.611 43.854 1.00 25.23  ? 174  ARG A CZ  1 
ATOM   1454 N  NH1 . ARG A 1 174 ? -4.196  54.901 43.570 1.00 22.00  ? 174  ARG A NH1 1 
ATOM   1455 N  NH2 . ARG A 1 174 ? -2.004  54.993 44.235 1.00 23.35  ? 174  ARG A NH2 1 
ATOM   1456 N  N   . MET A 1 175 ? -6.393  61.801 44.915 1.00 23.67  ? 175  MET A N   1 
ATOM   1457 C  CA  . MET A 1 175 ? -7.517  62.424 44.228 1.00 23.66  ? 175  MET A CA  1 
ATOM   1458 C  C   . MET A 1 175 ? -7.311  63.922 44.069 1.00 24.61  ? 175  MET A C   1 
ATOM   1459 O  O   . MET A 1 175 ? -7.709  64.508 43.058 1.00 23.84  ? 175  MET A O   1 
ATOM   1460 C  CB  . MET A 1 175 ? -8.827  62.153 44.963 1.00 24.11  ? 175  MET A CB  1 
ATOM   1461 C  CG  . MET A 1 175 ? -10.044 62.575 44.142 1.00 26.98  ? 175  MET A CG  1 
ATOM   1462 S  SD  . MET A 1 175 ? -11.560 61.831 44.732 1.00 29.56  ? 175  MET A SD  1 
ATOM   1463 C  CE  . MET A 1 175 ? -11.360 60.144 44.100 1.00 26.40  ? 175  MET A CE  1 
ATOM   1464 N  N   . ALA A 1 176 ? -6.689  64.543 45.066 1.00 23.30  ? 176  ALA A N   1 
ATOM   1465 C  CA  . ALA A 1 176 ? -6.411  65.968 45.000 1.00 22.82  ? 176  ALA A CA  1 
ATOM   1466 C  C   . ALA A 1 176 ? -5.364  66.193 43.912 1.00 22.46  ? 176  ALA A C   1 
ATOM   1467 O  O   . ALA A 1 176 ? -5.450  67.154 43.147 1.00 23.41  ? 176  ALA A O   1 
ATOM   1468 C  CB  . ALA A 1 176 ? -5.902  66.477 46.349 1.00 21.54  ? 176  ALA A CB  1 
ATOM   1469 N  N   . LEU A 1 177 ? -4.371  65.307 43.841 1.00 22.31  ? 177  LEU A N   1 
ATOM   1470 C  CA  . LEU A 1 177 ? -3.333  65.430 42.817 1.00 22.12  ? 177  LEU A CA  1 
ATOM   1471 C  C   . LEU A 1 177 ? -3.955  65.234 41.437 1.00 22.00  ? 177  LEU A C   1 
ATOM   1472 O  O   . LEU A 1 177 ? -3.541  65.860 40.459 1.00 21.70  ? 177  LEU A O   1 
ATOM   1473 C  CB  . LEU A 1 177 ? -2.226  64.390 43.029 1.00 22.98  ? 177  LEU A CB  1 
ATOM   1474 C  CG  . LEU A 1 177 ? -1.379  64.511 44.300 1.00 24.91  ? 177  LEU A CG  1 
ATOM   1475 C  CD1 . LEU A 1 177 ? -0.334  63.400 44.318 1.00 23.96  ? 177  LEU A CD1 1 
ATOM   1476 C  CD2 . LEU A 1 177 ? -0.703  65.879 44.351 1.00 22.27  ? 177  LEU A CD2 1 
ATOM   1477 N  N   . GLN A 1 178 ? -4.945  64.350 41.364 1.00 22.09  ? 178  GLN A N   1 
ATOM   1478 C  CA  . GLN A 1 178 ? -5.634  64.089 40.103 1.00 24.24  ? 178  GLN A CA  1 
ATOM   1479 C  C   . GLN A 1 178 ? -6.385  65.356 39.682 1.00 24.40  ? 178  GLN A C   1 
ATOM   1480 O  O   . GLN A 1 178 ? -6.373  65.737 38.511 1.00 25.12  ? 178  GLN A O   1 
ATOM   1481 C  CB  . GLN A 1 178 ? -6.627  62.933 40.266 1.00 23.68  ? 178  GLN A CB  1 
ATOM   1482 C  CG  . GLN A 1 178 ? -7.382  62.576 38.984 1.00 24.61  ? 178  GLN A CG  1 
ATOM   1483 C  CD  . GLN A 1 178 ? -6.479  61.959 37.922 1.00 26.15  ? 178  GLN A CD  1 
ATOM   1484 O  OE1 . GLN A 1 178 ? -5.912  60.883 38.125 1.00 26.00  ? 178  GLN A OE1 1 
ATOM   1485 N  NE2 . GLN A 1 178 ? -6.339  62.640 36.788 1.00 23.86  ? 178  GLN A NE2 1 
ATOM   1486 N  N   . TRP A 1 179 ? -7.031  66.009 40.647 1.00 24.78  ? 179  TRP A N   1 
ATOM   1487 C  CA  . TRP A 1 179 ? -7.786  67.230 40.371 1.00 23.69  ? 179  TRP A CA  1 
ATOM   1488 C  C   . TRP A 1 179 ? -6.844  68.319 39.866 1.00 23.09  ? 179  TRP A C   1 
ATOM   1489 O  O   . TRP A 1 179 ? -7.178  69.059 38.945 1.00 23.57  ? 179  TRP A O   1 
ATOM   1490 C  CB  . TRP A 1 179 ? -8.505  67.715 41.633 1.00 23.34  ? 179  TRP A CB  1 
ATOM   1491 C  CG  . TRP A 1 179 ? -9.554  68.748 41.359 1.00 23.95  ? 179  TRP A CG  1 
ATOM   1492 C  CD1 . TRP A 1 179 ? -10.881 68.529 41.107 1.00 25.98  ? 179  TRP A CD1 1 
ATOM   1493 C  CD2 . TRP A 1 179 ? -9.357  70.166 41.266 1.00 23.97  ? 179  TRP A CD2 1 
ATOM   1494 N  NE1 . TRP A 1 179 ? -11.522 69.723 40.863 1.00 25.06  ? 179  TRP A NE1 1 
ATOM   1495 C  CE2 . TRP A 1 179 ? -10.610 70.743 40.954 1.00 25.13  ? 179  TRP A CE2 1 
ATOM   1496 C  CE3 . TRP A 1 179 ? -8.243  71.004 41.414 1.00 24.26  ? 179  TRP A CE3 1 
ATOM   1497 C  CZ2 . TRP A 1 179 ? -10.781 72.124 40.789 1.00 25.17  ? 179  TRP A CZ2 1 
ATOM   1498 C  CZ3 . TRP A 1 179 ? -8.413  72.382 41.249 1.00 25.27  ? 179  TRP A CZ3 1 
ATOM   1499 C  CH2 . TRP A 1 179 ? -9.675  72.924 40.941 1.00 25.64  ? 179  TRP A CH2 1 
ATOM   1500 N  N   . VAL A 1 180 ? -5.668  68.417 40.477 1.00 23.20  ? 180  VAL A N   1 
ATOM   1501 C  CA  . VAL A 1 180 ? -4.668  69.402 40.072 1.00 22.51  ? 180  VAL A CA  1 
ATOM   1502 C  C   . VAL A 1 180 ? -4.210  69.086 38.647 1.00 24.72  ? 180  VAL A C   1 
ATOM   1503 O  O   . VAL A 1 180 ? -4.050  69.979 37.812 1.00 25.39  ? 180  VAL A O   1 
ATOM   1504 C  CB  . VAL A 1 180 ? -3.441  69.368 41.019 1.00 23.27  ? 180  VAL A CB  1 
ATOM   1505 C  CG1 . VAL A 1 180 ? -2.282  70.156 40.417 1.00 21.62  ? 180  VAL A CG1 1 
ATOM   1506 C  CG2 . VAL A 1 180 ? -3.823  69.944 42.375 1.00 20.78  ? 180  VAL A CG2 1 
ATOM   1507 N  N   . HIS A 1 181 ? -3.993  67.805 38.377 1.00 23.88  ? 181  HIS A N   1 
ATOM   1508 C  CA  . HIS A 1 181 ? -3.572  67.378 37.050 1.00 25.09  ? 181  HIS A CA  1 
ATOM   1509 C  C   . HIS A 1 181 ? -4.626  67.779 36.017 1.00 24.59  ? 181  HIS A C   1 
ATOM   1510 O  O   . HIS A 1 181 ? -4.303  68.305 34.954 1.00 24.91  ? 181  HIS A O   1 
ATOM   1511 C  CB  . HIS A 1 181 ? -3.375  65.859 37.034 1.00 26.28  ? 181  HIS A CB  1 
ATOM   1512 C  CG  . HIS A 1 181 ? -3.092  65.295 35.676 1.00 29.79  ? 181  HIS A CG  1 
ATOM   1513 N  ND1 . HIS A 1 181 ? -4.084  65.046 34.751 1.00 31.43  ? 181  HIS A ND1 1 
ATOM   1514 C  CD2 . HIS A 1 181 ? -1.928  64.933 35.087 1.00 28.32  ? 181  HIS A CD2 1 
ATOM   1515 C  CE1 . HIS A 1 181 ? -3.543  64.552 33.651 1.00 30.71  ? 181  HIS A CE1 1 
ATOM   1516 N  NE2 . HIS A 1 181 ? -2.236  64.473 33.829 1.00 30.35  ? 181  HIS A NE2 1 
ATOM   1517 N  N   . ASP A 1 182 ? -5.889  67.553 36.355 1.00 23.62  ? 182  ASP A N   1 
ATOM   1518 C  CA  . ASP A 1 182 ? -6.988  67.854 35.451 1.00 25.48  ? 182  ASP A CA  1 
ATOM   1519 C  C   . ASP A 1 182 ? -7.421  69.314 35.349 1.00 25.98  ? 182  ASP A C   1 
ATOM   1520 O  O   . ASP A 1 182 ? -7.940  69.725 34.310 1.00 27.04  ? 182  ASP A O   1 
ATOM   1521 C  CB  . ASP A 1 182 ? -8.225  67.023 35.827 1.00 24.36  ? 182  ASP A CB  1 
ATOM   1522 C  CG  . ASP A 1 182 ? -7.972  65.526 35.775 1.00 26.18  ? 182  ASP A CG  1 
ATOM   1523 O  OD1 . ASP A 1 182 ? -7.026  65.100 35.085 1.00 27.28  ? 182  ASP A OD1 1 
ATOM   1524 O  OD2 . ASP A 1 182 ? -8.733  64.776 36.418 1.00 27.37  ? 182  ASP A OD2 1 
ATOM   1525 N  N   . ASN A 1 183 ? -7.202  70.102 36.398 1.00 24.18  ? 183  ASN A N   1 
ATOM   1526 C  CA  . ASN A 1 183 ? -7.679  71.482 36.381 1.00 25.15  ? 183  ASN A CA  1 
ATOM   1527 C  C   . ASN A 1 183 ? -6.726  72.647 36.598 1.00 25.90  ? 183  ASN A C   1 
ATOM   1528 O  O   . ASN A 1 183 ? -7.093  73.787 36.314 1.00 27.28  ? 183  ASN A O   1 
ATOM   1529 C  CB  . ASN A 1 183 ? -8.812  71.633 37.403 1.00 24.13  ? 183  ASN A CB  1 
ATOM   1530 C  CG  . ASN A 1 183 ? -9.950  70.672 37.158 1.00 26.66  ? 183  ASN A CG  1 
ATOM   1531 O  OD1 . ASN A 1 183 ? -10.030 69.604 37.778 1.00 27.25  ? 183  ASN A OD1 1 
ATOM   1532 N  ND2 . ASN A 1 183 ? -10.837 71.038 36.242 1.00 22.91  ? 183  ASN A ND2 1 
ATOM   1533 N  N   . ILE A 1 184 ? -5.524  72.394 37.100 1.00 24.96  ? 184  ILE A N   1 
ATOM   1534 C  CA  . ILE A 1 184 ? -4.615  73.497 37.387 1.00 25.63  ? 184  ILE A CA  1 
ATOM   1535 C  C   . ILE A 1 184 ? -4.288  74.395 36.189 1.00 26.01  ? 184  ILE A C   1 
ATOM   1536 O  O   . ILE A 1 184 ? -3.924  75.559 36.367 1.00 26.73  ? 184  ILE A O   1 
ATOM   1537 C  CB  . ILE A 1 184 ? -3.306  72.989 38.053 1.00 23.60  ? 184  ILE A CB  1 
ATOM   1538 C  CG1 . ILE A 1 184 ? -2.716  74.099 38.930 1.00 23.05  ? 184  ILE A CG1 1 
ATOM   1539 C  CG2 . ILE A 1 184 ? -2.299  72.542 36.999 1.00 23.22  ? 184  ILE A CG2 1 
ATOM   1540 C  CD1 . ILE A 1 184 ? -3.605  74.492 40.116 1.00 20.23  ? 184  ILE A CD1 1 
ATOM   1541 N  N   . GLN A 1 185 ? -4.432  73.869 34.975 1.00 25.70  ? 185  GLN A N   1 
ATOM   1542 C  CA  . GLN A 1 185 ? -4.151  74.660 33.778 1.00 25.67  ? 185  GLN A CA  1 
ATOM   1543 C  C   . GLN A 1 185 ? -5.038  75.905 33.734 1.00 25.61  ? 185  GLN A C   1 
ATOM   1544 O  O   . GLN A 1 185 ? -4.629  76.955 33.240 1.00 25.53  ? 185  GLN A O   1 
ATOM   1545 C  CB  . GLN A 1 185 ? -4.388  73.824 32.511 1.00 26.03  ? 185  GLN A CB  1 
ATOM   1546 C  CG  . GLN A 1 185 ? -5.825  73.347 32.346 1.00 24.51  ? 185  GLN A CG  1 
ATOM   1547 C  CD  . GLN A 1 185 ? -5.996  72.327 31.229 1.00 28.10  ? 185  GLN A CD  1 
ATOM   1548 O  OE1 . GLN A 1 185 ? -6.171  72.679 30.057 1.00 28.81  ? 185  GLN A OE1 1 
ATOM   1549 N  NE2 . GLN A 1 185 ? -5.938  71.054 31.589 1.00 24.87  ? 185  GLN A NE2 1 
ATOM   1550 N  N   . PHE A 1 186 ? -6.251  75.789 34.262 1.00 25.66  ? 186  PHE A N   1 
ATOM   1551 C  CA  . PHE A 1 186 ? -7.183  76.912 34.246 1.00 27.26  ? 186  PHE A CA  1 
ATOM   1552 C  C   . PHE A 1 186 ? -6.806  78.024 35.220 1.00 28.69  ? 186  PHE A C   1 
ATOM   1553 O  O   . PHE A 1 186 ? -7.315  79.143 35.119 1.00 27.66  ? 186  PHE A O   1 
ATOM   1554 C  CB  . PHE A 1 186 ? -8.596  76.401 34.519 1.00 25.90  ? 186  PHE A CB  1 
ATOM   1555 C  CG  . PHE A 1 186 ? -9.026  75.323 33.565 1.00 26.41  ? 186  PHE A CG  1 
ATOM   1556 C  CD1 . PHE A 1 186 ? -9.103  75.584 32.199 1.00 24.28  ? 186  PHE A CD1 1 
ATOM   1557 C  CD2 . PHE A 1 186 ? -9.300  74.036 34.021 1.00 24.77  ? 186  PHE A CD2 1 
ATOM   1558 C  CE1 . PHE A 1 186 ? -9.442  74.578 31.296 1.00 27.16  ? 186  PHE A CE1 1 
ATOM   1559 C  CE2 . PHE A 1 186 ? -9.640  73.022 33.125 1.00 25.73  ? 186  PHE A CE2 1 
ATOM   1560 C  CZ  . PHE A 1 186 ? -9.710  73.295 31.760 1.00 24.62  ? 186  PHE A CZ  1 
ATOM   1561 N  N   . PHE A 1 187 ? -5.908  77.715 36.153 1.00 27.80  ? 187  PHE A N   1 
ATOM   1562 C  CA  . PHE A 1 187 ? -5.447  78.699 37.127 1.00 27.32  ? 187  PHE A CA  1 
ATOM   1563 C  C   . PHE A 1 187 ? -4.085  79.240 36.708 1.00 28.55  ? 187  PHE A C   1 
ATOM   1564 O  O   . PHE A 1 187 ? -3.469  80.021 37.434 1.00 28.65  ? 187  PHE A O   1 
ATOM   1565 C  CB  . PHE A 1 187 ? -5.331  78.078 38.525 1.00 26.99  ? 187  PHE A CB  1 
ATOM   1566 C  CG  . PHE A 1 187 ? -6.637  77.587 39.083 1.00 27.03  ? 187  PHE A CG  1 
ATOM   1567 C  CD1 . PHE A 1 187 ? -7.136  76.336 38.731 1.00 25.33  ? 187  PHE A CD1 1 
ATOM   1568 C  CD2 . PHE A 1 187 ? -7.377  78.383 39.954 1.00 25.94  ? 187  PHE A CD2 1 
ATOM   1569 C  CE1 . PHE A 1 187 ? -8.353  75.884 39.238 1.00 25.95  ? 187  PHE A CE1 1 
ATOM   1570 C  CE2 . PHE A 1 187 ? -8.593  77.945 40.467 1.00 25.89  ? 187  PHE A CE2 1 
ATOM   1571 C  CZ  . PHE A 1 187 ? -9.085  76.687 40.108 1.00 26.12  ? 187  PHE A CZ  1 
ATOM   1572 N  N   . GLY A 1 188 ? -3.613  78.817 35.539 1.00 27.46  ? 188  GLY A N   1 
ATOM   1573 C  CA  . GLY A 1 188 ? -2.323  79.282 35.059 1.00 27.20  ? 188  GLY A CA  1 
ATOM   1574 C  C   . GLY A 1 188 ? -1.170  78.358 35.405 1.00 27.11  ? 188  GLY A C   1 
ATOM   1575 O  O   . GLY A 1 188 ? -0.009  78.683 35.151 1.00 27.69  ? 188  GLY A O   1 
ATOM   1576 N  N   . GLY A 1 189 ? -1.482  77.204 35.986 1.00 27.95  ? 189  GLY A N   1 
ATOM   1577 C  CA  . GLY A 1 189 ? -0.436  76.262 36.346 1.00 27.34  ? 189  GLY A CA  1 
ATOM   1578 C  C   . GLY A 1 189 ? -0.168  75.249 35.249 1.00 27.93  ? 189  GLY A C   1 
ATOM   1579 O  O   . GLY A 1 189 ? -1.056  74.935 34.452 1.00 28.35  ? 189  GLY A O   1 
ATOM   1580 N  N   . ASP A 1 190 ? 1.062   74.746 35.198 1.00 26.32  ? 190  ASP A N   1 
ATOM   1581 C  CA  . ASP A 1 190 ? 1.445   73.746 34.207 1.00 26.69  ? 190  ASP A CA  1 
ATOM   1582 C  C   . ASP A 1 190 ? 1.319   72.354 34.821 1.00 26.63  ? 190  ASP A C   1 
ATOM   1583 O  O   . ASP A 1 190 ? 2.105   71.981 35.686 1.00 26.72  ? 190  ASP A O   1 
ATOM   1584 C  CB  . ASP A 1 190 ? 2.883   73.986 33.743 1.00 26.07  ? 190  ASP A CB  1 
ATOM   1585 C  CG  . ASP A 1 190 ? 3.361   72.928 32.782 1.00 28.34  ? 190  ASP A CG  1 
ATOM   1586 O  OD1 . ASP A 1 190 ? 2.507   72.186 32.257 1.00 30.07  ? 190  ASP A OD1 1 
ATOM   1587 O  OD2 . ASP A 1 190 ? 4.583   72.840 32.541 1.00 29.94  ? 190  ASP A OD2 1 
ATOM   1588 N  N   . PRO A 1 191 ? 0.327   71.565 34.375 1.00 26.54  ? 191  PRO A N   1 
ATOM   1589 C  CA  . PRO A 1 191 ? 0.141   70.219 34.923 1.00 25.72  ? 191  PRO A CA  1 
ATOM   1590 C  C   . PRO A 1 191 ? 1.282   69.226 34.711 1.00 26.19  ? 191  PRO A C   1 
ATOM   1591 O  O   . PRO A 1 191 ? 1.331   68.192 35.378 1.00 25.92  ? 191  PRO A O   1 
ATOM   1592 C  CB  . PRO A 1 191 ? -1.171  69.759 34.282 1.00 26.53  ? 191  PRO A CB  1 
ATOM   1593 C  CG  . PRO A 1 191 ? -1.193  70.495 32.977 1.00 27.03  ? 191  PRO A CG  1 
ATOM   1594 C  CD  . PRO A 1 191 ? -0.704  71.872 33.367 1.00 26.90  ? 191  PRO A CD  1 
ATOM   1595 N  N   A LYS A 1 192 ? 2.195   69.539 33.797 0.50 27.03  ? 192  LYS A N   1 
ATOM   1596 N  N   B LYS A 1 192 ? 2.192   69.526 33.790 0.50 26.40  ? 192  LYS A N   1 
ATOM   1597 C  CA  A LYS A 1 192 ? 3.320   68.649 33.523 0.50 28.22  ? 192  LYS A CA  1 
ATOM   1598 C  CA  B LYS A 1 192 ? 3.313   68.625 33.547 0.50 27.16  ? 192  LYS A CA  1 
ATOM   1599 C  C   A LYS A 1 192 ? 4.550   69.030 34.340 0.50 26.48  ? 192  LYS A C   1 
ATOM   1600 C  C   B LYS A 1 192 ? 4.552   69.029 34.339 0.50 25.77  ? 192  LYS A C   1 
ATOM   1601 O  O   A LYS A 1 192 ? 5.598   68.395 34.235 0.50 25.71  ? 192  LYS A O   1 
ATOM   1602 O  O   B LYS A 1 192 ? 5.609   68.411 34.217 0.50 25.09  ? 192  LYS A O   1 
ATOM   1603 C  CB  A LYS A 1 192 ? 3.664   68.674 32.031 0.50 31.34  ? 192  LYS A CB  1 
ATOM   1604 C  CB  B LYS A 1 192 ? 3.631   68.544 32.047 0.50 28.85  ? 192  LYS A CB  1 
ATOM   1605 C  CG  A LYS A 1 192 ? 4.257   69.986 31.546 0.50 34.55  ? 192  LYS A CG  1 
ATOM   1606 C  CG  B LYS A 1 192 ? 3.748   69.881 31.349 0.50 30.50  ? 192  LYS A CG  1 
ATOM   1607 C  CD  A LYS A 1 192 ? 3.840   70.282 30.110 0.50 38.39  ? 192  LYS A CD  1 
ATOM   1608 C  CD  B LYS A 1 192 ? 3.645   69.727 29.835 0.50 29.82  ? 192  LYS A CD  1 
ATOM   1609 C  CE  A LYS A 1 192 ? 4.290   69.194 29.155 0.50 38.37  ? 192  LYS A CE  1 
ATOM   1610 C  CE  B LYS A 1 192 ? 3.581   71.084 29.154 0.50 28.79  ? 192  LYS A CE  1 
ATOM   1611 N  NZ  A LYS A 1 192 ? 3.716   69.391 27.802 0.50 40.76  ? 192  LYS A NZ  1 
ATOM   1612 N  NZ  B LYS A 1 192 ? 2.438   71.889 29.666 0.50 25.15  ? 192  LYS A NZ  1 
ATOM   1613 N  N   . THR A 1 193 ? 4.416   70.067 35.158 1.00 25.84  ? 193  THR A N   1 
ATOM   1614 C  CA  . THR A 1 193 ? 5.527   70.522 35.988 1.00 26.07  ? 193  THR A CA  1 
ATOM   1615 C  C   . THR A 1 193 ? 5.042   70.734 37.418 1.00 25.15  ? 193  THR A C   1 
ATOM   1616 O  O   . THR A 1 193 ? 5.168   71.824 37.989 1.00 24.25  ? 193  THR A O   1 
ATOM   1617 C  CB  . THR A 1 193 ? 6.139   71.824 35.440 1.00 26.24  ? 193  THR A CB  1 
ATOM   1618 O  OG1 . THR A 1 193 ? 6.434   71.654 34.048 1.00 27.32  ? 193  THR A OG1 1 
ATOM   1619 C  CG2 . THR A 1 193 ? 7.438   72.154 36.174 1.00 24.68  ? 193  THR A CG2 1 
ATOM   1620 N  N   . VAL A 1 194 ? 4.475   69.673 37.986 1.00 23.89  ? 194  VAL A N   1 
ATOM   1621 C  CA  . VAL A 1 194 ? 3.962   69.714 39.348 1.00 22.81  ? 194  VAL A CA  1 
ATOM   1622 C  C   . VAL A 1 194 ? 4.928   69.035 40.306 1.00 23.59  ? 194  VAL A C   1 
ATOM   1623 O  O   . VAL A 1 194 ? 5.346   67.900 40.078 1.00 23.47  ? 194  VAL A O   1 
ATOM   1624 C  CB  . VAL A 1 194 ? 2.604   68.990 39.465 1.00 24.25  ? 194  VAL A CB  1 
ATOM   1625 C  CG1 . VAL A 1 194 ? 2.186   68.909 40.930 1.00 23.56  ? 194  VAL A CG1 1 
ATOM   1626 C  CG2 . VAL A 1 194 ? 1.542   69.722 38.649 1.00 22.79  ? 194  VAL A CG2 1 
ATOM   1627 N  N   . THR A 1 195 ? 5.280   69.738 41.376 1.00 23.25  ? 195  THR A N   1 
ATOM   1628 C  CA  . THR A 1 195 ? 6.163   69.186 42.392 1.00 22.73  ? 195  THR A CA  1 
ATOM   1629 C  C   . THR A 1 195 ? 5.353   68.985 43.664 1.00 22.97  ? 195  THR A C   1 
ATOM   1630 O  O   . THR A 1 195 ? 4.706   69.916 44.147 1.00 23.04  ? 195  THR A O   1 
ATOM   1631 C  CB  . THR A 1 195 ? 7.337   70.137 42.726 1.00 22.56  ? 195  THR A CB  1 
ATOM   1632 O  OG1 . THR A 1 195 ? 8.266   70.159 41.639 1.00 22.69  ? 195  THR A OG1 1 
ATOM   1633 C  CG2 . THR A 1 195 ? 8.068   69.667 43.991 1.00 23.58  ? 195  THR A CG2 1 
ATOM   1634 N  N   . ILE A 1 196 ? 5.354   67.767 44.192 1.00 20.96  ? 196  ILE A N   1 
ATOM   1635 C  CA  . ILE A 1 196 ? 4.653   67.537 45.441 1.00 20.96  ? 196  ILE A CA  1 
ATOM   1636 C  C   . ILE A 1 196 ? 5.705   67.628 46.537 1.00 21.81  ? 196  ILE A C   1 
ATOM   1637 O  O   . ILE A 1 196 ? 6.824   67.137 46.374 1.00 23.04  ? 196  ILE A O   1 
ATOM   1638 C  CB  . ILE A 1 196 ? 3.968   66.143 45.502 1.00 20.57  ? 196  ILE A CB  1 
ATOM   1639 C  CG1 . ILE A 1 196 ? 4.987   65.026 45.251 1.00 19.59  ? 196  ILE A CG1 1 
ATOM   1640 C  CG2 . ILE A 1 196 ? 2.820   66.089 44.490 1.00 19.43  ? 196  ILE A CG2 1 
ATOM   1641 C  CD1 . ILE A 1 196 ? 4.410   63.620 45.459 1.00 19.13  ? 196  ILE A CD1 1 
ATOM   1642 N  N   . PHE A 1 197 ? 5.366   68.302 47.631 1.00 22.16  ? 197  PHE A N   1 
ATOM   1643 C  CA  . PHE A 1 197 ? 6.288   68.415 48.749 1.00 20.64  ? 197  PHE A CA  1 
ATOM   1644 C  C   . PHE A 1 197 ? 5.513   68.340 50.058 1.00 19.98  ? 197  PHE A C   1 
ATOM   1645 O  O   . PHE A 1 197 ? 4.342   68.707 50.120 1.00 20.79  ? 197  PHE A O   1 
ATOM   1646 C  CB  . PHE A 1 197 ? 7.172   69.688 48.634 1.00 20.39  ? 197  PHE A CB  1 
ATOM   1647 C  CG  . PHE A 1 197 ? 6.461   71.010 48.882 1.00 21.11  ? 197  PHE A CG  1 
ATOM   1648 C  CD1 . PHE A 1 197 ? 5.324   71.371 48.171 1.00 21.09  ? 197  PHE A CD1 1 
ATOM   1649 C  CD2 . PHE A 1 197 ? 7.009   71.936 49.776 1.00 22.84  ? 197  PHE A CD2 1 
ATOM   1650 C  CE1 . PHE A 1 197 ? 4.740   72.633 48.340 1.00 21.68  ? 197  PHE A CE1 1 
ATOM   1651 C  CE2 . PHE A 1 197 ? 6.437   73.203 49.955 1.00 20.84  ? 197  PHE A CE2 1 
ATOM   1652 C  CZ  . PHE A 1 197 ? 5.301   73.553 49.236 1.00 22.16  ? 197  PHE A CZ  1 
ATOM   1653 N  N   . GLY A 1 198 ? 6.156   67.802 51.089 1.00 19.88  ? 198  GLY A N   1 
ATOM   1654 C  CA  . GLY A 1 198 ? 5.498   67.659 52.373 1.00 19.77  ? 198  GLY A CA  1 
ATOM   1655 C  C   . GLY A 1 198 ? 6.502   67.391 53.474 1.00 20.98  ? 198  GLY A C   1 
ATOM   1656 O  O   . GLY A 1 198 ? 7.647   67.020 53.206 1.00 19.43  ? 198  GLY A O   1 
ATOM   1657 N  N   . GLU A 1 199 ? 6.071   67.576 54.717 1.00 21.02  ? 199  GLU A N   1 
ATOM   1658 C  CA  . GLU A 1 199 ? 6.949   67.375 55.861 1.00 20.52  ? 199  GLU A CA  1 
ATOM   1659 C  C   . GLU A 1 199 ? 6.427   66.262 56.775 1.00 20.82  ? 199  GLU A C   1 
ATOM   1660 O  O   . GLU A 1 199 ? 5.217   66.065 56.901 1.00 20.46  ? 199  GLU A O   1 
ATOM   1661 C  CB  . GLU A 1 199 ? 7.092   68.702 56.622 1.00 20.27  ? 199  GLU A CB  1 
ATOM   1662 C  CG  . GLU A 1 199 ? 8.062   68.687 57.802 1.00 18.33  ? 199  GLU A CG  1 
ATOM   1663 C  CD  . GLU A 1 199 ? 7.408   68.228 59.093 1.00 20.56  ? 199  GLU A CD  1 
ATOM   1664 O  OE1 . GLU A 1 199 ? 6.160   68.144 59.137 1.00 19.52  ? 199  GLU A OE1 1 
ATOM   1665 O  OE2 . GLU A 1 199 ? 8.140   67.966 60.074 1.00 21.77  ? 199  GLU A OE2 1 
ATOM   1666 N  N   A SER A 1 200 ? 7.353   65.543 57.401 0.50 20.25  ? 200  SER A N   1 
ATOM   1667 N  N   B SER A 1 200 ? 7.353   65.547 57.408 0.50 20.06  ? 200  SER A N   1 
ATOM   1668 C  CA  A SER A 1 200 ? 7.017   64.446 58.301 0.50 21.57  ? 200  SER A CA  1 
ATOM   1669 C  CA  B SER A 1 200 ? 7.030   64.432 58.298 0.50 21.17  ? 200  SER A CA  1 
ATOM   1670 C  C   A SER A 1 200 ? 6.120   63.433 57.587 0.50 20.70  ? 200  SER A C   1 
ATOM   1671 C  C   B SER A 1 200 ? 6.122   63.425 57.589 0.50 20.48  ? 200  SER A C   1 
ATOM   1672 O  O   A SER A 1 200 ? 6.510   62.882 56.561 0.50 20.53  ? 200  SER A O   1 
ATOM   1673 O  O   B SER A 1 200 ? 6.508   62.869 56.564 0.50 20.32  ? 200  SER A O   1 
ATOM   1674 C  CB  A SER A 1 200 ? 6.328   64.990 59.556 0.50 22.71  ? 200  SER A CB  1 
ATOM   1675 C  CB  B SER A 1 200 ? 6.388   64.938 59.600 0.50 22.09  ? 200  SER A CB  1 
ATOM   1676 O  OG  A SER A 1 200 ? 6.405   64.052 60.614 0.50 24.64  ? 200  SER A OG  1 
ATOM   1677 O  OG  B SER A 1 200 ? 5.157   65.596 59.375 0.50 22.39  ? 200  SER A OG  1 
ATOM   1678 N  N   . ALA A 1 201 ? 4.926   63.183 58.117 1.00 20.84  ? 201  ALA A N   1 
ATOM   1679 C  CA  . ALA A 1 201 ? 4.012   62.230 57.476 1.00 20.42  ? 201  ALA A CA  1 
ATOM   1680 C  C   . ALA A 1 201 ? 3.740   62.679 56.036 1.00 20.44  ? 201  ALA A C   1 
ATOM   1681 O  O   . ALA A 1 201 ? 3.435   61.860 55.164 1.00 19.99  ? 201  ALA A O   1 
ATOM   1682 C  CB  . ALA A 1 201 ? 2.699   62.122 58.258 1.00 18.89  ? 201  ALA A CB  1 
ATOM   1683 N  N   . GLY A 1 202 ? 3.857   63.983 55.794 1.00 19.55  ? 202  GLY A N   1 
ATOM   1684 C  CA  . GLY A 1 202 ? 3.650   64.513 54.456 1.00 19.20  ? 202  GLY A CA  1 
ATOM   1685 C  C   . GLY A 1 202 ? 4.827   64.135 53.572 1.00 20.09  ? 202  GLY A C   1 
ATOM   1686 O  O   . GLY A 1 202 ? 4.676   63.917 52.365 1.00 19.87  ? 202  GLY A O   1 
ATOM   1687 N  N   . GLY A 1 203 ? 6.009   64.062 54.180 1.00 19.68  ? 203  GLY A N   1 
ATOM   1688 C  CA  . GLY A 1 203 ? 7.202   63.680 53.447 1.00 20.42  ? 203  GLY A CA  1 
ATOM   1689 C  C   . GLY A 1 203 ? 7.139   62.190 53.154 1.00 20.57  ? 203  GLY A C   1 
ATOM   1690 O  O   . GLY A 1 203 ? 7.500   61.748 52.064 1.00 20.64  ? 203  GLY A O   1 
ATOM   1691 N  N   . ALA A 1 204 ? 6.684   61.410 54.133 1.00 18.76  ? 204  ALA A N   1 
ATOM   1692 C  CA  . ALA A 1 204 ? 6.548   59.966 53.941 1.00 19.27  ? 204  ALA A CA  1 
ATOM   1693 C  C   . ALA A 1 204 ? 5.541   59.733 52.808 1.00 19.03  ? 204  ALA A C   1 
ATOM   1694 O  O   . ALA A 1 204 ? 5.727   58.851 51.963 1.00 18.09  ? 204  ALA A O   1 
ATOM   1695 C  CB  . ALA A 1 204 ? 6.049   59.302 55.228 1.00 17.83  ? 204  ALA A CB  1 
ATOM   1696 N  N   . SER A 1 205 ? 4.472   60.527 52.804 1.00 18.13  ? 205  SER A N   1 
ATOM   1697 C  CA  . SER A 1 205 ? 3.430   60.417 51.777 1.00 19.42  ? 205  SER A CA  1 
ATOM   1698 C  C   . SER A 1 205 ? 3.997   60.685 50.383 1.00 19.24  ? 205  SER A C   1 
ATOM   1699 O  O   . SER A 1 205 ? 3.724   59.938 49.439 1.00 19.62  ? 205  SER A O   1 
ATOM   1700 C  CB  . SER A 1 205 ? 2.290   61.403 52.059 1.00 19.27  ? 205  SER A CB  1 
ATOM   1701 O  OG  . SER A 1 205 ? 1.545   61.023 53.204 1.00 19.95  ? 205  SER A OG  1 
ATOM   1702 N  N   . VAL A 1 206 ? 4.770   61.760 50.250 1.00 19.18  ? 206  VAL A N   1 
ATOM   1703 C  CA  . VAL A 1 206 ? 5.381   62.093 48.965 1.00 20.64  ? 206  VAL A CA  1 
ATOM   1704 C  C   . VAL A 1 206 ? 6.152   60.866 48.471 1.00 22.52  ? 206  VAL A C   1 
ATOM   1705 O  O   . VAL A 1 206 ? 6.044   60.479 47.304 1.00 21.40  ? 206  VAL A O   1 
ATOM   1706 C  CB  . VAL A 1 206 ? 6.348   63.300 49.096 1.00 20.24  ? 206  VAL A CB  1 
ATOM   1707 C  CG1 . VAL A 1 206 ? 7.202   63.424 47.849 1.00 20.01  ? 206  VAL A CG1 1 
ATOM   1708 C  CG2 . VAL A 1 206 ? 5.548   64.593 49.307 1.00 20.64  ? 206  VAL A CG2 1 
ATOM   1709 N  N   . GLY A 1 207 ? 6.918   60.251 49.369 1.00 21.41  ? 207  GLY A N   1 
ATOM   1710 C  CA  . GLY A 1 207 ? 7.674   59.063 49.009 1.00 19.87  ? 207  GLY A CA  1 
ATOM   1711 C  C   . GLY A 1 207 ? 6.763   57.904 48.631 1.00 20.42  ? 207  GLY A C   1 
ATOM   1712 O  O   . GLY A 1 207 ? 7.090   57.107 47.753 1.00 20.19  ? 207  GLY A O   1 
ATOM   1713 N  N   . MET A 1 208 ? 5.613   57.808 49.288 1.00 19.65  ? 208  MET A N   1 
ATOM   1714 C  CA  . MET A 1 208 ? 4.669   56.737 48.994 1.00 20.40  ? 208  MET A CA  1 
ATOM   1715 C  C   . MET A 1 208 ? 4.045   56.898 47.604 1.00 20.29  ? 208  MET A C   1 
ATOM   1716 O  O   . MET A 1 208 ? 3.737   55.906 46.946 1.00 20.65  ? 208  MET A O   1 
ATOM   1717 C  CB  . MET A 1 208 ? 3.601   56.670 50.088 1.00 18.69  ? 208  MET A CB  1 
ATOM   1718 C  CG  . MET A 1 208 ? 4.190   56.210 51.429 1.00 18.21  ? 208  MET A CG  1 
ATOM   1719 S  SD  . MET A 1 208 ? 3.074   56.297 52.831 1.00 20.01  ? 208  MET A SD  1 
ATOM   1720 C  CE  . MET A 1 208 ? 3.992   55.349 54.054 1.00 17.88  ? 208  MET A CE  1 
ATOM   1721 N  N   . HIS A 1 209 ? 3.869   58.140 47.155 1.00 17.45  ? 209  HIS A N   1 
ATOM   1722 C  CA  . HIS A 1 209 ? 3.320   58.383 45.821 1.00 21.01  ? 209  HIS A CA  1 
ATOM   1723 C  C   . HIS A 1 209 ? 4.395   58.109 44.770 1.00 20.25  ? 209  HIS A C   1 
ATOM   1724 O  O   . HIS A 1 209 ? 4.084   57.758 43.632 1.00 22.56  ? 209  HIS A O   1 
ATOM   1725 C  CB  . HIS A 1 209 ? 2.797   59.820 45.705 1.00 19.51  ? 209  HIS A CB  1 
ATOM   1726 C  CG  . HIS A 1 209 ? 1.576   60.074 46.532 1.00 19.16  ? 209  HIS A CG  1 
ATOM   1727 N  ND1 . HIS A 1 209 ? 0.409   59.358 46.369 1.00 19.46  ? 209  HIS A ND1 1 
ATOM   1728 C  CD2 . HIS A 1 209 ? 1.355   60.925 47.561 1.00 18.91  ? 209  HIS A CD2 1 
ATOM   1729 C  CE1 . HIS A 1 209 ? -0.477  59.755 47.265 1.00 21.72  ? 209  HIS A CE1 1 
ATOM   1730 N  NE2 . HIS A 1 209 ? 0.072   60.705 48.001 1.00 20.54  ? 209  HIS A NE2 1 
ATOM   1731 N  N   . ILE A 1 210 ? 5.661   58.277 45.151 1.00 20.66  ? 210  ILE A N   1 
ATOM   1732 C  CA  . ILE A 1 210 ? 6.764   57.987 44.238 1.00 20.21  ? 210  ILE A CA  1 
ATOM   1733 C  C   . ILE A 1 210 ? 6.767   56.469 44.010 1.00 22.08  ? 210  ILE A C   1 
ATOM   1734 O  O   . ILE A 1 210 ? 7.011   55.986 42.898 1.00 22.63  ? 210  ILE A O   1 
ATOM   1735 C  CB  . ILE A 1 210 ? 8.126   58.427 44.846 1.00 21.54  ? 210  ILE A CB  1 
ATOM   1736 C  CG1 . ILE A 1 210 ? 8.277   59.949 44.733 1.00 20.87  ? 210  ILE A CG1 1 
ATOM   1737 C  CG2 . ILE A 1 210 ? 9.285   57.715 44.143 1.00 19.43  ? 210  ILE A CG2 1 
ATOM   1738 C  CD1 . ILE A 1 210 ? 9.500   60.508 45.450 1.00 21.92  ? 210  ILE A CD1 1 
ATOM   1739 N  N   . LEU A 1 211 ? 6.469   55.725 45.071 1.00 20.37  ? 211  LEU A N   1 
ATOM   1740 C  CA  . LEU A 1 211 ? 6.436   54.264 45.014 1.00 21.60  ? 211  LEU A CA  1 
ATOM   1741 C  C   . LEU A 1 211 ? 5.192   53.663 44.352 1.00 21.69  ? 211  LEU A C   1 
ATOM   1742 O  O   . LEU A 1 211 ? 5.303   52.790 43.492 1.00 22.51  ? 211  LEU A O   1 
ATOM   1743 C  CB  . LEU A 1 211 ? 6.555   53.684 46.427 1.00 22.08  ? 211  LEU A CB  1 
ATOM   1744 C  CG  . LEU A 1 211 ? 7.900   53.808 47.143 1.00 25.95  ? 211  LEU A CG  1 
ATOM   1745 C  CD1 . LEU A 1 211 ? 7.738   53.426 48.613 1.00 28.11  ? 211  LEU A CD1 1 
ATOM   1746 C  CD2 . LEU A 1 211 ? 8.916   52.910 46.467 1.00 29.03  ? 211  LEU A CD2 1 
ATOM   1747 N  N   . SER A 1 212 ? 4.015   54.126 44.759 1.00 20.86  ? 212  SER A N   1 
ATOM   1748 C  CA  . SER A 1 212 ? 2.758   53.592 44.243 1.00 23.40  ? 212  SER A CA  1 
ATOM   1749 C  C   . SER A 1 212 ? 2.503   53.834 42.760 1.00 23.23  ? 212  SER A C   1 
ATOM   1750 O  O   . SER A 1 212 ? 2.418   54.976 42.314 1.00 23.35  ? 212  SER A O   1 
ATOM   1751 C  CB  . SER A 1 212 ? 1.583   54.155 45.040 1.00 22.34  ? 212  SER A CB  1 
ATOM   1752 O  OG  . SER A 1 212 ? 0.381   53.493 44.690 1.00 24.17  ? 212  SER A OG  1 
ATOM   1753 N  N   . PRO A 1 213 ? 2.359   52.750 41.980 1.00 22.73  ? 213  PRO A N   1 
ATOM   1754 C  CA  . PRO A 1 213 ? 2.105   52.860 40.538 1.00 23.50  ? 213  PRO A CA  1 
ATOM   1755 C  C   . PRO A 1 213 ? 0.902   53.757 40.237 1.00 23.03  ? 213  PRO A C   1 
ATOM   1756 O  O   . PRO A 1 213 ? 0.894   54.490 39.249 1.00 23.32  ? 213  PRO A O   1 
ATOM   1757 C  CB  . PRO A 1 213 ? 1.860   51.411 40.121 1.00 23.54  ? 213  PRO A CB  1 
ATOM   1758 C  CG  . PRO A 1 213 ? 2.765   50.643 41.060 1.00 23.03  ? 213  PRO A CG  1 
ATOM   1759 C  CD  . PRO A 1 213 ? 2.508   51.340 42.387 1.00 22.65  ? 213  PRO A CD  1 
ATOM   1760 N  N   . GLY A 1 214 ? -0.105  53.698 41.103 1.00 24.09  ? 214  GLY A N   1 
ATOM   1761 C  CA  . GLY A 1 214 ? -1.302  54.497 40.903 1.00 25.08  ? 214  GLY A CA  1 
ATOM   1762 C  C   . GLY A 1 214 ? -1.155  55.994 41.120 1.00 25.28  ? 214  GLY A C   1 
ATOM   1763 O  O   . GLY A 1 214 ? -2.076  56.752 40.818 1.00 26.02  ? 214  GLY A O   1 
ATOM   1764 N  N   . SER A 1 215 ? -0.008  56.432 41.632 1.00 23.78  ? 215  SER A N   1 
ATOM   1765 C  CA  . SER A 1 215 ? 0.201   57.854 41.883 1.00 24.62  ? 215  SER A CA  1 
ATOM   1766 C  C   . SER A 1 215 ? 1.279   58.504 41.012 1.00 24.21  ? 215  SER A C   1 
ATOM   1767 O  O   . SER A 1 215 ? 1.214   59.702 40.741 1.00 23.26  ? 215  SER A O   1 
ATOM   1768 C  CB  . SER A 1 215 ? 0.572   58.084 43.357 1.00 21.65  ? 215  SER A CB  1 
ATOM   1769 O  OG  . SER A 1 215 ? -0.467  57.693 44.235 1.00 22.63  ? 215  SER A OG  1 
ATOM   1770 N  N   . ARG A 1 216 ? 2.261   57.710 40.588 1.00 24.11  ? 216  ARG A N   1 
ATOM   1771 C  CA  . ARG A 1 216 ? 3.400   58.189 39.793 1.00 24.46  ? 216  ARG A CA  1 
ATOM   1772 C  C   . ARG A 1 216 ? 3.146   59.161 38.646 1.00 24.55  ? 216  ARG A C   1 
ATOM   1773 O  O   . ARG A 1 216 ? 3.893   60.121 38.472 1.00 24.30  ? 216  ARG A O   1 
ATOM   1774 C  CB  . ARG A 1 216 ? 4.178   57.001 39.216 1.00 24.05  ? 216  ARG A CB  1 
ATOM   1775 C  CG  . ARG A 1 216 ? 4.724   56.032 40.241 1.00 25.02  ? 216  ARG A CG  1 
ATOM   1776 C  CD  . ARG A 1 216 ? 5.408   54.864 39.547 1.00 22.25  ? 216  ARG A CD  1 
ATOM   1777 N  NE  . ARG A 1 216 ? 5.692   53.783 40.481 1.00 23.03  ? 216  ARG A NE  1 
ATOM   1778 C  CZ  . ARG A 1 216 ? 6.158   52.591 40.128 1.00 24.28  ? 216  ARG A CZ  1 
ATOM   1779 N  NH1 . ARG A 1 216 ? 6.399   52.318 38.848 1.00 20.93  ? 216  ARG A NH1 1 
ATOM   1780 N  NH2 . ARG A 1 216 ? 6.374   51.671 41.057 1.00 23.42  ? 216  ARG A NH2 1 
ATOM   1781 N  N   . ASP A 1 217 ? 2.120   58.896 37.846 1.00 24.54  ? 217  ASP A N   1 
ATOM   1782 C  CA  . ASP A 1 217 ? 1.824   59.736 36.685 1.00 24.89  ? 217  ASP A CA  1 
ATOM   1783 C  C   . ASP A 1 217 ? 1.248   61.109 37.025 1.00 25.39  ? 217  ASP A C   1 
ATOM   1784 O  O   . ASP A 1 217 ? 1.134   61.961 36.146 1.00 24.57  ? 217  ASP A O   1 
ATOM   1785 C  CB  . ASP A 1 217 ? 0.829   59.030 35.752 1.00 24.05  ? 217  ASP A CB  1 
ATOM   1786 C  CG  . ASP A 1 217 ? 1.291   57.643 35.311 1.00 28.67  ? 217  ASP A CG  1 
ATOM   1787 O  OD1 . ASP A 1 217 ? 0.512   56.975 34.593 1.00 26.93  ? 217  ASP A OD1 1 
ATOM   1788 O  OD2 . ASP A 1 217 ? 2.410   57.214 35.669 1.00 25.28  ? 217  ASP A OD2 1 
ATOM   1789 N  N   . LEU A 1 218 ? 0.896   61.329 38.290 1.00 24.12  ? 218  LEU A N   1 
ATOM   1790 C  CA  . LEU A 1 218 ? 0.269   62.586 38.697 1.00 24.76  ? 218  LEU A CA  1 
ATOM   1791 C  C   . LEU A 1 218 ? 1.160   63.761 39.101 1.00 25.66  ? 218  LEU A C   1 
ATOM   1792 O  O   . LEU A 1 218 ? 0.652   64.819 39.475 1.00 25.71  ? 218  LEU A O   1 
ATOM   1793 C  CB  . LEU A 1 218 ? -0.742  62.306 39.813 1.00 23.73  ? 218  LEU A CB  1 
ATOM   1794 C  CG  . LEU A 1 218 ? -1.849  61.316 39.436 1.00 26.80  ? 218  LEU A CG  1 
ATOM   1795 C  CD1 . LEU A 1 218 ? -2.737  61.053 40.643 1.00 26.48  ? 218  LEU A CD1 1 
ATOM   1796 C  CD2 . LEU A 1 218 ? -2.671  61.873 38.270 1.00 25.60  ? 218  LEU A CD2 1 
ATOM   1797 N  N   . PHE A 1 219 ? 2.476   63.588 39.035 1.00 23.97  ? 219  PHE A N   1 
ATOM   1798 C  CA  . PHE A 1 219 ? 3.386   64.677 39.373 1.00 22.66  ? 219  PHE A CA  1 
ATOM   1799 C  C   . PHE A 1 219 ? 4.712   64.494 38.648 1.00 22.83  ? 219  PHE A C   1 
ATOM   1800 O  O   . PHE A 1 219 ? 5.007   63.408 38.152 1.00 22.98  ? 219  PHE A O   1 
ATOM   1801 C  CB  . PHE A 1 219 ? 3.607   64.766 40.888 1.00 22.01  ? 219  PHE A CB  1 
ATOM   1802 C  CG  . PHE A 1 219 ? 4.163   63.513 41.498 1.00 21.36  ? 219  PHE A CG  1 
ATOM   1803 C  CD1 . PHE A 1 219 ? 3.340   62.412 41.735 1.00 21.44  ? 219  PHE A CD1 1 
ATOM   1804 C  CD2 . PHE A 1 219 ? 5.511   63.430 41.832 1.00 21.12  ? 219  PHE A CD2 1 
ATOM   1805 C  CE1 . PHE A 1 219 ? 3.857   61.241 42.301 1.00 21.94  ? 219  PHE A CE1 1 
ATOM   1806 C  CE2 . PHE A 1 219 ? 6.039   62.263 42.397 1.00 21.39  ? 219  PHE A CE2 1 
ATOM   1807 C  CZ  . PHE A 1 219 ? 5.209   61.169 42.631 1.00 20.74  ? 219  PHE A CZ  1 
ATOM   1808 N  N   . ARG A 1 220 ? 5.501   65.564 38.597 1.00 22.31  ? 220  ARG A N   1 
ATOM   1809 C  CA  . ARG A 1 220 ? 6.788   65.575 37.903 1.00 23.57  ? 220  ARG A CA  1 
ATOM   1810 C  C   . ARG A 1 220 ? 7.992   65.244 38.792 1.00 23.64  ? 220  ARG A C   1 
ATOM   1811 O  O   . ARG A 1 220 ? 8.815   64.390 38.451 1.00 23.64  ? 220  ARG A O   1 
ATOM   1812 C  CB  . ARG A 1 220 ? 6.991   66.955 37.260 1.00 22.30  ? 220  ARG A CB  1 
ATOM   1813 C  CG  . ARG A 1 220 ? 8.290   67.147 36.480 1.00 25.75  ? 220  ARG A CG  1 
ATOM   1814 C  CD  . ARG A 1 220 ? 8.376   66.223 35.279 1.00 28.52  ? 220  ARG A CD  1 
ATOM   1815 N  NE  . ARG A 1 220 ? 9.435   66.605 34.340 1.00 32.58  ? 220  ARG A NE  1 
ATOM   1816 C  CZ  . ARG A 1 220 ? 9.315   67.533 33.387 1.00 34.49  ? 220  ARG A CZ  1 
ATOM   1817 N  NH1 . ARG A 1 220 ? 8.177   68.201 33.227 1.00 33.08  ? 220  ARG A NH1 1 
ATOM   1818 N  NH2 . ARG A 1 220 ? 10.334  67.778 32.572 1.00 34.37  ? 220  ARG A NH2 1 
ATOM   1819 N  N   . ARG A 1 221 ? 8.106   65.944 39.913 1.00 22.34  ? 221  ARG A N   1 
ATOM   1820 C  CA  . ARG A 1 221 ? 9.212   65.726 40.837 1.00 24.53  ? 221  ARG A CA  1 
ATOM   1821 C  C   . ARG A 1 221 ? 8.738   65.854 42.276 1.00 23.07  ? 221  ARG A C   1 
ATOM   1822 O  O   . ARG A 1 221 ? 7.580   66.206 42.522 1.00 22.11  ? 221  ARG A O   1 
ATOM   1823 C  CB  . ARG A 1 221 ? 10.368  66.692 40.535 1.00 26.54  ? 221  ARG A CB  1 
ATOM   1824 C  CG  . ARG A 1 221 ? 9.965   68.114 40.194 1.00 28.95  ? 221  ARG A CG  1 
ATOM   1825 C  CD  . ARG A 1 221 ? 11.188  68.947 39.778 1.00 29.67  ? 221  ARG A CD  1 
ATOM   1826 N  NE  . ARG A 1 221 ? 11.790  68.488 38.527 1.00 28.52  ? 221  ARG A NE  1 
ATOM   1827 C  CZ  . ARG A 1 221 ? 11.571  69.037 37.332 1.00 30.61  ? 221  ARG A CZ  1 
ATOM   1828 N  NH1 . ARG A 1 221 ? 10.763  70.083 37.204 1.00 29.31  ? 221  ARG A NH1 1 
ATOM   1829 N  NH2 . ARG A 1 221 ? 12.153  68.532 36.253 1.00 29.31  ? 221  ARG A NH2 1 
ATOM   1830 N  N   . ALA A 1 222 ? 9.624   65.580 43.227 1.00 23.17  ? 222  ALA A N   1 
ATOM   1831 C  CA  . ALA A 1 222 ? 9.220   65.598 44.624 1.00 22.14  ? 222  ALA A CA  1 
ATOM   1832 C  C   . ALA A 1 222 ? 10.232  66.115 45.635 1.00 21.04  ? 222  ALA A C   1 
ATOM   1833 O  O   . ALA A 1 222 ? 11.444  66.077 45.419 1.00 22.42  ? 222  ALA A O   1 
ATOM   1834 C  CB  . ALA A 1 222 ? 8.781   64.192 45.022 1.00 21.15  ? 222  ALA A CB  1 
ATOM   1835 N  N   . ILE A 1 223 ? 9.697   66.589 46.754 1.00 21.68  ? 223  ILE A N   1 
ATOM   1836 C  CA  . ILE A 1 223 ? 10.491  67.114 47.856 1.00 21.92  ? 223  ILE A CA  1 
ATOM   1837 C  C   . ILE A 1 223 ? 9.997   66.458 49.143 1.00 20.92  ? 223  ILE A C   1 
ATOM   1838 O  O   . ILE A 1 223 ? 8.804   66.491 49.435 1.00 20.57  ? 223  ILE A O   1 
ATOM   1839 C  CB  . ILE A 1 223 ? 10.317  68.640 47.989 1.00 22.24  ? 223  ILE A CB  1 
ATOM   1840 C  CG1 . ILE A 1 223 ? 10.831  69.334 46.726 1.00 24.25  ? 223  ILE A CG1 1 
ATOM   1841 C  CG2 . ILE A 1 223 ? 11.047  69.142 49.232 1.00 22.04  ? 223  ILE A CG2 1 
ATOM   1842 C  CD1 . ILE A 1 223 ? 10.601  70.838 46.719 1.00 22.22  ? 223  ILE A CD1 1 
ATOM   1843 N  N   . LEU A 1 224 ? 10.914  65.863 49.902 1.00 19.80  ? 224  LEU A N   1 
ATOM   1844 C  CA  . LEU A 1 224 ? 10.567  65.207 51.159 1.00 19.98  ? 224  LEU A CA  1 
ATOM   1845 C  C   . LEU A 1 224 ? 11.301  65.884 52.319 1.00 20.64  ? 224  LEU A C   1 
ATOM   1846 O  O   . LEU A 1 224 ? 12.531  65.930 52.342 1.00 21.41  ? 224  LEU A O   1 
ATOM   1847 C  CB  . LEU A 1 224 ? 10.945  63.717 51.113 1.00 19.84  ? 224  LEU A CB  1 
ATOM   1848 C  CG  . LEU A 1 224 ? 10.263  62.812 50.076 1.00 20.36  ? 224  LEU A CG  1 
ATOM   1849 C  CD1 . LEU A 1 224 ? 10.812  63.112 48.682 1.00 21.24  ? 224  LEU A CD1 1 
ATOM   1850 C  CD2 . LEU A 1 224 ? 10.520  61.351 50.434 1.00 19.65  ? 224  LEU A CD2 1 
ATOM   1851 N  N   . GLN A 1 225 ? 10.541  66.406 53.277 1.00 21.08  ? 225  GLN A N   1 
ATOM   1852 C  CA  . GLN A 1 225 ? 11.120  67.084 54.435 1.00 19.37  ? 225  GLN A CA  1 
ATOM   1853 C  C   . GLN A 1 225 ? 10.882  66.285 55.719 1.00 21.36  ? 225  GLN A C   1 
ATOM   1854 O  O   . GLN A 1 225 ? 9.734   66.053 56.119 1.00 20.01  ? 225  GLN A O   1 
ATOM   1855 C  CB  . GLN A 1 225 ? 10.514  68.490 54.571 1.00 19.87  ? 225  GLN A CB  1 
ATOM   1856 C  CG  . GLN A 1 225 ? 10.716  69.356 53.323 1.00 20.11  ? 225  GLN A CG  1 
ATOM   1857 C  CD  . GLN A 1 225 ? 9.868   70.618 53.307 1.00 21.70  ? 225  GLN A CD  1 
ATOM   1858 O  OE1 . GLN A 1 225 ? 9.573   71.157 52.240 1.00 21.82  ? 225  GLN A OE1 1 
ATOM   1859 N  NE2 . GLN A 1 225 ? 9.482   71.100 54.485 1.00 21.07  ? 225  GLN A NE2 1 
ATOM   1860 N  N   . SER A 1 226 ? 11.973  65.848 56.348 1.00 20.84  ? 226  SER A N   1 
ATOM   1861 C  CA  . SER A 1 226 ? 11.901  65.097 57.602 1.00 21.22  ? 226  SER A CA  1 
ATOM   1862 C  C   . SER A 1 226 ? 10.949  63.908 57.565 1.00 21.90  ? 226  SER A C   1 
ATOM   1863 O  O   . SER A 1 226 ? 10.183  63.689 58.507 1.00 21.70  ? 226  SER A O   1 
ATOM   1864 C  CB  . SER A 1 226 ? 11.479  66.026 58.748 1.00 20.33  ? 226  SER A CB  1 
ATOM   1865 O  OG  . SER A 1 226 ? 12.401  67.089 58.918 1.00 21.80  ? 226  SER A OG  1 
ATOM   1866 N  N   . GLY A 1 227 ? 10.994  63.138 56.485 1.00 22.18  ? 227  GLY A N   1 
ATOM   1867 C  CA  . GLY A 1 227 ? 10.122  61.986 56.383 1.00 20.88  ? 227  GLY A CA  1 
ATOM   1868 C  C   . GLY A 1 227 ? 10.387  61.184 55.128 1.00 21.44  ? 227  GLY A C   1 
ATOM   1869 O  O   . GLY A 1 227 ? 10.729  61.746 54.089 1.00 21.71  ? 227  GLY A O   1 
ATOM   1870 N  N   A SER A 1 228 ? 10.231  59.868 55.240 0.50 22.04  ? 228  SER A N   1 
ATOM   1871 N  N   B SER A 1 228 ? 10.248  59.866 55.227 0.50 20.60  ? 228  SER A N   1 
ATOM   1872 C  CA  A SER A 1 228 ? 10.447  58.944 54.132 0.50 22.33  ? 228  SER A CA  1 
ATOM   1873 C  CA  B SER A 1 228 ? 10.453  58.972 54.091 0.50 19.35  ? 228  SER A CA  1 
ATOM   1874 C  C   A SER A 1 228 ? 9.419   57.825 54.235 0.50 20.92  ? 228  SER A C   1 
ATOM   1875 C  C   B SER A 1 228 ? 9.433   57.842 54.221 0.50 19.35  ? 228  SER A C   1 
ATOM   1876 O  O   A SER A 1 228 ? 8.938   57.512 55.323 0.50 20.35  ? 228  SER A O   1 
ATOM   1877 O  O   B SER A 1 228 ? 8.975   57.536 55.320 0.50 18.70  ? 228  SER A O   1 
ATOM   1878 C  CB  A SER A 1 228 ? 11.851  58.336 54.203 0.50 23.43  ? 228  SER A CB  1 
ATOM   1879 C  CB  B SER A 1 228 ? 11.886  58.421 54.072 0.50 18.05  ? 228  SER A CB  1 
ATOM   1880 O  OG  A SER A 1 228 ? 12.846  59.338 54.178 0.50 30.42  ? 228  SER A OG  1 
ATOM   1881 O  OG  B SER A 1 228 ? 12.207  57.747 55.271 0.50 16.23  ? 228  SER A OG  1 
ATOM   1882 N  N   . PRO A 1 229 ? 9.072   57.200 53.101 1.00 20.72  ? 229  PRO A N   1 
ATOM   1883 C  CA  . PRO A 1 229 ? 8.087   56.115 53.140 1.00 19.88  ? 229  PRO A CA  1 
ATOM   1884 C  C   . PRO A 1 229 ? 8.436   54.941 54.052 1.00 20.33  ? 229  PRO A C   1 
ATOM   1885 O  O   . PRO A 1 229 ? 7.546   54.311 54.626 1.00 19.78  ? 229  PRO A O   1 
ATOM   1886 C  CB  . PRO A 1 229 ? 7.946   55.723 51.664 1.00 19.41  ? 229  PRO A CB  1 
ATOM   1887 C  CG  . PRO A 1 229 ? 9.292   56.061 51.085 1.00 20.64  ? 229  PRO A CG  1 
ATOM   1888 C  CD  . PRO A 1 229 ? 9.626   57.378 51.746 1.00 20.19  ? 229  PRO A CD  1 
ATOM   1889 N  N   . ASN A 1 230 ? 9.730   54.675 54.203 1.00 20.55  ? 230  ASN A N   1 
ATOM   1890 C  CA  . ASN A 1 230 ? 10.209  53.571 55.028 1.00 21.38  ? 230  ASN A CA  1 
ATOM   1891 C  C   . ASN A 1 230 ? 10.384  53.867 56.521 1.00 22.18  ? 230  ASN A C   1 
ATOM   1892 O  O   . ASN A 1 230 ? 10.910  53.027 57.245 1.00 21.21  ? 230  ASN A O   1 
ATOM   1893 C  CB  . ASN A 1 230 ? 11.536  53.042 54.472 1.00 20.60  ? 230  ASN A CB  1 
ATOM   1894 C  CG  . ASN A 1 230 ? 12.609  54.118 54.389 1.00 23.05  ? 230  ASN A CG  1 
ATOM   1895 O  OD1 . ASN A 1 230 ? 13.756  53.905 54.796 1.00 23.22  ? 230  ASN A OD1 1 
ATOM   1896 N  ND2 . ASN A 1 230 ? 12.248  55.274 53.849 1.00 20.57  ? 230  ASN A ND2 1 
ATOM   1897 N  N   . CYS A 1 231 ? 9.963   55.040 56.991 1.00 21.50  ? 231  CYS A N   1 
ATOM   1898 C  CA  . CYS A 1 231 ? 10.105  55.338 58.421 1.00 21.30  ? 231  CYS A CA  1 
ATOM   1899 C  C   . CYS A 1 231 ? 9.357   54.271 59.231 1.00 21.33  ? 231  CYS A C   1 
ATOM   1900 O  O   . CYS A 1 231 ? 8.275   53.833 58.840 1.00 22.62  ? 231  CYS A O   1 
ATOM   1901 C  CB  . CYS A 1 231 ? 9.567   56.734 58.741 1.00 20.53  ? 231  CYS A CB  1 
ATOM   1902 S  SG  . CYS A 1 231 ? 10.629  58.065 58.110 1.00 21.68  ? 231  CYS A SG  1 
ATOM   1903 N  N   . PRO A 1 232 ? 9.926   53.844 60.373 1.00 20.49  ? 232  PRO A N   1 
ATOM   1904 C  CA  . PRO A 1 232 ? 9.301   52.816 61.220 1.00 20.08  ? 232  PRO A CA  1 
ATOM   1905 C  C   . PRO A 1 232 ? 7.882   53.109 61.701 1.00 21.01  ? 232  PRO A C   1 
ATOM   1906 O  O   . PRO A 1 232 ? 7.119   52.188 61.996 1.00 22.63  ? 232  PRO A O   1 
ATOM   1907 C  CB  . PRO A 1 232 ? 10.299  52.661 62.373 1.00 20.69  ? 232  PRO A CB  1 
ATOM   1908 C  CG  . PRO A 1 232 ? 10.906  54.029 62.484 1.00 21.17  ? 232  PRO A CG  1 
ATOM   1909 C  CD  . PRO A 1 232 ? 11.126  54.405 61.026 1.00 20.18  ? 232  PRO A CD  1 
ATOM   1910 N  N   . TRP A 1 233 ? 7.529   54.388 61.767 1.00 19.42  ? 233  TRP A N   1 
ATOM   1911 C  CA  . TRP A 1 233 ? 6.206   54.812 62.211 1.00 19.29  ? 233  TRP A CA  1 
ATOM   1912 C  C   . TRP A 1 233 ? 5.232   55.052 61.055 1.00 20.09  ? 233  TRP A C   1 
ATOM   1913 O  O   . TRP A 1 233 ? 4.027   55.182 61.282 1.00 21.70  ? 233  TRP A O   1 
ATOM   1914 C  CB  . TRP A 1 233 ? 6.324   56.120 63.007 1.00 18.59  ? 233  TRP A CB  1 
ATOM   1915 C  CG  . TRP A 1 233 ? 7.137   57.170 62.280 1.00 18.34  ? 233  TRP A CG  1 
ATOM   1916 C  CD1 . TRP A 1 233 ? 8.478   57.398 62.404 1.00 17.15  ? 233  TRP A CD1 1 
ATOM   1917 C  CD2 . TRP A 1 233 ? 6.668   58.084 61.273 1.00 19.02  ? 233  TRP A CD2 1 
ATOM   1918 N  NE1 . TRP A 1 233 ? 8.876   58.395 61.539 1.00 18.54  ? 233  TRP A NE1 1 
ATOM   1919 C  CE2 . TRP A 1 233 ? 7.785   58.832 60.833 1.00 18.91  ? 233  TRP A CE2 1 
ATOM   1920 C  CE3 . TRP A 1 233 ? 5.413   58.340 60.700 1.00 20.53  ? 233  TRP A CE3 1 
ATOM   1921 C  CZ2 . TRP A 1 233 ? 7.687   59.823 59.844 1.00 20.11  ? 233  TRP A CZ2 1 
ATOM   1922 C  CZ3 . TRP A 1 233 ? 5.314   59.331 59.714 1.00 21.72  ? 233  TRP A CZ3 1 
ATOM   1923 C  CH2 . TRP A 1 233 ? 6.448   60.058 59.298 1.00 21.69  ? 233  TRP A CH2 1 
ATOM   1924 N  N   . ALA A 1 234 ? 5.749   55.098 59.828 1.00 18.55  ? 234  ALA A N   1 
ATOM   1925 C  CA  . ALA A 1 234 ? 4.931   55.411 58.651 1.00 19.03  ? 234  ALA A CA  1 
ATOM   1926 C  C   . ALA A 1 234 ? 4.013   54.344 58.057 1.00 20.68  ? 234  ALA A C   1 
ATOM   1927 O  O   . ALA A 1 234 ? 3.162   54.670 57.225 1.00 19.53  ? 234  ALA A O   1 
ATOM   1928 C  CB  . ALA A 1 234 ? 5.825   55.978 57.544 1.00 18.12  ? 234  ALA A CB  1 
ATOM   1929 N  N   . SER A 1 235 ? 4.180   53.085 58.451 1.00 20.49  ? 235  SER A N   1 
ATOM   1930 C  CA  . SER A 1 235 ? 3.315   52.031 57.931 1.00 21.59  ? 235  SER A CA  1 
ATOM   1931 C  C   . SER A 1 235 ? 3.272   50.820 58.856 1.00 21.95  ? 235  SER A C   1 
ATOM   1932 O  O   . SER A 1 235 ? 4.116   50.671 59.740 1.00 22.68  ? 235  SER A O   1 
ATOM   1933 C  CB  . SER A 1 235 ? 3.780   51.591 56.534 1.00 21.25  ? 235  SER A CB  1 
ATOM   1934 O  OG  . SER A 1 235 ? 5.051   50.964 56.577 1.00 23.21  ? 235  SER A OG  1 
ATOM   1935 N  N   . VAL A 1 236 ? 2.267   49.973 58.655 1.00 20.88  ? 236  VAL A N   1 
ATOM   1936 C  CA  . VAL A 1 236 ? 2.104   48.744 59.428 1.00 21.33  ? 236  VAL A CA  1 
ATOM   1937 C  C   . VAL A 1 236 ? 1.682   47.631 58.461 1.00 22.66  ? 236  VAL A C   1 
ATOM   1938 O  O   . VAL A 1 236 ? 1.255   47.910 57.339 1.00 21.43  ? 236  VAL A O   1 
ATOM   1939 C  CB  . VAL A 1 236 ? 1.015   48.885 60.530 1.00 21.00  ? 236  VAL A CB  1 
ATOM   1940 C  CG1 . VAL A 1 236 ? 1.457   49.907 61.579 1.00 19.66  ? 236  VAL A CG1 1 
ATOM   1941 C  CG2 . VAL A 1 236 ? -0.321  49.292 59.908 1.00 19.51  ? 236  VAL A CG2 1 
ATOM   1942 N  N   . SER A 1 237 ? 1.812   46.379 58.891 1.00 21.58  ? 237  SER A N   1 
ATOM   1943 C  CA  . SER A 1 237 ? 1.419   45.244 58.060 1.00 22.51  ? 237  SER A CA  1 
ATOM   1944 C  C   . SER A 1 237 ? -0.102  45.153 58.068 1.00 24.95  ? 237  SER A C   1 
ATOM   1945 O  O   . SER A 1 237 ? -0.757  45.774 58.907 1.00 24.06  ? 237  SER A O   1 
ATOM   1946 C  CB  . SER A 1 237 ? 1.992   43.946 58.632 1.00 23.89  ? 237  SER A CB  1 
ATOM   1947 O  OG  . SER A 1 237 ? 1.432   43.676 59.909 1.00 22.49  ? 237  SER A OG  1 
ATOM   1948 N  N   . VAL A 1 238 ? -0.672  44.381 57.147 1.00 24.88  ? 238  VAL A N   1 
ATOM   1949 C  CA  . VAL A 1 238 ? -2.123  44.240 57.121 1.00 26.62  ? 238  VAL A CA  1 
ATOM   1950 C  C   . VAL A 1 238 ? -2.583  43.559 58.407 1.00 24.10  ? 238  VAL A C   1 
ATOM   1951 O  O   . VAL A 1 238 ? -3.668  43.839 58.915 1.00 25.47  ? 238  VAL A O   1 
ATOM   1952 C  CB  . VAL A 1 238 ? -2.604  43.408 55.905 1.00 27.99  ? 238  VAL A CB  1 
ATOM   1953 C  CG1 . VAL A 1 238 ? -2.357  44.177 54.618 1.00 29.73  ? 238  VAL A CG1 1 
ATOM   1954 C  CG2 . VAL A 1 238 ? -1.882  42.078 55.867 1.00 29.01  ? 238  VAL A CG2 1 
ATOM   1955 N  N   . ALA A 1 239 ? -1.747  42.673 58.939 1.00 24.55  ? 239  ALA A N   1 
ATOM   1956 C  CA  . ALA A 1 239 ? -2.080  41.963 60.170 1.00 24.45  ? 239  ALA A CA  1 
ATOM   1957 C  C   . ALA A 1 239 ? -2.160  42.920 61.357 1.00 24.80  ? 239  ALA A C   1 
ATOM   1958 O  O   . ALA A 1 239 ? -3.112  42.871 62.139 1.00 25.17  ? 239  ALA A O   1 
ATOM   1959 C  CB  . ALA A 1 239 ? -1.044  40.875 60.448 1.00 25.89  ? 239  ALA A CB  1 
ATOM   1960 N  N   . GLU A 1 240 ? -1.161  43.788 61.496 1.00 24.69  ? 240  GLU A N   1 
ATOM   1961 C  CA  . GLU A 1 240 ? -1.145  44.742 62.603 1.00 23.90  ? 240  GLU A CA  1 
ATOM   1962 C  C   . GLU A 1 240 ? -2.266  45.766 62.436 1.00 23.12  ? 240  GLU A C   1 
ATOM   1963 O  O   . GLU A 1 240 ? -2.901  46.168 63.412 1.00 24.08  ? 240  GLU A O   1 
ATOM   1964 C  CB  . GLU A 1 240 ? 0.219   45.441 62.686 1.00 22.89  ? 240  GLU A CB  1 
ATOM   1965 C  CG  . GLU A 1 240 ? 0.316   46.552 63.749 1.00 23.64  ? 240  GLU A CG  1 
ATOM   1966 C  CD  . GLU A 1 240 ? 0.093   46.054 65.174 1.00 25.48  ? 240  GLU A CD  1 
ATOM   1967 O  OE1 . GLU A 1 240 ? 0.035   46.896 66.097 1.00 25.41  ? 240  GLU A OE1 1 
ATOM   1968 O  OE2 . GLU A 1 240 ? -0.023  44.827 65.379 1.00 27.35  ? 240  GLU A OE2 1 
ATOM   1969 N  N   . GLY A 1 241 ? -2.514  46.184 61.197 1.00 23.48  ? 241  GLY A N   1 
ATOM   1970 C  CA  . GLY A 1 241 ? -3.580  47.141 60.956 1.00 23.88  ? 241  GLY A CA  1 
ATOM   1971 C  C   . GLY A 1 241 ? -4.916  46.551 61.377 1.00 24.27  ? 241  GLY A C   1 
ATOM   1972 O  O   . GLY A 1 241 ? -5.756  47.226 61.977 1.00 23.01  ? 241  GLY A O   1 
ATOM   1973 N  N   . ARG A 1 242 ? -5.110  45.276 61.060 1.00 25.12  ? 242  ARG A N   1 
ATOM   1974 C  CA  . ARG A 1 242 ? -6.340  44.582 61.418 1.00 26.15  ? 242  ARG A CA  1 
ATOM   1975 C  C   . ARG A 1 242 ? -6.454  44.481 62.937 1.00 23.64  ? 242  ARG A C   1 
ATOM   1976 O  O   . ARG A 1 242 ? -7.513  44.733 63.502 1.00 24.83  ? 242  ARG A O   1 
ATOM   1977 C  CB  . ARG A 1 242 ? -6.355  43.183 60.788 1.00 26.74  ? 242  ARG A CB  1 
ATOM   1978 C  CG  . ARG A 1 242 ? -7.497  42.283 61.247 1.00 29.61  ? 242  ARG A CG  1 
ATOM   1979 C  CD  . ARG A 1 242 ? -7.623  41.066 60.320 1.00 30.42  ? 242  ARG A CD  1 
ATOM   1980 N  NE  . ARG A 1 242 ? -8.197  41.445 59.030 1.00 30.41  ? 242  ARG A NE  1 
ATOM   1981 C  CZ  . ARG A 1 242 ? -9.491  41.673 58.835 1.00 31.82  ? 242  ARG A CZ  1 
ATOM   1982 N  NH1 . ARG A 1 242 ? -10.344 41.547 59.844 1.00 32.93  ? 242  ARG A NH1 1 
ATOM   1983 N  NH2 . ARG A 1 242 ? -9.933  42.053 57.642 1.00 32.24  ? 242  ARG A NH2 1 
ATOM   1984 N  N   . ARG A 1 243 ? -5.358  44.119 63.596 1.00 24.18  ? 243  ARG A N   1 
ATOM   1985 C  CA  . ARG A 1 243 ? -5.364  44.002 65.050 1.00 24.97  ? 243  ARG A CA  1 
ATOM   1986 C  C   . ARG A 1 243 ? -5.791  45.307 65.721 1.00 24.96  ? 243  ARG A C   1 
ATOM   1987 O  O   . ARG A 1 243 ? -6.573  45.298 66.673 1.00 24.88  ? 243  ARG A O   1 
ATOM   1988 C  CB  . ARG A 1 243 ? -3.976  43.609 65.569 1.00 26.15  ? 243  ARG A CB  1 
ATOM   1989 C  CG  . ARG A 1 243 ? -3.947  43.346 67.073 1.00 28.23  ? 243  ARG A CG  1 
ATOM   1990 C  CD  . ARG A 1 243 ? -2.524  43.250 67.607 1.00 30.50  ? 243  ARG A CD  1 
ATOM   1991 N  NE  . ARG A 1 243 ? -1.864  44.554 67.665 1.00 30.29  ? 243  ARG A NE  1 
ATOM   1992 C  CZ  . ARG A 1 243 ? -2.216  45.542 68.486 1.00 31.10  ? 243  ARG A CZ  1 
ATOM   1993 N  NH1 . ARG A 1 243 ? -3.231  45.386 69.330 1.00 29.32  ? 243  ARG A NH1 1 
ATOM   1994 N  NH2 . ARG A 1 243 ? -1.549  46.690 68.468 1.00 30.66  ? 243  ARG A NH2 1 
ATOM   1995 N  N   . ARG A 1 244 ? -5.279  46.430 65.222 1.00 24.77  ? 244  ARG A N   1 
ATOM   1996 C  CA  . ARG A 1 244 ? -5.609  47.733 65.798 1.00 23.46  ? 244  ARG A CA  1 
ATOM   1997 C  C   . ARG A 1 244 ? -7.055  48.145 65.548 1.00 23.74  ? 244  ARG A C   1 
ATOM   1998 O  O   . ARG A 1 244 ? -7.675  48.782 66.401 1.00 23.29  ? 244  ARG A O   1 
ATOM   1999 C  CB  . ARG A 1 244 ? -4.659  48.812 65.263 1.00 23.55  ? 244  ARG A CB  1 
ATOM   2000 C  CG  . ARG A 1 244 ? -3.207  48.587 65.656 1.00 22.76  ? 244  ARG A CG  1 
ATOM   2001 C  CD  . ARG A 1 244 ? -2.286  49.693 65.146 1.00 23.88  ? 244  ARG A CD  1 
ATOM   2002 N  NE  . ARG A 1 244 ? -0.885  49.360 65.397 1.00 21.99  ? 244  ARG A NE  1 
ATOM   2003 C  CZ  . ARG A 1 244 ? 0.137   50.185 65.193 1.00 22.97  ? 244  ARG A CZ  1 
ATOM   2004 N  NH1 . ARG A 1 244 ? -0.070  51.413 64.735 1.00 20.02  ? 244  ARG A NH1 1 
ATOM   2005 N  NH2 . ARG A 1 244 ? 1.374   49.777 65.443 1.00 19.81  ? 244  ARG A NH2 1 
ATOM   2006 N  N   . ALA A 1 245 ? -7.588  47.792 64.381 1.00 22.83  ? 245  ALA A N   1 
ATOM   2007 C  CA  . ALA A 1 245 ? -8.973  48.125 64.054 1.00 23.71  ? 245  ALA A CA  1 
ATOM   2008 C  C   . ALA A 1 245 ? -9.893  47.371 65.021 1.00 24.62  ? 245  ALA A C   1 
ATOM   2009 O  O   . ALA A 1 245 ? -10.844 47.935 65.562 1.00 25.41  ? 245  ALA A O   1 
ATOM   2010 C  CB  . ALA A 1 245 ? -9.285  47.732 62.606 1.00 24.15  ? 245  ALA A CB  1 
ATOM   2011 N  N   . VAL A 1 246 ? -9.594  46.093 65.240 1.00 25.57  ? 246  VAL A N   1 
ATOM   2012 C  CA  . VAL A 1 246 ? -10.386 45.274 66.152 1.00 26.45  ? 246  VAL A CA  1 
ATOM   2013 C  C   . VAL A 1 246 ? -10.283 45.817 67.582 1.00 27.11  ? 246  VAL A C   1 
ATOM   2014 O  O   . VAL A 1 246 ? -11.284 45.902 68.295 1.00 27.96  ? 246  VAL A O   1 
ATOM   2015 C  CB  . VAL A 1 246 ? -9.915  43.801 66.130 1.00 27.72  ? 246  VAL A CB  1 
ATOM   2016 C  CG1 . VAL A 1 246 ? -10.685 42.989 67.166 1.00 28.34  ? 246  VAL A CG1 1 
ATOM   2017 C  CG2 . VAL A 1 246 ? -10.127 43.209 64.735 1.00 27.15  ? 246  VAL A CG2 1 
ATOM   2018 N  N   . GLU A 1 247 ? -9.074  46.193 67.991 1.00 26.16  ? 247  GLU A N   1 
ATOM   2019 C  CA  . GLU A 1 247 ? -8.855  46.732 69.331 1.00 25.70  ? 247  GLU A CA  1 
ATOM   2020 C  C   . GLU A 1 247 ? -9.622  48.041 69.501 1.00 24.93  ? 247  GLU A C   1 
ATOM   2021 O  O   . GLU A 1 247 ? -10.129 48.331 70.585 1.00 24.55  ? 247  GLU A O   1 
ATOM   2022 C  CB  . GLU A 1 247 ? -7.356  46.947 69.574 1.00 27.59  ? 247  GLU A CB  1 
ATOM   2023 C  CG  . GLU A 1 247 ? -6.970  47.344 71.002 1.00 28.95  ? 247  GLU A CG  1 
ATOM   2024 C  CD  . GLU A 1 247 ? -7.429  46.340 72.059 1.00 33.86  ? 247  GLU A CD  1 
ATOM   2025 O  OE1 . GLU A 1 247 ? -7.527  45.131 71.750 1.00 32.68  ? 247  GLU A OE1 1 
ATOM   2026 O  OE2 . GLU A 1 247 ? -7.677  46.763 73.210 1.00 31.76  ? 247  GLU A OE2 1 
ATOM   2027 N  N   . LEU A 1 248 ? -9.713  48.829 68.431 1.00 24.21  ? 248  LEU A N   1 
ATOM   2028 C  CA  . LEU A 1 248 ? -10.456 50.087 68.492 1.00 25.26  ? 248  LEU A CA  1 
ATOM   2029 C  C   . LEU A 1 248 ? -11.921 49.741 68.763 1.00 25.53  ? 248  LEU A C   1 
ATOM   2030 O  O   . LEU A 1 248 ? -12.570 50.345 69.619 1.00 26.84  ? 248  LEU A O   1 
ATOM   2031 C  CB  . LEU A 1 248 ? -10.350 50.849 67.165 1.00 24.47  ? 248  LEU A CB  1 
ATOM   2032 C  CG  . LEU A 1 248 ? -10.972 52.251 67.149 1.00 26.46  ? 248  LEU A CG  1 
ATOM   2033 C  CD1 . LEU A 1 248 ? -10.146 53.170 68.042 1.00 27.66  ? 248  LEU A CD1 1 
ATOM   2034 C  CD2 . LEU A 1 248 ? -11.011 52.803 65.723 1.00 27.44  ? 248  LEU A CD2 1 
ATOM   2035 N  N   . GLY A 1 249 ? -12.433 48.760 68.025 1.00 26.02  ? 249  GLY A N   1 
ATOM   2036 C  CA  . GLY A 1 249 ? -13.813 48.342 68.208 1.00 27.12  ? 249  GLY A CA  1 
ATOM   2037 C  C   . GLY A 1 249 ? -14.032 47.847 69.625 1.00 27.05  ? 249  GLY A C   1 
ATOM   2038 O  O   . GLY A 1 249 ? -15.065 48.118 70.238 1.00 28.00  ? 249  GLY A O   1 
ATOM   2039 N  N   . ARG A 1 250 ? -13.046 47.127 70.150 1.00 27.92  ? 250  ARG A N   1 
ATOM   2040 C  CA  . ARG A 1 250 ? -13.120 46.597 71.503 1.00 29.89  ? 250  ARG A CA  1 
ATOM   2041 C  C   . ARG A 1 250 ? -13.215 47.750 72.512 1.00 30.80  ? 250  ARG A C   1 
ATOM   2042 O  O   . ARG A 1 250 ? -13.901 47.645 73.532 1.00 29.44  ? 250  ARG A O   1 
ATOM   2043 C  CB  . ARG A 1 250 ? -11.892 45.722 71.780 1.00 32.20  ? 250  ARG A CB  1 
ATOM   2044 C  CG  . ARG A 1 250 ? -11.957 44.940 73.081 1.00 36.61  ? 250  ARG A CG  1 
ATOM   2045 C  CD  . ARG A 1 250 ? -10.769 43.991 73.247 1.00 40.19  ? 250  ARG A CD  1 
ATOM   2046 N  NE  . ARG A 1 250 ? -10.853 42.804 72.396 1.00 43.53  ? 250  ARG A NE  1 
ATOM   2047 C  CZ  . ARG A 1 250 ? -10.261 42.670 71.211 1.00 46.98  ? 250  ARG A CZ  1 
ATOM   2048 N  NH1 . ARG A 1 250 ? -9.522  43.654 70.709 1.00 48.50  ? 250  ARG A NH1 1 
ATOM   2049 N  NH2 . ARG A 1 250 ? -10.398 41.540 70.529 1.00 46.25  ? 250  ARG A NH2 1 
ATOM   2050 N  N   . ASN A 1 251 ? -12.540 48.857 72.216 1.00 29.75  ? 251  ASN A N   1 
ATOM   2051 C  CA  . ASN A 1 251 ? -12.564 50.030 73.090 1.00 29.14  ? 251  ASN A CA  1 
ATOM   2052 C  C   . ASN A 1 251 ? -13.923 50.721 73.048 1.00 29.65  ? 251  ASN A C   1 
ATOM   2053 O  O   . ASN A 1 251 ? -14.281 51.463 73.962 1.00 30.59  ? 251  ASN A O   1 
ATOM   2054 C  CB  . ASN A 1 251 ? -11.481 51.030 72.666 1.00 28.76  ? 251  ASN A CB  1 
ATOM   2055 C  CG  . ASN A 1 251 ? -10.151 50.784 73.358 1.00 29.06  ? 251  ASN A CG  1 
ATOM   2056 O  OD1 . ASN A 1 251 ? -9.867  51.370 74.403 1.00 29.46  ? 251  ASN A OD1 1 
ATOM   2057 N  ND2 . ASN A 1 251 ? -9.337  49.910 72.785 1.00 27.58  ? 251  ASN A ND2 1 
ATOM   2058 N  N   . LEU A 1 252 ? -14.681 50.473 71.986 1.00 29.91  ? 252  LEU A N   1 
ATOM   2059 C  CA  . LEU A 1 252 ? -15.989 51.099 71.829 1.00 30.97  ? 252  LEU A CA  1 
ATOM   2060 C  C   . LEU A 1 252 ? -17.145 50.114 71.993 1.00 32.20  ? 252  LEU A C   1 
ATOM   2061 O  O   . LEU A 1 252 ? -18.259 50.370 71.539 1.00 32.89  ? 252  LEU A O   1 
ATOM   2062 C  CB  . LEU A 1 252 ? -16.060 51.786 70.461 1.00 28.85  ? 252  LEU A CB  1 
ATOM   2063 C  CG  . LEU A 1 252 ? -14.980 52.859 70.286 1.00 28.80  ? 252  LEU A CG  1 
ATOM   2064 C  CD1 . LEU A 1 252 ? -14.896 53.305 68.843 1.00 28.11  ? 252  LEU A CD1 1 
ATOM   2065 C  CD2 . LEU A 1 252 ? -15.286 54.032 71.198 1.00 30.50  ? 252  LEU A CD2 1 
ATOM   2066 N  N   . ASN A 1 253 ? -16.870 48.994 72.650 1.00 32.90  ? 253  ASN A N   1 
ATOM   2067 C  CA  . ASN A 1 253 ? -17.877 47.966 72.893 1.00 36.87  ? 253  ASN A CA  1 
ATOM   2068 C  C   . ASN A 1 253 ? -18.589 47.555 71.607 1.00 36.50  ? 253  ASN A C   1 
ATOM   2069 O  O   . ASN A 1 253 ? -19.815 47.478 71.559 1.00 37.19  ? 253  ASN A O   1 
ATOM   2070 C  CB  . ASN A 1 253 ? -18.900 48.467 73.915 1.00 39.62  ? 253  ASN A CB  1 
ATOM   2071 C  CG  . ASN A 1 253 ? -18.245 49.109 75.128 1.00 45.48  ? 253  ASN A CG  1 
ATOM   2072 O  OD1 . ASN A 1 253 ? -18.148 50.336 75.220 1.00 46.80  ? 253  ASN A OD1 1 
ATOM   2073 N  ND2 . ASN A 1 253 ? -17.775 48.280 76.056 1.00 46.60  ? 253  ASN A ND2 1 
ATOM   2074 N  N   . CYS A 1 254 ? -17.808 47.290 70.567 1.00 35.14  ? 254  CYS A N   1 
ATOM   2075 C  CA  . CYS A 1 254 ? -18.353 46.887 69.278 1.00 34.28  ? 254  CYS A CA  1 
ATOM   2076 C  C   . CYS A 1 254 ? -18.491 45.375 69.139 1.00 34.49  ? 254  CYS A C   1 
ATOM   2077 O  O   . CYS A 1 254 ? -17.785 44.613 69.795 1.00 33.08  ? 254  CYS A O   1 
ATOM   2078 C  CB  . CYS A 1 254 ? -17.451 47.385 68.148 1.00 34.27  ? 254  CYS A CB  1 
ATOM   2079 S  SG  . CYS A 1 254 ? -17.609 49.142 67.702 1.00 33.57  ? 254  CYS A SG  1 
ATOM   2080 N  N   . ASN A 1 255 ? -19.410 44.948 68.279 1.00 35.81  ? 255  ASN A N   1 
ATOM   2081 C  CA  . ASN A 1 255 ? -19.595 43.528 68.001 1.00 36.56  ? 255  ASN A CA  1 
ATOM   2082 C  C   . ASN A 1 255 ? -18.402 43.198 67.108 1.00 36.34  ? 255  ASN A C   1 
ATOM   2083 O  O   . ASN A 1 255 ? -18.229 43.813 66.054 1.00 35.45  ? 255  ASN A O   1 
ATOM   2084 C  CB  . ASN A 1 255 ? -20.898 43.300 67.230 1.00 39.08  ? 255  ASN A CB  1 
ATOM   2085 C  CG  . ASN A 1 255 ? -21.095 41.853 66.831 1.00 40.85  ? 255  ASN A CG  1 
ATOM   2086 O  OD1 . ASN A 1 255 ? -20.221 41.239 66.221 1.00 41.51  ? 255  ASN A OD1 1 
ATOM   2087 N  ND2 . ASN A 1 255 ? -22.255 41.301 67.167 1.00 44.10  ? 255  ASN A ND2 1 
ATOM   2088 N  N   . LEU A 1 256 ? -17.581 42.239 67.520 1.00 35.65  ? 256  LEU A N   1 
ATOM   2089 C  CA  . LEU A 1 256 ? -16.395 41.884 66.746 1.00 37.73  ? 256  LEU A CA  1 
ATOM   2090 C  C   . LEU A 1 256 ? -16.521 40.580 65.960 1.00 39.29  ? 256  LEU A C   1 
ATOM   2091 O  O   . LEU A 1 256 ? -15.517 40.031 65.503 1.00 39.36  ? 256  LEU A O   1 
ATOM   2092 C  CB  . LEU A 1 256 ? -15.185 41.794 67.680 1.00 36.36  ? 256  LEU A CB  1 
ATOM   2093 C  CG  . LEU A 1 256 ? -14.994 42.966 68.649 1.00 36.63  ? 256  LEU A CG  1 
ATOM   2094 C  CD1 . LEU A 1 256 ? -13.794 42.695 69.546 1.00 36.93  ? 256  LEU A CD1 1 
ATOM   2095 C  CD2 . LEU A 1 256 ? -14.810 44.261 67.872 1.00 37.98  ? 256  LEU A CD2 1 
ATOM   2096 N  N   . ASN A 1 257 ? -17.746 40.094 65.787 1.00 40.56  ? 257  ASN A N   1 
ATOM   2097 C  CA  . ASN A 1 257 ? -17.968 38.841 65.071 1.00 40.98  ? 257  ASN A CA  1 
ATOM   2098 C  C   . ASN A 1 257 ? -17.560 38.848 63.602 1.00 40.43  ? 257  ASN A C   1 
ATOM   2099 O  O   . ASN A 1 257 ? -17.260 37.795 63.037 1.00 40.78  ? 257  ASN A O   1 
ATOM   2100 C  CB  . ASN A 1 257 ? -19.433 38.419 65.193 1.00 45.07  ? 257  ASN A CB  1 
ATOM   2101 C  CG  . ASN A 1 257 ? -19.830 38.115 66.623 1.00 47.45  ? 257  ASN A CG  1 
ATOM   2102 O  OD1 . ASN A 1 257 ? -19.121 37.402 67.334 1.00 49.84  ? 257  ASN A OD1 1 
ATOM   2103 N  ND2 . ASN A 1 257 ? -20.969 38.648 67.051 1.00 49.68  ? 257  ASN A ND2 1 
ATOM   2104 N  N   . SER A 1 258 ? -17.549 40.022 62.980 1.00 38.36  ? 258  SER A N   1 
ATOM   2105 C  CA  . SER A 1 258 ? -17.167 40.120 61.574 1.00 37.06  ? 258  SER A CA  1 
ATOM   2106 C  C   . SER A 1 258 ? -16.795 41.549 61.200 1.00 35.57  ? 258  SER A C   1 
ATOM   2107 O  O   . SER A 1 258 ? -17.144 42.491 61.910 1.00 37.09  ? 258  SER A O   1 
ATOM   2108 C  CB  . SER A 1 258 ? -18.318 39.660 60.680 1.00 35.39  ? 258  SER A CB  1 
ATOM   2109 O  OG  . SER A 1 258 ? -19.405 40.562 60.772 1.00 35.59  ? 258  SER A OG  1 
ATOM   2110 N  N   . ASP A 1 259 ? -16.088 41.703 60.083 1.00 35.85  ? 259  ASP A N   1 
ATOM   2111 C  CA  . ASP A 1 259 ? -15.691 43.028 59.612 1.00 36.54  ? 259  ASP A CA  1 
ATOM   2112 C  C   . ASP A 1 259 ? -16.934 43.881 59.405 1.00 36.96  ? 259  ASP A C   1 
ATOM   2113 O  O   . ASP A 1 259 ? -16.960 45.056 59.767 1.00 37.63  ? 259  ASP A O   1 
ATOM   2114 C  CB  . ASP A 1 259 ? -14.925 42.931 58.290 1.00 33.99  ? 259  ASP A CB  1 
ATOM   2115 C  CG  . ASP A 1 259 ? -13.523 42.384 58.464 1.00 35.01  ? 259  ASP A CG  1 
ATOM   2116 O  OD1 . ASP A 1 259 ? -12.807 42.245 57.449 1.00 34.67  ? 259  ASP A OD1 1 
ATOM   2117 O  OD2 . ASP A 1 259 ? -13.131 42.097 59.614 1.00 35.58  ? 259  ASP A OD2 1 
ATOM   2118 N  N   . GLU A 1 260 ? -17.962 43.277 58.818 1.00 37.11  ? 260  GLU A N   1 
ATOM   2119 C  CA  . GLU A 1 260 ? -19.217 43.968 58.548 1.00 38.23  ? 260  GLU A CA  1 
ATOM   2120 C  C   . GLU A 1 260 ? -19.807 44.563 59.823 1.00 36.47  ? 260  GLU A C   1 
ATOM   2121 O  O   . GLU A 1 260 ? -20.203 45.729 59.853 1.00 36.62  ? 260  GLU A O   1 
ATOM   2122 C  CB  . GLU A 1 260 ? -20.230 42.999 57.927 1.00 41.63  ? 260  GLU A CB  1 
ATOM   2123 C  CG  . GLU A 1 260 ? -19.806 42.390 56.589 1.00 47.51  ? 260  GLU A CG  1 
ATOM   2124 C  CD  . GLU A 1 260 ? -18.541 41.544 56.681 1.00 51.60  ? 260  GLU A CD  1 
ATOM   2125 O  OE1 . GLU A 1 260 ? -18.471 40.651 57.554 1.00 53.12  ? 260  GLU A OE1 1 
ATOM   2126 O  OE2 . GLU A 1 260 ? -17.617 41.765 55.870 1.00 54.50  ? 260  GLU A OE2 1 
ATOM   2127 N  N   A GLU A 1 261 ? -19.865 43.750 60.872 0.50 35.53  ? 261  GLU A N   1 
ATOM   2128 N  N   B GLU A 1 261 ? -19.865 43.757 60.875 0.50 35.74  ? 261  GLU A N   1 
ATOM   2129 C  CA  A GLU A 1 261 ? -20.400 44.183 62.157 0.50 34.95  ? 261  GLU A CA  1 
ATOM   2130 C  CA  B GLU A 1 261 ? -20.417 44.208 62.144 0.50 35.31  ? 261  GLU A CA  1 
ATOM   2131 C  C   A GLU A 1 261 ? -19.512 45.248 62.792 0.50 33.71  ? 261  GLU A C   1 
ATOM   2132 C  C   B GLU A 1 261 ? -19.513 45.247 62.806 0.50 33.92  ? 261  GLU A C   1 
ATOM   2133 O  O   A GLU A 1 261 ? -20.003 46.259 63.296 0.50 33.29  ? 261  GLU A O   1 
ATOM   2134 O  O   B GLU A 1 261 ? -19.996 46.244 63.344 0.50 33.43  ? 261  GLU A O   1 
ATOM   2135 C  CB  A GLU A 1 261 ? -20.522 42.986 63.107 0.50 36.22  ? 261  GLU A CB  1 
ATOM   2136 C  CB  B GLU A 1 261 ? -20.631 43.005 63.064 0.50 37.05  ? 261  GLU A CB  1 
ATOM   2137 C  CG  A GLU A 1 261 ? -21.668 42.041 62.776 0.50 38.68  ? 261  GLU A CG  1 
ATOM   2138 C  CG  B GLU A 1 261 ? -21.536 41.950 62.438 0.50 40.30  ? 261  GLU A CG  1 
ATOM   2139 C  CD  A GLU A 1 261 ? -23.010 42.571 63.241 0.50 39.60  ? 261  GLU A CD  1 
ATOM   2140 C  CD  B GLU A 1 261 ? -21.621 40.680 63.253 0.50 41.33  ? 261  GLU A CD  1 
ATOM   2141 O  OE1 A GLU A 1 261 ? -23.307 43.756 62.979 0.50 41.39  ? 261  GLU A OE1 1 
ATOM   2142 O  OE1 B GLU A 1 261 ? -22.205 40.714 64.357 0.50 44.01  ? 261  GLU A OE1 1 
ATOM   2143 O  OE2 A GLU A 1 261 ? -23.772 41.800 63.864 0.50 40.67  ? 261  GLU A OE2 1 
ATOM   2144 O  OE2 B GLU A 1 261 ? -21.097 39.647 62.787 0.50 42.64  ? 261  GLU A OE2 1 
ATOM   2145 N  N   . LEU A 1 262 ? -18.205 45.015 62.760 1.00 32.54  ? 262  LEU A N   1 
ATOM   2146 C  CA  . LEU A 1 262 ? -17.245 45.950 63.341 1.00 31.66  ? 262  LEU A CA  1 
ATOM   2147 C  C   . LEU A 1 262 ? -17.350 47.313 62.656 1.00 30.89  ? 262  LEU A C   1 
ATOM   2148 O  O   . LEU A 1 262 ? -17.525 48.341 63.311 1.00 30.75  ? 262  LEU A O   1 
ATOM   2149 C  CB  . LEU A 1 262 ? -15.820 45.402 63.196 1.00 30.85  ? 262  LEU A CB  1 
ATOM   2150 C  CG  . LEU A 1 262 ? -14.679 46.342 63.608 1.00 29.76  ? 262  LEU A CG  1 
ATOM   2151 C  CD1 . LEU A 1 262 ? -14.888 46.830 65.037 1.00 26.84  ? 262  LEU A CD1 1 
ATOM   2152 C  CD2 . LEU A 1 262 ? -13.350 45.612 63.473 1.00 27.26  ? 262  LEU A CD2 1 
ATOM   2153 N  N   . ILE A 1 263 ? -17.256 47.310 61.331 1.00 30.53  ? 263  ILE A N   1 
ATOM   2154 C  CA  . ILE A 1 263 ? -17.335 48.541 60.557 1.00 30.70  ? 263  ILE A CA  1 
ATOM   2155 C  C   . ILE A 1 263 ? -18.662 49.258 60.789 1.00 32.25  ? 263  ILE A C   1 
ATOM   2156 O  O   . ILE A 1 263 ? -18.696 50.481 60.936 1.00 31.21  ? 263  ILE A O   1 
ATOM   2157 C  CB  . ILE A 1 263 ? -17.140 48.246 59.048 1.00 31.17  ? 263  ILE A CB  1 
ATOM   2158 C  CG1 . ILE A 1 263 ? -15.736 47.680 58.822 1.00 30.82  ? 263  ILE A CG1 1 
ATOM   2159 C  CG2 . ILE A 1 263 ? -17.344 49.508 58.226 1.00 31.50  ? 263  ILE A CG2 1 
ATOM   2160 C  CD1 . ILE A 1 263 ? -15.451 47.254 57.399 1.00 31.67  ? 263  ILE A CD1 1 
ATOM   2161 N  N   . HIS A 1 264 ? -19.755 48.501 60.833 1.00 33.22  ? 264  HIS A N   1 
ATOM   2162 C  CA  . HIS A 1 264 ? -21.072 49.094 61.062 1.00 34.35  ? 264  HIS A CA  1 
ATOM   2163 C  C   . HIS A 1 264 ? -21.083 49.860 62.382 1.00 32.73  ? 264  HIS A C   1 
ATOM   2164 O  O   . HIS A 1 264 ? -21.586 50.979 62.469 1.00 32.87  ? 264  HIS A O   1 
ATOM   2165 C  CB  . HIS A 1 264 ? -22.149 48.009 61.111 1.00 37.64  ? 264  HIS A CB  1 
ATOM   2166 C  CG  . HIS A 1 264 ? -23.501 48.526 61.494 1.00 41.78  ? 264  HIS A CG  1 
ATOM   2167 N  ND1 . HIS A 1 264 ? -24.304 49.229 60.623 1.00 44.53  ? 264  HIS A ND1 1 
ATOM   2168 C  CD2 . HIS A 1 264 ? -24.170 48.483 62.671 1.00 43.49  ? 264  HIS A CD2 1 
ATOM   2169 C  CE1 . HIS A 1 264 ? -25.410 49.598 61.246 1.00 45.54  ? 264  HIS A CE1 1 
ATOM   2170 N  NE2 . HIS A 1 264 ? -25.353 49.158 62.490 1.00 45.26  ? 264  HIS A NE2 1 
ATOM   2171 N  N   . CYS A 1 265 ? -20.530 49.233 63.412 1.00 33.18  ? 265  CYS A N   1 
ATOM   2172 C  CA  . CYS A 1 265 ? -20.462 49.825 64.738 1.00 32.58  ? 265  CYS A CA  1 
ATOM   2173 C  C   . CYS A 1 265 ? -19.626 51.102 64.726 1.00 31.81  ? 265  CYS A C   1 
ATOM   2174 O  O   . CYS A 1 265 ? -20.058 52.144 65.220 1.00 31.53  ? 265  CYS A O   1 
ATOM   2175 C  CB  . CYS A 1 265 ? -19.858 48.809 65.707 1.00 33.45  ? 265  CYS A CB  1 
ATOM   2176 S  SG  . CYS A 1 265 ? -19.611 49.362 67.424 1.00 35.98  ? 265  CYS A SG  1 
ATOM   2177 N  N   . LEU A 1 266 ? -18.430 51.017 64.152 1.00 31.26  ? 266  LEU A N   1 
ATOM   2178 C  CA  . LEU A 1 266 ? -17.539 52.170 64.091 1.00 30.65  ? 266  LEU A CA  1 
ATOM   2179 C  C   . LEU A 1 266 ? -18.162 53.340 63.338 1.00 31.44  ? 266  LEU A C   1 
ATOM   2180 O  O   . LEU A 1 266 ? -17.913 54.500 63.668 1.00 31.99  ? 266  LEU A O   1 
ATOM   2181 C  CB  . LEU A 1 266 ? -16.206 51.773 63.447 1.00 29.07  ? 266  LEU A CB  1 
ATOM   2182 C  CG  . LEU A 1 266 ? -15.378 50.756 64.242 1.00 28.01  ? 266  LEU A CG  1 
ATOM   2183 C  CD1 . LEU A 1 266 ? -14.110 50.414 63.477 1.00 28.59  ? 266  LEU A CD1 1 
ATOM   2184 C  CD2 . LEU A 1 266 ? -15.038 51.328 65.615 1.00 28.38  ? 266  LEU A CD2 1 
ATOM   2185 N  N   . ARG A 1 267 ? -18.980 53.038 62.335 1.00 31.00  ? 267  ARG A N   1 
ATOM   2186 C  CA  . ARG A 1 267 ? -19.624 54.088 61.557 1.00 32.10  ? 267  ARG A CA  1 
ATOM   2187 C  C   . ARG A 1 267 ? -20.756 54.777 62.312 1.00 32.18  ? 267  ARG A C   1 
ATOM   2188 O  O   . ARG A 1 267 ? -21.158 55.884 61.957 1.00 32.36  ? 267  ARG A O   1 
ATOM   2189 C  CB  . ARG A 1 267 ? -20.151 53.523 60.232 1.00 32.73  ? 267  ARG A CB  1 
ATOM   2190 C  CG  . ARG A 1 267 ? -19.063 53.315 59.195 1.00 32.39  ? 267  ARG A CG  1 
ATOM   2191 C  CD  . ARG A 1 267 ? -19.607 52.733 57.903 1.00 33.27  ? 267  ARG A CD  1 
ATOM   2192 N  NE  . ARG A 1 267 ? -18.571 52.664 56.876 1.00 33.63  ? 267  ARG A NE  1 
ATOM   2193 C  CZ  . ARG A 1 267 ? -18.629 51.879 55.803 1.00 34.92  ? 267  ARG A CZ  1 
ATOM   2194 N  NH1 . ARG A 1 267 ? -19.679 51.087 55.612 1.00 33.34  ? 267  ARG A NH1 1 
ATOM   2195 N  NH2 . ARG A 1 267 ? -17.635 51.882 54.924 1.00 33.52  ? 267  ARG A NH2 1 
ATOM   2196 N  N   . GLU A 1 268 ? -21.266 54.130 63.354 1.00 33.66  ? 268  GLU A N   1 
ATOM   2197 C  CA  . GLU A 1 268 ? -22.349 54.715 64.141 1.00 36.49  ? 268  GLU A CA  1 
ATOM   2198 C  C   . GLU A 1 268 ? -21.817 55.658 65.215 1.00 35.31  ? 268  GLU A C   1 
ATOM   2199 O  O   . GLU A 1 268 ? -22.556 56.485 65.745 1.00 36.11  ? 268  GLU A O   1 
ATOM   2200 C  CB  . GLU A 1 268 ? -23.187 53.615 64.801 1.00 41.34  ? 268  GLU A CB  1 
ATOM   2201 C  CG  . GLU A 1 268 ? -23.977 52.761 63.822 1.00 48.82  ? 268  GLU A CG  1 
ATOM   2202 C  CD  . GLU A 1 268 ? -24.986 53.573 63.025 1.00 54.12  ? 268  GLU A CD  1 
ATOM   2203 O  OE1 . GLU A 1 268 ? -25.910 54.147 63.640 1.00 57.31  ? 268  GLU A OE1 1 
ATOM   2204 O  OE2 . GLU A 1 268 ? -24.854 53.640 61.784 1.00 57.75  ? 268  GLU A OE2 1 
ATOM   2205 N  N   . LYS A 1 269 ? -20.533 55.533 65.531 1.00 34.33  ? 269  LYS A N   1 
ATOM   2206 C  CA  . LYS A 1 269 ? -19.916 56.371 66.554 1.00 33.43  ? 269  LYS A CA  1 
ATOM   2207 C  C   . LYS A 1 269 ? -19.662 57.792 66.064 1.00 33.09  ? 269  LYS A C   1 
ATOM   2208 O  O   . LYS A 1 269 ? -19.396 58.015 64.883 1.00 33.07  ? 269  LYS A O   1 
ATOM   2209 C  CB  . LYS A 1 269 ? -18.586 55.759 66.997 1.00 33.43  ? 269  LYS A CB  1 
ATOM   2210 C  CG  . LYS A 1 269 ? -18.674 54.312 67.433 1.00 35.42  ? 269  LYS A CG  1 
ATOM   2211 C  CD  . LYS A 1 269 ? -19.570 54.150 68.653 1.00 37.22  ? 269  LYS A CD  1 
ATOM   2212 C  CE  . LYS A 1 269 ? -19.627 52.697 69.094 1.00 37.32  ? 269  LYS A CE  1 
ATOM   2213 N  NZ  . LYS A 1 269 ? -20.456 52.524 70.317 1.00 39.98  ? 269  LYS A NZ  1 
ATOM   2214 N  N   . LYS A 1 270 ? -19.752 58.756 66.974 1.00 32.65  ? 270  LYS A N   1 
ATOM   2215 C  CA  . LYS A 1 270 ? -19.477 60.140 66.616 1.00 31.95  ? 270  LYS A CA  1 
ATOM   2216 C  C   . LYS A 1 270 ? -17.960 60.218 66.430 1.00 30.03  ? 270  LYS A C   1 
ATOM   2217 O  O   . LYS A 1 270 ? -17.220 59.407 66.989 1.00 27.22  ? 270  LYS A O   1 
ATOM   2218 C  CB  . LYS A 1 270 ? -19.932 61.085 67.730 1.00 34.78  ? 270  LYS A CB  1 
ATOM   2219 C  CG  . LYS A 1 270 ? -21.443 61.117 67.924 1.00 40.41  ? 270  LYS A CG  1 
ATOM   2220 C  CD  . LYS A 1 270 ? -21.855 62.123 68.990 1.00 45.14  ? 270  LYS A CD  1 
ATOM   2221 C  CE  . LYS A 1 270 ? -23.374 62.215 69.106 1.00 49.58  ? 270  LYS A CE  1 
ATOM   2222 N  NZ  . LYS A 1 270 ? -23.815 63.241 70.100 1.00 52.24  ? 270  LYS A NZ  1 
ATOM   2223 N  N   . PRO A 1 271 ? -17.477 61.187 65.638 1.00 28.28  ? 271  PRO A N   1 
ATOM   2224 C  CA  . PRO A 1 271 ? -16.035 61.320 65.408 1.00 28.00  ? 271  PRO A CA  1 
ATOM   2225 C  C   . PRO A 1 271 ? -15.180 61.331 66.679 1.00 26.56  ? 271  PRO A C   1 
ATOM   2226 O  O   . PRO A 1 271 ? -14.187 60.614 66.768 1.00 25.11  ? 271  PRO A O   1 
ATOM   2227 C  CB  . PRO A 1 271 ? -15.931 62.631 64.628 1.00 27.27  ? 271  PRO A CB  1 
ATOM   2228 C  CG  . PRO A 1 271 ? -17.214 62.649 63.845 1.00 28.02  ? 271  PRO A CG  1 
ATOM   2229 C  CD  . PRO A 1 271 ? -18.228 62.205 64.882 1.00 28.21  ? 271  PRO A CD  1 
ATOM   2230 N  N   . GLN A 1 272 ? -15.575 62.136 67.659 1.00 27.17  ? 272  GLN A N   1 
ATOM   2231 C  CA  . GLN A 1 272 ? -14.817 62.248 68.901 1.00 27.26  ? 272  GLN A CA  1 
ATOM   2232 C  C   . GLN A 1 272 ? -14.732 60.946 69.698 1.00 28.22  ? 272  GLN A C   1 
ATOM   2233 O  O   . GLN A 1 272 ? -13.803 60.758 70.486 1.00 28.91  ? 272  GLN A O   1 
ATOM   2234 C  CB  . GLN A 1 272 ? -15.406 63.360 69.776 1.00 29.17  ? 272  GLN A CB  1 
ATOM   2235 C  CG  . GLN A 1 272 ? -14.468 63.846 70.882 1.00 31.63  ? 272  GLN A CG  1 
ATOM   2236 C  CD  . GLN A 1 272 ? -13.090 64.230 70.356 1.00 32.16  ? 272  GLN A CD  1 
ATOM   2237 O  OE1 . GLN A 1 272 ? -12.968 64.922 69.342 1.00 33.42  ? 272  GLN A OE1 1 
ATOM   2238 N  NE2 . GLN A 1 272 ? -12.044 63.784 71.050 1.00 32.35  ? 272  GLN A NE2 1 
ATOM   2239 N  N   . GLU A 1 273 ? -15.690 60.045 69.497 1.00 27.09  ? 273  GLU A N   1 
ATOM   2240 C  CA  . GLU A 1 273 ? -15.673 58.770 70.211 1.00 28.02  ? 273  GLU A CA  1 
ATOM   2241 C  C   . GLU A 1 273 ? -14.496 57.912 69.757 1.00 26.20  ? 273  GLU A C   1 
ATOM   2242 O  O   . GLU A 1 273 ? -13.893 57.197 70.561 1.00 26.08  ? 273  GLU A O   1 
ATOM   2243 C  CB  . GLU A 1 273 ? -16.983 58.008 69.994 1.00 30.23  ? 273  GLU A CB  1 
ATOM   2244 C  CG  . GLU A 1 273 ? -18.200 58.712 70.561 1.00 32.06  ? 273  GLU A CG  1 
ATOM   2245 C  CD  . GLU A 1 273 ? -19.445 57.854 70.487 1.00 35.27  ? 273  GLU A CD  1 
ATOM   2246 O  OE1 . GLU A 1 273 ? -19.546 56.886 71.270 1.00 35.33  ? 273  GLU A OE1 1 
ATOM   2247 O  OE2 . GLU A 1 273 ? -20.313 58.143 69.637 1.00 34.93  ? 273  GLU A OE2 1 
ATOM   2248 N  N   A LEU A 1 274 ? -14.182 57.983 68.468 0.50 24.91  ? 274  LEU A N   1 
ATOM   2249 N  N   B LEU A 1 274 ? -14.174 57.967 68.468 0.50 25.13  ? 274  LEU A N   1 
ATOM   2250 C  CA  A LEU A 1 274 ? -13.068 57.226 67.909 0.50 24.98  ? 274  LEU A CA  1 
ATOM   2251 C  CA  B LEU A 1 274 ? -13.046 57.199 67.952 0.50 25.34  ? 274  LEU A CA  1 
ATOM   2252 C  C   A LEU A 1 274 ? -11.762 57.861 68.380 0.50 24.07  ? 274  LEU A C   1 
ATOM   2253 C  C   B LEU A 1 274 ? -11.752 57.863 68.411 0.50 24.27  ? 274  LEU A C   1 
ATOM   2254 O  O   A LEU A 1 274 ? -10.837 57.173 68.813 0.50 24.73  ? 274  LEU A O   1 
ATOM   2255 O  O   B LEU A 1 274 ? -10.823 57.194 68.864 0.50 24.85  ? 274  LEU A O   1 
ATOM   2256 C  CB  A LEU A 1 274 ? -13.127 57.247 66.378 0.50 24.67  ? 274  LEU A CB  1 
ATOM   2257 C  CB  B LEU A 1 274 ? -13.076 57.138 66.421 0.50 25.49  ? 274  LEU A CB  1 
ATOM   2258 C  CG  A LEU A 1 274 ? -14.410 56.726 65.721 0.50 24.93  ? 274  LEU A CG  1 
ATOM   2259 C  CG  B LEU A 1 274 ? -14.072 56.171 65.774 0.50 26.36  ? 274  LEU A CG  1 
ATOM   2260 C  CD1 A LEU A 1 274 ? -14.296 56.840 64.206 0.50 24.87  ? 274  LEU A CD1 1 
ATOM   2261 C  CD1 B LEU A 1 274 ? -15.491 56.567 66.141 0.50 25.85  ? 274  LEU A CD1 1 
ATOM   2262 C  CD2 A LEU A 1 274 ? -14.646 55.279 66.131 0.50 23.96  ? 274  LEU A CD2 1 
ATOM   2263 C  CD2 B LEU A 1 274 ? -13.887 56.183 64.262 0.50 25.75  ? 274  LEU A CD2 1 
ATOM   2264 N  N   . ILE A 1 275 ? -11.705 59.185 68.294 1.00 24.08  ? 275  ILE A N   1 
ATOM   2265 C  CA  . ILE A 1 275 ? -10.530 59.949 68.697 1.00 24.45  ? 275  ILE A CA  1 
ATOM   2266 C  C   . ILE A 1 275 ? -10.192 59.758 70.175 1.00 24.23  ? 275  ILE A C   1 
ATOM   2267 O  O   . ILE A 1 275 ? -9.019  59.670 70.537 1.00 23.10  ? 275  ILE A O   1 
ATOM   2268 C  CB  . ILE A 1 275 ? -10.743 61.452 68.406 1.00 24.81  ? 275  ILE A CB  1 
ATOM   2269 C  CG1 . ILE A 1 275 ? -10.873 61.662 66.896 1.00 25.30  ? 275  ILE A CG1 1 
ATOM   2270 C  CG2 . ILE A 1 275 ? -9.589  62.275 68.969 1.00 25.39  ? 275  ILE A CG2 1 
ATOM   2271 C  CD1 . ILE A 1 275 ? -11.325 63.055 66.510 1.00 25.24  ? 275  ILE A CD1 1 
ATOM   2272 N  N   . ASP A 1 276 ? -11.215 59.681 71.024 1.00 24.75  ? 276  ASP A N   1 
ATOM   2273 C  CA  . ASP A 1 276 ? -10.996 59.506 72.460 1.00 25.77  ? 276  ASP A CA  1 
ATOM   2274 C  C   . ASP A 1 276 ? -10.267 58.225 72.862 1.00 26.62  ? 276  ASP A C   1 
ATOM   2275 O  O   . ASP A 1 276 ? -9.653  58.177 73.930 1.00 27.44  ? 276  ASP A O   1 
ATOM   2276 C  CB  . ASP A 1 276 ? -12.324 59.572 73.227 1.00 28.08  ? 276  ASP A CB  1 
ATOM   2277 C  CG  . ASP A 1 276 ? -12.842 60.992 73.385 1.00 29.89  ? 276  ASP A CG  1 
ATOM   2278 O  OD1 . ASP A 1 276 ? -12.057 61.950 73.219 1.00 31.88  ? 276  ASP A OD1 1 
ATOM   2279 O  OD2 . ASP A 1 276 ? -14.039 61.149 73.693 1.00 32.53  ? 276  ASP A OD2 1 
ATOM   2280 N  N   . VAL A 1 277 ? -10.329 57.188 72.028 1.00 24.44  ? 277  VAL A N   1 
ATOM   2281 C  CA  . VAL A 1 277 ? -9.657  55.926 72.355 1.00 23.31  ? 277  VAL A CA  1 
ATOM   2282 C  C   . VAL A 1 277 ? -8.575  55.523 71.347 1.00 23.13  ? 277  VAL A C   1 
ATOM   2283 O  O   . VAL A 1 277 ? -7.944  54.472 71.486 1.00 23.96  ? 277  VAL A O   1 
ATOM   2284 C  CB  . VAL A 1 277 ? -10.677 54.756 72.469 1.00 23.02  ? 277  VAL A CB  1 
ATOM   2285 C  CG1 . VAL A 1 277 ? -11.660 55.027 73.595 1.00 21.00  ? 277  VAL A CG1 1 
ATOM   2286 C  CG2 . VAL A 1 277 ? -11.424 54.575 71.149 1.00 24.23  ? 277  VAL A CG2 1 
ATOM   2287 N  N   . GLU A 1 278 ? -8.357  56.370 70.347 1.00 22.49  ? 278  GLU A N   1 
ATOM   2288 C  CA  . GLU A 1 278 ? -7.375  56.115 69.293 1.00 22.99  ? 278  GLU A CA  1 
ATOM   2289 C  C   . GLU A 1 278 ? -5.995  55.647 69.771 1.00 23.08  ? 278  GLU A C   1 
ATOM   2290 O  O   . GLU A 1 278 ? -5.408  54.727 69.198 1.00 23.80  ? 278  GLU A O   1 
ATOM   2291 C  CB  . GLU A 1 278 ? -7.216  57.376 68.433 1.00 23.96  ? 278  GLU A CB  1 
ATOM   2292 C  CG  . GLU A 1 278 ? -6.027  57.350 67.482 1.00 25.79  ? 278  GLU A CG  1 
ATOM   2293 C  CD  . GLU A 1 278 ? -5.868  58.640 66.691 1.00 26.93  ? 278  GLU A CD  1 
ATOM   2294 O  OE1 . GLU A 1 278 ? -4.780  58.842 66.108 1.00 29.31  ? 278  GLU A OE1 1 
ATOM   2295 O  OE2 . GLU A 1 278 ? -6.823  59.447 66.641 1.00 26.19  ? 278  GLU A OE2 1 
ATOM   2296 N  N   . TRP A 1 279 ? -5.477  56.275 70.819 1.00 23.10  ? 279  TRP A N   1 
ATOM   2297 C  CA  . TRP A 1 279 ? -4.155  55.927 71.324 1.00 24.60  ? 279  TRP A CA  1 
ATOM   2298 C  C   . TRP A 1 279 ? -4.086  54.644 72.148 1.00 26.80  ? 279  TRP A C   1 
ATOM   2299 O  O   . TRP A 1 279 ? -2.995  54.186 72.497 1.00 28.91  ? 279  TRP A O   1 
ATOM   2300 C  CB  . TRP A 1 279 ? -3.594  57.091 72.144 1.00 24.98  ? 279  TRP A CB  1 
ATOM   2301 C  CG  . TRP A 1 279 ? -3.447  58.345 71.341 1.00 26.52  ? 279  TRP A CG  1 
ATOM   2302 C  CD1 . TRP A 1 279 ? -4.343  59.372 71.239 1.00 27.47  ? 279  TRP A CD1 1 
ATOM   2303 C  CD2 . TRP A 1 279 ? -2.345  58.687 70.497 1.00 25.99  ? 279  TRP A CD2 1 
ATOM   2304 N  NE1 . TRP A 1 279 ? -3.864  60.335 70.380 1.00 27.59  ? 279  TRP A NE1 1 
ATOM   2305 C  CE2 . TRP A 1 279 ? -2.638  59.937 69.911 1.00 29.03  ? 279  TRP A CE2 1 
ATOM   2306 C  CE3 . TRP A 1 279 ? -1.134  58.056 70.177 1.00 26.74  ? 279  TRP A CE3 1 
ATOM   2307 C  CZ2 . TRP A 1 279 ? -1.761  60.574 69.020 1.00 29.47  ? 279  TRP A CZ2 1 
ATOM   2308 C  CZ3 . TRP A 1 279 ? -0.262  58.688 69.291 1.00 28.94  ? 279  TRP A CZ3 1 
ATOM   2309 C  CH2 . TRP A 1 279 ? -0.582  59.935 68.724 1.00 27.57  ? 279  TRP A CH2 1 
ATOM   2310 N  N   . ASN A 1 280 ? -5.236  54.053 72.449 1.00 24.92  ? 280  ASN A N   1 
ATOM   2311 C  CA  . ASN A 1 280 ? -5.254  52.834 73.249 1.00 25.49  ? 280  ASN A CA  1 
ATOM   2312 C  C   . ASN A 1 280 ? -4.948  51.562 72.470 1.00 24.67  ? 280  ASN A C   1 
ATOM   2313 O  O   . ASN A 1 280 ? -4.804  50.499 73.068 1.00 24.72  ? 280  ASN A O   1 
ATOM   2314 C  CB  . ASN A 1 280 ? -6.610  52.670 73.944 1.00 23.99  ? 280  ASN A CB  1 
ATOM   2315 C  CG  . ASN A 1 280 ? -6.938  53.829 74.862 1.00 27.17  ? 280  ASN A CG  1 
ATOM   2316 O  OD1 . ASN A 1 280 ? -6.055  54.599 75.245 1.00 24.88  ? 280  ASN A OD1 1 
ATOM   2317 N  ND2 . ASN A 1 280 ? -8.211  53.955 75.231 1.00 23.30  ? 280  ASN A ND2 1 
ATOM   2318 N  N   . VAL A 1 281 ? -4.829  51.661 71.149 1.00 24.37  ? 281  VAL A N   1 
ATOM   2319 C  CA  . VAL A 1 281 ? -4.579  50.474 70.338 1.00 23.58  ? 281  VAL A CA  1 
ATOM   2320 C  C   . VAL A 1 281 ? -3.116  50.194 69.992 1.00 24.32  ? 281  VAL A C   1 
ATOM   2321 O  O   . VAL A 1 281 ? -2.820  49.215 69.308 1.00 23.02  ? 281  VAL A O   1 
ATOM   2322 C  CB  . VAL A 1 281 ? -5.403  50.519 69.022 1.00 23.64  ? 281  VAL A CB  1 
ATOM   2323 C  CG1 . VAL A 1 281 ? -6.876  50.759 69.343 1.00 24.70  ? 281  VAL A CG1 1 
ATOM   2324 C  CG2 . VAL A 1 281 ? -4.872  51.607 68.097 1.00 21.32  ? 281  VAL A CG2 1 
ATOM   2325 N  N   . LEU A 1 282 ? -2.199  51.037 70.458 1.00 24.32  ? 282  LEU A N   1 
ATOM   2326 C  CA  . LEU A 1 282 ? -0.782  50.812 70.171 1.00 23.87  ? 282  LEU A CA  1 
ATOM   2327 C  C   . LEU A 1 282 ? -0.335  49.526 70.856 1.00 24.52  ? 282  LEU A C   1 
ATOM   2328 O  O   . LEU A 1 282 ? -0.736  49.242 71.984 1.00 24.75  ? 282  LEU A O   1 
ATOM   2329 C  CB  . LEU A 1 282 ? 0.068   51.994 70.653 1.00 23.06  ? 282  LEU A CB  1 
ATOM   2330 C  CG  . LEU A 1 282 ? -0.104  53.296 69.860 1.00 22.63  ? 282  LEU A CG  1 
ATOM   2331 C  CD1 . LEU A 1 282 ? 0.755   54.397 70.475 1.00 24.06  ? 282  LEU A CD1 1 
ATOM   2332 C  CD2 . LEU A 1 282 ? 0.293   53.066 68.406 1.00 22.92  ? 282  LEU A CD2 1 
ATOM   2333 N  N   . PRO A 1 283 ? 0.505   48.729 70.181 1.00 24.61  ? 283  PRO A N   1 
ATOM   2334 C  CA  . PRO A 1 283 ? 0.979   47.469 70.761 1.00 24.59  ? 283  PRO A CA  1 
ATOM   2335 C  C   . PRO A 1 283 ? 2.010   47.610 71.873 1.00 26.32  ? 283  PRO A C   1 
ATOM   2336 O  O   . PRO A 1 283 ? 2.105   46.746 72.742 1.00 25.24  ? 283  PRO A O   1 
ATOM   2337 C  CB  . PRO A 1 283 ? 1.549   46.735 69.554 1.00 25.25  ? 283  PRO A CB  1 
ATOM   2338 C  CG  . PRO A 1 283 ? 2.118   47.868 68.733 1.00 24.86  ? 283  PRO A CG  1 
ATOM   2339 C  CD  . PRO A 1 283 ? 1.017   48.906 68.809 1.00 23.17  ? 283  PRO A CD  1 
ATOM   2340 N  N   . PHE A 1 284 ? 2.775   48.697 71.853 1.00 23.88  ? 284  PHE A N   1 
ATOM   2341 C  CA  . PHE A 1 284 ? 3.819   48.888 72.858 1.00 25.20  ? 284  PHE A CA  1 
ATOM   2342 C  C   . PHE A 1 284 ? 3.759   50.226 73.565 1.00 24.09  ? 284  PHE A C   1 
ATOM   2343 O  O   . PHE A 1 284 ? 3.125   51.170 73.098 1.00 21.87  ? 284  PHE A O   1 
ATOM   2344 C  CB  . PHE A 1 284 ? 5.212   48.813 72.218 1.00 26.78  ? 284  PHE A CB  1 
ATOM   2345 C  CG  . PHE A 1 284 ? 5.435   47.618 71.340 1.00 30.38  ? 284  PHE A CG  1 
ATOM   2346 C  CD1 . PHE A 1 284 ? 5.474   46.336 71.877 1.00 31.41  ? 284  PHE A CD1 1 
ATOM   2347 C  CD2 . PHE A 1 284 ? 5.653   47.783 69.973 1.00 32.19  ? 284  PHE A CD2 1 
ATOM   2348 C  CE1 . PHE A 1 284 ? 5.733   45.230 71.065 1.00 33.79  ? 284  PHE A CE1 1 
ATOM   2349 C  CE2 . PHE A 1 284 ? 5.913   46.689 69.150 1.00 34.25  ? 284  PHE A CE2 1 
ATOM   2350 C  CZ  . PHE A 1 284 ? 5.953   45.408 69.698 1.00 33.51  ? 284  PHE A CZ  1 
ATOM   2351 N  N   . ASP A 1 285 ? 4.454   50.291 74.695 1.00 23.82  ? 285  ASP A N   1 
ATOM   2352 C  CA  . ASP A 1 285 ? 4.592   51.524 75.448 1.00 23.50  ? 285  ASP A CA  1 
ATOM   2353 C  C   . ASP A 1 285 ? 5.680   52.166 74.588 1.00 24.75  ? 285  ASP A C   1 
ATOM   2354 O  O   . ASP A 1 285 ? 6.818   51.690 74.560 1.00 25.37  ? 285  ASP A O   1 
ATOM   2355 C  CB  . ASP A 1 285 ? 5.126   51.223 76.848 1.00 26.15  ? 285  ASP A CB  1 
ATOM   2356 C  CG  . ASP A 1 285 ? 5.203   52.455 77.722 1.00 26.96  ? 285  ASP A CG  1 
ATOM   2357 O  OD1 . ASP A 1 285 ? 4.780   53.540 77.270 1.00 25.12  ? 285  ASP A OD1 1 
ATOM   2358 O  OD2 . ASP A 1 285 ? 5.685   52.331 78.865 1.00 30.04  ? 285  ASP A OD2 1 
ATOM   2359 N  N   . SER A 1 286 ? 5.342   53.234 73.879 1.00 22.95  ? 286  SER A N   1 
ATOM   2360 C  CA  . SER A 1 286 ? 6.315   53.836 72.980 1.00 23.05  ? 286  SER A CA  1 
ATOM   2361 C  C   . SER A 1 286 ? 6.124   55.316 72.710 1.00 23.15  ? 286  SER A C   1 
ATOM   2362 O  O   . SER A 1 286 ? 5.159   55.934 73.166 1.00 22.98  ? 286  SER A O   1 
ATOM   2363 C  CB  . SER A 1 286 ? 6.229   53.114 71.642 1.00 23.91  ? 286  SER A CB  1 
ATOM   2364 O  OG  . SER A 1 286 ? 4.898   53.217 71.131 1.00 24.15  ? 286  SER A OG  1 
ATOM   2365 N  N   . ILE A 1 287 ? 7.075   55.873 71.965 1.00 21.36  ? 287  ILE A N   1 
ATOM   2366 C  CA  . ILE A 1 287 ? 6.998   57.255 71.523 1.00 20.83  ? 287  ILE A CA  1 
ATOM   2367 C  C   . ILE A 1 287 ? 7.293   57.195 70.032 1.00 20.23  ? 287  ILE A C   1 
ATOM   2368 O  O   . ILE A 1 287 ? 7.932   56.256 69.551 1.00 18.79  ? 287  ILE A O   1 
ATOM   2369 C  CB  . ILE A 1 287 ? 8.014   58.191 72.231 1.00 21.49  ? 287  ILE A CB  1 
ATOM   2370 C  CG1 . ILE A 1 287 ? 9.447   57.715 71.996 1.00 21.36  ? 287  ILE A CG1 1 
ATOM   2371 C  CG2 . ILE A 1 287 ? 7.677   58.279 73.709 1.00 18.47  ? 287  ILE A CG2 1 
ATOM   2372 C  CD1 . ILE A 1 287 ? 10.493  58.681 72.559 1.00 23.55  ? 287  ILE A CD1 1 
ATOM   2373 N  N   . PHE A 1 288 ? 6.818   58.194 69.303 1.00 19.12  ? 288  PHE A N   1 
ATOM   2374 C  CA  . PHE A 1 288 ? 6.995   58.247 67.861 1.00 19.76  ? 288  PHE A CA  1 
ATOM   2375 C  C   . PHE A 1 288 ? 6.355   57.041 67.168 1.00 20.80  ? 288  PHE A C   1 
ATOM   2376 O  O   . PHE A 1 288 ? 6.903   56.494 66.210 1.00 21.52  ? 288  PHE A O   1 
ATOM   2377 C  CB  . PHE A 1 288 ? 8.479   58.339 67.481 1.00 18.59  ? 288  PHE A CB  1 
ATOM   2378 C  CG  . PHE A 1 288 ? 8.750   59.322 66.371 1.00 20.01  ? 288  PHE A CG  1 
ATOM   2379 C  CD1 . PHE A 1 288 ? 7.979   59.307 65.207 1.00 18.17  ? 288  PHE A CD1 1 
ATOM   2380 C  CD2 . PHE A 1 288 ? 9.752   60.282 66.499 1.00 19.76  ? 288  PHE A CD2 1 
ATOM   2381 C  CE1 . PHE A 1 288 ? 8.198   60.234 64.191 1.00 20.05  ? 288  PHE A CE1 1 
ATOM   2382 C  CE2 . PHE A 1 288 ? 9.981   61.219 65.483 1.00 19.59  ? 288  PHE A CE2 1 
ATOM   2383 C  CZ  . PHE A 1 288 ? 9.202   61.195 64.329 1.00 20.82  ? 288  PHE A CZ  1 
ATOM   2384 N  N   . ARG A 1 289 ? 5.212   56.604 67.687 1.00 21.93  ? 289  ARG A N   1 
ATOM   2385 C  CA  . ARG A 1 289 ? 4.458   55.511 67.077 1.00 22.27  ? 289  ARG A CA  1 
ATOM   2386 C  C   . ARG A 1 289 ? 3.014   55.991 67.097 1.00 21.36  ? 289  ARG A C   1 
ATOM   2387 O  O   . ARG A 1 289 ? 2.507   56.427 68.136 1.00 19.43  ? 289  ARG A O   1 
ATOM   2388 C  CB  . ARG A 1 289 ? 4.613   54.199 67.855 1.00 20.63  ? 289  ARG A CB  1 
ATOM   2389 C  CG  . ARG A 1 289 ? 6.000   53.563 67.739 1.00 22.07  ? 289  ARG A CG  1 
ATOM   2390 C  CD  . ARG A 1 289 ? 6.326   53.122 66.309 1.00 21.66  ? 289  ARG A CD  1 
ATOM   2391 N  NE  . ARG A 1 289 ? 7.607   52.412 66.224 1.00 22.30  ? 289  ARG A NE  1 
ATOM   2392 C  CZ  . ARG A 1 289 ? 8.795   52.997 66.081 1.00 23.34  ? 289  ARG A CZ  1 
ATOM   2393 N  NH1 . ARG A 1 289 ? 8.892   54.318 65.997 1.00 19.19  ? 289  ARG A NH1 1 
ATOM   2394 N  NH2 . ARG A 1 289 ? 9.897   52.258 66.033 1.00 21.19  ? 289  ARG A NH2 1 
ATOM   2395 N  N   . PHE A 1 290 ? 2.366   55.927 65.939 1.00 20.63  ? 290  PHE A N   1 
ATOM   2396 C  CA  . PHE A 1 290 ? 0.995   56.400 65.788 1.00 20.90  ? 290  PHE A CA  1 
ATOM   2397 C  C   . PHE A 1 290 ? 0.066   55.252 65.393 1.00 20.93  ? 290  PHE A C   1 
ATOM   2398 O  O   . PHE A 1 290 ? 0.451   54.356 64.651 1.00 21.05  ? 290  PHE A O   1 
ATOM   2399 C  CB  . PHE A 1 290 ? 1.003   57.535 64.760 1.00 19.92  ? 290  PHE A CB  1 
ATOM   2400 C  CG  . PHE A 1 290 ? 2.187   58.463 64.919 1.00 21.08  ? 290  PHE A CG  1 
ATOM   2401 C  CD1 . PHE A 1 290 ? 2.374   59.176 66.103 1.00 22.74  ? 290  PHE A CD1 1 
ATOM   2402 C  CD2 . PHE A 1 290 ? 3.145   58.576 63.915 1.00 21.30  ? 290  PHE A CD2 1 
ATOM   2403 C  CE1 . PHE A 1 290 ? 3.501   59.988 66.287 1.00 22.06  ? 290  PHE A CE1 1 
ATOM   2404 C  CE2 . PHE A 1 290 ? 4.271   59.381 64.087 1.00 22.75  ? 290  PHE A CE2 1 
ATOM   2405 C  CZ  . PHE A 1 290 ? 4.451   60.088 65.276 1.00 22.81  ? 290  PHE A CZ  1 
ATOM   2406 N  N   . SER A 1 291 ? -1.160  55.297 65.902 1.00 22.25  ? 291  SER A N   1 
ATOM   2407 C  CA  . SER A 1 291 ? -2.138  54.232 65.695 1.00 22.86  ? 291  SER A CA  1 
ATOM   2408 C  C   . SER A 1 291 ? -2.585  53.859 64.286 1.00 22.57  ? 291  SER A C   1 
ATOM   2409 O  O   . SER A 1 291 ? -2.467  52.698 63.885 1.00 22.17  ? 291  SER A O   1 
ATOM   2410 C  CB  . SER A 1 291 ? -3.373  54.513 66.556 1.00 22.00  ? 291  SER A CB  1 
ATOM   2411 O  OG  . SER A 1 291 ? -3.030  54.476 67.933 1.00 23.95  ? 291  SER A OG  1 
ATOM   2412 N  N   . PHE A 1 292 ? -3.101  54.828 63.537 1.00 20.55  ? 292  PHE A N   1 
ATOM   2413 C  CA  . PHE A 1 292 ? -3.600  54.550 62.196 1.00 21.18  ? 292  PHE A CA  1 
ATOM   2414 C  C   . PHE A 1 292 ? -2.761  55.205 61.117 1.00 20.54  ? 292  PHE A C   1 
ATOM   2415 O  O   . PHE A 1 292 ? -2.783  56.424 60.936 1.00 20.61  ? 292  PHE A O   1 
ATOM   2416 C  CB  . PHE A 1 292 ? -5.066  54.976 62.131 1.00 20.76  ? 292  PHE A CB  1 
ATOM   2417 C  CG  . PHE A 1 292 ? -5.922  54.252 63.131 1.00 22.30  ? 292  PHE A CG  1 
ATOM   2418 C  CD1 . PHE A 1 292 ? -6.229  52.905 62.949 1.00 21.22  ? 292  PHE A CD1 1 
ATOM   2419 C  CD2 . PHE A 1 292 ? -6.333  54.880 64.304 1.00 20.59  ? 292  PHE A CD2 1 
ATOM   2420 C  CE1 . PHE A 1 292 ? -6.927  52.191 63.926 1.00 23.09  ? 292  PHE A CE1 1 
ATOM   2421 C  CE2 . PHE A 1 292 ? -7.031  54.178 65.289 1.00 22.29  ? 292  PHE A CE2 1 
ATOM   2422 C  CZ  . PHE A 1 292 ? -7.328  52.830 65.101 1.00 22.34  ? 292  PHE A CZ  1 
ATOM   2423 N  N   . VAL A 1 293 ? -2.024  54.363 60.400 1.00 19.40  ? 293  VAL A N   1 
ATOM   2424 C  CA  . VAL A 1 293 ? -1.113  54.809 59.357 1.00 19.49  ? 293  VAL A CA  1 
ATOM   2425 C  C   . VAL A 1 293 ? -1.248  53.923 58.114 1.00 20.17  ? 293  VAL A C   1 
ATOM   2426 O  O   . VAL A 1 293 ? -1.967  52.928 58.131 1.00 20.81  ? 293  VAL A O   1 
ATOM   2427 C  CB  . VAL A 1 293 ? 0.349   54.729 59.873 1.00 19.74  ? 293  VAL A CB  1 
ATOM   2428 C  CG1 . VAL A 1 293 ? 0.512   55.586 61.122 1.00 18.32  ? 293  VAL A CG1 1 
ATOM   2429 C  CG2 . VAL A 1 293 ? 0.711   53.271 60.197 1.00 20.23  ? 293  VAL A CG2 1 
ATOM   2430 N  N   . PRO A 1 294 ? -0.561  54.281 57.018 1.00 19.78  ? 294  PRO A N   1 
ATOM   2431 C  CA  . PRO A 1 294 ? -0.637  53.476 55.795 1.00 19.94  ? 294  PRO A CA  1 
ATOM   2432 C  C   . PRO A 1 294 ? -0.348  51.995 56.054 1.00 21.43  ? 294  PRO A C   1 
ATOM   2433 O  O   . PRO A 1 294 ? 0.433   51.650 56.940 1.00 19.78  ? 294  PRO A O   1 
ATOM   2434 C  CB  . PRO A 1 294 ? 0.418   54.118 54.904 1.00 20.88  ? 294  PRO A CB  1 
ATOM   2435 C  CG  . PRO A 1 294 ? 0.279   55.577 55.257 1.00 19.62  ? 294  PRO A CG  1 
ATOM   2436 C  CD  . PRO A 1 294 ? 0.179   55.536 56.775 1.00 19.73  ? 294  PRO A CD  1 
ATOM   2437 N  N   . VAL A 1 295 ? -0.981  51.124 55.276 1.00 21.80  ? 295  VAL A N   1 
ATOM   2438 C  CA  . VAL A 1 295 ? -0.775  49.687 55.421 1.00 22.34  ? 295  VAL A CA  1 
ATOM   2439 C  C   . VAL A 1 295 ? -0.186  49.109 54.130 1.00 22.69  ? 295  VAL A C   1 
ATOM   2440 O  O   . VAL A 1 295 ? -0.563  49.520 53.032 1.00 22.43  ? 295  VAL A O   1 
ATOM   2441 C  CB  . VAL A 1 295 ? -2.109  48.977 55.752 1.00 25.43  ? 295  VAL A CB  1 
ATOM   2442 C  CG1 . VAL A 1 295 ? -3.125  49.218 54.636 1.00 26.36  ? 295  VAL A CG1 1 
ATOM   2443 C  CG2 . VAL A 1 295 ? -1.873  47.496 55.959 1.00 27.53  ? 295  VAL A CG2 1 
ATOM   2444 N  N   . ILE A 1 296 ? 0.757   48.180 54.264 1.00 23.17  ? 296  ILE A N   1 
ATOM   2445 C  CA  . ILE A 1 296 ? 1.372   47.541 53.101 1.00 23.80  ? 296  ILE A CA  1 
ATOM   2446 C  C   . ILE A 1 296 ? 0.331   46.513 52.651 1.00 25.85  ? 296  ILE A C   1 
ATOM   2447 O  O   . ILE A 1 296 ? 0.323   45.366 53.104 1.00 25.19  ? 296  ILE A O   1 
ATOM   2448 C  CB  . ILE A 1 296 ? 2.697   46.855 53.490 1.00 23.47  ? 296  ILE A CB  1 
ATOM   2449 C  CG1 . ILE A 1 296 ? 3.571   47.843 54.274 1.00 23.84  ? 296  ILE A CG1 1 
ATOM   2450 C  CG2 . ILE A 1 296 ? 3.440   46.384 52.234 1.00 23.60  ? 296  ILE A CG2 1 
ATOM   2451 C  CD1 . ILE A 1 296 ? 3.851   49.163 53.539 1.00 21.81  ? 296  ILE A CD1 1 
ATOM   2452 N  N   . ASP A 1 297 ? -0.543  46.956 51.750 1.00 25.71  ? 297  ASP A N   1 
ATOM   2453 C  CA  . ASP A 1 297 ? -1.675  46.169 51.268 1.00 27.12  ? 297  ASP A CA  1 
ATOM   2454 C  C   . ASP A 1 297 ? -1.546  45.295 50.025 1.00 27.79  ? 297  ASP A C   1 
ATOM   2455 O  O   . ASP A 1 297 ? -2.417  44.467 49.781 1.00 27.65  ? 297  ASP A O   1 
ATOM   2456 C  CB  . ASP A 1 297 ? -2.856  47.112 51.047 1.00 27.15  ? 297  ASP A CB  1 
ATOM   2457 C  CG  . ASP A 1 297 ? -2.556  48.177 50.005 1.00 28.83  ? 297  ASP A CG  1 
ATOM   2458 O  OD1 . ASP A 1 297 ? -3.464  48.962 49.665 1.00 32.16  ? 297  ASP A OD1 1 
ATOM   2459 O  OD2 . ASP A 1 297 ? -1.402  48.232 49.525 1.00 28.89  ? 297  ASP A OD2 1 
ATOM   2460 N  N   . GLY A 1 298 ? -0.496  45.475 49.234 1.00 27.52  ? 298  GLY A N   1 
ATOM   2461 C  CA  . GLY A 1 298 ? -0.372  44.683 48.020 1.00 28.44  ? 298  GLY A CA  1 
ATOM   2462 C  C   . GLY A 1 298 ? -1.143  45.335 46.879 1.00 29.79  ? 298  GLY A C   1 
ATOM   2463 O  O   . GLY A 1 298 ? -1.220  44.794 45.776 1.00 29.82  ? 298  GLY A O   1 
ATOM   2464 N  N   . GLU A 1 299 ? -1.718  46.507 47.148 1.00 28.99  ? 299  GLU A N   1 
ATOM   2465 C  CA  . GLU A 1 299 ? -2.480  47.256 46.150 1.00 30.62  ? 299  GLU A CA  1 
ATOM   2466 C  C   . GLU A 1 299 ? -1.828  48.626 45.949 1.00 28.65  ? 299  GLU A C   1 
ATOM   2467 O  O   . GLU A 1 299 ? -1.177  48.866 44.934 1.00 27.59  ? 299  GLU A O   1 
ATOM   2468 C  CB  . GLU A 1 299 ? -3.931  47.421 46.610 1.00 35.18  ? 299  GLU A CB  1 
ATOM   2469 C  CG  . GLU A 1 299 ? -4.661  46.100 46.811 1.00 44.95  ? 299  GLU A CG  1 
ATOM   2470 C  CD  . GLU A 1 299 ? -6.014  46.269 47.480 1.00 51.33  ? 299  GLU A CD  1 
ATOM   2471 O  OE1 . GLU A 1 299 ? -6.898  46.934 46.893 1.00 55.34  ? 299  GLU A OE1 1 
ATOM   2472 O  OE2 . GLU A 1 299 ? -6.191  45.737 48.598 1.00 55.28  ? 299  GLU A OE2 1 
ATOM   2473 N  N   . PHE A 1 300 ? -2.004  49.528 46.911 1.00 26.04  ? 300  PHE A N   1 
ATOM   2474 C  CA  . PHE A 1 300 ? -1.384  50.843 46.807 1.00 23.69  ? 300  PHE A CA  1 
ATOM   2475 C  C   . PHE A 1 300 ? 0.128   50.595 46.761 1.00 23.51  ? 300  PHE A C   1 
ATOM   2476 O  O   . PHE A 1 300 ? 0.857   51.258 46.028 1.00 21.93  ? 300  PHE A O   1 
ATOM   2477 C  CB  . PHE A 1 300 ? -1.771  51.707 48.014 1.00 23.13  ? 300  PHE A CB  1 
ATOM   2478 C  CG  . PHE A 1 300 ? -1.335  53.144 47.899 1.00 23.63  ? 300  PHE A CG  1 
ATOM   2479 C  CD1 . PHE A 1 300 ? -0.020  53.511 48.172 1.00 22.63  ? 300  PHE A CD1 1 
ATOM   2480 C  CD2 . PHE A 1 300 ? -2.243  54.130 47.515 1.00 22.40  ? 300  PHE A CD2 1 
ATOM   2481 C  CE1 . PHE A 1 300 ? 0.388   54.842 48.067 1.00 22.91  ? 300  PHE A CE1 1 
ATOM   2482 C  CE2 . PHE A 1 300 ? -1.847  55.465 47.405 1.00 21.08  ? 300  PHE A CE2 1 
ATOM   2483 C  CZ  . PHE A 1 300 ? -0.530  55.821 47.682 1.00 22.84  ? 300  PHE A CZ  1 
ATOM   2484 N  N   . PHE A 1 301 ? 0.578   49.618 47.548 1.00 22.55  ? 301  PHE A N   1 
ATOM   2485 C  CA  . PHE A 1 301 ? 1.982   49.205 47.603 1.00 23.37  ? 301  PHE A CA  1 
ATOM   2486 C  C   . PHE A 1 301 ? 1.997   47.749 47.112 1.00 25.90  ? 301  PHE A C   1 
ATOM   2487 O  O   . PHE A 1 301 ? 1.625   46.843 47.856 1.00 26.24  ? 301  PHE A O   1 
ATOM   2488 C  CB  . PHE A 1 301 ? 2.503   49.261 49.047 1.00 23.44  ? 301  PHE A CB  1 
ATOM   2489 C  CG  . PHE A 1 301 ? 2.447   50.632 49.665 1.00 22.27  ? 301  PHE A CG  1 
ATOM   2490 C  CD1 . PHE A 1 301 ? 3.281   51.650 49.210 1.00 22.10  ? 301  PHE A CD1 1 
ATOM   2491 C  CD2 . PHE A 1 301 ? 1.554   50.906 50.702 1.00 22.14  ? 301  PHE A CD2 1 
ATOM   2492 C  CE1 . PHE A 1 301 ? 3.227   52.928 49.783 1.00 22.55  ? 301  PHE A CE1 1 
ATOM   2493 C  CE2 . PHE A 1 301 ? 1.491   52.176 51.280 1.00 21.08  ? 301  PHE A CE2 1 
ATOM   2494 C  CZ  . PHE A 1 301 ? 2.330   53.189 50.819 1.00 20.09  ? 301  PHE A CZ  1 
ATOM   2495 N  N   . PRO A 1 302 ? 2.422   47.508 45.858 1.00 26.91  ? 302  PRO A N   1 
ATOM   2496 C  CA  . PRO A 1 302 ? 2.473   46.158 45.273 1.00 28.39  ? 302  PRO A CA  1 
ATOM   2497 C  C   . PRO A 1 302 ? 3.153   45.113 46.159 1.00 29.14  ? 302  PRO A C   1 
ATOM   2498 O  O   . PRO A 1 302 ? 2.629   44.014 46.355 1.00 28.66  ? 302  PRO A O   1 
ATOM   2499 C  CB  . PRO A 1 302 ? 3.232   46.375 43.963 1.00 29.19  ? 302  PRO A CB  1 
ATOM   2500 C  CG  . PRO A 1 302 ? 2.885   47.783 43.599 1.00 29.83  ? 302  PRO A CG  1 
ATOM   2501 C  CD  . PRO A 1 302 ? 2.986   48.499 44.924 1.00 28.39  ? 302  PRO A CD  1 
ATOM   2502 N  N   . THR A 1 303 ? 4.329   45.458 46.675 1.00 27.82  ? 303  THR A N   1 
ATOM   2503 C  CA  . THR A 1 303 ? 5.084   44.564 47.547 1.00 27.99  ? 303  THR A CA  1 
ATOM   2504 C  C   . THR A 1 303 ? 5.685   45.392 48.683 1.00 27.20  ? 303  THR A C   1 
ATOM   2505 O  O   . THR A 1 303 ? 5.406   46.588 48.797 1.00 25.66  ? 303  THR A O   1 
ATOM   2506 C  CB  . THR A 1 303 ? 6.222   43.854 46.781 1.00 27.88  ? 303  THR A CB  1 
ATOM   2507 O  OG1 . THR A 1 303 ? 7.182   44.821 46.338 1.00 28.30  ? 303  THR A OG1 1 
ATOM   2508 C  CG2 . THR A 1 303 ? 5.668   43.117 45.567 1.00 30.67  ? 303  THR A CG2 1 
ATOM   2509 N  N   . SER A 1 304 ? 6.501   44.761 49.523 1.00 25.28  ? 304  SER A N   1 
ATOM   2510 C  CA  . SER A 1 304 ? 7.125   45.466 50.642 1.00 25.87  ? 304  SER A CA  1 
ATOM   2511 C  C   . SER A 1 304 ? 7.887   46.690 50.140 1.00 24.83  ? 304  SER A C   1 
ATOM   2512 O  O   . SER A 1 304 ? 8.411   46.694 49.025 1.00 25.38  ? 304  SER A O   1 
ATOM   2513 C  CB  . SER A 1 304 ? 8.102   44.545 51.376 1.00 24.93  ? 304  SER A CB  1 
ATOM   2514 O  OG  . SER A 1 304 ? 9.253   44.309 50.583 1.00 24.65  ? 304  SER A OG  1 
ATOM   2515 N  N   . LEU A 1 305 ? 7.963   47.724 50.970 1.00 23.48  ? 305  LEU A N   1 
ATOM   2516 C  CA  . LEU A 1 305 ? 8.672   48.936 50.583 1.00 23.03  ? 305  LEU A CA  1 
ATOM   2517 C  C   . LEU A 1 305 ? 10.133  48.642 50.238 1.00 22.79  ? 305  LEU A C   1 
ATOM   2518 O  O   . LEU A 1 305 ? 10.664  49.177 49.267 1.00 22.74  ? 305  LEU A O   1 
ATOM   2519 C  CB  . LEU A 1 305 ? 8.606   49.977 51.709 1.00 22.72  ? 305  LEU A CB  1 
ATOM   2520 C  CG  . LEU A 1 305 ? 7.207   50.383 52.183 1.00 22.52  ? 305  LEU A CG  1 
ATOM   2521 C  CD1 . LEU A 1 305 ? 7.321   51.490 53.231 1.00 23.63  ? 305  LEU A CD1 1 
ATOM   2522 C  CD2 . LEU A 1 305 ? 6.382   50.857 50.996 1.00 22.23  ? 305  LEU A CD2 1 
ATOM   2523 N  N   . GLU A 1 306 ? 10.780  47.786 51.022 1.00 23.57  ? 306  GLU A N   1 
ATOM   2524 C  CA  . GLU A 1 306 ? 12.182  47.464 50.774 1.00 24.86  ? 306  GLU A CA  1 
ATOM   2525 C  C   . GLU A 1 306 ? 12.407  46.753 49.436 1.00 25.12  ? 306  GLU A C   1 
ATOM   2526 O  O   . GLU A 1 306 ? 13.368  47.058 48.732 1.00 24.37  ? 306  GLU A O   1 
ATOM   2527 C  CB  . GLU A 1 306 ? 12.748  46.612 51.916 1.00 27.70  ? 306  GLU A CB  1 
ATOM   2528 C  CG  . GLU A 1 306 ? 14.237  46.287 51.777 1.00 30.11  ? 306  GLU A CG  1 
ATOM   2529 C  CD  . GLU A 1 306 ? 15.144  47.509 51.921 1.00 33.39  ? 306  GLU A CD  1 
ATOM   2530 O  OE1 . GLU A 1 306 ? 16.367  47.367 51.716 1.00 34.53  ? 306  GLU A OE1 1 
ATOM   2531 O  OE2 . GLU A 1 306 ? 14.648  48.608 52.243 1.00 33.00  ? 306  GLU A OE2 1 
ATOM   2532 N  N   . SER A 1 307 ? 11.540  45.810 49.076 1.00 25.18  ? 307  SER A N   1 
ATOM   2533 C  CA  . SER A 1 307 ? 11.723  45.116 47.799 1.00 26.63  ? 307  SER A CA  1 
ATOM   2534 C  C   . SER A 1 307 ? 11.474  46.079 46.636 1.00 26.47  ? 307  SER A C   1 
ATOM   2535 O  O   . SER A 1 307 ? 12.101  45.964 45.582 1.00 26.14  ? 307  SER A O   1 
ATOM   2536 C  CB  . SER A 1 307 ? 10.800  43.891 47.687 1.00 26.72  ? 307  SER A CB  1 
ATOM   2537 O  OG  . SER A 1 307 ? 9.430   44.243 47.735 1.00 29.55  ? 307  SER A OG  1 
ATOM   2538 N  N   . MET A 1 308 ? 10.564  47.031 46.827 1.00 25.44  ? 308  MET A N   1 
ATOM   2539 C  CA  . MET A 1 308 ? 10.283  48.012 45.779 1.00 25.44  ? 308  MET A CA  1 
ATOM   2540 C  C   . MET A 1 308 ? 11.506  48.910 45.609 1.00 25.83  ? 308  MET A C   1 
ATOM   2541 O  O   . MET A 1 308 ? 11.934  49.193 44.492 1.00 25.60  ? 308  MET A O   1 
ATOM   2542 C  CB  . MET A 1 308 ? 9.053   48.857 46.141 1.00 26.08  ? 308  MET A CB  1 
ATOM   2543 C  CG  . MET A 1 308 ? 7.729   48.095 46.068 1.00 22.75  ? 308  MET A CG  1 
ATOM   2544 S  SD  . MET A 1 308 ? 6.267   49.124 46.371 1.00 25.42  ? 308  MET A SD  1 
ATOM   2545 C  CE  . MET A 1 308 ? 6.239   50.118 44.829 1.00 24.32  ? 308  MET A CE  1 
ATOM   2546 N  N   . LEU A 1 309 ? 12.078  49.348 46.725 1.00 25.92  ? 309  LEU A N   1 
ATOM   2547 C  CA  . LEU A 1 309 ? 13.255  50.206 46.678 1.00 25.79  ? 309  LEU A CA  1 
ATOM   2548 C  C   . LEU A 1 309 ? 14.448  49.495 46.045 1.00 27.77  ? 309  LEU A C   1 
ATOM   2549 O  O   . LEU A 1 309 ? 15.177  50.077 45.238 1.00 27.96  ? 309  LEU A O   1 
ATOM   2550 C  CB  . LEU A 1 309 ? 13.638  50.668 48.090 1.00 24.92  ? 309  LEU A CB  1 
ATOM   2551 C  CG  . LEU A 1 309 ? 12.751  51.730 48.749 1.00 26.31  ? 309  LEU A CG  1 
ATOM   2552 C  CD1 . LEU A 1 309 ? 13.197  51.962 50.190 1.00 25.89  ? 309  LEU A CD1 1 
ATOM   2553 C  CD2 . LEU A 1 309 ? 12.829  53.025 47.947 1.00 24.85  ? 309  LEU A CD2 1 
ATOM   2554 N  N   A ASN A 1 310 ? 14.645  48.233 46.412 0.50 27.61  ? 310  ASN A N   1 
ATOM   2555 N  N   B ASN A 1 310 ? 14.633  48.232 46.413 0.50 28.39  ? 310  ASN A N   1 
ATOM   2556 C  CA  A ASN A 1 310 ? 15.757  47.454 45.881 0.50 28.82  ? 310  ASN A CA  1 
ATOM   2557 C  CA  B ASN A 1 310 ? 15.746  47.439 45.910 0.50 30.20  ? 310  ASN A CA  1 
ATOM   2558 C  C   A ASN A 1 310 ? 15.650  47.164 44.394 0.50 28.84  ? 310  ASN A C   1 
ATOM   2559 C  C   B ASN A 1 310 ? 15.652  47.121 44.419 0.50 29.66  ? 310  ASN A C   1 
ATOM   2560 O  O   A ASN A 1 310 ? 16.649  47.202 43.678 0.50 30.12  ? 310  ASN A O   1 
ATOM   2561 O  O   B ASN A 1 310 ? 16.667  47.101 43.725 0.50 30.74  ? 310  ASN A O   1 
ATOM   2562 C  CB  A ASN A 1 310 ? 15.890  46.126 46.629 0.50 29.53  ? 310  ASN A CB  1 
ATOM   2563 C  CB  B ASN A 1 310 ? 15.851  46.137 46.710 0.50 32.41  ? 310  ASN A CB  1 
ATOM   2564 C  CG  A ASN A 1 310 ? 16.463  46.296 48.014 0.50 28.40  ? 310  ASN A CG  1 
ATOM   2565 C  CG  B ASN A 1 310 ? 17.198  45.464 46.550 0.50 34.05  ? 310  ASN A CG  1 
ATOM   2566 O  OD1 A ASN A 1 310 ? 17.417  47.046 48.212 0.50 28.78  ? 310  ASN A OD1 1 
ATOM   2567 O  OD1 B ASN A 1 310 ? 18.234  46.035 46.895 0.50 35.94  ? 310  ASN A OD1 1 
ATOM   2568 N  ND2 A ASN A 1 310 ? 15.897  45.587 48.982 0.50 31.64  ? 310  ASN A ND2 1 
ATOM   2569 N  ND2 B ASN A 1 310 ? 17.193  44.246 46.022 0.50 35.74  ? 310  ASN A ND2 1 
ATOM   2570 N  N   . SER A 1 311 ? 14.440  46.873 43.931 1.00 28.92  ? 311  SER A N   1 
ATOM   2571 C  CA  . SER A 1 311 ? 14.226  46.548 42.525 1.00 28.70  ? 311  SER A CA  1 
ATOM   2572 C  C   . SER A 1 311 ? 14.042  47.753 41.608 1.00 28.63  ? 311  SER A C   1 
ATOM   2573 O  O   . SER A 1 311 ? 13.933  47.596 40.390 1.00 28.12  ? 311  SER A O   1 
ATOM   2574 C  CB  . SER A 1 311 ? 13.009  45.632 42.384 1.00 30.03  ? 311  SER A CB  1 
ATOM   2575 O  OG  . SER A 1 311 ? 11.820  46.323 42.729 1.00 31.53  ? 311  SER A OG  1 
ATOM   2576 N  N   . GLY A 1 312 ? 14.007  48.951 42.182 1.00 26.58  ? 312  GLY A N   1 
ATOM   2577 C  CA  . GLY A 1 312 ? 13.823  50.138 41.365 1.00 25.95  ? 312  GLY A CA  1 
ATOM   2578 C  C   . GLY A 1 312 ? 12.379  50.278 40.920 1.00 25.40  ? 312  GLY A C   1 
ATOM   2579 O  O   . GLY A 1 312 ? 12.087  50.932 39.919 1.00 25.73  ? 312  GLY A O   1 
ATOM   2580 N  N   . ASN A 1 313 ? 11.469  49.657 41.666 1.00 24.77  ? 313  ASN A N   1 
ATOM   2581 C  CA  . ASN A 1 313 ? 10.049  49.724 41.346 1.00 24.42  ? 313  ASN A CA  1 
ATOM   2582 C  C   . ASN A 1 313 ? 9.460   51.002 41.928 1.00 23.74  ? 313  ASN A C   1 
ATOM   2583 O  O   . ASN A 1 313 ? 8.769   50.975 42.946 1.00 23.30  ? 313  ASN A O   1 
ATOM   2584 C  CB  . ASN A 1 313 ? 9.311   48.504 41.910 1.00 25.51  ? 313  ASN A CB  1 
ATOM   2585 C  CG  . ASN A 1 313 ? 7.860   48.443 41.463 1.00 28.23  ? 313  ASN A CG  1 
ATOM   2586 O  OD1 . ASN A 1 313 ? 7.425   49.233 40.625 1.00 29.53  ? 313  ASN A OD1 1 
ATOM   2587 N  ND2 . ASN A 1 313 ? 7.105   47.500 42.015 1.00 27.59  ? 313  ASN A ND2 1 
ATOM   2588 N  N   . PHE A 1 314 ? 9.757   52.124 41.280 1.00 23.43  ? 314  PHE A N   1 
ATOM   2589 C  CA  . PHE A 1 314 ? 9.265   53.425 41.713 1.00 22.26  ? 314  PHE A CA  1 
ATOM   2590 C  C   . PHE A 1 314 ? 9.487   54.472 40.628 1.00 22.79  ? 314  PHE A C   1 
ATOM   2591 O  O   . PHE A 1 314 ? 10.223  54.235 39.671 1.00 21.09  ? 314  PHE A O   1 
ATOM   2592 C  CB  . PHE A 1 314 ? 9.950   53.851 43.027 1.00 22.17  ? 314  PHE A CB  1 
ATOM   2593 C  CG  . PHE A 1 314 ? 11.463  53.784 42.997 1.00 23.87  ? 314  PHE A CG  1 
ATOM   2594 C  CD1 . PHE A 1 314 ? 12.211  54.752 42.330 1.00 23.07  ? 314  PHE A CD1 1 
ATOM   2595 C  CD2 . PHE A 1 314 ? 12.139  52.775 43.687 1.00 23.39  ? 314  PHE A CD2 1 
ATOM   2596 C  CE1 . PHE A 1 314 ? 13.611  54.721 42.355 1.00 23.11  ? 314  PHE A CE1 1 
ATOM   2597 C  CE2 . PHE A 1 314 ? 13.540  52.734 43.718 1.00 24.49  ? 314  PHE A CE2 1 
ATOM   2598 C  CZ  . PHE A 1 314 ? 14.276  53.711 43.051 1.00 21.81  ? 314  PHE A CZ  1 
ATOM   2599 N  N   . LYS A 1 315 ? 8.836   55.622 40.771 1.00 23.92  ? 315  LYS A N   1 
ATOM   2600 C  CA  . LYS A 1 315 ? 8.972   56.699 39.792 1.00 23.27  ? 315  LYS A CA  1 
ATOM   2601 C  C   . LYS A 1 315 ? 10.401  57.222 39.806 1.00 24.29  ? 315  LYS A C   1 
ATOM   2602 O  O   . LYS A 1 315 ? 10.946  57.545 40.866 1.00 23.80  ? 315  LYS A O   1 
ATOM   2603 C  CB  . LYS A 1 315 ? 8.014   57.847 40.118 1.00 22.11  ? 315  LYS A CB  1 
ATOM   2604 C  CG  . LYS A 1 315 ? 8.051   59.000 39.121 1.00 22.79  ? 315  LYS A CG  1 
ATOM   2605 C  CD  . LYS A 1 315 ? 7.226   60.183 39.620 1.00 22.39  ? 315  LYS A CD  1 
ATOM   2606 C  CE  . LYS A 1 315 ? 7.185   61.306 38.593 1.00 24.77  ? 315  LYS A CE  1 
ATOM   2607 N  NZ  . LYS A 1 315 ? 6.412   60.898 37.378 1.00 20.83  ? 315  LYS A NZ  1 
ATOM   2608 N  N   . LYS A 1 316 ? 11.006  57.305 38.627 1.00 23.29  ? 316  LYS A N   1 
ATOM   2609 C  CA  . LYS A 1 316 ? 12.371  57.792 38.512 1.00 25.45  ? 316  LYS A CA  1 
ATOM   2610 C  C   . LYS A 1 316 ? 12.355  59.229 38.021 1.00 25.57  ? 316  LYS A C   1 
ATOM   2611 O  O   . LYS A 1 316 ? 11.991  59.513 36.882 1.00 25.77  ? 316  LYS A O   1 
ATOM   2612 C  CB  . LYS A 1 316 ? 13.162  56.886 37.564 1.00 29.26  ? 316  LYS A CB  1 
ATOM   2613 C  CG  . LYS A 1 316 ? 13.218  55.454 38.081 1.00 31.67  ? 316  LYS A CG  1 
ATOM   2614 C  CD  . LYS A 1 316 ? 13.975  54.524 37.163 1.00 37.35  ? 316  LYS A CD  1 
ATOM   2615 C  CE  . LYS A 1 316 ? 13.885  53.098 37.682 1.00 38.81  ? 316  LYS A CE  1 
ATOM   2616 N  NZ  . LYS A 1 316 ? 12.465  52.663 37.816 1.00 38.46  ? 316  LYS A NZ  1 
ATOM   2617 N  N   . THR A 1 317 ? 12.744  60.139 38.903 1.00 23.95  ? 317  THR A N   1 
ATOM   2618 C  CA  . THR A 1 317 ? 12.749  61.556 38.584 1.00 23.93  ? 317  THR A CA  1 
ATOM   2619 C  C   . THR A 1 317 ? 13.753  62.222 39.522 1.00 25.11  ? 317  THR A C   1 
ATOM   2620 O  O   . THR A 1 317 ? 14.620  61.538 40.076 1.00 24.85  ? 317  THR A O   1 
ATOM   2621 C  CB  . THR A 1 317 ? 11.327  62.135 38.789 1.00 23.24  ? 317  THR A CB  1 
ATOM   2622 O  OG1 . THR A 1 317 ? 11.309  63.518 38.428 1.00 22.19  ? 317  THR A OG1 1 
ATOM   2623 C  CG2 . THR A 1 317 ? 10.886  61.972 40.247 1.00 21.34  ? 317  THR A CG2 1 
ATOM   2624 N  N   . GLN A 1 318 ? 13.662  63.540 39.689 1.00 23.79  ? 318  GLN A N   1 
ATOM   2625 C  CA  . GLN A 1 318 ? 14.576  64.241 40.592 1.00 23.45  ? 318  GLN A CA  1 
ATOM   2626 C  C   . GLN A 1 318 ? 13.874  64.445 41.931 1.00 23.46  ? 318  GLN A C   1 
ATOM   2627 O  O   . GLN A 1 318 ? 12.655  64.633 41.972 1.00 22.79  ? 318  GLN A O   1 
ATOM   2628 C  CB  . GLN A 1 318 ? 14.974  65.624 40.050 1.00 23.66  ? 318  GLN A CB  1 
ATOM   2629 C  CG  . GLN A 1 318 ? 15.530  65.662 38.633 1.00 27.32  ? 318  GLN A CG  1 
ATOM   2630 C  CD  . GLN A 1 318 ? 14.433  65.601 37.589 1.00 30.47  ? 318  GLN A CD  1 
ATOM   2631 O  OE1 . GLN A 1 318 ? 13.419  66.291 37.703 1.00 30.40  ? 318  GLN A OE1 1 
ATOM   2632 N  NE2 . GLN A 1 318 ? 14.630  64.779 36.564 1.00 32.67  ? 318  GLN A NE2 1 
ATOM   2633 N  N   . ILE A 1 319 ? 14.639  64.403 43.020 1.00 22.17  ? 319  ILE A N   1 
ATOM   2634 C  CA  . ILE A 1 319 ? 14.081  64.617 44.349 1.00 21.59  ? 319  ILE A CA  1 
ATOM   2635 C  C   . ILE A 1 319 ? 15.009  65.507 45.169 1.00 22.49  ? 319  ILE A C   1 
ATOM   2636 O  O   . ILE A 1 319 ? 16.226  65.512 44.966 1.00 23.27  ? 319  ILE A O   1 
ATOM   2637 C  CB  . ILE A 1 319 ? 13.880  63.289 45.140 1.00 23.28  ? 319  ILE A CB  1 
ATOM   2638 C  CG1 . ILE A 1 319 ? 15.230  62.613 45.393 1.00 21.96  ? 319  ILE A CG1 1 
ATOM   2639 C  CG2 . ILE A 1 319 ? 12.932  62.362 44.385 1.00 22.67  ? 319  ILE A CG2 1 
ATOM   2640 C  CD1 . ILE A 1 319 ? 15.155  61.411 46.331 1.00 21.04  ? 319  ILE A CD1 1 
ATOM   2641 N  N   . LEU A 1 320 ? 14.416  66.270 46.081 1.00 20.43  ? 320  LEU A N   1 
ATOM   2642 C  CA  . LEU A 1 320 ? 15.162  67.141 46.977 1.00 22.05  ? 320  LEU A CA  1 
ATOM   2643 C  C   . LEU A 1 320 ? 14.599  66.787 48.350 1.00 22.24  ? 320  LEU A C   1 
ATOM   2644 O  O   . LEU A 1 320 ? 13.381  66.785 48.551 1.00 22.01  ? 320  LEU A O   1 
ATOM   2645 C  CB  . LEU A 1 320 ? 14.920  68.618 46.629 1.00 20.57  ? 320  LEU A CB  1 
ATOM   2646 C  CG  . LEU A 1 320 ? 15.704  69.660 47.440 1.00 21.42  ? 320  LEU A CG  1 
ATOM   2647 C  CD1 . LEU A 1 320 ? 15.890  70.939 46.627 1.00 20.98  ? 320  LEU A CD1 1 
ATOM   2648 C  CD2 . LEU A 1 320 ? 14.970  69.950 48.736 1.00 20.65  ? 320  LEU A CD2 1 
ATOM   2649 N  N   . LEU A 1 321 ? 15.476  66.454 49.289 1.00 21.52  ? 321  LEU A N   1 
ATOM   2650 C  CA  . LEU A 1 321 ? 15.012  66.058 50.608 1.00 20.63  ? 321  LEU A CA  1 
ATOM   2651 C  C   . LEU A 1 321 ? 16.042  66.346 51.688 1.00 20.68  ? 321  LEU A C   1 
ATOM   2652 O  O   . LEU A 1 321 ? 17.206  66.624 51.398 1.00 21.65  ? 321  LEU A O   1 
ATOM   2653 C  CB  . LEU A 1 321 ? 14.663  64.562 50.601 1.00 18.70  ? 321  LEU A CB  1 
ATOM   2654 C  CG  . LEU A 1 321 ? 15.799  63.538 50.467 1.00 21.00  ? 321  LEU A CG  1 
ATOM   2655 C  CD1 . LEU A 1 321 ? 15.197  62.135 50.471 1.00 18.98  ? 321  LEU A CD1 1 
ATOM   2656 C  CD2 . LEU A 1 321 ? 16.600  63.771 49.178 1.00 21.47  ? 321  LEU A CD2 1 
ATOM   2657 N  N   . GLY A 1 322 ? 15.607  66.275 52.939 1.00 20.58  ? 322  GLY A N   1 
ATOM   2658 C  CA  . GLY A 1 322 ? 16.517  66.540 54.033 1.00 20.88  ? 322  GLY A CA  1 
ATOM   2659 C  C   . GLY A 1 322 ? 15.884  66.350 55.389 1.00 20.99  ? 322  GLY A C   1 
ATOM   2660 O  O   . GLY A 1 322 ? 14.720  65.953 55.498 1.00 19.89  ? 322  GLY A O   1 
ATOM   2661 N  N   . VAL A 1 323 ? 16.656  66.648 56.427 1.00 20.33  ? 323  VAL A N   1 
ATOM   2662 C  CA  . VAL A 1 323 ? 16.190  66.493 57.796 1.00 20.60  ? 323  VAL A CA  1 
ATOM   2663 C  C   . VAL A 1 323 ? 16.646  67.663 58.668 1.00 21.05  ? 323  VAL A C   1 
ATOM   2664 O  O   . VAL A 1 323 ? 17.456  68.493 58.236 1.00 22.39  ? 323  VAL A O   1 
ATOM   2665 C  CB  . VAL A 1 323 ? 16.734  65.181 58.401 1.00 19.90  ? 323  VAL A CB  1 
ATOM   2666 C  CG1 . VAL A 1 323 ? 16.314  63.989 57.541 1.00 19.34  ? 323  VAL A CG1 1 
ATOM   2667 C  CG2 . VAL A 1 323 ? 18.245  65.246 58.495 1.00 19.04  ? 323  VAL A CG2 1 
ATOM   2668 N  N   . ASN A 1 324 ? 16.116  67.722 59.888 1.00 20.93  ? 324  ASN A N   1 
ATOM   2669 C  CA  . ASN A 1 324 ? 16.471  68.760 60.854 1.00 20.86  ? 324  ASN A CA  1 
ATOM   2670 C  C   . ASN A 1 324 ? 17.427  68.141 61.880 1.00 22.63  ? 324  ASN A C   1 
ATOM   2671 O  O   . ASN A 1 324 ? 17.462  66.918 62.049 1.00 20.67  ? 324  ASN A O   1 
ATOM   2672 C  CB  . ASN A 1 324 ? 15.228  69.283 61.581 1.00 20.65  ? 324  ASN A CB  1 
ATOM   2673 C  CG  . ASN A 1 324 ? 14.271  70.036 60.661 1.00 21.75  ? 324  ASN A CG  1 
ATOM   2674 O  OD1 . ASN A 1 324 ? 13.193  70.461 61.090 1.00 26.01  ? 324  ASN A OD1 1 
ATOM   2675 N  ND2 . ASN A 1 324 ? 14.658  70.208 59.405 1.00 17.92  ? 324  ASN A ND2 1 
ATOM   2676 N  N   . LYS A 1 325 ? 18.184  68.986 62.574 1.00 22.44  ? 325  LYS A N   1 
ATOM   2677 C  CA  . LYS A 1 325 ? 19.154  68.518 63.560 1.00 23.36  ? 325  LYS A CA  1 
ATOM   2678 C  C   . LYS A 1 325 ? 18.585  67.737 64.744 1.00 23.07  ? 325  LYS A C   1 
ATOM   2679 O  O   . LYS A 1 325 ? 19.175  66.742 65.166 1.00 23.64  ? 325  LYS A O   1 
ATOM   2680 C  CB  . LYS A 1 325 ? 19.983  69.701 64.088 1.00 24.68  ? 325  LYS A CB  1 
ATOM   2681 C  CG  . LYS A 1 325 ? 21.045  69.305 65.120 1.00 27.69  ? 325  LYS A CG  1 
ATOM   2682 C  CD  . LYS A 1 325 ? 21.979  70.467 65.475 1.00 30.50  ? 325  LYS A CD  1 
ATOM   2683 C  CE  . LYS A 1 325 ? 21.260  71.604 66.205 1.00 33.99  ? 325  LYS A CE  1 
ATOM   2684 N  NZ  . LYS A 1 325 ? 20.959  71.323 67.649 1.00 35.14  ? 325  LYS A NZ  1 
ATOM   2685 N  N   . ASP A 1 326 ? 17.447  68.171 65.278 1.00 21.51  ? 326  ASP A N   1 
ATOM   2686 C  CA  . ASP A 1 326 ? 16.868  67.502 66.446 1.00 21.44  ? 326  ASP A CA  1 
ATOM   2687 C  C   . ASP A 1 326 ? 15.431  67.032 66.245 1.00 21.49  ? 326  ASP A C   1 
ATOM   2688 O  O   . ASP A 1 326 ? 14.514  67.488 66.931 1.00 21.58  ? 326  ASP A O   1 
ATOM   2689 C  CB  . ASP A 1 326 ? 16.940  68.449 67.645 1.00 22.02  ? 326  ASP A CB  1 
ATOM   2690 C  CG  . ASP A 1 326 ? 18.339  69.002 67.861 1.00 26.82  ? 326  ASP A CG  1 
ATOM   2691 O  OD1 . ASP A 1 326 ? 19.210  68.243 68.336 1.00 26.21  ? 326  ASP A OD1 1 
ATOM   2692 O  OD2 . ASP A 1 326 ? 18.573  70.189 67.537 1.00 23.77  ? 326  ASP A OD2 1 
ATOM   2693 N  N   . GLU A 1 327 ? 15.245  66.102 65.314 1.00 21.57  ? 327  GLU A N   1 
ATOM   2694 C  CA  . GLU A 1 327 ? 13.924  65.564 65.002 1.00 22.33  ? 327  GLU A CA  1 
ATOM   2695 C  C   . GLU A 1 327 ? 13.218  64.890 66.184 1.00 22.45  ? 327  GLU A C   1 
ATOM   2696 O  O   . GLU A 1 327 ? 11.990  64.904 66.269 1.00 23.23  ? 327  GLU A O   1 
ATOM   2697 C  CB  . GLU A 1 327 ? 14.041  64.549 63.856 1.00 21.27  ? 327  GLU A CB  1 
ATOM   2698 C  CG  . GLU A 1 327 ? 14.691  65.097 62.592 1.00 22.35  ? 327  GLU A CG  1 
ATOM   2699 C  CD  . GLU A 1 327 ? 13.709  65.801 61.673 1.00 24.23  ? 327  GLU A CD  1 
ATOM   2700 O  OE1 . GLU A 1 327 ? 12.579  66.108 62.111 1.00 24.00  ? 327  GLU A OE1 1 
ATOM   2701 O  OE2 . GLU A 1 327 ? 14.074  66.051 60.506 1.00 23.51  ? 327  GLU A OE2 1 
ATOM   2702 N  N   . GLY A 1 328 ? 13.984  64.308 67.100 1.00 23.11  ? 328  GLY A N   1 
ATOM   2703 C  CA  . GLY A 1 328 ? 13.357  63.606 68.209 1.00 23.42  ? 328  GLY A CA  1 
ATOM   2704 C  C   . GLY A 1 328 ? 12.942  64.347 69.470 1.00 23.85  ? 328  GLY A C   1 
ATOM   2705 O  O   . GLY A 1 328 ? 12.158  63.809 70.253 1.00 22.63  ? 328  GLY A O   1 
ATOM   2706 N  N   . SER A 1 329 ? 13.424  65.570 69.670 1.00 23.04  ? 329  SER A N   1 
ATOM   2707 C  CA  . SER A 1 329 ? 13.111  66.305 70.900 1.00 22.47  ? 329  SER A CA  1 
ATOM   2708 C  C   . SER A 1 329 ? 11.630  66.475 71.244 1.00 23.10  ? 329  SER A C   1 
ATOM   2709 O  O   . SER A 1 329 ? 11.238  66.335 72.404 1.00 22.35  ? 329  SER A O   1 
ATOM   2710 C  CB  . SER A 1 329 ? 13.804  67.676 70.889 1.00 21.44  ? 329  SER A CB  1 
ATOM   2711 O  OG  . SER A 1 329 ? 13.285  68.531 69.885 1.00 21.38  ? 329  SER A OG  1 
ATOM   2712 N  N   . PHE A 1 330 ? 10.802  66.769 70.251 1.00 21.90  ? 330  PHE A N   1 
ATOM   2713 C  CA  . PHE A 1 330 ? 9.380   66.960 70.508 1.00 22.54  ? 330  PHE A CA  1 
ATOM   2714 C  C   . PHE A 1 330 ? 8.703   65.745 71.142 1.00 22.58  ? 330  PHE A C   1 
ATOM   2715 O  O   . PHE A 1 330 ? 7.976   65.867 72.129 1.00 22.18  ? 330  PHE A O   1 
ATOM   2716 C  CB  . PHE A 1 330 ? 8.655   67.329 69.207 1.00 23.92  ? 330  PHE A CB  1 
ATOM   2717 C  CG  . PHE A 1 330 ? 7.158   67.479 69.360 1.00 27.25  ? 330  PHE A CG  1 
ATOM   2718 C  CD1 . PHE A 1 330 ? 6.313   66.380 69.211 1.00 26.78  ? 330  PHE A CD1 1 
ATOM   2719 C  CD2 . PHE A 1 330 ? 6.595   68.724 69.634 1.00 27.79  ? 330  PHE A CD2 1 
ATOM   2720 C  CE1 . PHE A 1 330 ? 4.922   66.518 69.329 1.00 28.44  ? 330  PHE A CE1 1 
ATOM   2721 C  CE2 . PHE A 1 330 ? 5.207   68.877 69.755 1.00 28.88  ? 330  PHE A CE2 1 
ATOM   2722 C  CZ  . PHE A 1 330 ? 4.368   67.768 69.600 1.00 28.89  ? 330  PHE A CZ  1 
ATOM   2723 N  N   A PHE A 1 331 ? 8.937   64.565 70.580 0.50 22.17  ? 331  PHE A N   1 
ATOM   2724 N  N   B PHE A 1 331 ? 8.970   64.574 70.580 0.50 22.23  ? 331  PHE A N   1 
ATOM   2725 C  CA  A PHE A 1 331 ? 8.301   63.370 71.111 0.50 21.40  ? 331  PHE A CA  1 
ATOM   2726 C  CA  B PHE A 1 331 ? 8.374   63.335 71.053 0.50 21.67  ? 331  PHE A CA  1 
ATOM   2727 C  C   A PHE A 1 331 ? 8.863   62.899 72.449 0.50 21.66  ? 331  PHE A C   1 
ATOM   2728 C  C   B PHE A 1 331 ? 8.877   62.889 72.420 0.50 21.75  ? 331  PHE A C   1 
ATOM   2729 O  O   A PHE A 1 331 ? 8.179   62.200 73.198 0.50 20.82  ? 331  PHE A O   1 
ATOM   2730 O  O   B PHE A 1 331 ? 8.166   62.206 73.159 0.50 20.95  ? 331  PHE A O   1 
ATOM   2731 C  CB  A PHE A 1 331 ? 8.318   62.261 70.054 0.50 22.71  ? 331  PHE A CB  1 
ATOM   2732 C  CB  B PHE A 1 331 ? 8.606   62.249 70.003 0.50 22.68  ? 331  PHE A CB  1 
ATOM   2733 C  CG  A PHE A 1 331 ? 7.515   62.608 68.826 0.50 19.79  ? 331  PHE A CG  1 
ATOM   2734 C  CG  B PHE A 1 331 ? 8.266   62.695 68.610 0.50 22.23  ? 331  PHE A CG  1 
ATOM   2735 C  CD1 A PHE A 1 331 ? 8.123   63.189 67.719 0.50 21.56  ? 331  PHE A CD1 1 
ATOM   2736 C  CD1 B PHE A 1 331 ? 9.135   63.521 67.897 0.50 22.03  ? 331  PHE A CD1 1 
ATOM   2737 C  CD2 A PHE A 1 331 ? 6.136   62.440 68.815 0.50 19.83  ? 331  PHE A CD2 1 
ATOM   2738 C  CD2 B PHE A 1 331 ? 7.048   62.352 68.037 0.50 21.33  ? 331  PHE A CD2 1 
ATOM   2739 C  CE1 A PHE A 1 331 ? 7.366   63.604 66.622 0.50 21.36  ? 331  PHE A CE1 1 
ATOM   2740 C  CE1 B PHE A 1 331 ? 8.790   64.001 66.634 0.50 21.99  ? 331  PHE A CE1 1 
ATOM   2741 C  CE2 A PHE A 1 331 ? 5.369   62.852 67.724 0.50 19.21  ? 331  PHE A CE2 1 
ATOM   2742 C  CE2 B PHE A 1 331 ? 6.694   62.825 66.777 0.50 22.81  ? 331  PHE A CE2 1 
ATOM   2743 C  CZ  A PHE A 1 331 ? 5.984   63.435 66.628 0.50 19.56  ? 331  PHE A CZ  1 
ATOM   2744 C  CZ  B PHE A 1 331 ? 7.566   63.652 66.075 0.50 22.63  ? 331  PHE A CZ  1 
ATOM   2745 N  N   . LEU A 1 332 ? 10.098  63.285 72.760 1.00 20.95  ? 332  LEU A N   1 
ATOM   2746 C  CA  . LEU A 1 332 ? 10.685  62.928 74.047 1.00 21.18  ? 332  LEU A CA  1 
ATOM   2747 C  C   . LEU A 1 332 ? 10.007  63.810 75.105 1.00 21.54  ? 332  LEU A C   1 
ATOM   2748 O  O   . LEU A 1 332 ? 9.639   63.340 76.185 1.00 22.07  ? 332  LEU A O   1 
ATOM   2749 C  CB  . LEU A 1 332 ? 12.195  63.176 74.036 1.00 21.01  ? 332  LEU A CB  1 
ATOM   2750 C  CG  . LEU A 1 332 ? 13.012  62.115 73.299 1.00 20.53  ? 332  LEU A CG  1 
ATOM   2751 C  CD1 . LEU A 1 332 ? 14.425  62.626 73.041 1.00 21.64  ? 332  LEU A CD1 1 
ATOM   2752 C  CD2 . LEU A 1 332 ? 13.030  60.832 74.140 1.00 19.78  ? 332  LEU A CD2 1 
ATOM   2753 N  N   . LEU A 1 333 ? 9.826   65.087 74.781 1.00 21.89  ? 333  LEU A N   1 
ATOM   2754 C  CA  . LEU A 1 333 ? 9.172   66.013 75.708 1.00 23.32  ? 333  LEU A CA  1 
ATOM   2755 C  C   . LEU A 1 333 ? 7.783   65.497 76.084 1.00 24.95  ? 333  LEU A C   1 
ATOM   2756 O  O   . LEU A 1 333 ? 7.408   65.459 77.259 1.00 23.71  ? 333  LEU A O   1 
ATOM   2757 C  CB  . LEU A 1 333 ? 9.036   67.408 75.076 1.00 22.41  ? 333  LEU A CB  1 
ATOM   2758 C  CG  . LEU A 1 333 ? 8.078   68.375 75.794 1.00 21.09  ? 333  LEU A CG  1 
ATOM   2759 C  CD1 . LEU A 1 333 ? 8.606   68.705 77.192 1.00 20.52  ? 333  LEU A CD1 1 
ATOM   2760 C  CD2 . LEU A 1 333 ? 7.922   69.647 74.981 1.00 21.04  ? 333  LEU A CD2 1 
ATOM   2761 N  N   . TYR A 1 334 ? 7.021   65.084 75.080 1.00 25.04  ? 334  TYR A N   1 
ATOM   2762 C  CA  . TYR A 1 334 ? 5.672   64.602 75.326 1.00 27.02  ? 334  TYR A CA  1 
ATOM   2763 C  C   . TYR A 1 334 ? 5.532   63.226 75.966 1.00 27.95  ? 334  TYR A C   1 
ATOM   2764 O  O   . TYR A 1 334 ? 4.529   62.962 76.622 1.00 31.04  ? 334  TYR A O   1 
ATOM   2765 C  CB  . TYR A 1 334 ? 4.861   64.632 74.030 1.00 25.95  ? 334  TYR A CB  1 
ATOM   2766 C  CG  . TYR A 1 334 ? 4.357   66.007 73.652 1.00 25.86  ? 334  TYR A CG  1 
ATOM   2767 C  CD1 . TYR A 1 334 ? 5.242   67.041 73.349 1.00 24.25  ? 334  TYR A CD1 1 
ATOM   2768 C  CD2 . TYR A 1 334 ? 2.988   66.274 73.597 1.00 24.50  ? 334  TYR A CD2 1 
ATOM   2769 C  CE1 . TYR A 1 334 ? 4.775   68.308 72.999 1.00 23.61  ? 334  TYR A CE1 1 
ATOM   2770 C  CE2 . TYR A 1 334 ? 2.512   67.536 73.249 1.00 24.49  ? 334  TYR A CE2 1 
ATOM   2771 C  CZ  . TYR A 1 334 ? 3.408   68.547 72.950 1.00 24.75  ? 334  TYR A CZ  1 
ATOM   2772 O  OH  . TYR A 1 334 ? 2.932   69.786 72.583 1.00 22.70  ? 334  TYR A OH  1 
ATOM   2773 N  N   . GLY A 1 335 ? 6.517   62.348 75.809 1.00 28.66  ? 335  GLY A N   1 
ATOM   2774 C  CA  . GLY A 1 335 ? 6.349   61.028 76.392 1.00 30.49  ? 335  GLY A CA  1 
ATOM   2775 C  C   . GLY A 1 335 ? 7.489   60.310 77.090 1.00 29.87  ? 335  GLY A C   1 
ATOM   2776 O  O   . GLY A 1 335 ? 7.311   59.166 77.504 1.00 33.37  ? 335  GLY A O   1 
ATOM   2777 N  N   . ALA A 1 336 ? 8.646   60.942 77.237 1.00 27.55  ? 336  ALA A N   1 
ATOM   2778 C  CA  . ALA A 1 336 ? 9.761   60.272 77.899 1.00 26.59  ? 336  ALA A CA  1 
ATOM   2779 C  C   . ALA A 1 336 ? 10.001  60.836 79.295 1.00 27.44  ? 336  ALA A C   1 
ATOM   2780 O  O   . ALA A 1 336 ? 9.906   62.043 79.513 1.00 25.55  ? 336  ALA A O   1 
ATOM   2781 C  CB  . ALA A 1 336 ? 11.026  60.401 77.059 1.00 24.49  ? 336  ALA A CB  1 
ATOM   2782 N  N   . PRO A 1 337 ? 10.308  59.959 80.262 1.00 30.16  ? 337  PRO A N   1 
ATOM   2783 C  CA  . PRO A 1 337 ? 10.561  60.383 81.642 1.00 30.40  ? 337  PRO A CA  1 
ATOM   2784 C  C   . PRO A 1 337 ? 11.793  61.271 81.761 1.00 29.19  ? 337  PRO A C   1 
ATOM   2785 O  O   . PRO A 1 337 ? 12.810  61.028 81.109 1.00 29.68  ? 337  PRO A O   1 
ATOM   2786 C  CB  . PRO A 1 337 ? 10.731  59.056 82.384 1.00 32.73  ? 337  PRO A CB  1 
ATOM   2787 C  CG  . PRO A 1 337 ? 11.312  58.157 81.336 1.00 34.08  ? 337  PRO A CG  1 
ATOM   2788 C  CD  . PRO A 1 337 ? 10.461  58.498 80.129 1.00 30.68  ? 337  PRO A CD  1 
ATOM   2789 N  N   . GLY A 1 338 ? 11.693  62.305 82.589 1.00 27.60  ? 338  GLY A N   1 
ATOM   2790 C  CA  . GLY A 1 338 ? 12.817  63.203 82.782 1.00 26.59  ? 338  GLY A CA  1 
ATOM   2791 C  C   . GLY A 1 338 ? 12.759  64.478 81.961 1.00 24.61  ? 338  GLY A C   1 
ATOM   2792 O  O   . GLY A 1 338 ? 13.432  65.457 82.286 1.00 24.19  ? 338  GLY A O   1 
ATOM   2793 N  N   . PHE A 1 339 ? 11.964  64.476 80.894 1.00 23.26  ? 339  PHE A N   1 
ATOM   2794 C  CA  . PHE A 1 339 ? 11.852  65.653 80.039 1.00 23.52  ? 339  PHE A CA  1 
ATOM   2795 C  C   . PHE A 1 339 ? 10.692  66.545 80.460 1.00 24.05  ? 339  PHE A C   1 
ATOM   2796 O  O   . PHE A 1 339 ? 9.617   66.055 80.799 1.00 24.50  ? 339  PHE A O   1 
ATOM   2797 C  CB  . PHE A 1 339 ? 11.667  65.240 78.574 1.00 22.47  ? 339  PHE A CB  1 
ATOM   2798 C  CG  . PHE A 1 339 ? 12.838  64.490 78.003 1.00 22.10  ? 339  PHE A CG  1 
ATOM   2799 C  CD1 . PHE A 1 339 ? 13.002  63.133 78.250 1.00 20.67  ? 339  PHE A CD1 1 
ATOM   2800 C  CD2 . PHE A 1 339 ? 13.787  65.150 77.229 1.00 20.50  ? 339  PHE A CD2 1 
ATOM   2801 C  CE1 . PHE A 1 339 ? 14.098  62.436 77.733 1.00 23.11  ? 339  PHE A CE1 1 
ATOM   2802 C  CE2 . PHE A 1 339 ? 14.888  64.466 76.706 1.00 21.92  ? 339  PHE A CE2 1 
ATOM   2803 C  CZ  . PHE A 1 339 ? 15.043  63.104 76.961 1.00 19.60  ? 339  PHE A CZ  1 
ATOM   2804 N  N   . SER A 1 340 ? 10.916  67.854 80.436 1.00 23.05  ? 340  SER A N   1 
ATOM   2805 C  CA  . SER A 1 340 ? 9.886   68.825 80.796 1.00 25.29  ? 340  SER A CA  1 
ATOM   2806 C  C   . SER A 1 340 ? 10.076  70.048 79.912 1.00 23.92  ? 340  SER A C   1 
ATOM   2807 O  O   . SER A 1 340 ? 11.195  70.349 79.500 1.00 24.06  ? 340  SER A O   1 
ATOM   2808 C  CB  . SER A 1 340 ? 10.015  69.221 82.272 1.00 27.29  ? 340  SER A CB  1 
ATOM   2809 O  OG  . SER A 1 340 ? 9.872   68.087 83.112 1.00 31.65  ? 340  SER A OG  1 
ATOM   2810 N  N   . LYS A 1 341 ? 8.991   70.758 79.621 1.00 23.28  ? 341  LYS A N   1 
ATOM   2811 C  CA  . LYS A 1 341 ? 9.090   71.932 78.763 1.00 23.94  ? 341  LYS A CA  1 
ATOM   2812 C  C   . LYS A 1 341 ? 9.821   73.115 79.395 1.00 24.40  ? 341  LYS A C   1 
ATOM   2813 O  O   . LYS A 1 341 ? 10.522  73.854 78.703 1.00 24.32  ? 341  LYS A O   1 
ATOM   2814 C  CB  . LYS A 1 341 ? 7.700   72.399 78.320 1.00 23.33  ? 341  LYS A CB  1 
ATOM   2815 C  CG  . LYS A 1 341 ? 7.750   73.486 77.240 1.00 25.07  ? 341  LYS A CG  1 
ATOM   2816 C  CD  . LYS A 1 341 ? 6.357   73.927 76.784 1.00 24.01  ? 341  LYS A CD  1 
ATOM   2817 C  CE  . LYS A 1 341 ? 5.658   74.779 77.839 1.00 26.08  ? 341  LYS A CE  1 
ATOM   2818 N  NZ  . LYS A 1 341 ? 6.398   76.049 78.105 1.00 25.92  ? 341  LYS A NZ  1 
ATOM   2819 N  N   . ASP A 1 342 ? 9.667   73.294 80.703 1.00 23.86  ? 342  ASP A N   1 
ATOM   2820 C  CA  . ASP A 1 342 ? 10.288  74.432 81.371 1.00 25.10  ? 342  ASP A CA  1 
ATOM   2821 C  C   . ASP A 1 342 ? 11.583  74.185 82.144 1.00 25.86  ? 342  ASP A C   1 
ATOM   2822 O  O   . ASP A 1 342 ? 11.991  75.015 82.961 1.00 24.21  ? 342  ASP A O   1 
ATOM   2823 C  CB  . ASP A 1 342 ? 9.252   75.099 82.275 1.00 26.15  ? 342  ASP A CB  1 
ATOM   2824 C  CG  . ASP A 1 342 ? 8.018   75.546 81.507 1.00 26.55  ? 342  ASP A CG  1 
ATOM   2825 O  OD1 . ASP A 1 342 ? 6.982   75.806 82.150 1.00 25.38  ? 342  ASP A OD1 1 
ATOM   2826 O  OD2 . ASP A 1 342 ? 8.085   75.640 80.258 1.00 26.34  ? 342  ASP A OD2 1 
ATOM   2827 N  N   . SER A 1 343 ? 12.236  73.056 81.887 1.00 26.65  ? 343  SER A N   1 
ATOM   2828 C  CA  . SER A 1 343 ? 13.506  72.758 82.545 1.00 28.00  ? 343  SER A CA  1 
ATOM   2829 C  C   . SER A 1 343 ? 14.514  72.373 81.464 1.00 28.96  ? 343  SER A C   1 
ATOM   2830 O  O   . SER A 1 343 ? 14.140  72.178 80.307 1.00 27.75  ? 343  SER A O   1 
ATOM   2831 C  CB  . SER A 1 343 ? 13.358  71.598 83.524 1.00 28.35  ? 343  SER A CB  1 
ATOM   2832 O  OG  . SER A 1 343 ? 13.305  70.365 82.834 1.00 33.22  ? 343  SER A OG  1 
ATOM   2833 N  N   . GLU A 1 344 ? 15.784  72.264 81.843 1.00 27.82  ? 344  GLU A N   1 
ATOM   2834 C  CA  . GLU A 1 344 ? 16.838  71.888 80.906 1.00 30.08  ? 344  GLU A CA  1 
ATOM   2835 C  C   . GLU A 1 344 ? 16.755  70.403 80.575 1.00 28.17  ? 344  GLU A C   1 
ATOM   2836 O  O   . GLU A 1 344 ? 17.457  69.913 79.691 1.00 27.17  ? 344  GLU A O   1 
ATOM   2837 C  CB  . GLU A 1 344 ? 18.216  72.196 81.496 1.00 33.26  ? 344  GLU A CB  1 
ATOM   2838 C  CG  . GLU A 1 344 ? 18.629  73.648 81.394 1.00 41.96  ? 344  GLU A CG  1 
ATOM   2839 C  CD  . GLU A 1 344 ? 20.006  73.896 81.984 1.00 46.49  ? 344  GLU A CD  1 
ATOM   2840 O  OE1 . GLU A 1 344 ? 20.956  73.171 81.614 1.00 47.43  ? 344  GLU A OE1 1 
ATOM   2841 O  OE2 . GLU A 1 344 ? 20.137  74.819 82.816 1.00 50.75  ? 344  GLU A OE2 1 
ATOM   2842 N  N   . SER A 1 345 ? 15.904  69.693 81.308 1.00 27.29  ? 345  SER A N   1 
ATOM   2843 C  CA  . SER A 1 345 ? 15.701  68.265 81.102 1.00 26.58  ? 345  SER A CA  1 
ATOM   2844 C  C   . SER A 1 345 ? 16.978  67.424 81.087 1.00 27.71  ? 345  SER A C   1 
ATOM   2845 O  O   . SER A 1 345 ? 17.182  66.605 80.188 1.00 24.49  ? 345  SER A O   1 
ATOM   2846 C  CB  . SER A 1 345 ? 14.923  68.033 79.802 1.00 26.45  ? 345  SER A CB  1 
ATOM   2847 O  OG  . SER A 1 345 ? 13.634  68.616 79.876 1.00 24.55  ? 345  SER A OG  1 
ATOM   2848 N  N   . LYS A 1 346 ? 17.848  67.630 82.070 1.00 28.37  ? 346  LYS A N   1 
ATOM   2849 C  CA  . LYS A 1 346 ? 19.059  66.827 82.151 1.00 30.37  ? 346  LYS A CA  1 
ATOM   2850 C  C   . LYS A 1 346 ? 18.553  65.456 82.587 1.00 30.39  ? 346  LYS A C   1 
ATOM   2851 O  O   . LYS A 1 346 ? 17.813  65.343 83.564 1.00 32.25  ? 346  LYS A O   1 
ATOM   2852 C  CB  . LYS A 1 346 ? 20.025  67.411 83.183 1.00 33.83  ? 346  LYS A CB  1 
ATOM   2853 C  CG  . LYS A 1 346 ? 20.575  68.773 82.785 1.00 36.69  ? 346  LYS A CG  1 
ATOM   2854 C  CD  . LYS A 1 346 ? 21.476  69.341 83.866 1.00 42.11  ? 346  LYS A CD  1 
ATOM   2855 C  CE  . LYS A 1 346 ? 21.974  70.729 83.492 1.00 46.51  ? 346  LYS A CE  1 
ATOM   2856 N  NZ  . LYS A 1 346 ? 22.779  71.335 84.593 1.00 50.85  ? 346  LYS A NZ  1 
ATOM   2857 N  N   . ILE A 1 347 ? 18.938  64.419 81.855 1.00 29.98  ? 347  ILE A N   1 
ATOM   2858 C  CA  . ILE A 1 347 ? 18.465  63.073 82.147 1.00 30.78  ? 347  ILE A CA  1 
ATOM   2859 C  C   . ILE A 1 347 ? 19.466  62.149 82.846 1.00 29.43  ? 347  ILE A C   1 
ATOM   2860 O  O   . ILE A 1 347 ? 20.644  62.090 82.494 1.00 28.48  ? 347  ILE A O   1 
ATOM   2861 C  CB  . ILE A 1 347 ? 17.936  62.410 80.831 1.00 33.56  ? 347  ILE A CB  1 
ATOM   2862 C  CG1 . ILE A 1 347 ? 16.433  62.670 80.684 1.00 35.44  ? 347  ILE A CG1 1 
ATOM   2863 C  CG2 . ILE A 1 347 ? 18.163  60.906 80.841 1.00 32.95  ? 347  ILE A CG2 1 
ATOM   2864 C  CD1 . ILE A 1 347 ? 16.038  64.103 80.688 1.00 35.95  ? 347  ILE A CD1 1 
ATOM   2865 N  N   . SER A 1 348 ? 18.970  61.428 83.844 1.00 30.70  ? 348  SER A N   1 
ATOM   2866 C  CA  . SER A 1 348 ? 19.781  60.486 84.607 1.00 31.05  ? 348  SER A CA  1 
ATOM   2867 C  C   . SER A 1 348 ? 19.977  59.237 83.765 1.00 31.66  ? 348  SER A C   1 
ATOM   2868 O  O   . SER A 1 348 ? 19.277  59.037 82.774 1.00 30.98  ? 348  SER A O   1 
ATOM   2869 C  CB  . SER A 1 348 ? 19.062  60.097 85.893 1.00 30.65  ? 348  SER A CB  1 
ATOM   2870 O  OG  . SER A 1 348 ? 17.902  59.337 85.591 1.00 29.59  ? 348  SER A OG  1 
ATOM   2871 N  N   . ARG A 1 349 ? 20.921  58.392 84.162 1.00 31.86  ? 349  ARG A N   1 
ATOM   2872 C  CA  . ARG A 1 349 ? 21.170  57.161 83.426 1.00 33.62  ? 349  ARG A CA  1 
ATOM   2873 C  C   . ARG A 1 349 ? 19.901  56.312 83.437 1.00 33.61  ? 349  ARG A C   1 
ATOM   2874 O  O   . ARG A 1 349 ? 19.582  55.644 82.453 1.00 33.26  ? 349  ARG A O   1 
ATOM   2875 C  CB  . ARG A 1 349 ? 22.319  56.375 84.061 1.00 34.19  ? 349  ARG A CB  1 
ATOM   2876 C  CG  . ARG A 1 349 ? 22.634  55.073 83.342 1.00 38.86  ? 349  ARG A CG  1 
ATOM   2877 C  CD  . ARG A 1 349 ? 23.934  55.156 82.556 1.00 39.59  ? 349  ARG A CD  1 
ATOM   2878 N  NE  . ARG A 1 349 ? 23.945  56.228 81.563 1.00 43.60  ? 349  ARG A NE  1 
ATOM   2879 C  CZ  . ARG A 1 349 ? 23.872  56.035 80.247 1.00 44.60  ? 349  ARG A CZ  1 
ATOM   2880 N  NH1 . ARG A 1 349 ? 23.777  54.804 79.753 1.00 42.29  ? 349  ARG A NH1 1 
ATOM   2881 N  NH2 . ARG A 1 349 ? 23.910  57.073 79.423 1.00 45.44  ? 349  ARG A NH2 1 
ATOM   2882 N  N   . GLU A 1 350 ? 19.180  56.344 84.555 1.00 32.91  ? 350  GLU A N   1 
ATOM   2883 C  CA  . GLU A 1 350 ? 17.946  55.576 84.691 1.00 34.47  ? 350  GLU A CA  1 
ATOM   2884 C  C   . GLU A 1 350 ? 16.905  56.014 83.665 1.00 33.68  ? 350  GLU A C   1 
ATOM   2885 O  O   . GLU A 1 350 ? 16.303  55.183 82.987 1.00 32.73  ? 350  GLU A O   1 
ATOM   2886 C  CB  . GLU A 1 350 ? 17.365  55.736 86.098 1.00 38.83  ? 350  GLU A CB  1 
ATOM   2887 C  CG  . GLU A 1 350 ? 18.180  55.073 87.202 1.00 46.61  ? 350  GLU A CG  1 
ATOM   2888 C  CD  . GLU A 1 350 ? 19.597  55.614 87.300 1.00 50.83  ? 350  GLU A CD  1 
ATOM   2889 O  OE1 . GLU A 1 350 ? 19.764  56.847 87.440 1.00 51.62  ? 350  GLU A OE1 1 
ATOM   2890 O  OE2 . GLU A 1 350 ? 20.545  54.801 87.241 1.00 54.69  ? 350  GLU A OE2 1 
ATOM   2891 N  N   . ASP A 1 351 ? 16.688  57.320 83.558 1.00 31.87  ? 351  ASP A N   1 
ATOM   2892 C  CA  . ASP A 1 351 ? 15.720  57.832 82.600 1.00 31.22  ? 351  ASP A CA  1 
ATOM   2893 C  C   . ASP A 1 351 ? 16.218  57.622 81.172 1.00 28.96  ? 351  ASP A C   1 
ATOM   2894 O  O   . ASP A 1 351 ? 15.421  57.495 80.247 1.00 29.46  ? 351  ASP A O   1 
ATOM   2895 C  CB  . ASP A 1 351 ? 15.436  59.310 82.872 1.00 31.65  ? 351  ASP A CB  1 
ATOM   2896 C  CG  . ASP A 1 351 ? 14.506  59.511 84.061 1.00 33.92  ? 351  ASP A CG  1 
ATOM   2897 O  OD1 . ASP A 1 351 ? 14.304  60.667 84.481 1.00 33.10  ? 351  ASP A OD1 1 
ATOM   2898 O  OD2 . ASP A 1 351 ? 13.970  58.505 84.572 1.00 35.77  ? 351  ASP A OD2 1 
ATOM   2899 N  N   . PHE A 1 352 ? 17.535  57.565 80.998 1.00 28.43  ? 352  PHE A N   1 
ATOM   2900 C  CA  . PHE A 1 352 ? 18.108  57.340 79.674 1.00 28.86  ? 352  PHE A CA  1 
ATOM   2901 C  C   . PHE A 1 352 ? 17.699  55.950 79.197 1.00 28.93  ? 352  PHE A C   1 
ATOM   2902 O  O   . PHE A 1 352 ? 17.227  55.782 78.073 1.00 28.22  ? 352  PHE A O   1 
ATOM   2903 C  CB  . PHE A 1 352 ? 19.634  57.420 79.721 1.00 26.58  ? 352  PHE A CB  1 
ATOM   2904 C  CG  . PHE A 1 352 ? 20.299  57.186 78.390 1.00 28.35  ? 352  PHE A CG  1 
ATOM   2905 C  CD1 . PHE A 1 352 ? 20.418  58.219 77.461 1.00 27.86  ? 352  PHE A CD1 1 
ATOM   2906 C  CD2 . PHE A 1 352 ? 20.801  55.929 78.062 1.00 28.47  ? 352  PHE A CD2 1 
ATOM   2907 C  CE1 . PHE A 1 352 ? 21.032  58.004 76.225 1.00 28.04  ? 352  PHE A CE1 1 
ATOM   2908 C  CE2 . PHE A 1 352 ? 21.415  55.702 76.830 1.00 29.97  ? 352  PHE A CE2 1 
ATOM   2909 C  CZ  . PHE A 1 352 ? 21.532  56.740 75.909 1.00 29.12  ? 352  PHE A CZ  1 
ATOM   2910 N  N   A MET A 1 353 ? 17.878  54.965 80.071 0.50 29.46  ? 353  MET A N   1 
ATOM   2911 N  N   B MET A 1 353 ? 17.889  54.949 80.053 0.50 29.49  ? 353  MET A N   1 
ATOM   2912 C  CA  A MET A 1 353 ? 17.538  53.579 79.768 0.50 29.99  ? 353  MET A CA  1 
ATOM   2913 C  CA  B MET A 1 353 ? 17.540  53.576 79.700 0.50 30.00  ? 353  MET A CA  1 
ATOM   2914 C  C   A MET A 1 353 ? 16.052  53.425 79.475 0.50 29.72  ? 353  MET A C   1 
ATOM   2915 C  C   B MET A 1 353 ? 16.040  53.413 79.470 0.50 29.75  ? 353  MET A C   1 
ATOM   2916 O  O   A MET A 1 353 ? 15.663  52.694 78.563 0.50 29.66  ? 353  MET A O   1 
ATOM   2917 O  O   B MET A 1 353 ? 15.626  52.655 78.591 0.50 29.66  ? 353  MET A O   1 
ATOM   2918 C  CB  A MET A 1 353 ? 17.918  52.684 80.949 0.50 31.28  ? 353  MET A CB  1 
ATOM   2919 C  CB  B MET A 1 353 ? 18.032  52.604 80.782 0.50 31.44  ? 353  MET A CB  1 
ATOM   2920 C  CG  A MET A 1 353 ? 19.366  52.820 81.365 0.50 32.35  ? 353  MET A CG  1 
ATOM   2921 C  CG  B MET A 1 353 ? 19.554  52.530 80.876 0.50 33.00  ? 353  MET A CG  1 
ATOM   2922 S  SD  A MET A 1 353 ? 20.481  52.330 80.047 0.50 35.43  ? 353  MET A SD  1 
ATOM   2923 S  SD  B MET A 1 353 ? 20.188  51.271 82.013 0.50 36.01  ? 353  MET A SD  1 
ATOM   2924 C  CE  A MET A 1 353 ? 20.844  50.646 80.549 0.50 32.91  ? 353  MET A CE  1 
ATOM   2925 C  CE  B MET A 1 353 ? 20.206  52.192 83.543 0.50 34.88  ? 353  MET A CE  1 
ATOM   2926 N  N   . SER A 1 354 ? 15.227  54.117 80.254 1.00 29.06  ? 354  SER A N   1 
ATOM   2927 C  CA  . SER A 1 354 ? 13.776  54.052 80.080 1.00 30.96  ? 354  SER A CA  1 
ATOM   2928 C  C   . SER A 1 354 ? 13.427  54.658 78.725 1.00 29.81  ? 354  SER A C   1 
ATOM   2929 O  O   . SER A 1 354 ? 12.582  54.134 77.996 1.00 29.35  ? 354  SER A O   1 
ATOM   2930 C  CB  . SER A 1 354 ? 13.057  54.834 81.180 1.00 31.89  ? 354  SER A CB  1 
ATOM   2931 O  OG  . SER A 1 354 ? 13.170  54.174 82.427 1.00 40.47  ? 354  SER A OG  1 
ATOM   2932 N  N   . GLY A 1 355 ? 14.089  55.767 78.402 1.00 28.27  ? 355  GLY A N   1 
ATOM   2933 C  CA  . GLY A 1 355 ? 13.857  56.435 77.134 1.00 27.11  ? 355  GLY A CA  1 
ATOM   2934 C  C   . GLY A 1 355 ? 14.232  55.548 75.961 1.00 26.61  ? 355  GLY A C   1 
ATOM   2935 O  O   . GLY A 1 355 ? 13.534  55.521 74.942 1.00 26.18  ? 355  GLY A O   1 
ATOM   2936 N  N   . VAL A 1 356 ? 15.337  54.820 76.097 1.00 24.88  ? 356  VAL A N   1 
ATOM   2937 C  CA  . VAL A 1 356 ? 15.777  53.926 75.034 1.00 24.35  ? 356  VAL A CA  1 
ATOM   2938 C  C   . VAL A 1 356 ? 14.706  52.882 74.746 1.00 23.26  ? 356  VAL A C   1 
ATOM   2939 O  O   . VAL A 1 356 ? 14.394  52.609 73.587 1.00 24.38  ? 356  VAL A O   1 
ATOM   2940 C  CB  . VAL A 1 356 ? 17.089  53.193 75.401 1.00 24.36  ? 356  VAL A CB  1 
ATOM   2941 C  CG1 . VAL A 1 356 ? 17.402  52.138 74.351 1.00 22.87  ? 356  VAL A CG1 1 
ATOM   2942 C  CG2 . VAL A 1 356 ? 18.240  54.196 75.500 1.00 23.84  ? 356  VAL A CG2 1 
ATOM   2943 N  N   . LYS A 1 357 ? 14.137  52.301 75.799 1.00 24.08  ? 357  LYS A N   1 
ATOM   2944 C  CA  . LYS A 1 357 ? 13.106  51.285 75.617 1.00 25.38  ? 357  LYS A CA  1 
ATOM   2945 C  C   . LYS A 1 357 ? 11.847  51.843 74.953 1.00 23.93  ? 357  LYS A C   1 
ATOM   2946 O  O   . LYS A 1 357 ? 11.211  51.156 74.156 1.00 23.54  ? 357  LYS A O   1 
ATOM   2947 C  CB  . LYS A 1 357 ? 12.745  50.629 76.954 1.00 28.68  ? 357  LYS A CB  1 
ATOM   2948 C  CG  . LYS A 1 357 ? 11.797  49.447 76.783 1.00 32.81  ? 357  LYS A CG  1 
ATOM   2949 C  CD  . LYS A 1 357 ? 11.773  48.536 77.998 1.00 37.92  ? 357  LYS A CD  1 
ATOM   2950 C  CE  . LYS A 1 357 ? 10.858  47.340 77.755 1.00 38.80  ? 357  LYS A CE  1 
ATOM   2951 N  NZ  . LYS A 1 357 ? 11.232  46.602 76.508 1.00 40.19  ? 357  LYS A NZ  1 
ATOM   2952 N  N   . LEU A 1 358 ? 11.484  53.083 75.276 1.00 22.82  ? 358  LEU A N   1 
ATOM   2953 C  CA  . LEU A 1 358 ? 10.305  53.704 74.667 1.00 24.39  ? 358  LEU A CA  1 
ATOM   2954 C  C   . LEU A 1 358 ? 10.554  54.035 73.196 1.00 24.19  ? 358  LEU A C   1 
ATOM   2955 O  O   . LEU A 1 358 ? 9.639   53.976 72.370 1.00 23.90  ? 358  LEU A O   1 
ATOM   2956 C  CB  . LEU A 1 358 ? 9.936   55.005 75.392 1.00 24.80  ? 358  LEU A CB  1 
ATOM   2957 C  CG  . LEU A 1 358 ? 9.329   54.936 76.793 1.00 26.91  ? 358  LEU A CG  1 
ATOM   2958 C  CD1 . LEU A 1 358 ? 9.133   56.353 77.328 1.00 26.61  ? 358  LEU A CD1 1 
ATOM   2959 C  CD2 . LEU A 1 358 ? 8.000   54.188 76.741 1.00 28.01  ? 358  LEU A CD2 1 
ATOM   2960 N  N   . SER A 1 359 ? 11.798  54.384 72.882 1.00 22.91  ? 359  SER A N   1 
ATOM   2961 C  CA  . SER A 1 359 ? 12.189  54.768 71.526 1.00 23.33  ? 359  SER A CA  1 
ATOM   2962 C  C   . SER A 1 359 ? 12.343  53.608 70.547 1.00 24.06  ? 359  SER A C   1 
ATOM   2963 O  O   . SER A 1 359 ? 12.135  53.773 69.345 1.00 24.94  ? 359  SER A O   1 
ATOM   2964 C  CB  . SER A 1 359 ? 13.494  55.562 71.581 1.00 22.06  ? 359  SER A CB  1 
ATOM   2965 O  OG  . SER A 1 359 ? 13.369  56.659 72.468 1.00 26.10  ? 359  SER A OG  1 
ATOM   2966 N  N   . VAL A 1 360 ? 12.725  52.440 71.051 1.00 22.91  ? 360  VAL A N   1 
ATOM   2967 C  CA  . VAL A 1 360 ? 12.891  51.269 70.194 1.00 24.12  ? 360  VAL A CA  1 
ATOM   2968 C  C   . VAL A 1 360 ? 12.062  50.152 70.822 1.00 25.81  ? 360  VAL A C   1 
ATOM   2969 O  O   . VAL A 1 360 ? 12.594  49.127 71.255 1.00 24.84  ? 360  VAL A O   1 
ATOM   2970 C  CB  . VAL A 1 360 ? 14.376  50.849 70.118 1.00 25.55  ? 360  VAL A CB  1 
ATOM   2971 C  CG1 . VAL A 1 360 ? 14.598  49.939 68.919 1.00 25.48  ? 360  VAL A CG1 1 
ATOM   2972 C  CG2 . VAL A 1 360 ? 15.259  52.087 70.031 1.00 25.49  ? 360  VAL A CG2 1 
ATOM   2973 N  N   . PRO A 1 361 ? 10.730  50.340 70.865 1.00 27.94  ? 361  PRO A N   1 
ATOM   2974 C  CA  . PRO A 1 361 ? 9.771   49.391 71.440 1.00 29.07  ? 361  PRO A CA  1 
ATOM   2975 C  C   . PRO A 1 361 ? 9.810   47.960 70.917 1.00 30.07  ? 361  PRO A C   1 
ATOM   2976 O  O   . PRO A 1 361 ? 9.498   47.027 71.649 1.00 31.01  ? 361  PRO A O   1 
ATOM   2977 C  CB  . PRO A 1 361 ? 8.423   50.069 71.184 1.00 29.77  ? 361  PRO A CB  1 
ATOM   2978 C  CG  . PRO A 1 361 ? 8.665   50.826 69.910 1.00 29.90  ? 361  PRO A CG  1 
ATOM   2979 C  CD  . PRO A 1 361 ? 10.026  51.426 70.154 1.00 27.71  ? 361  PRO A CD  1 
ATOM   2980 N  N   . HIS A 1 362 ? 10.203  47.788 69.661 1.00 32.11  ? 362  HIS A N   1 
ATOM   2981 C  CA  . HIS A 1 362 ? 10.250  46.463 69.049 1.00 33.72  ? 362  HIS A CA  1 
ATOM   2982 C  C   . HIS A 1 362 ? 11.517  45.665 69.352 1.00 34.16  ? 362  HIS A C   1 
ATOM   2983 O  O   . HIS A 1 362 ? 11.607  44.490 69.001 1.00 34.96  ? 362  HIS A O   1 
ATOM   2984 C  CB  . HIS A 1 362 ? 10.114  46.600 67.533 1.00 35.30  ? 362  HIS A CB  1 
ATOM   2985 C  CG  . HIS A 1 362 ? 11.140  47.502 66.923 1.00 36.15  ? 362  HIS A CG  1 
ATOM   2986 N  ND1 . HIS A 1 362 ? 11.143  48.866 67.124 1.00 36.31  ? 362  HIS A ND1 1 
ATOM   2987 C  CD2 . HIS A 1 362 ? 12.217  47.233 66.148 1.00 35.46  ? 362  HIS A CD2 1 
ATOM   2988 C  CE1 . HIS A 1 362 ? 12.178  49.399 66.499 1.00 36.40  ? 362  HIS A CE1 1 
ATOM   2989 N  NE2 . HIS A 1 362 ? 12.847  48.429 65.899 1.00 34.49  ? 362  HIS A NE2 1 
ATOM   2990 N  N   . ALA A 1 363 ? 12.489  46.293 70.004 1.00 32.29  ? 363  ALA A N   1 
ATOM   2991 C  CA  . ALA A 1 363 ? 13.752  45.623 70.304 1.00 32.57  ? 363  ALA A CA  1 
ATOM   2992 C  C   . ALA A 1 363 ? 13.738  44.736 71.543 1.00 31.24  ? 363  ALA A C   1 
ATOM   2993 O  O   . ALA A 1 363 ? 13.041  45.021 72.513 1.00 31.97  ? 363  ALA A O   1 
ATOM   2994 C  CB  . ALA A 1 363 ? 14.865  46.665 70.442 1.00 32.07  ? 363  ALA A CB  1 
ATOM   2995 N  N   . ASN A 1 364 ? 14.515  43.657 71.499 1.00 31.17  ? 364  ASN A N   1 
ATOM   2996 C  CA  . ASN A 1 364 ? 14.634  42.767 72.645 1.00 31.10  ? 364  ASN A CA  1 
ATOM   2997 C  C   . ASN A 1 364 ? 15.734  43.376 73.515 1.00 30.58  ? 364  ASN A C   1 
ATOM   2998 O  O   . ASN A 1 364 ? 16.336  44.384 73.138 1.00 30.50  ? 364  ASN A O   1 
ATOM   2999 C  CB  . ASN A 1 364 ? 15.006  41.340 72.213 1.00 31.52  ? 364  ASN A CB  1 
ATOM   3000 C  CG  . ASN A 1 364 ? 16.211  41.292 71.290 1.00 32.77  ? 364  ASN A CG  1 
ATOM   3001 O  OD1 . ASN A 1 364 ? 17.005  42.232 71.227 1.00 29.84  ? 364  ASN A OD1 1 
ATOM   3002 N  ND2 . ASN A 1 364 ? 16.360  40.179 70.580 1.00 32.11  ? 364  ASN A ND2 1 
ATOM   3003 N  N   A ASP A 1 365 ? 15.999  42.778 74.672 0.50 30.00  ? 365  ASP A N   1 
ATOM   3004 N  N   B ASP A 1 365 ? 15.998  42.755 74.659 0.50 30.96  ? 365  ASP A N   1 
ATOM   3005 C  CA  A ASP A 1 365 ? 17.017  43.310 75.572 0.50 30.13  ? 365  ASP A CA  1 
ATOM   3006 C  CA  B ASP A 1 365 ? 17.012  43.239 75.591 0.50 31.78  ? 365  ASP A CA  1 
ATOM   3007 C  C   A ASP A 1 365 ? 18.401  43.453 74.947 0.50 29.71  ? 365  ASP A C   1 
ATOM   3008 C  C   B ASP A 1 365 ? 18.387  43.436 74.959 0.50 30.76  ? 365  ASP A C   1 
ATOM   3009 O  O   A ASP A 1 365 ? 19.107  44.425 75.220 0.50 29.65  ? 365  ASP A O   1 
ATOM   3010 O  O   B ASP A 1 365 ? 19.067  44.425 75.235 0.50 30.60  ? 365  ASP A O   1 
ATOM   3011 C  CB  A ASP A 1 365 ? 17.092  42.464 76.844 0.50 31.97  ? 365  ASP A CB  1 
ATOM   3012 C  CB  B ASP A 1 365 ? 17.128  42.278 76.775 0.50 35.79  ? 365  ASP A CB  1 
ATOM   3013 C  CG  A ASP A 1 365 ? 15.895  42.683 77.753 0.50 34.69  ? 365  ASP A CG  1 
ATOM   3014 C  CG  B ASP A 1 365 ? 15.817  42.107 77.515 0.50 40.15  ? 365  ASP A CG  1 
ATOM   3015 O  OD1 A ASP A 1 365 ? 15.872  42.112 78.865 0.50 34.68  ? 365  ASP A OD1 1 
ATOM   3016 O  OD1 B ASP A 1 365 ? 15.249  43.126 77.966 0.50 42.85  ? 365  ASP A OD1 1 
ATOM   3017 O  OD2 A ASP A 1 365 ? 14.975  43.433 77.352 0.50 33.77  ? 365  ASP A OD2 1 
ATOM   3018 O  OD2 B ASP A 1 365 ? 15.353  40.955 77.648 0.50 43.49  ? 365  ASP A OD2 1 
ATOM   3019 N  N   . LEU A 1 366 ? 18.799  42.493 74.118 1.00 28.67  ? 366  LEU A N   1 
ATOM   3020 C  CA  . LEU A 1 366 ? 20.100  42.585 73.466 1.00 28.01  ? 366  LEU A CA  1 
ATOM   3021 C  C   . LEU A 1 366 ? 20.093  43.822 72.569 1.00 26.94  ? 366  LEU A C   1 
ATOM   3022 O  O   . LEU A 1 366 ? 21.049  44.593 72.554 1.00 26.74  ? 366  LEU A O   1 
ATOM   3023 C  CB  . LEU A 1 366 ? 20.386  41.339 72.625 1.00 27.30  ? 366  LEU A CB  1 
ATOM   3024 C  CG  . LEU A 1 366 ? 21.757  41.369 71.937 1.00 27.52  ? 366  LEU A CG  1 
ATOM   3025 C  CD1 . LEU A 1 366 ? 22.854  41.399 73.002 1.00 26.00  ? 366  LEU A CD1 1 
ATOM   3026 C  CD2 . LEU A 1 366 ? 21.917  40.158 71.031 1.00 27.45  ? 366  LEU A CD2 1 
ATOM   3027 N  N   . GLY A 1 367 ? 19.007  44.003 71.823 1.00 25.91  ? 367  GLY A N   1 
ATOM   3028 C  CA  . GLY A 1 367 ? 18.893  45.158 70.950 1.00 24.85  ? 367  GLY A CA  1 
ATOM   3029 C  C   . GLY A 1 367 ? 18.981  46.457 71.736 1.00 23.81  ? 367  GLY A C   1 
ATOM   3030 O  O   . GLY A 1 367 ? 19.654  47.399 71.316 1.00 22.49  ? 367  GLY A O   1 
ATOM   3031 N  N   . LEU A 1 368 ? 18.303  46.514 72.880 1.00 23.46  ? 368  LEU A N   1 
ATOM   3032 C  CA  . LEU A 1 368 ? 18.340  47.710 73.715 1.00 24.45  ? 368  LEU A CA  1 
ATOM   3033 C  C   . LEU A 1 368 ? 19.763  47.963 74.213 1.00 25.27  ? 368  LEU A C   1 
ATOM   3034 O  O   . LEU A 1 368 ? 20.200  49.112 74.288 1.00 24.57  ? 368  LEU A O   1 
ATOM   3035 C  CB  . LEU A 1 368 ? 17.383  47.570 74.904 1.00 25.33  ? 368  LEU A CB  1 
ATOM   3036 C  CG  . LEU A 1 368 ? 15.890  47.475 74.564 1.00 28.23  ? 368  LEU A CG  1 
ATOM   3037 C  CD1 . LEU A 1 368 ? 15.093  47.250 75.839 1.00 28.40  ? 368  LEU A CD1 1 
ATOM   3038 C  CD2 . LEU A 1 368 ? 15.429  48.748 73.858 1.00 26.61  ? 368  LEU A CD2 1 
ATOM   3039 N  N   . ASP A 1 369 ? 20.483  46.894 74.555 1.00 24.89  ? 369  ASP A N   1 
ATOM   3040 C  CA  . ASP A 1 369 ? 21.865  47.037 75.014 1.00 26.34  ? 369  ASP A CA  1 
ATOM   3041 C  C   . ASP A 1 369 ? 22.719  47.620 73.893 1.00 24.05  ? 369  ASP A C   1 
ATOM   3042 O  O   . ASP A 1 369 ? 23.585  48.459 74.133 1.00 24.85  ? 369  ASP A O   1 
ATOM   3043 C  CB  . ASP A 1 369 ? 22.473  45.686 75.420 1.00 27.55  ? 369  ASP A CB  1 
ATOM   3044 C  CG  . ASP A 1 369 ? 21.916  45.157 76.728 1.00 31.79  ? 369  ASP A CG  1 
ATOM   3045 O  OD1 . ASP A 1 369 ? 21.372  45.955 77.518 1.00 31.83  ? 369  ASP A OD1 1 
ATOM   3046 O  OD2 . ASP A 1 369 ? 22.040  43.937 76.969 1.00 33.51  ? 369  ASP A OD2 1 
ATOM   3047 N  N   . ALA A 1 370 ? 22.475  47.157 72.671 1.00 22.76  ? 370  ALA A N   1 
ATOM   3048 C  CA  . ALA A 1 370 ? 23.229  47.623 71.512 1.00 22.95  ? 370  ALA A CA  1 
ATOM   3049 C  C   . ALA A 1 370 ? 23.048  49.124 71.306 1.00 23.14  ? 370  ALA A C   1 
ATOM   3050 O  O   . ALA A 1 370 ? 24.016  49.847 71.068 1.00 21.92  ? 370  ALA A O   1 
ATOM   3051 C  CB  . ALA A 1 370 ? 22.786  46.869 70.263 1.00 23.89  ? 370  ALA A CB  1 
ATOM   3052 N  N   . VAL A 1 371 ? 21.803  49.585 71.394 1.00 23.55  ? 371  VAL A N   1 
ATOM   3053 C  CA  . VAL A 1 371 ? 21.499  51.002 71.220 1.00 22.72  ? 371  VAL A CA  1 
ATOM   3054 C  C   . VAL A 1 371 ? 22.147  51.807 72.343 1.00 23.50  ? 371  VAL A C   1 
ATOM   3055 O  O   . VAL A 1 371 ? 22.802  52.820 72.101 1.00 23.44  ? 371  VAL A O   1 
ATOM   3056 C  CB  . VAL A 1 371 ? 19.970  51.254 71.238 1.00 22.88  ? 371  VAL A CB  1 
ATOM   3057 C  CG1 . VAL A 1 371 ? 19.685  52.752 71.185 1.00 21.94  ? 371  VAL A CG1 1 
ATOM   3058 C  CG2 . VAL A 1 371 ? 19.314  50.551 70.055 1.00 20.04  ? 371  VAL A CG2 1 
ATOM   3059 N  N   . THR A 1 372 ? 21.967  51.343 73.573 1.00 24.36  ? 372  THR A N   1 
ATOM   3060 C  CA  . THR A 1 372 ? 22.534  52.024 74.730 1.00 25.45  ? 372  THR A CA  1 
ATOM   3061 C  C   . THR A 1 372 ? 24.048  52.202 74.609 1.00 25.03  ? 372  THR A C   1 
ATOM   3062 O  O   . THR A 1 372 ? 24.572  53.282 74.871 1.00 25.38  ? 372  THR A O   1 
ATOM   3063 C  CB  . THR A 1 372 ? 22.215  51.254 76.018 1.00 27.13  ? 372  THR A CB  1 
ATOM   3064 O  OG1 . THR A 1 372 ? 20.792  51.180 76.175 1.00 27.77  ? 372  THR A OG1 1 
ATOM   3065 C  CG2 . THR A 1 372 ? 22.827  51.953 77.232 1.00 27.24  ? 372  THR A CG2 1 
ATOM   3066 N  N   . LEU A 1 373 ? 24.746  51.147 74.206 1.00 24.58  ? 373  LEU A N   1 
ATOM   3067 C  CA  . LEU A 1 373 ? 26.196  51.212 74.063 1.00 25.08  ? 373  LEU A CA  1 
ATOM   3068 C  C   . LEU A 1 373 ? 26.607  52.159 72.938 1.00 24.98  ? 373  LEU A C   1 
ATOM   3069 O  O   . LEU A 1 373 ? 27.588  52.891 73.054 1.00 25.28  ? 373  LEU A O   1 
ATOM   3070 C  CB  . LEU A 1 373 ? 26.763  49.816 73.789 1.00 25.74  ? 373  LEU A CB  1 
ATOM   3071 C  CG  . LEU A 1 373 ? 28.278  49.725 73.582 1.00 28.53  ? 373  LEU A CG  1 
ATOM   3072 C  CD1 . LEU A 1 373 ? 29.001  50.313 74.794 1.00 30.37  ? 373  LEU A CD1 1 
ATOM   3073 C  CD2 . LEU A 1 373 ? 28.681  48.275 73.372 1.00 30.60  ? 373  LEU A CD2 1 
ATOM   3074 N  N   . GLN A 1 374 ? 25.843  52.139 71.852 1.00 24.16  ? 374  GLN A N   1 
ATOM   3075 C  CA  . GLN A 1 374 ? 26.115  52.978 70.692 1.00 25.61  ? 374  GLN A CA  1 
ATOM   3076 C  C   . GLN A 1 374 ? 26.021  54.473 71.020 1.00 24.69  ? 374  GLN A C   1 
ATOM   3077 O  O   . GLN A 1 374 ? 26.752  55.287 70.454 1.00 24.48  ? 374  GLN A O   1 
ATOM   3078 C  CB  . GLN A 1 374 ? 25.119  52.630 69.582 1.00 27.85  ? 374  GLN A CB  1 
ATOM   3079 C  CG  . GLN A 1 374 ? 25.434  53.207 68.215 1.00 31.74  ? 374  GLN A CG  1 
ATOM   3080 C  CD  . GLN A 1 374 ? 26.657  52.573 67.583 1.00 33.81  ? 374  GLN A CD  1 
ATOM   3081 O  OE1 . GLN A 1 374 ? 27.032  51.446 67.912 1.00 35.97  ? 374  GLN A OE1 1 
ATOM   3082 N  NE2 . GLN A 1 374 ? 27.276  53.289 66.659 1.00 34.18  ? 374  GLN A NE2 1 
ATOM   3083 N  N   . TYR A 1 375 ? 25.130  54.830 71.941 1.00 23.42  ? 375  TYR A N   1 
ATOM   3084 C  CA  . TYR A 1 375 ? 24.936  56.233 72.300 1.00 23.46  ? 375  TYR A CA  1 
ATOM   3085 C  C   . TYR A 1 375 ? 25.384  56.650 73.698 1.00 26.22  ? 375  TYR A C   1 
ATOM   3086 O  O   . TYR A 1 375 ? 25.030  57.732 74.169 1.00 28.50  ? 375  TYR A O   1 
ATOM   3087 C  CB  . TYR A 1 375 ? 23.466  56.616 72.119 1.00 20.76  ? 375  TYR A CB  1 
ATOM   3088 C  CG  . TYR A 1 375 ? 23.043  56.691 70.670 1.00 21.52  ? 375  TYR A CG  1 
ATOM   3089 C  CD1 . TYR A 1 375 ? 22.702  55.538 69.956 1.00 19.69  ? 375  TYR A CD1 1 
ATOM   3090 C  CD2 . TYR A 1 375 ? 23.003  57.916 70.006 1.00 21.12  ? 375  TYR A CD2 1 
ATOM   3091 C  CE1 . TYR A 1 375 ? 22.330  55.608 68.608 1.00 18.98  ? 375  TYR A CE1 1 
ATOM   3092 C  CE2 . TYR A 1 375 ? 22.635  57.999 68.662 1.00 20.76  ? 375  TYR A CE2 1 
ATOM   3093 C  CZ  . TYR A 1 375 ? 22.300  56.844 67.971 1.00 21.19  ? 375  TYR A CZ  1 
ATOM   3094 O  OH  . TYR A 1 375 ? 21.940  56.937 66.643 1.00 23.61  ? 375  TYR A OH  1 
ATOM   3095 N  N   . THR A 1 376 ? 26.159  55.808 74.367 1.00 24.40  ? 376  THR A N   1 
ATOM   3096 C  CA  . THR A 1 376 ? 26.625  56.158 75.702 1.00 25.55  ? 376  THR A CA  1 
ATOM   3097 C  C   . THR A 1 376 ? 28.122  56.446 75.752 1.00 27.28  ? 376  THR A C   1 
ATOM   3098 O  O   . THR A 1 376 ? 28.934  55.658 75.262 1.00 26.30  ? 376  THR A O   1 
ATOM   3099 C  CB  . THR A 1 376 ? 26.312  55.037 76.718 1.00 23.32  ? 376  THR A CB  1 
ATOM   3100 O  OG1 . THR A 1 376 ? 24.892  54.912 76.871 1.00 25.79  ? 376  THR A OG1 1 
ATOM   3101 C  CG2 . THR A 1 376 ? 26.934  55.352 78.072 1.00 24.56  ? 376  THR A CG2 1 
ATOM   3102 N  N   . ASP A 1 377 ? 28.479  57.591 76.330 1.00 26.55  ? 377  ASP A N   1 
ATOM   3103 C  CA  . ASP A 1 377 ? 29.883  57.959 76.495 1.00 27.61  ? 377  ASP A CA  1 
ATOM   3104 C  C   . ASP A 1 377 ? 30.265  57.381 77.858 1.00 27.85  ? 377  ASP A C   1 
ATOM   3105 O  O   . ASP A 1 377 ? 29.964  57.973 78.898 1.00 26.14  ? 377  ASP A O   1 
ATOM   3106 C  CB  . ASP A 1 377 ? 30.044  59.482 76.509 1.00 28.01  ? 377  ASP A CB  1 
ATOM   3107 C  CG  . ASP A 1 377 ? 31.471  59.921 76.809 1.00 31.41  ? 377  ASP A CG  1 
ATOM   3108 O  OD1 . ASP A 1 377 ? 31.734  61.143 76.760 1.00 29.70  ? 377  ASP A OD1 1 
ATOM   3109 O  OD2 . ASP A 1 377 ? 32.328  59.053 77.097 1.00 29.56  ? 377  ASP A OD2 1 
ATOM   3110 N  N   . TRP A 1 378 ? 30.912  56.221 77.853 1.00 27.28  ? 378  TRP A N   1 
ATOM   3111 C  CA  . TRP A 1 378 ? 31.280  55.577 79.104 1.00 28.89  ? 378  TRP A CA  1 
ATOM   3112 C  C   . TRP A 1 378 ? 32.357  56.241 79.946 1.00 29.49  ? 378  TRP A C   1 
ATOM   3113 O  O   . TRP A 1 378 ? 32.697  55.753 81.023 1.00 29.81  ? 378  TRP A O   1 
ATOM   3114 C  CB  . TRP A 1 378 ? 31.605  54.105 78.859 1.00 29.36  ? 378  TRP A CB  1 
ATOM   3115 C  CG  . TRP A 1 378 ? 30.347  53.314 78.799 1.00 31.77  ? 378  TRP A CG  1 
ATOM   3116 C  CD1 . TRP A 1 378 ? 29.774  52.755 77.694 1.00 32.14  ? 378  TRP A CD1 1 
ATOM   3117 C  CD2 . TRP A 1 378 ? 29.437  53.085 79.883 1.00 34.91  ? 378  TRP A CD2 1 
ATOM   3118 N  NE1 . TRP A 1 378 ? 28.559  52.197 78.022 1.00 34.84  ? 378  TRP A NE1 1 
ATOM   3119 C  CE2 . TRP A 1 378 ? 28.329  52.386 79.360 1.00 34.87  ? 378  TRP A CE2 1 
ATOM   3120 C  CE3 . TRP A 1 378 ? 29.452  53.409 81.249 1.00 36.68  ? 378  TRP A CE3 1 
ATOM   3121 C  CZ2 . TRP A 1 378 ? 27.241  52.002 80.153 1.00 38.45  ? 378  TRP A CZ2 1 
ATOM   3122 C  CZ3 . TRP A 1 378 ? 28.369  53.026 82.041 1.00 39.72  ? 378  TRP A CZ3 1 
ATOM   3123 C  CH2 . TRP A 1 378 ? 27.278  52.329 81.487 1.00 38.37  ? 378  TRP A CH2 1 
ATOM   3124 N  N   A MET A 1 379 ? 32.892  57.350 79.447 0.50 30.52  ? 379  MET A N   1 
ATOM   3125 N  N   B MET A 1 379 ? 32.893  57.354 79.464 0.50 29.91  ? 379  MET A N   1 
ATOM   3126 C  CA  A MET A 1 379 ? 33.905  58.111 80.170 0.50 32.28  ? 379  MET A CA  1 
ATOM   3127 C  CA  B MET A 1 379 ? 33.900  58.081 80.225 0.50 31.20  ? 379  MET A CA  1 
ATOM   3128 C  C   A MET A 1 379 ? 33.188  59.197 80.964 0.50 32.63  ? 379  MET A C   1 
ATOM   3129 C  C   B MET A 1 379 ? 33.163  59.136 81.041 0.50 31.85  ? 379  MET A C   1 
ATOM   3130 O  O   A MET A 1 379 ? 33.796  59.894 81.776 0.50 33.70  ? 379  MET A O   1 
ATOM   3131 O  O   B MET A 1 379 ? 33.730  59.748 81.945 0.50 32.79  ? 379  MET A O   1 
ATOM   3132 C  CB  A MET A 1 379 ? 34.890  58.765 79.197 0.50 33.38  ? 379  MET A CB  1 
ATOM   3133 C  CB  B MET A 1 379 ? 34.892  58.785 79.298 0.50 31.03  ? 379  MET A CB  1 
ATOM   3134 C  CG  A MET A 1 379 ? 36.056  57.884 78.778 0.50 36.34  ? 379  MET A CG  1 
ATOM   3135 C  CG  B MET A 1 379 ? 35.631  57.878 78.335 0.50 32.78  ? 379  MET A CG  1 
ATOM   3136 S  SD  A MET A 1 379 ? 37.204  57.573 80.138 0.50 39.70  ? 379  MET A SD  1 
ATOM   3137 S  SD  B MET A 1 379 ? 36.933  58.777 77.474 0.50 34.19  ? 379  MET A SD  1 
ATOM   3138 C  CE  A MET A 1 379 ? 38.149  59.095 80.143 0.50 38.83  ? 379  MET A CE  1 
ATOM   3139 C  CE  B MET A 1 379 ? 35.998  59.597 76.191 0.50 34.07  ? 379  MET A CE  1 
ATOM   3140 N  N   . ASP A 1 380 ? 31.888  59.334 80.720 1.00 31.81  ? 380  ASP A N   1 
ATOM   3141 C  CA  . ASP A 1 380 ? 31.082  60.345 81.395 1.00 31.79  ? 380  ASP A CA  1 
ATOM   3142 C  C   . ASP A 1 380 ? 29.594  59.987 81.293 1.00 31.71  ? 380  ASP A C   1 
ATOM   3143 O  O   . ASP A 1 380 ? 28.774  60.792 80.852 1.00 30.42  ? 380  ASP A O   1 
ATOM   3144 C  CB  . ASP A 1 380 ? 31.382  61.687 80.718 1.00 31.86  ? 380  ASP A CB  1 
ATOM   3145 C  CG  . ASP A 1 380 ? 30.787  62.865 81.443 1.00 32.15  ? 380  ASP A CG  1 
ATOM   3146 O  OD1 . ASP A 1 380 ? 30.511  62.750 82.654 1.00 34.85  ? 380  ASP A OD1 1 
ATOM   3147 O  OD2 . ASP A 1 380 ? 30.615  63.914 80.791 1.00 35.82  ? 380  ASP A OD2 1 
ATOM   3148 N  N   . ASP A 1 381 ? 29.261  58.776 81.729 1.00 32.13  ? 381  ASP A N   1 
ATOM   3149 C  CA  . ASP A 1 381 ? 27.898  58.250 81.660 1.00 33.36  ? 381  ASP A CA  1 
ATOM   3150 C  C   . ASP A 1 381 ? 26.828  58.906 82.531 1.00 34.72  ? 381  ASP A C   1 
ATOM   3151 O  O   . ASP A 1 381 ? 25.636  58.670 82.322 1.00 34.58  ? 381  ASP A O   1 
ATOM   3152 C  CB  . ASP A 1 381 ? 27.920  56.750 81.946 1.00 33.05  ? 381  ASP A CB  1 
ATOM   3153 C  CG  . ASP A 1 381 ? 28.508  56.427 83.307 1.00 35.67  ? 381  ASP A CG  1 
ATOM   3154 O  OD1 . ASP A 1 381 ? 27.777  55.874 84.154 1.00 35.32  ? 381  ASP A OD1 1 
ATOM   3155 O  OD2 . ASP A 1 381 ? 29.701  56.729 83.526 1.00 34.63  ? 381  ASP A OD2 1 
ATOM   3156 N  N   . ASN A 1 382 ? 27.232  59.711 83.508 1.00 34.47  ? 382  ASN A N   1 
ATOM   3157 C  CA  . ASN A 1 382 ? 26.253  60.374 84.364 1.00 35.43  ? 382  ASN A CA  1 
ATOM   3158 C  C   . ASN A 1 382 ? 26.055  61.835 83.980 1.00 34.58  ? 382  ASN A C   1 
ATOM   3159 O  O   . ASN A 1 382 ? 25.459  62.609 84.730 1.00 36.14  ? 382  ASN A O   1 
ATOM   3160 C  CB  . ASN A 1 382 ? 26.661  60.272 85.837 1.00 36.60  ? 382  ASN A CB  1 
ATOM   3161 C  CG  . ASN A 1 382 ? 26.441  58.883 86.403 1.00 38.97  ? 382  ASN A CG  1 
ATOM   3162 O  OD1 . ASN A 1 382 ? 25.343  58.327 86.306 1.00 39.97  ? 382  ASN A OD1 1 
ATOM   3163 N  ND2 . ASN A 1 382 ? 27.482  58.315 87.001 1.00 39.25  ? 382  ASN A ND2 1 
ATOM   3164 N  N   . ASN A 1 383 ? 26.560  62.206 82.810 1.00 31.69  ? 383  ASN A N   1 
ATOM   3165 C  CA  . ASN A 1 383 ? 26.420  63.569 82.317 1.00 31.41  ? 383  ASN A CA  1 
ATOM   3166 C  C   . ASN A 1 383 ? 24.977  63.727 81.831 1.00 30.80  ? 383  ASN A C   1 
ATOM   3167 O  O   . ASN A 1 383 ? 24.593  63.166 80.802 1.00 28.03  ? 383  ASN A O   1 
ATOM   3168 C  CB  . ASN A 1 383 ? 27.416  63.810 81.176 1.00 30.73  ? 383  ASN A CB  1 
ATOM   3169 C  CG  . ASN A 1 383 ? 27.423  65.250 80.691 1.00 33.79  ? 383  ASN A CG  1 
ATOM   3170 O  OD1 . ASN A 1 383 ? 28.482  65.802 80.371 1.00 35.96  ? 383  ASN A OD1 1 
ATOM   3171 N  ND2 . ASN A 1 383 ? 26.247  65.860 80.616 1.00 28.39  ? 383  ASN A ND2 1 
ATOM   3172 N  N   . GLY A 1 384 ? 24.187  64.482 82.591 1.00 29.28  ? 384  GLY A N   1 
ATOM   3173 C  CA  . GLY A 1 384 ? 22.789  64.705 82.261 1.00 29.05  ? 384  GLY A CA  1 
ATOM   3174 C  C   . GLY A 1 384 ? 22.529  65.321 80.899 1.00 28.35  ? 384  GLY A C   1 
ATOM   3175 O  O   . GLY A 1 384 ? 21.535  64.996 80.247 1.00 28.78  ? 384  GLY A O   1 
ATOM   3176 N  N   . ILE A 1 385 ? 23.408  66.219 80.469 1.00 27.91  ? 385  ILE A N   1 
ATOM   3177 C  CA  . ILE A 1 385 ? 23.258  66.865 79.172 1.00 27.86  ? 385  ILE A CA  1 
ATOM   3178 C  C   . ILE A 1 385 ? 23.568  65.875 78.046 1.00 28.25  ? 385  ILE A C   1 
ATOM   3179 O  O   . ILE A 1 385 ? 22.874  65.846 77.029 1.00 27.92  ? 385  ILE A O   1 
ATOM   3180 C  CB  . ILE A 1 385 ? 24.179  68.104 79.059 1.00 28.57  ? 385  ILE A CB  1 
ATOM   3181 C  CG1 . ILE A 1 385 ? 23.687  69.195 80.018 1.00 30.47  ? 385  ILE A CG1 1 
ATOM   3182 C  CG2 . ILE A 1 385 ? 24.204  68.617 77.625 1.00 27.22  ? 385  ILE A CG2 1 
ATOM   3183 C  CD1 . ILE A 1 385 ? 24.504  70.476 79.974 1.00 35.57  ? 385  ILE A CD1 1 
ATOM   3184 N  N   . LYS A 1 386 ? 24.602  65.059 78.233 1.00 27.83  ? 386  LYS A N   1 
ATOM   3185 C  CA  . LYS A 1 386 ? 24.969  64.067 77.227 1.00 28.03  ? 386  LYS A CA  1 
ATOM   3186 C  C   . LYS A 1 386 ? 23.885  63.001 77.107 1.00 27.20  ? 386  LYS A C   1 
ATOM   3187 O  O   . LYS A 1 386 ? 23.588  62.532 76.005 1.00 25.05  ? 386  LYS A O   1 
ATOM   3188 C  CB  . LYS A 1 386 ? 26.310  63.410 77.572 1.00 28.66  ? 386  LYS A CB  1 
ATOM   3189 C  CG  . LYS A 1 386 ? 27.524  64.283 77.272 1.00 31.26  ? 386  LYS A CG  1 
ATOM   3190 C  CD  . LYS A 1 386 ? 28.828  63.550 77.574 1.00 32.23  ? 386  LYS A CD  1 
ATOM   3191 C  CE  . LYS A 1 386 ? 30.042  64.409 77.232 1.00 33.99  ? 386  LYS A CE  1 
ATOM   3192 N  NZ  . LYS A 1 386 ? 31.327  63.753 77.616 1.00 34.26  ? 386  LYS A NZ  1 
ATOM   3193 N  N   . ASN A 1 387 ? 23.304  62.616 78.240 1.00 25.92  ? 387  ASN A N   1 
ATOM   3194 C  CA  . ASN A 1 387 ? 22.239  61.622 78.247 1.00 25.61  ? 387  ASN A CA  1 
ATOM   3195 C  C   . ASN A 1 387 ? 21.027  62.183 77.497 1.00 26.73  ? 387  ASN A C   1 
ATOM   3196 O  O   . ASN A 1 387 ? 20.424  61.498 76.670 1.00 24.83  ? 387  ASN A O   1 
ATOM   3197 C  CB  . ASN A 1 387 ? 21.845  61.274 79.684 1.00 25.54  ? 387  ASN A CB  1 
ATOM   3198 C  CG  . ASN A 1 387 ? 22.895  60.428 80.397 1.00 29.12  ? 387  ASN A CG  1 
ATOM   3199 O  OD1 . ASN A 1 387 ? 22.817  60.220 81.611 1.00 31.02  ? 387  ASN A OD1 1 
ATOM   3200 N  ND2 . ASN A 1 387 ? 23.873  59.929 79.645 1.00 25.10  ? 387  ASN A ND2 1 
ATOM   3201 N  N   . ARG A 1 388 ? 20.677  63.433 77.793 1.00 25.98  ? 388  ARG A N   1 
ATOM   3202 C  CA  . ARG A 1 388 ? 19.548  64.090 77.138 1.00 25.64  ? 388  ARG A CA  1 
ATOM   3203 C  C   . ARG A 1 388 ? 19.769  64.169 75.624 1.00 24.49  ? 388  ARG A C   1 
ATOM   3204 O  O   . ARG A 1 388 ? 18.921  63.746 74.841 1.00 24.87  ? 388  ARG A O   1 
ATOM   3205 C  CB  . ARG A 1 388 ? 19.364  65.506 77.694 1.00 24.60  ? 388  ARG A CB  1 
ATOM   3206 C  CG  . ARG A 1 388 ? 18.189  66.275 77.101 1.00 24.25  ? 388  ARG A CG  1 
ATOM   3207 C  CD  . ARG A 1 388 ? 18.329  67.769 77.387 1.00 24.86  ? 388  ARG A CD  1 
ATOM   3208 N  NE  . ARG A 1 388 ? 19.438  68.346 76.630 1.00 24.81  ? 388  ARG A NE  1 
ATOM   3209 C  CZ  . ARG A 1 388 ? 20.078  69.465 76.956 1.00 25.36  ? 388  ARG A CZ  1 
ATOM   3210 N  NH1 . ARG A 1 388 ? 19.726  70.148 78.039 1.00 23.53  ? 388  ARG A NH1 1 
ATOM   3211 N  NH2 . ARG A 1 388 ? 21.077  69.897 76.199 1.00 24.49  ? 388  ARG A NH2 1 
ATOM   3212 N  N   . ASP A 1 389 ? 20.912  64.714 75.213 1.00 24.45  ? 389  ASP A N   1 
ATOM   3213 C  CA  . ASP A 1 389 ? 21.216  64.846 73.791 1.00 24.70  ? 389  ASP A CA  1 
ATOM   3214 C  C   . ASP A 1 389 ? 21.336  63.479 73.111 1.00 24.80  ? 389  ASP A C   1 
ATOM   3215 O  O   . ASP A 1 389 ? 20.983  63.325 71.937 1.00 21.86  ? 389  ASP A O   1 
ATOM   3216 C  CB  . ASP A 1 389 ? 22.505  65.652 73.605 1.00 25.47  ? 389  ASP A CB  1 
ATOM   3217 C  CG  . ASP A 1 389 ? 22.341  67.121 73.989 1.00 28.07  ? 389  ASP A CG  1 
ATOM   3218 O  OD1 . ASP A 1 389 ? 23.362  67.838 74.075 1.00 28.92  ? 389  ASP A OD1 1 
ATOM   3219 O  OD2 . ASP A 1 389 ? 21.193  67.563 74.199 1.00 26.79  ? 389  ASP A OD2 1 
ATOM   3220 N  N   . GLY A 1 390 ? 21.826  62.493 73.859 1.00 23.65  ? 390  GLY A N   1 
ATOM   3221 C  CA  . GLY A 1 390 ? 21.973  61.148 73.325 1.00 24.52  ? 390  GLY A CA  1 
ATOM   3222 C  C   . GLY A 1 390 ? 20.624  60.540 72.972 1.00 24.83  ? 390  GLY A C   1 
ATOM   3223 O  O   . GLY A 1 390 ? 20.469  59.941 71.906 1.00 23.32  ? 390  GLY A O   1 
ATOM   3224 N  N   . LEU A 1 391 ? 19.651  60.686 73.870 1.00 23.03  ? 391  LEU A N   1 
ATOM   3225 C  CA  . LEU A 1 391 ? 18.305  60.170 73.635 1.00 24.11  ? 391  LEU A CA  1 
ATOM   3226 C  C   . LEU A 1 391 ? 17.681  60.907 72.465 1.00 23.36  ? 391  LEU A C   1 
ATOM   3227 O  O   . LEU A 1 391 ? 17.004  60.309 71.628 1.00 22.26  ? 391  LEU A O   1 
ATOM   3228 C  CB  . LEU A 1 391 ? 17.417  60.371 74.864 1.00 25.35  ? 391  LEU A CB  1 
ATOM   3229 C  CG  . LEU A 1 391 ? 17.190  59.162 75.767 1.00 31.55  ? 391  LEU A CG  1 
ATOM   3230 C  CD1 . LEU A 1 391 ? 16.261  59.557 76.908 1.00 29.36  ? 391  LEU A CD1 1 
ATOM   3231 C  CD2 . LEU A 1 391 ? 16.585  58.016 74.951 1.00 31.96  ? 391  LEU A CD2 1 
ATOM   3232 N  N   . ASP A 1 392 ? 17.898  62.217 72.429 1.00 22.64  ? 392  ASP A N   1 
ATOM   3233 C  CA  . ASP A 1 392 ? 17.373  63.052 71.359 1.00 24.21  ? 392  ASP A CA  1 
ATOM   3234 C  C   . ASP A 1 392 ? 17.868  62.499 70.019 1.00 23.07  ? 392  ASP A C   1 
ATOM   3235 O  O   . ASP A 1 392 ? 17.089  62.337 69.081 1.00 22.52  ? 392  ASP A O   1 
ATOM   3236 C  CB  . ASP A 1 392 ? 17.846  64.494 71.557 1.00 25.83  ? 392  ASP A CB  1 
ATOM   3237 C  CG  . ASP A 1 392 ? 17.058  65.494 70.723 1.00 31.65  ? 392  ASP A CG  1 
ATOM   3238 O  OD1 . ASP A 1 392 ? 17.256  66.711 70.923 1.00 35.69  ? 392  ASP A OD1 1 
ATOM   3239 O  OD2 . ASP A 1 392 ? 16.242  65.075 69.874 1.00 32.05  ? 392  ASP A OD2 1 
ATOM   3240 N  N   . ASP A 1 393 ? 19.164  62.193 69.950 1.00 22.87  ? 393  ASP A N   1 
ATOM   3241 C  CA  . ASP A 1 393 ? 19.785  61.647 68.741 1.00 22.59  ? 393  ASP A CA  1 
ATOM   3242 C  C   . ASP A 1 393 ? 19.227  60.268 68.393 1.00 22.94  ? 393  ASP A C   1 
ATOM   3243 O  O   . ASP A 1 393 ? 18.996  59.964 67.223 1.00 21.44  ? 393  ASP A O   1 
ATOM   3244 C  CB  . ASP A 1 393 ? 21.300  61.546 68.926 1.00 24.51  ? 393  ASP A CB  1 
ATOM   3245 C  CG  . ASP A 1 393 ? 22.000  62.884 68.778 1.00 29.74  ? 393  ASP A CG  1 
ATOM   3246 O  OD1 . ASP A 1 393 ? 23.154  63.003 69.237 1.00 32.04  ? 393  ASP A OD1 1 
ATOM   3247 O  OD2 . ASP A 1 393 ? 21.408  63.812 68.194 1.00 30.49  ? 393  ASP A OD2 1 
ATOM   3248 N  N   . ILE A 1 394 ? 19.023  59.432 69.407 1.00 21.63  ? 394  ILE A N   1 
ATOM   3249 C  CA  . ILE A 1 394 ? 18.476  58.098 69.182 1.00 21.15  ? 394  ILE A CA  1 
ATOM   3250 C  C   . ILE A 1 394 ? 17.117  58.197 68.496 1.00 20.96  ? 394  ILE A C   1 
ATOM   3251 O  O   . ILE A 1 394 ? 16.870  57.549 67.476 1.00 19.22  ? 394  ILE A O   1 
ATOM   3252 C  CB  . ILE A 1 394 ? 18.292  57.328 70.513 1.00 20.91  ? 394  ILE A CB  1 
ATOM   3253 C  CG1 . ILE A 1 394 ? 19.656  56.858 71.037 1.00 18.99  ? 394  ILE A CG1 1 
ATOM   3254 C  CG2 . ILE A 1 394 ? 17.341  56.150 70.309 1.00 20.27  ? 394  ILE A CG2 1 
ATOM   3255 C  CD1 . ILE A 1 394 ? 19.615  56.297 72.451 1.00 19.21  ? 394  ILE A CD1 1 
ATOM   3256 N  N   . VAL A 1 395 ? 16.237  59.012 69.063 1.00 19.36  ? 395  VAL A N   1 
ATOM   3257 C  CA  . VAL A 1 395 ? 14.899  59.181 68.517 1.00 19.99  ? 395  VAL A CA  1 
ATOM   3258 C  C   . VAL A 1 395 ? 14.923  59.754 67.097 1.00 20.12  ? 395  VAL A C   1 
ATOM   3259 O  O   . VAL A 1 395 ? 14.225  59.256 66.211 1.00 21.22  ? 395  VAL A O   1 
ATOM   3260 C  CB  . VAL A 1 395 ? 14.046  60.082 69.448 1.00 19.51  ? 395  VAL A CB  1 
ATOM   3261 C  CG1 . VAL A 1 395 ? 12.636  60.252 68.881 1.00 17.89  ? 395  VAL A CG1 1 
ATOM   3262 C  CG2 . VAL A 1 395 ? 13.977  59.450 70.837 1.00 17.19  ? 395  VAL A CG2 1 
ATOM   3263 N  N   . GLY A 1 396 ? 15.736  60.783 66.880 1.00 20.64  ? 396  GLY A N   1 
ATOM   3264 C  CA  . GLY A 1 396 ? 15.820  61.390 65.561 1.00 20.13  ? 396  GLY A CA  1 
ATOM   3265 C  C   . GLY A 1 396 ? 16.449  60.478 64.521 1.00 21.41  ? 396  GLY A C   1 
ATOM   3266 O  O   . GLY A 1 396 ? 15.960  60.375 63.390 1.00 20.04  ? 396  GLY A O   1 
ATOM   3267 N  N   . ASP A 1 397 ? 17.534  59.808 64.900 1.00 19.79  ? 397  ASP A N   1 
ATOM   3268 C  CA  . ASP A 1 397 ? 18.236  58.901 63.998 1.00 21.24  ? 397  ASP A CA  1 
ATOM   3269 C  C   . ASP A 1 397 ? 17.366  57.711 63.600 1.00 20.84  ? 397  ASP A C   1 
ATOM   3270 O  O   . ASP A 1 397 ? 17.230  57.393 62.422 1.00 20.29  ? 397  ASP A O   1 
ATOM   3271 C  CB  . ASP A 1 397 ? 19.519  58.381 64.658 1.00 19.61  ? 397  ASP A CB  1 
ATOM   3272 C  CG  . ASP A 1 397 ? 20.592  59.451 64.785 1.00 22.89  ? 397  ASP A CG  1 
ATOM   3273 O  OD1 . ASP A 1 397 ? 21.592  59.211 65.495 1.00 22.43  ? 397  ASP A OD1 1 
ATOM   3274 O  OD2 . ASP A 1 397 ? 20.445  60.525 64.168 1.00 22.01  ? 397  ASP A OD2 1 
ATOM   3275 N  N   . HIS A 1 398 ? 16.778  57.058 64.595 1.00 19.41  ? 398  HIS A N   1 
ATOM   3276 C  CA  . HIS A 1 398 ? 15.940  55.891 64.352 1.00 20.24  ? 398  HIS A CA  1 
ATOM   3277 C  C   . HIS A 1 398 ? 14.651  56.168 63.576 1.00 20.16  ? 398  HIS A C   1 
ATOM   3278 O  O   . HIS A 1 398 ? 14.290  55.417 62.668 1.00 19.10  ? 398  HIS A O   1 
ATOM   3279 C  CB  . HIS A 1 398 ? 15.581  55.219 65.684 1.00 19.57  ? 398  HIS A CB  1 
ATOM   3280 C  CG  . HIS A 1 398 ? 14.532  54.154 65.561 1.00 21.18  ? 398  HIS A CG  1 
ATOM   3281 N  ND1 . HIS A 1 398 ? 14.703  53.024 64.789 1.00 21.06  ? 398  HIS A ND1 1 
ATOM   3282 C  CD2 . HIS A 1 398 ? 13.294  54.056 66.103 1.00 21.89  ? 398  HIS A CD2 1 
ATOM   3283 C  CE1 . HIS A 1 398 ? 13.615  52.276 64.860 1.00 21.28  ? 398  HIS A CE1 1 
ATOM   3284 N  NE2 . HIS A 1 398 ? 12.745  52.880 65.650 1.00 22.11  ? 398  HIS A NE2 1 
ATOM   3285 N  N   . ASN A 1 399 ? 13.963  57.246 63.932 1.00 18.60  ? 399  ASN A N   1 
ATOM   3286 C  CA  . ASN A 1 399 ? 12.684  57.568 63.305 1.00 19.14  ? 399  ASN A CA  1 
ATOM   3287 C  C   . ASN A 1 399 ? 12.685  58.409 62.036 1.00 19.35  ? 399  ASN A C   1 
ATOM   3288 O  O   . ASN A 1 399 ? 11.775  58.291 61.212 1.00 19.98  ? 399  ASN A O   1 
ATOM   3289 C  CB  . ASN A 1 399 ? 11.778  58.238 64.338 1.00 18.75  ? 399  ASN A CB  1 
ATOM   3290 C  CG  . ASN A 1 399 ? 11.297  57.270 65.405 1.00 20.47  ? 399  ASN A CG  1 
ATOM   3291 O  OD1 . ASN A 1 399 ? 10.525  56.359 65.118 1.00 19.61  ? 399  ASN A OD1 1 
ATOM   3292 N  ND2 . ASN A 1 399 ? 11.758  57.460 66.644 1.00 18.24  ? 399  ASN A ND2 1 
ATOM   3293 N  N   . VAL A 1 400 ? 13.690  59.257 61.865 1.00 18.74  ? 400  VAL A N   1 
ATOM   3294 C  CA  . VAL A 1 400 ? 13.709  60.125 60.695 1.00 18.95  ? 400  VAL A CA  1 
ATOM   3295 C  C   . VAL A 1 400 ? 14.965  60.094 59.839 1.00 19.71  ? 400  VAL A C   1 
ATOM   3296 O  O   . VAL A 1 400 ? 14.916  59.739 58.663 1.00 19.79  ? 400  VAL A O   1 
ATOM   3297 C  CB  . VAL A 1 400 ? 13.466  61.601 61.107 1.00 17.66  ? 400  VAL A CB  1 
ATOM   3298 C  CG1 . VAL A 1 400 ? 13.505  62.506 59.872 1.00 19.43  ? 400  VAL A CG1 1 
ATOM   3299 C  CG2 . VAL A 1 400 ? 12.122  61.729 61.827 1.00 17.85  ? 400  VAL A CG2 1 
ATOM   3300 N  N   . ILE A 1 401 ? 16.092  60.471 60.427 1.00 19.06  ? 401  ILE A N   1 
ATOM   3301 C  CA  . ILE A 1 401 ? 17.331  60.541 59.667 1.00 19.93  ? 401  ILE A CA  1 
ATOM   3302 C  C   . ILE A 1 401 ? 17.813  59.260 58.998 1.00 20.39  ? 401  ILE A C   1 
ATOM   3303 O  O   . ILE A 1 401 ? 17.981  59.229 57.777 1.00 19.64  ? 401  ILE A O   1 
ATOM   3304 C  CB  . ILE A 1 401 ? 18.468  61.132 60.525 1.00 19.36  ? 401  ILE A CB  1 
ATOM   3305 C  CG1 . ILE A 1 401 ? 18.039  62.513 61.046 1.00 20.74  ? 401  ILE A CG1 1 
ATOM   3306 C  CG2 . ILE A 1 401 ? 19.735  61.262 59.687 1.00 19.10  ? 401  ILE A CG2 1 
ATOM   3307 C  CD1 . ILE A 1 401 ? 19.125  63.279 61.785 1.00 19.85  ? 401  ILE A CD1 1 
ATOM   3308 N  N   . CYS A 1 402 ? 18.025  58.198 59.766 1.00 19.05  ? 402  CYS A N   1 
ATOM   3309 C  CA  . CYS A 1 402 ? 18.519  56.981 59.148 1.00 20.19  ? 402  CYS A CA  1 
ATOM   3310 C  C   . CYS A 1 402 ? 17.542  56.358 58.148 1.00 20.15  ? 402  CYS A C   1 
ATOM   3311 O  O   . CYS A 1 402 ? 17.965  55.801 57.139 1.00 19.44  ? 402  CYS A O   1 
ATOM   3312 C  CB  . CYS A 1 402 ? 18.980  56.005 60.223 1.00 20.27  ? 402  CYS A CB  1 
ATOM   3313 S  SG  . CYS A 1 402 ? 20.449  56.684 61.082 1.00 21.58  ? 402  CYS A SG  1 
ATOM   3314 N  N   . PRO A 1 403 ? 16.227  56.427 58.417 1.00 19.73  ? 403  PRO A N   1 
ATOM   3315 C  CA  . PRO A 1 403 ? 15.323  55.841 57.422 1.00 20.71  ? 403  PRO A CA  1 
ATOM   3316 C  C   . PRO A 1 403 ? 15.423  56.680 56.136 1.00 20.92  ? 403  PRO A C   1 
ATOM   3317 O  O   . PRO A 1 403 ? 15.423  56.143 55.029 1.00 20.90  ? 403  PRO A O   1 
ATOM   3318 C  CB  . PRO A 1 403 ? 13.954  55.970 58.080 1.00 22.47  ? 403  PRO A CB  1 
ATOM   3319 C  CG  . PRO A 1 403 ? 14.276  55.802 59.534 1.00 21.98  ? 403  PRO A CG  1 
ATOM   3320 C  CD  . PRO A 1 403 ? 15.527  56.645 59.697 1.00 20.93  ? 403  PRO A CD  1 
ATOM   3321 N  N   . LEU A 1 404 ? 15.523  58.001 56.282 1.00 20.10  ? 404  LEU A N   1 
ATOM   3322 C  CA  . LEU A 1 404 ? 15.626  58.858 55.103 1.00 21.33  ? 404  LEU A CA  1 
ATOM   3323 C  C   . LEU A 1 404 ? 16.936  58.604 54.354 1.00 21.43  ? 404  LEU A C   1 
ATOM   3324 O  O   . LEU A 1 404 ? 16.964  58.603 53.120 1.00 20.94  ? 404  LEU A O   1 
ATOM   3325 C  CB  . LEU A 1 404 ? 15.506  60.341 55.485 1.00 21.03  ? 404  LEU A CB  1 
ATOM   3326 C  CG  . LEU A 1 404 ? 15.511  61.306 54.286 1.00 22.03  ? 404  LEU A CG  1 
ATOM   3327 C  CD1 . LEU A 1 404 ? 14.550  62.458 54.522 1.00 20.97  ? 404  LEU A CD1 1 
ATOM   3328 C  CD2 . LEU A 1 404 ? 16.931  61.811 54.042 1.00 21.51  ? 404  LEU A CD2 1 
ATOM   3329 N  N   . MET A 1 405 ? 18.021  58.379 55.092 1.00 21.29  ? 405  MET A N   1 
ATOM   3330 C  CA  . MET A 1 405 ? 19.303  58.111 54.452 1.00 20.84  ? 405  MET A CA  1 
ATOM   3331 C  C   . MET A 1 405 ? 19.254  56.783 53.693 1.00 21.11  ? 405  MET A C   1 
ATOM   3332 O  O   . MET A 1 405 ? 19.848  56.647 52.623 1.00 21.55  ? 405  MET A O   1 
ATOM   3333 C  CB  . MET A 1 405 ? 20.433  58.104 55.486 1.00 22.36  ? 405  MET A CB  1 
ATOM   3334 C  CG  . MET A 1 405 ? 20.760  59.491 56.042 1.00 20.46  ? 405  MET A CG  1 
ATOM   3335 S  SD  . MET A 1 405 ? 20.897  60.755 54.738 1.00 23.15  ? 405  MET A SD  1 
ATOM   3336 C  CE  . MET A 1 405 ? 22.221  60.077 53.720 1.00 20.96  ? 405  MET A CE  1 
ATOM   3337 N  N   . HIS A 1 406 ? 18.544  55.801 54.239 1.00 21.89  ? 406  HIS A N   1 
ATOM   3338 C  CA  . HIS A 1 406 ? 18.415  54.513 53.559 1.00 22.69  ? 406  HIS A CA  1 
ATOM   3339 C  C   . HIS A 1 406 ? 17.639  54.748 52.254 1.00 23.76  ? 406  HIS A C   1 
ATOM   3340 O  O   . HIS A 1 406 ? 17.983  54.208 51.200 1.00 22.05  ? 406  HIS A O   1 
ATOM   3341 C  CB  . HIS A 1 406 ? 17.657  53.517 54.441 1.00 24.03  ? 406  HIS A CB  1 
ATOM   3342 C  CG  . HIS A 1 406 ? 17.397  52.197 53.781 1.00 26.90  ? 406  HIS A CG  1 
ATOM   3343 N  ND1 . HIS A 1 406 ? 18.407  51.324 53.431 1.00 26.34  ? 406  HIS A ND1 1 
ATOM   3344 C  CD2 . HIS A 1 406 ? 16.239  51.601 53.405 1.00 24.94  ? 406  HIS A CD2 1 
ATOM   3345 C  CE1 . HIS A 1 406 ? 17.883  50.249 52.870 1.00 26.05  ? 406  HIS A CE1 1 
ATOM   3346 N  NE2 . HIS A 1 406 ? 16.570  50.392 52.842 1.00 27.71  ? 406  HIS A NE2 1 
ATOM   3347 N  N   . PHE A 1 407 ? 16.596  55.568 52.334 1.00 22.52  ? 407  PHE A N   1 
ATOM   3348 C  CA  . PHE A 1 407 ? 15.780  55.877 51.160 1.00 22.89  ? 407  PHE A CA  1 
ATOM   3349 C  C   . PHE A 1 407 ? 16.588  56.614 50.089 1.00 22.36  ? 407  PHE A C   1 
ATOM   3350 O  O   . PHE A 1 407 ? 16.532  56.269 48.911 1.00 22.40  ? 407  PHE A O   1 
ATOM   3351 C  CB  . PHE A 1 407 ? 14.578  56.746 51.557 1.00 20.90  ? 407  PHE A CB  1 
ATOM   3352 C  CG  . PHE A 1 407 ? 13.754  57.216 50.385 1.00 20.84  ? 407  PHE A CG  1 
ATOM   3353 C  CD1 . PHE A 1 407 ? 12.876  56.349 49.742 1.00 22.61  ? 407  PHE A CD1 1 
ATOM   3354 C  CD2 . PHE A 1 407 ? 13.878  58.519 49.909 1.00 23.32  ? 407  PHE A CD2 1 
ATOM   3355 C  CE1 . PHE A 1 407 ? 12.129  56.771 48.637 1.00 21.91  ? 407  PHE A CE1 1 
ATOM   3356 C  CE2 . PHE A 1 407 ? 13.139  58.953 48.805 1.00 22.27  ? 407  PHE A CE2 1 
ATOM   3357 C  CZ  . PHE A 1 407 ? 12.262  58.072 48.169 1.00 23.48  ? 407  PHE A CZ  1 
ATOM   3358 N  N   A VAL A 1 408 ? 17.333  57.638 50.494 0.50 22.44  ? 408  VAL A N   1 
ATOM   3359 N  N   B VAL A 1 408 ? 17.337  57.624 50.519 0.50 23.15  ? 408  VAL A N   1 
ATOM   3360 C  CA  A VAL A 1 408 ? 18.108  58.408 49.530 0.50 23.17  ? 408  VAL A CA  1 
ATOM   3361 C  CA  B VAL A 1 408 ? 18.159  58.422 49.619 0.50 24.61  ? 408  VAL A CA  1 
ATOM   3362 C  C   A VAL A 1 408 ? 19.158  57.561 48.813 0.50 24.01  ? 408  VAL A C   1 
ATOM   3363 C  C   B VAL A 1 408 ? 19.143  57.563 48.836 0.50 24.82  ? 408  VAL A C   1 
ATOM   3364 O  O   A VAL A 1 408 ? 19.330  57.682 47.601 0.50 23.45  ? 408  VAL A O   1 
ATOM   3365 O  O   B VAL A 1 408 ? 19.250  57.674 47.615 0.50 24.30  ? 408  VAL A O   1 
ATOM   3366 C  CB  A VAL A 1 408 ? 18.777  59.642 50.189 0.50 23.60  ? 408  VAL A CB  1 
ATOM   3367 C  CB  B VAL A 1 408 ? 18.967  59.483 50.398 0.50 25.93  ? 408  VAL A CB  1 
ATOM   3368 C  CG1 A VAL A 1 408 ? 19.878  59.213 51.138 0.50 21.73  ? 408  VAL A CG1 1 
ATOM   3369 C  CG1 B VAL A 1 408 ? 19.925  60.201 49.461 0.50 29.00  ? 408  VAL A CG1 1 
ATOM   3370 C  CG2 A VAL A 1 408 ? 19.312  60.570 49.112 0.50 25.08  ? 408  VAL A CG2 1 
ATOM   3371 C  CG2 B VAL A 1 408 ? 18.026  60.474 51.050 0.50 26.67  ? 408  VAL A CG2 1 
ATOM   3372 N  N   . ASN A 1 409 ? 19.854  56.700 49.549 1.00 24.06  ? 409  ASN A N   1 
ATOM   3373 C  CA  . ASN A 1 409 ? 20.850  55.846 48.924 1.00 25.70  ? 409  ASN A CA  1 
ATOM   3374 C  C   . ASN A 1 409 ? 20.226  54.829 47.971 1.00 25.82  ? 409  ASN A C   1 
ATOM   3375 O  O   . ASN A 1 409 ? 20.770  54.573 46.898 1.00 25.19  ? 409  ASN A O   1 
ATOM   3376 C  CB  . ASN A 1 409 ? 21.711  55.166 49.990 1.00 26.58  ? 409  ASN A CB  1 
ATOM   3377 C  CG  . ASN A 1 409 ? 22.727  56.123 50.600 1.00 30.83  ? 409  ASN A CG  1 
ATOM   3378 O  OD1 . ASN A 1 409 ? 22.527  56.658 51.693 1.00 33.10  ? 409  ASN A OD1 1 
ATOM   3379 N  ND2 . ASN A 1 409 ? 23.816  56.362 49.875 1.00 29.96  ? 409  ASN A ND2 1 
ATOM   3380 N  N   . LYS A 1 410 ? 19.082  54.264 48.343 1.00 23.52  ? 410  LYS A N   1 
ATOM   3381 C  CA  . LYS A 1 410 ? 18.411  53.307 47.467 1.00 24.70  ? 410  LYS A CA  1 
ATOM   3382 C  C   . LYS A 1 410 ? 17.846  54.013 46.230 1.00 24.73  ? 410  LYS A C   1 
ATOM   3383 O  O   . LYS A 1 410 ? 17.995  53.538 45.102 1.00 24.33  ? 410  LYS A O   1 
ATOM   3384 C  CB  . LYS A 1 410 ? 17.268  52.607 48.207 1.00 26.13  ? 410  LYS A CB  1 
ATOM   3385 C  CG  . LYS A 1 410 ? 17.718  51.600 49.260 1.00 30.19  ? 410  LYS A CG  1 
ATOM   3386 C  CD  . LYS A 1 410 ? 18.463  50.439 48.616 1.00 32.22  ? 410  LYS A CD  1 
ATOM   3387 C  CE  . LYS A 1 410 ? 18.828  49.375 49.637 1.00 34.79  ? 410  LYS A CE  1 
ATOM   3388 N  NZ  . LYS A 1 410 ? 19.555  48.244 48.998 1.00 36.84  ? 410  LYS A NZ  1 
ATOM   3389 N  N   . TYR A 1 411 ? 17.197  55.152 46.448 1.00 23.37  ? 411  TYR A N   1 
ATOM   3390 C  CA  . TYR A 1 411 ? 16.594  55.903 45.352 1.00 24.15  ? 411  TYR A CA  1 
ATOM   3391 C  C   . TYR A 1 411 ? 17.608  56.400 44.323 1.00 24.60  ? 411  TYR A C   1 
ATOM   3392 O  O   . TYR A 1 411 ? 17.408  56.254 43.116 1.00 24.35  ? 411  TYR A O   1 
ATOM   3393 C  CB  . TYR A 1 411 ? 15.822  57.117 45.884 1.00 22.57  ? 411  TYR A CB  1 
ATOM   3394 C  CG  . TYR A 1 411 ? 14.995  57.786 44.809 1.00 22.51  ? 411  TYR A CG  1 
ATOM   3395 C  CD1 . TYR A 1 411 ? 13.726  57.307 44.489 1.00 22.99  ? 411  TYR A CD1 1 
ATOM   3396 C  CD2 . TYR A 1 411 ? 15.513  58.840 44.052 1.00 22.79  ? 411  TYR A CD2 1 
ATOM   3397 C  CE1 . TYR A 1 411 ? 12.991  57.853 43.440 1.00 22.02  ? 411  TYR A CE1 1 
ATOM   3398 C  CE2 . TYR A 1 411 ? 14.786  59.393 42.994 1.00 20.92  ? 411  TYR A CE2 1 
ATOM   3399 C  CZ  . TYR A 1 411 ? 13.527  58.889 42.695 1.00 22.89  ? 411  TYR A CZ  1 
ATOM   3400 O  OH  . TYR A 1 411 ? 12.813  59.391 41.631 1.00 24.85  ? 411  TYR A OH  1 
ATOM   3401 N  N   . THR A 1 412 ? 18.686  56.999 44.815 1.00 23.41  ? 412  THR A N   1 
ATOM   3402 C  CA  . THR A 1 412 ? 19.718  57.570 43.965 1.00 24.63  ? 412  THR A CA  1 
ATOM   3403 C  C   . THR A 1 412 ? 20.312  56.609 42.934 1.00 26.66  ? 412  THR A C   1 
ATOM   3404 O  O   . THR A 1 412 ? 20.832  57.041 41.906 1.00 26.38  ? 412  THR A O   1 
ATOM   3405 C  CB  . THR A 1 412 ? 20.836  58.189 44.836 1.00 24.65  ? 412  THR A CB  1 
ATOM   3406 O  OG1 . THR A 1 412 ? 20.273  59.236 45.640 1.00 23.04  ? 412  THR A OG1 1 
ATOM   3407 C  CG2 . THR A 1 412 ? 21.941  58.779 43.969 1.00 21.96  ? 412  THR A CG2 1 
ATOM   3408 N  N   A LYS A 1 413 ? 20.230  55.311 43.207 0.50 26.82  ? 413  LYS A N   1 
ATOM   3409 N  N   B LYS A 1 413 ? 20.231  55.311 43.206 0.50 26.44  ? 413  LYS A N   1 
ATOM   3410 C  CA  A LYS A 1 413 ? 20.756  54.311 42.285 0.50 28.34  ? 413  LYS A CA  1 
ATOM   3411 C  CA  B LYS A 1 413 ? 20.756  54.317 42.279 0.50 27.68  ? 413  LYS A CA  1 
ATOM   3412 C  C   A LYS A 1 413 ? 19.959  54.288 40.981 0.50 28.25  ? 413  LYS A C   1 
ATOM   3413 C  C   B LYS A 1 413 ? 19.964  54.319 40.973 0.50 27.85  ? 413  LYS A C   1 
ATOM   3414 O  O   A LYS A 1 413 ? 20.514  54.026 39.912 0.50 28.34  ? 413  LYS A O   1 
ATOM   3415 O  O   B LYS A 1 413 ? 20.526  54.107 39.896 0.50 27.89  ? 413  LYS A O   1 
ATOM   3416 C  CB  A LYS A 1 413 ? 20.722  52.923 42.933 0.50 29.16  ? 413  LYS A CB  1 
ATOM   3417 C  CB  B LYS A 1 413 ? 20.691  52.920 42.903 0.50 27.76  ? 413  LYS A CB  1 
ATOM   3418 C  CG  A LYS A 1 413 ? 21.632  52.780 44.145 0.50 31.32  ? 413  LYS A CG  1 
ATOM   3419 C  CG  B LYS A 1 413 ? 21.103  51.803 41.953 0.50 28.61  ? 413  LYS A CG  1 
ATOM   3420 C  CD  A LYS A 1 413 ? 21.553  51.382 44.734 0.50 32.99  ? 413  LYS A CD  1 
ATOM   3421 C  CD  B LYS A 1 413 ? 20.933  50.437 42.593 0.50 30.13  ? 413  LYS A CD  1 
ATOM   3422 C  CE  A LYS A 1 413 ? 22.441  51.249 45.959 0.50 34.68  ? 413  LYS A CE  1 
ATOM   3423 C  CE  B LYS A 1 413 ? 21.214  49.320 41.598 0.50 29.88  ? 413  LYS A CE  1 
ATOM   3424 N  NZ  A LYS A 1 413 ? 22.340  49.891 46.565 0.50 35.90  ? 413  LYS A NZ  1 
ATOM   3425 N  NZ  B LYS A 1 413 ? 20.987  47.981 42.208 0.50 30.16  ? 413  LYS A NZ  1 
ATOM   3426 N  N   . PHE A 1 414 ? 18.660  54.568 41.075 1.00 26.16  ? 414  PHE A N   1 
ATOM   3427 C  CA  . PHE A 1 414 ? 17.778  54.574 39.903 1.00 26.35  ? 414  PHE A CA  1 
ATOM   3428 C  C   . PHE A 1 414 ? 17.258  55.951 39.492 1.00 26.13  ? 414  PHE A C   1 
ATOM   3429 O  O   . PHE A 1 414 ? 16.816  56.136 38.358 1.00 26.45  ? 414  PHE A O   1 
ATOM   3430 C  CB  . PHE A 1 414 ? 16.569  53.669 40.165 1.00 26.03  ? 414  PHE A CB  1 
ATOM   3431 C  CG  . PHE A 1 414 ? 16.910  52.211 40.306 1.00 29.55  ? 414  PHE A CG  1 
ATOM   3432 C  CD1 . PHE A 1 414 ? 17.081  51.410 39.181 1.00 30.49  ? 414  PHE A CD1 1 
ATOM   3433 C  CD2 . PHE A 1 414 ? 17.045  51.635 41.567 1.00 28.74  ? 414  PHE A CD2 1 
ATOM   3434 C  CE1 . PHE A 1 414 ? 17.377  50.052 39.308 1.00 32.17  ? 414  PHE A CE1 1 
ATOM   3435 C  CE2 . PHE A 1 414 ? 17.341  50.281 41.707 1.00 31.08  ? 414  PHE A CE2 1 
ATOM   3436 C  CZ  . PHE A 1 414 ? 17.507  49.486 40.573 1.00 31.98  ? 414  PHE A CZ  1 
ATOM   3437 N  N   . GLY A 1 415 ? 17.308  56.906 40.417 1.00 25.89  ? 415  GLY A N   1 
ATOM   3438 C  CA  . GLY A 1 415 ? 16.803  58.245 40.156 1.00 26.07  ? 415  GLY A CA  1 
ATOM   3439 C  C   . GLY A 1 415 ? 17.552  59.088 39.145 1.00 26.55  ? 415  GLY A C   1 
ATOM   3440 O  O   . GLY A 1 415 ? 18.615  58.700 38.664 1.00 24.83  ? 415  GLY A O   1 
ATOM   3441 N  N   . ASN A 1 416 ? 16.997  60.261 38.845 1.00 25.96  ? 416  ASN A N   1 
ATOM   3442 C  CA  . ASN A 1 416 ? 17.588  61.173 37.872 1.00 26.44  ? 416  ASN A CA  1 
ATOM   3443 C  C   . ASN A 1 416 ? 18.200  62.431 38.490 1.00 27.75  ? 416  ASN A C   1 
ATOM   3444 O  O   . ASN A 1 416 ? 18.517  63.380 37.776 1.00 27.95  ? 416  ASN A O   1 
ATOM   3445 C  CB  . ASN A 1 416 ? 16.535  61.588 36.836 1.00 28.31  ? 416  ASN A CB  1 
ATOM   3446 C  CG  . ASN A 1 416 ? 17.138  62.355 35.669 1.00 30.69  ? 416  ASN A CG  1 
ATOM   3447 O  OD1 . ASN A 1 416 ? 16.632  63.407 35.274 1.00 28.14  ? 416  ASN A OD1 1 
ATOM   3448 N  ND2 . ASN A 1 416 ? 18.226  61.823 35.122 1.00 31.59  ? 416  ASN A ND2 1 
ATOM   3449 N  N   . GLY A 1 417 ? 18.365  62.446 39.810 1.00 26.11  ? 417  GLY A N   1 
ATOM   3450 C  CA  . GLY A 1 417 ? 18.949  63.612 40.454 1.00 25.73  ? 417  GLY A CA  1 
ATOM   3451 C  C   . GLY A 1 417 ? 18.483  63.771 41.886 1.00 25.74  ? 417  GLY A C   1 
ATOM   3452 O  O   . GLY A 1 417 ? 17.284  63.901 42.141 1.00 25.24  ? 417  GLY A O   1 
ATOM   3453 N  N   . THR A 1 418 ? 19.434  63.774 42.818 1.00 23.91  ? 418  THR A N   1 
ATOM   3454 C  CA  . THR A 1 418 ? 19.132  63.898 44.240 1.00 22.40  ? 418  THR A CA  1 
ATOM   3455 C  C   . THR A 1 418 ? 19.870  65.069 44.889 1.00 24.05  ? 418  THR A C   1 
ATOM   3456 O  O   . THR A 1 418 ? 21.070  65.253 44.668 1.00 25.04  ? 418  THR A O   1 
ATOM   3457 C  CB  . THR A 1 418 ? 19.534  62.607 45.006 1.00 23.31  ? 418  THR A CB  1 
ATOM   3458 O  OG1 . THR A 1 418 ? 18.838  61.477 44.458 1.00 23.09  ? 418  THR A OG1 1 
ATOM   3459 C  CG2 . THR A 1 418 ? 19.201  62.734 46.490 1.00 20.06  ? 418  THR A CG2 1 
ATOM   3460 N  N   . TYR A 1 419 ? 19.144  65.853 45.685 1.00 21.98  ? 419  TYR A N   1 
ATOM   3461 C  CA  . TYR A 1 419 ? 19.711  66.987 46.415 1.00 22.58  ? 419  TYR A CA  1 
ATOM   3462 C  C   . TYR A 1 419 ? 19.340  66.800 47.886 1.00 22.39  ? 419  TYR A C   1 
ATOM   3463 O  O   . TYR A 1 419 ? 18.160  66.719 48.231 1.00 22.57  ? 419  TYR A O   1 
ATOM   3464 C  CB  . TYR A 1 419 ? 19.153  68.300 45.865 1.00 24.15  ? 419  TYR A CB  1 
ATOM   3465 C  CG  . TYR A 1 419 ? 19.632  68.577 44.456 1.00 24.91  ? 419  TYR A CG  1 
ATOM   3466 C  CD1 . TYR A 1 419 ? 20.899  69.111 44.223 1.00 25.73  ? 419  TYR A CD1 1 
ATOM   3467 C  CD2 . TYR A 1 419 ? 18.845  68.244 43.353 1.00 24.88  ? 419  TYR A CD2 1 
ATOM   3468 C  CE1 . TYR A 1 419 ? 21.375  69.303 42.921 1.00 27.16  ? 419  TYR A CE1 1 
ATOM   3469 C  CE2 . TYR A 1 419 ? 19.309  68.431 42.052 1.00 25.51  ? 419  TYR A CE2 1 
ATOM   3470 C  CZ  . TYR A 1 419 ? 20.574  68.959 41.844 1.00 26.71  ? 419  TYR A CZ  1 
ATOM   3471 O  OH  . TYR A 1 419 ? 21.039  69.129 40.559 1.00 27.96  ? 419  TYR A OH  1 
ATOM   3472 N  N   . LEU A 1 420 ? 20.353  66.723 48.745 1.00 20.80  ? 420  LEU A N   1 
ATOM   3473 C  CA  . LEU A 1 420 ? 20.141  66.484 50.174 1.00 21.18  ? 420  LEU A CA  1 
ATOM   3474 C  C   . LEU A 1 420 ? 20.561  67.646 51.072 1.00 21.64  ? 420  LEU A C   1 
ATOM   3475 O  O   . LEU A 1 420 ? 21.592  68.279 50.842 1.00 23.34  ? 420  LEU A O   1 
ATOM   3476 C  CB  . LEU A 1 420 ? 20.899  65.214 50.583 1.00 20.19  ? 420  LEU A CB  1 
ATOM   3477 C  CG  . LEU A 1 420 ? 20.803  64.706 52.028 1.00 22.14  ? 420  LEU A CG  1 
ATOM   3478 C  CD1 . LEU A 1 420 ? 19.373  64.234 52.317 1.00 20.95  ? 420  LEU A CD1 1 
ATOM   3479 C  CD2 . LEU A 1 420 ? 21.791  63.550 52.225 1.00 20.09  ? 420  LEU A CD2 1 
ATOM   3480 N  N   . TYR A 1 421 ? 19.761  67.919 52.103 1.00 21.14  ? 421  TYR A N   1 
ATOM   3481 C  CA  . TYR A 1 421 ? 20.071  69.006 53.032 1.00 21.09  ? 421  TYR A CA  1 
ATOM   3482 C  C   . TYR A 1 421 ? 19.974  68.589 54.496 1.00 22.13  ? 421  TYR A C   1 
ATOM   3483 O  O   . TYR A 1 421 ? 19.323  67.596 54.841 1.00 20.82  ? 421  TYR A O   1 
ATOM   3484 C  CB  . TYR A 1 421 ? 19.133  70.202 52.801 1.00 20.86  ? 421  TYR A CB  1 
ATOM   3485 C  CG  . TYR A 1 421 ? 17.701  69.991 53.266 1.00 22.31  ? 421  TYR A CG  1 
ATOM   3486 C  CD1 . TYR A 1 421 ? 17.357  70.096 54.618 1.00 22.89  ? 421  TYR A CD1 1 
ATOM   3487 C  CD2 . TYR A 1 421 ? 16.691  69.676 52.354 1.00 21.31  ? 421  TYR A CD2 1 
ATOM   3488 C  CE1 . TYR A 1 421 ? 16.042  69.890 55.049 1.00 21.41  ? 421  TYR A CE1 1 
ATOM   3489 C  CE2 . TYR A 1 421 ? 15.375  69.468 52.772 1.00 20.97  ? 421  TYR A CE2 1 
ATOM   3490 C  CZ  . TYR A 1 421 ? 15.058  69.575 54.117 1.00 22.68  ? 421  TYR A CZ  1 
ATOM   3491 O  OH  . TYR A 1 421 ? 13.763  69.352 54.529 1.00 22.32  ? 421  TYR A OH  1 
ATOM   3492 N  N   . PHE A 1 422 ? 20.639  69.365 55.346 1.00 20.56  ? 422  PHE A N   1 
ATOM   3493 C  CA  . PHE A 1 422 ? 20.620  69.154 56.787 1.00 22.16  ? 422  PHE A CA  1 
ATOM   3494 C  C   . PHE A 1 422 ? 20.321  70.539 57.367 1.00 22.01  ? 422  PHE A C   1 
ATOM   3495 O  O   . PHE A 1 422 ? 21.197  71.410 57.403 1.00 22.26  ? 422  PHE A O   1 
ATOM   3496 C  CB  . PHE A 1 422 ? 21.982  68.655 57.286 1.00 21.40  ? 422  PHE A CB  1 
ATOM   3497 C  CG  . PHE A 1 422 ? 22.020  68.357 58.768 1.00 23.73  ? 422  PHE A CG  1 
ATOM   3498 C  CD1 . PHE A 1 422 ? 21.346  67.254 59.290 1.00 24.04  ? 422  PHE A CD1 1 
ATOM   3499 C  CD2 . PHE A 1 422 ? 22.739  69.175 59.637 1.00 23.48  ? 422  PHE A CD2 1 
ATOM   3500 C  CE1 . PHE A 1 422 ? 21.388  66.964 60.665 1.00 25.35  ? 422  PHE A CE1 1 
ATOM   3501 C  CE2 . PHE A 1 422 ? 22.790  68.898 61.015 1.00 25.02  ? 422  PHE A CE2 1 
ATOM   3502 C  CZ  . PHE A 1 422 ? 22.112  67.789 61.528 1.00 24.42  ? 422  PHE A CZ  1 
ATOM   3503 N  N   . PHE A 1 423 ? 19.078  70.738 57.798 1.00 21.13  ? 423  PHE A N   1 
ATOM   3504 C  CA  . PHE A 1 423 ? 18.635  72.016 58.358 1.00 22.73  ? 423  PHE A CA  1 
ATOM   3505 C  C   . PHE A 1 423 ? 18.985  72.086 59.840 1.00 24.33  ? 423  PHE A C   1 
ATOM   3506 O  O   . PHE A 1 423 ? 18.416  71.351 60.651 1.00 23.07  ? 423  PHE A O   1 
ATOM   3507 C  CB  . PHE A 1 423 ? 17.121  72.160 58.181 1.00 20.97  ? 423  PHE A CB  1 
ATOM   3508 C  CG  . PHE A 1 423 ? 16.575  73.480 58.647 1.00 24.26  ? 423  PHE A CG  1 
ATOM   3509 C  CD1 . PHE A 1 423 ? 16.671  74.612 57.843 1.00 24.23  ? 423  PHE A CD1 1 
ATOM   3510 C  CD2 . PHE A 1 423 ? 15.956  73.592 59.889 1.00 23.09  ? 423  PHE A CD2 1 
ATOM   3511 C  CE1 . PHE A 1 423 ? 16.156  75.839 58.267 1.00 24.37  ? 423  PHE A CE1 1 
ATOM   3512 C  CE2 . PHE A 1 423 ? 15.437  74.816 60.326 1.00 24.01  ? 423  PHE A CE2 1 
ATOM   3513 C  CZ  . PHE A 1 423 ? 15.537  75.942 59.511 1.00 22.94  ? 423  PHE A CZ  1 
ATOM   3514 N  N   . ASN A 1 424 ? 19.917  72.964 60.201 1.00 24.80  ? 424  ASN A N   1 
ATOM   3515 C  CA  . ASN A 1 424 ? 20.308  73.068 61.600 1.00 25.84  ? 424  ASN A CA  1 
ATOM   3516 C  C   . ASN A 1 424 ? 20.265  74.479 62.185 1.00 27.34  ? 424  ASN A C   1 
ATOM   3517 O  O   . ASN A 1 424 ? 21.070  74.824 63.053 1.00 28.28  ? 424  ASN A O   1 
ATOM   3518 C  CB  . ASN A 1 424 ? 21.699  72.442 61.804 1.00 25.33  ? 424  ASN A CB  1 
ATOM   3519 C  CG  . ASN A 1 424 ? 22.793  73.161 61.035 1.00 28.56  ? 424  ASN A CG  1 
ATOM   3520 O  OD1 . ASN A 1 424 ? 22.525  74.021 60.196 1.00 29.17  ? 424  ASN A OD1 1 
ATOM   3521 N  ND2 . ASN A 1 424 ? 24.041  72.799 61.316 1.00 28.52  ? 424  ASN A ND2 1 
ATOM   3522 N  N   . HIS A 1 425 ? 19.317  75.290 61.726 1.00 26.67  ? 425  HIS A N   1 
ATOM   3523 C  CA  . HIS A 1 425 ? 19.189  76.641 62.253 1.00 26.67  ? 425  HIS A CA  1 
ATOM   3524 C  C   . HIS A 1 425 ? 18.116  76.737 63.331 1.00 26.14  ? 425  HIS A C   1 
ATOM   3525 O  O   . HIS A 1 425 ? 16.950  76.415 63.098 1.00 26.80  ? 425  HIS A O   1 
ATOM   3526 C  CB  . HIS A 1 425 ? 18.851  77.650 61.152 1.00 27.39  ? 425  HIS A CB  1 
ATOM   3527 C  CG  . HIS A 1 425 ? 18.657  79.044 61.668 1.00 28.91  ? 425  HIS A CG  1 
ATOM   3528 N  ND1 . HIS A 1 425 ? 19.694  79.800 62.173 1.00 30.05  ? 425  HIS A ND1 1 
ATOM   3529 C  CD2 . HIS A 1 425 ? 17.539  79.793 61.820 1.00 29.20  ? 425  HIS A CD2 1 
ATOM   3530 C  CE1 . HIS A 1 425 ? 19.223  80.952 62.617 1.00 28.97  ? 425  HIS A CE1 1 
ATOM   3531 N  NE2 . HIS A 1 425 ? 17.918  80.973 62.415 1.00 30.31  ? 425  HIS A NE2 1 
ATOM   3532 N  N   . ARG A 1 426 ? 18.526  77.184 64.510 1.00 25.97  ? 426  ARG A N   1 
ATOM   3533 C  CA  . ARG A 1 426 ? 17.617  77.376 65.633 1.00 27.09  ? 426  ARG A CA  1 
ATOM   3534 C  C   . ARG A 1 426 ? 17.089  78.806 65.502 1.00 27.77  ? 426  ARG A C   1 
ATOM   3535 O  O   . ARG A 1 426 ? 17.847  79.757 65.655 1.00 27.83  ? 426  ARG A O   1 
ATOM   3536 C  CB  . ARG A 1 426 ? 18.389  77.218 66.947 1.00 27.57  ? 426  ARG A CB  1 
ATOM   3537 C  CG  . ARG A 1 426 ? 17.701  77.802 68.171 1.00 29.36  ? 426  ARG A CG  1 
ATOM   3538 C  CD  . ARG A 1 426 ? 16.673  76.868 68.772 1.00 28.76  ? 426  ARG A CD  1 
ATOM   3539 N  NE  . ARG A 1 426 ? 16.048  77.474 69.946 1.00 30.54  ? 426  ARG A NE  1 
ATOM   3540 C  CZ  . ARG A 1 426 ? 15.299  76.816 70.827 1.00 32.30  ? 426  ARG A CZ  1 
ATOM   3541 N  NH1 . ARG A 1 426 ? 15.072  75.510 70.680 1.00 27.18  ? 426  ARG A NH1 1 
ATOM   3542 N  NH2 . ARG A 1 426 ? 14.771  77.468 71.856 1.00 29.10  ? 426  ARG A NH2 1 
ATOM   3543 N  N   . ALA A 1 427 ? 15.800  78.953 65.206 1.00 28.75  ? 427  ALA A N   1 
ATOM   3544 C  CA  . ALA A 1 427 ? 15.193  80.273 65.038 1.00 29.45  ? 427  ALA A CA  1 
ATOM   3545 C  C   . ALA A 1 427 ? 15.348  81.152 66.279 1.00 30.37  ? 427  ALA A C   1 
ATOM   3546 O  O   . ALA A 1 427 ? 15.220  80.684 67.411 1.00 29.61  ? 427  ALA A O   1 
ATOM   3547 C  CB  . ALA A 1 427 ? 13.718  80.131 64.680 1.00 29.44  ? 427  ALA A CB  1 
ATOM   3548 N  N   . SER A 1 428 ? 15.610  82.435 66.044 1.00 30.45  ? 428  SER A N   1 
ATOM   3549 C  CA  . SER A 1 428 ? 15.817  83.411 67.112 1.00 30.49  ? 428  SER A CA  1 
ATOM   3550 C  C   . SER A 1 428 ? 14.587  83.685 67.969 1.00 30.98  ? 428  SER A C   1 
ATOM   3551 O  O   . SER A 1 428 ? 14.710  84.135 69.106 1.00 31.45  ? 428  SER A O   1 
ATOM   3552 C  CB  . SER A 1 428 ? 16.302  84.734 66.509 1.00 30.01  ? 428  SER A CB  1 
ATOM   3553 O  OG  . SER A 1 428 ? 15.306  85.289 65.664 1.00 29.15  ? 428  SER A OG  1 
ATOM   3554 N  N   . ASN A 1 429 ? 13.404  83.415 67.428 1.00 30.78  ? 429  ASN A N   1 
ATOM   3555 C  CA  . ASN A 1 429 ? 12.167  83.667 68.156 1.00 31.23  ? 429  ASN A CA  1 
ATOM   3556 C  C   . ASN A 1 429 ? 11.415  82.409 68.598 1.00 31.45  ? 429  ASN A C   1 
ATOM   3557 O  O   . ASN A 1 429 ? 10.220  82.471 68.889 1.00 31.55  ? 429  ASN A O   1 
ATOM   3558 C  CB  . ASN A 1 429 ? 11.238  84.525 67.295 1.00 33.41  ? 429  ASN A CB  1 
ATOM   3559 C  CG  . ASN A 1 429 ? 10.996  83.916 65.925 1.00 36.01  ? 429  ASN A CG  1 
ATOM   3560 O  OD1 . ASN A 1 429 ? 11.335  82.756 65.684 1.00 34.90  ? 429  ASN A OD1 1 
ATOM   3561 N  ND2 . ASN A 1 429 ? 10.404  84.692 65.023 1.00 35.11  ? 429  ASN A ND2 1 
ATOM   3562 N  N   A LEU A 1 430 ? 12.110  81.277 68.653 0.50 30.16  ? 430  LEU A N   1 
ATOM   3563 N  N   B LEU A 1 430 ? 12.107  81.274 68.647 0.50 31.08  ? 430  LEU A N   1 
ATOM   3564 C  CA  A LEU A 1 430 ? 11.479  80.022 69.053 0.50 29.81  ? 430  LEU A CA  1 
ATOM   3565 C  CA  B LEU A 1 430 ? 11.468  80.028 69.060 0.50 31.36  ? 430  LEU A CA  1 
ATOM   3566 C  C   A LEU A 1 430 ? 10.961  80.100 70.489 0.50 29.54  ? 430  LEU A C   1 
ATOM   3567 C  C   B LEU A 1 430 ? 10.954  80.113 70.490 0.50 30.53  ? 430  LEU A C   1 
ATOM   3568 O  O   A LEU A 1 430 ? 11.664  80.566 71.386 0.50 29.58  ? 430  LEU A O   1 
ATOM   3569 O  O   B LEU A 1 430 ? 11.652  80.593 71.385 0.50 30.50  ? 430  LEU A O   1 
ATOM   3570 C  CB  A LEU A 1 430 ? 12.475  78.864 68.922 0.50 29.55  ? 430  LEU A CB  1 
ATOM   3571 C  CB  B LEU A 1 430 ? 12.444  78.854 68.934 0.50 33.04  ? 430  LEU A CB  1 
ATOM   3572 C  CG  A LEU A 1 430 ? 11.879  77.453 68.960 0.50 28.58  ? 430  LEU A CG  1 
ATOM   3573 C  CG  B LEU A 1 430 ? 12.697  78.340 67.515 0.50 34.50  ? 430  LEU A CG  1 
ATOM   3574 C  CD1 A LEU A 1 430 ? 10.880  77.290 67.834 0.50 28.33  ? 430  LEU A CD1 1 
ATOM   3575 C  CD1 B LEU A 1 430 ? 13.668  77.180 67.561 0.50 35.82  ? 430  LEU A CD1 1 
ATOM   3576 C  CD2 A LEU A 1 430 ? 12.978  76.425 68.826 0.50 28.56  ? 430  LEU A CD2 1 
ATOM   3577 C  CD2 B LEU A 1 430 ? 11.388  77.899 66.884 0.50 34.43  ? 430  LEU A CD2 1 
ATOM   3578 N  N   . VAL A 1 431 ? 9.730   79.643 70.701 1.00 28.41  ? 431  VAL A N   1 
ATOM   3579 C  CA  . VAL A 1 431 ? 9.122   79.668 72.026 1.00 27.99  ? 431  VAL A CA  1 
ATOM   3580 C  C   . VAL A 1 431 ? 9.404   78.398 72.826 1.00 27.62  ? 431  VAL A C   1 
ATOM   3581 O  O   . VAL A 1 431 ? 9.180   78.360 74.040 1.00 26.49  ? 431  VAL A O   1 
ATOM   3582 C  CB  . VAL A 1 431 ? 7.594   79.888 71.930 1.00 29.05  ? 431  VAL A CB  1 
ATOM   3583 C  CG1 . VAL A 1 431 ? 7.315   81.218 71.239 1.00 30.47  ? 431  VAL A CG1 1 
ATOM   3584 C  CG2 . VAL A 1 431 ? 6.941   78.746 71.157 1.00 29.84  ? 431  VAL A CG2 1 
ATOM   3585 N  N   . TRP A 1 432 ? 9.892   77.361 72.147 1.00 25.94  ? 432  TRP A N   1 
ATOM   3586 C  CA  . TRP A 1 432 ? 10.224  76.098 72.808 1.00 24.80  ? 432  TRP A CA  1 
ATOM   3587 C  C   . TRP A 1 432 ? 11.585  76.248 73.490 1.00 24.15  ? 432  TRP A C   1 
ATOM   3588 O  O   . TRP A 1 432 ? 12.406  77.059 73.063 1.00 24.90  ? 432  TRP A O   1 
ATOM   3589 C  CB  . TRP A 1 432 ? 10.292  74.948 71.792 1.00 23.17  ? 432  TRP A CB  1 
ATOM   3590 C  CG  . TRP A 1 432 ? 8.973   74.567 71.172 1.00 22.10  ? 432  TRP A CG  1 
ATOM   3591 C  CD1 . TRP A 1 432 ? 8.516   74.909 69.929 1.00 22.06  ? 432  TRP A CD1 1 
ATOM   3592 C  CD2 . TRP A 1 432 ? 7.964   73.727 71.752 1.00 21.71  ? 432  TRP A CD2 1 
ATOM   3593 N  NE1 . TRP A 1 432 ? 7.288   74.327 69.696 1.00 20.57  ? 432  TRP A NE1 1 
ATOM   3594 C  CE2 . TRP A 1 432 ? 6.927   73.597 70.799 1.00 21.81  ? 432  TRP A CE2 1 
ATOM   3595 C  CE3 . TRP A 1 432 ? 7.836   73.070 72.985 1.00 21.52  ? 432  TRP A CE3 1 
ATOM   3596 C  CZ2 . TRP A 1 432 ? 5.778   72.834 71.040 1.00 19.82  ? 432  TRP A CZ2 1 
ATOM   3597 C  CZ3 . TRP A 1 432 ? 6.693   72.312 73.225 1.00 22.34  ? 432  TRP A CZ3 1 
ATOM   3598 C  CH2 . TRP A 1 432 ? 5.680   72.201 72.254 1.00 23.74  ? 432  TRP A CH2 1 
ATOM   3599 N  N   . PRO A 1 433 ? 11.850  75.455 74.545 1.00 23.31  ? 433  PRO A N   1 
ATOM   3600 C  CA  . PRO A 1 433 ? 13.132  75.549 75.248 1.00 23.66  ? 433  PRO A CA  1 
ATOM   3601 C  C   . PRO A 1 433 ? 14.346  75.251 74.369 1.00 25.27  ? 433  PRO A C   1 
ATOM   3602 O  O   . PRO A 1 433 ? 14.239  74.568 73.345 1.00 23.59  ? 433  PRO A O   1 
ATOM   3603 C  CB  . PRO A 1 433 ? 12.969  74.552 76.399 1.00 24.92  ? 433  PRO A CB  1 
ATOM   3604 C  CG  . PRO A 1 433 ? 12.038  73.524 75.823 1.00 23.17  ? 433  PRO A CG  1 
ATOM   3605 C  CD  . PRO A 1 433 ? 11.019  74.379 75.114 1.00 21.21  ? 433  PRO A CD  1 
ATOM   3606 N  N   A GLU A 1 434 ? 15.501  75.765 74.781 0.50 24.35  ? 434  GLU A N   1 
ATOM   3607 N  N   B GLU A 1 434 ? 15.500  75.769 74.779 0.50 24.38  ? 434  GLU A N   1 
ATOM   3608 C  CA  A GLU A 1 434 ? 16.743  75.577 74.041 0.50 25.74  ? 434  GLU A CA  1 
ATOM   3609 C  CA  B GLU A 1 434 ? 16.745  75.582 74.042 0.50 25.81  ? 434  GLU A CA  1 
ATOM   3610 C  C   A GLU A 1 434 ? 17.166  74.120 73.895 0.50 24.46  ? 434  GLU A C   1 
ATOM   3611 C  C   B GLU A 1 434 ? 17.170  74.123 73.898 0.50 24.50  ? 434  GLU A C   1 
ATOM   3612 O  O   A GLU A 1 434 ? 17.718  73.734 72.863 0.50 23.01  ? 434  GLU A O   1 
ATOM   3613 O  O   B GLU A 1 434 ? 17.727  73.740 72.868 0.50 23.04  ? 434  GLU A O   1 
ATOM   3614 C  CB  A GLU A 1 434 ? 17.883  76.357 74.706 0.50 27.52  ? 434  GLU A CB  1 
ATOM   3615 C  CB  B GLU A 1 434 ? 17.880  76.365 74.715 0.50 27.65  ? 434  GLU A CB  1 
ATOM   3616 C  CG  A GLU A 1 434 ? 17.709  77.864 74.691 0.50 31.96  ? 434  GLU A CG  1 
ATOM   3617 C  CG  B GLU A 1 434 ? 17.759  77.881 74.616 0.50 32.23  ? 434  GLU A CG  1 
ATOM   3618 C  CD  A GLU A 1 434 ? 18.949  78.594 75.175 0.50 33.98  ? 434  GLU A CD  1 
ATOM   3619 C  CD  B GLU A 1 434 ? 17.911  78.396 73.195 0.50 34.25  ? 434  GLU A CD  1 
ATOM   3620 O  OE1 A GLU A 1 434 ? 20.020  78.418 74.558 0.50 35.33  ? 434  GLU A OE1 1 
ATOM   3621 O  OE1 B GLU A 1 434 ? 18.898  78.024 72.525 0.50 35.88  ? 434  GLU A OE1 1 
ATOM   3622 O  OE2 A GLU A 1 434 ? 18.854  79.341 76.171 0.50 36.95  ? 434  GLU A OE2 1 
ATOM   3623 O  OE2 B GLU A 1 434 ? 17.047  79.181 72.749 0.50 37.22  ? 434  GLU A OE2 1 
ATOM   3624 N  N   . TRP A 1 435 ? 16.916  73.310 74.921 1.00 23.79  ? 435  TRP A N   1 
ATOM   3625 C  CA  . TRP A 1 435 ? 17.312  71.906 74.868 1.00 23.89  ? 435  TRP A CA  1 
ATOM   3626 C  C   . TRP A 1 435 ? 16.716  71.133 73.693 1.00 23.61  ? 435  TRP A C   1 
ATOM   3627 O  O   . TRP A 1 435 ? 17.300  70.153 73.236 1.00 23.69  ? 435  TRP A O   1 
ATOM   3628 C  CB  . TRP A 1 435 ? 17.009  71.175 76.193 1.00 23.25  ? 435  TRP A CB  1 
ATOM   3629 C  CG  . TRP A 1 435 ? 15.562  70.836 76.485 1.00 24.66  ? 435  TRP A CG  1 
ATOM   3630 C  CD1 . TRP A 1 435 ? 14.712  71.515 77.314 1.00 24.69  ? 435  TRP A CD1 1 
ATOM   3631 C  CD2 . TRP A 1 435 ? 14.817  69.710 75.983 1.00 24.52  ? 435  TRP A CD2 1 
ATOM   3632 N  NE1 . TRP A 1 435 ? 13.487  70.880 77.364 1.00 25.25  ? 435  TRP A NE1 1 
ATOM   3633 C  CE2 . TRP A 1 435 ? 13.524  69.775 76.555 1.00 24.22  ? 435  TRP A CE2 1 
ATOM   3634 C  CE3 . TRP A 1 435 ? 15.118  68.657 75.107 1.00 22.75  ? 435  TRP A CE3 1 
ATOM   3635 C  CZ2 . TRP A 1 435 ? 12.530  68.824 76.276 1.00 24.76  ? 435  TRP A CZ2 1 
ATOM   3636 C  CZ3 . TRP A 1 435 ? 14.129  67.709 74.829 1.00 24.18  ? 435  TRP A CZ3 1 
ATOM   3637 C  CH2 . TRP A 1 435 ? 12.849  67.803 75.414 1.00 25.37  ? 435  TRP A CH2 1 
ATOM   3638 N  N   . MET A 1 436 ? 15.570  71.580 73.189 1.00 23.40  ? 436  MET A N   1 
ATOM   3639 C  CA  . MET A 1 436 ? 14.922  70.901 72.068 1.00 23.59  ? 436  MET A CA  1 
ATOM   3640 C  C   . MET A 1 436 ? 15.597  71.160 70.717 1.00 23.61  ? 436  MET A C   1 
ATOM   3641 O  O   . MET A 1 436 ? 15.349  70.443 69.745 1.00 23.20  ? 436  MET A O   1 
ATOM   3642 C  CB  . MET A 1 436 ? 13.445  71.289 72.018 1.00 21.40  ? 436  MET A CB  1 
ATOM   3643 C  CG  . MET A 1 436 ? 12.664  70.744 73.206 1.00 21.08  ? 436  MET A CG  1 
ATOM   3644 S  SD  . MET A 1 436 ? 10.955  71.280 73.249 1.00 23.26  ? 436  MET A SD  1 
ATOM   3645 C  CE  . MET A 1 436 ? 10.206  70.149 72.032 1.00 22.62  ? 436  MET A CE  1 
ATOM   3646 N  N   . GLY A 1 437 ? 16.447  72.182 70.662 1.00 23.41  ? 437  GLY A N   1 
ATOM   3647 C  CA  . GLY A 1 437 ? 17.174  72.496 69.439 1.00 23.43  ? 437  GLY A CA  1 
ATOM   3648 C  C   . GLY A 1 437 ? 16.363  72.839 68.201 1.00 23.96  ? 437  GLY A C   1 
ATOM   3649 O  O   . GLY A 1 437 ? 15.437  73.654 68.249 1.00 24.68  ? 437  GLY A O   1 
ATOM   3650 N  N   . VAL A 1 438 ? 16.733  72.221 67.082 1.00 23.81  ? 438  VAL A N   1 
ATOM   3651 C  CA  . VAL A 1 438 ? 16.065  72.432 65.799 1.00 24.20  ? 438  VAL A CA  1 
ATOM   3652 C  C   . VAL A 1 438 ? 15.012  71.334 65.678 1.00 24.66  ? 438  VAL A C   1 
ATOM   3653 O  O   . VAL A 1 438 ? 15.274  70.221 65.209 1.00 23.13  ? 438  VAL A O   1 
ATOM   3654 C  CB  . VAL A 1 438 ? 17.088  72.361 64.648 1.00 24.04  ? 438  VAL A CB  1 
ATOM   3655 C  CG1 . VAL A 1 438 ? 16.435  72.753 63.336 1.00 23.29  ? 438  VAL A CG1 1 
ATOM   3656 C  CG2 . VAL A 1 438 ? 18.265  73.289 64.963 1.00 24.40  ? 438  VAL A CG2 1 
ATOM   3657 N  N   . ILE A 1 439 ? 13.813  71.694 66.112 1.00 24.02  ? 439  ILE A N   1 
ATOM   3658 C  CA  . ILE A 1 439 ? 12.661  70.812 66.197 1.00 23.90  ? 439  ILE A CA  1 
ATOM   3659 C  C   . ILE A 1 439 ? 11.998  70.283 64.929 1.00 24.11  ? 439  ILE A C   1 
ATOM   3660 O  O   . ILE A 1 439 ? 12.046  70.897 63.862 1.00 22.91  ? 439  ILE A O   1 
ATOM   3661 C  CB  . ILE A 1 439 ? 11.594  71.498 67.083 1.00 24.68  ? 439  ILE A CB  1 
ATOM   3662 C  CG1 . ILE A 1 439 ? 12.243  71.894 68.417 1.00 24.62  ? 439  ILE A CG1 1 
ATOM   3663 C  CG2 . ILE A 1 439 ? 10.402  70.580 67.322 1.00 21.65  ? 439  ILE A CG2 1 
ATOM   3664 C  CD1 . ILE A 1 439 ? 11.403  72.832 69.264 1.00 24.79  ? 439  ILE A CD1 1 
ATOM   3665 N  N   . HIS A 1 440 ? 11.383  69.115 65.087 1.00 22.68  ? 440  HIS A N   1 
ATOM   3666 C  CA  . HIS A 1 440 ? 10.646  68.436 64.031 1.00 23.95  ? 440  HIS A CA  1 
ATOM   3667 C  C   . HIS A 1 440 ? 9.561   69.386 63.528 1.00 24.54  ? 440  HIS A C   1 
ATOM   3668 O  O   . HIS A 1 440 ? 8.650   69.750 64.279 1.00 24.45  ? 440  HIS A O   1 
ATOM   3669 C  CB  . HIS A 1 440 ? 10.002  67.174 64.616 1.00 23.94  ? 440  HIS A CB  1 
ATOM   3670 C  CG  . HIS A 1 440 ? 9.337   66.293 63.606 1.00 24.44  ? 440  HIS A CG  1 
ATOM   3671 N  ND1 . HIS A 1 440 ? 10.010  65.746 62.534 1.00 25.95  ? 440  HIS A ND1 1 
ATOM   3672 C  CD2 . HIS A 1 440 ? 8.075   65.804 63.547 1.00 25.51  ? 440  HIS A CD2 1 
ATOM   3673 C  CE1 . HIS A 1 440 ? 9.193   64.953 61.862 1.00 25.31  ? 440  HIS A CE1 1 
ATOM   3674 N  NE2 . HIS A 1 440 ? 8.013   64.971 62.456 1.00 26.65  ? 440  HIS A NE2 1 
ATOM   3675 N  N   . GLY A 1 441 ? 9.679   69.800 62.269 1.00 23.15  ? 441  GLY A N   1 
ATOM   3676 C  CA  . GLY A 1 441 ? 8.696   70.690 61.678 1.00 22.79  ? 441  GLY A CA  1 
ATOM   3677 C  C   . GLY A 1 441 ? 9.052   72.167 61.651 1.00 23.88  ? 441  GLY A C   1 
ATOM   3678 O  O   . GLY A 1 441 ? 8.339   72.969 61.044 1.00 23.31  ? 441  GLY A O   1 
ATOM   3679 N  N   . TYR A 1 442 ? 10.160  72.546 62.277 1.00 23.79  ? 442  TYR A N   1 
ATOM   3680 C  CA  . TYR A 1 442 ? 10.501  73.957 62.307 1.00 23.43  ? 442  TYR A CA  1 
ATOM   3681 C  C   . TYR A 1 442 ? 11.288  74.556 61.148 1.00 23.64  ? 442  TYR A C   1 
ATOM   3682 O  O   . TYR A 1 442 ? 11.752  75.692 61.227 1.00 24.36  ? 442  TYR A O   1 
ATOM   3683 C  CB  . TYR A 1 442 ? 11.120  74.303 63.665 1.00 23.82  ? 442  TYR A CB  1 
ATOM   3684 C  CG  . TYR A 1 442 ? 10.020  74.477 64.687 1.00 23.29  ? 442  TYR A CG  1 
ATOM   3685 C  CD1 . TYR A 1 442 ? 9.354   73.369 65.222 1.00 22.39  ? 442  TYR A CD1 1 
ATOM   3686 C  CD2 . TYR A 1 442 ? 9.528   75.749 64.991 1.00 24.90  ? 442  TYR A CD2 1 
ATOM   3687 C  CE1 . TYR A 1 442 ? 8.216   73.526 66.024 1.00 24.02  ? 442  TYR A CE1 1 
ATOM   3688 C  CE2 . TYR A 1 442 ? 8.391   75.916 65.787 1.00 24.96  ? 442  TYR A CE2 1 
ATOM   3689 C  CZ  . TYR A 1 442 ? 7.739   74.804 66.294 1.00 24.37  ? 442  TYR A CZ  1 
ATOM   3690 O  OH  . TYR A 1 442 ? 6.592   74.974 67.034 1.00 24.40  ? 442  TYR A OH  1 
ATOM   3691 N  N   . GLU A 1 443 ? 11.411  73.805 60.059 1.00 22.15  ? 443  GLU A N   1 
ATOM   3692 C  CA  . GLU A 1 443 ? 12.069  74.321 58.869 1.00 22.23  ? 443  GLU A CA  1 
ATOM   3693 C  C   . GLU A 1 443 ? 10.934  74.822 57.965 1.00 22.61  ? 443  GLU A C   1 
ATOM   3694 O  O   . GLU A 1 443 ? 11.152  75.611 57.045 1.00 22.31  ? 443  GLU A O   1 
ATOM   3695 C  CB  . GLU A 1 443 ? 12.854  73.222 58.137 1.00 21.91  ? 443  GLU A CB  1 
ATOM   3696 C  CG  . GLU A 1 443 ? 12.023  72.365 57.168 1.00 22.20  ? 443  GLU A CG  1 
ATOM   3697 C  CD  . GLU A 1 443 ? 11.098  71.364 57.859 1.00 23.24  ? 443  GLU A CD  1 
ATOM   3698 O  OE1 . GLU A 1 443 ? 10.310  70.705 57.150 1.00 21.93  ? 443  GLU A OE1 1 
ATOM   3699 O  OE2 . GLU A 1 443 ? 11.160  71.228 59.100 1.00 21.44  ? 443  GLU A OE2 1 
ATOM   3700 N  N   . ILE A 1 444 ? 9.716   74.361 58.246 1.00 21.99  ? 444  ILE A N   1 
ATOM   3701 C  CA  . ILE A 1 444 ? 8.548   74.729 57.444 1.00 21.31  ? 444  ILE A CA  1 
ATOM   3702 C  C   . ILE A 1 444 ? 8.320   76.236 57.332 1.00 23.35  ? 444  ILE A C   1 
ATOM   3703 O  O   . ILE A 1 444 ? 8.077   76.752 56.236 1.00 21.94  ? 444  ILE A O   1 
ATOM   3704 C  CB  . ILE A 1 444 ? 7.255   74.075 57.994 1.00 22.17  ? 444  ILE A CB  1 
ATOM   3705 C  CG1 . ILE A 1 444 ? 7.413   72.550 58.035 1.00 21.41  ? 444  ILE A CG1 1 
ATOM   3706 C  CG2 . ILE A 1 444 ? 6.065   74.452 57.107 1.00 21.38  ? 444  ILE A CG2 1 
ATOM   3707 C  CD1 . ILE A 1 444 ? 6.178   71.815 58.542 1.00 19.83  ? 444  ILE A CD1 1 
ATOM   3708 N  N   . GLU A 1 445 ? 8.400   76.939 58.458 1.00 22.53  ? 445  GLU A N   1 
ATOM   3709 C  CA  . GLU A 1 445 ? 8.197   78.383 58.456 1.00 24.01  ? 445  GLU A CA  1 
ATOM   3710 C  C   . GLU A 1 445 ? 9.180   79.087 57.520 1.00 23.64  ? 445  GLU A C   1 
ATOM   3711 O  O   . GLU A 1 445 ? 8.868   80.140 56.965 1.00 25.87  ? 445  GLU A O   1 
ATOM   3712 C  CB  . GLU A 1 445 ? 8.294   78.940 59.889 1.00 23.60  ? 445  GLU A CB  1 
ATOM   3713 C  CG  . GLU A 1 445 ? 9.558   78.574 60.649 1.00 24.37  ? 445  GLU A CG  1 
ATOM   3714 C  CD  . GLU A 1 445 ? 9.367   78.671 62.156 1.00 28.33  ? 445  GLU A CD  1 
ATOM   3715 O  OE1 . GLU A 1 445 ? 8.472   77.977 62.683 1.00 27.21  ? 445  GLU A OE1 1 
ATOM   3716 O  OE2 . GLU A 1 445 ? 10.106  79.436 62.816 1.00 27.26  ? 445  GLU A OE2 1 
ATOM   3717 N  N   . PHE A 1 446 ? 10.358  78.502 57.327 1.00 23.03  ? 446  PHE A N   1 
ATOM   3718 C  CA  . PHE A 1 446 ? 11.339  79.095 56.424 1.00 23.96  ? 446  PHE A CA  1 
ATOM   3719 C  C   . PHE A 1 446 ? 10.988  78.761 54.975 1.00 25.26  ? 446  PHE A C   1 
ATOM   3720 O  O   . PHE A 1 446 ? 11.160  79.587 54.074 1.00 25.82  ? 446  PHE A O   1 
ATOM   3721 C  CB  . PHE A 1 446 ? 12.752  78.604 56.752 1.00 24.70  ? 446  PHE A CB  1 
ATOM   3722 C  CG  . PHE A 1 446 ? 13.341  79.239 57.982 1.00 25.51  ? 446  PHE A CG  1 
ATOM   3723 C  CD1 . PHE A 1 446 ? 13.002  78.780 59.252 1.00 23.26  ? 446  PHE A CD1 1 
ATOM   3724 C  CD2 . PHE A 1 446 ? 14.199  80.332 57.867 1.00 26.20  ? 446  PHE A CD2 1 
ATOM   3725 C  CE1 . PHE A 1 446 ? 13.505  79.400 60.396 1.00 25.49  ? 446  PHE A CE1 1 
ATOM   3726 C  CE2 . PHE A 1 446 ? 14.710  80.964 59.007 1.00 26.86  ? 446  PHE A CE2 1 
ATOM   3727 C  CZ  . PHE A 1 446 ? 14.362  80.497 60.273 1.00 26.05  ? 446  PHE A CZ  1 
ATOM   3728 N  N   . VAL A 1 447 ? 10.487  77.550 54.756 1.00 24.28  ? 447  VAL A N   1 
ATOM   3729 C  CA  . VAL A 1 447 ? 10.094  77.120 53.419 1.00 23.10  ? 447  VAL A CA  1 
ATOM   3730 C  C   . VAL A 1 447 ? 8.905   77.950 52.923 1.00 23.77  ? 447  VAL A C   1 
ATOM   3731 O  O   . VAL A 1 447 ? 8.815   78.270 51.734 1.00 25.21  ? 447  VAL A O   1 
ATOM   3732 C  CB  . VAL A 1 447 ? 9.723   75.612 53.414 1.00 22.44  ? 447  VAL A CB  1 
ATOM   3733 C  CG1 . VAL A 1 447 ? 9.084   75.217 52.082 1.00 23.61  ? 447  VAL A CG1 1 
ATOM   3734 C  CG2 . VAL A 1 447 ? 10.975  74.779 53.660 1.00 20.64  ? 447  VAL A CG2 1 
ATOM   3735 N  N   . PHE A 1 448 ? 8.002   78.308 53.834 1.00 24.02  ? 448  PHE A N   1 
ATOM   3736 C  CA  . PHE A 1 448 ? 6.832   79.100 53.461 1.00 25.19  ? 448  PHE A CA  1 
ATOM   3737 C  C   . PHE A 1 448 ? 7.034   80.613 53.565 1.00 26.05  ? 448  PHE A C   1 
ATOM   3738 O  O   . PHE A 1 448 ? 6.103   81.388 53.353 1.00 26.52  ? 448  PHE A O   1 
ATOM   3739 C  CB  . PHE A 1 448 ? 5.605   78.666 54.269 1.00 23.63  ? 448  PHE A CB  1 
ATOM   3740 C  CG  . PHE A 1 448 ? 4.962   77.409 53.746 1.00 26.40  ? 448  PHE A CG  1 
ATOM   3741 C  CD1 . PHE A 1 448 ? 5.571   76.168 53.929 1.00 23.99  ? 448  PHE A CD1 1 
ATOM   3742 C  CD2 . PHE A 1 448 ? 3.770   77.473 53.026 1.00 26.19  ? 448  PHE A CD2 1 
ATOM   3743 C  CE1 . PHE A 1 448 ? 5.001   75.005 53.398 1.00 25.82  ? 448  PHE A CE1 1 
ATOM   3744 C  CE2 . PHE A 1 448 ? 3.190   76.316 52.490 1.00 26.33  ? 448  PHE A CE2 1 
ATOM   3745 C  CZ  . PHE A 1 448 ? 3.808   75.081 52.677 1.00 27.06  ? 448  PHE A CZ  1 
ATOM   3746 N  N   . GLY A 1 449 ? 8.255   81.020 53.896 1.00 26.24  ? 449  GLY A N   1 
ATOM   3747 C  CA  . GLY A 1 449 ? 8.589   82.433 53.961 1.00 28.01  ? 449  GLY A CA  1 
ATOM   3748 C  C   . GLY A 1 449 ? 8.080   83.328 55.074 1.00 28.75  ? 449  GLY A C   1 
ATOM   3749 O  O   . GLY A 1 449 ? 8.033   84.545 54.902 1.00 29.89  ? 449  GLY A O   1 
ATOM   3750 N  N   A LEU A 1 450 ? 7.710   82.742 56.208 0.50 28.61  ? 450  LEU A N   1 
ATOM   3751 N  N   B LEU A 1 450 ? 7.694   82.755 56.209 0.50 28.25  ? 450  LEU A N   1 
ATOM   3752 C  CA  A LEU A 1 450 ? 7.220   83.521 57.341 0.50 29.46  ? 450  LEU A CA  1 
ATOM   3753 C  CA  B LEU A 1 450 ? 7.206   83.571 57.316 0.50 28.87  ? 450  LEU A CA  1 
ATOM   3754 C  C   A LEU A 1 450 ? 8.220   84.587 57.801 0.50 29.56  ? 450  LEU A C   1 
ATOM   3755 C  C   B LEU A 1 450 ? 8.225   84.618 57.776 0.50 29.22  ? 450  LEU A C   1 
ATOM   3756 O  O   A LEU A 1 450 ? 7.821   85.657 58.262 0.50 30.72  ? 450  LEU A O   1 
ATOM   3757 O  O   B LEU A 1 450 ? 7.844   85.704 58.214 0.50 30.54  ? 450  LEU A O   1 
ATOM   3758 C  CB  A LEU A 1 450 ? 6.880   82.599 58.517 0.50 29.20  ? 450  LEU A CB  1 
ATOM   3759 C  CB  B LEU A 1 450 ? 6.783   82.688 58.493 0.50 27.68  ? 450  LEU A CB  1 
ATOM   3760 C  CG  A LEU A 1 450 ? 5.600   81.760 58.417 0.50 30.12  ? 450  LEU A CG  1 
ATOM   3761 C  CG  B LEU A 1 450 ? 5.339   82.173 58.419 0.50 27.53  ? 450  LEU A CG  1 
ATOM   3762 C  CD1 A LEU A 1 450 ? 4.394   82.684 58.387 0.50 28.83  ? 450  LEU A CD1 1 
ATOM   3763 C  CD1 B LEU A 1 450 ? 5.097   81.453 57.096 0.50 26.49  ? 450  LEU A CD1 1 
ATOM   3764 C  CD2 A LEU A 1 450 ? 5.637   80.881 57.173 0.50 29.78  ? 450  LEU A CD2 1 
ATOM   3765 C  CD2 B LEU A 1 450 ? 5.071   81.249 59.593 0.50 26.51  ? 450  LEU A CD2 1 
ATOM   3766 N  N   . PRO A 1 451 ? 9.531   84.305 57.693 1.00 28.99  ? 451  PRO A N   1 
ATOM   3767 C  CA  . PRO A 1 451 ? 10.539  85.285 58.117 1.00 30.58  ? 451  PRO A CA  1 
ATOM   3768 C  C   . PRO A 1 451 ? 10.509  86.596 57.318 1.00 31.69  ? 451  PRO A C   1 
ATOM   3769 O  O   . PRO A 1 451 ? 11.172  87.565 57.689 1.00 31.06  ? 451  PRO A O   1 
ATOM   3770 C  CB  . PRO A 1 451 ? 11.855  84.528 57.938 1.00 30.48  ? 451  PRO A CB  1 
ATOM   3771 C  CG  . PRO A 1 451 ? 11.459  83.116 58.247 1.00 30.72  ? 451  PRO A CG  1 
ATOM   3772 C  CD  . PRO A 1 451 ? 10.165  82.991 57.464 1.00 29.61  ? 451  PRO A CD  1 
ATOM   3773 N  N   . LEU A 1 452 ? 9.753   86.625 56.223 1.00 31.36  ? 452  LEU A N   1 
ATOM   3774 C  CA  . LEU A 1 452 ? 9.654   87.842 55.418 1.00 33.36  ? 452  LEU A CA  1 
ATOM   3775 C  C   . LEU A 1 452 ? 8.643   88.812 56.026 1.00 34.15  ? 452  LEU A C   1 
ATOM   3776 O  O   . LEU A 1 452 ? 8.555   89.967 55.612 1.00 36.67  ? 452  LEU A O   1 
ATOM   3777 C  CB  . LEU A 1 452 ? 9.246   87.514 53.975 1.00 31.03  ? 452  LEU A CB  1 
ATOM   3778 C  CG  . LEU A 1 452 ? 10.331  87.004 53.021 1.00 32.30  ? 452  LEU A CG  1 
ATOM   3779 C  CD1 . LEU A 1 452 ? 10.920  85.684 53.520 1.00 29.85  ? 452  LEU A CD1 1 
ATOM   3780 C  CD2 . LEU A 1 452 ? 9.719   86.830 51.633 1.00 31.53  ? 452  LEU A CD2 1 
ATOM   3781 N  N   . VAL A 1 453 ? 7.880   88.334 57.006 1.00 34.68  ? 453  VAL A N   1 
ATOM   3782 C  CA  . VAL A 1 453 ? 6.878   89.157 57.674 1.00 36.53  ? 453  VAL A CA  1 
ATOM   3783 C  C   . VAL A 1 453 ? 7.510   89.817 58.902 1.00 38.40  ? 453  VAL A C   1 
ATOM   3784 O  O   . VAL A 1 453 ? 7.741   89.167 59.923 1.00 35.65  ? 453  VAL A O   1 
ATOM   3785 C  CB  . VAL A 1 453 ? 5.665   88.304 58.106 1.00 36.62  ? 453  VAL A CB  1 
ATOM   3786 C  CG1 . VAL A 1 453 ? 4.618   89.177 58.777 1.00 35.56  ? 453  VAL A CG1 1 
ATOM   3787 C  CG2 . VAL A 1 453 ? 5.069   87.602 56.890 1.00 37.03  ? 453  VAL A CG2 1 
ATOM   3788 N  N   . LYS A 1 454 ? 7.786   91.114 58.788 1.00 41.10  ? 454  LYS A N   1 
ATOM   3789 C  CA  . LYS A 1 454 ? 8.419   91.886 59.858 1.00 42.61  ? 454  LYS A CA  1 
ATOM   3790 C  C   . LYS A 1 454 ? 7.809   91.663 61.239 1.00 42.62  ? 454  LYS A C   1 
ATOM   3791 O  O   . LYS A 1 454 ? 8.529   91.466 62.218 1.00 43.16  ? 454  LYS A O   1 
ATOM   3792 C  CB  . LYS A 1 454 ? 8.371   93.378 59.516 1.00 46.42  ? 454  LYS A CB  1 
ATOM   3793 C  CG  . LYS A 1 454 ? 8.821   93.698 58.097 1.00 51.23  ? 454  LYS A CG  1 
ATOM   3794 C  CD  . LYS A 1 454 ? 10.233  93.194 57.824 1.00 54.83  ? 454  LYS A CD  1 
ATOM   3795 C  CE  . LYS A 1 454 ? 10.586  93.294 56.345 1.00 56.86  ? 454  LYS A CE  1 
ATOM   3796 N  NZ  . LYS A 1 454 ? 10.478  94.690 55.832 1.00 59.39  ? 454  LYS A NZ  1 
ATOM   3797 N  N   . GLU A 1 455 ? 6.484   91.689 61.312 1.00 42.91  ? 455  GLU A N   1 
ATOM   3798 C  CA  . GLU A 1 455 ? 5.779   91.508 62.577 1.00 44.72  ? 455  GLU A CA  1 
ATOM   3799 C  C   . GLU A 1 455 ? 6.073   90.190 63.294 1.00 44.60  ? 455  GLU A C   1 
ATOM   3800 O  O   . GLU A 1 455 ? 5.780   90.058 64.481 1.00 44.31  ? 455  GLU A O   1 
ATOM   3801 C  CB  . GLU A 1 455 ? 4.266   91.620 62.361 1.00 48.30  ? 455  GLU A CB  1 
ATOM   3802 C  CG  . GLU A 1 455 ? 3.803   92.924 61.732 1.00 53.95  ? 455  GLU A CG  1 
ATOM   3803 C  CD  . GLU A 1 455 ? 4.224   93.057 60.279 1.00 57.57  ? 455  GLU A CD  1 
ATOM   3804 O  OE1 . GLU A 1 455 ? 3.835   92.191 59.465 1.00 58.22  ? 455  GLU A OE1 1 
ATOM   3805 O  OE2 . GLU A 1 455 ? 4.942   94.027 59.952 1.00 60.69  ? 455  GLU A OE2 1 
ATOM   3806 N  N   . LEU A 1 456 ? 6.650   89.218 62.590 1.00 43.35  ? 456  LEU A N   1 
ATOM   3807 C  CA  . LEU A 1 456 ? 6.934   87.924 63.209 1.00 42.83  ? 456  LEU A CA  1 
ATOM   3808 C  C   . LEU A 1 456 ? 8.234   87.859 64.012 1.00 42.60  ? 456  LEU A C   1 
ATOM   3809 O  O   . LEU A 1 456 ? 8.558   86.827 64.604 1.00 42.18  ? 456  LEU A O   1 
ATOM   3810 C  CB  . LEU A 1 456 ? 6.898   86.816 62.150 1.00 41.15  ? 456  LEU A CB  1 
ATOM   3811 C  CG  . LEU A 1 456 ? 5.531   86.662 61.471 1.00 40.41  ? 456  LEU A CG  1 
ATOM   3812 C  CD1 . LEU A 1 456 ? 5.533   85.440 60.562 1.00 38.93  ? 456  LEU A CD1 1 
ATOM   3813 C  CD2 . LEU A 1 456 ? 4.442   86.534 62.530 1.00 39.54  ? 456  LEU A CD2 1 
ATOM   3814 N  N   . ASN A 1 457 ? 8.973   88.964 64.025 1.00 41.86  ? 457  ASN A N   1 
ATOM   3815 C  CA  . ASN A 1 457 ? 10.213  89.075 64.793 1.00 42.22  ? 457  ASN A CA  1 
ATOM   3816 C  C   . ASN A 1 457 ? 11.402  88.188 64.419 1.00 40.63  ? 457  ASN A C   1 
ATOM   3817 O  O   . ASN A 1 457 ? 12.134  87.745 65.304 1.00 40.79  ? 457  ASN A O   1 
ATOM   3818 C  CB  . ASN A 1 457 ? 9.922   88.877 66.288 1.00 44.41  ? 457  ASN A CB  1 
ATOM   3819 C  CG  . ASN A 1 457 ? 8.925   89.885 66.832 1.00 47.15  ? 457  ASN A CG  1 
ATOM   3820 O  OD1 . ASN A 1 457 ? 8.982   91.070 66.509 1.00 47.31  ? 457  ASN A OD1 1 
ATOM   3821 N  ND2 . ASN A 1 457 ? 8.012   89.416 67.677 1.00 48.80  ? 457  ASN A ND2 1 
ATOM   3822 N  N   . TYR A 1 458 ? 11.601  87.922 63.132 1.00 37.59  ? 458  TYR A N   1 
ATOM   3823 C  CA  . TYR A 1 458 ? 12.748  87.121 62.702 1.00 34.90  ? 458  TYR A CA  1 
ATOM   3824 C  C   . TYR A 1 458 ? 13.887  88.102 62.409 1.00 34.57  ? 458  TYR A C   1 
ATOM   3825 O  O   . TYR A 1 458 ? 13.644  89.292 62.211 1.00 35.25  ? 458  TYR A O   1 
ATOM   3826 C  CB  . TYR A 1 458 ? 12.416  86.331 61.432 1.00 32.92  ? 458  TYR A CB  1 
ATOM   3827 C  CG  . TYR A 1 458 ? 11.519  85.126 61.640 1.00 31.72  ? 458  TYR A CG  1 
ATOM   3828 C  CD1 . TYR A 1 458 ? 12.044  83.903 62.066 1.00 31.76  ? 458  TYR A CD1 1 
ATOM   3829 C  CD2 . TYR A 1 458 ? 10.152  85.198 61.376 1.00 31.97  ? 458  TYR A CD2 1 
ATOM   3830 C  CE1 . TYR A 1 458 ? 11.223  82.778 62.217 1.00 31.16  ? 458  TYR A CE1 1 
ATOM   3831 C  CE2 . TYR A 1 458 ? 9.323   84.082 61.524 1.00 32.17  ? 458  TYR A CE2 1 
ATOM   3832 C  CZ  . TYR A 1 458 ? 9.866   82.876 61.942 1.00 31.08  ? 458  TYR A CZ  1 
ATOM   3833 O  OH  . TYR A 1 458 ? 9.053   81.772 62.067 1.00 32.09  ? 458  TYR A OH  1 
ATOM   3834 N  N   . THR A 1 459 ? 15.122  87.614 62.378 1.00 34.31  ? 459  THR A N   1 
ATOM   3835 C  CA  . THR A 1 459 ? 16.260  88.483 62.099 1.00 33.89  ? 459  THR A CA  1 
ATOM   3836 C  C   . THR A 1 459 ? 16.431  88.681 60.598 1.00 34.62  ? 459  THR A C   1 
ATOM   3837 O  O   . THR A 1 459 ? 15.807  87.986 59.791 1.00 33.69  ? 459  THR A O   1 
ATOM   3838 C  CB  . THR A 1 459 ? 17.574  87.902 62.655 1.00 33.97  ? 459  THR A CB  1 
ATOM   3839 O  OG1 . THR A 1 459 ? 17.922  86.720 61.924 1.00 31.77  ? 459  THR A OG1 1 
ATOM   3840 C  CG2 . THR A 1 459 ? 17.423  87.559 64.135 1.00 33.67  ? 459  THR A CG2 1 
ATOM   3841 N  N   . ALA A 1 460 ? 17.282  89.633 60.230 1.00 33.46  ? 460  ALA A N   1 
ATOM   3842 C  CA  . ALA A 1 460 ? 17.553  89.917 58.825 1.00 33.57  ? 460  ALA A CA  1 
ATOM   3843 C  C   . ALA A 1 460 ? 18.169  88.676 58.196 1.00 32.71  ? 460  ALA A C   1 
ATOM   3844 O  O   . ALA A 1 460 ? 17.859  88.322 57.057 1.00 32.79  ? 460  ALA A O   1 
ATOM   3845 C  CB  . ALA A 1 460 ? 18.512  91.100 58.704 1.00 33.94  ? 460  ALA A CB  1 
ATOM   3846 N  N   . GLU A 1 461 ? 19.047  88.022 58.951 1.00 32.71  ? 461  GLU A N   1 
ATOM   3847 C  CA  . GLU A 1 461 ? 19.715  86.808 58.487 1.00 33.20  ? 461  GLU A CA  1 
ATOM   3848 C  C   . GLU A 1 461 ? 18.690  85.699 58.234 1.00 32.30  ? 461  GLU A C   1 
ATOM   3849 O  O   . GLU A 1 461 ? 18.834  84.903 57.303 1.00 31.41  ? 461  GLU A O   1 
ATOM   3850 C  CB  . GLU A 1 461 ? 20.734  86.331 59.526 1.00 34.95  ? 461  GLU A CB  1 
ATOM   3851 C  CG  . GLU A 1 461 ? 21.895  87.293 59.788 1.00 40.65  ? 461  GLU A CG  1 
ATOM   3852 C  CD  . GLU A 1 461 ? 21.444  88.643 60.326 1.00 42.37  ? 461  GLU A CD  1 
ATOM   3853 O  OE1 . GLU A 1 461 ? 20.633  88.675 61.276 1.00 42.40  ? 461  GLU A OE1 1 
ATOM   3854 O  OE2 . GLU A 1 461 ? 21.909  89.676 59.801 1.00 49.15  ? 461  GLU A OE2 1 
ATOM   3855 N  N   . GLU A 1 462 ? 17.655  85.650 59.066 1.00 30.86  ? 462  GLU A N   1 
ATOM   3856 C  CA  . GLU A 1 462 ? 16.625  84.633 58.909 1.00 30.77  ? 462  GLU A CA  1 
ATOM   3857 C  C   . GLU A 1 462 ? 15.739  84.921 57.699 1.00 31.01  ? 462  GLU A C   1 
ATOM   3858 O  O   . GLU A 1 462 ? 15.235  83.993 57.062 1.00 29.70  ? 462  GLU A O   1 
ATOM   3859 C  CB  . GLU A 1 462 ? 15.812  84.514 60.201 1.00 30.13  ? 462  GLU A CB  1 
ATOM   3860 C  CG  . GLU A 1 462 ? 16.694  84.060 61.365 1.00 29.58  ? 462  GLU A CG  1 
ATOM   3861 C  CD  . GLU A 1 462 ? 15.967  83.961 62.689 1.00 29.94  ? 462  GLU A CD  1 
ATOM   3862 O  OE1 . GLU A 1 462 ? 15.179  84.874 63.019 1.00 29.04  ? 462  GLU A OE1 1 
ATOM   3863 O  OE2 . GLU A 1 462 ? 16.200  82.971 63.413 1.00 31.22  ? 462  GLU A OE2 1 
ATOM   3864 N  N   . GLU A 1 463 ? 15.555  86.198 57.365 1.00 30.07  ? 463  GLU A N   1 
ATOM   3865 C  CA  . GLU A 1 463 ? 14.761  86.528 56.187 1.00 29.89  ? 463  GLU A CA  1 
ATOM   3866 C  C   . GLU A 1 463 ? 15.562  86.059 54.976 1.00 29.49  ? 463  GLU A C   1 
ATOM   3867 O  O   . GLU A 1 463 ? 15.008  85.486 54.037 1.00 29.03  ? 463  GLU A O   1 
ATOM   3868 C  CB  . GLU A 1 463 ? 14.513  88.035 56.059 1.00 31.50  ? 463  GLU A CB  1 
ATOM   3869 C  CG  . GLU A 1 463 ? 13.542  88.364 54.921 1.00 34.21  ? 463  GLU A CG  1 
ATOM   3870 C  CD  . GLU A 1 463 ? 13.430  89.850 54.619 1.00 35.51  ? 463  GLU A CD  1 
ATOM   3871 O  OE1 . GLU A 1 463 ? 13.332  90.655 55.566 1.00 35.64  ? 463  GLU A OE1 1 
ATOM   3872 O  OE2 . GLU A 1 463 ? 13.425  90.207 53.423 1.00 36.55  ? 463  GLU A OE2 1 
ATOM   3873 N  N   . ALA A 1 464 ? 16.871  86.302 55.010 1.00 28.58  ? 464  ALA A N   1 
ATOM   3874 C  CA  . ALA A 1 464 ? 17.753  85.905 53.918 1.00 28.67  ? 464  ALA A CA  1 
ATOM   3875 C  C   . ALA A 1 464 ? 17.764  84.387 53.730 1.00 28.94  ? 464  ALA A C   1 
ATOM   3876 O  O   . ALA A 1 464 ? 17.727  83.893 52.599 1.00 28.15  ? 464  ALA A O   1 
ATOM   3877 C  CB  . ALA A 1 464 ? 19.171  86.407 54.180 1.00 29.55  ? 464  ALA A CB  1 
ATOM   3878 N  N   . LEU A 1 465 ? 17.828  83.650 54.835 1.00 27.42  ? 465  LEU A N   1 
ATOM   3879 C  CA  . LEU A 1 465 ? 17.836  82.192 54.769 1.00 26.68  ? 465  LEU A CA  1 
ATOM   3880 C  C   . LEU A 1 465 ? 16.531  81.691 54.154 1.00 26.32  ? 465  LEU A C   1 
ATOM   3881 O  O   . LEU A 1 465 ? 16.537  80.801 53.303 1.00 27.58  ? 465  LEU A O   1 
ATOM   3882 C  CB  . LEU A 1 465 ? 18.022  81.592 56.170 1.00 25.46  ? 465  LEU A CB  1 
ATOM   3883 C  CG  . LEU A 1 465 ? 17.908  80.066 56.306 1.00 25.27  ? 465  LEU A CG  1 
ATOM   3884 C  CD1 . LEU A 1 465 ? 18.866  79.372 55.347 1.00 25.27  ? 465  LEU A CD1 1 
ATOM   3885 C  CD2 . LEU A 1 465 ? 18.213  79.669 57.743 1.00 25.25  ? 465  LEU A CD2 1 
ATOM   3886 N  N   . SER A 1 466 ? 15.415  82.272 54.585 1.00 25.66  ? 466  SER A N   1 
ATOM   3887 C  CA  . SER A 1 466 ? 14.110  81.888 54.066 1.00 27.47  ? 466  SER A CA  1 
ATOM   3888 C  C   . SER A 1 466 ? 14.019  82.131 52.559 1.00 28.88  ? 466  SER A C   1 
ATOM   3889 O  O   . SER A 1 466 ? 13.551  81.269 51.811 1.00 26.96  ? 466  SER A O   1 
ATOM   3890 C  CB  . SER A 1 466 ? 13.001  82.664 54.781 1.00 25.75  ? 466  SER A CB  1 
ATOM   3891 O  OG  . SER A 1 466 ? 11.722  82.316 54.267 1.00 26.09  ? 466  SER A OG  1 
ATOM   3892 N  N   . ARG A 1 467 ? 14.466  83.302 52.110 1.00 29.26  ? 467  ARG A N   1 
ATOM   3893 C  CA  . ARG A 1 467 ? 14.420  83.613 50.683 1.00 29.23  ? 467  ARG A CA  1 
ATOM   3894 C  C   . ARG A 1 467 ? 15.275  82.632 49.894 1.00 28.64  ? 467  ARG A C   1 
ATOM   3895 O  O   . ARG A 1 467 ? 14.900  82.208 48.802 1.00 28.47  ? 467  ARG A O   1 
ATOM   3896 C  CB  . ARG A 1 467 ? 14.892  85.052 50.423 1.00 29.50  ? 467  ARG A CB  1 
ATOM   3897 C  CG  . ARG A 1 467 ? 13.871  86.116 50.825 1.00 30.75  ? 467  ARG A CG  1 
ATOM   3898 C  CD  . ARG A 1 467 ? 14.391  87.538 50.599 1.00 31.53  ? 467  ARG A CD  1 
ATOM   3899 N  NE  . ARG A 1 467 ? 13.405  88.534 51.012 1.00 31.68  ? 467  ARG A NE  1 
ATOM   3900 C  CZ  . ARG A 1 467 ? 12.318  88.848 50.314 1.00 32.69  ? 467  ARG A CZ  1 
ATOM   3901 N  NH1 . ARG A 1 467 ? 12.077  88.250 49.154 1.00 32.08  ? 467  ARG A NH1 1 
ATOM   3902 N  NH2 . ARG A 1 467 ? 11.463  89.750 50.782 1.00 33.54  ? 467  ARG A NH2 1 
ATOM   3903 N  N   . ARG A 1 468 ? 16.425  82.268 50.449 1.00 28.25  ? 468  ARG A N   1 
ATOM   3904 C  CA  . ARG A 1 468 ? 17.313  81.331 49.771 1.00 29.90  ? 468  ARG A CA  1 
ATOM   3905 C  C   . ARG A 1 468 ? 16.677  79.940 49.697 1.00 28.04  ? 468  ARG A C   1 
ATOM   3906 O  O   . ARG A 1 468 ? 16.794  79.250 48.684 1.00 28.49  ? 468  ARG A O   1 
ATOM   3907 C  CB  . ARG A 1 468 ? 18.660  81.265 50.495 1.00 32.06  ? 468  ARG A CB  1 
ATOM   3908 C  CG  . ARG A 1 468 ? 19.718  80.450 49.773 1.00 34.99  ? 468  ARG A CG  1 
ATOM   3909 C  CD  . ARG A 1 468 ? 21.109  80.902 50.197 1.00 37.86  ? 468  ARG A CD  1 
ATOM   3910 N  NE  . ARG A 1 468 ? 21.324  80.751 51.633 1.00 39.18  ? 468  ARG A NE  1 
ATOM   3911 C  CZ  . ARG A 1 468 ? 21.736  79.628 52.213 1.00 41.14  ? 468  ARG A CZ  1 
ATOM   3912 N  NH1 . ARG A 1 468 ? 21.901  79.584 53.528 1.00 42.73  ? 468  ARG A NH1 1 
ATOM   3913 N  NH2 . ARG A 1 468 ? 22.002  78.554 51.480 1.00 40.66  ? 468  ARG A NH2 1 
ATOM   3914 N  N   . ILE A 1 469 ? 15.997  79.539 50.767 1.00 26.15  ? 469  ILE A N   1 
ATOM   3915 C  CA  . ILE A 1 469 ? 15.338  78.237 50.805 1.00 25.65  ? 469  ILE A CA  1 
ATOM   3916 C  C   . ILE A 1 469 ? 14.153  78.214 49.845 1.00 24.95  ? 469  ILE A C   1 
ATOM   3917 O  O   . ILE A 1 469 ? 13.996  77.270 49.067 1.00 24.88  ? 469  ILE A O   1 
ATOM   3918 C  CB  . ILE A 1 469 ? 14.870  77.887 52.247 1.00 24.73  ? 469  ILE A CB  1 
ATOM   3919 C  CG1 . ILE A 1 469 ? 16.094  77.560 53.108 1.00 23.52  ? 469  ILE A CG1 1 
ATOM   3920 C  CG2 . ILE A 1 469 ? 13.902  76.701 52.228 1.00 23.10  ? 469  ILE A CG2 1 
ATOM   3921 C  CD1 . ILE A 1 469 ? 15.777  77.266 54.564 1.00 24.33  ? 469  ILE A CD1 1 
ATOM   3922 N  N   . MET A 1 470 ? 13.320  79.248 49.890 1.00 25.56  ? 470  MET A N   1 
ATOM   3923 C  CA  . MET A 1 470 ? 12.174  79.306 48.990 1.00 26.99  ? 470  MET A CA  1 
ATOM   3924 C  C   . MET A 1 470 ? 12.647  79.255 47.540 1.00 26.93  ? 470  MET A C   1 
ATOM   3925 O  O   . MET A 1 470 ? 12.032  78.592 46.699 1.00 26.36  ? 470  MET A O   1 
ATOM   3926 C  CB  . MET A 1 470 ? 11.358  80.586 49.206 1.00 26.96  ? 470  MET A CB  1 
ATOM   3927 C  CG  . MET A 1 470 ? 10.551  80.617 50.491 1.00 27.62  ? 470  MET A CG  1 
ATOM   3928 S  SD  . MET A 1 470 ? 9.316   81.929 50.470 1.00 32.46  ? 470  MET A SD  1 
ATOM   3929 C  CE  . MET A 1 470 ? 10.353  83.356 50.799 1.00 27.23  ? 470  MET A CE  1 
ATOM   3930 N  N   . HIS A 1 471 ? 13.745  79.948 47.247 1.00 26.88  ? 471  HIS A N   1 
ATOM   3931 C  CA  . HIS A 1 471 ? 14.260  79.963 45.885 1.00 26.53  ? 471  HIS A CA  1 
ATOM   3932 C  C   . HIS A 1 471 ? 14.847  78.606 45.494 1.00 25.78  ? 471  HIS A C   1 
ATOM   3933 O  O   . HIS A 1 471 ? 14.741  78.199 44.336 1.00 24.65  ? 471  HIS A O   1 
ATOM   3934 C  CB  . HIS A 1 471 ? 15.302  81.072 45.703 1.00 27.72  ? 471  HIS A CB  1 
ATOM   3935 C  CG  . HIS A 1 471 ? 15.600  81.373 44.266 1.00 29.84  ? 471  HIS A CG  1 
ATOM   3936 N  ND1 . HIS A 1 471 ? 14.618  81.723 43.364 1.00 31.50  ? 471  HIS A ND1 1 
ATOM   3937 C  CD2 . HIS A 1 471 ? 16.758  81.334 43.565 1.00 30.74  ? 471  HIS A CD2 1 
ATOM   3938 C  CE1 . HIS A 1 471 ? 15.157  81.885 42.169 1.00 31.43  ? 471  HIS A CE1 1 
ATOM   3939 N  NE2 . HIS A 1 471 ? 16.454  81.654 42.263 1.00 30.64  ? 471  HIS A NE2 1 
ATOM   3940 N  N   . TYR A 1 472 ? 15.464  77.907 46.448 1.00 25.00  ? 472  TYR A N   1 
ATOM   3941 C  CA  . TYR A 1 472 ? 16.015  76.578 46.165 1.00 24.46  ? 472  TYR A CA  1 
ATOM   3942 C  C   . TYR A 1 472 ? 14.854  75.649 45.794 1.00 24.57  ? 472  TYR A C   1 
ATOM   3943 O  O   . TYR A 1 472 ? 14.901  74.935 44.790 1.00 23.05  ? 472  TYR A O   1 
ATOM   3944 C  CB  . TYR A 1 472 ? 16.696  75.961 47.397 1.00 26.19  ? 472  TYR A CB  1 
ATOM   3945 C  CG  . TYR A 1 472 ? 18.090  76.444 47.738 1.00 27.91  ? 472  TYR A CG  1 
ATOM   3946 C  CD1 . TYR A 1 472 ? 19.018  76.759 46.743 1.00 30.56  ? 472  TYR A CD1 1 
ATOM   3947 C  CD2 . TYR A 1 472 ? 18.505  76.510 49.069 1.00 28.26  ? 472  TYR A CD2 1 
ATOM   3948 C  CE1 . TYR A 1 472 ? 20.330  77.126 47.071 1.00 29.94  ? 472  TYR A CE1 1 
ATOM   3949 C  CE2 . TYR A 1 472 ? 19.804  76.872 49.405 1.00 29.03  ? 472  TYR A CE2 1 
ATOM   3950 C  CZ  . TYR A 1 472 ? 20.712  77.179 48.406 1.00 31.54  ? 472  TYR A CZ  1 
ATOM   3951 O  OH  . TYR A 1 472 ? 21.995  77.538 48.753 1.00 32.55  ? 472  TYR A OH  1 
ATOM   3952 N  N   . TRP A 1 473 ? 13.826  75.656 46.642 1.00 23.25  ? 473  TRP A N   1 
ATOM   3953 C  CA  . TRP A 1 473 ? 12.644  74.816 46.458 1.00 23.67  ? 473  TRP A CA  1 
ATOM   3954 C  C   . TRP A 1 473 ? 11.928  75.094 45.134 1.00 25.30  ? 473  TRP A C   1 
ATOM   3955 O  O   . TRP A 1 473 ? 11.639  74.173 44.371 1.00 24.23  ? 473  TRP A O   1 
ATOM   3956 C  CB  . TRP A 1 473 ? 11.657  75.031 47.611 1.00 22.42  ? 473  TRP A CB  1 
ATOM   3957 C  CG  . TRP A 1 473 ? 11.748  74.063 48.784 1.00 23.01  ? 473  TRP A CG  1 
ATOM   3958 C  CD1 . TRP A 1 473 ? 10.700  73.410 49.376 1.00 21.73  ? 473  TRP A CD1 1 
ATOM   3959 C  CD2 . TRP A 1 473 ? 12.913  73.724 49.558 1.00 22.73  ? 473  TRP A CD2 1 
ATOM   3960 N  NE1 . TRP A 1 473 ? 11.136  72.696 50.468 1.00 22.29  ? 473  TRP A NE1 1 
ATOM   3961 C  CE2 . TRP A 1 473 ? 12.487  72.869 50.604 1.00 22.68  ? 473  TRP A CE2 1 
ATOM   3962 C  CE3 . TRP A 1 473 ? 14.271  74.060 49.474 1.00 23.67  ? 473  TRP A CE3 1 
ATOM   3963 C  CZ2 . TRP A 1 473 ? 13.372  72.348 51.559 1.00 22.13  ? 473  TRP A CZ2 1 
ATOM   3964 C  CZ3 . TRP A 1 473 ? 15.152  73.541 50.427 1.00 23.05  ? 473  TRP A CZ3 1 
ATOM   3965 C  CH2 . TRP A 1 473 ? 14.695  72.695 51.455 1.00 22.14  ? 473  TRP A CH2 1 
ATOM   3966 N  N   . ALA A 1 474 ? 11.637  76.366 44.874 1.00 25.09  ? 474  ALA A N   1 
ATOM   3967 C  CA  . ALA A 1 474 ? 10.943  76.765 43.654 1.00 25.40  ? 474  ALA A CA  1 
ATOM   3968 C  C   . ALA A 1 474 ? 11.758  76.501 42.391 1.00 25.12  ? 474  ALA A C   1 
ATOM   3969 O  O   . ALA A 1 474 ? 11.210  76.083 41.374 1.00 26.57  ? 474  ALA A O   1 
ATOM   3970 C  CB  . ALA A 1 474 ? 10.562  78.241 43.730 1.00 24.62  ? 474  ALA A CB  1 
ATOM   3971 N  N   . THR A 1 475 ? 13.062  76.748 42.447 1.00 25.01  ? 475  THR A N   1 
ATOM   3972 C  CA  . THR A 1 475 ? 13.905  76.518 41.279 1.00 25.63  ? 475  THR A CA  1 
ATOM   3973 C  C   . THR A 1 475 ? 13.990  75.022 41.002 1.00 25.63  ? 475  THR A C   1 
ATOM   3974 O  O   . THR A 1 475 ? 14.004  74.593 39.843 1.00 23.62  ? 475  THR A O   1 
ATOM   3975 C  CB  . THR A 1 475 ? 15.322  77.093 41.481 1.00 26.92  ? 475  THR A CB  1 
ATOM   3976 O  OG1 . THR A 1 475 ? 15.231  78.507 41.701 1.00 24.87  ? 475  THR A OG1 1 
ATOM   3977 C  CG2 . THR A 1 475 ? 16.182  76.836 40.252 1.00 25.57  ? 475  THR A CG2 1 
ATOM   3978 N  N   . PHE A 1 476 ? 14.045  74.226 42.067 1.00 24.46  ? 476  PHE A N   1 
ATOM   3979 C  CA  . PHE A 1 476 ? 14.089  72.779 41.906 1.00 23.27  ? 476  PHE A CA  1 
ATOM   3980 C  C   . PHE A 1 476 ? 12.781  72.324 41.262 1.00 22.43  ? 476  PHE A C   1 
ATOM   3981 O  O   . PHE A 1 476 ? 12.780  71.521 40.331 1.00 23.63  ? 476  PHE A O   1 
ATOM   3982 C  CB  . PHE A 1 476 ? 14.238  72.072 43.258 1.00 24.10  ? 476  PHE A CB  1 
ATOM   3983 C  CG  . PHE A 1 476 ? 14.056  70.575 43.176 1.00 24.33  ? 476  PHE A CG  1 
ATOM   3984 C  CD1 . PHE A 1 476 ? 15.056  69.766 42.647 1.00 24.15  ? 476  PHE A CD1 1 
ATOM   3985 C  CD2 . PHE A 1 476 ? 12.863  69.984 43.583 1.00 24.62  ? 476  PHE A CD2 1 
ATOM   3986 C  CE1 . PHE A 1 476 ? 14.872  68.390 42.524 1.00 24.06  ? 476  PHE A CE1 1 
ATOM   3987 C  CE2 . PHE A 1 476 ? 12.667  68.608 43.464 1.00 25.02  ? 476  PHE A CE2 1 
ATOM   3988 C  CZ  . PHE A 1 476 ? 13.673  67.809 42.933 1.00 23.06  ? 476  PHE A CZ  1 
ATOM   3989 N  N   . ALA A 1 477 ? 11.664  72.839 41.764 1.00 22.33  ? 477  ALA A N   1 
ATOM   3990 C  CA  . ALA A 1 477 ? 10.361  72.459 41.227 1.00 24.39  ? 477  ALA A CA  1 
ATOM   3991 C  C   . ALA A 1 477 ? 10.277  72.803 39.746 1.00 25.38  ? 477  ALA A C   1 
ATOM   3992 O  O   . ALA A 1 477 ? 9.758   72.033 38.935 1.00 24.80  ? 477  ALA A O   1 
ATOM   3993 C  CB  . ALA A 1 477 ? 9.252   73.173 41.986 1.00 23.17  ? 477  ALA A CB  1 
ATOM   3994 N  N   . LYS A 1 478 ? 10.807  73.966 39.397 1.00 25.74  ? 478  LYS A N   1 
ATOM   3995 C  CA  . LYS A 1 478 ? 10.765  74.431 38.023 1.00 28.31  ? 478  LYS A CA  1 
ATOM   3996 C  C   . LYS A 1 478 ? 11.704  73.705 37.066 1.00 27.79  ? 478  LYS A C   1 
ATOM   3997 O  O   . LYS A 1 478 ? 11.328  73.423 35.928 1.00 26.36  ? 478  LYS A O   1 
ATOM   3998 C  CB  . LYS A 1 478 ? 11.065  75.931 37.989 1.00 30.65  ? 478  LYS A CB  1 
ATOM   3999 C  CG  . LYS A 1 478 ? 11.152  76.530 36.591 1.00 38.43  ? 478  LYS A CG  1 
ATOM   4000 C  CD  . LYS A 1 478 ? 11.294  78.047 36.666 1.00 42.51  ? 478  LYS A CD  1 
ATOM   4001 C  CE  . LYS A 1 478 ? 11.513  78.665 35.293 1.00 45.37  ? 478  LYS A CE  1 
ATOM   4002 N  NZ  . LYS A 1 478 ? 12.808  78.236 34.696 1.00 48.21  ? 478  LYS A NZ  1 
ATOM   4003 N  N   . THR A 1 479 ? 12.903  73.372 37.537 1.00 25.41  ? 479  THR A N   1 
ATOM   4004 C  CA  . THR A 1 479 ? 13.904  72.755 36.675 1.00 26.91  ? 479  THR A CA  1 
ATOM   4005 C  C   . THR A 1 479 ? 14.481  71.400 37.076 1.00 28.51  ? 479  THR A C   1 
ATOM   4006 O  O   . THR A 1 479 ? 15.114  70.739 36.252 1.00 28.71  ? 479  THR A O   1 
ATOM   4007 C  CB  . THR A 1 479 ? 15.098  73.703 36.513 1.00 28.19  ? 479  THR A CB  1 
ATOM   4008 O  OG1 . THR A 1 479 ? 15.815  73.765 37.754 1.00 26.93  ? 479  THR A OG1 1 
ATOM   4009 C  CG2 . THR A 1 479 ? 14.620  75.112 36.146 1.00 26.41  ? 479  THR A CG2 1 
ATOM   4010 N  N   . GLY A 1 480 ? 14.296  70.997 38.330 1.00 27.08  ? 480  GLY A N   1 
ATOM   4011 C  CA  . GLY A 1 480 ? 14.848  69.728 38.778 1.00 25.78  ? 480  GLY A CA  1 
ATOM   4012 C  C   . GLY A 1 480 ? 16.234  69.927 39.368 1.00 26.01  ? 480  GLY A C   1 
ATOM   4013 O  O   . GLY A 1 480 ? 16.949  68.965 39.650 1.00 26.01  ? 480  GLY A O   1 
ATOM   4014 N  N   . ASN A 1 481 ? 16.605  71.191 39.558 1.00 24.87  ? 481  ASN A N   1 
ATOM   4015 C  CA  . ASN A 1 481 ? 17.905  71.578 40.110 1.00 25.45  ? 481  ASN A CA  1 
ATOM   4016 C  C   . ASN A 1 481 ? 17.646  72.848 40.923 1.00 25.73  ? 481  ASN A C   1 
ATOM   4017 O  O   . ASN A 1 481 ? 17.141  73.834 40.392 1.00 26.95  ? 481  ASN A O   1 
ATOM   4018 C  CB  . ASN A 1 481 ? 18.876  71.850 38.949 1.00 26.58  ? 481  ASN A CB  1 
ATOM   4019 C  CG  . ASN A 1 481 ? 20.278  72.228 39.408 1.00 28.62  ? 481  ASN A CG  1 
ATOM   4020 O  OD1 . ASN A 1 481 ? 21.213  72.239 38.603 1.00 31.28  ? 481  ASN A OD1 1 
ATOM   4021 N  ND2 . ASN A 1 481 ? 20.431  72.551 40.684 1.00 27.83  ? 481  ASN A ND2 1 
ATOM   4022 N  N   . PRO A 1 482 ? 17.982  72.840 42.227 1.00 25.67  ? 482  PRO A N   1 
ATOM   4023 C  CA  . PRO A 1 482 ? 17.753  74.021 43.065 1.00 26.61  ? 482  PRO A CA  1 
ATOM   4024 C  C   . PRO A 1 482 ? 18.676  75.196 42.751 1.00 28.88  ? 482  PRO A C   1 
ATOM   4025 O  O   . PRO A 1 482 ? 18.435  76.316 43.198 1.00 28.65  ? 482  PRO A O   1 
ATOM   4026 C  CB  . PRO A 1 482 ? 17.963  73.484 44.474 1.00 26.40  ? 482  PRO A CB  1 
ATOM   4027 C  CG  . PRO A 1 482 ? 19.056  72.488 44.273 1.00 26.00  ? 482  PRO A CG  1 
ATOM   4028 C  CD  . PRO A 1 482 ? 18.638  71.768 43.000 1.00 25.24  ? 482  PRO A CD  1 
ATOM   4029 N  N   . ASN A 1 483 ? 19.728  74.933 41.981 1.00 30.55  ? 483  ASN A N   1 
ATOM   4030 C  CA  . ASN A 1 483 ? 20.694  75.967 41.614 1.00 34.37  ? 483  ASN A CA  1 
ATOM   4031 C  C   . ASN A 1 483 ? 20.300  76.670 40.326 1.00 37.47  ? 483  ASN A C   1 
ATOM   4032 O  O   . ASN A 1 483 ? 19.827  76.034 39.388 1.00 35.86  ? 483  ASN A O   1 
ATOM   4033 C  CB  . ASN A 1 483 ? 22.078  75.350 41.415 1.00 31.57  ? 483  ASN A CB  1 
ATOM   4034 C  CG  . ASN A 1 483 ? 22.549  74.579 42.620 1.00 30.48  ? 483  ASN A CG  1 
ATOM   4035 O  OD1 . ASN A 1 483 ? 22.793  75.151 43.682 1.00 31.30  ? 483  ASN A OD1 1 
ATOM   4036 N  ND2 . ASN A 1 483 ? 22.681  73.267 42.463 1.00 26.86  ? 483  ASN A ND2 1 
ATOM   4037 N  N   . GLU A 1 484 ? 20.505  77.982 40.282 1.00 43.02  ? 484  GLU A N   1 
ATOM   4038 C  CA  . GLU A 1 484 ? 20.196  78.747 39.084 1.00 49.50  ? 484  GLU A CA  1 
ATOM   4039 C  C   . GLU A 1 484 ? 21.339  78.601 38.095 1.00 53.15  ? 484  GLU A C   1 
ATOM   4040 O  O   . GLU A 1 484 ? 22.511  78.610 38.478 1.00 52.40  ? 484  GLU A O   1 
ATOM   4041 C  CB  . GLU A 1 484 ? 20.018  80.231 39.398 1.00 50.87  ? 484  GLU A CB  1 
ATOM   4042 C  CG  . GLU A 1 484 ? 18.745  80.581 40.118 1.00 55.26  ? 484  GLU A CG  1 
ATOM   4043 C  CD  . GLU A 1 484 ? 18.320  82.004 39.842 1.00 57.54  ? 484  GLU A CD  1 
ATOM   4044 O  OE1 . GLU A 1 484 ? 17.993  82.301 38.673 1.00 60.11  ? 484  GLU A OE1 1 
ATOM   4045 O  OE2 . GLU A 1 484 ? 18.320  82.824 40.783 1.00 60.56  ? 484  GLU A OE2 1 
ATOM   4046 N  N   . PRO A 1 485 ? 21.011  78.458 36.804 1.00 57.70  ? 485  PRO A N   1 
ATOM   4047 C  CA  . PRO A 1 485 ? 22.034  78.314 35.766 1.00 60.13  ? 485  PRO A CA  1 
ATOM   4048 C  C   . PRO A 1 485 ? 22.910  79.561 35.693 1.00 62.16  ? 485  PRO A C   1 
ATOM   4049 O  O   . PRO A 1 485 ? 22.404  80.686 35.695 1.00 62.36  ? 485  PRO A O   1 
ATOM   4050 C  CB  . PRO A 1 485 ? 21.209  78.122 34.494 1.00 60.30  ? 485  PRO A CB  1 
ATOM   4051 C  CG  . PRO A 1 485 ? 19.957  77.468 34.995 1.00 60.46  ? 485  PRO A CG  1 
ATOM   4052 C  CD  . PRO A 1 485 ? 19.665  78.273 36.237 1.00 59.26  ? 485  PRO A CD  1 
ATOM   4053 N  N   . HIS A 1 486 ? 24.221  79.355 35.645 1.00 63.91  ? 486  HIS A N   1 
ATOM   4054 C  CA  . HIS A 1 486 ? 25.174  80.456 35.548 1.00 66.02  ? 486  HIS A CA  1 
ATOM   4055 C  C   . HIS A 1 486 ? 25.034  81.463 36.687 1.00 65.61  ? 486  HIS A C   1 
ATOM   4056 O  O   . HIS A 1 486 ? 25.141  82.673 36.477 1.00 66.09  ? 486  HIS A O   1 
ATOM   4057 C  CB  . HIS A 1 486 ? 24.996  81.165 34.204 1.00 68.35  ? 486  HIS A CB  1 
ATOM   4058 C  CG  . HIS A 1 486 ? 24.789  80.227 33.057 1.00 71.11  ? 486  HIS A CG  1 
ATOM   4059 N  ND1 . HIS A 1 486 ? 25.696  79.243 32.726 1.00 72.18  ? 486  HIS A ND1 1 
ATOM   4060 C  CD2 . HIS A 1 486 ? 23.763  80.102 32.181 1.00 72.37  ? 486  HIS A CD2 1 
ATOM   4061 C  CE1 . HIS A 1 486 ? 25.238  78.553 31.697 1.00 73.36  ? 486  HIS A CE1 1 
ATOM   4062 N  NE2 . HIS A 1 486 ? 24.067  79.053 31.347 1.00 73.70  ? 486  HIS A NE2 1 
ATOM   4063 N  N   . SER A 1 487 ? 24.794  80.961 37.893 1.00 64.69  ? 487  SER A N   1 
ATOM   4064 C  CA  . SER A 1 487 ? 24.656  81.820 39.062 1.00 63.18  ? 487  SER A CA  1 
ATOM   4065 C  C   . SER A 1 487 ? 26.027  82.042 39.687 1.00 62.48  ? 487  SER A C   1 
ATOM   4066 O  O   . SER A 1 487 ? 26.963  81.285 39.432 1.00 61.34  ? 487  SER A O   1 
ATOM   4067 C  CB  . SER A 1 487 ? 23.724  81.176 40.088 1.00 63.54  ? 487  SER A CB  1 
ATOM   4068 O  OG  . SER A 1 487 ? 23.654  81.954 41.270 1.00 63.50  ? 487  SER A OG  1 
ATOM   4069 N  N   . GLN A 1 488 ? 26.141  83.081 40.507 1.00 62.16  ? 488  GLN A N   1 
ATOM   4070 C  CA  . GLN A 1 488 ? 27.402  83.391 41.169 1.00 62.44  ? 488  GLN A CA  1 
ATOM   4071 C  C   . GLN A 1 488 ? 27.408  82.858 42.598 1.00 61.13  ? 488  GLN A C   1 
ATOM   4072 O  O   . GLN A 1 488 ? 28.438  82.875 43.274 1.00 61.06  ? 488  GLN A O   1 
ATOM   4073 C  CB  . GLN A 1 488 ? 27.634  84.905 41.184 1.00 64.45  ? 488  GLN A CB  1 
ATOM   4074 C  CG  . GLN A 1 488 ? 27.674  85.547 39.802 1.00 67.30  ? 488  GLN A CG  1 
ATOM   4075 C  CD  . GLN A 1 488 ? 28.724  84.926 38.895 1.00 68.31  ? 488  GLN A CD  1 
ATOM   4076 O  OE1 . GLN A 1 488 ? 29.911  84.902 39.224 1.00 68.99  ? 488  GLN A OE1 1 
ATOM   4077 N  NE2 . GLN A 1 488 ? 28.290  84.423 37.743 1.00 68.90  ? 488  GLN A NE2 1 
ATOM   4078 N  N   . GLU A 1 489 ? 26.254  82.378 43.050 1.00 59.17  ? 489  GLU A N   1 
ATOM   4079 C  CA  . GLU A 1 489 ? 26.118  81.850 44.403 1.00 57.19  ? 489  GLU A CA  1 
ATOM   4080 C  C   . GLU A 1 489 ? 26.718  80.452 44.541 1.00 53.68  ? 489  GLU A C   1 
ATOM   4081 O  O   . GLU A 1 489 ? 26.940  79.759 43.547 1.00 51.67  ? 489  GLU A O   1 
ATOM   4082 C  CB  . GLU A 1 489 ? 24.641  81.811 44.801 1.00 61.13  ? 489  GLU A CB  1 
ATOM   4083 C  CG  . GLU A 1 489 ? 23.892  83.114 44.561 1.00 65.75  ? 489  GLU A CG  1 
ATOM   4084 C  CD  . GLU A 1 489 ? 24.563  84.306 45.219 1.00 69.07  ? 489  GLU A CD  1 
ATOM   4085 O  OE1 . GLU A 1 489 ? 24.798  84.258 46.445 1.00 71.87  ? 489  GLU A OE1 1 
ATOM   4086 O  OE2 . GLU A 1 489 ? 24.854  85.293 44.508 1.00 71.32  ? 489  GLU A OE2 1 
ATOM   4087 N  N   . SER A 1 490 ? 26.981  80.049 45.781 1.00 50.39  ? 490  SER A N   1 
ATOM   4088 C  CA  . SER A 1 490 ? 27.542  78.730 46.062 1.00 47.02  ? 490  SER A CA  1 
ATOM   4089 C  C   . SER A 1 490 ? 26.597  77.672 45.503 1.00 43.95  ? 490  SER A C   1 
ATOM   4090 O  O   . SER A 1 490 ? 25.376  77.825 45.575 1.00 42.81  ? 490  SER A O   1 
ATOM   4091 C  CB  . SER A 1 490 ? 27.702  78.535 47.571 1.00 48.40  ? 490  SER A CB  1 
ATOM   4092 O  OG  . SER A 1 490 ? 28.478  79.573 48.142 1.00 49.24  ? 490  SER A OG  1 
ATOM   4093 N  N   . LYS A 1 491 ? 27.159  76.603 44.949 1.00 41.07  ? 491  LYS A N   1 
ATOM   4094 C  CA  . LYS A 1 491 ? 26.352  75.542 44.361 1.00 39.34  ? 491  LYS A CA  1 
ATOM   4095 C  C   . LYS A 1 491 ? 26.053  74.361 45.282 1.00 36.63  ? 491  LYS A C   1 
ATOM   4096 O  O   . LYS A 1 491 ? 26.952  73.790 45.898 1.00 35.71  ? 491  LYS A O   1 
ATOM   4097 C  CB  . LYS A 1 491 ? 27.020  75.015 43.087 1.00 40.50  ? 491  LYS A CB  1 
ATOM   4098 C  CG  . LYS A 1 491 ? 27.116  76.032 41.955 1.00 44.99  ? 491  LYS A CG  1 
ATOM   4099 C  CD  . LYS A 1 491 ? 25.740  76.504 41.506 1.00 47.14  ? 491  LYS A CD  1 
ATOM   4100 C  CE  . LYS A 1 491 ? 25.831  77.413 40.285 1.00 50.30  ? 491  LYS A CE  1 
ATOM   4101 N  NZ  . LYS A 1 491 ? 26.655  78.632 40.542 1.00 51.70  ? 491  LYS A NZ  1 
ATOM   4102 N  N   . TRP A 1 492 ? 24.774  74.012 45.364 1.00 33.17  ? 492  TRP A N   1 
ATOM   4103 C  CA  . TRP A 1 492 ? 24.314  72.879 46.158 1.00 29.59  ? 492  TRP A CA  1 
ATOM   4104 C  C   . TRP A 1 492 ? 24.636  71.692 45.252 1.00 29.15  ? 492  TRP A C   1 
ATOM   4105 O  O   . TRP A 1 492 ? 24.009  71.505 44.211 1.00 28.87  ? 492  TRP A O   1 
ATOM   4106 C  CB  . TRP A 1 492 ? 22.803  72.995 46.373 1.00 28.43  ? 492  TRP A CB  1 
ATOM   4107 C  CG  . TRP A 1 492 ? 22.169  71.911 47.202 1.00 27.21  ? 492  TRP A CG  1 
ATOM   4108 C  CD1 . TRP A 1 492 ? 22.679  70.673 47.481 1.00 25.99  ? 492  TRP A CD1 1 
ATOM   4109 C  CD2 . TRP A 1 492 ? 20.876  71.961 47.815 1.00 25.58  ? 492  TRP A CD2 1 
ATOM   4110 N  NE1 . TRP A 1 492 ? 21.779  69.948 48.231 1.00 25.37  ? 492  TRP A NE1 1 
ATOM   4111 C  CE2 . TRP A 1 492 ? 20.664  70.714 48.450 1.00 26.01  ? 492  TRP A CE2 1 
ATOM   4112 C  CE3 . TRP A 1 492 ? 19.873  72.937 47.888 1.00 25.32  ? 492  TRP A CE3 1 
ATOM   4113 C  CZ2 . TRP A 1 492 ? 19.488  70.419 49.152 1.00 24.50  ? 492  TRP A CZ2 1 
ATOM   4114 C  CZ3 . TRP A 1 492 ? 18.698  72.643 48.587 1.00 26.62  ? 492  TRP A CZ3 1 
ATOM   4115 C  CH2 . TRP A 1 492 ? 18.520  71.392 49.209 1.00 25.06  ? 492  TRP A CH2 1 
ATOM   4116 N  N   . PRO A 1 493 ? 25.626  70.875 45.631 1.00 28.49  ? 493  PRO A N   1 
ATOM   4117 C  CA  . PRO A 1 493 ? 25.968  69.737 44.779 1.00 27.77  ? 493  PRO A CA  1 
ATOM   4118 C  C   . PRO A 1 493 ? 24.981  68.584 44.755 1.00 28.49  ? 493  PRO A C   1 
ATOM   4119 O  O   . PRO A 1 493 ? 24.218  68.368 45.703 1.00 27.35  ? 493  PRO A O   1 
ATOM   4120 C  CB  . PRO A 1 493 ? 27.325  69.303 45.321 1.00 28.48  ? 493  PRO A CB  1 
ATOM   4121 C  CG  . PRO A 1 493 ? 27.173  69.567 46.791 1.00 29.22  ? 493  PRO A CG  1 
ATOM   4122 C  CD  . PRO A 1 493 ? 26.507  70.935 46.812 1.00 28.53  ? 493  PRO A CD  1 
ATOM   4123 N  N   A LEU A 1 494 ? 25.006  67.843 43.655 0.50 27.21  ? 494  LEU A N   1 
ATOM   4124 N  N   B LEU A 1 494 ? 24.991  67.849 43.650 0.50 26.54  ? 494  LEU A N   1 
ATOM   4125 C  CA  A LEU A 1 494 ? 24.143  66.688 43.475 0.50 27.64  ? 494  LEU A CA  1 
ATOM   4126 C  CA  B LEU A 1 494 ? 24.129  66.692 43.502 0.50 26.58  ? 494  LEU A CA  1 
ATOM   4127 C  C   A LEU A 1 494 ? 24.632  65.593 44.420 0.50 27.53  ? 494  LEU A C   1 
ATOM   4128 C  C   B LEU A 1 494 ? 24.628  65.628 44.464 0.50 26.73  ? 494  LEU A C   1 
ATOM   4129 O  O   A LEU A 1 494 ? 25.838  65.418 44.601 0.50 27.26  ? 494  LEU A O   1 
ATOM   4130 O  O   B LEU A 1 494 ? 25.832  65.510 44.702 0.50 26.18  ? 494  LEU A O   1 
ATOM   4131 C  CB  A LEU A 1 494 ? 24.240  66.205 42.027 0.50 28.64  ? 494  LEU A CB  1 
ATOM   4132 C  CB  B LEU A 1 494 ? 24.204  66.142 42.074 0.50 26.35  ? 494  LEU A CB  1 
ATOM   4133 C  CG  A LEU A 1 494 ? 23.313  65.097 41.530 0.50 27.28  ? 494  LEU A CG  1 
ATOM   4134 C  CG  B LEU A 1 494 ? 23.204  66.633 41.026 0.50 23.89  ? 494  LEU A CG  1 
ATOM   4135 C  CD1 A LEU A 1 494 ? 21.875  65.592 41.502 0.50 26.53  ? 494  LEU A CD1 1 
ATOM   4136 C  CD1 B LEU A 1 494 ? 23.705  66.280 39.635 0.50 23.87  ? 494  LEU A CD1 1 
ATOM   4137 C  CD2 A LEU A 1 494 ? 23.749  64.678 40.135 0.50 28.81  ? 494  LEU A CD2 1 
ATOM   4138 C  CD2 B LEU A 1 494 ? 21.845  65.999 41.283 0.50 22.00  ? 494  LEU A CD2 1 
ATOM   4139 N  N   . PHE A 1 495 ? 23.701  64.870 45.035 1.00 26.10  ? 495  PHE A N   1 
ATOM   4140 C  CA  . PHE A 1 495 ? 24.063  63.789 45.935 1.00 25.36  ? 495  PHE A CA  1 
ATOM   4141 C  C   . PHE A 1 495 ? 24.254  62.598 44.997 1.00 25.85  ? 495  PHE A C   1 
ATOM   4142 O  O   . PHE A 1 495 ? 23.364  62.284 44.207 1.00 25.15  ? 495  PHE A O   1 
ATOM   4143 C  CB  . PHE A 1 495 ? 22.930  63.509 46.937 1.00 23.29  ? 495  PHE A CB  1 
ATOM   4144 C  CG  . PHE A 1 495 ? 23.089  62.212 47.701 1.00 25.39  ? 495  PHE A CG  1 
ATOM   4145 C  CD1 . PHE A 1 495 ? 22.857  60.986 47.080 1.00 25.43  ? 495  PHE A CD1 1 
ATOM   4146 C  CD2 . PHE A 1 495 ? 23.476  62.218 49.040 1.00 25.26  ? 495  PHE A CD2 1 
ATOM   4147 C  CE1 . PHE A 1 495 ? 23.008  59.785 47.777 1.00 25.74  ? 495  PHE A CE1 1 
ATOM   4148 C  CE2 . PHE A 1 495 ? 23.629  61.025 49.748 1.00 24.47  ? 495  PHE A CE2 1 
ATOM   4149 C  CZ  . PHE A 1 495 ? 23.396  59.806 49.117 1.00 27.62  ? 495  PHE A CZ  1 
ATOM   4150 N  N   . THR A 1 496 ? 25.414  61.952 45.066 1.00 25.89  ? 496  THR A N   1 
ATOM   4151 C  CA  . THR A 1 496 ? 25.686  60.796 44.219 1.00 28.16  ? 496  THR A CA  1 
ATOM   4152 C  C   . THR A 1 496 ? 25.979  59.568 45.073 1.00 30.08  ? 496  THR A C   1 
ATOM   4153 O  O   . THR A 1 496 ? 26.408  59.683 46.219 1.00 28.86  ? 496  THR A O   1 
ATOM   4154 C  CB  . THR A 1 496 ? 26.899  61.034 43.279 1.00 29.72  ? 496  THR A CB  1 
ATOM   4155 O  OG1 . THR A 1 496 ? 28.081  61.262 44.060 1.00 29.37  ? 496  THR A OG1 1 
ATOM   4156 C  CG2 . THR A 1 496 ? 26.647  62.233 42.374 1.00 29.02  ? 496  THR A CG2 1 
ATOM   4157 N  N   . THR A 1 497 ? 25.744  58.393 44.500 1.00 32.42  ? 497  THR A N   1 
ATOM   4158 C  CA  . THR A 1 497 ? 25.972  57.131 45.195 1.00 35.31  ? 497  THR A CA  1 
ATOM   4159 C  C   . THR A 1 497 ? 27.396  57.042 45.730 1.00 35.87  ? 497  THR A C   1 
ATOM   4160 O  O   . THR A 1 497 ? 27.642  56.458 46.787 1.00 36.13  ? 497  THR A O   1 
ATOM   4161 C  CB  . THR A 1 497 ? 25.734  55.933 44.249 1.00 36.08  ? 497  THR A CB  1 
ATOM   4162 O  OG1 . THR A 1 497 ? 24.372  55.933 43.807 1.00 37.81  ? 497  THR A OG1 1 
ATOM   4163 C  CG2 . THR A 1 497 ? 26.037  54.619 44.958 1.00 37.79  ? 497  THR A CG2 1 
ATOM   4164 N  N   . LYS A 1 498 ? 28.328  57.639 44.995 1.00 35.67  ? 498  LYS A N   1 
ATOM   4165 C  CA  . LYS A 1 498 ? 29.734  57.608 45.364 1.00 37.07  ? 498  LYS A CA  1 
ATOM   4166 C  C   . LYS A 1 498 ? 30.206  58.651 46.376 1.00 35.69  ? 498  LYS A C   1 
ATOM   4167 O  O   . LYS A 1 498 ? 30.832  58.303 47.379 1.00 36.57  ? 498  LYS A O   1 
ATOM   4168 C  CB  . LYS A 1 498 ? 30.595  57.721 44.103 1.00 38.85  ? 498  LYS A CB  1 
ATOM   4169 C  CG  . LYS A 1 498 ? 32.087  57.592 44.359 1.00 45.12  ? 498  LYS A CG  1 
ATOM   4170 C  CD  . LYS A 1 498 ? 32.887  57.814 43.082 1.00 48.36  ? 498  LYS A CD  1 
ATOM   4171 C  CE  . LYS A 1 498 ? 34.380  57.660 43.332 1.00 52.32  ? 498  LYS A CE  1 
ATOM   4172 N  NZ  . LYS A 1 498 ? 34.867  58.589 44.392 1.00 54.86  ? 498  LYS A NZ  1 
ATOM   4173 N  N   A GLU A 1 499 ? 29.910  59.922 46.117 0.50 33.41  ? 499  GLU A N   1 
ATOM   4174 N  N   B GLU A 1 499 ? 29.904  59.920 46.114 0.50 33.95  ? 499  GLU A N   1 
ATOM   4175 C  CA  A GLU A 1 499 ? 30.348  60.990 47.010 0.50 32.22  ? 499  GLU A CA  1 
ATOM   4176 C  CA  B GLU A 1 499 ? 30.329  61.005 46.993 0.50 33.17  ? 499  GLU A CA  1 
ATOM   4177 C  C   A GLU A 1 499 ? 29.350  61.352 48.111 0.50 31.03  ? 499  GLU A C   1 
ATOM   4178 C  C   B GLU A 1 499 ? 29.352  61.328 48.118 0.50 31.66  ? 499  GLU A C   1 
ATOM   4179 O  O   A GLU A 1 499 ? 29.738  61.904 49.141 0.50 29.65  ? 499  GLU A O   1 
ATOM   4180 O  O   B GLU A 1 499 ? 29.754  61.828 49.168 0.50 30.38  ? 499  GLU A O   1 
ATOM   4181 C  CB  A GLU A 1 499 ? 30.728  62.230 46.192 0.50 32.90  ? 499  GLU A CB  1 
ATOM   4182 C  CB  B GLU A 1 499 ? 30.594  62.267 46.169 0.50 34.82  ? 499  GLU A CB  1 
ATOM   4183 C  CG  A GLU A 1 499 ? 31.821  61.945 45.162 0.50 35.00  ? 499  GLU A CG  1 
ATOM   4184 C  CG  B GLU A 1 499 ? 31.691  62.096 45.136 0.50 38.49  ? 499  GLU A CG  1 
ATOM   4185 C  CD  A GLU A 1 499 ? 32.537  63.194 44.680 0.50 36.36  ? 499  GLU A CD  1 
ATOM   4186 C  CD  B GLU A 1 499 ? 32.980  61.588 45.747 0.50 40.77  ? 499  GLU A CD  1 
ATOM   4187 O  OE1 A GLU A 1 499 ? 31.884  64.081 44.095 0.50 38.39  ? 499  GLU A OE1 1 
ATOM   4188 O  OE1 B GLU A 1 499 ? 33.520  62.262 46.649 0.50 43.40  ? 499  GLU A OE1 1 
ATOM   4189 O  OE2 A GLU A 1 499 ? 33.765  63.287 44.888 0.50 38.24  ? 499  GLU A OE2 1 
ATOM   4190 O  OE2 B GLU A 1 499 ? 33.452  60.512 45.329 0.50 43.46  ? 499  GLU A OE2 1 
ATOM   4191 N  N   . GLN A 1 500 ? 28.073  61.050 47.889 1.00 29.98  ? 500  GLN A N   1 
ATOM   4192 C  CA  . GLN A 1 500 ? 27.029  61.303 48.886 1.00 28.60  ? 500  GLN A CA  1 
ATOM   4193 C  C   . GLN A 1 500 ? 27.094  62.669 49.572 1.00 27.60  ? 500  GLN A C   1 
ATOM   4194 O  O   . GLN A 1 500 ? 26.983  62.772 50.796 1.00 26.89  ? 500  GLN A O   1 
ATOM   4195 C  CB  . GLN A 1 500 ? 27.080  60.180 49.929 1.00 29.88  ? 500  GLN A CB  1 
ATOM   4196 C  CG  . GLN A 1 500 ? 27.108  58.800 49.270 1.00 31.03  ? 500  GLN A CG  1 
ATOM   4197 C  CD  . GLN A 1 500 ? 27.441  57.661 50.218 1.00 34.42  ? 500  GLN A CD  1 
ATOM   4198 O  OE1 . GLN A 1 500 ? 28.001  56.644 49.800 1.00 37.94  ? 500  GLN A OE1 1 
ATOM   4199 N  NE2 . GLN A 1 500 ? 27.086  57.812 51.487 1.00 31.20  ? 500  GLN A NE2 1 
ATOM   4200 N  N   . LYS A 1 501 ? 27.245  63.722 48.779 1.00 25.03  ? 501  LYS A N   1 
ATOM   4201 C  CA  . LYS A 1 501 ? 27.337  65.068 49.326 1.00 26.35  ? 501  LYS A CA  1 
ATOM   4202 C  C   . LYS A 1 501 ? 25.993  65.679 49.703 1.00 25.86  ? 501  LYS A C   1 
ATOM   4203 O  O   . LYS A 1 501 ? 24.952  65.350 49.124 1.00 25.05  ? 501  LYS A O   1 
ATOM   4204 C  CB  . LYS A 1 501 ? 28.033  65.997 48.327 1.00 27.27  ? 501  LYS A CB  1 
ATOM   4205 C  CG  . LYS A 1 501 ? 29.446  65.586 47.956 1.00 29.25  ? 501  LYS A CG  1 
ATOM   4206 C  CD  . LYS A 1 501 ? 30.018  66.523 46.898 1.00 32.05  ? 501  LYS A CD  1 
ATOM   4207 C  CE  . LYS A 1 501 ? 31.442  66.140 46.524 1.00 34.15  ? 501  LYS A CE  1 
ATOM   4208 N  NZ  . LYS A 1 501 ? 32.003  67.070 45.505 1.00 37.11  ? 501  LYS A NZ  1 
ATOM   4209 N  N   . PHE A 1 502 ? 26.031  66.571 50.685 1.00 24.69  ? 502  PHE A N   1 
ATOM   4210 C  CA  . PHE A 1 502 ? 24.845  67.288 51.132 1.00 25.27  ? 502  PHE A CA  1 
ATOM   4211 C  C   . PHE A 1 502 ? 25.311  68.621 51.683 1.00 26.41  ? 502  PHE A C   1 
ATOM   4212 O  O   . PHE A 1 502 ? 26.509  68.828 51.888 1.00 27.82  ? 502  PHE A O   1 
ATOM   4213 C  CB  . PHE A 1 502 ? 24.075  66.511 52.215 1.00 24.39  ? 502  PHE A CB  1 
ATOM   4214 C  CG  . PHE A 1 502 ? 24.773  66.435 53.552 1.00 22.66  ? 502  PHE A CG  1 
ATOM   4215 C  CD1 . PHE A 1 502 ? 25.696  65.427 53.815 1.00 23.37  ? 502  PHE A CD1 1 
ATOM   4216 C  CD2 . PHE A 1 502 ? 24.458  67.337 54.568 1.00 24.38  ? 502  PHE A CD2 1 
ATOM   4217 C  CE1 . PHE A 1 502 ? 26.293  65.311 55.074 1.00 24.12  ? 502  PHE A CE1 1 
ATOM   4218 C  CE2 . PHE A 1 502 ? 25.047  67.233 55.833 1.00 22.72  ? 502  PHE A CE2 1 
ATOM   4219 C  CZ  . PHE A 1 502 ? 25.966  66.215 56.087 1.00 23.55  ? 502  PHE A CZ  1 
ATOM   4220 N  N   . ILE A 1 503 ? 24.376  69.533 51.910 1.00 25.61  ? 503  ILE A N   1 
ATOM   4221 C  CA  . ILE A 1 503 ? 24.737  70.833 52.449 1.00 26.28  ? 503  ILE A CA  1 
ATOM   4222 C  C   . ILE A 1 503 ? 23.928  71.110 53.700 1.00 27.02  ? 503  ILE A C   1 
ATOM   4223 O  O   . ILE A 1 503 ? 22.868  70.514 53.910 1.00 25.78  ? 503  ILE A O   1 
ATOM   4224 C  CB  . ILE A 1 503 ? 24.437  71.979 51.453 1.00 26.62  ? 503  ILE A CB  1 
ATOM   4225 C  CG1 . ILE A 1 503 ? 22.928  72.063 51.201 1.00 26.60  ? 503  ILE A CG1 1 
ATOM   4226 C  CG2 . ILE A 1 503 ? 25.186  71.754 50.148 1.00 27.94  ? 503  ILE A CG2 1 
ATOM   4227 C  CD1 . ILE A 1 503 ? 22.491  73.360 50.536 1.00 29.22  ? 503  ILE A CD1 1 
ATOM   4228 N  N   . ASP A 1 504 ? 24.437  72.010 54.534 1.00 25.94  ? 504  ASP A N   1 
ATOM   4229 C  CA  . ASP A 1 504 ? 23.717  72.409 55.729 1.00 27.38  ? 504  ASP A CA  1 
ATOM   4230 C  C   . ASP A 1 504 ? 22.845  73.569 55.271 1.00 27.14  ? 504  ASP A C   1 
ATOM   4231 O  O   . ASP A 1 504 ? 23.164  74.237 54.287 1.00 26.67  ? 504  ASP A O   1 
ATOM   4232 C  CB  . ASP A 1 504 ? 24.665  72.927 56.818 1.00 29.68  ? 504  ASP A CB  1 
ATOM   4233 C  CG  . ASP A 1 504 ? 25.620  71.868 57.329 1.00 35.04  ? 504  ASP A CG  1 
ATOM   4234 O  OD1 . ASP A 1 504 ? 25.193  70.706 57.501 1.00 32.83  ? 504  ASP A OD1 1 
ATOM   4235 O  OD2 . ASP A 1 504 ? 26.798  72.209 57.579 1.00 37.90  ? 504  ASP A OD2 1 
ATOM   4236 N  N   . LEU A 1 505 ? 21.741  73.796 55.966 1.00 25.88  ? 505  LEU A N   1 
ATOM   4237 C  CA  . LEU A 1 505 ? 20.873  74.914 55.651 1.00 27.18  ? 505  LEU A CA  1 
ATOM   4238 C  C   . LEU A 1 505 ? 20.787  75.759 56.912 1.00 28.58  ? 505  LEU A C   1 
ATOM   4239 O  O   . LEU A 1 505 ? 20.121  75.384 57.879 1.00 28.31  ? 505  LEU A O   1 
ATOM   4240 C  CB  . LEU A 1 505 ? 19.472  74.446 55.236 1.00 26.62  ? 505  LEU A CB  1 
ATOM   4241 C  CG  . LEU A 1 505 ? 19.280  74.013 53.781 1.00 26.46  ? 505  LEU A CG  1 
ATOM   4242 C  CD1 . LEU A 1 505 ? 17.822  73.627 53.554 1.00 22.99  ? 505  LEU A CD1 1 
ATOM   4243 C  CD2 . LEU A 1 505 ? 19.676  75.155 52.844 1.00 26.35  ? 505  LEU A CD2 1 
ATOM   4244 N  N   . ASN A 1 506 ? 21.500  76.881 56.910 1.00 26.76  ? 506  ASN A N   1 
ATOM   4245 C  CA  . ASN A 1 506 ? 21.502  77.795 58.045 1.00 30.52  ? 506  ASN A CA  1 
ATOM   4246 C  C   . ASN A 1 506 ? 21.950  79.178 57.581 1.00 31.83  ? 506  ASN A C   1 
ATOM   4247 O  O   . ASN A 1 506 ? 22.113  79.406 56.383 1.00 30.87  ? 506  ASN A O   1 
ATOM   4248 C  CB  . ASN A 1 506 ? 22.403  77.257 59.170 1.00 29.64  ? 506  ASN A CB  1 
ATOM   4249 C  CG  . ASN A 1 506 ? 23.813  76.950 58.704 1.00 30.14  ? 506  ASN A CG  1 
ATOM   4250 O  OD1 . ASN A 1 506 ? 24.382  75.913 59.057 1.00 31.73  ? 506  ASN A OD1 1 
ATOM   4251 N  ND2 . ASN A 1 506 ? 24.390  77.853 57.927 1.00 29.33  ? 506  ASN A ND2 1 
ATOM   4252 N  N   . THR A 1 507 ? 22.152  80.098 58.518 1.00 33.57  ? 507  THR A N   1 
ATOM   4253 C  CA  . THR A 1 507 ? 22.538  81.462 58.161 1.00 35.34  ? 507  THR A CA  1 
ATOM   4254 C  C   . THR A 1 507 ? 24.024  81.686 57.888 1.00 38.39  ? 507  THR A C   1 
ATOM   4255 O  O   . THR A 1 507 ? 24.446  82.812 57.627 1.00 40.34  ? 507  THR A O   1 
ATOM   4256 C  CB  . THR A 1 507 ? 22.079  82.457 59.243 1.00 34.46  ? 507  THR A CB  1 
ATOM   4257 O  OG1 . THR A 1 507 ? 22.748  82.170 60.477 1.00 33.94  ? 507  THR A OG1 1 
ATOM   4258 C  CG2 . THR A 1 507 ? 20.576  82.346 59.454 1.00 32.46  ? 507  THR A CG2 1 
ATOM   4259 N  N   . GLU A 1 508 ? 24.814  80.621 57.945 1.00 39.49  ? 508  GLU A N   1 
ATOM   4260 C  CA  . GLU A 1 508 ? 26.248  80.722 57.690 1.00 40.94  ? 508  GLU A CA  1 
ATOM   4261 C  C   . GLU A 1 508 ? 26.512  80.420 56.217 1.00 40.98  ? 508  GLU A C   1 
ATOM   4262 O  O   . GLU A 1 508 ? 25.653  79.876 55.527 1.00 38.89  ? 508  GLU A O   1 
ATOM   4263 C  CB  . GLU A 1 508 ? 27.011  79.714 58.553 1.00 42.16  ? 508  GLU A CB  1 
ATOM   4264 C  CG  . GLU A 1 508 ? 26.770  79.846 60.044 1.00 46.99  ? 508  GLU A CG  1 
ATOM   4265 C  CD  . GLU A 1 508 ? 27.396  78.707 60.828 1.00 51.15  ? 508  GLU A CD  1 
ATOM   4266 O  OE1 . GLU A 1 508 ? 28.634  78.548 60.767 1.00 53.27  ? 508  GLU A OE1 1 
ATOM   4267 O  OE2 . GLU A 1 508 ? 26.649  77.965 61.503 1.00 54.00  ? 508  GLU A OE2 1 
ATOM   4268 N  N   . PRO A 1 509 ? 27.701  80.783 55.709 1.00 42.11  ? 509  PRO A N   1 
ATOM   4269 C  CA  . PRO A 1 509 ? 27.979  80.494 54.299 1.00 42.54  ? 509  PRO A CA  1 
ATOM   4270 C  C   . PRO A 1 509 ? 27.897  78.988 54.052 1.00 42.92  ? 509  PRO A C   1 
ATOM   4271 O  O   . PRO A 1 509 ? 28.268  78.188 54.914 1.00 43.09  ? 509  PRO A O   1 
ATOM   4272 C  CB  . PRO A 1 509 ? 29.387  81.061 54.098 1.00 42.06  ? 509  PRO A CB  1 
ATOM   4273 C  CG  . PRO A 1 509 ? 29.991  80.992 55.472 1.00 43.95  ? 509  PRO A CG  1 
ATOM   4274 C  CD  . PRO A 1 509 ? 28.850  81.441 56.350 1.00 42.83  ? 509  PRO A CD  1 
ATOM   4275 N  N   . MET A 1 510 ? 27.408  78.608 52.877 1.00 42.94  ? 510  MET A N   1 
ATOM   4276 C  CA  . MET A 1 510 ? 27.246  77.201 52.527 1.00 41.56  ? 510  MET A CA  1 
ATOM   4277 C  C   . MET A 1 510 ? 28.466  76.327 52.781 1.00 41.46  ? 510  MET A C   1 
ATOM   4278 O  O   . MET A 1 510 ? 29.598  76.711 52.494 1.00 41.95  ? 510  MET A O   1 
ATOM   4279 C  CB  . MET A 1 510 ? 26.840  77.061 51.056 1.00 42.96  ? 510  MET A CB  1 
ATOM   4280 C  CG  . MET A 1 510 ? 26.552  75.622 50.636 1.00 42.85  ? 510  MET A CG  1 
ATOM   4281 S  SD  . MET A 1 510 ? 26.243  75.422 48.867 1.00 44.58  ? 510  MET A SD  1 
ATOM   4282 C  CE  . MET A 1 510 ? 24.542  75.960 48.749 1.00 44.16  ? 510  MET A CE  1 
ATOM   4283 N  N   . LYS A 1 511 ? 28.211  75.145 53.330 1.00 39.84  ? 511  LYS A N   1 
ATOM   4284 C  CA  . LYS A 1 511 ? 29.251  74.162 53.603 1.00 39.39  ? 511  LYS A CA  1 
ATOM   4285 C  C   . LYS A 1 511 ? 28.777  72.825 53.055 1.00 37.93  ? 511  LYS A C   1 
ATOM   4286 O  O   . LYS A 1 511 ? 27.641  72.409 53.299 1.00 37.41  ? 511  LYS A O   1 
ATOM   4287 C  CB  . LYS A 1 511 ? 29.512  74.022 55.105 1.00 42.67  ? 511  LYS A CB  1 
ATOM   4288 C  CG  . LYS A 1 511 ? 30.418  75.084 55.695 1.00 48.71  ? 511  LYS A CG  1 
ATOM   4289 C  CD  . LYS A 1 511 ? 30.801  74.731 57.129 1.00 52.92  ? 511  LYS A CD  1 
ATOM   4290 C  CE  . LYS A 1 511 ? 31.782  75.743 57.710 1.00 56.12  ? 511  LYS A CE  1 
ATOM   4291 N  NZ  . LYS A 1 511 ? 32.139  75.434 59.126 1.00 57.71  ? 511  LYS A NZ  1 
ATOM   4292 N  N   . VAL A 1 512 ? 29.643  72.162 52.301 1.00 35.07  ? 512  VAL A N   1 
ATOM   4293 C  CA  . VAL A 1 512 ? 29.315  70.867 51.734 1.00 33.31  ? 512  VAL A CA  1 
ATOM   4294 C  C   . VAL A 1 512 ? 29.920  69.777 52.615 1.00 33.19  ? 512  VAL A C   1 
ATOM   4295 O  O   . VAL A 1 512 ? 31.066  69.886 53.059 1.00 32.84  ? 512  VAL A O   1 
ATOM   4296 C  CB  . VAL A 1 512 ? 29.864  70.731 50.295 1.00 33.57  ? 512  VAL A CB  1 
ATOM   4297 C  CG1 . VAL A 1 512 ? 29.652  69.314 49.782 1.00 32.27  ? 512  VAL A CG1 1 
ATOM   4298 C  CG2 . VAL A 1 512 ? 29.167  71.730 49.379 1.00 33.02  ? 512  VAL A CG2 1 
ATOM   4299 N  N   . HIS A 1 513 ? 29.135  68.738 52.878 1.00 30.19  ? 513  HIS A N   1 
ATOM   4300 C  CA  . HIS A 1 513 ? 29.582  67.616 53.697 1.00 29.77  ? 513  HIS A CA  1 
ATOM   4301 C  C   . HIS A 1 513 ? 29.298  66.329 52.937 1.00 29.12  ? 513  HIS A C   1 
ATOM   4302 O  O   . HIS A 1 513 ? 28.710  66.354 51.858 1.00 28.02  ? 513  HIS A O   1 
ATOM   4303 C  CB  . HIS A 1 513 ? 28.821  67.577 55.024 1.00 30.87  ? 513  HIS A CB  1 
ATOM   4304 C  CG  . HIS A 1 513 ? 28.962  68.817 55.849 1.00 32.47  ? 513  HIS A CG  1 
ATOM   4305 N  ND1 . HIS A 1 513 ? 30.162  69.216 56.397 1.00 33.90  ? 513  HIS A ND1 1 
ATOM   4306 C  CD2 . HIS A 1 513 ? 28.045  69.731 56.245 1.00 34.46  ? 513  HIS A CD2 1 
ATOM   4307 C  CE1 . HIS A 1 513 ? 29.977  70.321 57.098 1.00 35.85  ? 513  HIS A CE1 1 
ATOM   4308 N  NE2 . HIS A 1 513 ? 28.701  70.655 57.023 1.00 34.85  ? 513  HIS A NE2 1 
ATOM   4309 N  N   . GLN A 1 514 ? 29.704  65.205 53.514 1.00 28.09  ? 514  GLN A N   1 
ATOM   4310 C  CA  . GLN A 1 514 ? 29.476  63.906 52.896 1.00 28.85  ? 514  GLN A CA  1 
ATOM   4311 C  C   . GLN A 1 514 ? 29.045  62.876 53.933 1.00 27.38  ? 514  GLN A C   1 
ATOM   4312 O  O   . GLN A 1 514 ? 29.401  62.980 55.106 1.00 25.38  ? 514  GLN A O   1 
ATOM   4313 C  CB  . GLN A 1 514 ? 30.748  63.414 52.205 1.00 32.42  ? 514  GLN A CB  1 
ATOM   4314 C  CG  . GLN A 1 514 ? 31.086  64.142 50.920 1.00 36.14  ? 514  GLN A CG  1 
ATOM   4315 C  CD  . GLN A 1 514 ? 32.447  63.749 50.382 1.00 39.18  ? 514  GLN A CD  1 
ATOM   4316 O  OE1 . GLN A 1 514 ? 33.477  64.218 50.866 1.00 42.45  ? 514  GLN A OE1 1 
ATOM   4317 N  NE2 . GLN A 1 514 ? 32.459  62.871 49.388 1.00 37.84  ? 514  GLN A NE2 1 
ATOM   4318 N  N   . ARG A 1 515 ? 28.267  61.895 53.484 1.00 25.59  ? 515  ARG A N   1 
ATOM   4319 C  CA  . ARG A 1 515 ? 27.795  60.805 54.335 1.00 25.81  ? 515  ARG A CA  1 
ATOM   4320 C  C   . ARG A 1 515 ? 27.123  61.254 55.629 1.00 25.78  ? 515  ARG A C   1 
ATOM   4321 O  O   . ARG A 1 515 ? 27.642  61.029 56.728 1.00 23.91  ? 515  ARG A O   1 
ATOM   4322 C  CB  . ARG A 1 515 ? 28.962  59.866 54.644 1.00 28.45  ? 515  ARG A CB  1 
ATOM   4323 C  CG  . ARG A 1 515 ? 29.571  59.260 53.390 1.00 29.40  ? 515  ARG A CG  1 
ATOM   4324 C  CD  . ARG A 1 515 ? 30.634  58.230 53.708 1.00 32.89  ? 515  ARG A CD  1 
ATOM   4325 N  NE  . ARG A 1 515 ? 31.081  57.554 52.493 1.00 37.27  ? 515  ARG A NE  1 
ATOM   4326 C  CZ  . ARG A 1 515 ? 31.889  56.499 52.474 1.00 42.96  ? 515  ARG A CZ  1 
ATOM   4327 N  NH1 . ARG A 1 515 ? 32.350  55.992 53.610 1.00 42.47  ? 515  ARG A NH1 1 
ATOM   4328 N  NH2 . ARG A 1 515 ? 32.229  55.941 51.318 1.00 42.63  ? 515  ARG A NH2 1 
ATOM   4329 N  N   A LEU A 1 516 ? 25.956  61.877 55.489 0.50 24.70  ? 516  LEU A N   1 
ATOM   4330 N  N   B LEU A 1 516 ? 25.962  61.885 55.484 0.50 23.63  ? 516  LEU A N   1 
ATOM   4331 C  CA  A LEU A 1 516 ? 25.195  62.363 56.633 0.50 24.60  ? 516  LEU A CA  1 
ATOM   4332 C  CA  B LEU A 1 516 ? 25.191  62.386 56.616 0.50 22.74  ? 516  LEU A CA  1 
ATOM   4333 C  C   A LEU A 1 516 ? 24.964  61.272 57.679 0.50 24.74  ? 516  LEU A C   1 
ATOM   4334 C  C   B LEU A 1 516 ? 25.001  61.302 57.686 0.50 22.81  ? 516  LEU A C   1 
ATOM   4335 O  O   A LEU A 1 516 ? 24.382  60.227 57.382 0.50 23.82  ? 516  LEU A O   1 
ATOM   4336 O  O   B LEU A 1 516 ? 24.422  60.248 57.419 0.50 22.06  ? 516  LEU A O   1 
ATOM   4337 C  CB  A LEU A 1 516 ? 23.846  62.921 56.164 0.50 24.01  ? 516  LEU A CB  1 
ATOM   4338 C  CB  B LEU A 1 516 ? 23.838  62.897 56.108 0.50 20.95  ? 516  LEU A CB  1 
ATOM   4339 C  CG  A LEU A 1 516 ? 22.884  63.397 57.257 0.50 25.44  ? 516  LEU A CG  1 
ATOM   4340 C  CG  B LEU A 1 516 ? 22.992  63.794 57.011 0.50 21.97  ? 516  LEU A CG  1 
ATOM   4341 C  CD1 A LEU A 1 516 ? 23.550  64.472 58.102 0.50 24.56  ? 516  LEU A CD1 1 
ATOM   4342 C  CD1 B LEU A 1 516 ? 21.939  64.504 56.167 0.50 20.06  ? 516  LEU A CD1 1 
ATOM   4343 C  CD2 A LEU A 1 516 ? 21.612  63.932 56.619 0.50 25.75  ? 516  LEU A CD2 1 
ATOM   4344 C  CD2 B LEU A 1 516 ? 22.348  62.971 58.113 0.50 20.05  ? 516  LEU A CD2 1 
ATOM   4345 N  N   A ARG A 1 517 ? 25.428  61.536 58.899 0.50 25.46  ? 517  ARG A N   1 
ATOM   4346 N  N   B ARG A 1 517 ? 25.497  61.585 58.892 0.50 23.54  ? 517  ARG A N   1 
ATOM   4347 C  CA  A ARG A 1 517 ? 25.298  60.617 60.030 0.50 26.83  ? 517  ARG A CA  1 
ATOM   4348 C  CA  B ARG A 1 517 ? 25.436  60.674 60.042 0.50 24.69  ? 517  ARG A CA  1 
ATOM   4349 C  C   A ARG A 1 517 ? 25.494  59.160 59.627 0.50 25.66  ? 517  ARG A C   1 
ATOM   4350 C  C   B ARG A 1 517 ? 25.549  59.199 59.677 0.50 24.32  ? 517  ARG A C   1 
ATOM   4351 O  O   A ARG A 1 517 ? 24.754  58.278 60.064 0.50 26.16  ? 517  ARG A O   1 
ATOM   4352 O  O   B ARG A 1 517 ? 24.810  58.352 60.180 0.50 24.90  ? 517  ARG A O   1 
ATOM   4353 C  CB  A ARG A 1 517 ? 23.923  60.796 60.691 0.50 29.63  ? 517  ARG A CB  1 
ATOM   4354 C  CB  B ARG A 1 517 ? 24.166  60.932 60.869 0.50 26.49  ? 517  ARG A CB  1 
ATOM   4355 C  CG  A ARG A 1 517 ? 23.575  62.254 60.975 0.50 34.14  ? 517  ARG A CG  1 
ATOM   4356 C  CG  B ARG A 1 517 ? 24.237  62.239 61.665 0.50 26.50  ? 517  ARG A CG  1 
ATOM   4357 C  CD  A ARG A 1 517 ? 22.310  62.395 61.805 0.50 37.17  ? 517  ARG A CD  1 
ATOM   4358 C  CD  B ARG A 1 517 ? 22.999  62.495 62.508 0.50 26.16  ? 517  ARG A CD  1 
ATOM   4359 N  NE  A ARG A 1 517 ? 22.546  62.161 63.227 0.50 39.21  ? 517  ARG A NE  1 
ATOM   4360 N  NE  B ARG A 1 517 ? 22.946  61.683 63.722 0.50 25.78  ? 517  ARG A NE  1 
ATOM   4361 C  CZ  A ARG A 1 517 ? 23.277  62.954 64.003 0.50 40.54  ? 517  ARG A CZ  1 
ATOM   4362 C  CZ  B ARG A 1 517 ? 23.805  61.784 64.735 0.50 24.83  ? 517  ARG A CZ  1 
ATOM   4363 N  NH1 A ARG A 1 517 ? 23.846  64.039 63.496 0.50 40.82  ? 517  ARG A NH1 1 
ATOM   4364 N  NH1 B ARG A 1 517 ? 24.800  62.662 64.682 0.50 24.35  ? 517  ARG A NH1 1 
ATOM   4365 N  NH2 A ARG A 1 517 ? 23.440  62.665 65.289 0.50 41.65  ? 517  ARG A NH2 1 
ATOM   4366 N  NH2 B ARG A 1 517 ? 23.651  61.026 65.814 0.50 15.33  ? 517  ARG A NH2 1 
ATOM   4367 N  N   . VAL A 1 518 ? 26.507  58.904 58.807 1.00 23.85  ? 518  VAL A N   1 
ATOM   4368 C  CA  . VAL A 1 518 ? 26.760  57.549 58.340 1.00 23.92  ? 518  VAL A CA  1 
ATOM   4369 C  C   . VAL A 1 518 ? 27.091  56.529 59.434 1.00 23.07  ? 518  VAL A C   1 
ATOM   4370 O  O   . VAL A 1 518 ? 26.652  55.384 59.360 1.00 22.34  ? 518  VAL A O   1 
ATOM   4371 C  CB  . VAL A 1 518 ? 27.891  57.549 57.282 1.00 23.24  ? 518  VAL A CB  1 
ATOM   4372 C  CG1 . VAL A 1 518 ? 29.206  57.986 57.919 1.00 23.70  ? 518  VAL A CG1 1 
ATOM   4373 C  CG2 . VAL A 1 518 ? 28.012  56.176 56.648 1.00 22.46  ? 518  VAL A CG2 1 
ATOM   4374 N  N   . GLN A 1 519 ? 27.846  56.933 60.452 1.00 23.15  ? 519  GLN A N   1 
ATOM   4375 C  CA  . GLN A 1 519 ? 28.215  55.994 61.513 1.00 24.26  ? 519  GLN A CA  1 
ATOM   4376 C  C   . GLN A 1 519 ? 26.982  55.442 62.231 1.00 24.10  ? 519  GLN A C   1 
ATOM   4377 O  O   . GLN A 1 519 ? 26.831  54.231 62.377 1.00 23.51  ? 519  GLN A O   1 
ATOM   4378 C  CB  . GLN A 1 519 ? 29.157  56.659 62.528 1.00 24.99  ? 519  GLN A CB  1 
ATOM   4379 C  CG  . GLN A 1 519 ? 29.865  55.661 63.451 1.00 27.86  ? 519  GLN A CG  1 
ATOM   4380 C  CD  . GLN A 1 519 ? 30.928  54.826 62.734 1.00 29.47  ? 519  GLN A CD  1 
ATOM   4381 O  OE1 . GLN A 1 519 ? 31.190  53.679 63.108 1.00 29.85  ? 519  GLN A OE1 1 
ATOM   4382 N  NE2 . GLN A 1 519 ? 31.552  55.405 61.713 1.00 24.79  ? 519  GLN A NE2 1 
ATOM   4383 N  N   . MET A 1 520 ? 26.094  56.323 62.676 1.00 22.23  ? 520  MET A N   1 
ATOM   4384 C  CA  . MET A 1 520 ? 24.893  55.866 63.364 1.00 22.67  ? 520  MET A CA  1 
ATOM   4385 C  C   . MET A 1 520 ? 23.939  55.138 62.423 1.00 22.64  ? 520  MET A C   1 
ATOM   4386 O  O   . MET A 1 520 ? 23.324  54.140 62.802 1.00 24.22  ? 520  MET A O   1 
ATOM   4387 C  CB  . MET A 1 520 ? 24.163  57.044 64.019 1.00 22.64  ? 520  MET A CB  1 
ATOM   4388 C  CG  . MET A 1 520 ? 24.928  57.677 65.174 1.00 26.64  ? 520  MET A CG  1 
ATOM   4389 S  SD  . MET A 1 520 ? 25.375  56.464 66.444 1.00 28.87  ? 520  MET A SD  1 
ATOM   4390 C  CE  . MET A 1 520 ? 27.087  56.137 65.986 1.00 32.46  ? 520  MET A CE  1 
ATOM   4391 N  N   . CYS A 1 521 ? 23.814  55.620 61.193 1.00 22.14  ? 521  CYS A N   1 
ATOM   4392 C  CA  . CYS A 1 521 ? 22.896  54.976 60.267 1.00 22.95  ? 521  CYS A CA  1 
ATOM   4393 C  C   . CYS A 1 521 ? 23.315  53.574 59.832 1.00 22.25  ? 521  CYS A C   1 
ATOM   4394 O  O   . CYS A 1 521 ? 22.465  52.762 59.466 1.00 21.81  ? 521  CYS A O   1 
ATOM   4395 C  CB  . CYS A 1 521 ? 22.628  55.888 59.076 1.00 22.55  ? 521  CYS A CB  1 
ATOM   4396 S  SG  . CYS A 1 521 ? 21.648  57.347 59.572 1.00 24.76  ? 521  CYS A SG  1 
ATOM   4397 N  N   . VAL A 1 522 ? 24.610  53.271 59.870 1.00 22.80  ? 522  VAL A N   1 
ATOM   4398 C  CA  . VAL A 1 522 ? 25.029  51.910 59.537 1.00 22.15  ? 522  VAL A CA  1 
ATOM   4399 C  C   . VAL A 1 522 ? 24.493  51.037 60.678 1.00 21.90  ? 522  VAL A C   1 
ATOM   4400 O  O   . VAL A 1 522 ? 24.075  49.898 60.471 1.00 22.26  ? 522  VAL A O   1 
ATOM   4401 C  CB  . VAL A 1 522 ? 26.566  51.770 59.472 1.00 24.10  ? 522  VAL A CB  1 
ATOM   4402 C  CG1 . VAL A 1 522 ? 26.954  50.292 59.477 1.00 24.74  ? 522  VAL A CG1 1 
ATOM   4403 C  CG2 . VAL A 1 522 ? 27.098  52.445 58.207 1.00 22.37  ? 522  VAL A CG2 1 
ATOM   4404 N  N   . PHE A 1 523 ? 24.501  51.589 61.889 1.00 21.35  ? 523  PHE A N   1 
ATOM   4405 C  CA  . PHE A 1 523 ? 23.995  50.863 63.048 1.00 21.69  ? 523  PHE A CA  1 
ATOM   4406 C  C   . PHE A 1 523 ? 22.493  50.593 62.900 1.00 21.07  ? 523  PHE A C   1 
ATOM   4407 O  O   . PHE A 1 523 ? 22.037  49.453 63.026 1.00 20.74  ? 523  PHE A O   1 
ATOM   4408 C  CB  . PHE A 1 523 ? 24.239  51.664 64.333 1.00 20.59  ? 523  PHE A CB  1 
ATOM   4409 C  CG  . PHE A 1 523 ? 23.561  51.081 65.541 1.00 22.23  ? 523  PHE A CG  1 
ATOM   4410 C  CD1 . PHE A 1 523 ? 24.133  50.016 66.232 1.00 21.19  ? 523  PHE A CD1 1 
ATOM   4411 C  CD2 . PHE A 1 523 ? 22.324  51.566 65.960 1.00 21.65  ? 523  PHE A CD2 1 
ATOM   4412 C  CE1 . PHE A 1 523 ? 23.482  49.441 67.322 1.00 22.38  ? 523  PHE A CE1 1 
ATOM   4413 C  CE2 . PHE A 1 523 ? 21.664  50.998 67.048 1.00 21.47  ? 523  PHE A CE2 1 
ATOM   4414 C  CZ  . PHE A 1 523 ? 22.243  49.933 67.731 1.00 21.85  ? 523  PHE A CZ  1 
ATOM   4415 N  N   . TRP A 1 524 ? 21.727  51.646 62.630 1.00 20.40  ? 524  TRP A N   1 
ATOM   4416 C  CA  . TRP A 1 524 ? 20.276  51.524 62.486 1.00 21.69  ? 524  TRP A CA  1 
ATOM   4417 C  C   . TRP A 1 524 ? 19.791  50.800 61.233 1.00 22.58  ? 524  TRP A C   1 
ATOM   4418 O  O   . TRP A 1 524 ? 18.787  50.088 61.278 1.00 23.55  ? 524  TRP A O   1 
ATOM   4419 C  CB  . TRP A 1 524 ? 19.618  52.909 62.524 1.00 20.19  ? 524  TRP A CB  1 
ATOM   4420 C  CG  . TRP A 1 524 ? 19.715  53.586 63.857 1.00 21.71  ? 524  TRP A CG  1 
ATOM   4421 C  CD1 . TRP A 1 524 ? 20.519  54.635 64.188 1.00 20.78  ? 524  TRP A CD1 1 
ATOM   4422 C  CD2 . TRP A 1 524 ? 18.993  53.241 65.044 1.00 20.93  ? 524  TRP A CD2 1 
ATOM   4423 N  NE1 . TRP A 1 524 ? 20.345  54.967 65.511 1.00 22.48  ? 524  TRP A NE1 1 
ATOM   4424 C  CE2 . TRP A 1 524 ? 19.413  54.126 66.060 1.00 20.74  ? 524  TRP A CE2 1 
ATOM   4425 C  CE3 . TRP A 1 524 ? 18.030  52.267 65.348 1.00 20.11  ? 524  TRP A CE3 1 
ATOM   4426 C  CZ2 . TRP A 1 524 ? 18.905  54.068 67.365 1.00 21.19  ? 524  TRP A CZ2 1 
ATOM   4427 C  CZ3 . TRP A 1 524 ? 17.523  52.209 66.648 1.00 20.19  ? 524  TRP A CZ3 1 
ATOM   4428 C  CH2 . TRP A 1 524 ? 17.963  53.105 67.638 1.00 20.27  ? 524  TRP A CH2 1 
ATOM   4429 N  N   . ASN A 1 525 ? 20.500  50.978 60.124 1.00 22.95  ? 525  ASN A N   1 
ATOM   4430 C  CA  . ASN A 1 525 ? 20.092  50.379 58.854 1.00 23.93  ? 525  ASN A CA  1 
ATOM   4431 C  C   . ASN A 1 525 ? 20.667  49.002 58.534 1.00 25.32  ? 525  ASN A C   1 
ATOM   4432 O  O   . ASN A 1 525 ? 20.062  48.244 57.780 1.00 24.07  ? 525  ASN A O   1 
ATOM   4433 C  CB  . ASN A 1 525 ? 20.435  51.332 57.701 1.00 23.41  ? 525  ASN A CB  1 
ATOM   4434 C  CG  . ASN A 1 525 ? 19.690  52.657 57.788 1.00 25.34  ? 525  ASN A CG  1 
ATOM   4435 O  OD1 . ASN A 1 525 ? 20.059  53.637 57.132 1.00 27.60  ? 525  ASN A OD1 1 
ATOM   4436 N  ND2 . ASN A 1 525 ? 18.633  52.690 58.585 1.00 26.23  ? 525  ASN A ND2 1 
ATOM   4437 N  N   A GLN A 1 526 ? 21.827  48.683 59.100 0.50 24.83  ? 526  GLN A N   1 
ATOM   4438 N  N   B GLN A 1 526 ? 21.828  48.679 59.094 0.50 25.50  ? 526  GLN A N   1 
ATOM   4439 C  CA  A GLN A 1 526 ? 22.465  47.398 58.832 0.50 26.30  ? 526  GLN A CA  1 
ATOM   4440 C  CA  B GLN A 1 526 ? 22.450  47.384 58.830 0.50 27.45  ? 526  GLN A CA  1 
ATOM   4441 C  C   A GLN A 1 526 ? 22.600  46.486 60.047 0.50 25.85  ? 526  GLN A C   1 
ATOM   4442 C  C   B GLN A 1 526 ? 22.594  46.482 60.053 0.50 26.56  ? 526  GLN A C   1 
ATOM   4443 O  O   A GLN A 1 526 ? 22.032  45.397 60.079 0.50 26.48  ? 526  GLN A O   1 
ATOM   4444 O  O   B GLN A 1 526 ? 22.024  45.394 60.096 0.50 27.13  ? 526  GLN A O   1 
ATOM   4445 C  CB  A GLN A 1 526 ? 23.852  47.619 58.221 0.50 26.76  ? 526  GLN A CB  1 
ATOM   4446 C  CB  B GLN A 1 526 ? 23.829  47.570 58.190 0.50 29.27  ? 526  GLN A CB  1 
ATOM   4447 C  CG  A GLN A 1 526 ? 23.848  48.408 56.921 0.50 31.00  ? 526  GLN A CG  1 
ATOM   4448 C  CG  B GLN A 1 526 ? 23.846  47.509 56.665 0.50 35.92  ? 526  GLN A CG  1 
ATOM   4449 C  CD  A GLN A 1 526 ? 25.221  48.473 56.276 0.50 32.79  ? 526  GLN A CD  1 
ATOM   4450 C  CD  B GLN A 1 526 ? 23.320  48.768 56.001 0.50 38.20  ? 526  GLN A CD  1 
ATOM   4451 O  OE1 A GLN A 1 526 ? 25.838  47.444 56.001 0.50 35.10  ? 526  GLN A OE1 1 
ATOM   4452 O  OE1 B GLN A 1 526 ? 22.143  49.106 56.118 0.50 41.26  ? 526  GLN A OE1 1 
ATOM   4453 N  NE2 A GLN A 1 526 ? 25.704  49.686 56.029 0.50 33.52  ? 526  GLN A NE2 1 
ATOM   4454 N  NE2 B GLN A 1 526 ? 24.199  49.469 55.294 0.50 41.16  ? 526  GLN A NE2 1 
ATOM   4455 N  N   . PHE A 1 527 ? 23.357  46.931 61.044 1.00 25.90  ? 527  PHE A N   1 
ATOM   4456 C  CA  . PHE A 1 527 ? 23.583  46.125 62.240 1.00 24.83  ? 527  PHE A CA  1 
ATOM   4457 C  C   . PHE A 1 527 ? 22.397  45.757 63.130 1.00 24.28  ? 527  PHE A C   1 
ATOM   4458 O  O   . PHE A 1 527 ? 22.150  44.575 63.362 1.00 25.16  ? 527  PHE A O   1 
ATOM   4459 C  CB  . PHE A 1 527 ? 24.663  46.757 63.119 1.00 23.82  ? 527  PHE A CB  1 
ATOM   4460 C  CG  . PHE A 1 527 ? 25.050  45.894 64.288 1.00 24.41  ? 527  PHE A CG  1 
ATOM   4461 C  CD1 . PHE A 1 527 ? 25.716  44.685 64.082 1.00 22.95  ? 527  PHE A CD1 1 
ATOM   4462 C  CD2 . PHE A 1 527 ? 24.708  46.259 65.586 1.00 23.67  ? 527  PHE A CD2 1 
ATOM   4463 C  CE1 . PHE A 1 527 ? 26.033  43.849 65.154 1.00 22.98  ? 527  PHE A CE1 1 
ATOM   4464 C  CE2 . PHE A 1 527 ? 25.020  45.431 66.667 1.00 24.33  ? 527  PHE A CE2 1 
ATOM   4465 C  CZ  . PHE A 1 527 ? 25.683  44.223 66.450 1.00 23.18  ? 527  PHE A CZ  1 
ATOM   4466 N  N   . LEU A 1 528 ? 21.673  46.748 63.642 1.00 23.82  ? 528  LEU A N   1 
ATOM   4467 C  CA  . LEU A 1 528 ? 20.552  46.452 64.531 1.00 24.39  ? 528  LEU A CA  1 
ATOM   4468 C  C   . LEU A 1 528 ? 19.512  45.509 63.923 1.00 25.21  ? 528  LEU A C   1 
ATOM   4469 O  O   . LEU A 1 528 ? 19.091  44.550 64.570 1.00 24.33  ? 528  LEU A O   1 
ATOM   4470 C  CB  . LEU A 1 528 ? 19.873  47.742 65.010 1.00 23.32  ? 528  LEU A CB  1 
ATOM   4471 C  CG  . LEU A 1 528 ? 18.757  47.522 66.042 1.00 23.94  ? 528  LEU A CG  1 
ATOM   4472 C  CD1 . LEU A 1 528 ? 19.327  46.798 67.261 1.00 26.05  ? 528  LEU A CD1 1 
ATOM   4473 C  CD2 . LEU A 1 528 ? 18.145  48.861 66.453 1.00 24.67  ? 528  LEU A CD2 1 
ATOM   4474 N  N   . PRO A 1 529 ? 19.077  45.768 62.679 1.00 26.16  ? 529  PRO A N   1 
ATOM   4475 C  CA  . PRO A 1 529 ? 18.082  44.872 62.076 1.00 27.48  ? 529  PRO A CA  1 
ATOM   4476 C  C   . PRO A 1 529 ? 18.597  43.431 62.016 1.00 28.60  ? 529  PRO A C   1 
ATOM   4477 O  O   . PRO A 1 529 ? 17.854  42.480 62.252 1.00 28.30  ? 529  PRO A O   1 
ATOM   4478 C  CB  . PRO A 1 529 ? 17.870  45.473 60.688 1.00 28.05  ? 529  PRO A CB  1 
ATOM   4479 C  CG  . PRO A 1 529 ? 18.094  46.944 60.924 1.00 28.58  ? 529  PRO A CG  1 
ATOM   4480 C  CD  . PRO A 1 529 ? 19.330  46.934 61.813 1.00 26.01  ? 529  PRO A CD  1 
ATOM   4481 N  N   . LYS A 1 530 ? 19.879  43.280 61.707 1.00 30.13  ? 530  LYS A N   1 
ATOM   4482 C  CA  . LYS A 1 530 ? 20.491  41.959 61.629 1.00 31.97  ? 530  LYS A CA  1 
ATOM   4483 C  C   . LYS A 1 530 ? 20.490  41.310 63.015 1.00 31.12  ? 530  LYS A C   1 
ATOM   4484 O  O   . LYS A 1 530 ? 20.189  40.126 63.161 1.00 31.01  ? 530  LYS A O   1 
ATOM   4485 C  CB  . LYS A 1 530 ? 21.920  42.085 61.097 1.00 34.94  ? 530  LYS A CB  1 
ATOM   4486 C  CG  . LYS A 1 530 ? 22.564  40.777 60.678 1.00 40.12  ? 530  LYS A CG  1 
ATOM   4487 C  CD  . LYS A 1 530 ? 23.858  41.047 59.920 1.00 44.81  ? 530  LYS A CD  1 
ATOM   4488 C  CE  . LYS A 1 530 ? 24.500  39.762 59.407 1.00 48.72  ? 530  LYS A CE  1 
ATOM   4489 N  NZ  . LYS A 1 530 ? 24.971  38.880 60.511 1.00 51.12  ? 530  LYS A NZ  1 
ATOM   4490 N  N   . LEU A 1 531 ? 20.815  42.096 64.036 1.00 29.87  ? 531  LEU A N   1 
ATOM   4491 C  CA  . LEU A 1 531 ? 20.840  41.595 65.405 1.00 29.07  ? 531  LEU A CA  1 
ATOM   4492 C  C   . LEU A 1 531 ? 19.450  41.135 65.847 1.00 29.81  ? 531  LEU A C   1 
ATOM   4493 O  O   . LEU A 1 531 ? 19.289  40.038 66.390 1.00 27.85  ? 531  LEU A O   1 
ATOM   4494 C  CB  . LEU A 1 531 ? 21.362  42.689 66.350 1.00 27.11  ? 531  LEU A CB  1 
ATOM   4495 C  CG  . LEU A 1 531 ? 21.465  42.389 67.851 1.00 28.67  ? 531  LEU A CG  1 
ATOM   4496 C  CD1 . LEU A 1 531 ? 22.448  43.355 68.497 1.00 27.09  ? 531  LEU A CD1 1 
ATOM   4497 C  CD2 . LEU A 1 531 ? 20.095  42.497 68.511 1.00 27.98  ? 531  LEU A CD2 1 
ATOM   4498 N  N   . LEU A 1 532 ? 18.447  41.973 65.609 1.00 29.83  ? 532  LEU A N   1 
ATOM   4499 C  CA  . LEU A 1 532 ? 17.080  41.650 65.999 1.00 32.12  ? 532  LEU A CA  1 
ATOM   4500 C  C   . LEU A 1 532 ? 16.533  40.424 65.272 1.00 34.64  ? 532  LEU A C   1 
ATOM   4501 O  O   . LEU A 1 532 ? 15.736  39.671 65.831 1.00 34.87  ? 532  LEU A O   1 
ATOM   4502 C  CB  . LEU A 1 532 ? 16.161  42.854 65.757 1.00 30.17  ? 532  LEU A CB  1 
ATOM   4503 C  CG  . LEU A 1 532 ? 16.435  44.086 66.630 1.00 29.83  ? 532  LEU A CG  1 
ATOM   4504 C  CD1 . LEU A 1 532 ? 15.491  45.219 66.250 1.00 28.76  ? 532  LEU A CD1 1 
ATOM   4505 C  CD2 . LEU A 1 532 ? 16.263  43.715 68.094 1.00 26.71  ? 532  LEU A CD2 1 
ATOM   4506 N  N   . ASN A 1 533 ? 16.971  40.218 64.036 1.00 37.51  ? 533  ASN A N   1 
ATOM   4507 C  CA  . ASN A 1 533 ? 16.513  39.080 63.248 1.00 41.91  ? 533  ASN A CA  1 
ATOM   4508 C  C   . ASN A 1 533 ? 17.205  37.774 63.639 1.00 43.50  ? 533  ASN A C   1 
ATOM   4509 O  O   . ASN A 1 533 ? 16.633  36.694 63.493 1.00 43.39  ? 533  ASN A O   1 
ATOM   4510 C  CB  . ASN A 1 533 ? 16.724  39.360 61.756 1.00 43.88  ? 533  ASN A CB  1 
ATOM   4511 C  CG  . ASN A 1 533 ? 16.364  38.173 60.881 1.00 47.99  ? 533  ASN A CG  1 
ATOM   4512 O  OD1 . ASN A 1 533 ? 17.155  37.243 60.715 1.00 50.33  ? 533  ASN A OD1 1 
ATOM   4513 N  ND2 . ASN A 1 533 ? 15.158  38.194 60.324 1.00 50.21  ? 533  ASN A ND2 1 
ATOM   4514 N  N   . ALA A 1 534 ? 18.430  37.876 64.145 1.00 44.21  ? 534  ALA A N   1 
ATOM   4515 C  CA  . ALA A 1 534 ? 19.191  36.697 64.543 1.00 46.04  ? 534  ALA A CA  1 
ATOM   4516 C  C   . ALA A 1 534 ? 18.855  36.245 65.957 1.00 47.91  ? 534  ALA A C   1 
ATOM   4517 O  O   . ALA A 1 534 ? 19.100  35.097 66.319 1.00 48.29  ? 534  ALA A O   1 
ATOM   4518 C  CB  . ALA A 1 534 ? 20.682  36.978 64.433 1.00 44.51  ? 534  ALA A CB  1 
ATOM   4519 N  N   . THR A 1 535 ? 18.295  37.151 66.751 1.00 50.65  ? 535  THR A N   1 
ATOM   4520 C  CA  . THR A 1 535 ? 17.941  36.845 68.133 1.00 52.94  ? 535  THR A CA  1 
ATOM   4521 C  C   . THR A 1 535 ? 16.432  36.811 68.353 1.00 54.61  ? 535  THR A C   1 
ATOM   4522 O  O   . THR A 1 535 ? 15.966  35.882 69.045 1.00 56.92  ? 535  THR A O   1 
ATOM   4523 C  CB  . THR A 1 535 ? 18.560  37.872 69.103 1.00 52.97  ? 535  THR A CB  1 
ATOM   4524 O  OG1 . THR A 1 535 ? 18.129  39.191 68.745 1.00 52.32  ? 535  THR A OG1 1 
ATOM   4525 C  CG2 . THR A 1 535 ? 20.078  37.806 69.047 1.00 53.38  ? 535  THR A CG2 1 
ATOM   4526 N  N   . ALA A 1 536 ? 15.737  37.717 67.849 1.00 56.61  ? 536  ALA A N   1 
HETATM 4527 S  SD  . ETM B 2 .   ? 4.040   68.592 61.559 1.00 38.65  ? 1536 ETM A SD  1 
HETATM 4528 C  C1  . ETM B 2 .   ? 3.986   68.387 63.377 1.00 36.30  ? 1536 ETM A C1  1 
HETATM 4529 C  C2  . ETM B 2 .   ? 4.838   69.420 64.120 1.00 34.62  ? 1536 ETM A C2  1 
HETATM 4530 N  N1  . ETM B 2 .   ? 4.955   69.138 65.561 1.00 34.83  ? 1536 ETM A N1  1 
HETATM 4531 C  C3  . ETM B 2 .   ? 5.672   67.875 65.791 1.00 34.88  ? 1536 ETM A C3  1 
HETATM 4532 C  C4  . ETM B 2 .   ? 5.721   70.227 66.184 1.00 33.27  ? 1536 ETM A C4  1 
HETATM 4533 C  C5  . ETM B 2 .   ? 3.631   69.073 66.198 1.00 34.68  ? 1536 ETM A C5  1 
HETATM 4534 CL CL  . CL  C 3 .   ? 2.136   90.135 54.383 1.00 57.17  ? 1537 CL  A CL  1 
HETATM 4535 S  SD  . ETM D 2 .   ? 1.939   63.223 70.481 1.00 68.57  ? 1538 ETM A SD  1 
HETATM 4536 C  C1  . ETM D 2 .   ? 1.355   62.277 71.934 1.00 65.67  ? 1538 ETM A C1  1 
HETATM 4537 C  C2  . ETM D 2 .   ? -0.165  62.089 71.953 1.00 65.61  ? 1538 ETM A C2  1 
HETATM 4538 N  N1  . ETM D 2 .   ? -0.624  61.193 73.028 1.00 65.43  ? 1538 ETM A N1  1 
HETATM 4539 C  C3  . ETM D 2 .   ? -2.089  61.104 72.957 1.00 66.04  ? 1538 ETM A C3  1 
HETATM 4540 C  C4  . ETM D 2 .   ? -0.065  59.843 72.868 1.00 66.58  ? 1538 ETM A C4  1 
HETATM 4541 C  C5  . ETM D 2 .   ? -0.261  61.721 74.351 1.00 66.99  ? 1538 ETM A C5  1 
HETATM 4542 CL CL  . CL  E 3 .   ? 0.579   48.940 75.837 1.00 83.40  ? 1539 CL  A CL  1 
HETATM 4543 CL CL  . CL  F 3 .   ? 4.630   57.843 76.180 1.00 66.79  ? 1540 CL  A CL  1 
HETATM 4544 CL CL  . CL  G 3 .   ? 22.495  54.377 55.068 1.00 69.25  ? 1541 CL  A CL  1 
HETATM 4545 CL CL  . CL  H 3 .   ? 8.386   79.371 68.048 1.00 67.36  ? 1542 CL  A CL  1 
HETATM 4546 CL CL  . CL  I 3 .   ? 12.730  79.802 75.048 1.00 82.80  ? 1543 CL  A CL  1 
HETATM 4547 CL CL  . CL  J 3 .   ? -13.451 40.887 62.289 1.00 77.31  ? 1544 CL  A CL  1 
HETATM 4548 C  C1  . NAG K 4 .   ? 18.823  62.424 33.945 1.00 35.32  ? 1545 NAG A C1  1 
HETATM 4549 C  C2  . NAG K 4 .   ? 20.350  62.315 34.032 1.00 36.08  ? 1545 NAG A C2  1 
HETATM 4550 C  C3  . NAG K 4 .   ? 20.994  62.913 32.781 1.00 39.21  ? 1545 NAG A C3  1 
HETATM 4551 C  C4  . NAG K 4 .   ? 20.395  62.285 31.518 1.00 40.28  ? 1545 NAG A C4  1 
HETATM 4552 C  C5  . NAG K 4 .   ? 18.863  62.370 31.545 1.00 40.84  ? 1545 NAG A C5  1 
HETATM 4553 C  C6  . NAG K 4 .   ? 18.243  61.618 30.379 1.00 40.94  ? 1545 NAG A C6  1 
HETATM 4554 C  C7  . NAG K 4 .   ? 21.250  62.332 36.267 1.00 36.52  ? 1545 NAG A C7  1 
HETATM 4555 C  C8  . NAG K 4 .   ? 21.955  63.116 37.362 1.00 37.15  ? 1545 NAG A C8  1 
HETATM 4556 N  N2  . NAG K 4 .   ? 20.831  63.015 35.207 1.00 36.94  ? 1545 NAG A N2  1 
HETATM 4557 O  O3  . NAG K 4 .   ? 22.396  62.679 32.818 1.00 39.29  ? 1545 NAG A O3  1 
HETATM 4558 O  O4  . NAG K 4 .   ? 20.883  62.966 30.369 1.00 43.30  ? 1545 NAG A O4  1 
HETATM 4559 O  O5  . NAG K 4 .   ? 18.344  61.776 32.758 1.00 36.97  ? 1545 NAG A O5  1 
HETATM 4560 O  O6  . NAG K 4 .   ? 16.823  61.642 30.442 1.00 45.39  ? 1545 NAG A O6  1 
HETATM 4561 O  O7  . NAG K 4 .   ? 21.087  61.117 36.388 1.00 37.53  ? 1545 NAG A O7  1 
HETATM 4562 C  C1  . NAG L 4 .   ? -18.828 83.727 50.091 1.00 61.91  ? 1546 NAG A C1  1 
HETATM 4563 C  C2  . NAG L 4 .   ? -17.964 84.824 50.723 1.00 63.80  ? 1546 NAG A C2  1 
HETATM 4564 C  C3  . NAG L 4 .   ? -18.801 86.098 50.913 1.00 65.78  ? 1546 NAG A C3  1 
HETATM 4565 C  C4  . NAG L 4 .   ? -19.463 86.508 49.595 1.00 65.85  ? 1546 NAG A C4  1 
HETATM 4566 C  C5  . NAG L 4 .   ? -20.241 85.324 49.005 1.00 65.78  ? 1546 NAG A C5  1 
HETATM 4567 C  C6  . NAG L 4 .   ? -20.832 85.627 47.644 1.00 65.50  ? 1546 NAG A C6  1 
HETATM 4568 C  C7  . NAG L 4 .   ? -18.020 84.695 53.142 1.00 67.56  ? 1546 NAG A C7  1 
HETATM 4569 C  C8  . NAG L 4 .   ? -17.425 85.858 53.918 1.00 68.27  ? 1546 NAG A C8  1 
HETATM 4570 N  N2  . NAG L 4 .   ? -17.430 84.367 51.995 1.00 66.79  ? 1546 NAG A N2  1 
HETATM 4571 O  O3  . NAG L 4 .   ? -17.973 87.155 51.377 1.00 65.91  ? 1546 NAG A O3  1 
HETATM 4572 O  O4  . NAG L 4 .   ? -20.347 87.596 49.828 1.00 66.65  ? 1546 NAG A O4  1 
HETATM 4573 O  O5  . NAG L 4 .   ? -19.368 84.184 48.844 1.00 65.16  ? 1546 NAG A O5  1 
HETATM 4574 O  O6  . NAG L 4 .   ? -22.083 84.977 47.473 1.00 67.18  ? 1546 NAG A O6  1 
HETATM 4575 O  O7  . NAG L 4 .   ? -19.004 84.101 53.585 1.00 68.42  ? 1546 NAG A O7  1 
HETATM 4576 C  C1  . PGE M 5 .   ? -1.711  40.552 52.369 1.00 65.37  ? 1547 PGE A C1  1 
HETATM 4577 O  O1  . PGE M 5 .   ? -0.873  39.807 53.257 1.00 66.32  ? 1547 PGE A O1  1 
HETATM 4578 C  C2  . PGE M 5 .   ? -0.882  40.977 51.170 1.00 65.07  ? 1547 PGE A C2  1 
HETATM 4579 O  O2  . PGE M 5 .   ? 0.219   41.796 51.598 1.00 64.11  ? 1547 PGE A O2  1 
HETATM 4580 C  C3  . PGE M 5 .   ? 0.955   42.157 50.446 1.00 63.80  ? 1547 PGE A C3  1 
HETATM 4581 C  C4  . PGE M 5 .   ? 2.162   43.046 50.798 1.00 64.52  ? 1547 PGE A C4  1 
HETATM 4582 O  O4  . PGE M 5 .   ? 4.362   40.917 53.657 1.00 66.98  ? 1547 PGE A O4  1 
HETATM 4583 C  C6  . PGE M 5 .   ? 5.028   41.138 52.415 1.00 65.84  ? 1547 PGE A C6  1 
HETATM 4584 C  C5  . PGE M 5 .   ? 3.993   41.398 51.319 1.00 66.30  ? 1547 PGE A C5  1 
HETATM 4585 O  O3  . PGE M 5 .   ? 3.236   42.572 51.704 1.00 65.35  ? 1547 PGE A O3  1 
HETATM 4586 C  C1  . PGE N 5 .   ? 22.240  68.215 68.037 1.00 81.61  ? 1548 PGE A C1  1 
HETATM 4587 O  O1  . PGE N 5 .   ? 23.068  67.152 67.531 1.00 82.82  ? 1548 PGE A O1  1 
HETATM 4588 C  C2  . PGE N 5 .   ? 22.154  68.172 69.572 1.00 80.85  ? 1548 PGE A C2  1 
HETATM 4589 O  O2  . PGE N 5 .   ? 21.310  69.249 70.045 1.00 79.50  ? 1548 PGE A O2  1 
HETATM 4590 C  C3  . PGE N 5 .   ? 21.215  69.218 71.471 1.00 77.66  ? 1548 PGE A C3  1 
HETATM 4591 C  C4  . PGE N 5 .   ? 20.293  70.384 71.939 1.00 76.28  ? 1548 PGE A C4  1 
HETATM 4592 O  O4  . PGE N 5 .   ? 23.371  74.169 72.294 1.00 77.48  ? 1548 PGE A O4  1 
HETATM 4593 C  C6  . PGE N 5 .   ? 22.127  73.713 71.757 1.00 76.39  ? 1548 PGE A C6  1 
HETATM 4594 C  C5  . PGE N 5 .   ? 21.916  72.265 72.168 1.00 75.95  ? 1548 PGE A C5  1 
HETATM 4595 O  O3  . PGE N 5 .   ? 20.654  71.785 71.629 1.00 75.14  ? 1548 PGE A O3  1 
HETATM 4596 O  O   . HOH O 6 .   ? -14.695 89.405 33.807 1.00 83.74  ? 2001 HOH A O   1 
HETATM 4597 O  O   . HOH O 6 .   ? -16.211 87.320 33.323 1.00 58.96  ? 2002 HOH A O   1 
HETATM 4598 O  O   . HOH O 6 .   ? -11.406 90.174 40.014 1.00 61.71  ? 2003 HOH A O   1 
HETATM 4599 O  O   . HOH O 6 .   ? -14.206 89.820 40.912 1.00 82.72  ? 2004 HOH A O   1 
HETATM 4600 O  O   . HOH O 6 .   ? -13.982 86.942 32.064 1.00 67.27  ? 2005 HOH A O   1 
HETATM 4601 O  O   . HOH O 6 .   ? -16.130 87.273 38.086 1.00 100.47 ? 2006 HOH A O   1 
HETATM 4602 O  O   . HOH O 6 .   ? -6.342  84.031 38.858 1.00 31.66  ? 2007 HOH A O   1 
HETATM 4603 O  O   . HOH O 6 .   ? -10.533 91.126 37.323 1.00 67.95  ? 2008 HOH A O   1 
HETATM 4604 O  O   . HOH O 6 .   ? -4.728  91.176 35.851 1.00 63.77  ? 2009 HOH A O   1 
HETATM 4605 O  O   . HOH O 6 .   ? -7.884  92.039 37.082 1.00 70.62  ? 2010 HOH A O   1 
HETATM 4606 O  O   . HOH O 6 .   ? -9.857  90.293 34.807 1.00 95.12  ? 2011 HOH A O   1 
HETATM 4607 O  O   . HOH O 6 .   ? -12.680 91.755 34.564 1.00 37.64  ? 2012 HOH A O   1 
HETATM 4608 O  O   . HOH O 6 .   ? -17.265 84.891 33.419 1.00 89.14  ? 2013 HOH A O   1 
HETATM 4609 O  O   . HOH O 6 .   ? -8.493  90.710 41.424 1.00 50.27  ? 2014 HOH A O   1 
HETATM 4610 O  O   . HOH O 6 .   ? -15.300 85.421 30.261 1.00 55.93  ? 2015 HOH A O   1 
HETATM 4611 O  O   . HOH O 6 .   ? -8.075  88.017 33.714 1.00 74.55  ? 2016 HOH A O   1 
HETATM 4612 O  O   . HOH O 6 .   ? -14.888 83.311 33.266 1.00 61.47  ? 2017 HOH A O   1 
HETATM 4613 O  O   . HOH O 6 .   ? -10.206 92.160 42.919 1.00 79.11  ? 2018 HOH A O   1 
HETATM 4614 O  O   . HOH O 6 .   ? -20.430 68.040 34.035 1.00 61.89  ? 2019 HOH A O   1 
HETATM 4615 O  O   . HOH O 6 .   ? -20.297 76.066 34.989 1.00 64.84  ? 2020 HOH A O   1 
HETATM 4616 O  O   . HOH O 6 .   ? -17.704 72.198 32.831 1.00 60.11  ? 2021 HOH A O   1 
HETATM 4617 O  O   . HOH O 6 .   ? -14.109 81.036 32.112 1.00 65.58  ? 2022 HOH A O   1 
HETATM 4618 O  O   . HOH O 6 .   ? -9.261  78.965 31.079 1.00 44.85  ? 2023 HOH A O   1 
HETATM 4619 O  O   . HOH O 6 .   ? -12.697 84.690 34.373 1.00 47.00  ? 2024 HOH A O   1 
HETATM 4620 O  O   . HOH O 6 .   ? -18.261 65.677 34.701 1.00 68.05  ? 2025 HOH A O   1 
HETATM 4621 O  O   . HOH O 6 .   ? -18.318 68.611 32.239 1.00 83.16  ? 2026 HOH A O   1 
HETATM 4622 O  O   . HOH O 6 .   ? -15.869 65.518 36.427 1.00 48.58  ? 2027 HOH A O   1 
HETATM 4623 O  O   . HOH O 6 .   ? -4.836  66.232 30.783 1.00 79.99  ? 2028 HOH A O   1 
HETATM 4624 O  O   . HOH O 6 .   ? -7.266  91.354 53.681 1.00 75.40  ? 2029 HOH A O   1 
HETATM 4625 O  O   . HOH O 6 .   ? -14.590 63.923 38.098 1.00 70.54  ? 2030 HOH A O   1 
HETATM 4626 O  O   . HOH O 6 .   ? 2.562   90.236 76.853 1.00 57.39  ? 2031 HOH A O   1 
HETATM 4627 O  O   . HOH O 6 .   ? -18.132 74.564 34.154 1.00 78.44  ? 2032 HOH A O   1 
HETATM 4628 O  O   . HOH O 6 .   ? -16.587 79.878 31.732 1.00 103.82 ? 2033 HOH A O   1 
HETATM 4629 O  O   . HOH O 6 .   ? -13.468 77.402 30.053 1.00 49.16  ? 2034 HOH A O   1 
HETATM 4630 O  O   . HOH O 6 .   ? -13.260 74.856 31.217 1.00 52.30  ? 2035 HOH A O   1 
HETATM 4631 O  O   . HOH O 6 .   ? -11.619 77.894 31.676 1.00 77.49  ? 2036 HOH A O   1 
HETATM 4632 O  O   . HOH O 6 .   ? -11.719 80.011 33.249 1.00 41.64  ? 2037 HOH A O   1 
HETATM 4633 O  O   . HOH O 6 .   ? -18.095 75.081 31.118 1.00 83.16  ? 2038 HOH A O   1 
HETATM 4634 O  O   . HOH O 6 .   ? -23.288 83.110 36.328 1.00 97.65  ? 2039 HOH A O   1 
HETATM 4635 O  O   . HOH O 6 .   ? -24.256 81.884 39.105 1.00 69.79  ? 2040 HOH A O   1 
HETATM 4636 O  O   . HOH O 6 .   ? -15.339 86.891 47.779 1.00 73.72  ? 2041 HOH A O   1 
HETATM 4637 O  O   . HOH O 6 .   ? -10.849 82.797 68.700 1.00 68.11  ? 2042 HOH A O   1 
HETATM 4638 O  O   . HOH O 6 .   ? -14.511 73.151 32.604 1.00 87.05  ? 2043 HOH A O   1 
HETATM 4639 O  O   . HOH O 6 .   ? -7.678  85.791 53.155 1.00 70.40  ? 2044 HOH A O   1 
HETATM 4640 O  O   . HOH O 6 .   ? -11.659 92.143 45.209 1.00 86.31  ? 2045 HOH A O   1 
HETATM 4641 O  O   . HOH O 6 .   ? -10.361 93.363 48.044 1.00 79.33  ? 2046 HOH A O   1 
HETATM 4642 O  O   . HOH O 6 .   ? -6.855  93.711 51.579 1.00 70.54  ? 2047 HOH A O   1 
HETATM 4643 O  O   . HOH O 6 .   ? -24.078 61.652 57.275 1.00 59.08  ? 2048 HOH A O   1 
HETATM 4644 O  O   . HOH O 6 .   ? -24.583 63.694 54.775 1.00 75.19  ? 2049 HOH A O   1 
HETATM 4645 O  O   . HOH O 6 .   ? -23.018 65.495 61.533 1.00 77.21  ? 2050 HOH A O   1 
HETATM 4646 O  O   . HOH O 6 .   ? -17.190 45.243 44.363 1.00 37.69  ? 2051 HOH A O   1 
HETATM 4647 O  O   . HOH O 6 .   ? -9.985  46.220 44.919 1.00 81.08  ? 2052 HOH A O   1 
HETATM 4648 O  O   . HOH O 6 .   ? -21.727 60.871 39.079 1.00 37.54  ? 2053 HOH A O   1 
HETATM 4649 O  O   . HOH O 6 .   ? -22.707 73.962 48.676 1.00 89.25  ? 2054 HOH A O   1 
HETATM 4650 O  O   . HOH O 6 .   ? -22.244 76.051 51.684 1.00 37.61  ? 2055 HOH A O   1 
HETATM 4651 O  O   . HOH O 6 .   ? 26.278  47.440 33.335 1.00 37.75  ? 2056 HOH A O   1 
HETATM 4652 O  O   . HOH O 6 .   ? -16.508 67.573 33.782 1.00 54.30  ? 2057 HOH A O   1 
HETATM 4653 O  O   . HOH O 6 .   ? -18.526 71.242 35.010 1.00 56.69  ? 2058 HOH A O   1 
HETATM 4654 O  O   . HOH O 6 .   ? -6.895  68.602 30.355 1.00 58.89  ? 2059 HOH A O   1 
HETATM 4655 O  O   . HOH O 6 .   ? -19.750 85.001 42.338 1.00 63.78  ? 2060 HOH A O   1 
HETATM 4656 O  O   . HOH O 6 .   ? -15.473 67.285 38.283 1.00 81.19  ? 2061 HOH A O   1 
HETATM 4657 O  O   . HOH O 6 .   ? 3.714   94.278 54.398 1.00 60.47  ? 2062 HOH A O   1 
HETATM 4658 O  O   . HOH O 6 .   ? -0.500  97.737 49.555 1.00 77.43  ? 2063 HOH A O   1 
HETATM 4659 O  O   . HOH O 6 .   ? -3.834  95.653 52.896 1.00 84.18  ? 2064 HOH A O   1 
HETATM 4660 O  O   . HOH O 6 .   ? -13.213 72.480 71.473 1.00 75.60  ? 2065 HOH A O   1 
HETATM 4661 O  O   . HOH O 6 .   ? -0.121  87.616 76.206 1.00 79.53  ? 2066 HOH A O   1 
HETATM 4662 O  O   . HOH O 6 .   ? -19.218 83.215 34.025 1.00 61.01  ? 2067 HOH A O   1 
HETATM 4663 O  O   . HOH O 6 .   ? -20.673 83.303 36.166 1.00 60.81  ? 2068 HOH A O   1 
HETATM 4664 O  O   . HOH O 6 .   ? -22.851 80.424 36.547 1.00 68.46  ? 2069 HOH A O   1 
HETATM 4665 O  O   . HOH O 6 .   ? -23.192 81.254 33.088 1.00 73.85  ? 2070 HOH A O   1 
HETATM 4666 O  O   . HOH O 6 .   ? -17.115 81.182 34.119 1.00 85.17  ? 2071 HOH A O   1 
HETATM 4667 O  O   . HOH O 6 .   ? -29.213 37.116 71.764 1.00 37.67  ? 2072 HOH A O   1 
HETATM 4668 O  O   . HOH O 6 .   ? -31.380 35.026 68.607 1.00 75.11  ? 2073 HOH A O   1 
HETATM 4669 O  O   . HOH O 6 .   ? -17.075 74.291 52.871 1.00 37.90  ? 2074 HOH A O   1 
HETATM 4670 O  O   . HOH O 6 .   ? -12.169 64.124 39.410 1.00 81.91  ? 2075 HOH A O   1 
HETATM 4671 O  O   . HOH O 6 .   ? -8.662  79.842 69.139 1.00 91.21  ? 2076 HOH A O   1 
HETATM 4672 O  O   . HOH O 6 .   ? -23.503 64.425 57.248 1.00 80.27  ? 2077 HOH A O   1 
HETATM 4673 O  O   . HOH O 6 .   ? -14.349 82.950 69.025 1.00 77.19  ? 2078 HOH A O   1 
HETATM 4674 O  O   . HOH O 6 .   ? -22.800 64.249 51.407 1.00 54.19  ? 2079 HOH A O   1 
HETATM 4675 O  O   . HOH O 6 .   ? 23.781  44.356 33.716 1.00 37.73  ? 2080 HOH A O   1 
HETATM 4676 O  O   . HOH O 6 .   ? 23.992  47.599 34.929 1.00 73.83  ? 2081 HOH A O   1 
HETATM 4677 O  O   . HOH O 6 .   ? 24.206  44.951 36.276 1.00 90.77  ? 2082 HOH A O   1 
HETATM 4678 O  O   . HOH O 6 .   ? 25.839  48.290 36.694 1.00 74.37  ? 2083 HOH A O   1 
HETATM 4679 O  O   . HOH O 6 .   ? -14.091 87.551 45.586 1.00 52.73  ? 2084 HOH A O   1 
HETATM 4680 O  O   . HOH O 6 .   ? -13.281 88.254 48.963 1.00 63.57  ? 2085 HOH A O   1 
HETATM 4681 O  O   . HOH O 6 .   ? -9.793  87.867 51.288 1.00 66.30  ? 2086 HOH A O   1 
HETATM 4682 O  O   . HOH O 6 .   ? -24.692 60.552 54.641 1.00 78.77  ? 2087 HOH A O   1 
HETATM 4683 O  O   . HOH O 6 .   ? -22.162 56.413 47.978 1.00 67.59  ? 2088 HOH A O   1 
HETATM 4684 O  O   . HOH O 6 .   ? -24.166 56.602 59.333 1.00 65.12  ? 2089 HOH A O   1 
HETATM 4685 O  O   . HOH O 6 .   ? -10.669 90.807 49.865 1.00 70.75  ? 2090 HOH A O   1 
HETATM 4686 O  O   . HOH O 6 .   ? -11.394 89.874 46.677 1.00 41.16  ? 2091 HOH A O   1 
HETATM 4687 O  O   . HOH O 6 .   ? -6.510  88.976 42.481 1.00 43.99  ? 2092 HOH A O   1 
HETATM 4688 O  O   . HOH O 6 .   ? -7.665  93.975 47.263 1.00 71.22  ? 2093 HOH A O   1 
HETATM 4689 O  O   . HOH O 6 .   ? -0.947  92.762 42.146 1.00 81.82  ? 2094 HOH A O   1 
HETATM 4690 O  O   . HOH O 6 .   ? -6.865  92.296 49.187 1.00 52.80  ? 2095 HOH A O   1 
HETATM 4691 O  O   . HOH O 6 .   ? -4.994  96.792 44.861 1.00 81.97  ? 2096 HOH A O   1 
HETATM 4692 O  O   . HOH O 6 .   ? -3.097  96.530 42.479 1.00 76.34  ? 2097 HOH A O   1 
HETATM 4693 O  O   . HOH O 6 .   ? -22.609 59.828 61.459 1.00 91.37  ? 2098 HOH A O   1 
HETATM 4694 O  O   . HOH O 6 .   ? -21.720 62.604 63.149 1.00 60.15  ? 2099 HOH A O   1 
HETATM 4695 O  O   . HOH O 6 .   ? -16.840 46.661 46.899 1.00 79.37  ? 2100 HOH A O   1 
HETATM 4696 O  O   . HOH O 6 .   ? -9.950  48.756 44.201 1.00 75.59  ? 2101 HOH A O   1 
HETATM 4697 O  O   . HOH O 6 .   ? -10.934 53.754 44.691 1.00 94.35  ? 2102 HOH A O   1 
HETATM 4698 O  O   . HOH O 6 .   ? -8.442  53.918 44.095 1.00 56.70  ? 2103 HOH A O   1 
HETATM 4699 O  O   . HOH O 6 .   ? -5.187  51.335 46.247 1.00 42.94  ? 2104 HOH A O   1 
HETATM 4700 O  O   . HOH O 6 .   ? -10.616 57.069 42.444 1.00 75.31  ? 2105 HOH A O   1 
HETATM 4701 O  O   . HOH O 6 .   ? -18.694 61.722 39.697 1.00 68.63  ? 2106 HOH A O   1 
HETATM 4702 O  O   . HOH O 6 .   ? -19.072 63.904 36.375 1.00 65.35  ? 2107 HOH A O   1 
HETATM 4703 O  O   . HOH O 6 .   ? -21.278 72.707 50.578 1.00 81.70  ? 2108 HOH A O   1 
HETATM 4704 O  O   . HOH O 6 .   ? -8.634  94.954 41.498 1.00 90.25  ? 2109 HOH A O   1 
HETATM 4705 O  O   . HOH O 6 .   ? -7.962  92.655 56.189 1.00 37.66  ? 2110 HOH A O   1 
HETATM 4706 O  O   . HOH O 6 .   ? 22.884  50.363 32.081 1.00 54.70  ? 2111 HOH A O   1 
HETATM 4707 O  O   . HOH O 6 .   ? 23.384  52.532 33.599 1.00 63.92  ? 2112 HOH A O   1 
HETATM 4708 O  O   . HOH O 6 .   ? 3.733   92.126 75.667 1.00 59.43  ? 2113 HOH A O   1 
HETATM 4709 O  O   . HOH O 6 .   ? -8.011  84.634 67.165 1.00 68.09  ? 2114 HOH A O   1 
HETATM 4710 O  O   . HOH O 6 .   ? 25.017  49.813 33.777 1.00 58.50  ? 2115 HOH A O   1 
HETATM 4711 O  O   . HOH O 6 .   ? -23.411 70.003 36.302 1.00 74.58  ? 2116 HOH A O   1 
HETATM 4712 O  O   . HOH O 6 .   ? -0.325  91.372 53.842 1.00 66.93  ? 2117 HOH A O   1 
HETATM 4713 O  O   . HOH O 6 .   ? -25.298 70.406 38.440 1.00 82.80  ? 2118 HOH A O   1 
HETATM 4714 O  O   . HOH O 6 .   ? -22.448 75.412 44.790 1.00 48.21  ? 2119 HOH A O   1 
HETATM 4715 O  O   . HOH O 6 .   ? -22.455 79.783 46.943 1.00 83.66  ? 2120 HOH A O   1 
HETATM 4716 O  O   . HOH O 6 .   ? -23.061 82.824 43.569 1.00 60.97  ? 2121 HOH A O   1 
HETATM 4717 O  O   . HOH O 6 .   ? -18.924 83.406 44.966 1.00 56.18  ? 2122 HOH A O   1 
HETATM 4718 O  O   . HOH O 6 .   ? 6.647   92.946 47.905 1.00 44.48  ? 2123 HOH A O   1 
HETATM 4719 O  O   . HOH O 6 .   ? -20.689 76.355 49.047 1.00 66.44  ? 2124 HOH A O   1 
HETATM 4720 O  O   . HOH O 6 .   ? 0.929   93.664 52.197 1.00 58.82  ? 2125 HOH A O   1 
HETATM 4721 O  O   . HOH O 6 .   ? 0.670   98.040 46.774 1.00 79.52  ? 2126 HOH A O   1 
HETATM 4722 O  O   . HOH O 6 .   ? 5.885   94.436 52.926 1.00 56.80  ? 2127 HOH A O   1 
HETATM 4723 O  O   . HOH O 6 .   ? 5.106   99.149 47.914 1.00 71.77  ? 2128 HOH A O   1 
HETATM 4724 O  O   . HOH O 6 .   ? 4.205   99.983 50.763 1.00 77.01  ? 2129 HOH A O   1 
HETATM 4725 O  O   . HOH O 6 .   ? -11.588 84.267 56.567 1.00 77.40  ? 2130 HOH A O   1 
HETATM 4726 O  O   . HOH O 6 .   ? -7.948  83.442 54.483 1.00 73.39  ? 2131 HOH A O   1 
HETATM 4727 O  O   . HOH O 6 .   ? -16.760 75.631 55.467 1.00 69.37  ? 2132 HOH A O   1 
HETATM 4728 O  O   . HOH O 6 .   ? -22.522 72.455 53.994 1.00 86.94  ? 2133 HOH A O   1 
HETATM 4729 O  O   . HOH O 6 .   ? 3.572   91.902 41.884 1.00 76.16  ? 2134 HOH A O   1 
HETATM 4730 O  O   . HOH O 6 .   ? 2.317   95.365 43.341 1.00 55.31  ? 2135 HOH A O   1 
HETATM 4731 O  O   . HOH O 6 .   ? -0.405  94.754 50.067 1.00 46.21  ? 2136 HOH A O   1 
HETATM 4732 O  O   . HOH O 6 .   ? -14.874 69.610 67.681 1.00 59.17  ? 2137 HOH A O   1 
HETATM 4733 O  O   . HOH O 6 .   ? -11.219 68.365 70.337 1.00 35.92  ? 2138 HOH A O   1 
HETATM 4734 O  O   . HOH O 6 .   ? -1.230  94.738 44.509 1.00 64.22  ? 2139 HOH A O   1 
HETATM 4735 O  O   . HOH O 6 .   ? 1.125   90.936 42.196 1.00 78.35  ? 2140 HOH A O   1 
HETATM 4736 O  O   . HOH O 6 .   ? -1.921  97.621 46.809 1.00 107.50 ? 2141 HOH A O   1 
HETATM 4737 O  O   . HOH O 6 .   ? -5.054  95.618 50.456 1.00 74.19  ? 2142 HOH A O   1 
HETATM 4738 O  O   . HOH O 6 .   ? 0.738   65.871 70.858 1.00 54.58  ? 2143 HOH A O   1 
HETATM 4739 O  O   . HOH O 6 .   ? -3.569  59.883 75.081 1.00 48.48  ? 2144 HOH A O   1 
HETATM 4740 O  O   . HOH O 6 .   ? -8.127  73.739 70.877 1.00 92.70  ? 2145 HOH A O   1 
HETATM 4741 O  O   . HOH O 6 .   ? 0.399   68.486 67.099 1.00 32.84  ? 2146 HOH A O   1 
HETATM 4742 O  O   . HOH O 6 .   ? -11.323 70.967 69.895 1.00 50.83  ? 2147 HOH A O   1 
HETATM 4743 O  O   . HOH O 6 .   ? -13.530 68.116 72.215 1.00 76.73  ? 2148 HOH A O   1 
HETATM 4744 O  O   . HOH O 6 .   ? -13.042 70.771 75.774 1.00 63.52  ? 2149 HOH A O   1 
HETATM 4745 O  O   . HOH O 6 .   ? -10.943 65.903 74.289 1.00 55.09  ? 2150 HOH A O   1 
HETATM 4746 O  O   . HOH O 6 .   ? 4.757   41.859 57.213 1.00 40.79  ? 2151 HOH A O   1 
HETATM 4747 O  O   . HOH O 6 .   ? 0.934   38.543 62.857 1.00 73.86  ? 2152 HOH A O   1 
HETATM 4748 O  O   . HOH O 6 .   ? 7.276   41.246 56.526 1.00 67.04  ? 2153 HOH A O   1 
HETATM 4749 O  O   . HOH O 6 .   ? -4.358  85.893 39.775 1.00 28.89  ? 2154 HOH A O   1 
HETATM 4750 O  O   . HOH O 6 .   ? 2.793   76.433 78.918 1.00 58.62  ? 2155 HOH A O   1 
HETATM 4751 O  O   . HOH O 6 .   ? 2.677   79.316 80.040 1.00 37.75  ? 2156 HOH A O   1 
HETATM 4752 O  O   . HOH O 6 .   ? 4.328   80.696 77.398 1.00 67.64  ? 2157 HOH A O   1 
HETATM 4753 O  O   . HOH O 6 .   ? 1.117   85.855 77.915 1.00 72.51  ? 2158 HOH A O   1 
HETATM 4754 O  O   . HOH O 6 .   ? -2.232  37.095 61.515 1.00 68.77  ? 2159 HOH A O   1 
HETATM 4755 O  O   . HOH O 6 .   ? -4.799  36.975 64.830 1.00 76.40  ? 2160 HOH A O   1 
HETATM 4756 O  O   . HOH O 6 .   ? -0.535  37.248 58.996 1.00 57.60  ? 2161 HOH A O   1 
HETATM 4757 O  O   . HOH O 6 .   ? 5.347   81.519 74.496 1.00 75.36  ? 2162 HOH A O   1 
HETATM 4758 O  O   . HOH O 6 .   ? 2.631   80.526 66.252 1.00 53.49  ? 2163 HOH A O   1 
HETATM 4759 O  O   . HOH O 6 .   ? 5.103   80.964 65.332 1.00 84.33  ? 2164 HOH A O   1 
HETATM 4760 O  O   . HOH O 6 .   ? 6.718   82.029 67.485 1.00 54.63  ? 2165 HOH A O   1 
HETATM 4761 O  O   . HOH O 6 .   ? 1.696   83.505 68.738 1.00 67.26  ? 2166 HOH A O   1 
HETATM 4762 O  O   . HOH O 6 .   ? 6.757   84.146 68.879 1.00 70.79  ? 2167 HOH A O   1 
HETATM 4763 O  O   . HOH O 6 .   ? -23.658 48.794 79.684 1.00 74.20  ? 2168 HOH A O   1 
HETATM 4764 O  O   . HOH O 6 .   ? 2.253   80.175 63.521 1.00 53.12  ? 2169 HOH A O   1 
HETATM 4765 O  O   . HOH O 6 .   ? -22.771 42.031 56.529 1.00 62.67  ? 2170 HOH A O   1 
HETATM 4766 O  O   . HOH O 6 .   ? -31.337 39.632 66.525 1.00 61.69  ? 2171 HOH A O   1 
HETATM 4767 O  O   . HOH O 6 .   ? -28.823 36.640 68.952 1.00 70.05  ? 2172 HOH A O   1 
HETATM 4768 O  O   . HOH O 6 .   ? -30.098 41.353 68.356 1.00 89.05  ? 2173 HOH A O   1 
HETATM 4769 O  O   . HOH O 6 .   ? -15.008 75.008 51.426 1.00 38.38  ? 2174 HOH A O   1 
HETATM 4770 O  O   . HOH O 6 .   ? -13.381 76.720 46.984 1.00 154.37 ? 2175 HOH A O   1 
HETATM 4771 O  O   . HOH O 6 .   ? -3.232  79.439 65.890 1.00 79.90  ? 2176 HOH A O   1 
HETATM 4772 O  O   . HOH O 6 .   ? -5.394  77.046 68.952 1.00 60.81  ? 2177 HOH A O   1 
HETATM 4773 O  O   . HOH O 6 .   ? -10.321 72.237 67.818 1.00 48.91  ? 2178 HOH A O   1 
HETATM 4774 O  O   . HOH O 6 .   ? -6.867  79.702 65.959 1.00 57.64  ? 2179 HOH A O   1 
HETATM 4775 O  O   . HOH O 6 .   ? -11.455 76.504 66.139 1.00 60.79  ? 2180 HOH A O   1 
HETATM 4776 O  O   . HOH O 6 .   ? -10.651 74.871 69.767 1.00 59.63  ? 2181 HOH A O   1 
HETATM 4777 O  O   . HOH O 6 .   ? -11.425 79.301 68.588 1.00 37.67  ? 2182 HOH A O   1 
HETATM 4778 O  O   . HOH O 6 .   ? -11.375 81.675 62.485 1.00 89.17  ? 2183 HOH A O   1 
HETATM 4779 O  O   . HOH O 6 .   ? -15.327 84.575 56.141 1.00 76.00  ? 2184 HOH A O   1 
HETATM 4780 O  O   . HOH O 6 .   ? -5.266  83.646 56.249 1.00 71.99  ? 2185 HOH A O   1 
HETATM 4781 O  O   . HOH O 6 .   ? -14.121 69.483 42.238 1.00 61.90  ? 2186 HOH A O   1 
HETATM 4782 O  O   . HOH O 6 .   ? -17.612 72.190 68.252 1.00 83.23  ? 2187 HOH A O   1 
HETATM 4783 O  O   . HOH O 6 .   ? -13.386 79.917 62.226 1.00 65.12  ? 2188 HOH A O   1 
HETATM 4784 O  O   . HOH O 6 .   ? -14.327 76.273 66.309 1.00 106.93 ? 2189 HOH A O   1 
HETATM 4785 O  O   . HOH O 6 .   ? -15.289 79.124 64.798 1.00 89.55  ? 2190 HOH A O   1 
HETATM 4786 O  O   . HOH O 6 .   ? -15.284 74.103 67.594 1.00 121.82 ? 2191 HOH A O   1 
HETATM 4787 O  O   . HOH O 6 .   ? -12.400 65.322 41.941 1.00 30.10  ? 2192 HOH A O   1 
HETATM 4788 O  O   . HOH O 6 .   ? -21.118 67.207 57.548 1.00 72.83  ? 2193 HOH A O   1 
HETATM 4789 O  O   . HOH O 6 .   ? -22.543 62.393 59.457 1.00 73.04  ? 2194 HOH A O   1 
HETATM 4790 O  O   . HOH O 6 .   ? -21.047 64.932 59.000 1.00 78.93  ? 2195 HOH A O   1 
HETATM 4791 O  O   . HOH O 6 .   ? -15.299 67.926 49.509 1.00 23.76  ? 2196 HOH A O   1 
HETATM 4792 O  O   . HOH O 6 .   ? -22.913 65.851 53.398 1.00 69.44  ? 2197 HOH A O   1 
HETATM 4793 O  O   . HOH O 6 .   ? 8.420   44.872 57.348 1.00 77.70  ? 2198 HOH A O   1 
HETATM 4794 O  O   . HOH O 6 .   ? 13.466  44.625 54.955 1.00 61.53  ? 2199 HOH A O   1 
HETATM 4795 O  O   . HOH O 6 .   ? -21.343 66.766 46.019 1.00 56.93  ? 2200 HOH A O   1 
HETATM 4796 O  O   . HOH O 6 .   ? -21.815 61.396 48.127 1.00 44.77  ? 2201 HOH A O   1 
HETATM 4797 O  O   . HOH O 6 .   ? -22.033 65.898 48.470 1.00 66.16  ? 2202 HOH A O   1 
HETATM 4798 O  O   . HOH O 6 .   ? -15.447 60.590 49.117 1.00 28.82  ? 2203 HOH A O   1 
HETATM 4799 O  O   . HOH O 6 .   ? 16.176  42.995 35.860 1.00 94.31  ? 2204 HOH A O   1 
HETATM 4800 O  O   . HOH O 6 .   ? 19.904  47.600 38.065 1.00 67.42  ? 2205 HOH A O   1 
HETATM 4801 O  O   . HOH O 6 .   ? 21.488  47.503 35.902 1.00 68.28  ? 2206 HOH A O   1 
HETATM 4802 O  O   . HOH O 6 .   ? 20.658  45.696 34.032 1.00 82.26  ? 2207 HOH A O   1 
HETATM 4803 O  O   . HOH O 6 .   ? -21.253 62.195 50.796 1.00 36.60  ? 2208 HOH A O   1 
HETATM 4804 O  O   . HOH O 6 .   ? -5.457  83.276 53.787 1.00 56.67  ? 2209 HOH A O   1 
HETATM 4805 O  O   . HOH O 6 .   ? 17.434  48.942 32.214 1.00 74.98  ? 2210 HOH A O   1 
HETATM 4806 O  O   . HOH O 6 .   ? -22.405 60.218 52.590 1.00 48.25  ? 2211 HOH A O   1 
HETATM 4807 O  O   . HOH O 6 .   ? 3.652   91.147 37.631 1.00 81.10  ? 2212 HOH A O   1 
HETATM 4808 O  O   . HOH O 6 .   ? -23.330 51.791 57.858 1.00 76.69  ? 2213 HOH A O   1 
HETATM 4809 O  O   . HOH O 6 .   ? -24.578 57.583 54.635 1.00 47.33  ? 2214 HOH A O   1 
HETATM 4810 O  O   . HOH O 6 .   ? -23.367 57.645 51.098 1.00 56.99  ? 2215 HOH A O   1 
HETATM 4811 O  O   . HOH O 6 .   ? -23.292 54.388 58.409 1.00 71.57  ? 2216 HOH A O   1 
HETATM 4812 O  O   . HOH O 6 .   ? 4.006   82.879 30.139 1.00 49.36  ? 2217 HOH A O   1 
HETATM 4813 O  O   . HOH O 6 .   ? -2.311  72.957 29.885 1.00 61.63  ? 2218 HOH A O   1 
HETATM 4814 O  O   . HOH O 6 .   ? 9.100   76.159 30.017 1.00 64.73  ? 2219 HOH A O   1 
HETATM 4815 O  O   . HOH O 6 .   ? 9.695   78.367 31.713 1.00 64.04  ? 2220 HOH A O   1 
HETATM 4816 O  O   . HOH O 6 .   ? 26.892  72.191 78.136 1.00 78.31  ? 2221 HOH A O   1 
HETATM 4817 O  O   . HOH O 6 .   ? 15.621  45.494 82.928 1.00 83.62  ? 2222 HOH A O   1 
HETATM 4818 O  O   . HOH O 6 .   ? -20.847 60.189 63.394 1.00 48.00  ? 2223 HOH A O   1 
HETATM 4819 O  O   . HOH O 6 .   ? 18.036  45.093 84.170 1.00 37.70  ? 2224 HOH A O   1 
HETATM 4820 O  O   . HOH O 6 .   ? 33.599  60.396 72.843 1.00 76.46  ? 2225 HOH A O   1 
HETATM 4821 O  O   . HOH O 6 .   ? -9.965  52.437 55.139 1.00 24.30  ? 2226 HOH A O   1 
HETATM 4822 O  O   . HOH O 6 .   ? 30.016  66.792 74.475 1.00 75.62  ? 2227 HOH A O   1 
HETATM 4823 O  O   . HOH O 6 .   ? -18.010 50.868 45.176 1.00 37.86  ? 2228 HOH A O   1 
HETATM 4824 O  O   . HOH O 6 .   ? -22.556 53.501 49.410 1.00 89.88  ? 2229 HOH A O   1 
HETATM 4825 O  O   . HOH O 6 .   ? -17.536 49.143 48.343 1.00 86.59  ? 2230 HOH A O   1 
HETATM 4826 O  O   . HOH O 6 .   ? -14.502 51.421 46.106 1.00 91.57  ? 2231 HOH A O   1 
HETATM 4827 O  O   . HOH O 6 .   ? -19.105 54.876 47.957 1.00 86.05  ? 2232 HOH A O   1 
HETATM 4828 O  O   . HOH O 6 .   ? -0.539  79.917 67.494 1.00 62.89  ? 2233 HOH A O   1 
HETATM 4829 O  O   . HOH O 6 .   ? 1.580   84.049 60.908 1.00 63.21  ? 2234 HOH A O   1 
HETATM 4830 O  O   . HOH O 6 .   ? -4.193  81.999 65.886 1.00 80.68  ? 2235 HOH A O   1 
HETATM 4831 O  O   . HOH O 6 .   ? 3.031   82.368 62.276 1.00 62.88  ? 2236 HOH A O   1 
HETATM 4832 O  O   . HOH O 6 .   ? 3.314   83.461 64.983 1.00 56.98  ? 2237 HOH A O   1 
HETATM 4833 O  O   . HOH O 6 .   ? -1.763  86.355 57.965 1.00 69.06  ? 2238 HOH A O   1 
HETATM 4834 O  O   . HOH O 6 .   ? -5.244  90.027 55.284 1.00 80.27  ? 2239 HOH A O   1 
HETATM 4835 O  O   . HOH O 6 .   ? -5.880  87.749 53.859 1.00 70.07  ? 2240 HOH A O   1 
HETATM 4836 O  O   . HOH O 6 .   ? 1.156   87.970 60.632 1.00 74.15  ? 2241 HOH A O   1 
HETATM 4837 O  O   . HOH O 6 .   ? -11.339 51.129 44.172 1.00 104.46 ? 2242 HOH A O   1 
HETATM 4838 O  O   . HOH O 6 .   ? -15.378 58.158 50.974 1.00 35.43  ? 2243 HOH A O   1 
HETATM 4839 O  O   . HOH O 6 .   ? -7.127  50.913 49.784 1.00 28.18  ? 2244 HOH A O   1 
HETATM 4840 O  O   . HOH O 6 .   ? -7.841  51.760 45.318 1.00 56.06  ? 2245 HOH A O   1 
HETATM 4841 O  O   . HOH O 6 .   ? -17.140 56.974 48.903 1.00 124.10 ? 2246 HOH A O   1 
HETATM 4842 O  O   . HOH O 6 .   ? 7.854   89.373 43.190 1.00 60.13  ? 2247 HOH A O   1 
HETATM 4843 O  O   . HOH O 6 .   ? 9.353   89.637 45.414 1.00 63.08  ? 2248 HOH A O   1 
HETATM 4844 O  O   . HOH O 6 .   ? 12.232  88.207 41.299 1.00 94.19  ? 2249 HOH A O   1 
HETATM 4845 O  O   . HOH O 6 .   ? 12.646  86.936 44.916 1.00 53.30  ? 2250 HOH A O   1 
HETATM 4846 O  O   . HOH O 6 .   ? 10.705  81.288 36.817 1.00 63.58  ? 2251 HOH A O   1 
HETATM 4847 O  O   . HOH O 6 .   ? 12.148  82.567 38.699 1.00 84.67  ? 2252 HOH A O   1 
HETATM 4848 O  O   . HOH O 6 .   ? 12.779  84.414 41.259 1.00 60.94  ? 2253 HOH A O   1 
HETATM 4849 O  O   . HOH O 6 .   ? 16.213  84.879 44.597 1.00 61.55  ? 2254 HOH A O   1 
HETATM 4850 O  O   . HOH O 6 .   ? 9.311   88.237 34.551 1.00 37.68  ? 2255 HOH A O   1 
HETATM 4851 O  O   . HOH O 6 .   ? 20.700  51.289 33.373 1.00 51.55  ? 2256 HOH A O   1 
HETATM 4852 O  O   . HOH O 6 .   ? 21.311  54.141 34.133 1.00 51.58  ? 2257 HOH A O   1 
HETATM 4853 O  O   . HOH O 6 .   ? 19.846  86.007 67.064 1.00 73.03  ? 2258 HOH A O   1 
HETATM 4854 O  O   . HOH O 6 .   ? -9.959  56.565 45.244 1.00 38.30  ? 2259 HOH A O   1 
HETATM 4855 O  O   . HOH O 6 .   ? -12.623 56.208 43.996 1.00 105.67 ? 2260 HOH A O   1 
HETATM 4856 O  O   . HOH O 6 .   ? -16.008 57.408 40.478 1.00 108.01 ? 2261 HOH A O   1 
HETATM 4857 O  O   . HOH O 6 .   ? -20.936 55.463 45.724 1.00 68.04  ? 2262 HOH A O   1 
HETATM 4858 O  O   . HOH O 6 .   ? -13.429 53.752 45.518 1.00 88.08  ? 2263 HOH A O   1 
HETATM 4859 O  O   . HOH O 6 .   ? -15.887 54.901 47.705 1.00 38.70  ? 2264 HOH A O   1 
HETATM 4860 O  O   . HOH O 6 .   ? -17.752 59.850 48.075 1.00 108.75 ? 2265 HOH A O   1 
HETATM 4861 O  O   . HOH O 6 .   ? -19.162 53.406 45.355 1.00 77.33  ? 2266 HOH A O   1 
HETATM 4862 O  O   . HOH O 6 .   ? -20.987 59.385 46.782 1.00 68.48  ? 2267 HOH A O   1 
HETATM 4863 O  O   . HOH O 6 .   ? -14.499 56.078 42.055 1.00 59.92  ? 2268 HOH A O   1 
HETATM 4864 O  O   . HOH O 6 .   ? -18.080 58.005 41.956 1.00 58.63  ? 2269 HOH A O   1 
HETATM 4865 O  O   . HOH O 6 .   ? -20.196 59.657 44.410 1.00 74.90  ? 2270 HOH A O   1 
HETATM 4866 O  O   . HOH O 6 .   ? 16.897  94.328 59.997 1.00 71.43  ? 2271 HOH A O   1 
HETATM 4867 O  O   . HOH O 6 .   ? 3.965   90.802 73.356 1.00 53.34  ? 2272 HOH A O   1 
HETATM 4868 O  O   . HOH O 6 .   ? 5.598   93.129 74.205 1.00 66.53  ? 2273 HOH A O   1 
HETATM 4869 O  O   . HOH O 6 .   ? 10.909  89.007 72.978 1.00 37.78  ? 2274 HOH A O   1 
HETATM 4870 O  O   . HOH O 6 .   ? 18.017  90.506 66.622 1.00 37.71  ? 2275 HOH A O   1 
HETATM 4871 O  O   . HOH O 6 .   ? 20.757  89.196 51.967 1.00 66.84  ? 2276 HOH A O   1 
HETATM 4872 O  O   . HOH O 6 .   ? 2.293   89.064 74.531 1.00 68.67  ? 2277 HOH A O   1 
HETATM 4873 O  O   . HOH O 6 .   ? 3.663   94.392 72.493 1.00 94.55  ? 2278 HOH A O   1 
HETATM 4874 O  O   . HOH O 6 .   ? 7.057   95.373 74.160 1.00 37.71  ? 2279 HOH A O   1 
HETATM 4875 O  O   . HOH O 6 .   ? -18.666 60.762 42.426 1.00 41.76  ? 2280 HOH A O   1 
HETATM 4876 O  O   . HOH O 6 .   ? -17.902 69.034 49.103 1.00 27.66  ? 2281 HOH A O   1 
HETATM 4877 O  O   . HOH O 6 .   ? -21.795 68.149 49.736 1.00 52.97  ? 2282 HOH A O   1 
HETATM 4878 O  O   . HOH O 6 .   ? -17.150 63.751 38.992 1.00 68.99  ? 2283 HOH A O   1 
HETATM 4879 O  O   . HOH O 6 .   ? -14.416 66.801 40.695 1.00 54.77  ? 2284 HOH A O   1 
HETATM 4880 O  O   . HOH O 6 .   ? -21.639 70.574 47.785 1.00 69.29  ? 2285 HOH A O   1 
HETATM 4881 O  O   . HOH O 6 .   ? -7.705  38.844 52.662 1.00 78.12  ? 2286 HOH A O   1 
HETATM 4882 O  O   . HOH O 6 .   ? -11.832 39.269 54.033 1.00 76.65  ? 2287 HOH A O   1 
HETATM 4883 O  O   . HOH O 6 .   ? -5.946  39.655 55.275 1.00 63.09  ? 2288 HOH A O   1 
HETATM 4884 O  O   . HOH O 6 .   ? -21.771 68.837 43.569 1.00 45.38  ? 2289 HOH A O   1 
HETATM 4885 O  O   . HOH O 6 .   ? -19.590 43.875 53.592 1.00 37.49  ? 2290 HOH A O   1 
HETATM 4886 O  O   . HOH O 6 .   ? -19.264 45.814 55.541 1.00 56.78  ? 2291 HOH A O   1 
HETATM 4887 O  O   . HOH O 6 .   ? -8.071  40.773 50.050 1.00 76.40  ? 2292 HOH A O   1 
HETATM 4888 O  O   . HOH O 6 .   ? -23.136 50.469 53.733 1.00 68.37  ? 2293 HOH A O   1 
HETATM 4889 O  O   . HOH O 6 .   ? 25.947  63.069 38.824 1.00 48.50  ? 2294 HOH A O   1 
HETATM 4890 O  O   . HOH O 6 .   ? 27.423  60.485 39.197 1.00 96.87  ? 2295 HOH A O   1 
HETATM 4891 O  O   . HOH O 6 .   ? -23.019 66.528 39.574 1.00 76.05  ? 2296 HOH A O   1 
HETATM 4892 O  O   . HOH O 6 .   ? -20.831 71.651 35.885 1.00 57.85  ? 2297 HOH A O   1 
HETATM 4893 O  O   . HOH O 6 .   ? -25.058 72.210 41.539 1.00 56.36  ? 2298 HOH A O   1 
HETATM 4894 O  O   . HOH O 6 .   ? -25.627 75.344 43.276 1.00 88.66  ? 2299 HOH A O   1 
HETATM 4895 O  O   . HOH O 6 .   ? -27.029 77.053 40.434 1.00 37.59  ? 2300 HOH A O   1 
HETATM 4896 O  O   . HOH O 6 .   ? -6.830  52.679 40.939 1.00 66.74  ? 2301 HOH A O   1 
HETATM 4897 O  O   . HOH O 6 .   ? -10.328 59.037 40.697 1.00 53.93  ? 2302 HOH A O   1 
HETATM 4898 O  O   . HOH O 6 .   ? -9.930  61.398 41.305 1.00 61.78  ? 2303 HOH A O   1 
HETATM 4899 O  O   . HOH O 6 .   ? -11.111 61.563 39.077 1.00 49.08  ? 2304 HOH A O   1 
HETATM 4900 O  O   . HOH O 6 .   ? 33.432  76.657 55.052 1.00 101.91 ? 2305 HOH A O   1 
HETATM 4901 O  O   . HOH O 6 .   ? 23.461  64.666 22.477 1.00 80.21  ? 2306 HOH A O   1 
HETATM 4902 O  O   . HOH O 6 .   ? -20.216 75.744 37.772 1.00 32.34  ? 2307 HOH A O   1 
HETATM 4903 O  O   . HOH O 6 .   ? -23.626 77.338 36.310 1.00 74.23  ? 2308 HOH A O   1 
HETATM 4904 O  O   . HOH O 6 .   ? -21.264 77.921 36.627 1.00 37.99  ? 2309 HOH A O   1 
HETATM 4905 O  O   . HOH O 6 .   ? -20.963 81.766 45.338 1.00 48.56  ? 2310 HOH A O   1 
HETATM 4906 O  O   . HOH O 6 .   ? -23.889 80.710 42.013 1.00 48.04  ? 2311 HOH A O   1 
HETATM 4907 O  O   . HOH O 6 .   ? -23.318 78.449 44.662 1.00 78.54  ? 2312 HOH A O   1 
HETATM 4908 O  O   . HOH O 6 .   ? -0.762  67.177 31.164 1.00 41.79  ? 2313 HOH A O   1 
HETATM 4909 O  O   . HOH O 6 .   ? -16.358 76.876 50.309 1.00 95.01  ? 2314 HOH A O   1 
HETATM 4910 O  O   . HOH O 6 .   ? -14.448 78.792 50.486 1.00 41.08  ? 2315 HOH A O   1 
HETATM 4911 O  O   . HOH O 6 .   ? -20.229 78.205 47.363 1.00 43.49  ? 2316 HOH A O   1 
HETATM 4912 O  O   . HOH O 6 .   ? -15.464 84.346 46.438 1.00 50.31  ? 2317 HOH A O   1 
HETATM 4913 O  O   . HOH O 6 .   ? -18.794 77.900 49.866 1.00 59.31  ? 2318 HOH A O   1 
HETATM 4914 O  O   . HOH O 6 .   ? -18.614 80.617 51.787 1.00 76.27  ? 2319 HOH A O   1 
HETATM 4915 O  O   . HOH O 6 .   ? 9.275   73.837 31.229 1.00 46.60  ? 2320 HOH A O   1 
HETATM 4916 O  O   . HOH O 6 .   ? -10.224 84.600 53.615 1.00 60.00  ? 2321 HOH A O   1 
HETATM 4917 O  O   . HOH O 6 .   ? -15.986 81.146 51.127 1.00 71.39  ? 2322 HOH A O   1 
HETATM 4918 O  O   . HOH O 6 .   ? -14.549 77.430 52.640 1.00 40.99  ? 2323 HOH A O   1 
HETATM 4919 O  O   . HOH O 6 .   ? -10.306 82.069 55.657 1.00 36.42  ? 2324 HOH A O   1 
HETATM 4920 O  O   . HOH O 6 .   ? -2.612  80.019 56.496 1.00 42.47  ? 2325 HOH A O   1 
HETATM 4921 O  O   . HOH O 6 .   ? -15.656 77.970 54.974 1.00 83.51  ? 2326 HOH A O   1 
HETATM 4922 O  O   . HOH O 6 .   ? -2.653  77.646 55.204 1.00 72.30  ? 2327 HOH A O   1 
HETATM 4923 O  O   . HOH O 6 .   ? -9.654  70.596 54.834 1.00 25.83  ? 2328 HOH A O   1 
HETATM 4924 O  O   . HOH O 6 .   ? -15.161 73.179 54.347 1.00 35.98  ? 2329 HOH A O   1 
HETATM 4925 O  O   . HOH O 6 .   ? -17.441 71.423 54.884 1.00 74.61  ? 2330 HOH A O   1 
HETATM 4926 O  O   . HOH O 6 .   ? -14.492 75.631 59.884 1.00 79.76  ? 2331 HOH A O   1 
HETATM 4927 O  O   . HOH O 6 .   ? -19.702 72.333 56.310 1.00 76.48  ? 2332 HOH A O   1 
HETATM 4928 O  O   . HOH O 6 .   ? -9.547  62.605 59.883 1.00 20.59  ? 2333 HOH A O   1 
HETATM 4929 O  O   . HOH O 6 .   ? -12.118 63.365 59.505 1.00 23.43  ? 2334 HOH A O   1 
HETATM 4930 O  O   . HOH O 6 .   ? -14.456 66.107 67.156 1.00 37.23  ? 2335 HOH A O   1 
HETATM 4931 O  O   . HOH O 6 .   ? -8.648  61.264 63.700 1.00 22.11  ? 2336 HOH A O   1 
HETATM 4932 O  O   . HOH O 6 .   ? -10.366 66.093 69.013 1.00 27.68  ? 2337 HOH A O   1 
HETATM 4933 O  O   . HOH O 6 .   ? 10.048  49.051 37.345 1.00 64.70  ? 2338 HOH A O   1 
HETATM 4934 O  O   . HOH O 6 .   ? 8.880   51.427 34.870 1.00 106.58 ? 2339 HOH A O   1 
HETATM 4935 O  O   . HOH O 6 .   ? -0.646  65.495 73.079 1.00 39.40  ? 2340 HOH A O   1 
HETATM 4936 O  O   . HOH O 6 .   ? -3.560  62.539 75.202 1.00 44.65  ? 2341 HOH A O   1 
HETATM 4937 O  O   . HOH O 6 .   ? -4.225  68.205 65.856 1.00 34.05  ? 2342 HOH A O   1 
HETATM 4938 O  O   . HOH O 6 .   ? 13.351  65.515 30.594 1.00 62.93  ? 2343 HOH A O   1 
HETATM 4939 O  O   . HOH O 6 .   ? -8.491  65.452 71.034 1.00 34.75  ? 2344 HOH A O   1 
HETATM 4940 O  O   . HOH O 6 .   ? -5.887  73.084 72.434 1.00 58.41  ? 2345 HOH A O   1 
HETATM 4941 O  O   . HOH O 6 .   ? 1.127   70.404 68.779 1.00 25.38  ? 2346 HOH A O   1 
HETATM 4942 O  O   . HOH O 6 .   ? -9.520  71.711 72.336 1.00 54.76  ? 2347 HOH A O   1 
HETATM 4943 O  O   . HOH O 6 .   ? -2.941  66.857 74.590 1.00 41.56  ? 2348 HOH A O   1 
HETATM 4944 O  O   . HOH O 6 .   ? -11.330 69.189 74.621 1.00 49.15  ? 2349 HOH A O   1 
HETATM 4945 O  O   . HOH O 6 .   ? -10.311 67.670 72.576 1.00 68.82  ? 2350 HOH A O   1 
HETATM 4946 O  O   . HOH O 6 .   ? -3.328  69.124 79.220 1.00 39.59  ? 2351 HOH A O   1 
HETATM 4947 O  O   . HOH O 6 .   ? 8.955   49.934 59.191 1.00 76.21  ? 2352 HOH A O   1 
HETATM 4948 O  O   . HOH O 6 .   ? 13.382  50.939 60.985 1.00 59.08  ? 2353 HOH A O   1 
HETATM 4949 O  O   . HOH O 6 .   ? 10.732  49.356 54.678 1.00 30.55  ? 2354 HOH A O   1 
HETATM 4950 O  O   . HOH O 6 .   ? 7.538   46.414 62.539 1.00 91.14  ? 2355 HOH A O   1 
HETATM 4951 O  O   . HOH O 6 .   ? 10.437  47.382 62.408 1.00 91.37  ? 2356 HOH A O   1 
HETATM 4952 O  O   . HOH O 6 .   ? -1.990  65.993 77.066 1.00 51.76  ? 2357 HOH A O   1 
HETATM 4953 O  O   . HOH O 6 .   ? 1.209   71.720 80.481 1.00 45.54  ? 2358 HOH A O   1 
HETATM 4954 O  O   . HOH O 6 .   ? 0.620   64.135 75.429 1.00 55.98  ? 2359 HOH A O   1 
HETATM 4955 O  O   . HOH O 6 .   ? -1.108  64.725 79.252 1.00 108.59 ? 2360 HOH A O   1 
HETATM 4956 O  O   . HOH O 6 .   ? 4.124   67.560 78.316 1.00 87.87  ? 2361 HOH A O   1 
HETATM 4957 O  O   . HOH O 6 .   ? 4.814   48.061 63.185 1.00 31.61  ? 2362 HOH A O   1 
HETATM 4958 O  O   . HOH O 6 .   ? 5.548   46.071 59.811 1.00 56.82  ? 2363 HOH A O   1 
HETATM 4959 O  O   . HOH O 6 .   ? 4.008   44.105 55.829 1.00 27.69  ? 2364 HOH A O   1 
HETATM 4960 O  O   . HOH O 6 .   ? 2.573   40.109 59.186 1.00 46.61  ? 2365 HOH A O   1 
HETATM 4961 O  O   . HOH O 6 .   ? 3.686   44.504 63.512 1.00 41.18  ? 2366 HOH A O   1 
HETATM 4962 O  O   . HOH O 6 .   ? 2.039   41.484 63.464 1.00 52.73  ? 2367 HOH A O   1 
HETATM 4963 O  O   . HOH O 6 .   ? 5.901   42.712 59.427 1.00 75.57  ? 2368 HOH A O   1 
HETATM 4964 O  O   . HOH O 6 .   ? 6.560   43.939 63.237 1.00 77.80  ? 2369 HOH A O   1 
HETATM 4965 O  O   . HOH O 6 .   ? 0.324   78.707 79.522 1.00 156.98 ? 2370 HOH A O   1 
HETATM 4966 O  O   . HOH O 6 .   ? 0.479   75.618 78.990 1.00 55.27  ? 2371 HOH A O   1 
HETATM 4967 O  O   . HOH O 6 .   ? -6.871  40.622 64.366 1.00 52.87  ? 2372 HOH A O   1 
HETATM 4968 O  O   . HOH O 6 .   ? -4.531  38.769 60.962 1.00 37.40  ? 2373 HOH A O   1 
HETATM 4969 O  O   . HOH O 6 .   ? -1.898  40.202 64.412 1.00 51.65  ? 2374 HOH A O   1 
HETATM 4970 O  O   . HOH O 6 .   ? -3.770  39.753 66.271 1.00 97.25  ? 2375 HOH A O   1 
HETATM 4971 O  O   . HOH O 6 .   ? -1.772  38.948 57.331 1.00 41.23  ? 2376 HOH A O   1 
HETATM 4972 O  O   . HOH O 6 .   ? 1.706   40.945 67.155 1.00 73.11  ? 2377 HOH A O   1 
HETATM 4973 O  O   . HOH O 6 .   ? 3.924   45.208 66.165 1.00 42.63  ? 2378 HOH A O   1 
HETATM 4974 O  O   . HOH O 6 .   ? -1.087  81.878 77.013 1.00 67.03  ? 2379 HOH A O   1 
HETATM 4975 O  O   . HOH O 6 .   ? -0.749  81.842 72.793 1.00 76.20  ? 2380 HOH A O   1 
HETATM 4976 O  O   . HOH O 6 .   ? 1.672   79.840 77.571 1.00 78.59  ? 2381 HOH A O   1 
HETATM 4977 O  O   . HOH O 6 .   ? 1.105   83.115 76.083 1.00 83.11  ? 2382 HOH A O   1 
HETATM 4978 O  O   . HOH O 6 .   ? -4.377  41.254 55.315 1.00 38.16  ? 2383 HOH A O   1 
HETATM 4979 O  O   . HOH O 6 .   ? -4.061  39.708 58.403 1.00 41.27  ? 2384 HOH A O   1 
HETATM 4980 O  O   . HOH O 6 .   ? -9.753  37.524 60.993 1.00 65.45  ? 2385 HOH A O   1 
HETATM 4981 O  O   . HOH O 6 .   ? -7.184  37.292 61.057 1.00 69.08  ? 2386 HOH A O   1 
HETATM 4982 O  O   . HOH O 6 .   ? -8.167  38.446 63.567 1.00 83.41  ? 2387 HOH A O   1 
HETATM 4983 O  O   . HOH O 6 .   ? -11.407 39.313 65.308 1.00 57.57  ? 2388 HOH A O   1 
HETATM 4984 O  O   . HOH O 6 .   ? -1.599  44.384 73.174 1.00 70.47  ? 2389 HOH A O   1 
HETATM 4985 O  O   . HOH O 6 .   ? -3.931  45.435 73.814 1.00 65.27  ? 2390 HOH A O   1 
HETATM 4986 O  O   . HOH O 6 .   ? -1.328  46.714 74.777 1.00 58.98  ? 2391 HOH A O   1 
HETATM 4987 O  O   . HOH O 6 .   ? -7.123  40.785 66.902 1.00 44.64  ? 2392 HOH A O   1 
HETATM 4988 O  O   . HOH O 6 .   ? 2.352   81.224 73.764 1.00 38.54  ? 2393 HOH A O   1 
HETATM 4989 O  O   . HOH O 6 .   ? 4.225   83.729 69.739 1.00 72.30  ? 2394 HOH A O   1 
HETATM 4990 O  O   . HOH O 6 .   ? 4.855   79.829 68.240 1.00 41.25  ? 2395 HOH A O   1 
HETATM 4991 O  O   . HOH O 6 .   ? 4.012   82.617 72.267 1.00 65.78  ? 2396 HOH A O   1 
HETATM 4992 O  O   . HOH O 6 .   ? -10.214 46.638 76.039 1.00 46.29  ? 2397 HOH A O   1 
HETATM 4993 O  O   . HOH O 6 .   ? -5.532  44.932 75.752 1.00 37.72  ? 2398 HOH A O   1 
HETATM 4994 O  O   . HOH O 6 .   ? -1.074  72.431 73.702 1.00 29.10  ? 2399 HOH A O   1 
HETATM 4995 O  O   . HOH O 6 .   ? -13.608 38.049 68.586 1.00 76.24  ? 2400 HOH A O   1 
HETATM 4996 O  O   . HOH O 6 .   ? -13.079 44.905 76.387 1.00 75.74  ? 2401 HOH A O   1 
HETATM 4997 O  O   . HOH O 6 .   ? -14.601 48.029 77.942 1.00 60.73  ? 2402 HOH A O   1 
HETATM 4998 O  O   . HOH O 6 .   ? -16.024 41.731 72.497 1.00 55.74  ? 2403 HOH A O   1 
HETATM 4999 O  O   . HOH O 6 .   ? -1.673  79.945 71.002 1.00 46.06  ? 2404 HOH A O   1 
HETATM 5000 O  O   . HOH O 6 .   ? -3.622  73.604 73.908 1.00 46.34  ? 2405 HOH A O   1 
HETATM 5001 O  O   . HOH O 6 .   ? -21.990 50.236 77.753 1.00 77.95  ? 2406 HOH A O   1 
HETATM 5002 O  O   . HOH O 6 .   ? -22.254 50.814 74.016 1.00 81.36  ? 2407 HOH A O   1 
HETATM 5003 O  O   . HOH O 6 .   ? -25.447 39.901 68.711 1.00 61.41  ? 2408 HOH A O   1 
HETATM 5004 O  O   . HOH O 6 .   ? -23.672 39.790 71.397 1.00 81.00  ? 2409 HOH A O   1 
HETATM 5005 O  O   . HOH O 6 .   ? -13.468 38.113 62.451 1.00 69.90  ? 2410 HOH A O   1 
HETATM 5006 O  O   . HOH O 6 .   ? -11.453 36.524 63.322 1.00 37.80  ? 2411 HOH A O   1 
HETATM 5007 O  O   . HOH O 6 .   ? 0.472   77.771 62.429 1.00 26.23  ? 2412 HOH A O   1 
HETATM 5008 O  O   . HOH O 6 .   ? -26.220 38.123 65.380 1.00 83.04  ? 2413 HOH A O   1 
HETATM 5009 O  O   . HOH O 6 .   ? -18.017 36.647 58.060 1.00 81.65  ? 2414 HOH A O   1 
HETATM 5010 O  O   . HOH O 6 .   ? -0.221  69.792 62.687 1.00 21.62  ? 2415 HOH A O   1 
HETATM 5011 O  O   . HOH O 6 .   ? -14.013 39.107 55.723 1.00 81.95  ? 2416 HOH A O   1 
HETATM 5012 O  O   . HOH O 6 .   ? -23.573 43.667 59.300 1.00 98.05  ? 2417 HOH A O   1 
HETATM 5013 O  O   . HOH O 6 .   ? -25.712 46.316 65.975 1.00 86.65  ? 2418 HOH A O   1 
HETATM 5014 O  O   . HOH O 6 .   ? -27.520 46.198 62.936 1.00 77.68  ? 2419 HOH A O   1 
HETATM 5015 O  O   . HOH O 6 .   ? -27.773 39.317 67.214 1.00 78.65  ? 2420 HOH A O   1 
HETATM 5016 O  O   . HOH O 6 .   ? -27.385 39.293 63.219 1.00 37.87  ? 2421 HOH A O   1 
HETATM 5017 O  O   . HOH O 6 .   ? -2.107  68.947 66.984 1.00 35.26  ? 2422 HOH A O   1 
HETATM 5018 O  O   . HOH O 6 .   ? -3.447  76.373 64.826 1.00 34.97  ? 2423 HOH A O   1 
HETATM 5019 O  O   . HOH O 6 .   ? -5.902  74.774 69.965 1.00 45.35  ? 2424 HOH A O   1 
HETATM 5020 O  O   . HOH O 6 .   ? -9.263  76.450 67.534 1.00 77.96  ? 2425 HOH A O   1 
HETATM 5021 O  O   . HOH O 6 .   ? -5.858  76.940 66.396 1.00 48.47  ? 2426 HOH A O   1 
HETATM 5022 O  O   . HOH O 6 .   ? -7.714  73.306 67.771 1.00 39.71  ? 2427 HOH A O   1 
HETATM 5023 O  O   . HOH O 6 .   ? -9.185  79.959 64.654 1.00 64.57  ? 2428 HOH A O   1 
HETATM 5024 O  O   . HOH O 6 .   ? -24.656 61.374 62.760 1.00 79.67  ? 2429 HOH A O   1 
HETATM 5025 O  O   . HOH O 6 .   ? -24.094 50.474 71.812 1.00 78.26  ? 2430 HOH A O   1 
HETATM 5026 O  O   . HOH O 6 .   ? -19.962 65.036 66.099 1.00 69.60  ? 2431 HOH A O   1 
HETATM 5027 O  O   . HOH O 6 .   ? -18.934 63.607 70.348 1.00 58.01  ? 2432 HOH A O   1 
HETATM 5028 O  O   . HOH O 6 .   ? -17.773 61.870 72.220 1.00 61.28  ? 2433 HOH A O   1 
HETATM 5029 O  O   . HOH O 6 .   ? -12.162 80.631 56.260 1.00 85.26  ? 2434 HOH A O   1 
HETATM 5030 O  O   . HOH O 6 .   ? -7.343  81.407 61.842 1.00 84.35  ? 2435 HOH A O   1 
HETATM 5031 O  O   . HOH O 6 .   ? -14.284 76.790 57.690 1.00 49.27  ? 2436 HOH A O   1 
HETATM 5032 O  O   . HOH O 6 .   ? -8.072  82.991 57.038 1.00 74.10  ? 2437 HOH A O   1 
HETATM 5033 O  O   . HOH O 6 .   ? -13.617 82.356 57.806 1.00 74.77  ? 2438 HOH A O   1 
HETATM 5034 O  O   . HOH O 6 .   ? -11.585 73.060 65.732 1.00 43.20  ? 2439 HOH A O   1 
HETATM 5035 O  O   . HOH O 6 .   ? -6.841  81.539 59.182 1.00 47.05  ? 2440 HOH A O   1 
HETATM 5036 O  O   . HOH O 6 .   ? -18.964 56.823 75.323 1.00 67.57  ? 2441 HOH A O   1 
HETATM 5037 O  O   . HOH O 6 .   ? -16.922 64.399 73.547 1.00 62.57  ? 2442 HOH A O   1 
HETATM 5038 O  O   . HOH O 6 .   ? -17.125 63.019 76.132 1.00 37.65  ? 2443 HOH A O   1 
HETATM 5039 O  O   . HOH O 6 .   ? 1.479   56.640 73.171 1.00 47.92  ? 2444 HOH A O   1 
HETATM 5040 O  O   . HOH O 6 .   ? -18.320 70.138 62.455 1.00 53.47  ? 2445 HOH A O   1 
HETATM 5041 O  O   . HOH O 6 .   ? -18.081 71.685 65.633 1.00 76.69  ? 2446 HOH A O   1 
HETATM 5042 O  O   . HOH O 6 .   ? -13.238 77.440 64.237 1.00 90.91  ? 2447 HOH A O   1 
HETATM 5043 O  O   . HOH O 6 .   ? -16.822 75.606 65.782 1.00 38.01  ? 2448 HOH A O   1 
HETATM 5044 O  O   . HOH O 6 .   ? -20.652 75.545 62.090 1.00 87.85  ? 2449 HOH A O   1 
HETATM 5045 O  O   . HOH O 6 .   ? -19.171 72.133 59.989 1.00 82.72  ? 2450 HOH A O   1 
HETATM 5046 O  O   . HOH O 6 .   ? -14.277 77.603 61.331 1.00 50.33  ? 2451 HOH A O   1 
HETATM 5047 O  O   . HOH O 6 .   ? -17.195 76.544 60.268 1.00 79.30  ? 2452 HOH A O   1 
HETATM 5048 O  O   . HOH O 6 .   ? 8.246   48.712 77.160 1.00 89.72  ? 2453 HOH A O   1 
HETATM 5049 O  O   . HOH O 6 .   ? 2.523   59.875 69.836 1.00 74.78  ? 2454 HOH A O   1 
HETATM 5050 O  O   . HOH O 6 .   ? 3.933   59.723 74.121 1.00 60.93  ? 2455 HOH A O   1 
HETATM 5051 O  O   . HOH O 6 .   ? 7.340   47.519 64.970 1.00 58.85  ? 2456 HOH A O   1 
HETATM 5052 O  O   . HOH O 6 .   ? -14.259 71.815 65.845 1.00 32.81  ? 2457 HOH A O   1 
HETATM 5053 O  O   . HOH O 6 .   ? -16.692 68.798 65.284 1.00 51.97  ? 2458 HOH A O   1 
HETATM 5054 O  O   . HOH O 6 .   ? -19.479 67.959 61.425 1.00 60.25  ? 2459 HOH A O   1 
HETATM 5055 O  O   . HOH O 6 .   ? -12.821 65.047 58.329 1.00 116.18 ? 2460 HOH A O   1 
HETATM 5056 O  O   . HOH O 6 .   ? -19.697 70.251 58.233 1.00 66.89  ? 2461 HOH A O   1 
HETATM 5057 O  O   . HOH O 6 .   ? -18.030 65.772 61.622 1.00 28.35  ? 2462 HOH A O   1 
HETATM 5058 O  O   . HOH O 6 .   ? -20.093 59.959 59.376 1.00 30.64  ? 2463 HOH A O   1 
HETATM 5059 O  O   . HOH O 6 .   ? -13.412 62.691 57.083 1.00 23.67  ? 2464 HOH A O   1 
HETATM 5060 O  O   . HOH O 6 .   ? -14.792 60.279 57.364 1.00 23.67  ? 2465 HOH A O   1 
HETATM 5061 O  O   . HOH O 6 .   ? -19.469 63.551 61.134 1.00 36.15  ? 2466 HOH A O   1 
HETATM 5062 O  O   . HOH O 6 .   ? 0.788   44.123 41.508 1.00 68.06  ? 2467 HOH A O   1 
HETATM 5063 O  O   . HOH O 6 .   ? -0.057  47.982 40.523 1.00 52.29  ? 2468 HOH A O   1 
HETATM 5064 O  O   . HOH O 6 .   ? -0.548  40.893 48.091 1.00 62.50  ? 2469 HOH A O   1 
HETATM 5065 O  O   . HOH O 6 .   ? -20.802 69.882 55.864 1.00 68.98  ? 2470 HOH A O   1 
HETATM 5066 O  O   . HOH O 6 .   ? -15.324 66.833 52.082 1.00 23.81  ? 2471 HOH A O   1 
HETATM 5067 O  O   . HOH O 6 .   ? -21.357 67.263 54.850 1.00 65.23  ? 2472 HOH A O   1 
HETATM 5068 O  O   . HOH O 6 .   ? -20.059 69.718 51.328 1.00 36.42  ? 2473 HOH A O   1 
HETATM 5069 O  O   . HOH O 6 .   ? -4.605  47.484 43.629 1.00 66.55  ? 2474 HOH A O   1 
HETATM 5070 O  O   . HOH O 6 .   ? 4.754   40.537 48.254 1.00 58.77  ? 2475 HOH A O   1 
HETATM 5071 O  O   . HOH O 6 .   ? 8.165   42.655 54.504 1.00 49.10  ? 2476 HOH A O   1 
HETATM 5072 O  O   . HOH O 6 .   ? 10.720  44.383 54.369 1.00 44.73  ? 2477 HOH A O   1 
HETATM 5073 O  O   . HOH O 6 .   ? 13.285  42.839 50.542 1.00 50.79  ? 2478 HOH A O   1 
HETATM 5074 O  O   . HOH O 6 .   ? 5.986   44.548 54.030 1.00 25.10  ? 2479 HOH A O   1 
HETATM 5075 O  O   . HOH O 6 .   ? 16.257  48.002 56.636 1.00 82.31  ? 2480 HOH A O   1 
HETATM 5076 O  O   . HOH O 6 .   ? 20.449  46.217 54.625 1.00 89.89  ? 2481 HOH A O   1 
HETATM 5077 O  O   . HOH O 6 .   ? 20.163  44.436 49.750 1.00 73.79  ? 2482 HOH A O   1 
HETATM 5078 O  O   . HOH O 6 .   ? 13.637  47.472 55.955 1.00 75.42  ? 2483 HOH A O   1 
HETATM 5079 O  O   . HOH O 6 .   ? -18.811 72.683 51.596 1.00 51.40  ? 2484 HOH A O   1 
HETATM 5080 O  O   . HOH O 6 .   ? 9.334   41.181 45.242 1.00 57.93  ? 2485 HOH A O   1 
HETATM 5081 O  O   . HOH O 6 .   ? 6.672   39.468 46.202 1.00 37.74  ? 2486 HOH A O   1 
HETATM 5082 O  O   . HOH O 6 .   ? 11.525  40.163 48.012 1.00 90.36  ? 2487 HOH A O   1 
HETATM 5083 O  O   . HOH O 6 .   ? 13.466  47.543 36.655 1.00 69.30  ? 2488 HOH A O   1 
HETATM 5084 O  O   . HOH O 6 .   ? 15.142  45.512 35.896 1.00 84.49  ? 2489 HOH A O   1 
HETATM 5085 O  O   . HOH O 6 .   ? 17.512  46.508 36.431 1.00 67.42  ? 2490 HOH A O   1 
HETATM 5086 O  O   . HOH O 6 .   ? 3.448   44.289 40.924 1.00 72.94  ? 2491 HOH A O   1 
HETATM 5087 O  O   . HOH O 6 .   ? 5.927   43.719 41.877 1.00 65.44  ? 2492 HOH A O   1 
HETATM 5088 O  O   . HOH O 6 .   ? 14.405  49.915 34.066 1.00 60.84  ? 2493 HOH A O   1 
HETATM 5089 O  O   . HOH O 6 .   ? 15.900  48.510 36.128 1.00 56.04  ? 2494 HOH A O   1 
HETATM 5090 O  O   . HOH O 6 .   ? 14.217  53.518 33.473 1.00 84.84  ? 2495 HOH A O   1 
HETATM 5091 O  O   . HOH O 6 .   ? 15.045  58.858 34.252 1.00 72.67  ? 2496 HOH A O   1 
HETATM 5092 O  O   . HOH O 6 .   ? -3.701  83.646 52.092 1.00 32.76  ? 2497 HOH A O   1 
HETATM 5093 O  O   . HOH O 6 .   ? -1.787  92.425 39.488 1.00 66.82  ? 2498 HOH A O   1 
HETATM 5094 O  O   . HOH O 6 .   ? 3.354   88.481 38.818 1.00 56.98  ? 2499 HOH A O   1 
HETATM 5095 O  O   . HOH O 6 .   ? 0.749   87.934 42.702 1.00 52.59  ? 2500 HOH A O   1 
HETATM 5096 O  O   . HOH O 6 .   ? 2.529   88.353 41.206 1.00 58.91  ? 2501 HOH A O   1 
HETATM 5097 O  O   . HOH O 6 .   ? 21.905  76.041 66.979 1.00 61.16  ? 2502 HOH A O   1 
HETATM 5098 O  O   . HOH O 6 .   ? 2.041   86.927 37.076 1.00 44.90  ? 2503 HOH A O   1 
HETATM 5099 O  O   . HOH O 6 .   ? 0.736   86.278 33.012 1.00 55.54  ? 2504 HOH A O   1 
HETATM 5100 O  O   . HOH O 6 .   ? -5.175  88.198 35.330 1.00 42.05  ? 2505 HOH A O   1 
HETATM 5101 O  O   . HOH O 6 .   ? -10.924 82.767 33.466 1.00 42.67  ? 2506 HOH A O   1 
HETATM 5102 O  O   . HOH O 6 .   ? -3.209  86.789 32.849 1.00 36.74  ? 2507 HOH A O   1 
HETATM 5103 O  O   . HOH O 6 .   ? 4.770   63.715 71.157 1.00 139.76 ? 2508 HOH A O   1 
HETATM 5104 O  O   . HOH O 6 .   ? 5.218   64.370 81.513 1.00 74.09  ? 2509 HOH A O   1 
HETATM 5105 O  O   . HOH O 6 .   ? -3.985  82.686 32.494 1.00 40.84  ? 2510 HOH A O   1 
HETATM 5106 O  O   . HOH O 6 .   ? 2.600   83.423 32.589 1.00 52.65  ? 2511 HOH A O   1 
HETATM 5107 O  O   . HOH O 6 .   ? -3.367  78.072 31.264 1.00 43.04  ? 2512 HOH A O   1 
HETATM 5108 O  O   . HOH O 6 .   ? -5.947  84.046 31.428 1.00 82.77  ? 2513 HOH A O   1 
HETATM 5109 O  O   . HOH O 6 .   ? 11.591  63.751 86.359 1.00 75.00  ? 2514 HOH A O   1 
HETATM 5110 O  O   . HOH O 6 .   ? 6.015   77.000 31.331 1.00 61.00  ? 2515 HOH A O   1 
HETATM 5111 O  O   . HOH O 6 .   ? 0.610   74.441 29.679 1.00 60.26  ? 2516 HOH A O   1 
HETATM 5112 O  O   . HOH O 6 .   ? 4.342   75.227 29.504 1.00 52.37  ? 2517 HOH A O   1 
HETATM 5113 O  O   . HOH O 6 .   ? 7.262   78.242 33.357 1.00 68.29  ? 2518 HOH A O   1 
HETATM 5114 O  O   . HOH O 6 .   ? 3.346   81.036 32.655 1.00 45.74  ? 2519 HOH A O   1 
HETATM 5115 O  O   . HOH O 6 .   ? 11.111  80.112 77.442 1.00 86.14  ? 2520 HOH A O   1 
HETATM 5116 O  O   . HOH O 6 .   ? 13.099  77.480 78.857 1.00 48.44  ? 2521 HOH A O   1 
HETATM 5117 O  O   . HOH O 6 .   ? 15.534  76.280 82.213 1.00 79.96  ? 2522 HOH A O   1 
HETATM 5118 O  O   . HOH O 6 .   ? 11.688  78.899 81.961 1.00 94.44  ? 2523 HOH A O   1 
HETATM 5119 O  O   . HOH O 6 .   ? 16.280  76.458 79.121 1.00 101.31 ? 2524 HOH A O   1 
HETATM 5120 O  O   . HOH O 6 .   ? 23.743  73.263 78.121 1.00 59.31  ? 2525 HOH A O   1 
HETATM 5121 O  O   . HOH O 6 .   ? 19.396  74.245 77.535 1.00 44.06  ? 2526 HOH A O   1 
HETATM 5122 O  O   . HOH O 6 .   ? 8.587   78.894 38.680 1.00 64.74  ? 2527 HOH A O   1 
HETATM 5123 O  O   . HOH O 6 .   ? 7.582   78.387 36.023 1.00 37.83  ? 2528 HOH A O   1 
HETATM 5124 O  O   . HOH O 6 .   ? 7.800   75.917 34.764 1.00 51.30  ? 2529 HOH A O   1 
HETATM 5125 O  O   . HOH O 6 .   ? 17.344  63.276 87.691 1.00 60.26  ? 2530 HOH A O   1 
HETATM 5126 O  O   . HOH O 6 .   ? 21.282  64.084 85.586 1.00 67.02  ? 2531 HOH A O   1 
HETATM 5127 O  O   . HOH O 6 .   ? 17.832  67.532 87.005 1.00 67.04  ? 2532 HOH A O   1 
HETATM 5128 O  O   . HOH O 6 .   ? 24.306  50.099 80.123 1.00 84.28  ? 2533 HOH A O   1 
HETATM 5129 O  O   . HOH O 6 .   ? 24.335  52.064 83.901 1.00 69.12  ? 2534 HOH A O   1 
HETATM 5130 O  O   . HOH O 6 .   ? 20.199  61.317 89.243 1.00 59.39  ? 2535 HOH A O   1 
HETATM 5131 O  O   . HOH O 6 .   ? 17.598  50.636 83.319 1.00 108.67 ? 2536 HOH A O   1 
HETATM 5132 O  O   . HOH O 6 .   ? 14.671  50.685 82.070 1.00 58.21  ? 2537 HOH A O   1 
HETATM 5133 O  O   . HOH O 6 .   ? 17.971  52.327 85.644 1.00 72.61  ? 2538 HOH A O   1 
HETATM 5134 O  O   . HOH O 6 .   ? 13.827  49.611 79.865 1.00 93.88  ? 2539 HOH A O   1 
HETATM 5135 O  O   . HOH O 6 .   ? 16.285  48.607 80.067 1.00 77.80  ? 2540 HOH A O   1 
HETATM 5136 O  O   . HOH O 6 .   ? 9.787   55.145 83.634 1.00 52.49  ? 2541 HOH A O   1 
HETATM 5137 O  O   . HOH O 6 .   ? 9.479   54.414 80.814 1.00 47.84  ? 2542 HOH A O   1 
HETATM 5138 O  O   . HOH O 6 .   ? 11.387  41.186 73.178 1.00 74.40  ? 2543 HOH A O   1 
HETATM 5139 O  O   . HOH O 6 .   ? 11.634  40.803 70.581 1.00 62.58  ? 2544 HOH A O   1 
HETATM 5140 O  O   . HOH O 6 .   ? 7.350   44.642 66.281 1.00 56.74  ? 2545 HOH A O   1 
HETATM 5141 O  O   . HOH O 6 .   ? 12.305  44.799 63.857 1.00 80.24  ? 2546 HOH A O   1 
HETATM 5142 O  O   . HOH O 6 .   ? 14.862  46.368 62.583 1.00 48.61  ? 2547 HOH A O   1 
HETATM 5143 O  O   . HOH O 6 .   ? 11.785  41.960 75.732 1.00 74.63  ? 2548 HOH A O   1 
HETATM 5144 O  O   . HOH O 6 .   ? 14.322  46.547 80.016 1.00 75.50  ? 2549 HOH A O   1 
HETATM 5145 O  O   . HOH O 6 .   ? 15.319  37.810 74.004 1.00 76.07  ? 2550 HOH A O   1 
HETATM 5146 O  O   . HOH O 6 .   ? 18.422  37.625 72.370 1.00 70.81  ? 2551 HOH A O   1 
HETATM 5147 O  O   . HOH O 6 .   ? 23.743  46.319 80.471 1.00 62.17  ? 2552 HOH A O   1 
HETATM 5148 O  O   . HOH O 6 .   ? 17.833  48.157 82.210 1.00 65.34  ? 2553 HOH A O   1 
HETATM 5149 O  O   . HOH O 6 .   ? 2.731   65.852 65.153 1.00 33.80  ? 2554 HOH A O   1 
HETATM 5150 O  O   . HOH O 6 .   ? 0.710   66.238 68.387 1.00 35.94  ? 2555 HOH A O   1 
HETATM 5151 O  O   . HOH O 6 .   ? 0.481   67.827 64.414 1.00 23.91  ? 2556 HOH A O   1 
HETATM 5152 O  O   . HOH O 6 .   ? 28.941  58.492 69.404 1.00 64.77  ? 2557 HOH A O   1 
HETATM 5153 O  O   . HOH O 6 .   ? 30.693  56.760 66.918 1.00 66.14  ? 2558 HOH A O   1 
HETATM 5154 O  O   . HOH O 6 .   ? 28.057  59.159 71.734 1.00 68.76  ? 2559 HOH A O   1 
HETATM 5155 O  O   . HOH O 6 .   ? 27.510  61.130 74.634 1.00 38.81  ? 2560 HOH A O   1 
HETATM 5156 O  O   . HOH O 6 .   ? 31.416  59.435 69.748 1.00 74.22  ? 2561 HOH A O   1 
HETATM 5157 O  O   . HOH O 6 .   ? 30.838  60.589 72.280 1.00 64.49  ? 2562 HOH A O   1 
HETATM 5158 O  O   . HOH O 6 .   ? -7.167  68.391 57.988 1.00 23.12  ? 2563 HOH A O   1 
HETATM 5159 O  O   . HOH O 6 .   ? -4.045  70.339 62.540 1.00 20.52  ? 2564 HOH A O   1 
HETATM 5160 O  O   . HOH O 6 .   ? 33.633  59.722 86.047 1.00 98.45  ? 2565 HOH A O   1 
HETATM 5161 O  O   . HOH O 6 .   ? 34.254  65.486 79.593 1.00 78.42  ? 2566 HOH A O   1 
HETATM 5162 O  O   . HOH O 6 .   ? 34.776  63.390 82.968 1.00 68.25  ? 2567 HOH A O   1 
HETATM 5163 O  O   . HOH O 6 .   ? 38.413  62.916 79.839 1.00 84.16  ? 2568 HOH A O   1 
HETATM 5164 O  O   . HOH O 6 .   ? 29.016  67.847 83.657 1.00 37.71  ? 2569 HOH A O   1 
HETATM 5165 O  O   . HOH O 6 .   ? 27.621  65.921 85.112 1.00 76.09  ? 2570 HOH A O   1 
HETATM 5166 O  O   . HOH O 6 .   ? 28.246  51.987 85.788 1.00 70.04  ? 2571 HOH A O   1 
HETATM 5167 O  O   . HOH O 6 .   ? -7.380  70.781 56.605 1.00 22.91  ? 2572 HOH A O   1 
HETATM 5168 O  O   . HOH O 6 .   ? -8.141  71.798 52.905 1.00 26.76  ? 2573 HOH A O   1 
HETATM 5169 O  O   . HOH O 6 .   ? 22.462  66.410 85.805 1.00 71.60  ? 2574 HOH A O   1 
HETATM 5170 O  O   . HOH O 6 .   ? 32.628  61.788 87.642 1.00 37.73  ? 2575 HOH A O   1 
HETATM 5171 O  O   . HOH O 6 .   ? 27.992  70.555 79.934 1.00 37.61  ? 2576 HOH A O   1 
HETATM 5172 O  O   . HOH O 6 .   ? 27.621  67.991 75.974 1.00 40.98  ? 2577 HOH A O   1 
HETATM 5173 O  O   . HOH O 6 .   ? 31.671  68.132 76.022 1.00 83.84  ? 2578 HOH A O   1 
HETATM 5174 O  O   . HOH O 6 .   ? 26.064  64.806 72.723 1.00 48.85  ? 2579 HOH A O   1 
HETATM 5175 O  O   . HOH O 6 .   ? 20.732  73.798 75.349 1.00 47.63  ? 2580 HOH A O   1 
HETATM 5176 O  O   . HOH O 6 .   ? 25.212  70.837 71.881 1.00 107.93 ? 2581 HOH A O   1 
HETATM 5177 O  O   . HOH O 6 .   ? 26.506  70.767 75.052 1.00 57.84  ? 2582 HOH A O   1 
HETATM 5178 O  O   . HOH O 6 .   ? -4.795  83.629 61.186 1.00 37.56  ? 2583 HOH A O   1 
HETATM 5179 O  O   . HOH O 6 .   ? 0.615   83.029 57.823 1.00 37.68  ? 2584 HOH A O   1 
HETATM 5180 O  O   . HOH O 6 .   ? -4.252  80.601 58.604 1.00 37.78  ? 2585 HOH A O   1 
HETATM 5181 O  O   . HOH O 6 .   ? -4.794  80.603 62.995 1.00 42.51  ? 2586 HOH A O   1 
HETATM 5182 O  O   . HOH O 6 .   ? 0.568   82.613 63.309 1.00 77.99  ? 2587 HOH A O   1 
HETATM 5183 O  O   . HOH O 6 .   ? -0.376  80.407 64.674 1.00 71.27  ? 2588 HOH A O   1 
HETATM 5184 O  O   . HOH O 6 .   ? -2.222  78.233 62.796 1.00 36.08  ? 2589 HOH A O   1 
HETATM 5185 O  O   . HOH O 6 .   ? 28.185  61.471 70.323 1.00 69.38  ? 2590 HOH A O   1 
HETATM 5186 O  O   . HOH O 6 .   ? 25.470  68.158 71.086 1.00 77.23  ? 2591 HOH A O   1 
HETATM 5187 O  O   . HOH O 6 .   ? 0.051   69.605 59.917 1.00 19.91  ? 2592 HOH A O   1 
HETATM 5188 O  O   . HOH O 6 .   ? 3.769   69.293 58.006 1.00 20.19  ? 2593 HOH A O   1 
HETATM 5189 O  O   . HOH O 6 .   ? -1.765  75.863 52.926 1.00 28.42  ? 2594 HOH A O   1 
HETATM 5190 O  O   . HOH O 6 .   ? 4.082   80.893 51.508 1.00 24.72  ? 2595 HOH A O   1 
HETATM 5191 O  O   . HOH O 6 .   ? -2.428  83.670 57.693 1.00 81.82  ? 2596 HOH A O   1 
HETATM 5192 O  O   . HOH O 6 .   ? -3.795  85.998 53.984 1.00 46.49  ? 2597 HOH A O   1 
HETATM 5193 O  O   . HOH O 6 .   ? -2.366  90.154 55.620 1.00 74.62  ? 2598 HOH A O   1 
HETATM 5194 O  O   . HOH O 6 .   ? 22.358  51.454 51.495 1.00 53.33  ? 2599 HOH A O   1 
HETATM 5195 O  O   . HOH O 6 .   ? 1.230   85.596 58.570 1.00 93.65  ? 2600 HOH A O   1 
HETATM 5196 O  O   . HOH O 6 .   ? 0.448   88.779 56.200 1.00 73.88  ? 2601 HOH A O   1 
HETATM 5197 O  O   . HOH O 6 .   ? 24.853  52.564 48.189 1.00 66.27  ? 2602 HOH A O   1 
HETATM 5198 O  O   . HOH O 6 .   ? 22.984  58.045 35.703 1.00 56.28  ? 2603 HOH A O   1 
HETATM 5199 O  O   . HOH O 6 .   ? 20.737  51.251 36.924 1.00 75.52  ? 2604 HOH A O   1 
HETATM 5200 O  O   . HOH O 6 .   ? 21.063  56.624 35.160 1.00 52.78  ? 2605 HOH A O   1 
HETATM 5201 O  O   . HOH O 6 .   ? 14.713  56.349 34.262 1.00 60.82  ? 2606 HOH A O   1 
HETATM 5202 O  O   . HOH O 6 .   ? 15.945  52.533 35.450 1.00 55.73  ? 2607 HOH A O   1 
HETATM 5203 O  O   . HOH O 6 .   ? 19.055  55.089 33.724 1.00 60.87  ? 2608 HOH A O   1 
HETATM 5204 O  O   . HOH O 6 .   ? 1.129   84.520 44.691 1.00 119.34 ? 2609 HOH A O   1 
HETATM 5205 O  O   . HOH O 6 .   ? 4.407   86.806 41.848 1.00 46.17  ? 2610 HOH A O   1 
HETATM 5206 O  O   . HOH O 6 .   ? 5.680   92.987 43.142 1.00 63.93  ? 2611 HOH A O   1 
HETATM 5207 O  O   . HOH O 6 .   ? 19.314  66.515 32.690 1.00 73.08  ? 2612 HOH A O   1 
HETATM 5208 O  O   . HOH O 6 .   ? 10.640  87.833 43.868 1.00 52.36  ? 2613 HOH A O   1 
HETATM 5209 O  O   . HOH O 6 .   ? 9.124   88.678 48.381 1.00 33.60  ? 2614 HOH A O   1 
HETATM 5210 O  O   . HOH O 6 .   ? 23.795  69.154 37.295 1.00 62.55  ? 2615 HOH A O   1 
HETATM 5211 O  O   . HOH O 6 .   ? 13.494  84.716 43.771 1.00 39.87  ? 2616 HOH A O   1 
HETATM 5212 O  O   . HOH O 6 .   ? 11.583  80.722 41.150 1.00 67.52  ? 2617 HOH A O   1 
HETATM 5213 O  O   . HOH O 6 .   ? 12.908  83.751 47.756 1.00 28.13  ? 2618 HOH A O   1 
HETATM 5214 O  O   . HOH O 6 .   ? 9.838   81.071 39.290 1.00 98.89  ? 2619 HOH A O   1 
HETATM 5215 O  O   . HOH O 6 .   ? 25.261  77.381 65.924 1.00 83.92  ? 2620 HOH A O   1 
HETATM 5216 O  O   . HOH O 6 .   ? 25.180  72.477 65.278 1.00 55.17  ? 2621 HOH A O   1 
HETATM 5217 O  O   . HOH O 6 .   ? 26.943  70.335 61.368 1.00 52.60  ? 2622 HOH A O   1 
HETATM 5218 O  O   . HOH O 6 .   ? 30.222  72.363 60.325 1.00 60.86  ? 2623 HOH A O   1 
HETATM 5219 O  O   . HOH O 6 .   ? 24.733  67.773 64.294 1.00 47.26  ? 2624 HOH A O   1 
HETATM 5220 O  O   . HOH O 6 .   ? 4.134   85.175 38.448 1.00 88.70  ? 2625 HOH A O   1 
HETATM 5221 O  O   . HOH O 6 .   ? 7.956   81.120 37.474 1.00 64.65  ? 2626 HOH A O   1 
HETATM 5222 O  O   . HOH O 6 .   ? 10.260  84.695 40.737 1.00 70.60  ? 2627 HOH A O   1 
HETATM 5223 O  O   . HOH O 6 .   ? 9.382   88.056 41.516 1.00 66.08  ? 2628 HOH A O   1 
HETATM 5224 O  O   . HOH O 6 .   ? 4.799   82.673 37.079 1.00 66.38  ? 2629 HOH A O   1 
HETATM 5225 O  O   . HOH O 6 .   ? 6.485   88.406 36.005 1.00 89.32  ? 2630 HOH A O   1 
HETATM 5226 O  O   . HOH O 6 .   ? 21.434  79.360 68.082 1.00 77.60  ? 2631 HOH A O   1 
HETATM 5227 O  O   . HOH O 6 .   ? 22.687  82.889 64.878 1.00 82.54  ? 2632 HOH A O   1 
HETATM 5228 O  O   . HOH O 6 .   ? 19.522  83.937 65.276 1.00 52.23  ? 2633 HOH A O   1 
HETATM 5229 O  O   . HOH O 6 .   ? 19.555  83.057 69.240 1.00 83.92  ? 2634 HOH A O   1 
HETATM 5230 O  O   . HOH O 6 .   ? 14.417  83.892 73.204 1.00 75.53  ? 2635 HOH A O   1 
HETATM 5231 O  O   . HOH O 6 .   ? 10.820  82.496 74.430 1.00 81.57  ? 2636 HOH A O   1 
HETATM 5232 O  O   . HOH O 6 .   ? -1.725  76.580 43.444 1.00 148.55 ? 2637 HOH A O   1 
HETATM 5233 O  O   . HOH O 6 .   ? -1.516  70.052 52.820 1.00 20.96  ? 2638 HOH A O   1 
HETATM 5234 O  O   . HOH O 6 .   ? -0.395  63.685 59.102 1.00 17.59  ? 2639 HOH A O   1 
HETATM 5235 O  O   . HOH O 6 .   ? -8.938  58.969 54.114 1.00 142.32 ? 2640 HOH A O   1 
HETATM 5236 O  O   . HOH O 6 .   ? 3.993   91.988 55.723 1.00 56.28  ? 2641 HOH A O   1 
HETATM 5237 O  O   . HOH O 6 .   ? 15.127  92.641 58.552 1.00 70.22  ? 2642 HOH A O   1 
HETATM 5238 O  O   . HOH O 6 .   ? 13.463  91.844 65.202 1.00 58.54  ? 2643 HOH A O   1 
HETATM 5239 O  O   . HOH O 6 .   ? 4.441   89.335 70.897 1.00 62.66  ? 2644 HOH A O   1 
HETATM 5240 O  O   . HOH O 6 .   ? 6.087   91.118 72.034 1.00 64.65  ? 2645 HOH A O   1 
HETATM 5241 O  O   . HOH O 6 .   ? 8.029   92.672 71.415 1.00 74.72  ? 2646 HOH A O   1 
HETATM 5242 O  O   . HOH O 6 .   ? 8.599   95.161 70.781 1.00 78.05  ? 2647 HOH A O   1 
HETATM 5243 O  O   . HOH O 6 .   ? 12.622  87.146 69.447 1.00 57.96  ? 2648 HOH A O   1 
HETATM 5244 O  O   . HOH O 6 .   ? 7.406   95.118 63.331 1.00 63.93  ? 2649 HOH A O   1 
HETATM 5245 O  O   . HOH O 6 .   ? 8.673   90.595 73.044 1.00 65.34  ? 2650 HOH A O   1 
HETATM 5246 O  O   . HOH O 6 .   ? 17.147  88.248 67.981 1.00 69.58  ? 2651 HOH A O   1 
HETATM 5247 O  O   . HOH O 6 .   ? 14.918  93.257 61.509 1.00 79.21  ? 2652 HOH A O   1 
HETATM 5248 O  O   . HOH O 6 .   ? 20.250  90.157 54.347 1.00 53.25  ? 2653 HOH A O   1 
HETATM 5249 O  O   . HOH O 6 .   ? 15.935  91.584 64.171 1.00 85.98  ? 2654 HOH A O   1 
HETATM 5250 O  O   . HOH O 6 .   ? -13.383 58.178 56.709 1.00 20.47  ? 2655 HOH A O   1 
HETATM 5251 O  O   . HOH O 6 .   ? 20.474  93.968 58.995 1.00 72.17  ? 2656 HOH A O   1 
HETATM 5252 O  O   . HOH O 6 .   ? 21.646  87.919 64.854 1.00 80.57  ? 2657 HOH A O   1 
HETATM 5253 O  O   . HOH O 6 .   ? 19.753  93.503 56.392 1.00 85.47  ? 2658 HOH A O   1 
HETATM 5254 O  O   . HOH O 6 .   ? 20.980  92.900 54.019 1.00 37.54  ? 2659 HOH A O   1 
HETATM 5255 O  O   . HOH O 6 .   ? 22.731  86.605 56.008 1.00 50.08  ? 2660 HOH A O   1 
HETATM 5256 O  O   . HOH O 6 .   ? 12.239  93.395 49.729 1.00 73.69  ? 2661 HOH A O   1 
HETATM 5257 O  O   . HOH O 6 .   ? 18.508  88.031 50.836 1.00 35.07  ? 2662 HOH A O   1 
HETATM 5258 O  O   . HOH O 6 .   ? -4.298  52.270 56.450 1.00 19.98  ? 2663 HOH A O   1 
HETATM 5259 O  O   . HOH O 6 .   ? 13.025  91.673 47.686 1.00 70.75  ? 2664 HOH A O   1 
HETATM 5260 O  O   . HOH O 6 .   ? 14.364  90.294 45.219 1.00 83.42  ? 2665 HOH A O   1 
HETATM 5261 O  O   . HOH O 6 .   ? 17.251  88.777 48.296 1.00 52.03  ? 2666 HOH A O   1 
HETATM 5262 O  O   . HOH O 6 .   ? 16.075  86.468 47.044 1.00 34.68  ? 2667 HOH A O   1 
HETATM 5263 O  O   . HOH O 6 .   ? 24.874  83.546 52.359 1.00 63.38  ? 2668 HOH A O   1 
HETATM 5264 O  O   . HOH O 6 .   ? 18.559  82.832 46.409 1.00 46.89  ? 2669 HOH A O   1 
HETATM 5265 O  O   . HOH O 6 .   ? 21.371  80.590 46.317 1.00 50.07  ? 2670 HOH A O   1 
HETATM 5266 O  O   . HOH O 6 .   ? 22.689  86.892 52.523 1.00 58.03  ? 2671 HOH A O   1 
HETATM 5267 O  O   . HOH O 6 .   ? 24.290  81.338 48.716 1.00 46.92  ? 2672 HOH A O   1 
HETATM 5268 O  O   . HOH O 6 .   ? -4.205  40.190 49.882 1.00 61.85  ? 2673 HOH A O   1 
HETATM 5269 O  O   . HOH O 6 .   ? -6.607  46.602 51.822 1.00 31.99  ? 2674 HOH A O   1 
HETATM 5270 O  O   . HOH O 6 .   ? -8.803  38.937 55.408 1.00 83.12  ? 2675 HOH A O   1 
HETATM 5271 O  O   . HOH O 6 .   ? 13.353  82.816 35.908 1.00 109.47 ? 2676 HOH A O   1 
HETATM 5272 O  O   . HOH O 6 .   ? 13.034  78.549 30.555 1.00 71.49  ? 2677 HOH A O   1 
HETATM 5273 O  O   . HOH O 6 .   ? 16.987  75.006 33.161 1.00 79.99  ? 2678 HOH A O   1 
HETATM 5274 O  O   . HOH O 6 .   ? 10.373  81.030 33.676 1.00 76.86  ? 2679 HOH A O   1 
HETATM 5275 O  O   . HOH O 6 .   ? 12.547  73.816 32.412 1.00 59.39  ? 2680 HOH A O   1 
HETATM 5276 O  O   . HOH O 6 .   ? 16.830  77.603 36.408 1.00 58.53  ? 2681 HOH A O   1 
HETATM 5277 O  O   . HOH O 6 .   ? -16.599 44.749 54.905 1.00 38.09  ? 2682 HOH A O   1 
HETATM 5278 O  O   . HOH O 6 .   ? -9.263  45.369 51.390 1.00 38.32  ? 2683 HOH A O   1 
HETATM 5279 O  O   . HOH O 6 .   ? 18.700  74.301 35.342 1.00 43.97  ? 2684 HOH A O   1 
HETATM 5280 O  O   . HOH O 6 .   ? -12.428 42.767 48.867 1.00 84.47  ? 2685 HOH A O   1 
HETATM 5281 O  O   . HOH O 6 .   ? -13.712 51.653 49.714 1.00 31.30  ? 2686 HOH A O   1 
HETATM 5282 O  O   . HOH O 6 .   ? -15.956 44.332 51.509 1.00 56.03  ? 2687 HOH A O   1 
HETATM 5283 O  O   . HOH O 6 .   ? -14.913 48.664 45.700 1.00 74.09  ? 2688 HOH A O   1 
HETATM 5284 O  O   . HOH O 6 .   ? -8.873  43.469 49.411 1.00 58.12  ? 2689 HOH A O   1 
HETATM 5285 O  O   . HOH O 6 .   ? -21.956 48.187 54.139 1.00 74.15  ? 2690 HOH A O   1 
HETATM 5286 O  O   . HOH O 6 .   ? -18.695 45.934 50.674 1.00 69.84  ? 2691 HOH A O   1 
HETATM 5287 O  O   . HOH O 6 .   ? 18.391  79.591 32.282 1.00 37.60  ? 2692 HOH A O   1 
HETATM 5288 O  O   . HOH O 6 .   ? 27.942  83.350 51.850 1.00 58.77  ? 2693 HOH A O   1 
HETATM 5289 O  O   . HOH O 6 .   ? 27.868  84.081 49.219 1.00 37.60  ? 2694 HOH A O   1 
HETATM 5290 O  O   . HOH O 6 .   ? 27.988  71.418 42.271 1.00 70.67  ? 2695 HOH A O   1 
HETATM 5291 O  O   . HOH O 6 .   ? 27.823  65.140 40.178 1.00 52.96  ? 2696 HOH A O   1 
HETATM 5292 O  O   . HOH O 6 .   ? 27.407  67.715 39.288 1.00 62.02  ? 2697 HOH A O   1 
HETATM 5293 O  O   . HOH O 6 .   ? 23.931  61.244 39.950 1.00 38.64  ? 2698 HOH A O   1 
HETATM 5294 O  O   . HOH O 6 .   ? 29.956  59.364 40.937 1.00 65.14  ? 2699 HOH A O   1 
HETATM 5295 O  O   . HOH O 6 .   ? 30.193  63.848 40.096 1.00 85.80  ? 2700 HOH A O   1 
HETATM 5296 O  O   . HOH O 6 .   ? 29.836  53.921 44.302 1.00 55.47  ? 2701 HOH A O   1 
HETATM 5297 O  O   . HOH O 6 .   ? 24.442  51.846 42.561 1.00 81.64  ? 2702 HOH A O   1 
HETATM 5298 O  O   . HOH O 6 .   ? 28.583  54.626 41.881 1.00 61.98  ? 2703 HOH A O   1 
HETATM 5299 O  O   . HOH O 6 .   ? 34.448  59.287 40.600 1.00 112.19 ? 2704 HOH A O   1 
HETATM 5300 O  O   . HOH O 6 .   ? 34.830  65.982 47.939 1.00 76.45  ? 2705 HOH A O   1 
HETATM 5301 O  O   . HOH O 6 .   ? 31.356  66.161 41.044 1.00 78.98  ? 2706 HOH A O   1 
HETATM 5302 O  O   . HOH O 6 .   ? 29.250  53.873 52.398 1.00 60.07  ? 2707 HOH A O   1 
HETATM 5303 O  O   . HOH O 6 .   ? 24.589  53.826 53.397 1.00 75.84  ? 2708 HOH A O   1 
HETATM 5304 O  O   . HOH O 6 .   ? 33.025  69.925 47.867 1.00 63.48  ? 2709 HOH A O   1 
HETATM 5305 O  O   . HOH O 6 .   ? 33.298  67.593 49.424 1.00 62.84  ? 2710 HOH A O   1 
HETATM 5306 O  O   . HOH O 6 .   ? 25.266  66.488 59.877 1.00 32.70  ? 2711 HOH A O   1 
HETATM 5307 O  O   . HOH O 6 .   ? 28.630  67.633 59.424 1.00 65.57  ? 2712 HOH A O   1 
HETATM 5308 O  O   . HOH O 6 .   ? -7.817  58.475 44.741 1.00 26.16  ? 2713 HOH A O   1 
HETATM 5309 O  O   . HOH O 6 .   ? 26.900  85.647 53.618 1.00 93.18  ? 2714 HOH A O   1 
HETATM 5310 O  O   . HOH O 6 .   ? 32.616  81.676 58.372 1.00 90.58  ? 2715 HOH A O   1 
HETATM 5311 O  O   . HOH O 6 .   ? 32.740  79.768 56.411 1.00 88.32  ? 2716 HOH A O   1 
HETATM 5312 O  O   . HOH O 6 .   ? -1.172  64.746 49.586 1.00 153.27 ? 2717 HOH A O   1 
HETATM 5313 O  O   . HOH O 6 .   ? 33.032  70.743 58.278 1.00 37.76  ? 2718 HOH A O   1 
HETATM 5314 O  O   . HOH O 6 .   ? 32.943  72.495 49.144 1.00 37.60  ? 2719 HOH A O   1 
HETATM 5315 O  O   . HOH O 6 .   ? 30.035  64.478 61.070 1.00 86.50  ? 2720 HOH A O   1 
HETATM 5316 O  O   . HOH O 6 .   ? 37.243  60.328 52.287 1.00 67.41  ? 2721 HOH A O   1 
HETATM 5317 O  O   . HOH O 6 .   ? -3.320  52.367 41.828 1.00 135.65 ? 2722 HOH A O   1 
HETATM 5318 O  O   . HOH O 6 .   ? -7.054  55.783 43.063 1.00 43.59  ? 2723 HOH A O   1 
HETATM 5319 O  O   . HOH O 6 .   ? -3.575  51.962 44.338 1.00 31.80  ? 2724 HOH A O   1 
HETATM 5320 O  O   . HOH O 6 .   ? 23.821  56.487 55.246 1.00 53.88  ? 2725 HOH A O   1 
HETATM 5321 O  O   . HOH O 6 .   ? 27.204  63.554 61.825 1.00 62.60  ? 2726 HOH A O   1 
HETATM 5322 O  O   . HOH O 6 .   ? 30.955  62.627 62.718 1.00 80.67  ? 2727 HOH A O   1 
HETATM 5323 O  O   . HOH O 6 .   ? 30.179  58.723 65.132 1.00 53.93  ? 2728 HOH A O   1 
HETATM 5324 O  O   . HOH O 6 .   ? 31.072  59.749 62.650 1.00 34.85  ? 2729 HOH A O   1 
HETATM 5325 O  O   . HOH O 6 .   ? 34.354  56.836 64.353 1.00 50.43  ? 2730 HOH A O   1 
HETATM 5326 O  O   . HOH O 6 .   ? 24.581  60.418 24.812 1.00 56.28  ? 2731 HOH A O   1 
HETATM 5327 O  O   . HOH O 6 .   ? -19.285 88.406 42.875 1.00 92.41  ? 2732 HOH A O   1 
HETATM 5328 O  O   . HOH O 6 .   ? 19.718  63.145 23.349 1.00 70.16  ? 2733 HOH A O   1 
HETATM 5329 O  O   . HOH O 6 .   ? -9.925  64.128 40.939 1.00 41.82  ? 2734 HOH A O   1 
HETATM 5330 O  O   . HOH O 6 .   ? -7.876  59.744 42.292 1.00 26.35  ? 2735 HOH A O   1 
HETATM 5331 O  O   . HOH O 6 .   ? 14.762  47.577 59.805 1.00 61.05  ? 2736 HOH A O   1 
HETATM 5332 O  O   . HOH O 6 .   ? 15.828  45.597 57.521 1.00 70.32  ? 2737 HOH A O   1 
HETATM 5333 O  O   . HOH O 6 .   ? 22.616  44.160 53.468 1.00 91.10  ? 2738 HOH A O   1 
HETATM 5334 O  O   . HOH O 6 .   ? 24.392  40.245 56.382 1.00 62.53  ? 2739 HOH A O   1 
HETATM 5335 O  O   . HOH O 6 .   ? 26.826  45.881 60.300 1.00 33.00  ? 2740 HOH A O   1 
HETATM 5336 O  O   . HOH O 6 .   ? 18.805  41.881 58.348 1.00 60.51  ? 2741 HOH A O   1 
HETATM 5337 O  O   . HOH O 6 .   ? -8.997  60.402 38.212 1.00 127.48 ? 2742 HOH A O   1 
HETATM 5338 O  O   . HOH O 6 .   ? -6.156  59.141 40.248 1.00 27.80  ? 2743 HOH A O   1 
HETATM 5339 O  O   . HOH O 6 .   ? -4.918  61.572 34.392 1.00 38.46  ? 2744 HOH A O   1 
HETATM 5340 O  O   . HOH O 6 .   ? -5.354  58.582 36.827 1.00 33.47  ? 2745 HOH A O   1 
HETATM 5341 O  O   . HOH O 6 .   ? 15.801  41.892 58.830 1.00 72.36  ? 2746 HOH A O   1 
HETATM 5342 O  O   . HOH O 6 .   ? 13.481  40.757 63.016 1.00 68.66  ? 2747 HOH A O   1 
HETATM 5343 O  O   . HOH O 6 .   ? 21.038  34.951 62.026 1.00 84.01  ? 2748 HOH A O   1 
HETATM 5344 O  O   . HOH O 6 .   ? 21.399  39.993 56.933 1.00 78.70  ? 2749 HOH A O   1 
HETATM 5345 O  O   . HOH O 6 .   ? -1.404  61.414 34.149 1.00 39.74  ? 2750 HOH A O   1 
HETATM 5346 O  O   . HOH O 6 .   ? -2.976  67.472 32.381 1.00 45.21  ? 2751 HOH A O   1 
HETATM 5347 O  O   . HOH O 6 .   ? -11.788 63.350 35.278 1.00 48.68  ? 2752 HOH A O   1 
HETATM 5348 O  O   . HOH O 6 .   ? -10.191 65.778 38.577 1.00 30.35  ? 2753 HOH A O   1 
HETATM 5349 O  O   . HOH O 6 .   ? -6.810  65.903 32.408 1.00 54.30  ? 2754 HOH A O   1 
HETATM 5350 O  O   . HOH O 6 .   ? -9.523  62.226 36.329 1.00 40.15  ? 2755 HOH A O   1 
HETATM 5351 O  O   . HOH O 6 .   ? -6.741  63.327 33.158 1.00 74.09  ? 2756 HOH A O   1 
HETATM 5352 O  O   . HOH O 6 .   ? -12.159 67.499 37.423 1.00 30.87  ? 2757 HOH A O   1 
HETATM 5353 O  O   . HOH O 6 .   ? -4.125  68.864 30.228 1.00 74.24  ? 2758 HOH A O   1 
HETATM 5354 O  O   . HOH O 6 .   ? -4.656  71.039 34.127 1.00 22.95  ? 2759 HOH A O   1 
HETATM 5355 O  O   . HOH O 6 .   ? -5.608  69.989 28.465 1.00 136.71 ? 2760 HOH A O   1 
HETATM 5356 O  O   . HOH O 6 .   ? -8.405  70.885 30.452 1.00 148.23 ? 2761 HOH A O   1 
HETATM 5357 O  O   . HOH O 6 .   ? -7.287  80.516 32.366 1.00 40.05  ? 2762 HOH A O   1 
HETATM 5358 O  O   . HOH O 6 .   ? -9.291  79.685 33.604 1.00 94.43  ? 2763 HOH A O   1 
HETATM 5359 O  O   . HOH O 6 .   ? -1.484  75.167 31.372 1.00 38.47  ? 2764 HOH A O   1 
HETATM 5360 O  O   . HOH O 6 .   ? 0.328   75.551 32.565 1.00 115.72 ? 2765 HOH A O   1 
HETATM 5361 O  O   . HOH O 6 .   ? 6.041   75.140 33.181 1.00 52.66  ? 2766 HOH A O   1 
HETATM 5362 O  O   . HOH O 6 .   ? 6.245   72.029 30.256 1.00 74.89  ? 2767 HOH A O   1 
HETATM 5363 O  O   . HOH O 6 .   ? 6.820   74.475 30.915 1.00 70.35  ? 2768 HOH A O   1 
HETATM 5364 O  O   . HOH O 6 .   ? 3.534   67.274 36.781 1.00 23.45  ? 2769 HOH A O   1 
HETATM 5365 O  O   . HOH O 6 .   ? -0.193  66.678 36.891 1.00 25.77  ? 2770 HOH A O   1 
HETATM 5366 O  O   . HOH O 6 .   ? 0.828   69.089 31.529 1.00 129.18 ? 2771 HOH A O   1 
HETATM 5367 O  O   . HOH O 6 .   ? -0.123  71.780 29.146 1.00 55.57  ? 2772 HOH A O   1 
HETATM 5368 O  O   . HOH O 6 .   ? 5.904   70.581 26.982 1.00 53.93  ? 2773 HOH A O   1 
HETATM 5369 O  O   . HOH O 6 .   ? 2.991   73.427 26.914 1.00 38.16  ? 2774 HOH A O   1 
HETATM 5370 O  O   . HOH O 6 .   ? 8.728   71.705 32.566 1.00 35.28  ? 2775 HOH A O   1 
HETATM 5371 O  O   . HOH O 6 .   ? 7.465   71.031 39.400 1.00 26.23  ? 2776 HOH A O   1 
HETATM 5372 O  O   . HOH O 6 .   ? 10.564  68.772 59.827 1.00 22.05  ? 2777 HOH A O   1 
HETATM 5373 O  O   . HOH O 6 .   ? 4.153   63.949 61.107 1.00 48.96  ? 2778 HOH A O   1 
HETATM 5374 O  O   . HOH O 6 .   ? 5.638   62.929 62.973 1.00 52.97  ? 2779 HOH A O   1 
HETATM 5375 O  O   . HOH O 6 .   ? 4.422   65.122 63.369 1.00 51.21  ? 2780 HOH A O   1 
HETATM 5376 O  O   . HOH O 6 .   ? -4.291  57.391 39.535 1.00 48.75  ? 2781 HOH A O   1 
HETATM 5377 O  O   . HOH O 6 .   ? -1.018  51.376 42.873 1.00 39.46  ? 2782 HOH A O   1 
HETATM 5378 O  O   . HOH O 6 .   ? 7.871   50.312 37.275 1.00 39.43  ? 2783 HOH A O   1 
HETATM 5379 O  O   . HOH O 6 .   ? 2.436   54.641 36.801 1.00 21.52  ? 2784 HOH A O   1 
HETATM 5380 O  O   . HOH O 6 .   ? -0.067  57.085 38.334 1.00 27.63  ? 2785 HOH A O   1 
HETATM 5381 O  O   . HOH O 6 .   ? 5.037   56.340 35.379 1.00 42.10  ? 2786 HOH A O   1 
HETATM 5382 O  O   . HOH O 6 .   ? 1.283   64.584 35.646 1.00 28.61  ? 2787 HOH A O   1 
HETATM 5383 O  O   . HOH O 6 .   ? 4.532   58.543 36.344 1.00 79.08  ? 2788 HOH A O   1 
HETATM 5384 O  O   . HOH O 6 .   ? -0.901  66.874 39.996 1.00 33.76  ? 2789 HOH A O   1 
HETATM 5385 O  O   . HOH O 6 .   ? 4.157   64.860 35.609 1.00 27.04  ? 2790 HOH A O   1 
HETATM 5386 O  O   . HOH O 6 .   ? 11.269  65.146 35.544 1.00 42.32  ? 2791 HOH A O   1 
HETATM 5387 O  O   . HOH O 6 .   ? 9.205   63.049 35.869 1.00 46.45  ? 2792 HOH A O   1 
HETATM 5388 O  O   . HOH O 6 .   ? 11.720  69.325 29.843 1.00 77.05  ? 2793 HOH A O   1 
HETATM 5389 O  O   . HOH O 6 .   ? 10.805  66.253 29.616 1.00 67.36  ? 2794 HOH A O   1 
HETATM 5390 O  O   . HOH O 6 .   ? 12.627  66.153 33.705 1.00 45.60  ? 2795 HOH A O   1 
HETATM 5391 O  O   . HOH O 6 .   ? 13.262  70.041 33.584 1.00 69.62  ? 2796 HOH A O   1 
HETATM 5392 O  O   . HOH O 6 .   ? 14.797  67.635 34.370 1.00 63.16  ? 2797 HOH A O   1 
HETATM 5393 O  O   . HOH O 6 .   ? 8.601   62.577 60.242 1.00 151.64 ? 2798 HOH A O   1 
HETATM 5394 O  O   . HOH O 6 .   ? 12.582  59.851 57.089 1.00 40.53  ? 2799 HOH A O   1 
HETATM 5395 O  O   . HOH O 6 .   ? 7.256   52.544 56.641 1.00 19.67  ? 2800 HOH A O   1 
HETATM 5396 O  O   . HOH O 6 .   ? 9.078   50.172 56.620 1.00 38.97  ? 2801 HOH A O   1 
HETATM 5397 O  O   . HOH O 6 .   ? 13.835  52.403 58.392 1.00 83.55  ? 2802 HOH A O   1 
HETATM 5398 O  O   . HOH O 6 .   ? 14.440  51.384 56.162 1.00 30.66  ? 2803 HOH A O   1 
HETATM 5399 O  O   . HOH O 6 .   ? 11.717  51.229 59.042 1.00 70.03  ? 2804 HOH A O   1 
HETATM 5400 O  O   . HOH O 6 .   ? 8.482   49.020 61.649 1.00 61.10  ? 2805 HOH A O   1 
HETATM 5401 O  O   . HOH O 6 .   ? 4.828   50.836 62.261 1.00 25.55  ? 2806 HOH A O   1 
HETATM 5402 O  O   . HOH O 6 .   ? 6.523   48.552 55.931 1.00 27.30  ? 2807 HOH A O   1 
HETATM 5403 O  O   . HOH O 6 .   ? 6.882   48.564 59.502 1.00 50.42  ? 2808 HOH A O   1 
HETATM 5404 O  O   . HOH O 6 .   ? 5.032   46.409 57.300 1.00 32.93  ? 2809 HOH A O   1 
HETATM 5405 O  O   . HOH O 6 .   ? 2.875   41.905 61.192 1.00 47.07  ? 2810 HOH A O   1 
HETATM 5406 O  O   . HOH O 6 .   ? 4.562   43.914 61.261 1.00 37.90  ? 2811 HOH A O   1 
HETATM 5407 O  O   . HOH O 6 .   ? 3.481   46.260 61.500 1.00 23.54  ? 2812 HOH A O   1 
HETATM 5408 O  O   . HOH O 6 .   ? -5.575  45.301 57.719 1.00 26.32  ? 2813 HOH A O   1 
HETATM 5409 O  O   . HOH O 6 .   ? -4.399  40.629 62.918 1.00 29.76  ? 2814 HOH A O   1 
HETATM 5410 O  O   . HOH O 6 .   ? 0.371   41.015 57.576 1.00 29.69  ? 2815 HOH A O   1 
HETATM 5411 O  O   . HOH O 6 .   ? 1.657   43.803 67.570 1.00 45.45  ? 2816 HOH A O   1 
HETATM 5412 O  O   . HOH O 6 .   ? -0.056  42.108 64.554 1.00 34.53  ? 2817 HOH A O   1 
HETATM 5413 O  O   . HOH O 6 .   ? -6.310  49.798 61.374 1.00 24.03  ? 2818 HOH A O   1 
HETATM 5414 O  O   . HOH O 6 .   ? -5.973  41.343 57.331 1.00 53.83  ? 2819 HOH A O   1 
HETATM 5415 O  O   . HOH O 6 .   ? -8.643  37.959 58.423 1.00 66.40  ? 2820 HOH A O   1 
HETATM 5416 O  O   . HOH O 6 .   ? -10.055 40.062 62.334 1.00 46.70  ? 2821 HOH A O   1 
HETATM 5417 O  O   . HOH O 6 .   ? -3.513  47.102 71.894 1.00 40.74  ? 2822 HOH A O   1 
HETATM 5418 O  O   . HOH O 6 .   ? -5.088  43.264 70.172 1.00 41.94  ? 2823 HOH A O   1 
HETATM 5419 O  O   . HOH O 6 .   ? 0.209   43.437 69.902 1.00 55.44  ? 2824 HOH A O   1 
HETATM 5420 O  O   . HOH O 6 .   ? -7.111  43.163 68.270 1.00 26.23  ? 2825 HOH A O   1 
HETATM 5421 O  O   . HOH O 6 .   ? 3.471   51.784 64.470 1.00 21.04  ? 2826 HOH A O   1 
HETATM 5422 O  O   . HOH O 6 .   ? 3.684   47.918 65.607 1.00 26.94  ? 2827 HOH A O   1 
HETATM 5423 O  O   . HOH O 6 .   ? 4.438   50.269 67.183 1.00 28.55  ? 2828 HOH A O   1 
HETATM 5424 O  O   . HOH O 6 .   ? -8.153  45.236 75.340 1.00 40.86  ? 2829 HOH A O   1 
HETATM 5425 O  O   . HOH O 6 .   ? -6.960  49.156 74.324 1.00 33.28  ? 2830 HOH A O   1 
HETATM 5426 O  O   . HOH O 6 .   ? -7.103  43.016 73.605 1.00 71.93  ? 2831 HOH A O   1 
HETATM 5427 O  O   . HOH O 6 .   ? -15.789 45.741 74.365 1.00 49.05  ? 2832 HOH A O   1 
HETATM 5428 O  O   . HOH O 6 .   ? -15.142 49.009 75.590 1.00 119.90 ? 2833 HOH A O   1 
HETATM 5429 O  O   . HOH O 6 .   ? -12.905 41.224 73.060 1.00 54.40  ? 2834 HOH A O   1 
HETATM 5430 O  O   . HOH O 6 .   ? -12.148 48.309 76.482 1.00 44.82  ? 2835 HOH A O   1 
HETATM 5431 O  O   . HOH O 6 .   ? -7.628  40.285 72.299 1.00 81.85  ? 2836 HOH A O   1 
HETATM 5432 O  O   . HOH O 6 .   ? -12.472 39.122 70.830 1.00 66.99  ? 2837 HOH A O   1 
HETATM 5433 O  O   . HOH O 6 .   ? -9.311  39.493 68.756 1.00 86.73  ? 2838 HOH A O   1 
HETATM 5434 O  O   . HOH O 6 .   ? -11.057 52.849 77.319 1.00 48.20  ? 2839 HOH A O   1 
HETATM 5435 O  O   . HOH O 6 .   ? -9.936  49.159 76.174 1.00 67.12  ? 2840 HOH A O   1 
HETATM 5436 O  O   . HOH O 6 .   ? -20.119 52.219 74.575 1.00 66.86  ? 2841 HOH A O   1 
HETATM 5437 O  O   . HOH O 6 .   ? -19.842 52.065 77.684 1.00 63.61  ? 2842 HOH A O   1 
HETATM 5438 O  O   . HOH O 6 .   ? -22.566 45.050 72.329 1.00 75.76  ? 2843 HOH A O   1 
HETATM 5439 O  O   . HOH O 6 .   ? -16.247 44.326 71.887 1.00 60.83  ? 2844 HOH A O   1 
HETATM 5440 O  O   . HOH O 6 .   ? -20.200 42.594 71.699 1.00 73.37  ? 2845 HOH A O   1 
HETATM 5441 O  O   . HOH O 6 .   ? -21.806 46.731 67.573 1.00 39.80  ? 2846 HOH A O   1 
HETATM 5442 O  O   . HOH O 6 .   ? -23.899 42.366 69.629 1.00 80.07  ? 2847 HOH A O   1 
HETATM 5443 O  O   . HOH O 6 .   ? -13.493 37.240 64.963 1.00 80.73  ? 2848 HOH A O   1 
HETATM 5444 O  O   . HOH O 6 .   ? -17.975 40.334 69.522 1.00 48.07  ? 2849 HOH A O   1 
HETATM 5445 O  O   . HOH O 6 .   ? -13.098 41.149 64.851 1.00 49.35  ? 2850 HOH A O   1 
HETATM 5446 O  O   . HOH O 6 .   ? -23.644 38.658 66.431 1.00 66.36  ? 2851 HOH A O   1 
HETATM 5447 O  O   . HOH O 6 .   ? -16.009 36.678 60.508 1.00 88.61  ? 2852 HOH A O   1 
HETATM 5448 O  O   . HOH O 6 .   ? -23.156 37.910 69.443 1.00 73.21  ? 2853 HOH A O   1 
HETATM 5449 O  O   . HOH O 6 .   ? -21.924 39.338 59.273 1.00 77.43  ? 2854 HOH A O   1 
HETATM 5450 O  O   . HOH O 6 .   ? -13.882 41.738 55.074 1.00 49.11  ? 2855 HOH A O   1 
HETATM 5451 O  O   . HOH O 6 .   ? -15.339 39.115 58.672 1.00 44.61  ? 2856 HOH A O   1 
HETATM 5452 O  O   . HOH O 6 .   ? -12.348 39.106 57.804 1.00 67.90  ? 2857 HOH A O   1 
HETATM 5453 O  O   . HOH O 6 .   ? -23.374 46.287 58.401 1.00 82.95  ? 2858 HOH A O   1 
HETATM 5454 O  O   . HOH O 6 .   ? -21.046 47.334 57.725 1.00 49.43  ? 2859 HOH A O   1 
HETATM 5455 O  O   . HOH O 6 .   ? -16.101 42.407 53.985 1.00 76.56  ? 2860 HOH A O   1 
HETATM 5456 O  O   . HOH O 6 .   ? -20.104 45.819 65.884 1.00 130.61 ? 2861 HOH A O   1 
HETATM 5457 O  O   . HOH O 6 .   ? -26.242 41.217 65.925 1.00 72.52  ? 2862 HOH A O   1 
HETATM 5458 O  O   . HOH O 6 .   ? -23.976 43.778 65.636 1.00 90.00  ? 2863 HOH A O   1 
HETATM 5459 O  O   . HOH O 6 .   ? -22.766 37.667 63.073 1.00 96.16  ? 2864 HOH A O   1 
HETATM 5460 O  O   . HOH O 6 .   ? -24.677 45.300 61.135 1.00 56.61  ? 2865 HOH A O   1 
HETATM 5461 O  O   . HOH O 6 .   ? -22.533 46.231 64.583 1.00 44.38  ? 2866 HOH A O   1 
HETATM 5462 O  O   . HOH O 6 .   ? -23.906 48.753 65.757 1.00 100.07 ? 2867 HOH A O   1 
HETATM 5463 O  O   . HOH O 6 .   ? -22.589 51.603 67.205 1.00 75.22  ? 2868 HOH A O   1 
HETATM 5464 O  O   . HOH O 6 .   ? -21.865 49.782 57.547 1.00 56.53  ? 2869 HOH A O   1 
HETATM 5465 O  O   . HOH O 6 .   ? -20.083 57.185 59.831 1.00 29.68  ? 2870 HOH A O   1 
HETATM 5466 O  O   . HOH O 6 .   ? -23.102 59.187 64.008 1.00 69.56  ? 2871 HOH A O   1 
HETATM 5467 O  O   . HOH O 6 .   ? -23.473 51.892 60.480 1.00 55.79  ? 2872 HOH A O   1 
HETATM 5468 O  O   . HOH O 6 .   ? -18.782 53.374 72.583 1.00 37.46  ? 2873 HOH A O   1 
HETATM 5469 O  O   . HOH O 6 .   ? -21.304 49.831 70.699 1.00 55.27  ? 2874 HOH A O   1 
HETATM 5470 O  O   . HOH O 6 .   ? -23.635 53.827 69.144 1.00 80.90  ? 2875 HOH A O   1 
HETATM 5471 O  O   . HOH O 6 .   ? -21.801 65.476 68.343 1.00 81.04  ? 2876 HOH A O   1 
HETATM 5472 O  O   . HOH O 6 .   ? -21.303 61.810 72.029 1.00 81.31  ? 2877 HOH A O   1 
HETATM 5473 O  O   . HOH O 6 .   ? -17.533 64.330 67.490 1.00 42.25  ? 2878 HOH A O   1 
HETATM 5474 O  O   . HOH O 6 .   ? -13.438 65.782 73.668 1.00 55.92  ? 2879 HOH A O   1 
HETATM 5475 O  O   . HOH O 6 .   ? -22.846 57.267 69.333 1.00 59.10  ? 2880 HOH A O   1 
HETATM 5476 O  O   . HOH O 6 .   ? -21.214 59.371 73.282 1.00 66.56  ? 2881 HOH A O   1 
HETATM 5477 O  O   . HOH O 6 .   ? -15.323 57.006 72.993 1.00 27.28  ? 2882 HOH A O   1 
HETATM 5478 O  O   . HOH O 6 .   ? -21.645 55.097 71.451 1.00 58.41  ? 2883 HOH A O   1 
HETATM 5479 O  O   . HOH O 6 .   ? -17.890 55.784 73.056 1.00 34.43  ? 2884 HOH A O   1 
HETATM 5480 O  O   . HOH O 6 .   ? -9.429  56.516 66.372 1.00 44.90  ? 2885 HOH A O   1 
HETATM 5481 O  O   . HOH O 6 .   ? -7.369  60.870 72.535 1.00 36.64  ? 2886 HOH A O   1 
HETATM 5482 O  O   . HOH O 6 .   ? -15.922 59.428 73.775 1.00 43.22  ? 2887 HOH A O   1 
HETATM 5483 O  O   . HOH O 6 .   ? -14.555 63.628 74.649 1.00 53.66  ? 2888 HOH A O   1 
HETATM 5484 O  O   . HOH O 6 .   ? -6.609  61.880 65.412 1.00 21.41  ? 2889 HOH A O   1 
HETATM 5485 O  O   . HOH O 6 .   ? -8.815  58.675 64.845 1.00 22.98  ? 2890 HOH A O   1 
HETATM 5486 O  O   . HOH O 6 .   ? -2.230  57.940 66.960 1.00 26.01  ? 2891 HOH A O   1 
HETATM 5487 O  O   . HOH O 6 .   ? -3.875  57.538 64.118 1.00 22.94  ? 2892 HOH A O   1 
HETATM 5488 O  O   . HOH O 6 .   ? -6.642  60.711 69.180 1.00 59.97  ? 2893 HOH A O   1 
HETATM 5489 O  O   . HOH O 6 .   ? -0.643  55.171 73.678 1.00 61.83  ? 2894 HOH A O   1 
HETATM 5490 O  O   . HOH O 6 .   ? -1.780  51.743 73.600 1.00 49.11  ? 2895 HOH A O   1 
HETATM 5491 O  O   . HOH O 6 .   ? -6.718  57.606 73.022 1.00 39.10  ? 2896 HOH A O   1 
HETATM 5492 O  O   . HOH O 6 .   ? -7.549  56.888 75.300 1.00 79.57  ? 2897 HOH A O   1 
HETATM 5493 O  O   . HOH O 6 .   ? -2.592  48.792 73.907 1.00 98.74  ? 2898 HOH A O   1 
HETATM 5494 O  O   . HOH O 6 .   ? 3.347   45.664 75.277 1.00 75.64  ? 2899 HOH A O   1 
HETATM 5495 O  O   . HOH O 6 .   ? 1.677   43.870 72.003 1.00 48.91  ? 2900 HOH A O   1 
HETATM 5496 O  O   . HOH O 6 .   ? 0.532   52.516 74.699 1.00 44.52  ? 2901 HOH A O   1 
HETATM 5497 O  O   . HOH O 6 .   ? 2.330   53.871 73.780 1.00 51.13  ? 2902 HOH A O   1 
HETATM 5498 O  O   . HOH O 6 .   ? 5.382   53.792 80.914 1.00 43.68  ? 2903 HOH A O   1 
HETATM 5499 O  O   . HOH O 6 .   ? 4.506   55.923 78.612 1.00 31.95  ? 2904 HOH A O   1 
HETATM 5500 O  O   . HOH O 6 .   ? 3.553   55.132 75.618 1.00 45.60  ? 2905 HOH A O   1 
HETATM 5501 O  O   . HOH O 6 .   ? 5.711   47.783 75.464 1.00 34.31  ? 2906 HOH A O   1 
HETATM 5502 O  O   . HOH O 6 .   ? 8.777   50.971 78.382 1.00 45.58  ? 2907 HOH A O   1 
HETATM 5503 O  O   . HOH O 6 .   ? 8.809   50.146 75.101 1.00 29.28  ? 2908 HOH A O   1 
HETATM 5504 O  O   . HOH O 6 .   ? 2.966   58.239 72.030 1.00 60.18  ? 2909 HOH A O   1 
HETATM 5505 O  O   . HOH O 6 .   ? 3.539   50.893 69.855 1.00 19.39  ? 2910 HOH A O   1 
HETATM 5506 O  O   . HOH O 6 .   ? 4.997   59.890 70.330 1.00 22.42  ? 2911 HOH A O   1 
HETATM 5507 O  O   . HOH O 6 .   ? 3.929   56.272 70.498 1.00 28.58  ? 2912 HOH A O   1 
HETATM 5508 O  O   . HOH O 6 .   ? 7.547   49.522 66.570 1.00 33.21  ? 2913 HOH A O   1 
HETATM 5509 O  O   . HOH O 6 .   ? 2.963   54.339 63.751 1.00 20.51  ? 2914 HOH A O   1 
HETATM 5510 O  O   . HOH O 6 .   ? -3.681  50.511 62.258 1.00 23.66  ? 2915 HOH A O   1 
HETATM 5511 O  O   . HOH O 6 .   ? -1.536  58.040 62.774 1.00 21.62  ? 2916 HOH A O   1 
HETATM 5512 O  O   . HOH O 6 .   ? -3.535  51.409 59.813 1.00 22.26  ? 2917 HOH A O   1 
HETATM 5513 O  O   . HOH O 6 .   ? 1.493   43.696 55.017 1.00 26.10  ? 2918 HOH A O   1 
HETATM 5514 O  O   . HOH O 6 .   ? -5.849  48.284 49.967 1.00 50.04  ? 2919 HOH A O   1 
HETATM 5515 O  O   . HOH O 6 .   ? -4.868  51.022 48.761 1.00 50.29  ? 2920 HOH A O   1 
HETATM 5516 O  O   . HOH O 6 .   ? -3.841  42.941 47.705 1.00 70.07  ? 2921 HOH A O   1 
HETATM 5517 O  O   . HOH O 6 .   ? -4.392  43.911 44.748 1.00 98.69  ? 2922 HOH A O   1 
HETATM 5518 O  O   . HOH O 6 .   ? -1.184  41.701 45.483 1.00 72.88  ? 2923 HOH A O   1 
HETATM 5519 O  O   . HOH O 6 .   ? -1.024  45.880 42.870 1.00 78.76  ? 2924 HOH A O   1 
HETATM 5520 O  O   . HOH O 6 .   ? 0.215   49.111 42.777 1.00 101.83 ? 2925 HOH A O   1 
HETATM 5521 O  O   . HOH O 6 .   ? -7.466  48.987 45.269 1.00 75.26  ? 2926 HOH A O   1 
HETATM 5522 O  O   . HOH O 6 .   ? 2.564   41.907 48.034 1.00 60.01  ? 2927 HOH A O   1 
HETATM 5523 O  O   . HOH O 6 .   ? 1.618   42.600 44.189 1.00 52.73  ? 2928 HOH A O   1 
HETATM 5524 O  O   . HOH O 6 .   ? 10.888  42.614 51.649 1.00 42.25  ? 2929 HOH A O   1 
HETATM 5525 O  O   . HOH O 6 .   ? 8.271   40.990 51.605 1.00 71.69  ? 2930 HOH A O   1 
HETATM 5526 O  O   . HOH O 6 .   ? 6.869   41.791 49.522 1.00 35.53  ? 2931 HOH A O   1 
HETATM 5527 O  O   . HOH O 6 .   ? 7.117   47.070 53.821 1.00 23.58  ? 2932 HOH A O   1 
HETATM 5528 O  O   . HOH O 6 .   ? 13.205  49.950 53.885 1.00 37.58  ? 2933 HOH A O   1 
HETATM 5529 O  O   . HOH O 6 .   ? 17.431  45.176 51.139 1.00 48.39  ? 2934 HOH A O   1 
HETATM 5530 O  O   . HOH O 6 .   ? 9.764   46.920 53.697 1.00 25.31  ? 2935 HOH A O   1 
HETATM 5531 O  O   . HOH O 6 .   ? 11.516  50.393 52.091 1.00 137.88 ? 2936 HOH A O   1 
HETATM 5532 O  O   . HOH O 6 .   ? 17.302  46.869 54.284 1.00 64.02  ? 2937 HOH A O   1 
HETATM 5533 O  O   . HOH O 6 .   ? 13.510  43.495 45.257 1.00 40.42  ? 2938 HOH A O   1 
HETATM 5534 O  O   . HOH O 6 .   ? 8.810   40.949 47.752 1.00 63.23  ? 2939 HOH A O   1 
HETATM 5535 O  O   . HOH O 6 .   ? 14.407  42.789 47.866 1.00 49.42  ? 2940 HOH A O   1 
HETATM 5536 O  O   . HOH O 6 .   ? 15.747  43.302 43.301 1.00 59.55  ? 2941 HOH A O   1 
HETATM 5537 O  O   . HOH O 6 .   ? 17.860  45.628 41.144 1.00 78.75  ? 2942 HOH A O   1 
HETATM 5538 O  O   . HOH O 6 .   ? 18.354  43.070 43.891 1.00 93.83  ? 2943 HOH A O   1 
HETATM 5539 O  O   . HOH O 6 .   ? 10.157  44.523 43.652 1.00 53.32  ? 2944 HOH A O   1 
HETATM 5540 O  O   . HOH O 6 .   ? 15.819  45.654 38.916 1.00 68.18  ? 2945 HOH A O   1 
HETATM 5541 O  O   . HOH O 6 .   ? 10.262  45.456 40.093 1.00 53.71  ? 2946 HOH A O   1 
HETATM 5542 O  O   . HOH O 6 .   ? 11.368  46.893 38.258 1.00 59.65  ? 2947 HOH A O   1 
HETATM 5543 O  O   . HOH O 6 .   ? 4.471   46.873 40.490 1.00 34.27  ? 2948 HOH A O   1 
HETATM 5544 O  O   . HOH O 6 .   ? 7.915   45.431 43.580 1.00 40.46  ? 2949 HOH A O   1 
HETATM 5545 O  O   . HOH O 6 .   ? 8.807   47.352 38.724 1.00 53.34  ? 2950 HOH A O   1 
HETATM 5546 O  O   . HOH O 6 .   ? 6.236   45.091 39.469 1.00 37.65  ? 2951 HOH A O   1 
HETATM 5547 O  O   . HOH O 6 .   ? 6.118   62.851 35.415 1.00 28.24  ? 2952 HOH A O   1 
HETATM 5548 O  O   . HOH O 6 .   ? 8.848   60.042 35.952 1.00 57.50  ? 2953 HOH A O   1 
HETATM 5549 O  O   . HOH O 6 .   ? 6.807   58.572 35.466 1.00 44.58  ? 2954 HOH A O   1 
HETATM 5550 O  O   . HOH O 6 .   ? 9.892   51.861 37.200 1.00 44.00  ? 2955 HOH A O   1 
HETATM 5551 O  O   . HOH O 6 .   ? 9.590   56.562 36.219 1.00 27.33  ? 2956 HOH A O   1 
HETATM 5552 O  O   . HOH O 6 .   ? 10.924  61.288 35.050 1.00 58.04  ? 2957 HOH A O   1 
HETATM 5553 O  O   . HOH O 6 .   ? 13.436  60.872 34.733 1.00 52.82  ? 2958 HOH A O   1 
HETATM 5554 O  O   . HOH O 6 .   ? 11.867  53.110 34.882 1.00 58.47  ? 2959 HOH A O   1 
HETATM 5555 O  O   . HOH O 6 .   ? 13.981  50.003 37.671 1.00 81.72  ? 2960 HOH A O   1 
HETATM 5556 O  O   . HOH O 6 .   ? 11.984  49.829 36.039 1.00 62.66  ? 2961 HOH A O   1 
HETATM 5557 O  O   . HOH O 6 .   ? 13.335  63.400 34.603 1.00 52.50  ? 2962 HOH A O   1 
HETATM 5558 O  O   . HOH O 6 .   ? 21.192  65.225 64.085 1.00 32.19  ? 2963 HOH A O   1 
HETATM 5559 O  O   . HOH O 6 .   ? 20.042  74.195 68.417 1.00 35.87  ? 2964 HOH A O   1 
HETATM 5560 O  O   . HOH O 6 .   ? 17.250  64.641 64.107 1.00 30.83  ? 2965 HOH A O   1 
HETATM 5561 O  O   . HOH O 6 .   ? 5.618   61.363 72.496 1.00 23.21  ? 2966 HOH A O   1 
HETATM 5562 O  O   . HOH O 6 .   ? 6.442   66.823 79.431 1.00 22.39  ? 2967 HOH A O   1 
HETATM 5563 O  O   . HOH O 6 .   ? 8.976   66.386 78.577 1.00 126.32 ? 2968 HOH A O   1 
HETATM 5564 O  O   . HOH O 6 .   ? 2.656   61.862 74.744 1.00 74.99  ? 2969 HOH A O   1 
HETATM 5565 O  O   . HOH O 6 .   ? 2.487   64.392 77.198 1.00 33.62  ? 2970 HOH A O   1 
HETATM 5566 O  O   . HOH O 6 .   ? 6.455   57.729 79.551 1.00 73.34  ? 2971 HOH A O   1 
HETATM 5567 O  O   . HOH O 6 .   ? 7.750   63.582 79.170 1.00 22.13  ? 2972 HOH A O   1 
HETATM 5568 O  O   . HOH O 6 .   ? 7.616   60.329 80.815 1.00 58.48  ? 2973 HOH A O   1 
HETATM 5569 O  O   . HOH O 6 .   ? 10.106  61.291 84.773 1.00 38.83  ? 2974 HOH A O   1 
HETATM 5570 O  O   . HOH O 6 .   ? 10.333  64.581 83.496 1.00 88.40  ? 2975 HOH A O   1 
HETATM 5571 O  O   . HOH O 6 .   ? 7.454   65.214 81.033 1.00 29.76  ? 2976 HOH A O   1 
HETATM 5572 O  O   . HOH O 6 .   ? 12.345  67.530 83.660 1.00 28.39  ? 2977 HOH A O   1 
HETATM 5573 O  O   . HOH O 6 .   ? 11.115  66.084 85.465 1.00 71.84  ? 2978 HOH A O   1 
HETATM 5574 O  O   . HOH O 6 .   ? 7.628   66.610 82.953 1.00 32.83  ? 2979 HOH A O   1 
HETATM 5575 O  O   . HOH O 6 .   ? 4.661   78.062 78.850 1.00 40.20  ? 2980 HOH A O   1 
HETATM 5576 O  O   . HOH O 6 .   ? 10.561  76.606 78.244 1.00 29.31  ? 2981 HOH A O   1 
HETATM 5577 O  O   . HOH O 6 .   ? 7.610   79.450 78.065 1.00 89.29  ? 2982 HOH A O   1 
HETATM 5578 O  O   . HOH O 6 .   ? 11.608  77.364 84.287 1.00 47.21  ? 2983 HOH A O   1 
HETATM 5579 O  O   . HOH O 6 .   ? 9.525   78.364 80.217 1.00 71.33  ? 2984 HOH A O   1 
HETATM 5580 O  O   . HOH O 6 .   ? 14.171  75.646 85.388 1.00 56.68  ? 2985 HOH A O   1 
HETATM 5581 O  O   . HOH O 6 .   ? 5.443   77.810 81.530 1.00 34.32  ? 2986 HOH A O   1 
HETATM 5582 O  O   . HOH O 6 .   ? 14.106  68.533 85.529 1.00 69.28  ? 2987 HOH A O   1 
HETATM 5583 O  O   . HOH O 6 .   ? 14.064  75.443 79.934 1.00 51.11  ? 2988 HOH A O   1 
HETATM 5584 O  O   . HOH O 6 .   ? 23.776  73.485 82.195 1.00 62.27  ? 2989 HOH A O   1 
HETATM 5585 O  O   . HOH O 6 .   ? 19.302  72.825 85.034 1.00 66.47  ? 2990 HOH A O   1 
HETATM 5586 O  O   . HOH O 6 .   ? 22.470  74.926 84.011 1.00 66.82  ? 2991 HOH A O   1 
HETATM 5587 O  O   . HOH O 6 .   ? 16.574  73.188 84.353 1.00 49.73  ? 2992 HOH A O   1 
HETATM 5588 O  O   . HOH O 6 .   ? 18.310  77.092 81.141 1.00 97.87  ? 2993 HOH A O   1 
HETATM 5589 O  O   . HOH O 6 .   ? 21.049  72.576 78.945 1.00 35.13  ? 2994 HOH A O   1 
HETATM 5590 O  O   . HOH O 6 .   ? 18.176  75.652 84.619 1.00 81.76  ? 2995 HOH A O   1 
HETATM 5591 O  O   . HOH O 6 .   ? 17.104  69.090 84.529 1.00 38.44  ? 2996 HOH A O   1 
HETATM 5592 O  O   . HOH O 6 .   ? 18.922  64.794 86.316 1.00 57.60  ? 2997 HOH A O   1 
HETATM 5593 O  O   . HOH O 6 .   ? 25.441  72.214 83.949 1.00 85.15  ? 2998 HOH A O   1 
HETATM 5594 O  O   . HOH O 6 .   ? 23.261  69.808 87.621 1.00 90.10  ? 2999 HOH A O   1 
HETATM 5595 O  O   . HOH O 6 .   ? 21.699  73.333 86.036 1.00 114.37 ? 3000 HOH A O   1 
HETATM 5596 O  O   . HOH O 6 .   ? 15.243  65.153 84.298 1.00 30.11  ? 3001 HOH A O   1 
HETATM 5597 O  O   . HOH O 6 .   ? 16.120  59.352 87.426 1.00 53.97  ? 3002 HOH A O   1 
HETATM 5598 O  O   . HOH O 6 .   ? 23.999  58.408 77.162 1.00 58.23  ? 3003 HOH A O   1 
HETATM 5599 O  O   . HOH O 6 .   ? 26.232  54.824 80.788 1.00 143.14 ? 3004 HOH A O   1 
HETATM 5600 O  O   . HOH O 6 .   ? 23.399  52.392 81.045 1.00 44.02  ? 3005 HOH A O   1 
HETATM 5601 O  O   . HOH O 6 .   ? 22.900  55.041 88.103 1.00 71.47  ? 3006 HOH A O   1 
HETATM 5602 O  O   . HOH O 6 .   ? 15.700  52.559 83.769 1.00 43.22  ? 3007 HOH A O   1 
HETATM 5603 O  O   . HOH O 6 .   ? 22.202  52.713 85.822 1.00 94.14  ? 3008 HOH A O   1 
HETATM 5604 O  O   . HOH O 6 .   ? 18.245  58.017 89.398 1.00 69.62  ? 3009 HOH A O   1 
HETATM 5605 O  O   . HOH O 6 .   ? 21.529  58.688 88.251 1.00 71.64  ? 3010 HOH A O   1 
HETATM 5606 O  O   . HOH O 6 .   ? 13.587  59.203 79.119 1.00 32.48  ? 3011 HOH A O   1 
HETATM 5607 O  O   . HOH O 6 .   ? 15.059  61.784 87.845 1.00 69.04  ? 3012 HOH A O   1 
HETATM 5608 O  O   . HOH O 6 .   ? 16.180  62.502 84.720 1.00 33.62  ? 3013 HOH A O   1 
HETATM 5609 O  O   . HOH O 6 .   ? 12.327  61.338 86.102 1.00 42.25  ? 3014 HOH A O   1 
HETATM 5610 O  O   . HOH O 6 .   ? 12.450  57.693 86.588 1.00 57.73  ? 3015 HOH A O   1 
HETATM 5611 O  O   . HOH O 6 .   ? 16.595  50.211 78.070 1.00 40.06  ? 3016 HOH A O   1 
HETATM 5612 O  O   . HOH O 6 .   ? 11.858  51.106 81.381 1.00 47.53  ? 3017 HOH A O   1 
HETATM 5613 O  O   . HOH O 6 .   ? 12.646  55.974 84.408 1.00 50.08  ? 3018 HOH A O   1 
HETATM 5614 O  O   . HOH O 6 .   ? 13.624  52.795 85.142 1.00 65.92  ? 3019 HOH A O   1 
HETATM 5615 O  O   . HOH O 6 .   ? 10.603  52.673 79.245 1.00 34.20  ? 3020 HOH A O   1 
HETATM 5616 O  O   . HOH O 6 .   ? 11.095  52.451 83.538 1.00 86.74  ? 3021 HOH A O   1 
HETATM 5617 O  O   . HOH O 6 .   ? 8.671   45.174 76.082 1.00 70.26  ? 3022 HOH A O   1 
HETATM 5618 O  O   . HOH O 6 .   ? 10.692  55.948 68.742 1.00 20.40  ? 3023 HOH A O   1 
HETATM 5619 O  O   . HOH O 6 .   ? 9.137   43.864 73.394 1.00 65.90  ? 3024 HOH A O   1 
HETATM 5620 O  O   . HOH O 6 .   ? 8.467   47.513 74.145 1.00 38.31  ? 3025 HOH A O   1 
HETATM 5621 O  O   . HOH O 6 .   ? 14.926  48.602 63.979 1.00 41.38  ? 3026 HOH A O   1 
HETATM 5622 O  O   . HOH O 6 .   ? 12.031  43.184 66.102 1.00 60.18  ? 3027 HOH A O   1 
HETATM 5623 O  O   . HOH O 6 .   ? 12.253  49.371 62.626 1.00 48.66  ? 3028 HOH A O   1 
HETATM 5624 O  O   . HOH O 6 .   ? 13.381  42.309 68.630 1.00 66.68  ? 3029 HOH A O   1 
HETATM 5625 O  O   . HOH O 6 .   ? 8.862   43.150 68.148 1.00 78.85  ? 3030 HOH A O   1 
HETATM 5626 O  O   . HOH O 6 .   ? 9.678   49.393 64.001 1.00 66.12  ? 3031 HOH A O   1 
HETATM 5627 O  O   . HOH O 6 .   ? 10.176  43.073 71.219 1.00 77.32  ? 3032 HOH A O   1 
HETATM 5628 O  O   . HOH O 6 .   ? 11.927  47.393 73.769 1.00 37.04  ? 3033 HOH A O   1 
HETATM 5629 O  O   . HOH O 6 .   ? 14.311  40.306 75.396 1.00 43.78  ? 3034 HOH A O   1 
HETATM 5630 O  O   . HOH O 6 .   ? 13.119  45.253 78.060 1.00 64.27  ? 3035 HOH A O   1 
HETATM 5631 O  O   . HOH O 6 .   ? 12.760  41.530 78.523 1.00 78.00  ? 3036 HOH A O   1 
HETATM 5632 O  O   . HOH O 6 .   ? 13.016  44.270 75.515 1.00 50.47  ? 3037 HOH A O   1 
HETATM 5633 O  O   . HOH O 6 .   ? 17.701  39.742 74.044 1.00 33.20  ? 3038 HOH A O   1 
HETATM 5634 O  O   . HOH O 6 .   ? 17.902  46.016 78.680 1.00 57.28  ? 3039 HOH A O   1 
HETATM 5635 O  O   . HOH O 6 .   ? 20.041  47.897 79.668 1.00 99.33  ? 3040 HOH A O   1 
HETATM 5636 O  O   . HOH O 6 .   ? 22.830  48.314 78.539 1.00 44.05  ? 3041 HOH A O   1 
HETATM 5637 O  O   . HOH O 6 .   ? 19.941  44.454 79.671 1.00 68.01  ? 3042 HOH A O   1 
HETATM 5638 O  O   . HOH O 6 .   ? 22.554  43.731 79.784 1.00 72.97  ? 3043 HOH A O   1 
HETATM 5639 O  O   . HOH O 6 .   ? 24.731  48.379 76.688 1.00 32.96  ? 3044 HOH A O   1 
HETATM 5640 O  O   . HOH O 6 .   ? 25.188  43.981 77.226 1.00 41.12  ? 3045 HOH A O   1 
HETATM 5641 O  O   . HOH O 6 .   ? 20.112  48.443 77.117 1.00 96.77  ? 3046 HOH A O   1 
HETATM 5642 O  O   . HOH O 6 .   ? 26.442  49.063 69.989 1.00 39.50  ? 3047 HOH A O   1 
HETATM 5643 O  O   . HOH O 6 .   ? 19.117  50.579 78.165 1.00 55.14  ? 3048 HOH A O   1 
HETATM 5644 O  O   . HOH O 6 .   ? 30.094  52.469 71.747 1.00 35.03  ? 3049 HOH A O   1 
HETATM 5645 O  O   . HOH O 6 .   ? 26.384  58.010 68.711 1.00 65.95  ? 3050 HOH A O   1 
HETATM 5646 O  O   . HOH O 6 .   ? 29.385  50.073 67.409 1.00 59.96  ? 3051 HOH A O   1 
HETATM 5647 O  O   . HOH O 6 .   ? 28.145  52.534 64.330 1.00 66.84  ? 3052 HOH A O   1 
HETATM 5648 O  O   . HOH O 6 .   ? 26.826  48.244 67.549 1.00 67.20  ? 3053 HOH A O   1 
HETATM 5649 O  O   . HOH O 6 .   ? 29.108  54.901 69.053 1.00 51.58  ? 3054 HOH A O   1 
HETATM 5650 O  O   . HOH O 6 .   ? 25.234  60.152 72.327 1.00 44.20  ? 3055 HOH A O   1 
HETATM 5651 O  O   . HOH O 6 .   ? 29.794  57.375 72.162 1.00 52.50  ? 3056 HOH A O   1 
HETATM 5652 O  O   . HOH O 6 .   ? 34.272  61.774 77.301 1.00 44.87  ? 3057 HOH A O   1 
HETATM 5653 O  O   . HOH O 6 .   ? 30.090  62.031 74.387 1.00 59.50  ? 3058 HOH A O   1 
HETATM 5654 O  O   . HOH O 6 .   ? 26.662  59.617 76.915 1.00 32.77  ? 3059 HOH A O   1 
HETATM 5655 O  O   . HOH O 6 .   ? 26.212  50.545 77.607 1.00 34.68  ? 3060 HOH A O   1 
HETATM 5656 O  O   . HOH O 6 .   ? 36.072  58.832 82.953 1.00 49.28  ? 3061 HOH A O   1 
HETATM 5657 O  O   . HOH O 6 .   ? 34.780  62.830 80.114 1.00 63.52  ? 3062 HOH A O   1 
HETATM 5658 O  O   . HOH O 6 .   ? 32.098  58.936 84.017 1.00 117.38 ? 3063 HOH A O   1 
HETATM 5659 O  O   . HOH O 6 .   ? 29.499  61.081 84.288 1.00 35.77  ? 3064 HOH A O   1 
HETATM 5660 O  O   . HOH O 6 .   ? 32.213  66.300 80.977 1.00 65.01  ? 3065 HOH A O   1 
HETATM 5661 O  O   . HOH O 6 .   ? 29.856  65.156 83.732 1.00 58.99  ? 3066 HOH A O   1 
HETATM 5662 O  O   . HOH O 6 .   ? 29.337  55.254 86.101 1.00 48.05  ? 3067 HOH A O   1 
HETATM 5663 O  O   . HOH O 6 .   ? 26.025  53.947 84.909 1.00 47.71  ? 3068 HOH A O   1 
HETATM 5664 O  O   . HOH O 6 .   ? 30.587  56.934 81.409 1.00 37.98  ? 3069 HOH A O   1 
HETATM 5665 O  O   . HOH O 6 .   ? 30.176  58.343 85.585 1.00 57.84  ? 3070 HOH A O   1 
HETATM 5666 O  O   . HOH O 6 .   ? 28.745  62.846 86.270 1.00 55.56  ? 3071 HOH A O   1 
HETATM 5667 O  O   . HOH O 6 .   ? 22.864  59.412 86.083 1.00 36.09  ? 3072 HOH A O   1 
HETATM 5668 O  O   . HOH O 6 .   ? 22.967  62.083 85.416 1.00 62.12  ? 3073 HOH A O   1 
HETATM 5669 O  O   . HOH O 6 .   ? 28.013  55.724 88.412 1.00 50.20  ? 3074 HOH A O   1 
HETATM 5670 O  O   . HOH O 6 .   ? 30.236  60.076 87.535 1.00 73.48  ? 3075 HOH A O   1 
HETATM 5671 O  O   . HOH O 6 .   ? 25.379  56.897 84.274 1.00 139.00 ? 3076 HOH A O   1 
HETATM 5672 O  O   . HOH O 6 .   ? 30.238  57.220 88.966 1.00 86.57  ? 3077 HOH A O   1 
HETATM 5673 O  O   . HOH O 6 .   ? 24.936  55.560 86.599 1.00 44.95  ? 3078 HOH A O   1 
HETATM 5674 O  O   . HOH O 6 .   ? 24.260  63.905 87.701 1.00 37.57  ? 3079 HOH A O   1 
HETATM 5675 O  O   . HOH O 6 .   ? 25.082  68.268 83.089 1.00 65.59  ? 3080 HOH A O   1 
HETATM 5676 O  O   . HOH O 6 .   ? 31.092  67.636 78.712 1.00 58.26  ? 3081 HOH A O   1 
HETATM 5677 O  O   . HOH O 6 .   ? 28.406  68.207 78.759 1.00 40.84  ? 3082 HOH A O   1 
HETATM 5678 O  O   . HOH O 6 .   ? 27.269  68.808 81.695 1.00 73.90  ? 3083 HOH A O   1 
HETATM 5679 O  O   . HOH O 6 .   ? 24.869  66.287 84.797 1.00 39.97  ? 3084 HOH A O   1 
HETATM 5680 O  O   . HOH O 6 .   ? 20.258  63.283 80.112 1.00 38.05  ? 3085 HOH A O   1 
HETATM 5681 O  O   . HOH O 6 .   ? 25.312  62.383 73.936 1.00 34.05  ? 3086 HOH A O   1 
HETATM 5682 O  O   . HOH O 6 .   ? 33.212  65.747 76.963 1.00 64.37  ? 3087 HOH A O   1 
HETATM 5683 O  O   . HOH O 6 .   ? 26.468  60.641 79.321 1.00 35.52  ? 3088 HOH A O   1 
HETATM 5684 O  O   . HOH O 6 .   ? 22.629  72.124 76.098 1.00 39.00  ? 3089 HOH A O   1 
HETATM 5685 O  O   . HOH O 6 .   ? 22.028  65.433 70.587 1.00 79.88  ? 3090 HOH A O   1 
HETATM 5686 O  O   . HOH O 6 .   ? 25.675  66.603 74.716 1.00 33.11  ? 3091 HOH A O   1 
HETATM 5687 O  O   . HOH O 6 .   ? 23.648  70.509 74.076 1.00 33.83  ? 3092 HOH A O   1 
HETATM 5688 O  O   . HOH O 6 .   ? 19.722  66.444 70.220 1.00 94.41  ? 3093 HOH A O   1 
HETATM 5689 O  O   . HOH O 6 .   ? 16.794  64.071 67.221 1.00 27.66  ? 3094 HOH A O   1 
HETATM 5690 O  O   . HOH O 6 .   ? 19.233  65.240 67.946 1.00 50.59  ? 3095 HOH A O   1 
HETATM 5691 O  O   . HOH O 6 .   ? 24.660  65.406 70.530 1.00 59.68  ? 3096 HOH A O   1 
HETATM 5692 O  O   . HOH O 6 .   ? 24.702  60.828 69.823 1.00 53.75  ? 3097 HOH A O   1 
HETATM 5693 O  O   . HOH O 6 .   ? 25.052  64.324 67.265 1.00 64.91  ? 3098 HOH A O   1 
HETATM 5694 O  O   . HOH O 6 .   ? 24.957  62.794 71.421 1.00 77.51  ? 3099 HOH A O   1 
HETATM 5695 O  O   . HOH O 6 .   ? 19.708  62.939 65.120 1.00 32.81  ? 3100 HOH A O   1 
HETATM 5696 O  O   . HOH O 6 .   ? 15.545  53.180 61.774 1.00 27.93  ? 3101 HOH A O   1 
HETATM 5697 O  O   . HOH O 6 .   ? 21.247  52.220 53.951 1.00 28.57  ? 3102 HOH A O   1 
HETATM 5698 O  O   . HOH O 6 .   ? 25.166  55.251 48.008 1.00 46.52  ? 3103 HOH A O   1 
HETATM 5699 O  O   . HOH O 6 .   ? 17.802  50.816 45.041 1.00 25.14  ? 3104 HOH A O   1 
HETATM 5700 O  O   . HOH O 6 .   ? 20.031  46.612 51.283 1.00 61.09  ? 3105 HOH A O   1 
HETATM 5701 O  O   . HOH O 6 .   ? 21.993  57.026 38.880 1.00 52.95  ? 3106 HOH A O   1 
HETATM 5702 O  O   . HOH O 6 .   ? 23.918  56.531 40.357 1.00 71.68  ? 3107 HOH A O   1 
HETATM 5703 O  O   . HOH O 6 .   ? 20.664  59.745 41.047 1.00 30.86  ? 3108 HOH A O   1 
HETATM 5704 O  O   . HOH O 6 .   ? 20.049  55.766 37.325 1.00 46.47  ? 3109 HOH A O   1 
HETATM 5705 O  O   . HOH O 6 .   ? 21.912  51.925 48.979 1.00 53.56  ? 3110 HOH A O   1 
HETATM 5706 O  O   . HOH O 6 .   ? 19.533  48.792 45.283 1.00 51.82  ? 3111 HOH A O   1 
HETATM 5707 O  O   . HOH O 6 .   ? 23.136  52.975 38.354 1.00 82.66  ? 3112 HOH A O   1 
HETATM 5708 O  O   . HOH O 6 .   ? 22.254  49.011 49.146 1.00 84.31  ? 3113 HOH A O   1 
HETATM 5709 O  O   . HOH O 6 .   ? 17.962  54.846 36.042 1.00 45.17  ? 3114 HOH A O   1 
HETATM 5710 O  O   . HOH O 6 .   ? 16.527  57.859 36.189 1.00 29.55  ? 3115 HOH A O   1 
HETATM 5711 O  O   . HOH O 6 .   ? 20.534  58.354 37.155 1.00 40.58  ? 3116 HOH A O   1 
HETATM 5712 O  O   . HOH O 6 .   ? 19.027  65.861 37.001 1.00 34.03  ? 3117 HOH A O   1 
HETATM 5713 O  O   . HOH O 6 .   ? 17.336  66.954 35.304 1.00 76.42  ? 3118 HOH A O   1 
HETATM 5714 O  O   . HOH O 6 .   ? 16.134  65.001 33.143 1.00 70.42  ? 3119 HOH A O   1 
HETATM 5715 O  O   . HOH O 6 .   ? 18.828  59.030 35.341 1.00 30.54  ? 3120 HOH A O   1 
HETATM 5716 O  O   . HOH O 6 .   ? 18.148  60.495 41.905 1.00 23.20  ? 3121 HOH A O   1 
HETATM 5717 O  O   . HOH O 6 .   ? 19.369  68.142 38.584 1.00 31.99  ? 3122 HOH A O   1 
HETATM 5718 O  O   . HOH O 6 .   ? 23.513  69.958 40.118 1.00 38.62  ? 3123 HOH A O   1 
HETATM 5719 O  O   . HOH O 6 .   ? 13.399  69.011 57.174 1.00 20.16  ? 3124 HOH A O   1 
HETATM 5720 O  O   . HOH O 6 .   ? 24.739  70.703 63.488 1.00 32.26  ? 3125 HOH A O   1 
HETATM 5721 O  O   . HOH O 6 .   ? 26.748  73.152 60.330 1.00 53.76  ? 3126 HOH A O   1 
HETATM 5722 O  O   . HOH O 6 .   ? 22.759  74.014 65.519 1.00 60.78  ? 3127 HOH A O   1 
HETATM 5723 O  O   . HOH O 6 .   ? 24.225  76.147 63.620 1.00 62.09  ? 3128 HOH A O   1 
HETATM 5724 O  O   . HOH O 6 .   ? 14.461  76.485 64.416 1.00 29.46  ? 3129 HOH A O   1 
HETATM 5725 O  O   . HOH O 6 .   ? 19.194  81.730 66.748 1.00 67.23  ? 3130 HOH A O   1 
HETATM 5726 O  O   . HOH O 6 .   ? 21.255  80.387 65.569 1.00 68.84  ? 3131 HOH A O   1 
HETATM 5727 O  O   . HOH O 6 .   ? 21.265  77.790 65.024 1.00 35.24  ? 3132 HOH A O   1 
HETATM 5728 O  O   . HOH O 6 .   ? 16.078  80.246 70.008 1.00 38.31  ? 3133 HOH A O   1 
HETATM 5729 O  O   . HOH O 6 .   ? 17.189  84.407 70.158 1.00 63.96  ? 3134 HOH A O   1 
HETATM 5730 O  O   . HOH O 6 .   ? 9.619   84.561 70.493 1.00 73.51  ? 3135 HOH A O   1 
HETATM 5731 O  O   . HOH O 6 .   ? 11.621  84.087 72.417 1.00 59.20  ? 3136 HOH A O   1 
HETATM 5732 O  O   . HOH O 6 .   ? 14.139  81.720 71.262 1.00 46.90  ? 3137 HOH A O   1 
HETATM 5733 O  O   . HOH O 6 .   ? 8.511   76.943 76.318 1.00 29.13  ? 3138 HOH A O   1 
HETATM 5734 O  O   . HOH O 6 .   ? 8.149   80.672 75.302 1.00 43.47  ? 3139 HOH A O   1 
HETATM 5735 O  O   . HOH O 6 .   ? 17.667  79.342 78.463 1.00 82.54  ? 3140 HOH A O   1 
HETATM 5736 O  O   . HOH O 6 .   ? 21.261  81.022 74.402 1.00 121.45 ? 3141 HOH A O   1 
HETATM 5737 O  O   . HOH O 6 .   ? 19.764  76.963 78.295 1.00 75.06  ? 3142 HOH A O   1 
HETATM 5738 O  O   . HOH O 6 .   ? 15.237  77.645 76.947 1.00 30.80  ? 3143 HOH A O   1 
HETATM 5739 O  O   . HOH O 6 .   ? 20.556  77.898 70.498 1.00 80.05  ? 3144 HOH A O   1 
HETATM 5740 O  O   . HOH O 6 .   ? 21.319  76.259 74.329 1.00 80.17  ? 3145 HOH A O   1 
HETATM 5741 O  O   . HOH O 6 .   ? 18.750  80.461 70.517 1.00 65.91  ? 3146 HOH A O   1 
HETATM 5742 O  O   . HOH O 6 .   ? 15.155  80.607 73.806 1.00 82.11  ? 3147 HOH A O   1 
HETATM 5743 O  O   . HOH O 6 .   ? 18.982  75.288 71.020 1.00 37.36  ? 3148 HOH A O   1 
HETATM 5744 O  O   . HOH O 6 .   ? 18.467  67.630 73.313 1.00 28.38  ? 3149 HOH A O   1 
HETATM 5745 O  O   . HOH O 6 .   ? 16.633  74.269 77.724 1.00 26.68  ? 3150 HOH A O   1 
HETATM 5746 O  O   . HOH O 6 .   ? 13.483  74.516 66.345 1.00 23.56  ? 3151 HOH A O   1 
HETATM 5747 O  O   . HOH O 6 .   ? 11.652  67.545 67.535 1.00 20.55  ? 3152 HOH A O   1 
HETATM 5748 O  O   . HOH O 6 .   ? 12.361  77.567 62.962 1.00 25.74  ? 3153 HOH A O   1 
HETATM 5749 O  O   . HOH O 6 .   ? 6.231   77.846 67.397 1.00 39.51  ? 3154 HOH A O   1 
HETATM 5750 O  O   . HOH O 6 .   ? 7.750   75.863 61.027 1.00 25.10  ? 3155 HOH A O   1 
HETATM 5751 O  O   . HOH O 6 .   ? 6.814   79.051 64.571 1.00 35.83  ? 3156 HOH A O   1 
HETATM 5752 O  O   . HOH O 6 .   ? 9.838   80.284 65.416 1.00 33.42  ? 3157 HOH A O   1 
HETATM 5753 O  O   . HOH O 6 .   ? 12.633  88.853 59.571 1.00 78.13  ? 3158 HOH A O   1 
HETATM 5754 O  O   . HOH O 6 .   ? 10.197  91.112 53.661 1.00 50.22  ? 3159 HOH A O   1 
HETATM 5755 O  O   . HOH O 6 .   ? 7.275   92.356 55.831 1.00 63.28  ? 3160 HOH A O   1 
HETATM 5756 O  O   . HOH O 6 .   ? 10.258  88.755 60.741 1.00 42.57  ? 3161 HOH A O   1 
HETATM 5757 O  O   . HOH O 6 .   ? 11.222  90.985 62.538 1.00 71.20  ? 3162 HOH A O   1 
HETATM 5758 O  O   . HOH O 6 .   ? 13.671  94.063 54.732 1.00 91.84  ? 3163 HOH A O   1 
HETATM 5759 O  O   . HOH O 6 .   ? 12.960  94.674 58.123 1.00 71.94  ? 3164 HOH A O   1 
HETATM 5760 O  O   . HOH O 6 .   ? 7.594   95.009 55.539 1.00 87.94  ? 3165 HOH A O   1 
HETATM 5761 O  O   . HOH O 6 .   ? 1.522   91.046 58.054 1.00 80.39  ? 3166 HOH A O   1 
HETATM 5762 O  O   . HOH O 6 .   ? 5.086   95.649 57.795 1.00 79.24  ? 3167 HOH A O   1 
HETATM 5763 O  O   . HOH O 6 .   ? 5.479   92.903 57.582 1.00 81.61  ? 3168 HOH A O   1 
HETATM 5764 O  O   . HOH O 6 .   ? 2.187   94.296 57.043 1.00 90.89  ? 3169 HOH A O   1 
HETATM 5765 O  O   . HOH O 6 .   ? 6.853   84.516 65.308 1.00 65.53  ? 3170 HOH A O   1 
HETATM 5766 O  O   . HOH O 6 .   ? 14.213  87.423 66.792 1.00 48.65  ? 3171 HOH A O   1 
HETATM 5767 O  O   . HOH O 6 .   ? 7.825   90.420 70.126 1.00 56.05  ? 3172 HOH A O   1 
HETATM 5768 O  O   . HOH O 6 .   ? 4.981   87.509 67.860 1.00 64.79  ? 3173 HOH A O   1 
HETATM 5769 O  O   . HOH O 6 .   ? 9.240   93.208 64.993 1.00 72.80  ? 3174 HOH A O   1 
HETATM 5770 O  O   . HOH O 6 .   ? 7.536   86.580 68.460 1.00 73.76  ? 3175 HOH A O   1 
HETATM 5771 O  O   . HOH O 6 .   ? 12.160  91.445 67.515 1.00 81.94  ? 3176 HOH A O   1 
HETATM 5772 O  O   . HOH O 6 .   ? 9.968   87.276 69.343 1.00 80.31  ? 3177 HOH A O   1 
HETATM 5773 O  O   . HOH O 6 .   ? 9.617   93.234 68.481 1.00 74.82  ? 3178 HOH A O   1 
HETATM 5774 O  O   . HOH O 6 .   ? 5.725   89.748 68.806 1.00 55.89  ? 3179 HOH A O   1 
HETATM 5775 O  O   . HOH O 6 .   ? 5.769   81.458 62.900 1.00 65.77  ? 3180 HOH A O   1 
HETATM 5776 O  O   . HOH O 6 .   ? 7.460   82.018 64.906 1.00 69.24  ? 3181 HOH A O   1 
HETATM 5777 O  O   . HOH O 6 .   ? 13.260  91.396 59.751 1.00 61.10  ? 3182 HOH A O   1 
HETATM 5778 O  O   . HOH O 6 .   ? 19.490  84.966 62.991 1.00 36.17  ? 3183 HOH A O   1 
HETATM 5779 O  O   . HOH O 6 .   ? 18.181  91.549 62.167 1.00 43.41  ? 3184 HOH A O   1 
HETATM 5780 O  O   . HOH O 6 .   ? 17.656  89.975 54.897 1.00 38.06  ? 3185 HOH A O   1 
HETATM 5781 O  O   . HOH O 6 .   ? 21.161  84.157 56.344 1.00 35.18  ? 3186 HOH A O   1 
HETATM 5782 O  O   . HOH O 6 .   ? 21.521  88.956 56.250 1.00 48.05  ? 3187 HOH A O   1 
HETATM 5783 O  O   . HOH O 6 .   ? 24.294  90.039 57.980 1.00 80.49  ? 3188 HOH A O   1 
HETATM 5784 O  O   . HOH O 6 .   ? 21.780  91.508 57.168 1.00 101.08 ? 3189 HOH A O   1 
HETATM 5785 O  O   . HOH O 6 .   ? 20.462  90.553 63.278 1.00 87.95  ? 3190 HOH A O   1 
HETATM 5786 O  O   . HOH O 6 .   ? 21.669  92.398 60.960 1.00 84.69  ? 3191 HOH A O   1 
HETATM 5787 O  O   . HOH O 6 .   ? 16.734  89.110 52.560 1.00 34.69  ? 3192 HOH A O   1 
HETATM 5788 O  O   . HOH O 6 .   ? 15.855  91.955 55.742 1.00 77.56  ? 3193 HOH A O   1 
HETATM 5789 O  O   . HOH O 6 .   ? 15.596  91.193 51.160 1.00 55.57  ? 3194 HOH A O   1 
HETATM 5790 O  O   . HOH O 6 .   ? 11.686  90.641 57.721 1.00 65.17  ? 3195 HOH A O   1 
HETATM 5791 O  O   . HOH O 6 .   ? 13.772  92.698 52.460 1.00 69.80  ? 3196 HOH A O   1 
HETATM 5792 O  O   . HOH O 6 .   ? 18.765  85.187 50.537 1.00 29.79  ? 3197 HOH A O   1 
HETATM 5793 O  O   . HOH O 6 .   ? 9.091   91.331 49.225 1.00 44.17  ? 3198 HOH A O   1 
HETATM 5794 O  O   . HOH O 6 .   ? 13.501  86.430 47.485 1.00 29.06  ? 3199 HOH A O   1 
HETATM 5795 O  O   . HOH O 6 .   ? 15.227  90.388 48.508 1.00 63.72  ? 3200 HOH A O   1 
HETATM 5796 O  O   . HOH O 6 .   ? 9.361   92.529 51.673 1.00 62.90  ? 3201 HOH A O   1 
HETATM 5797 O  O   . HOH O 6 .   ? 11.814  90.034 46.022 1.00 77.52  ? 3202 HOH A O   1 
HETATM 5798 O  O   . HOH O 6 .   ? 21.413  84.127 51.480 1.00 54.05  ? 3203 HOH A O   1 
HETATM 5799 O  O   . HOH O 6 .   ? 21.139  82.638 53.853 1.00 41.35  ? 3204 HOH A O   1 
HETATM 5800 O  O   . HOH O 6 .   ? 17.620  84.531 48.269 1.00 40.10  ? 3205 HOH A O   1 
HETATM 5801 O  O   . HOH O 6 .   ? 18.354  80.102 46.595 1.00 28.18  ? 3206 HOH A O   1 
HETATM 5802 O  O   . HOH O 6 .   ? 23.775  81.737 53.907 1.00 80.37  ? 3207 HOH A O   1 
HETATM 5803 O  O   . HOH O 6 .   ? 23.430  79.065 47.083 1.00 36.11  ? 3208 HOH A O   1 
HETATM 5804 O  O   . HOH O 6 .   ? 25.133  78.881 49.214 1.00 142.70 ? 3209 HOH A O   1 
HETATM 5805 O  O   . HOH O 6 .   ? 10.861  78.611 39.804 1.00 54.57  ? 3210 HOH A O   1 
HETATM 5806 O  O   . HOH O 6 .   ? 14.053  79.911 39.405 1.00 53.15  ? 3211 HOH A O   1 
HETATM 5807 O  O   . HOH O 6 .   ? 9.810   74.508 33.889 1.00 44.24  ? 3212 HOH A O   1 
HETATM 5808 O  O   . HOH O 6 .   ? 10.923  70.963 34.179 1.00 41.93  ? 3213 HOH A O   1 
HETATM 5809 O  O   . HOH O 6 .   ? 14.668  78.914 37.017 1.00 62.04  ? 3214 HOH A O   1 
HETATM 5810 O  O   . HOH O 6 .   ? 11.453  76.204 32.934 1.00 75.04  ? 3215 HOH A O   1 
HETATM 5811 O  O   . HOH O 6 .   ? 12.847  80.852 32.595 1.00 77.23  ? 3216 HOH A O   1 
HETATM 5812 O  O   . HOH O 6 .   ? 14.352  77.048 32.788 1.00 72.69  ? 3217 HOH A O   1 
HETATM 5813 O  O   . HOH O 6 .   ? 14.847  80.389 34.525 1.00 109.62 ? 3218 HOH A O   1 
HETATM 5814 O  O   . HOH O 6 .   ? 14.878  72.332 33.333 1.00 66.55  ? 3219 HOH A O   1 
HETATM 5815 O  O   . HOH O 6 .   ? 17.815  70.027 35.851 1.00 88.54  ? 3220 HOH A O   1 
HETATM 5816 O  O   . HOH O 6 .   ? 20.202  71.205 35.727 1.00 61.00  ? 3221 HOH A O   1 
HETATM 5817 O  O   . HOH O 6 .   ? 24.239  73.070 39.293 1.00 37.71  ? 3222 HOH A O   1 
HETATM 5818 O  O   . HOH O 6 .   ? 18.926  78.908 44.123 1.00 44.08  ? 3223 HOH A O   1 
HETATM 5819 O  O   . HOH O 6 .   ? 17.918  78.497 41.919 1.00 130.27 ? 3224 HOH A O   1 
HETATM 5820 O  O   . HOH O 6 .   ? 23.003  77.796 44.045 1.00 34.63  ? 3225 HOH A O   1 
HETATM 5821 O  O   . HOH O 6 .   ? 18.067  75.424 37.713 1.00 27.76  ? 3226 HOH A O   1 
HETATM 5822 O  O   . HOH O 6 .   ? 21.605  79.423 42.452 1.00 49.03  ? 3227 HOH A O   1 
HETATM 5823 O  O   . HOH O 6 .   ? 23.603  76.191 38.047 1.00 95.29  ? 3228 HOH A O   1 
HETATM 5824 O  O   . HOH O 6 .   ? 15.314  84.380 39.643 1.00 68.51  ? 3229 HOH A O   1 
HETATM 5825 O  O   . HOH O 6 .   ? 17.179  79.977 37.646 1.00 115.82 ? 3230 HOH A O   1 
HETATM 5826 O  O   . HOH O 6 .   ? 15.206  82.006 38.289 1.00 98.97  ? 3231 HOH A O   1 
HETATM 5827 O  O   . HOH O 6 .   ? 18.725  84.226 43.996 1.00 37.65  ? 3232 HOH A O   1 
HETATM 5828 O  O   . HOH O 6 .   ? 21.987  83.414 37.449 1.00 72.94  ? 3233 HOH A O   1 
HETATM 5829 O  O   . HOH O 6 .   ? 19.497  81.937 35.824 1.00 79.83  ? 3234 HOH A O   1 
HETATM 5830 O  O   . HOH O 6 .   ? 22.064  75.330 36.182 1.00 75.93  ? 3235 HOH A O   1 
HETATM 5831 O  O   . HOH O 6 .   ? 25.484  77.512 36.791 1.00 75.98  ? 3236 HOH A O   1 
HETATM 5832 O  O   . HOH O 6 .   ? 20.968  79.078 31.471 1.00 72.35  ? 3237 HOH A O   1 
HETATM 5833 O  O   . HOH O 6 .   ? 27.821  82.489 34.867 1.00 85.29  ? 3238 HOH A O   1 
HETATM 5834 O  O   . HOH O 6 .   ? 24.041  76.699 29.401 1.00 37.76  ? 3239 HOH A O   1 
HETATM 5835 O  O   . HOH O 6 .   ? 21.155  82.410 43.114 1.00 79.06  ? 3240 HOH A O   1 
HETATM 5836 O  O   . HOH O 6 .   ? 21.629  84.608 40.221 1.00 93.39  ? 3241 HOH A O   1 
HETATM 5837 O  O   . HOH O 6 .   ? 24.183  85.206 41.268 1.00 73.51  ? 3242 HOH A O   1 
HETATM 5838 O  O   . HOH O 6 .   ? 22.179  83.033 47.474 1.00 60.09  ? 3243 HOH A O   1 
HETATM 5839 O  O   . HOH O 6 .   ? 29.311  79.424 42.080 1.00 86.09  ? 3244 HOH A O   1 
HETATM 5840 O  O   . HOH O 6 .   ? 24.383  79.252 42.308 1.00 116.02 ? 3245 HOH A O   1 
HETATM 5841 O  O   . HOH O 6 .   ? 26.618  82.233 47.574 1.00 55.51  ? 3246 HOH A O   1 
HETATM 5842 O  O   . HOH O 6 .   ? 27.691  80.583 50.702 1.00 53.21  ? 3247 HOH A O   1 
HETATM 5843 O  O   . HOH O 6 .   ? 30.538  81.943 46.610 1.00 76.39  ? 3248 HOH A O   1 
HETATM 5844 O  O   . HOH O 6 .   ? 29.908  76.828 45.123 1.00 54.66  ? 3249 HOH A O   1 
HETATM 5845 O  O   . HOH O 6 .   ? 29.528  74.422 46.935 1.00 55.69  ? 3250 HOH A O   1 
HETATM 5846 O  O   . HOH O 6 .   ? 29.149  72.318 44.731 1.00 74.18  ? 3251 HOH A O   1 
HETATM 5847 O  O   . HOH O 6 .   ? 25.114  71.777 41.571 1.00 69.95  ? 3252 HOH A O   1 
HETATM 5848 O  O   . HOH O 6 .   ? 21.643  71.850 44.128 1.00 160.45 ? 3253 HOH A O   1 
HETATM 5849 O  O   . HOH O 6 .   ? 23.137  67.132 47.900 1.00 23.65  ? 3254 HOH A O   1 
HETATM 5850 O  O   . HOH O 6 .   ? 27.514  63.724 45.872 1.00 26.48  ? 3255 HOH A O   1 
HETATM 5851 O  O   . HOH O 6 .   ? 25.931  69.052 41.245 1.00 40.36  ? 3256 HOH A O   1 
HETATM 5852 O  O   . HOH O 6 .   ? 27.832  66.141 42.943 1.00 34.19  ? 3257 HOH A O   1 
HETATM 5853 O  O   . HOH O 6 .   ? 21.952  62.083 41.926 1.00 26.95  ? 3258 HOH A O   1 
HETATM 5854 O  O   . HOH O 6 .   ? 30.156  61.541 42.412 1.00 50.64  ? 3259 HOH A O   1 
HETATM 5855 O  O   . HOH O 6 .   ? 24.233  54.375 41.651 1.00 56.33  ? 3260 HOH A O   1 
HETATM 5856 O  O   . HOH O 6 .   ? 23.131  55.571 46.143 1.00 38.12  ? 3261 HOH A O   1 
HETATM 5857 O  O   . HOH O 6 .   ? 29.324  53.866 47.525 1.00 73.29  ? 3262 HOH A O   1 
HETATM 5858 O  O   . HOH O 6 .   ? 24.838  58.686 41.376 1.00 33.97  ? 3263 HOH A O   1 
HETATM 5859 O  O   . HOH O 6 .   ? 28.070  57.869 42.039 1.00 39.03  ? 3264 HOH A O   1 
HETATM 5860 O  O   . HOH O 6 .   ? 31.625  55.998 48.469 1.00 48.68  ? 3265 HOH A O   1 
HETATM 5861 O  O   . HOH O 6 .   ? 31.145  58.817 50.012 1.00 39.66  ? 3266 HOH A O   1 
HETATM 5862 O  O   . HOH O 6 .   ? 35.850  58.788 47.328 1.00 91.62  ? 3267 HOH A O   1 
HETATM 5863 O  O   . HOH O 6 .   ? 33.648  65.328 42.800 1.00 75.85  ? 3268 HOH A O   1 
HETATM 5864 O  O   . HOH O 6 .   ? 34.673  65.649 45.326 1.00 59.48  ? 3269 HOH A O   1 
HETATM 5865 O  O   . HOH O 6 .   ? 29.499  64.382 43.823 1.00 45.09  ? 3270 HOH A O   1 
HETATM 5866 O  O   . HOH O 6 .   ? 34.052  59.997 48.847 1.00 58.23  ? 3271 HOH A O   1 
HETATM 5867 O  O   . HOH O 6 .   ? 35.247  61.250 43.168 1.00 87.08  ? 3272 HOH A O   1 
HETATM 5868 O  O   . HOH O 6 .   ? 32.749  60.859 42.380 1.00 111.75 ? 3273 HOH A O   1 
HETATM 5869 O  O   . HOH O 6 .   ? 35.642  62.052 48.219 1.00 92.88  ? 3274 HOH A O   1 
HETATM 5870 O  O   . HOH O 6 .   ? 24.980  58.861 52.547 1.00 25.60  ? 3275 HOH A O   1 
HETATM 5871 O  O   . HOH O 6 .   ? 26.894  54.600 53.174 1.00 49.89  ? 3276 HOH A O   1 
HETATM 5872 O  O   . HOH O 6 .   ? 27.475  53.593 50.739 1.00 52.07  ? 3277 HOH A O   1 
HETATM 5873 O  O   . HOH O 6 .   ? 34.926  68.224 46.549 1.00 80.60  ? 3278 HOH A O   1 
HETATM 5874 O  O   . HOH O 6 .   ? 31.061  70.304 46.179 1.00 47.38  ? 3279 HOH A O   1 
HETATM 5875 O  O   . HOH O 6 .   ? 30.193  67.461 43.142 1.00 63.90  ? 3280 HOH A O   1 
HETATM 5876 O  O   . HOH O 6 .   ? 33.630  68.803 43.683 1.00 73.70  ? 3281 HOH A O   1 
HETATM 5877 O  O   . HOH O 6 .   ? 27.206  75.121 58.183 1.00 33.47  ? 3282 HOH A O   1 
HETATM 5878 O  O   . HOH O 6 .   ? 23.102  76.704 53.251 1.00 52.33  ? 3283 HOH A O   1 
HETATM 5879 O  O   . HOH O 6 .   ? 25.756  74.779 54.439 1.00 69.99  ? 3284 HOH A O   1 
HETATM 5880 O  O   . HOH O 6 .   ? 26.352  68.899 59.202 1.00 34.13  ? 3285 HOH A O   1 
HETATM 5881 O  O   . HOH O 6 .   ? 26.205  76.593 56.227 1.00 40.14  ? 3286 HOH A O   1 
HETATM 5882 O  O   . HOH O 6 .   ? 23.793  77.503 55.416 1.00 65.03  ? 3287 HOH A O   1 
HETATM 5883 O  O   . HOH O 6 .   ? 22.320  79.718 61.482 1.00 34.17  ? 3288 HOH A O   1 
HETATM 5884 O  O   . HOH O 6 .   ? 25.886  83.086 60.955 1.00 61.31  ? 3289 HOH A O   1 
HETATM 5885 O  O   . HOH O 6 .   ? 22.051  84.649 62.546 1.00 67.51  ? 3290 HOH A O   1 
HETATM 5886 O  O   . HOH O 6 .   ? 25.982  83.461 54.787 1.00 70.48  ? 3291 HOH A O   1 
HETATM 5887 O  O   . HOH O 6 .   ? 26.814  75.225 61.914 1.00 63.32  ? 3292 HOH A O   1 
HETATM 5888 O  O   . HOH O 6 .   ? 24.165  78.410 62.571 1.00 61.10  ? 3293 HOH A O   1 
HETATM 5889 O  O   . HOH O 6 .   ? 29.180  76.612 58.945 1.00 58.31  ? 3294 HOH A O   1 
HETATM 5890 O  O   . HOH O 6 .   ? 29.641  76.949 63.057 1.00 81.68  ? 3295 HOH A O   1 
HETATM 5891 O  O   . HOH O 6 .   ? 31.120  79.270 59.678 1.00 87.15  ? 3296 HOH A O   1 
HETATM 5892 O  O   . HOH O 6 .   ? 30.239  78.181 56.754 1.00 49.73  ? 3297 HOH A O   1 
HETATM 5893 O  O   . HOH O 6 .   ? 24.979  80.679 51.089 1.00 57.64  ? 3298 HOH A O   1 
HETATM 5894 O  O   . HOH O 6 .   ? 30.409  75.563 49.162 1.00 66.50  ? 3299 HOH A O   1 
HETATM 5895 O  O   . HOH O 6 .   ? 30.883  79.160 51.120 1.00 73.70  ? 3300 HOH A O   1 
HETATM 5896 O  O   . HOH O 6 .   ? 24.757  78.773 53.191 1.00 69.47  ? 3301 HOH A O   1 
HETATM 5897 O  O   . HOH O 6 .   ? 31.737  73.818 51.301 1.00 49.96  ? 3302 HOH A O   1 
HETATM 5898 O  O   . HOH O 6 .   ? 32.781  71.789 55.286 1.00 70.17  ? 3303 HOH A O   1 
HETATM 5899 O  O   . HOH O 6 .   ? 32.626  68.135 56.258 1.00 66.41  ? 3304 HOH A O   1 
HETATM 5900 O  O   . HOH O 6 .   ? 30.507  66.210 58.223 1.00 64.13  ? 3305 HOH A O   1 
HETATM 5901 O  O   . HOH O 6 .   ? 31.976  65.553 55.309 1.00 35.79  ? 3306 HOH A O   1 
HETATM 5902 O  O   . HOH O 6 .   ? 28.750  64.329 57.608 1.00 39.94  ? 3307 HOH A O   1 
HETATM 5903 O  O   . HOH O 6 .   ? 33.339  67.152 52.066 1.00 74.10  ? 3308 HOH A O   1 
HETATM 5904 O  O   . HOH O 6 .   ? 34.831  61.489 52.493 1.00 102.01 ? 3309 HOH A O   1 
HETATM 5905 O  O   . HOH O 6 .   ? 32.531  60.650 51.434 1.00 95.99  ? 3310 HOH A O   1 
HETATM 5906 O  O   . HOH O 6 .   ? 36.253  63.699 50.903 1.00 71.96  ? 3311 HOH A O   1 
HETATM 5907 O  O   . HOH O 6 .   ? 29.059  61.692 59.224 1.00 49.43  ? 3312 HOH A O   1 
HETATM 5908 O  O   . HOH O 6 .   ? 30.713  52.760 50.340 1.00 79.18  ? 3313 HOH A O   1 
HETATM 5909 O  O   . HOH O 6 .   ? 30.171  54.553 54.737 1.00 117.27 ? 3314 HOH A O   1 
HETATM 5910 O  O   . HOH O 6 .   ? 25.086  58.543 55.373 1.00 23.66  ? 3315 HOH A O   1 
HETATM 5911 O  O   . HOH O 6 .   ? 25.149  61.753 52.889 1.00 22.15  ? 3316 HOH A O   1 
HETATM 5912 O  O   . HOH O 6 .   ? 18.926  64.125 27.251 1.00 55.26  ? 3317 HOH A O   1 
HETATM 5913 O  O   . HOH O 6 .   ? 23.230  66.137 31.577 1.00 37.64  ? 3318 HOH A O   1 
HETATM 5914 O  O   . HOH O 6 .   ? 25.050  61.084 29.822 1.00 58.56  ? 3319 HOH A O   1 
HETATM 5915 O  O   . HOH O 6 .   ? 18.101  60.415 27.057 1.00 84.07  ? 3320 HOH A O   1 
HETATM 5916 O  O   . HOH O 6 .   ? 27.791  62.514 35.332 1.00 73.63  ? 3321 HOH A O   1 
HETATM 5917 O  O   . HOH O 6 .   ? 25.046  64.463 36.104 1.00 80.00  ? 3322 HOH A O   1 
HETATM 5918 O  O   . HOH O 6 .   ? 22.074  58.355 33.150 1.00 52.60  ? 3323 HOH A O   1 
HETATM 5919 O  O   . HOH O 6 .   ? 24.730  59.187 37.126 1.00 59.53  ? 3324 HOH A O   1 
HETATM 5920 O  O   . HOH O 6 .   ? 22.891  61.285 27.019 1.00 62.64  ? 3325 HOH A O   1 
HETATM 5921 O  O   . HOH O 6 .   ? -20.760 90.180 53.188 1.00 80.68  ? 3326 HOH A O   1 
HETATM 5922 O  O   . HOH O 6 .   ? -20.037 87.158 45.319 1.00 93.41  ? 3327 HOH A O   1 
HETATM 5923 O  O   . HOH O 6 .   ? -17.550 86.804 44.343 1.00 117.91 ? 3328 HOH A O   1 
HETATM 5924 O  O   . HOH O 6 .   ? -18.632 90.394 55.018 1.00 76.72  ? 3329 HOH A O   1 
HETATM 5925 O  O   . HOH O 6 .   ? -17.550 87.549 56.287 1.00 75.08  ? 3330 HOH A O   1 
HETATM 5926 O  O   . HOH O 6 .   ? 20.756  67.301 24.876 1.00 74.18  ? 3331 HOH A O   1 
HETATM 5927 O  O   . HOH O 6 .   ? 26.763  64.102 59.372 1.00 27.04  ? 3332 HOH A O   1 
HETATM 5928 O  O   . HOH O 6 .   ? 25.420  65.775 62.383 1.00 53.40  ? 3333 HOH A O   1 
HETATM 5929 O  O   . HOH O 6 .   ? 27.357  60.257 65.369 1.00 43.83  ? 3334 HOH A O   1 
HETATM 5930 O  O   . HOH O 6 .   ? 25.637  60.756 67.465 1.00 58.89  ? 3335 HOH A O   1 
HETATM 5931 O  O   . HOH O 6 .   ? 28.357  62.649 64.019 1.00 70.94  ? 3336 HOH A O   1 
HETATM 5932 O  O   . HOH O 6 .   ? 24.950  54.539 56.947 1.00 55.08  ? 3337 HOH A O   1 
HETATM 5933 O  O   . HOH O 6 .   ? 32.545  57.882 61.637 1.00 42.44  ? 3338 HOH A O   1 
HETATM 5934 O  O   . HOH O 6 .   ? 28.894  59.727 61.201 1.00 25.93  ? 3339 HOH A O   1 
HETATM 5935 O  O   . HOH O 6 .   ? 31.916  54.455 66.496 1.00 98.84  ? 3340 HOH A O   1 
HETATM 5936 O  O   . HOH O 6 .   ? 26.705  59.354 62.793 1.00 25.37  ? 3341 HOH A O   1 
HETATM 5937 O  O   . HOH O 6 .   ? 16.336  50.768 62.789 1.00 38.17  ? 3342 HOH A O   1 
HETATM 5938 O  O   . HOH O 6 .   ? 16.343  49.726 59.538 1.00 49.93  ? 3343 HOH A O   1 
HETATM 5939 O  O   . HOH O 6 .   ? 16.183  53.149 59.248 1.00 29.18  ? 3344 HOH A O   1 
HETATM 5940 O  O   . HOH O 6 .   ? 16.792  50.507 56.747 1.00 40.84  ? 3345 HOH A O   1 
HETATM 5941 O  O   . HOH O 6 .   ? 18.648  48.990 55.567 1.00 60.31  ? 3346 HOH A O   1 
HETATM 5942 O  O   . HOH O 6 .   ? 18.366  45.416 56.547 1.00 77.27  ? 3347 HOH A O   1 
HETATM 5943 O  O   . HOH O 6 .   ? 19.791  45.944 58.618 1.00 153.40 ? 3348 HOH A O   1 
HETATM 5944 O  O   . HOH O 6 .   ? 21.099  43.992 57.812 1.00 48.53  ? 3349 HOH A O   1 
HETATM 5945 O  O   . HOH O 6 .   ? 27.284  46.710 57.884 1.00 46.86  ? 3350 HOH A O   1 
HETATM 5946 O  O   . HOH O 6 .   ? 26.314  51.842 54.209 1.00 62.30  ? 3351 HOH A O   1 
HETATM 5947 O  O   . HOH O 6 .   ? 28.341  50.509 54.975 1.00 62.00  ? 3352 HOH A O   1 
HETATM 5948 O  O   . HOH O 6 .   ? 25.858  44.538 57.495 1.00 102.69 ? 3353 HOH A O   1 
HETATM 5949 O  O   . HOH O 6 .   ? 24.922  50.636 52.234 1.00 69.32  ? 3354 HOH A O   1 
HETATM 5950 O  O   . HOH O 6 .   ? 24.961  44.244 55.018 1.00 104.82 ? 3355 HOH A O   1 
HETATM 5951 O  O   . HOH O 6 .   ? 20.856  48.574 52.856 1.00 67.48  ? 3356 HOH A O   1 
HETATM 5952 O  O   . HOH O 6 .   ? 23.702  51.767 56.312 1.00 37.38  ? 3357 HOH A O   1 
HETATM 5953 O  O   . HOH O 6 .   ? 24.939  47.671 52.479 1.00 85.56  ? 3358 HOH A O   1 
HETATM 5954 O  O   . HOH O 6 .   ? 23.729  43.173 57.747 1.00 79.32  ? 3359 HOH A O   1 
HETATM 5955 O  O   . HOH O 6 .   ? 22.906  46.775 53.884 1.00 114.59 ? 3360 HOH A O   1 
HETATM 5956 O  O   . HOH O 6 .   ? 28.694  48.307 56.421 1.00 93.86  ? 3361 HOH A O   1 
HETATM 5957 O  O   . HOH O 6 .   ? 15.118  42.767 61.992 1.00 38.08  ? 3362 HOH A O   1 
HETATM 5958 O  O   . HOH O 6 .   ? 20.212  38.114 61.145 1.00 47.37  ? 3363 HOH A O   1 
HETATM 5959 O  O   . HOH O 6 .   ? 24.293  36.592 61.506 1.00 59.16  ? 3364 HOH A O   1 
HETATM 5960 O  O   . HOH O 6 .   ? 26.703  37.840 58.672 1.00 87.13  ? 3365 HOH A O   1 
HETATM 5961 O  O   . HOH O 6 .   ? 16.994  37.471 57.550 1.00 71.97  ? 3366 HOH A O   1 
HETATM 5962 O  O   . HOH O 6 .   ? 19.032  39.260 58.789 1.00 61.65  ? 3367 HOH A O   1 
HETATM 5963 O  O   . HOH O 6 .   ? 15.215  35.894 58.760 1.00 86.28  ? 3368 HOH A O   1 
HETATM 5964 O  O   . HOH O 6 .   ? 18.289  35.159 59.095 1.00 77.82  ? 3369 HOH A O   1 
HETATM 5965 O  O   . HOH O 6 .   ? 13.616  35.821 62.840 1.00 78.46  ? 3370 HOH A O   1 
HETATM 5966 O  O   . HOH O 6 .   ? 16.234  33.539 63.738 1.00 72.30  ? 3371 HOH A O   1 
HETATM 5967 O  O   . HOH O 6 .   ? 18.394  34.293 61.528 1.00 88.95  ? 3372 HOH A O   1 
HETATM 5968 O  O   . HOH O 6 .   ? 18.199  32.621 67.771 1.00 65.36  ? 3373 HOH A O   1 
HETATM 5969 O  O   . HOH O 6 .   ? 14.202  37.616 70.970 1.00 68.38  ? 3374 HOH A O   1 
HETATM 5970 O  O   . HOH O 6 .   ? 15.921  33.626 66.596 1.00 96.64  ? 3375 HOH A O   1 
HETATM 5971 O  O   . HOH O 6 .   ? 13.467  36.009 67.986 1.00 92.81  ? 3376 HOH A O   1 
HETATM 5972 O  O   . HOH O 6 .   ? 14.008  36.377 65.467 1.00 71.86  ? 3377 HOH A O   1 
HETATM 5973 O  O   . HOH O 6 .   ? 13.980  39.924 68.121 1.00 61.33  ? 3378 HOH A O   1 
HETATM 5974 O  O   . HOH O 6 .   ? 21.117  62.986 27.779 1.00 55.96  ? 3379 HOH A O   1 
HETATM 5975 O  O   . HOH O 6 .   ? 19.491  58.550 32.892 1.00 38.91  ? 3380 HOH A O   1 
HETATM 5976 O  O   . HOH O 6 .   ? 21.847  60.033 38.615 1.00 40.56  ? 3381 HOH A O   1 
HETATM 5977 O  O   . HOH O 6 .   ? 16.919  59.055 32.174 1.00 45.87  ? 3382 HOH A O   1 
HETATM 5978 O  O   . HOH O 6 .   ? 22.522  61.362 29.505 1.00 53.94  ? 3383 HOH A O   1 
HETATM 5979 O  O   . HOH O 6 .   ? 23.984  59.889 34.113 1.00 56.53  ? 3384 HOH A O   1 
HETATM 5980 O  O   . HOH O 6 .   ? 14.573  63.433 31.571 1.00 59.14  ? 3385 HOH A O   1 
HETATM 5981 O  O   . HOH O 6 .   ? 15.272  61.032 32.852 1.00 54.87  ? 3386 HOH A O   1 
HETATM 5982 O  O   . HOH O 6 .   ? 16.562  64.984 30.606 1.00 59.63  ? 3387 HOH A O   1 
HETATM 5983 O  O   . HOH O 6 .   ? 21.093  65.700 35.200 1.00 49.92  ? 3388 HOH A O   1 
HETATM 5984 O  O   . HOH O 6 .   ? 25.062  62.152 34.742 1.00 57.77  ? 3389 HOH A O   1 
HETATM 5985 O  O   . HOH O 6 .   ? 14.698  62.745 28.960 1.00 78.04  ? 3390 HOH A O   1 
HETATM 5986 O  O   . HOH O 6 .   ? 16.583  58.605 29.189 1.00 69.16  ? 3391 HOH A O   1 
HETATM 5987 O  O   . HOH O 6 .   ? 23.630  63.697 30.299 1.00 77.75  ? 3392 HOH A O   1 
HETATM 5988 O  O   . HOH O 6 .   ? 20.653  65.376 28.528 1.00 57.69  ? 3393 HOH A O   1 
HETATM 5989 O  O   . HOH O 6 .   ? -18.829 88.458 53.323 1.00 57.06  ? 3394 HOH A O   1 
HETATM 5990 O  O   . HOH O 6 .   ? -21.588 82.413 48.129 1.00 63.13  ? 3395 HOH A O   1 
HETATM 5991 O  O   . HOH O 6 .   ? -20.174 86.039 55.186 1.00 74.19  ? 3396 HOH A O   1 
HETATM 5992 O  O   . HOH O 6 .   ? -20.658 83.377 55.571 1.00 67.70  ? 3397 HOH A O   1 
HETATM 5993 O  O   . HOH O 6 .   ? -18.152 83.803 55.996 1.00 74.80  ? 3398 HOH A O   1 
HETATM 5994 O  O   . HOH O 6 .   ? -16.061 88.644 53.905 1.00 62.30  ? 3399 HOH A O   1 
HETATM 5995 O  O   . HOH O 6 .   ? -17.854 85.448 46.764 1.00 105.89 ? 3400 HOH A O   1 
HETATM 5996 O  O   . HOH O 6 .   ? -18.839 81.699 54.664 1.00 80.60  ? 3401 HOH A O   1 
HETATM 5997 O  O   . HOH O 6 .   ? -22.734 85.302 50.879 1.00 89.58  ? 3402 HOH A O   1 
HETATM 5998 O  O   . HOH O 6 .   ? -21.072 87.240 52.408 1.00 120.38 ? 3403 HOH A O   1 
HETATM 5999 O  O   . HOH O 6 .   ? -15.133 87.228 50.883 1.00 91.80  ? 3404 HOH A O   1 
HETATM 6000 O  O   . HOH O 6 .   ? 1.277   41.106 54.684 1.00 34.94  ? 3405 HOH A O   1 
HETATM 6001 O  O   . HOH O 6 .   ? -3.002  38.554 54.900 1.00 73.85  ? 3406 HOH A O   1 
HETATM 6002 O  O   . HOH O 6 .   ? 23.767  71.155 69.573 1.00 88.35  ? 3407 HOH A O   1 
HETATM 6003 O  O   . HOH O 6 .   ? 23.449  76.129 69.212 1.00 74.95  ? 3408 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 486 HIS HIS A . n 
A 1 487 SER 487 487 487 SER SER A . n 
A 1 488 GLN 488 488 488 GLN GLN A . n 
A 1 489 GLU 489 489 489 GLU GLU A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 536 ALA ALA A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ETM 1    1536 1536 ETM ETM A . 
C 3 CL  1    1537 1537 CL  CL  A . 
D 2 ETM 1    1538 1538 ETM ETM A . 
E 3 CL  1    1539 1539 CL  CL  A . 
F 3 CL  1    1540 1540 CL  CL  A . 
G 3 CL  1    1541 1541 CL  CL  A . 
H 3 CL  1    1542 1542 CL  CL  A . 
I 3 CL  1    1543 1543 CL  CL  A . 
J 3 CL  1    1544 1544 CL  CL  A . 
K 4 NAG 1    1545 1545 NAG NAG A . 
L 4 NAG 1    1546 1546 NAG NAG A . 
M 5 PGE 1    1547 1547 PGE PGE A . 
N 5 PGE 1    1548 1548 PGE PGE A . 
O 6 HOH 1    2001 2001 HOH HOH A . 
O 6 HOH 2    2002 2002 HOH HOH A . 
O 6 HOH 3    2003 2003 HOH HOH A . 
O 6 HOH 4    2004 2004 HOH HOH A . 
O 6 HOH 5    2005 2005 HOH HOH A . 
O 6 HOH 6    2006 2006 HOH HOH A . 
O 6 HOH 7    2007 2007 HOH HOH A . 
O 6 HOH 8    2008 2008 HOH HOH A . 
O 6 HOH 9    2009 2009 HOH HOH A . 
O 6 HOH 10   2010 2010 HOH HOH A . 
O 6 HOH 11   2011 2011 HOH HOH A . 
O 6 HOH 12   2012 2012 HOH HOH A . 
O 6 HOH 13   2013 2013 HOH HOH A . 
O 6 HOH 14   2014 2014 HOH HOH A . 
O 6 HOH 15   2015 2015 HOH HOH A . 
O 6 HOH 16   2016 2016 HOH HOH A . 
O 6 HOH 17   2017 2017 HOH HOH A . 
O 6 HOH 18   2018 2018 HOH HOH A . 
O 6 HOH 19   2019 2019 HOH HOH A . 
O 6 HOH 20   2020 2020 HOH HOH A . 
O 6 HOH 21   2021 2021 HOH HOH A . 
O 6 HOH 22   2022 2022 HOH HOH A . 
O 6 HOH 23   2023 2023 HOH HOH A . 
O 6 HOH 24   2024 2024 HOH HOH A . 
O 6 HOH 25   2025 2025 HOH HOH A . 
O 6 HOH 26   2026 2026 HOH HOH A . 
O 6 HOH 27   2027 2027 HOH HOH A . 
O 6 HOH 28   2028 2028 HOH HOH A . 
O 6 HOH 29   2029 2029 HOH HOH A . 
O 6 HOH 30   2030 2030 HOH HOH A . 
O 6 HOH 31   2031 2031 HOH HOH A . 
O 6 HOH 32   2032 2032 HOH HOH A . 
O 6 HOH 33   2033 2033 HOH HOH A . 
O 6 HOH 34   2034 2034 HOH HOH A . 
O 6 HOH 35   2035 2035 HOH HOH A . 
O 6 HOH 36   2036 2036 HOH HOH A . 
O 6 HOH 37   2037 2037 HOH HOH A . 
O 6 HOH 38   2038 2038 HOH HOH A . 
O 6 HOH 39   2039 2039 HOH HOH A . 
O 6 HOH 40   2040 2040 HOH HOH A . 
O 6 HOH 41   2041 2041 HOH HOH A . 
O 6 HOH 42   2042 2042 HOH HOH A . 
O 6 HOH 43   2043 2043 HOH HOH A . 
O 6 HOH 44   2044 2044 HOH HOH A . 
O 6 HOH 45   2045 2045 HOH HOH A . 
O 6 HOH 46   2046 2046 HOH HOH A . 
O 6 HOH 47   2047 2047 HOH HOH A . 
O 6 HOH 48   2048 2048 HOH HOH A . 
O 6 HOH 49   2049 2049 HOH HOH A . 
O 6 HOH 50   2050 2050 HOH HOH A . 
O 6 HOH 51   2051 2051 HOH HOH A . 
O 6 HOH 52   2052 2052 HOH HOH A . 
O 6 HOH 53   2053 2053 HOH HOH A . 
O 6 HOH 54   2054 2054 HOH HOH A . 
O 6 HOH 55   2055 2055 HOH HOH A . 
O 6 HOH 56   2056 2056 HOH HOH A . 
O 6 HOH 57   2057 2057 HOH HOH A . 
O 6 HOH 58   2058 2058 HOH HOH A . 
O 6 HOH 59   2059 2059 HOH HOH A . 
O 6 HOH 60   2060 2060 HOH HOH A . 
O 6 HOH 61   2061 2061 HOH HOH A . 
O 6 HOH 62   2062 2062 HOH HOH A . 
O 6 HOH 63   2063 2063 HOH HOH A . 
O 6 HOH 64   2064 2064 HOH HOH A . 
O 6 HOH 65   2065 2065 HOH HOH A . 
O 6 HOH 66   2066 2066 HOH HOH A . 
O 6 HOH 67   2067 2067 HOH HOH A . 
O 6 HOH 68   2068 2068 HOH HOH A . 
O 6 HOH 69   2069 2069 HOH HOH A . 
O 6 HOH 70   2070 2070 HOH HOH A . 
O 6 HOH 71   2071 2071 HOH HOH A . 
O 6 HOH 72   2072 2072 HOH HOH A . 
O 6 HOH 73   2073 2073 HOH HOH A . 
O 6 HOH 74   2074 2074 HOH HOH A . 
O 6 HOH 75   2075 2075 HOH HOH A . 
O 6 HOH 76   2076 2076 HOH HOH A . 
O 6 HOH 77   2077 2077 HOH HOH A . 
O 6 HOH 78   2078 2078 HOH HOH A . 
O 6 HOH 79   2079 2079 HOH HOH A . 
O 6 HOH 80   2080 2080 HOH HOH A . 
O 6 HOH 81   2081 2081 HOH HOH A . 
O 6 HOH 82   2082 2082 HOH HOH A . 
O 6 HOH 83   2083 2083 HOH HOH A . 
O 6 HOH 84   2084 2084 HOH HOH A . 
O 6 HOH 85   2085 2085 HOH HOH A . 
O 6 HOH 86   2086 2086 HOH HOH A . 
O 6 HOH 87   2087 2087 HOH HOH A . 
O 6 HOH 88   2088 2088 HOH HOH A . 
O 6 HOH 89   2089 2089 HOH HOH A . 
O 6 HOH 90   2090 2090 HOH HOH A . 
O 6 HOH 91   2091 2091 HOH HOH A . 
O 6 HOH 92   2092 2092 HOH HOH A . 
O 6 HOH 93   2093 2093 HOH HOH A . 
O 6 HOH 94   2094 2094 HOH HOH A . 
O 6 HOH 95   2095 2095 HOH HOH A . 
O 6 HOH 96   2096 2096 HOH HOH A . 
O 6 HOH 97   2097 2097 HOH HOH A . 
O 6 HOH 98   2098 2098 HOH HOH A . 
O 6 HOH 99   2099 2099 HOH HOH A . 
O 6 HOH 100  2100 2100 HOH HOH A . 
O 6 HOH 101  2101 2101 HOH HOH A . 
O 6 HOH 102  2102 2102 HOH HOH A . 
O 6 HOH 103  2103 2103 HOH HOH A . 
O 6 HOH 104  2104 2104 HOH HOH A . 
O 6 HOH 105  2105 2105 HOH HOH A . 
O 6 HOH 106  2106 2106 HOH HOH A . 
O 6 HOH 107  2107 2107 HOH HOH A . 
O 6 HOH 108  2108 2108 HOH HOH A . 
O 6 HOH 109  2109 2109 HOH HOH A . 
O 6 HOH 110  2110 2110 HOH HOH A . 
O 6 HOH 111  2111 2111 HOH HOH A . 
O 6 HOH 112  2112 2112 HOH HOH A . 
O 6 HOH 113  2113 2113 HOH HOH A . 
O 6 HOH 114  2114 2114 HOH HOH A . 
O 6 HOH 115  2115 2115 HOH HOH A . 
O 6 HOH 116  2116 2116 HOH HOH A . 
O 6 HOH 117  2117 2117 HOH HOH A . 
O 6 HOH 118  2118 2118 HOH HOH A . 
O 6 HOH 119  2119 2119 HOH HOH A . 
O 6 HOH 120  2120 2120 HOH HOH A . 
O 6 HOH 121  2121 2121 HOH HOH A . 
O 6 HOH 122  2122 2122 HOH HOH A . 
O 6 HOH 123  2123 2123 HOH HOH A . 
O 6 HOH 124  2124 2124 HOH HOH A . 
O 6 HOH 125  2125 2125 HOH HOH A . 
O 6 HOH 126  2126 2126 HOH HOH A . 
O 6 HOH 127  2127 2127 HOH HOH A . 
O 6 HOH 128  2128 2128 HOH HOH A . 
O 6 HOH 129  2129 2129 HOH HOH A . 
O 6 HOH 130  2130 2130 HOH HOH A . 
O 6 HOH 131  2131 2131 HOH HOH A . 
O 6 HOH 132  2132 2132 HOH HOH A . 
O 6 HOH 133  2133 2133 HOH HOH A . 
O 6 HOH 134  2134 2134 HOH HOH A . 
O 6 HOH 135  2135 2135 HOH HOH A . 
O 6 HOH 136  2136 2136 HOH HOH A . 
O 6 HOH 137  2137 2137 HOH HOH A . 
O 6 HOH 138  2138 2138 HOH HOH A . 
O 6 HOH 139  2139 2139 HOH HOH A . 
O 6 HOH 140  2140 2140 HOH HOH A . 
O 6 HOH 141  2141 2141 HOH HOH A . 
O 6 HOH 142  2142 2142 HOH HOH A . 
O 6 HOH 143  2143 2143 HOH HOH A . 
O 6 HOH 144  2144 2144 HOH HOH A . 
O 6 HOH 145  2145 2145 HOH HOH A . 
O 6 HOH 146  2146 2146 HOH HOH A . 
O 6 HOH 147  2147 2147 HOH HOH A . 
O 6 HOH 148  2148 2148 HOH HOH A . 
O 6 HOH 149  2149 2149 HOH HOH A . 
O 6 HOH 150  2150 2150 HOH HOH A . 
O 6 HOH 151  2151 2151 HOH HOH A . 
O 6 HOH 152  2152 2152 HOH HOH A . 
O 6 HOH 153  2153 2153 HOH HOH A . 
O 6 HOH 154  2154 2154 HOH HOH A . 
O 6 HOH 155  2155 2155 HOH HOH A . 
O 6 HOH 156  2156 2156 HOH HOH A . 
O 6 HOH 157  2157 2157 HOH HOH A . 
O 6 HOH 158  2158 2158 HOH HOH A . 
O 6 HOH 159  2159 2159 HOH HOH A . 
O 6 HOH 160  2160 2160 HOH HOH A . 
O 6 HOH 161  2161 2161 HOH HOH A . 
O 6 HOH 162  2162 2162 HOH HOH A . 
O 6 HOH 163  2163 2163 HOH HOH A . 
O 6 HOH 164  2164 2164 HOH HOH A . 
O 6 HOH 165  2165 2165 HOH HOH A . 
O 6 HOH 166  2166 2166 HOH HOH A . 
O 6 HOH 167  2167 2167 HOH HOH A . 
O 6 HOH 168  2168 2168 HOH HOH A . 
O 6 HOH 169  2169 2169 HOH HOH A . 
O 6 HOH 170  2170 2170 HOH HOH A . 
O 6 HOH 171  2171 2171 HOH HOH A . 
O 6 HOH 172  2172 2172 HOH HOH A . 
O 6 HOH 173  2173 2173 HOH HOH A . 
O 6 HOH 174  2174 2174 HOH HOH A . 
O 6 HOH 175  2175 2175 HOH HOH A . 
O 6 HOH 176  2176 2176 HOH HOH A . 
O 6 HOH 177  2177 2177 HOH HOH A . 
O 6 HOH 178  2178 2178 HOH HOH A . 
O 6 HOH 179  2179 2179 HOH HOH A . 
O 6 HOH 180  2180 2180 HOH HOH A . 
O 6 HOH 181  2181 2181 HOH HOH A . 
O 6 HOH 182  2182 2182 HOH HOH A . 
O 6 HOH 183  2183 2183 HOH HOH A . 
O 6 HOH 184  2184 2184 HOH HOH A . 
O 6 HOH 185  2185 2185 HOH HOH A . 
O 6 HOH 186  2186 2186 HOH HOH A . 
O 6 HOH 187  2187 2187 HOH HOH A . 
O 6 HOH 188  2188 2188 HOH HOH A . 
O 6 HOH 189  2189 2189 HOH HOH A . 
O 6 HOH 190  2190 2190 HOH HOH A . 
O 6 HOH 191  2191 2191 HOH HOH A . 
O 6 HOH 192  2192 2192 HOH HOH A . 
O 6 HOH 193  2193 2193 HOH HOH A . 
O 6 HOH 194  2194 2194 HOH HOH A . 
O 6 HOH 195  2195 2195 HOH HOH A . 
O 6 HOH 196  2196 2196 HOH HOH A . 
O 6 HOH 197  2197 2197 HOH HOH A . 
O 6 HOH 198  2198 2198 HOH HOH A . 
O 6 HOH 199  2199 2199 HOH HOH A . 
O 6 HOH 200  2200 2200 HOH HOH A . 
O 6 HOH 201  2201 2201 HOH HOH A . 
O 6 HOH 202  2202 2202 HOH HOH A . 
O 6 HOH 203  2203 2203 HOH HOH A . 
O 6 HOH 204  2204 2204 HOH HOH A . 
O 6 HOH 205  2205 2205 HOH HOH A . 
O 6 HOH 206  2206 2206 HOH HOH A . 
O 6 HOH 207  2207 2207 HOH HOH A . 
O 6 HOH 208  2208 2208 HOH HOH A . 
O 6 HOH 209  2209 2209 HOH HOH A . 
O 6 HOH 210  2210 2210 HOH HOH A . 
O 6 HOH 211  2211 2211 HOH HOH A . 
O 6 HOH 212  2212 2212 HOH HOH A . 
O 6 HOH 213  2213 2213 HOH HOH A . 
O 6 HOH 214  2214 2214 HOH HOH A . 
O 6 HOH 215  2215 2215 HOH HOH A . 
O 6 HOH 216  2216 2216 HOH HOH A . 
O 6 HOH 217  2217 2217 HOH HOH A . 
O 6 HOH 218  2218 2218 HOH HOH A . 
O 6 HOH 219  2219 2219 HOH HOH A . 
O 6 HOH 220  2220 2220 HOH HOH A . 
O 6 HOH 221  2221 2221 HOH HOH A . 
O 6 HOH 222  2222 2222 HOH HOH A . 
O 6 HOH 223  2223 2223 HOH HOH A . 
O 6 HOH 224  2224 2224 HOH HOH A . 
O 6 HOH 225  2225 2225 HOH HOH A . 
O 6 HOH 226  2226 2226 HOH HOH A . 
O 6 HOH 227  2227 2227 HOH HOH A . 
O 6 HOH 228  2228 2228 HOH HOH A . 
O 6 HOH 229  2229 2229 HOH HOH A . 
O 6 HOH 230  2230 2230 HOH HOH A . 
O 6 HOH 231  2231 2231 HOH HOH A . 
O 6 HOH 232  2232 2232 HOH HOH A . 
O 6 HOH 233  2233 2233 HOH HOH A . 
O 6 HOH 234  2234 2234 HOH HOH A . 
O 6 HOH 235  2235 2235 HOH HOH A . 
O 6 HOH 236  2236 2236 HOH HOH A . 
O 6 HOH 237  2237 2237 HOH HOH A . 
O 6 HOH 238  2238 2238 HOH HOH A . 
O 6 HOH 239  2239 2239 HOH HOH A . 
O 6 HOH 240  2240 2240 HOH HOH A . 
O 6 HOH 241  2241 2241 HOH HOH A . 
O 6 HOH 242  2242 2242 HOH HOH A . 
O 6 HOH 243  2243 2243 HOH HOH A . 
O 6 HOH 244  2244 2244 HOH HOH A . 
O 6 HOH 245  2245 2245 HOH HOH A . 
O 6 HOH 246  2246 2246 HOH HOH A . 
O 6 HOH 247  2247 2247 HOH HOH A . 
O 6 HOH 248  2248 2248 HOH HOH A . 
O 6 HOH 249  2249 2249 HOH HOH A . 
O 6 HOH 250  2250 2250 HOH HOH A . 
O 6 HOH 251  2251 2251 HOH HOH A . 
O 6 HOH 252  2252 2252 HOH HOH A . 
O 6 HOH 253  2253 2253 HOH HOH A . 
O 6 HOH 254  2254 2254 HOH HOH A . 
O 6 HOH 255  2255 2255 HOH HOH A . 
O 6 HOH 256  2256 2256 HOH HOH A . 
O 6 HOH 257  2257 2257 HOH HOH A . 
O 6 HOH 258  2258 2258 HOH HOH A . 
O 6 HOH 259  2259 2259 HOH HOH A . 
O 6 HOH 260  2260 2260 HOH HOH A . 
O 6 HOH 261  2261 2261 HOH HOH A . 
O 6 HOH 262  2262 2262 HOH HOH A . 
O 6 HOH 263  2263 2263 HOH HOH A . 
O 6 HOH 264  2264 2264 HOH HOH A . 
O 6 HOH 265  2265 2265 HOH HOH A . 
O 6 HOH 266  2266 2266 HOH HOH A . 
O 6 HOH 267  2267 2267 HOH HOH A . 
O 6 HOH 268  2268 2268 HOH HOH A . 
O 6 HOH 269  2269 2269 HOH HOH A . 
O 6 HOH 270  2270 2270 HOH HOH A . 
O 6 HOH 271  2271 2271 HOH HOH A . 
O 6 HOH 272  2272 2272 HOH HOH A . 
O 6 HOH 273  2273 2273 HOH HOH A . 
O 6 HOH 274  2274 2274 HOH HOH A . 
O 6 HOH 275  2275 2275 HOH HOH A . 
O 6 HOH 276  2276 2276 HOH HOH A . 
O 6 HOH 277  2277 2277 HOH HOH A . 
O 6 HOH 278  2278 2278 HOH HOH A . 
O 6 HOH 279  2279 2279 HOH HOH A . 
O 6 HOH 280  2280 2280 HOH HOH A . 
O 6 HOH 281  2281 2281 HOH HOH A . 
O 6 HOH 282  2282 2282 HOH HOH A . 
O 6 HOH 283  2283 2283 HOH HOH A . 
O 6 HOH 284  2284 2284 HOH HOH A . 
O 6 HOH 285  2285 2285 HOH HOH A . 
O 6 HOH 286  2286 2286 HOH HOH A . 
O 6 HOH 287  2287 2287 HOH HOH A . 
O 6 HOH 288  2288 2288 HOH HOH A . 
O 6 HOH 289  2289 2289 HOH HOH A . 
O 6 HOH 290  2290 2290 HOH HOH A . 
O 6 HOH 291  2291 2291 HOH HOH A . 
O 6 HOH 292  2292 2292 HOH HOH A . 
O 6 HOH 293  2293 2293 HOH HOH A . 
O 6 HOH 294  2294 2294 HOH HOH A . 
O 6 HOH 295  2295 2295 HOH HOH A . 
O 6 HOH 296  2296 2296 HOH HOH A . 
O 6 HOH 297  2297 2297 HOH HOH A . 
O 6 HOH 298  2298 2298 HOH HOH A . 
O 6 HOH 299  2299 2299 HOH HOH A . 
O 6 HOH 300  2300 2300 HOH HOH A . 
O 6 HOH 301  2301 2301 HOH HOH A . 
O 6 HOH 302  2302 2302 HOH HOH A . 
O 6 HOH 303  2303 2303 HOH HOH A . 
O 6 HOH 304  2304 2304 HOH HOH A . 
O 6 HOH 305  2305 2305 HOH HOH A . 
O 6 HOH 306  2306 2306 HOH HOH A . 
O 6 HOH 307  2307 2307 HOH HOH A . 
O 6 HOH 308  2308 2308 HOH HOH A . 
O 6 HOH 309  2309 2309 HOH HOH A . 
O 6 HOH 310  2310 2310 HOH HOH A . 
O 6 HOH 311  2311 2311 HOH HOH A . 
O 6 HOH 312  2312 2312 HOH HOH A . 
O 6 HOH 313  2313 2313 HOH HOH A . 
O 6 HOH 314  2314 2314 HOH HOH A . 
O 6 HOH 315  2315 2315 HOH HOH A . 
O 6 HOH 316  2316 2316 HOH HOH A . 
O 6 HOH 317  2317 2317 HOH HOH A . 
O 6 HOH 318  2318 2318 HOH HOH A . 
O 6 HOH 319  2319 2319 HOH HOH A . 
O 6 HOH 320  2320 2320 HOH HOH A . 
O 6 HOH 321  2321 2321 HOH HOH A . 
O 6 HOH 322  2322 2322 HOH HOH A . 
O 6 HOH 323  2323 2323 HOH HOH A . 
O 6 HOH 324  2324 2324 HOH HOH A . 
O 6 HOH 325  2325 2325 HOH HOH A . 
O 6 HOH 326  2326 2326 HOH HOH A . 
O 6 HOH 327  2327 2327 HOH HOH A . 
O 6 HOH 328  2328 2328 HOH HOH A . 
O 6 HOH 329  2329 2329 HOH HOH A . 
O 6 HOH 330  2330 2330 HOH HOH A . 
O 6 HOH 331  2331 2331 HOH HOH A . 
O 6 HOH 332  2332 2332 HOH HOH A . 
O 6 HOH 333  2333 2333 HOH HOH A . 
O 6 HOH 334  2334 2334 HOH HOH A . 
O 6 HOH 335  2335 2335 HOH HOH A . 
O 6 HOH 336  2336 2336 HOH HOH A . 
O 6 HOH 337  2337 2337 HOH HOH A . 
O 6 HOH 338  2338 2338 HOH HOH A . 
O 6 HOH 339  2339 2339 HOH HOH A . 
O 6 HOH 340  2340 2340 HOH HOH A . 
O 6 HOH 341  2341 2341 HOH HOH A . 
O 6 HOH 342  2342 2342 HOH HOH A . 
O 6 HOH 343  2343 2343 HOH HOH A . 
O 6 HOH 344  2344 2344 HOH HOH A . 
O 6 HOH 345  2345 2345 HOH HOH A . 
O 6 HOH 346  2346 2346 HOH HOH A . 
O 6 HOH 347  2347 2347 HOH HOH A . 
O 6 HOH 348  2348 2348 HOH HOH A . 
O 6 HOH 349  2349 2349 HOH HOH A . 
O 6 HOH 350  2350 2350 HOH HOH A . 
O 6 HOH 351  2351 2351 HOH HOH A . 
O 6 HOH 352  2352 2352 HOH HOH A . 
O 6 HOH 353  2353 2353 HOH HOH A . 
O 6 HOH 354  2354 2354 HOH HOH A . 
O 6 HOH 355  2355 2355 HOH HOH A . 
O 6 HOH 356  2356 2356 HOH HOH A . 
O 6 HOH 357  2357 2357 HOH HOH A . 
O 6 HOH 358  2358 2358 HOH HOH A . 
O 6 HOH 359  2359 2359 HOH HOH A . 
O 6 HOH 360  2360 2360 HOH HOH A . 
O 6 HOH 361  2361 2361 HOH HOH A . 
O 6 HOH 362  2362 2362 HOH HOH A . 
O 6 HOH 363  2363 2363 HOH HOH A . 
O 6 HOH 364  2364 2364 HOH HOH A . 
O 6 HOH 365  2365 2365 HOH HOH A . 
O 6 HOH 366  2366 2366 HOH HOH A . 
O 6 HOH 367  2367 2367 HOH HOH A . 
O 6 HOH 368  2368 2368 HOH HOH A . 
O 6 HOH 369  2369 2369 HOH HOH A . 
O 6 HOH 370  2370 2370 HOH HOH A . 
O 6 HOH 371  2371 2371 HOH HOH A . 
O 6 HOH 372  2372 2372 HOH HOH A . 
O 6 HOH 373  2373 2373 HOH HOH A . 
O 6 HOH 374  2374 2374 HOH HOH A . 
O 6 HOH 375  2375 2375 HOH HOH A . 
O 6 HOH 376  2376 2376 HOH HOH A . 
O 6 HOH 377  2377 2377 HOH HOH A . 
O 6 HOH 378  2378 2378 HOH HOH A . 
O 6 HOH 379  2379 2379 HOH HOH A . 
O 6 HOH 380  2380 2380 HOH HOH A . 
O 6 HOH 381  2381 2381 HOH HOH A . 
O 6 HOH 382  2382 2382 HOH HOH A . 
O 6 HOH 383  2383 2383 HOH HOH A . 
O 6 HOH 384  2384 2384 HOH HOH A . 
O 6 HOH 385  2385 2385 HOH HOH A . 
O 6 HOH 386  2386 2386 HOH HOH A . 
O 6 HOH 387  2387 2387 HOH HOH A . 
O 6 HOH 388  2388 2388 HOH HOH A . 
O 6 HOH 389  2389 2389 HOH HOH A . 
O 6 HOH 390  2390 2390 HOH HOH A . 
O 6 HOH 391  2391 2391 HOH HOH A . 
O 6 HOH 392  2392 2392 HOH HOH A . 
O 6 HOH 393  2393 2393 HOH HOH A . 
O 6 HOH 394  2394 2394 HOH HOH A . 
O 6 HOH 395  2395 2395 HOH HOH A . 
O 6 HOH 396  2396 2396 HOH HOH A . 
O 6 HOH 397  2397 2397 HOH HOH A . 
O 6 HOH 398  2398 2398 HOH HOH A . 
O 6 HOH 399  2399 2399 HOH HOH A . 
O 6 HOH 400  2400 2400 HOH HOH A . 
O 6 HOH 401  2401 2401 HOH HOH A . 
O 6 HOH 402  2402 2402 HOH HOH A . 
O 6 HOH 403  2403 2403 HOH HOH A . 
O 6 HOH 404  2404 2404 HOH HOH A . 
O 6 HOH 405  2405 2405 HOH HOH A . 
O 6 HOH 406  2406 2406 HOH HOH A . 
O 6 HOH 407  2407 2407 HOH HOH A . 
O 6 HOH 408  2408 2408 HOH HOH A . 
O 6 HOH 409  2409 2409 HOH HOH A . 
O 6 HOH 410  2410 2410 HOH HOH A . 
O 6 HOH 411  2411 2411 HOH HOH A . 
O 6 HOH 412  2412 2412 HOH HOH A . 
O 6 HOH 413  2413 2413 HOH HOH A . 
O 6 HOH 414  2414 2414 HOH HOH A . 
O 6 HOH 415  2415 2415 HOH HOH A . 
O 6 HOH 416  2416 2416 HOH HOH A . 
O 6 HOH 417  2417 2417 HOH HOH A . 
O 6 HOH 418  2418 2418 HOH HOH A . 
O 6 HOH 419  2419 2419 HOH HOH A . 
O 6 HOH 420  2420 2420 HOH HOH A . 
O 6 HOH 421  2421 2421 HOH HOH A . 
O 6 HOH 422  2422 2422 HOH HOH A . 
O 6 HOH 423  2423 2423 HOH HOH A . 
O 6 HOH 424  2424 2424 HOH HOH A . 
O 6 HOH 425  2425 2425 HOH HOH A . 
O 6 HOH 426  2426 2426 HOH HOH A . 
O 6 HOH 427  2427 2427 HOH HOH A . 
O 6 HOH 428  2428 2428 HOH HOH A . 
O 6 HOH 429  2429 2429 HOH HOH A . 
O 6 HOH 430  2430 2430 HOH HOH A . 
O 6 HOH 431  2431 2431 HOH HOH A . 
O 6 HOH 432  2432 2432 HOH HOH A . 
O 6 HOH 433  2433 2433 HOH HOH A . 
O 6 HOH 434  2434 2434 HOH HOH A . 
O 6 HOH 435  2435 2435 HOH HOH A . 
O 6 HOH 436  2436 2436 HOH HOH A . 
O 6 HOH 437  2437 2437 HOH HOH A . 
O 6 HOH 438  2438 2438 HOH HOH A . 
O 6 HOH 439  2439 2439 HOH HOH A . 
O 6 HOH 440  2440 2440 HOH HOH A . 
O 6 HOH 441  2441 2441 HOH HOH A . 
O 6 HOH 442  2442 2442 HOH HOH A . 
O 6 HOH 443  2443 2443 HOH HOH A . 
O 6 HOH 444  2444 2444 HOH HOH A . 
O 6 HOH 445  2445 2445 HOH HOH A . 
O 6 HOH 446  2446 2446 HOH HOH A . 
O 6 HOH 447  2447 2447 HOH HOH A . 
O 6 HOH 448  2448 2448 HOH HOH A . 
O 6 HOH 449  2449 2449 HOH HOH A . 
O 6 HOH 450  2450 2450 HOH HOH A . 
O 6 HOH 451  2451 2451 HOH HOH A . 
O 6 HOH 452  2452 2452 HOH HOH A . 
O 6 HOH 453  2453 2453 HOH HOH A . 
O 6 HOH 454  2454 2454 HOH HOH A . 
O 6 HOH 455  2455 2455 HOH HOH A . 
O 6 HOH 456  2456 2456 HOH HOH A . 
O 6 HOH 457  2457 2457 HOH HOH A . 
O 6 HOH 458  2458 2458 HOH HOH A . 
O 6 HOH 459  2459 2459 HOH HOH A . 
O 6 HOH 460  2460 2460 HOH HOH A . 
O 6 HOH 461  2461 2461 HOH HOH A . 
O 6 HOH 462  2462 2462 HOH HOH A . 
O 6 HOH 463  2463 2463 HOH HOH A . 
O 6 HOH 464  2464 2464 HOH HOH A . 
O 6 HOH 465  2465 2465 HOH HOH A . 
O 6 HOH 466  2466 2466 HOH HOH A . 
O 6 HOH 467  2467 2467 HOH HOH A . 
O 6 HOH 468  2468 2468 HOH HOH A . 
O 6 HOH 469  2469 2469 HOH HOH A . 
O 6 HOH 470  2470 2470 HOH HOH A . 
O 6 HOH 471  2471 2471 HOH HOH A . 
O 6 HOH 472  2472 2472 HOH HOH A . 
O 6 HOH 473  2473 2473 HOH HOH A . 
O 6 HOH 474  2474 2474 HOH HOH A . 
O 6 HOH 475  2475 2475 HOH HOH A . 
O 6 HOH 476  2476 2476 HOH HOH A . 
O 6 HOH 477  2477 2477 HOH HOH A . 
O 6 HOH 478  2478 2478 HOH HOH A . 
O 6 HOH 479  2479 2479 HOH HOH A . 
O 6 HOH 480  2480 2480 HOH HOH A . 
O 6 HOH 481  2481 2481 HOH HOH A . 
O 6 HOH 482  2482 2482 HOH HOH A . 
O 6 HOH 483  2483 2483 HOH HOH A . 
O 6 HOH 484  2484 2484 HOH HOH A . 
O 6 HOH 485  2485 2485 HOH HOH A . 
O 6 HOH 486  2486 2486 HOH HOH A . 
O 6 HOH 487  2487 2487 HOH HOH A . 
O 6 HOH 488  2488 2488 HOH HOH A . 
O 6 HOH 489  2489 2489 HOH HOH A . 
O 6 HOH 490  2490 2490 HOH HOH A . 
O 6 HOH 491  2491 2491 HOH HOH A . 
O 6 HOH 492  2492 2492 HOH HOH A . 
O 6 HOH 493  2493 2493 HOH HOH A . 
O 6 HOH 494  2494 2494 HOH HOH A . 
O 6 HOH 495  2495 2495 HOH HOH A . 
O 6 HOH 496  2496 2496 HOH HOH A . 
O 6 HOH 497  2497 2497 HOH HOH A . 
O 6 HOH 498  2498 2498 HOH HOH A . 
O 6 HOH 499  2499 2499 HOH HOH A . 
O 6 HOH 500  2500 2500 HOH HOH A . 
O 6 HOH 501  2501 2501 HOH HOH A . 
O 6 HOH 502  2502 2502 HOH HOH A . 
O 6 HOH 503  2503 2503 HOH HOH A . 
O 6 HOH 504  2504 2504 HOH HOH A . 
O 6 HOH 505  2505 2505 HOH HOH A . 
O 6 HOH 506  2506 2506 HOH HOH A . 
O 6 HOH 507  2507 2507 HOH HOH A . 
O 6 HOH 508  2508 2508 HOH HOH A . 
O 6 HOH 509  2509 2509 HOH HOH A . 
O 6 HOH 510  2510 2510 HOH HOH A . 
O 6 HOH 511  2511 2511 HOH HOH A . 
O 6 HOH 512  2512 2512 HOH HOH A . 
O 6 HOH 513  2513 2513 HOH HOH A . 
O 6 HOH 514  2514 2514 HOH HOH A . 
O 6 HOH 515  2515 2515 HOH HOH A . 
O 6 HOH 516  2516 2516 HOH HOH A . 
O 6 HOH 517  2517 2517 HOH HOH A . 
O 6 HOH 518  2518 2518 HOH HOH A . 
O 6 HOH 519  2519 2519 HOH HOH A . 
O 6 HOH 520  2520 2520 HOH HOH A . 
O 6 HOH 521  2521 2521 HOH HOH A . 
O 6 HOH 522  2522 2522 HOH HOH A . 
O 6 HOH 523  2523 2523 HOH HOH A . 
O 6 HOH 524  2524 2524 HOH HOH A . 
O 6 HOH 525  2525 2525 HOH HOH A . 
O 6 HOH 526  2526 2526 HOH HOH A . 
O 6 HOH 527  2527 2527 HOH HOH A . 
O 6 HOH 528  2528 2528 HOH HOH A . 
O 6 HOH 529  2529 2529 HOH HOH A . 
O 6 HOH 530  2530 2530 HOH HOH A . 
O 6 HOH 531  2531 2531 HOH HOH A . 
O 6 HOH 532  2532 2532 HOH HOH A . 
O 6 HOH 533  2533 2533 HOH HOH A . 
O 6 HOH 534  2534 2534 HOH HOH A . 
O 6 HOH 535  2535 2535 HOH HOH A . 
O 6 HOH 536  2536 2536 HOH HOH A . 
O 6 HOH 537  2537 2537 HOH HOH A . 
O 6 HOH 538  2538 2538 HOH HOH A . 
O 6 HOH 539  2539 2539 HOH HOH A . 
O 6 HOH 540  2540 2540 HOH HOH A . 
O 6 HOH 541  2541 2541 HOH HOH A . 
O 6 HOH 542  2542 2542 HOH HOH A . 
O 6 HOH 543  2543 2543 HOH HOH A . 
O 6 HOH 544  2544 2544 HOH HOH A . 
O 6 HOH 545  2545 2545 HOH HOH A . 
O 6 HOH 546  2546 2546 HOH HOH A . 
O 6 HOH 547  2547 2547 HOH HOH A . 
O 6 HOH 548  2548 2548 HOH HOH A . 
O 6 HOH 549  2549 2549 HOH HOH A . 
O 6 HOH 550  2550 2550 HOH HOH A . 
O 6 HOH 551  2551 2551 HOH HOH A . 
O 6 HOH 552  2552 2552 HOH HOH A . 
O 6 HOH 553  2553 2553 HOH HOH A . 
O 6 HOH 554  2554 2554 HOH HOH A . 
O 6 HOH 555  2555 2555 HOH HOH A . 
O 6 HOH 556  2556 2556 HOH HOH A . 
O 6 HOH 557  2557 2557 HOH HOH A . 
O 6 HOH 558  2558 2558 HOH HOH A . 
O 6 HOH 559  2559 2559 HOH HOH A . 
O 6 HOH 560  2560 2560 HOH HOH A . 
O 6 HOH 561  2561 2561 HOH HOH A . 
O 6 HOH 562  2562 2562 HOH HOH A . 
O 6 HOH 563  2563 2563 HOH HOH A . 
O 6 HOH 564  2564 2564 HOH HOH A . 
O 6 HOH 565  2565 2565 HOH HOH A . 
O 6 HOH 566  2566 2566 HOH HOH A . 
O 6 HOH 567  2567 2567 HOH HOH A . 
O 6 HOH 568  2568 2568 HOH HOH A . 
O 6 HOH 569  2569 2569 HOH HOH A . 
O 6 HOH 570  2570 2570 HOH HOH A . 
O 6 HOH 571  2571 2571 HOH HOH A . 
O 6 HOH 572  2572 2572 HOH HOH A . 
O 6 HOH 573  2573 2573 HOH HOH A . 
O 6 HOH 574  2574 2574 HOH HOH A . 
O 6 HOH 575  2575 2575 HOH HOH A . 
O 6 HOH 576  2576 2576 HOH HOH A . 
O 6 HOH 577  2577 2577 HOH HOH A . 
O 6 HOH 578  2578 2578 HOH HOH A . 
O 6 HOH 579  2579 2579 HOH HOH A . 
O 6 HOH 580  2580 2580 HOH HOH A . 
O 6 HOH 581  2581 2581 HOH HOH A . 
O 6 HOH 582  2582 2582 HOH HOH A . 
O 6 HOH 583  2583 2583 HOH HOH A . 
O 6 HOH 584  2584 2584 HOH HOH A . 
O 6 HOH 585  2585 2585 HOH HOH A . 
O 6 HOH 586  2586 2586 HOH HOH A . 
O 6 HOH 587  2587 2587 HOH HOH A . 
O 6 HOH 588  2588 2588 HOH HOH A . 
O 6 HOH 589  2589 2589 HOH HOH A . 
O 6 HOH 590  2590 2590 HOH HOH A . 
O 6 HOH 591  2591 2591 HOH HOH A . 
O 6 HOH 592  2592 2592 HOH HOH A . 
O 6 HOH 593  2593 2593 HOH HOH A . 
O 6 HOH 594  2594 2594 HOH HOH A . 
O 6 HOH 595  2595 2595 HOH HOH A . 
O 6 HOH 596  2596 2596 HOH HOH A . 
O 6 HOH 597  2597 2597 HOH HOH A . 
O 6 HOH 598  2598 2598 HOH HOH A . 
O 6 HOH 599  2599 2599 HOH HOH A . 
O 6 HOH 600  2600 2600 HOH HOH A . 
O 6 HOH 601  2601 2601 HOH HOH A . 
O 6 HOH 602  2602 2602 HOH HOH A . 
O 6 HOH 603  2603 2603 HOH HOH A . 
O 6 HOH 604  2604 2604 HOH HOH A . 
O 6 HOH 605  2605 2605 HOH HOH A . 
O 6 HOH 606  2606 2606 HOH HOH A . 
O 6 HOH 607  2607 2607 HOH HOH A . 
O 6 HOH 608  2608 2608 HOH HOH A . 
O 6 HOH 609  2609 2609 HOH HOH A . 
O 6 HOH 610  2610 2610 HOH HOH A . 
O 6 HOH 611  2611 2611 HOH HOH A . 
O 6 HOH 612  2612 2612 HOH HOH A . 
O 6 HOH 613  2613 2613 HOH HOH A . 
O 6 HOH 614  2614 2614 HOH HOH A . 
O 6 HOH 615  2615 2615 HOH HOH A . 
O 6 HOH 616  2616 2616 HOH HOH A . 
O 6 HOH 617  2617 2617 HOH HOH A . 
O 6 HOH 618  2618 2618 HOH HOH A . 
O 6 HOH 619  2619 2619 HOH HOH A . 
O 6 HOH 620  2620 2620 HOH HOH A . 
O 6 HOH 621  2621 2621 HOH HOH A . 
O 6 HOH 622  2622 2622 HOH HOH A . 
O 6 HOH 623  2623 2623 HOH HOH A . 
O 6 HOH 624  2624 2624 HOH HOH A . 
O 6 HOH 625  2625 2625 HOH HOH A . 
O 6 HOH 626  2626 2626 HOH HOH A . 
O 6 HOH 627  2627 2627 HOH HOH A . 
O 6 HOH 628  2628 2628 HOH HOH A . 
O 6 HOH 629  2629 2629 HOH HOH A . 
O 6 HOH 630  2630 2630 HOH HOH A . 
O 6 HOH 631  2631 2631 HOH HOH A . 
O 6 HOH 632  2632 2632 HOH HOH A . 
O 6 HOH 633  2633 2633 HOH HOH A . 
O 6 HOH 634  2634 2634 HOH HOH A . 
O 6 HOH 635  2635 2635 HOH HOH A . 
O 6 HOH 636  2636 2636 HOH HOH A . 
O 6 HOH 637  2637 2637 HOH HOH A . 
O 6 HOH 638  2638 2638 HOH HOH A . 
O 6 HOH 639  2639 2639 HOH HOH A . 
O 6 HOH 640  2640 2640 HOH HOH A . 
O 6 HOH 641  2641 2641 HOH HOH A . 
O 6 HOH 642  2642 2642 HOH HOH A . 
O 6 HOH 643  2643 2643 HOH HOH A . 
O 6 HOH 644  2644 2644 HOH HOH A . 
O 6 HOH 645  2645 2645 HOH HOH A . 
O 6 HOH 646  2646 2646 HOH HOH A . 
O 6 HOH 647  2647 2647 HOH HOH A . 
O 6 HOH 648  2648 2648 HOH HOH A . 
O 6 HOH 649  2649 2649 HOH HOH A . 
O 6 HOH 650  2650 2650 HOH HOH A . 
O 6 HOH 651  2651 2651 HOH HOH A . 
O 6 HOH 652  2652 2652 HOH HOH A . 
O 6 HOH 653  2653 2653 HOH HOH A . 
O 6 HOH 654  2654 2654 HOH HOH A . 
O 6 HOH 655  2655 2655 HOH HOH A . 
O 6 HOH 656  2656 2656 HOH HOH A . 
O 6 HOH 657  2657 2657 HOH HOH A . 
O 6 HOH 658  2658 2658 HOH HOH A . 
O 6 HOH 659  2659 2659 HOH HOH A . 
O 6 HOH 660  2660 2660 HOH HOH A . 
O 6 HOH 661  2661 2661 HOH HOH A . 
O 6 HOH 662  2662 2662 HOH HOH A . 
O 6 HOH 663  2663 2663 HOH HOH A . 
O 6 HOH 664  2664 2664 HOH HOH A . 
O 6 HOH 665  2665 2665 HOH HOH A . 
O 6 HOH 666  2666 2666 HOH HOH A . 
O 6 HOH 667  2667 2667 HOH HOH A . 
O 6 HOH 668  2668 2668 HOH HOH A . 
O 6 HOH 669  2669 2669 HOH HOH A . 
O 6 HOH 670  2670 2670 HOH HOH A . 
O 6 HOH 671  2671 2671 HOH HOH A . 
O 6 HOH 672  2672 2672 HOH HOH A . 
O 6 HOH 673  2673 2673 HOH HOH A . 
O 6 HOH 674  2674 2674 HOH HOH A . 
O 6 HOH 675  2675 2675 HOH HOH A . 
O 6 HOH 676  2676 2676 HOH HOH A . 
O 6 HOH 677  2677 2677 HOH HOH A . 
O 6 HOH 678  2678 2678 HOH HOH A . 
O 6 HOH 679  2679 2679 HOH HOH A . 
O 6 HOH 680  2680 2680 HOH HOH A . 
O 6 HOH 681  2681 2681 HOH HOH A . 
O 6 HOH 682  2682 2682 HOH HOH A . 
O 6 HOH 683  2683 2683 HOH HOH A . 
O 6 HOH 684  2684 2684 HOH HOH A . 
O 6 HOH 685  2685 2685 HOH HOH A . 
O 6 HOH 686  2686 2686 HOH HOH A . 
O 6 HOH 687  2687 2687 HOH HOH A . 
O 6 HOH 688  2688 2688 HOH HOH A . 
O 6 HOH 689  2689 2689 HOH HOH A . 
O 6 HOH 690  2690 2690 HOH HOH A . 
O 6 HOH 691  2691 2691 HOH HOH A . 
O 6 HOH 692  2692 2692 HOH HOH A . 
O 6 HOH 693  2693 2693 HOH HOH A . 
O 6 HOH 694  2694 2694 HOH HOH A . 
O 6 HOH 695  2695 2695 HOH HOH A . 
O 6 HOH 696  2696 2696 HOH HOH A . 
O 6 HOH 697  2697 2697 HOH HOH A . 
O 6 HOH 698  2698 2698 HOH HOH A . 
O 6 HOH 699  2699 2699 HOH HOH A . 
O 6 HOH 700  2700 2700 HOH HOH A . 
O 6 HOH 701  2701 2701 HOH HOH A . 
O 6 HOH 702  2702 2702 HOH HOH A . 
O 6 HOH 703  2703 2703 HOH HOH A . 
O 6 HOH 704  2704 2704 HOH HOH A . 
O 6 HOH 705  2705 2705 HOH HOH A . 
O 6 HOH 706  2706 2706 HOH HOH A . 
O 6 HOH 707  2707 2707 HOH HOH A . 
O 6 HOH 708  2708 2708 HOH HOH A . 
O 6 HOH 709  2709 2709 HOH HOH A . 
O 6 HOH 710  2710 2710 HOH HOH A . 
O 6 HOH 711  2711 2711 HOH HOH A . 
O 6 HOH 712  2712 2712 HOH HOH A . 
O 6 HOH 713  2713 2713 HOH HOH A . 
O 6 HOH 714  2714 2714 HOH HOH A . 
O 6 HOH 715  2715 2715 HOH HOH A . 
O 6 HOH 716  2716 2716 HOH HOH A . 
O 6 HOH 717  2717 2717 HOH HOH A . 
O 6 HOH 718  2718 2718 HOH HOH A . 
O 6 HOH 719  2719 2719 HOH HOH A . 
O 6 HOH 720  2720 2720 HOH HOH A . 
O 6 HOH 721  2721 2721 HOH HOH A . 
O 6 HOH 722  2722 2722 HOH HOH A . 
O 6 HOH 723  2723 2723 HOH HOH A . 
O 6 HOH 724  2724 2724 HOH HOH A . 
O 6 HOH 725  2725 2725 HOH HOH A . 
O 6 HOH 726  2726 2726 HOH HOH A . 
O 6 HOH 727  2727 2727 HOH HOH A . 
O 6 HOH 728  2728 2728 HOH HOH A . 
O 6 HOH 729  2729 2729 HOH HOH A . 
O 6 HOH 730  2730 2730 HOH HOH A . 
O 6 HOH 731  2731 2731 HOH HOH A . 
O 6 HOH 732  2732 2732 HOH HOH A . 
O 6 HOH 733  2733 2733 HOH HOH A . 
O 6 HOH 734  2734 2734 HOH HOH A . 
O 6 HOH 735  2735 2735 HOH HOH A . 
O 6 HOH 736  2736 2736 HOH HOH A . 
O 6 HOH 737  2737 2737 HOH HOH A . 
O 6 HOH 738  2738 2738 HOH HOH A . 
O 6 HOH 739  2739 2739 HOH HOH A . 
O 6 HOH 740  2740 2740 HOH HOH A . 
O 6 HOH 741  2741 2741 HOH HOH A . 
O 6 HOH 742  2742 2742 HOH HOH A . 
O 6 HOH 743  2743 2743 HOH HOH A . 
O 6 HOH 744  2744 2744 HOH HOH A . 
O 6 HOH 745  2745 2745 HOH HOH A . 
O 6 HOH 746  2746 2746 HOH HOH A . 
O 6 HOH 747  2747 2747 HOH HOH A . 
O 6 HOH 748  2748 2748 HOH HOH A . 
O 6 HOH 749  2749 2749 HOH HOH A . 
O 6 HOH 750  2750 2750 HOH HOH A . 
O 6 HOH 751  2751 2751 HOH HOH A . 
O 6 HOH 752  2752 2752 HOH HOH A . 
O 6 HOH 753  2753 2753 HOH HOH A . 
O 6 HOH 754  2754 2754 HOH HOH A . 
O 6 HOH 755  2755 2755 HOH HOH A . 
O 6 HOH 756  2756 2756 HOH HOH A . 
O 6 HOH 757  2757 2757 HOH HOH A . 
O 6 HOH 758  2758 2758 HOH HOH A . 
O 6 HOH 759  2759 2759 HOH HOH A . 
O 6 HOH 760  2760 2760 HOH HOH A . 
O 6 HOH 761  2761 2761 HOH HOH A . 
O 6 HOH 762  2762 2762 HOH HOH A . 
O 6 HOH 763  2763 2763 HOH HOH A . 
O 6 HOH 764  2764 2764 HOH HOH A . 
O 6 HOH 765  2765 2765 HOH HOH A . 
O 6 HOH 766  2766 2766 HOH HOH A . 
O 6 HOH 767  2767 2767 HOH HOH A . 
O 6 HOH 768  2768 2768 HOH HOH A . 
O 6 HOH 769  2769 2769 HOH HOH A . 
O 6 HOH 770  2770 2770 HOH HOH A . 
O 6 HOH 771  2771 2771 HOH HOH A . 
O 6 HOH 772  2772 2772 HOH HOH A . 
O 6 HOH 773  2773 2773 HOH HOH A . 
O 6 HOH 774  2774 2774 HOH HOH A . 
O 6 HOH 775  2775 2775 HOH HOH A . 
O 6 HOH 776  2776 2776 HOH HOH A . 
O 6 HOH 777  2777 2777 HOH HOH A . 
O 6 HOH 778  2778 2778 HOH HOH A . 
O 6 HOH 779  2779 2779 HOH HOH A . 
O 6 HOH 780  2780 2780 HOH HOH A . 
O 6 HOH 781  2781 2781 HOH HOH A . 
O 6 HOH 782  2782 2782 HOH HOH A . 
O 6 HOH 783  2783 2783 HOH HOH A . 
O 6 HOH 784  2784 2784 HOH HOH A . 
O 6 HOH 785  2785 2785 HOH HOH A . 
O 6 HOH 786  2786 2786 HOH HOH A . 
O 6 HOH 787  2787 2787 HOH HOH A . 
O 6 HOH 788  2788 2788 HOH HOH A . 
O 6 HOH 789  2789 2789 HOH HOH A . 
O 6 HOH 790  2790 2790 HOH HOH A . 
O 6 HOH 791  2791 2791 HOH HOH A . 
O 6 HOH 792  2792 2792 HOH HOH A . 
O 6 HOH 793  2793 2793 HOH HOH A . 
O 6 HOH 794  2794 2794 HOH HOH A . 
O 6 HOH 795  2795 2795 HOH HOH A . 
O 6 HOH 796  2796 2796 HOH HOH A . 
O 6 HOH 797  2797 2797 HOH HOH A . 
O 6 HOH 798  2798 2798 HOH HOH A . 
O 6 HOH 799  2799 2799 HOH HOH A . 
O 6 HOH 800  2800 2800 HOH HOH A . 
O 6 HOH 801  2801 2801 HOH HOH A . 
O 6 HOH 802  2802 2802 HOH HOH A . 
O 6 HOH 803  2803 2803 HOH HOH A . 
O 6 HOH 804  2804 2804 HOH HOH A . 
O 6 HOH 805  2805 2805 HOH HOH A . 
O 6 HOH 806  2806 2806 HOH HOH A . 
O 6 HOH 807  2807 2807 HOH HOH A . 
O 6 HOH 808  2808 2808 HOH HOH A . 
O 6 HOH 809  2809 2809 HOH HOH A . 
O 6 HOH 810  2810 2810 HOH HOH A . 
O 6 HOH 811  2811 2811 HOH HOH A . 
O 6 HOH 812  2812 2812 HOH HOH A . 
O 6 HOH 813  2813 2813 HOH HOH A . 
O 6 HOH 814  2814 2814 HOH HOH A . 
O 6 HOH 815  2815 2815 HOH HOH A . 
O 6 HOH 816  2816 2816 HOH HOH A . 
O 6 HOH 817  2817 2817 HOH HOH A . 
O 6 HOH 818  2818 2818 HOH HOH A . 
O 6 HOH 819  2819 2819 HOH HOH A . 
O 6 HOH 820  2820 2820 HOH HOH A . 
O 6 HOH 821  2821 2821 HOH HOH A . 
O 6 HOH 822  2822 2822 HOH HOH A . 
O 6 HOH 823  2823 2823 HOH HOH A . 
O 6 HOH 824  2824 2824 HOH HOH A . 
O 6 HOH 825  2825 2825 HOH HOH A . 
O 6 HOH 826  2826 2826 HOH HOH A . 
O 6 HOH 827  2827 2827 HOH HOH A . 
O 6 HOH 828  2828 2828 HOH HOH A . 
O 6 HOH 829  2829 2829 HOH HOH A . 
O 6 HOH 830  2830 2830 HOH HOH A . 
O 6 HOH 831  2831 2831 HOH HOH A . 
O 6 HOH 832  2832 2832 HOH HOH A . 
O 6 HOH 833  2833 2833 HOH HOH A . 
O 6 HOH 834  2834 2834 HOH HOH A . 
O 6 HOH 835  2835 2835 HOH HOH A . 
O 6 HOH 836  2836 2836 HOH HOH A . 
O 6 HOH 837  2837 2837 HOH HOH A . 
O 6 HOH 838  2838 2838 HOH HOH A . 
O 6 HOH 839  2839 2839 HOH HOH A . 
O 6 HOH 840  2840 2840 HOH HOH A . 
O 6 HOH 841  2841 2841 HOH HOH A . 
O 6 HOH 842  2842 2842 HOH HOH A . 
O 6 HOH 843  2843 2843 HOH HOH A . 
O 6 HOH 844  2844 2844 HOH HOH A . 
O 6 HOH 845  2845 2845 HOH HOH A . 
O 6 HOH 846  2846 2846 HOH HOH A . 
O 6 HOH 847  2847 2847 HOH HOH A . 
O 6 HOH 848  2848 2848 HOH HOH A . 
O 6 HOH 849  2849 2849 HOH HOH A . 
O 6 HOH 850  2850 2850 HOH HOH A . 
O 6 HOH 851  2851 2851 HOH HOH A . 
O 6 HOH 852  2852 2852 HOH HOH A . 
O 6 HOH 853  2853 2853 HOH HOH A . 
O 6 HOH 854  2854 2854 HOH HOH A . 
O 6 HOH 855  2855 2855 HOH HOH A . 
O 6 HOH 856  2856 2856 HOH HOH A . 
O 6 HOH 857  2857 2857 HOH HOH A . 
O 6 HOH 858  2858 2858 HOH HOH A . 
O 6 HOH 859  2859 2859 HOH HOH A . 
O 6 HOH 860  2860 2860 HOH HOH A . 
O 6 HOH 861  2861 2861 HOH HOH A . 
O 6 HOH 862  2862 2862 HOH HOH A . 
O 6 HOH 863  2863 2863 HOH HOH A . 
O 6 HOH 864  2864 2864 HOH HOH A . 
O 6 HOH 865  2865 2865 HOH HOH A . 
O 6 HOH 866  2866 2866 HOH HOH A . 
O 6 HOH 867  2867 2867 HOH HOH A . 
O 6 HOH 868  2868 2868 HOH HOH A . 
O 6 HOH 869  2869 2869 HOH HOH A . 
O 6 HOH 870  2870 2870 HOH HOH A . 
O 6 HOH 871  2871 2871 HOH HOH A . 
O 6 HOH 872  2872 2872 HOH HOH A . 
O 6 HOH 873  2873 2873 HOH HOH A . 
O 6 HOH 874  2874 2874 HOH HOH A . 
O 6 HOH 875  2875 2875 HOH HOH A . 
O 6 HOH 876  2876 2876 HOH HOH A . 
O 6 HOH 877  2877 2877 HOH HOH A . 
O 6 HOH 878  2878 2878 HOH HOH A . 
O 6 HOH 879  2879 2879 HOH HOH A . 
O 6 HOH 880  2880 2880 HOH HOH A . 
O 6 HOH 881  2881 2881 HOH HOH A . 
O 6 HOH 882  2882 2882 HOH HOH A . 
O 6 HOH 883  2883 2883 HOH HOH A . 
O 6 HOH 884  2884 2884 HOH HOH A . 
O 6 HOH 885  2885 2885 HOH HOH A . 
O 6 HOH 886  2886 2886 HOH HOH A . 
O 6 HOH 887  2887 2887 HOH HOH A . 
O 6 HOH 888  2888 2888 HOH HOH A . 
O 6 HOH 889  2889 2889 HOH HOH A . 
O 6 HOH 890  2890 2890 HOH HOH A . 
O 6 HOH 891  2891 2891 HOH HOH A . 
O 6 HOH 892  2892 2892 HOH HOH A . 
O 6 HOH 893  2893 2893 HOH HOH A . 
O 6 HOH 894  2894 2894 HOH HOH A . 
O 6 HOH 895  2895 2895 HOH HOH A . 
O 6 HOH 896  2896 2896 HOH HOH A . 
O 6 HOH 897  2897 2897 HOH HOH A . 
O 6 HOH 898  2898 2898 HOH HOH A . 
O 6 HOH 899  2899 2899 HOH HOH A . 
O 6 HOH 900  2900 2900 HOH HOH A . 
O 6 HOH 901  2901 2901 HOH HOH A . 
O 6 HOH 902  2902 2902 HOH HOH A . 
O 6 HOH 903  2903 2903 HOH HOH A . 
O 6 HOH 904  2904 2904 HOH HOH A . 
O 6 HOH 905  2905 2905 HOH HOH A . 
O 6 HOH 906  2906 2906 HOH HOH A . 
O 6 HOH 907  2907 2907 HOH HOH A . 
O 6 HOH 908  2908 2908 HOH HOH A . 
O 6 HOH 909  2909 2909 HOH HOH A . 
O 6 HOH 910  2910 2910 HOH HOH A . 
O 6 HOH 911  2911 2911 HOH HOH A . 
O 6 HOH 912  2912 2912 HOH HOH A . 
O 6 HOH 913  2913 2913 HOH HOH A . 
O 6 HOH 914  2914 2914 HOH HOH A . 
O 6 HOH 915  2915 2915 HOH HOH A . 
O 6 HOH 916  2916 2916 HOH HOH A . 
O 6 HOH 917  2917 2917 HOH HOH A . 
O 6 HOH 918  2918 2918 HOH HOH A . 
O 6 HOH 919  2919 2919 HOH HOH A . 
O 6 HOH 920  2920 2920 HOH HOH A . 
O 6 HOH 921  2921 2921 HOH HOH A . 
O 6 HOH 922  2922 2922 HOH HOH A . 
O 6 HOH 923  2923 2923 HOH HOH A . 
O 6 HOH 924  2924 2924 HOH HOH A . 
O 6 HOH 925  2925 2925 HOH HOH A . 
O 6 HOH 926  2926 2926 HOH HOH A . 
O 6 HOH 927  2927 2927 HOH HOH A . 
O 6 HOH 928  2928 2928 HOH HOH A . 
O 6 HOH 929  2929 2929 HOH HOH A . 
O 6 HOH 930  2930 2930 HOH HOH A . 
O 6 HOH 931  2931 2931 HOH HOH A . 
O 6 HOH 932  2932 2932 HOH HOH A . 
O 6 HOH 933  2933 2933 HOH HOH A . 
O 6 HOH 934  2934 2934 HOH HOH A . 
O 6 HOH 935  2935 2935 HOH HOH A . 
O 6 HOH 936  2936 2936 HOH HOH A . 
O 6 HOH 937  2937 2937 HOH HOH A . 
O 6 HOH 938  2938 2938 HOH HOH A . 
O 6 HOH 939  2939 2939 HOH HOH A . 
O 6 HOH 940  2940 2940 HOH HOH A . 
O 6 HOH 941  2941 2941 HOH HOH A . 
O 6 HOH 942  2942 2942 HOH HOH A . 
O 6 HOH 943  2943 2943 HOH HOH A . 
O 6 HOH 944  2944 2944 HOH HOH A . 
O 6 HOH 945  2945 2945 HOH HOH A . 
O 6 HOH 946  2946 2946 HOH HOH A . 
O 6 HOH 947  2947 2947 HOH HOH A . 
O 6 HOH 948  2948 2948 HOH HOH A . 
O 6 HOH 949  2949 2949 HOH HOH A . 
O 6 HOH 950  2950 2950 HOH HOH A . 
O 6 HOH 951  2951 2951 HOH HOH A . 
O 6 HOH 952  2952 2952 HOH HOH A . 
O 6 HOH 953  2953 2953 HOH HOH A . 
O 6 HOH 954  2954 2954 HOH HOH A . 
O 6 HOH 955  2955 2955 HOH HOH A . 
O 6 HOH 956  2956 2956 HOH HOH A . 
O 6 HOH 957  2957 2957 HOH HOH A . 
O 6 HOH 958  2958 2958 HOH HOH A . 
O 6 HOH 959  2959 2959 HOH HOH A . 
O 6 HOH 960  2960 2960 HOH HOH A . 
O 6 HOH 961  2961 2961 HOH HOH A . 
O 6 HOH 962  2962 2962 HOH HOH A . 
O 6 HOH 963  2963 2963 HOH HOH A . 
O 6 HOH 964  2964 2964 HOH HOH A . 
O 6 HOH 965  2965 2965 HOH HOH A . 
O 6 HOH 966  2966 2966 HOH HOH A . 
O 6 HOH 967  2967 2967 HOH HOH A . 
O 6 HOH 968  2968 2968 HOH HOH A . 
O 6 HOH 969  2969 2969 HOH HOH A . 
O 6 HOH 970  2970 2970 HOH HOH A . 
O 6 HOH 971  2971 2971 HOH HOH A . 
O 6 HOH 972  2972 2972 HOH HOH A . 
O 6 HOH 973  2973 2973 HOH HOH A . 
O 6 HOH 974  2974 2974 HOH HOH A . 
O 6 HOH 975  2975 2975 HOH HOH A . 
O 6 HOH 976  2976 2976 HOH HOH A . 
O 6 HOH 977  2977 2977 HOH HOH A . 
O 6 HOH 978  2978 2978 HOH HOH A . 
O 6 HOH 979  2979 2979 HOH HOH A . 
O 6 HOH 980  2980 2980 HOH HOH A . 
O 6 HOH 981  2981 2981 HOH HOH A . 
O 6 HOH 982  2982 2982 HOH HOH A . 
O 6 HOH 983  2983 2983 HOH HOH A . 
O 6 HOH 984  2984 2984 HOH HOH A . 
O 6 HOH 985  2985 2985 HOH HOH A . 
O 6 HOH 986  2986 2986 HOH HOH A . 
O 6 HOH 987  2987 2987 HOH HOH A . 
O 6 HOH 988  2988 2988 HOH HOH A . 
O 6 HOH 989  2989 2989 HOH HOH A . 
O 6 HOH 990  2990 2990 HOH HOH A . 
O 6 HOH 991  2991 2991 HOH HOH A . 
O 6 HOH 992  2992 2992 HOH HOH A . 
O 6 HOH 993  2993 2993 HOH HOH A . 
O 6 HOH 994  2994 2994 HOH HOH A . 
O 6 HOH 995  2995 2995 HOH HOH A . 
O 6 HOH 996  2996 2996 HOH HOH A . 
O 6 HOH 997  2997 2997 HOH HOH A . 
O 6 HOH 998  2998 2998 HOH HOH A . 
O 6 HOH 999  2999 2999 HOH HOH A . 
O 6 HOH 1000 3000 3000 HOH HOH A . 
O 6 HOH 1001 3001 3001 HOH HOH A . 
O 6 HOH 1002 3002 3002 HOH HOH A . 
O 6 HOH 1003 3003 3003 HOH HOH A . 
O 6 HOH 1004 3004 3004 HOH HOH A . 
O 6 HOH 1005 3005 3005 HOH HOH A . 
O 6 HOH 1006 3006 3006 HOH HOH A . 
O 6 HOH 1007 3007 3007 HOH HOH A . 
O 6 HOH 1008 3008 3008 HOH HOH A . 
O 6 HOH 1009 3009 3009 HOH HOH A . 
O 6 HOH 1010 3010 3010 HOH HOH A . 
O 6 HOH 1011 3011 3011 HOH HOH A . 
O 6 HOH 1012 3012 3012 HOH HOH A . 
O 6 HOH 1013 3013 3013 HOH HOH A . 
O 6 HOH 1014 3014 3014 HOH HOH A . 
O 6 HOH 1015 3015 3015 HOH HOH A . 
O 6 HOH 1016 3016 3016 HOH HOH A . 
O 6 HOH 1017 3017 3017 HOH HOH A . 
O 6 HOH 1018 3018 3018 HOH HOH A . 
O 6 HOH 1019 3019 3019 HOH HOH A . 
O 6 HOH 1020 3020 3020 HOH HOH A . 
O 6 HOH 1021 3021 3021 HOH HOH A . 
O 6 HOH 1022 3022 3022 HOH HOH A . 
O 6 HOH 1023 3023 3023 HOH HOH A . 
O 6 HOH 1024 3024 3024 HOH HOH A . 
O 6 HOH 1025 3025 3025 HOH HOH A . 
O 6 HOH 1026 3026 3026 HOH HOH A . 
O 6 HOH 1027 3027 3027 HOH HOH A . 
O 6 HOH 1028 3028 3028 HOH HOH A . 
O 6 HOH 1029 3029 3029 HOH HOH A . 
O 6 HOH 1030 3030 3030 HOH HOH A . 
O 6 HOH 1031 3031 3031 HOH HOH A . 
O 6 HOH 1032 3032 3032 HOH HOH A . 
O 6 HOH 1033 3033 3033 HOH HOH A . 
O 6 HOH 1034 3034 3034 HOH HOH A . 
O 6 HOH 1035 3035 3035 HOH HOH A . 
O 6 HOH 1036 3036 3036 HOH HOH A . 
O 6 HOH 1037 3037 3037 HOH HOH A . 
O 6 HOH 1038 3038 3038 HOH HOH A . 
O 6 HOH 1039 3039 3039 HOH HOH A . 
O 6 HOH 1040 3040 3040 HOH HOH A . 
O 6 HOH 1041 3041 3041 HOH HOH A . 
O 6 HOH 1042 3042 3042 HOH HOH A . 
O 6 HOH 1043 3043 3043 HOH HOH A . 
O 6 HOH 1044 3044 3044 HOH HOH A . 
O 6 HOH 1045 3045 3045 HOH HOH A . 
O 6 HOH 1046 3046 3046 HOH HOH A . 
O 6 HOH 1047 3047 3047 HOH HOH A . 
O 6 HOH 1048 3048 3048 HOH HOH A . 
O 6 HOH 1049 3049 3049 HOH HOH A . 
O 6 HOH 1050 3050 3050 HOH HOH A . 
O 6 HOH 1051 3051 3051 HOH HOH A . 
O 6 HOH 1052 3052 3052 HOH HOH A . 
O 6 HOH 1053 3053 3053 HOH HOH A . 
O 6 HOH 1054 3054 3054 HOH HOH A . 
O 6 HOH 1055 3055 3055 HOH HOH A . 
O 6 HOH 1056 3056 3056 HOH HOH A . 
O 6 HOH 1057 3057 3057 HOH HOH A . 
O 6 HOH 1058 3058 3058 HOH HOH A . 
O 6 HOH 1059 3059 3059 HOH HOH A . 
O 6 HOH 1060 3060 3060 HOH HOH A . 
O 6 HOH 1061 3061 3061 HOH HOH A . 
O 6 HOH 1062 3062 3062 HOH HOH A . 
O 6 HOH 1063 3063 3063 HOH HOH A . 
O 6 HOH 1064 3064 3064 HOH HOH A . 
O 6 HOH 1065 3065 3065 HOH HOH A . 
O 6 HOH 1066 3066 3066 HOH HOH A . 
O 6 HOH 1067 3067 3067 HOH HOH A . 
O 6 HOH 1068 3068 3068 HOH HOH A . 
O 6 HOH 1069 3069 3069 HOH HOH A . 
O 6 HOH 1070 3070 3070 HOH HOH A . 
O 6 HOH 1071 3071 3071 HOH HOH A . 
O 6 HOH 1072 3072 3072 HOH HOH A . 
O 6 HOH 1073 3073 3073 HOH HOH A . 
O 6 HOH 1074 3074 3074 HOH HOH A . 
O 6 HOH 1075 3075 3075 HOH HOH A . 
O 6 HOH 1076 3076 3076 HOH HOH A . 
O 6 HOH 1077 3077 3077 HOH HOH A . 
O 6 HOH 1078 3078 3078 HOH HOH A . 
O 6 HOH 1079 3079 3079 HOH HOH A . 
O 6 HOH 1080 3080 3080 HOH HOH A . 
O 6 HOH 1081 3081 3081 HOH HOH A . 
O 6 HOH 1082 3082 3082 HOH HOH A . 
O 6 HOH 1083 3083 3083 HOH HOH A . 
O 6 HOH 1084 3084 3084 HOH HOH A . 
O 6 HOH 1085 3085 3085 HOH HOH A . 
O 6 HOH 1086 3086 3086 HOH HOH A . 
O 6 HOH 1087 3087 3087 HOH HOH A . 
O 6 HOH 1088 3088 3088 HOH HOH A . 
O 6 HOH 1089 3089 3089 HOH HOH A . 
O 6 HOH 1090 3090 3090 HOH HOH A . 
O 6 HOH 1091 3091 3091 HOH HOH A . 
O 6 HOH 1092 3092 3092 HOH HOH A . 
O 6 HOH 1093 3093 3093 HOH HOH A . 
O 6 HOH 1094 3094 3094 HOH HOH A . 
O 6 HOH 1095 3095 3095 HOH HOH A . 
O 6 HOH 1096 3096 3096 HOH HOH A . 
O 6 HOH 1097 3097 3097 HOH HOH A . 
O 6 HOH 1098 3098 3098 HOH HOH A . 
O 6 HOH 1099 3099 3099 HOH HOH A . 
O 6 HOH 1100 3100 3100 HOH HOH A . 
O 6 HOH 1101 3101 3101 HOH HOH A . 
O 6 HOH 1102 3102 3102 HOH HOH A . 
O 6 HOH 1103 3103 3103 HOH HOH A . 
O 6 HOH 1104 3104 3104 HOH HOH A . 
O 6 HOH 1105 3105 3105 HOH HOH A . 
O 6 HOH 1106 3106 3106 HOH HOH A . 
O 6 HOH 1107 3107 3107 HOH HOH A . 
O 6 HOH 1108 3108 3108 HOH HOH A . 
O 6 HOH 1109 3109 3109 HOH HOH A . 
O 6 HOH 1110 3110 3110 HOH HOH A . 
O 6 HOH 1111 3111 3111 HOH HOH A . 
O 6 HOH 1112 3112 3112 HOH HOH A . 
O 6 HOH 1113 3113 3113 HOH HOH A . 
O 6 HOH 1114 3114 3114 HOH HOH A . 
O 6 HOH 1115 3115 3115 HOH HOH A . 
O 6 HOH 1116 3116 3116 HOH HOH A . 
O 6 HOH 1117 3117 3117 HOH HOH A . 
O 6 HOH 1118 3118 3118 HOH HOH A . 
O 6 HOH 1119 3119 3119 HOH HOH A . 
O 6 HOH 1120 3120 3120 HOH HOH A . 
O 6 HOH 1121 3121 3121 HOH HOH A . 
O 6 HOH 1122 3122 3122 HOH HOH A . 
O 6 HOH 1123 3123 3123 HOH HOH A . 
O 6 HOH 1124 3124 3124 HOH HOH A . 
O 6 HOH 1125 3125 3125 HOH HOH A . 
O 6 HOH 1126 3126 3126 HOH HOH A . 
O 6 HOH 1127 3127 3127 HOH HOH A . 
O 6 HOH 1128 3128 3128 HOH HOH A . 
O 6 HOH 1129 3129 3129 HOH HOH A . 
O 6 HOH 1130 3130 3130 HOH HOH A . 
O 6 HOH 1131 3131 3131 HOH HOH A . 
O 6 HOH 1132 3132 3132 HOH HOH A . 
O 6 HOH 1133 3133 3133 HOH HOH A . 
O 6 HOH 1134 3134 3134 HOH HOH A . 
O 6 HOH 1135 3135 3135 HOH HOH A . 
O 6 HOH 1136 3136 3136 HOH HOH A . 
O 6 HOH 1137 3137 3137 HOH HOH A . 
O 6 HOH 1138 3138 3138 HOH HOH A . 
O 6 HOH 1139 3139 3139 HOH HOH A . 
O 6 HOH 1140 3140 3140 HOH HOH A . 
O 6 HOH 1141 3141 3141 HOH HOH A . 
O 6 HOH 1142 3142 3142 HOH HOH A . 
O 6 HOH 1143 3143 3143 HOH HOH A . 
O 6 HOH 1144 3144 3144 HOH HOH A . 
O 6 HOH 1145 3145 3145 HOH HOH A . 
O 6 HOH 1146 3146 3146 HOH HOH A . 
O 6 HOH 1147 3147 3147 HOH HOH A . 
O 6 HOH 1148 3148 3148 HOH HOH A . 
O 6 HOH 1149 3149 3149 HOH HOH A . 
O 6 HOH 1150 3150 3150 HOH HOH A . 
O 6 HOH 1151 3151 3151 HOH HOH A . 
O 6 HOH 1152 3152 3152 HOH HOH A . 
O 6 HOH 1153 3153 3153 HOH HOH A . 
O 6 HOH 1154 3154 3154 HOH HOH A . 
O 6 HOH 1155 3155 3155 HOH HOH A . 
O 6 HOH 1156 3156 3156 HOH HOH A . 
O 6 HOH 1157 3157 3157 HOH HOH A . 
O 6 HOH 1158 3158 3158 HOH HOH A . 
O 6 HOH 1159 3159 3159 HOH HOH A . 
O 6 HOH 1160 3160 3160 HOH HOH A . 
O 6 HOH 1161 3161 3161 HOH HOH A . 
O 6 HOH 1162 3162 3162 HOH HOH A . 
O 6 HOH 1163 3163 3163 HOH HOH A . 
O 6 HOH 1164 3164 3164 HOH HOH A . 
O 6 HOH 1165 3165 3165 HOH HOH A . 
O 6 HOH 1166 3166 3166 HOH HOH A . 
O 6 HOH 1167 3167 3167 HOH HOH A . 
O 6 HOH 1168 3168 3168 HOH HOH A . 
O 6 HOH 1169 3169 3169 HOH HOH A . 
O 6 HOH 1170 3170 3170 HOH HOH A . 
O 6 HOH 1171 3171 3171 HOH HOH A . 
O 6 HOH 1172 3172 3172 HOH HOH A . 
O 6 HOH 1173 3173 3173 HOH HOH A . 
O 6 HOH 1174 3174 3174 HOH HOH A . 
O 6 HOH 1175 3175 3175 HOH HOH A . 
O 6 HOH 1176 3176 3176 HOH HOH A . 
O 6 HOH 1177 3177 3177 HOH HOH A . 
O 6 HOH 1178 3178 3178 HOH HOH A . 
O 6 HOH 1179 3179 3179 HOH HOH A . 
O 6 HOH 1180 3180 3180 HOH HOH A . 
O 6 HOH 1181 3181 3181 HOH HOH A . 
O 6 HOH 1182 3182 3182 HOH HOH A . 
O 6 HOH 1183 3183 3183 HOH HOH A . 
O 6 HOH 1184 3184 3184 HOH HOH A . 
O 6 HOH 1185 3185 3185 HOH HOH A . 
O 6 HOH 1186 3186 3186 HOH HOH A . 
O 6 HOH 1187 3187 3187 HOH HOH A . 
O 6 HOH 1188 3188 3188 HOH HOH A . 
O 6 HOH 1189 3189 3189 HOH HOH A . 
O 6 HOH 1190 3190 3190 HOH HOH A . 
O 6 HOH 1191 3191 3191 HOH HOH A . 
O 6 HOH 1192 3192 3192 HOH HOH A . 
O 6 HOH 1193 3193 3193 HOH HOH A . 
O 6 HOH 1194 3194 3194 HOH HOH A . 
O 6 HOH 1195 3195 3195 HOH HOH A . 
O 6 HOH 1196 3196 3196 HOH HOH A . 
O 6 HOH 1197 3197 3197 HOH HOH A . 
O 6 HOH 1198 3198 3198 HOH HOH A . 
O 6 HOH 1199 3199 3199 HOH HOH A . 
O 6 HOH 1200 3200 3200 HOH HOH A . 
O 6 HOH 1201 3201 3201 HOH HOH A . 
O 6 HOH 1202 3202 3202 HOH HOH A . 
O 6 HOH 1203 3203 3203 HOH HOH A . 
O 6 HOH 1204 3204 3204 HOH HOH A . 
O 6 HOH 1205 3205 3205 HOH HOH A . 
O 6 HOH 1206 3206 3206 HOH HOH A . 
O 6 HOH 1207 3207 3207 HOH HOH A . 
O 6 HOH 1208 3208 3208 HOH HOH A . 
O 6 HOH 1209 3209 3209 HOH HOH A . 
O 6 HOH 1210 3210 3210 HOH HOH A . 
O 6 HOH 1211 3211 3211 HOH HOH A . 
O 6 HOH 1212 3212 3212 HOH HOH A . 
O 6 HOH 1213 3213 3213 HOH HOH A . 
O 6 HOH 1214 3214 3214 HOH HOH A . 
O 6 HOH 1215 3215 3215 HOH HOH A . 
O 6 HOH 1216 3216 3216 HOH HOH A . 
O 6 HOH 1217 3217 3217 HOH HOH A . 
O 6 HOH 1218 3218 3218 HOH HOH A . 
O 6 HOH 1219 3219 3219 HOH HOH A . 
O 6 HOH 1220 3220 3220 HOH HOH A . 
O 6 HOH 1221 3221 3221 HOH HOH A . 
O 6 HOH 1222 3222 3222 HOH HOH A . 
O 6 HOH 1223 3223 3223 HOH HOH A . 
O 6 HOH 1224 3224 3224 HOH HOH A . 
O 6 HOH 1225 3225 3225 HOH HOH A . 
O 6 HOH 1226 3226 3226 HOH HOH A . 
O 6 HOH 1227 3227 3227 HOH HOH A . 
O 6 HOH 1228 3228 3228 HOH HOH A . 
O 6 HOH 1229 3229 3229 HOH HOH A . 
O 6 HOH 1230 3230 3230 HOH HOH A . 
O 6 HOH 1231 3231 3231 HOH HOH A . 
O 6 HOH 1232 3232 3232 HOH HOH A . 
O 6 HOH 1233 3233 3233 HOH HOH A . 
O 6 HOH 1234 3234 3234 HOH HOH A . 
O 6 HOH 1235 3235 3235 HOH HOH A . 
O 6 HOH 1236 3236 3236 HOH HOH A . 
O 6 HOH 1237 3237 3237 HOH HOH A . 
O 6 HOH 1238 3238 3238 HOH HOH A . 
O 6 HOH 1239 3239 3239 HOH HOH A . 
O 6 HOH 1240 3240 3240 HOH HOH A . 
O 6 HOH 1241 3241 3241 HOH HOH A . 
O 6 HOH 1242 3242 3242 HOH HOH A . 
O 6 HOH 1243 3243 3243 HOH HOH A . 
O 6 HOH 1244 3244 3244 HOH HOH A . 
O 6 HOH 1245 3245 3245 HOH HOH A . 
O 6 HOH 1246 3246 3246 HOH HOH A . 
O 6 HOH 1247 3247 3247 HOH HOH A . 
O 6 HOH 1248 3248 3248 HOH HOH A . 
O 6 HOH 1249 3249 3249 HOH HOH A . 
O 6 HOH 1250 3250 3250 HOH HOH A . 
O 6 HOH 1251 3251 3251 HOH HOH A . 
O 6 HOH 1252 3252 3252 HOH HOH A . 
O 6 HOH 1253 3253 3253 HOH HOH A . 
O 6 HOH 1254 3254 3254 HOH HOH A . 
O 6 HOH 1255 3255 3255 HOH HOH A . 
O 6 HOH 1256 3256 3256 HOH HOH A . 
O 6 HOH 1257 3257 3257 HOH HOH A . 
O 6 HOH 1258 3258 3258 HOH HOH A . 
O 6 HOH 1259 3259 3259 HOH HOH A . 
O 6 HOH 1260 3260 3260 HOH HOH A . 
O 6 HOH 1261 3261 3261 HOH HOH A . 
O 6 HOH 1262 3262 3262 HOH HOH A . 
O 6 HOH 1263 3263 3263 HOH HOH A . 
O 6 HOH 1264 3264 3264 HOH HOH A . 
O 6 HOH 1265 3265 3265 HOH HOH A . 
O 6 HOH 1266 3266 3266 HOH HOH A . 
O 6 HOH 1267 3267 3267 HOH HOH A . 
O 6 HOH 1268 3268 3268 HOH HOH A . 
O 6 HOH 1269 3269 3269 HOH HOH A . 
O 6 HOH 1270 3270 3270 HOH HOH A . 
O 6 HOH 1271 3271 3271 HOH HOH A . 
O 6 HOH 1272 3272 3272 HOH HOH A . 
O 6 HOH 1273 3273 3273 HOH HOH A . 
O 6 HOH 1274 3274 3274 HOH HOH A . 
O 6 HOH 1275 3275 3275 HOH HOH A . 
O 6 HOH 1276 3276 3276 HOH HOH A . 
O 6 HOH 1277 3277 3277 HOH HOH A . 
O 6 HOH 1278 3278 3278 HOH HOH A . 
O 6 HOH 1279 3279 3279 HOH HOH A . 
O 6 HOH 1280 3280 3280 HOH HOH A . 
O 6 HOH 1281 3281 3281 HOH HOH A . 
O 6 HOH 1282 3282 3282 HOH HOH A . 
O 6 HOH 1283 3283 3283 HOH HOH A . 
O 6 HOH 1284 3284 3284 HOH HOH A . 
O 6 HOH 1285 3285 3285 HOH HOH A . 
O 6 HOH 1286 3286 3286 HOH HOH A . 
O 6 HOH 1287 3287 3287 HOH HOH A . 
O 6 HOH 1288 3288 3288 HOH HOH A . 
O 6 HOH 1289 3289 3289 HOH HOH A . 
O 6 HOH 1290 3290 3290 HOH HOH A . 
O 6 HOH 1291 3291 3291 HOH HOH A . 
O 6 HOH 1292 3292 3292 HOH HOH A . 
O 6 HOH 1293 3293 3293 HOH HOH A . 
O 6 HOH 1294 3294 3294 HOH HOH A . 
O 6 HOH 1295 3295 3295 HOH HOH A . 
O 6 HOH 1296 3296 3296 HOH HOH A . 
O 6 HOH 1297 3297 3297 HOH HOH A . 
O 6 HOH 1298 3298 3298 HOH HOH A . 
O 6 HOH 1299 3299 3299 HOH HOH A . 
O 6 HOH 1300 3300 3300 HOH HOH A . 
O 6 HOH 1301 3301 3301 HOH HOH A . 
O 6 HOH 1302 3302 3302 HOH HOH A . 
O 6 HOH 1303 3303 3303 HOH HOH A . 
O 6 HOH 1304 3304 3304 HOH HOH A . 
O 6 HOH 1305 3305 3305 HOH HOH A . 
O 6 HOH 1306 3306 3306 HOH HOH A . 
O 6 HOH 1307 3307 3307 HOH HOH A . 
O 6 HOH 1308 3308 3308 HOH HOH A . 
O 6 HOH 1309 3309 3309 HOH HOH A . 
O 6 HOH 1310 3310 3310 HOH HOH A . 
O 6 HOH 1311 3311 3311 HOH HOH A . 
O 6 HOH 1312 3312 3312 HOH HOH A . 
O 6 HOH 1313 3313 3313 HOH HOH A . 
O 6 HOH 1314 3314 3314 HOH HOH A . 
O 6 HOH 1315 3315 3315 HOH HOH A . 
O 6 HOH 1316 3316 3316 HOH HOH A . 
O 6 HOH 1317 3317 3317 HOH HOH A . 
O 6 HOH 1318 3318 3318 HOH HOH A . 
O 6 HOH 1319 3319 3319 HOH HOH A . 
O 6 HOH 1320 3320 3320 HOH HOH A . 
O 6 HOH 1321 3321 3321 HOH HOH A . 
O 6 HOH 1322 3322 3322 HOH HOH A . 
O 6 HOH 1323 3323 3323 HOH HOH A . 
O 6 HOH 1324 3324 3324 HOH HOH A . 
O 6 HOH 1325 3325 3325 HOH HOH A . 
O 6 HOH 1326 3326 3326 HOH HOH A . 
O 6 HOH 1327 3327 3327 HOH HOH A . 
O 6 HOH 1328 3328 3328 HOH HOH A . 
O 6 HOH 1329 3329 3329 HOH HOH A . 
O 6 HOH 1330 3330 3330 HOH HOH A . 
O 6 HOH 1331 3331 3331 HOH HOH A . 
O 6 HOH 1332 3332 3332 HOH HOH A . 
O 6 HOH 1333 3333 3333 HOH HOH A . 
O 6 HOH 1334 3334 3334 HOH HOH A . 
O 6 HOH 1335 3335 3335 HOH HOH A . 
O 6 HOH 1336 3336 3336 HOH HOH A . 
O 6 HOH 1337 3337 3337 HOH HOH A . 
O 6 HOH 1338 3338 3338 HOH HOH A . 
O 6 HOH 1339 3339 3339 HOH HOH A . 
O 6 HOH 1340 3340 3340 HOH HOH A . 
O 6 HOH 1341 3341 3341 HOH HOH A . 
O 6 HOH 1342 3342 3342 HOH HOH A . 
O 6 HOH 1343 3343 3343 HOH HOH A . 
O 6 HOH 1344 3344 3344 HOH HOH A . 
O 6 HOH 1345 3345 3345 HOH HOH A . 
O 6 HOH 1346 3346 3346 HOH HOH A . 
O 6 HOH 1347 3347 3347 HOH HOH A . 
O 6 HOH 1348 3348 3348 HOH HOH A . 
O 6 HOH 1349 3349 3349 HOH HOH A . 
O 6 HOH 1350 3350 3350 HOH HOH A . 
O 6 HOH 1351 3351 3351 HOH HOH A . 
O 6 HOH 1352 3352 3352 HOH HOH A . 
O 6 HOH 1353 3353 3353 HOH HOH A . 
O 6 HOH 1354 3354 3354 HOH HOH A . 
O 6 HOH 1355 3355 3355 HOH HOH A . 
O 6 HOH 1356 3356 3356 HOH HOH A . 
O 6 HOH 1357 3357 3357 HOH HOH A . 
O 6 HOH 1358 3358 3358 HOH HOH A . 
O 6 HOH 1359 3359 3359 HOH HOH A . 
O 6 HOH 1360 3360 3360 HOH HOH A . 
O 6 HOH 1361 3361 3361 HOH HOH A . 
O 6 HOH 1362 3362 3362 HOH HOH A . 
O 6 HOH 1363 3363 3363 HOH HOH A . 
O 6 HOH 1364 3364 3364 HOH HOH A . 
O 6 HOH 1365 3365 3365 HOH HOH A . 
O 6 HOH 1366 3366 3366 HOH HOH A . 
O 6 HOH 1367 3367 3367 HOH HOH A . 
O 6 HOH 1368 3368 3368 HOH HOH A . 
O 6 HOH 1369 3369 3369 HOH HOH A . 
O 6 HOH 1370 3370 3370 HOH HOH A . 
O 6 HOH 1371 3371 3371 HOH HOH A . 
O 6 HOH 1372 3372 3372 HOH HOH A . 
O 6 HOH 1373 3373 3373 HOH HOH A . 
O 6 HOH 1374 3374 3374 HOH HOH A . 
O 6 HOH 1375 3375 3375 HOH HOH A . 
O 6 HOH 1376 3376 3376 HOH HOH A . 
O 6 HOH 1377 3377 3377 HOH HOH A . 
O 6 HOH 1378 3378 3378 HOH HOH A . 
O 6 HOH 1379 3379 3379 HOH HOH A . 
O 6 HOH 1380 3380 3380 HOH HOH A . 
O 6 HOH 1381 3381 3381 HOH HOH A . 
O 6 HOH 1382 3382 3382 HOH HOH A . 
O 6 HOH 1383 3383 3383 HOH HOH A . 
O 6 HOH 1384 3384 3384 HOH HOH A . 
O 6 HOH 1385 3385 3385 HOH HOH A . 
O 6 HOH 1386 3386 3386 HOH HOH A . 
O 6 HOH 1387 3387 3387 HOH HOH A . 
O 6 HOH 1388 3388 3388 HOH HOH A . 
O 6 HOH 1389 3389 3389 HOH HOH A . 
O 6 HOH 1390 3390 3390 HOH HOH A . 
O 6 HOH 1391 3391 3391 HOH HOH A . 
O 6 HOH 1392 3392 3392 HOH HOH A . 
O 6 HOH 1393 3393 3393 HOH HOH A . 
O 6 HOH 1394 3394 3394 HOH HOH A . 
O 6 HOH 1395 3395 3395 HOH HOH A . 
O 6 HOH 1396 3396 3396 HOH HOH A . 
O 6 HOH 1397 3397 3397 HOH HOH A . 
O 6 HOH 1398 3398 3398 HOH HOH A . 
O 6 HOH 1399 3399 3399 HOH HOH A . 
O 6 HOH 1400 3400 3400 HOH HOH A . 
O 6 HOH 1401 3401 3401 HOH HOH A . 
O 6 HOH 1402 3402 3402 HOH HOH A . 
O 6 HOH 1403 3403 3403 HOH HOH A . 
O 6 HOH 1404 3404 3404 HOH HOH A . 
O 6 HOH 1405 3405 3405 HOH HOH A . 
O 6 HOH 1406 3406 3406 HOH HOH A . 
O 6 HOH 1407 3407 3407 HOH HOH A . 
O 6 HOH 1408 3408 3408 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 59  A ASN 59  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 416 A ASN 416 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
1 2 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.3700000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-06-14 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-04-03 
5 'Structure model' 1 4 2020-07-29 
6 'Structure model' 1 5 2021-05-12 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Data collection'           
4  4 'Structure model' 'Derived calculations'      
5  4 'Structure model' 'Experimental preparation'  
6  4 'Structure model' Other                       
7  5 'Structure model' 'Data collection'           
8  5 'Structure model' 'Derived calculations'      
9  5 'Structure model' Other                       
10 5 'Structure model' 'Structure summary'         
11 6 'Structure model' 'Derived calculations'      
12 6 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' exptl_crystal_grow        
2  4 'Structure model' pdbx_database_proc        
3  4 'Structure model' pdbx_database_status      
4  4 'Structure model' struct_conn               
5  5 'Structure model' chem_comp                 
6  5 'Structure model' entity                    
7  5 'Structure model' pdbx_chem_comp_identifier 
8  5 'Structure model' pdbx_database_status      
9  5 'Structure model' pdbx_entity_nonpoly       
10 5 'Structure model' struct_conn               
11 5 'Structure model' struct_site               
12 5 'Structure model' struct_site_gen           
13 6 'Structure model' chem_comp                 
14 6 'Structure model' pdbx_struct_assembly      
15 6 'Structure model' pdbx_struct_assembly_gen  
16 6 'Structure model' pdbx_struct_oper_list     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_exptl_crystal_grow.temp'                    
2  4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
3  4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
4  5 'Structure model' '_chem_comp.name'                             
5  5 'Structure model' '_chem_comp.type'                             
6  5 'Structure model' '_entity.pdbx_description'                    
7  5 'Structure model' '_pdbx_database_status.status_code_sf'        
8  5 'Structure model' '_pdbx_entity_nonpoly.name'                   
9  5 'Structure model' '_struct_conn.pdbx_role'                      
10 6 'Structure model' '_chem_comp.pdbx_synonyms'                    
11 6 'Structure model' '_pdbx_struct_assembly.details'               
12 6 'Structure model' '_pdbx_struct_assembly.method_details'        
13 6 'Structure model' '_pdbx_struct_assembly.oligomeric_count'      
14 6 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
XDS    'data reduction' .   ? 2 
XSCALE 'data scaling'   .   ? 3 
CNS    phasing          .   ? 4 
# 
_pdbx_entry_details.entry_id                 2C5G 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         'RESIDUES 1, 2, 3, 536 AND 537 MISSING' 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A GLY 384  ? ? O A HOH 3085 ? ? 2.14 
2 1 O A HOH 2334 ? ? O A HOH 2460 ? ? 2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 2141 ? ? 1_555 O A HOH 2141 ? ? 5_675 2.07 
2 1 O A HOH 3373 ? ? 1_555 O A HOH 3373 ? ? 4_556 2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 45  ? ? 81.03   -16.77  
2  1 PHE A 45  ? ? 81.03   -16.13  
3  1 ALA A 60  ? ? -108.90 46.86   
4  1 SER A 108 ? ? -157.10 75.96   
5  1 ASN A 167 ? ? 59.80   12.57   
6  1 SER A 200 ? A 54.87   -121.47 
7  1 SER A 200 ? B 53.10   -120.07 
8  1 GLU A 299 ? ? -120.24 -74.43  
9  1 ASP A 380 ? ? -161.17 54.60   
10 1 ASP A 380 ? ? -156.06 54.60   
11 1 VAL A 400 ? ? -126.62 -61.83  
12 1 ARG A 517 ? A 38.81   43.92   
13 1 ARG A 517 ? B 34.27   45.36   
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1  1 O ? A HOH 2031 ? 10.70 .    
2  1 O ? A HOH 2042 ? 7.84  .    
3  1 O ? A HOH 2049 ? 5.87  .    
4  1 O ? A HOH 2050 ? 6.46  .    
5  1 O ? A HOH 2051 ? 6.12  .    
6  1 O ? A HOH 2054 ? 6.30  .    
7  1 O ? A HOH 2055 ? 7.29  .    
8  1 O ? A HOH 2056 ? 10.34 .    
9  1 O ? A HOH 2065 ? 6.13  .    
10 1 O ? A HOH 2066 ? 7.59  .    
11 1 O ? A HOH 2072 ? 9.33  .    
12 1 O ? A HOH 2073 ? 11.13 .    
13 1 O ? A HOH 2076 ? 6.64  .    
14 1 O ? A HOH 2078 ? 9.46  .    
15 1 O ? A HOH 2080 ? 9.65  .    
16 1 O ? A HOH 2081 ? 7.88  .    
17 1 O ? A HOH 2082 ? 7.40  .    
18 1 O ? A HOH 2083 ? 7.35  .    
19 1 O ? A HOH 2110 ? 7.58  .    
20 1 O ? A HOH 2111 ? 8.96  .    
21 1 O ? A HOH 2112 ? 7.09  .    
22 1 O ? A HOH 2113 ? 9.46  .    
23 1 O ? A HOH 2114 ? 8.12  .    
24 1 O ? A HOH 2115 ? 8.70  .    
25 1 O ? A HOH 2152 ? 5.81  .    
26 1 O ? A HOH 2158 ? 6.65  .    
27 1 O ? A HOH 2159 ? 5.88  .    
28 1 O ? A HOH 2160 ? 6.70  .    
29 1 O ? A HOH 2168 ? 6.93  .    
30 1 O ? A HOH 2171 ? 8.31  .    
31 1 O ? A HOH 2172 ? 8.25  .    
32 1 O ? A HOH 2173 ? 7.77  .    
33 1 O ? A HOH 2182 ? 6.39  .    
34 1 O ? A HOH 2198 ? .     6.76 
35 1 O ? A HOH 2204 ? 6.84  .    
36 1 O ? A HOH 2206 ? 6.34  .    
37 1 O ? A HOH 2207 ? 8.50  .    
38 1 O ? A HOH 2210 ? 8.36  .    
39 1 O ? A HOH 2219 ? 5.98  .    
40 1 O ? A HOH 2221 ? 6.54  .    
41 1 O ? A HOH 2224 ? 6.46  .    
42 1 O ? A HOH 2237 ? 6.13  .    
43 1 O ? A HOH 2256 ? 7.09  .    
44 1 O ? A HOH 2257 ? 5.82  .    
45 1 O ? A HOH 2272 ? 7.11  .    
46 1 O ? A HOH 2273 ? 7.89  .    
47 1 O ? A HOH 2274 ? 6.05  .    
48 1 O ? A HOH 2275 ? 5.90  .    
49 1 O ? A HOH 2277 ? 8.93  .    
50 1 O ? A HOH 2278 ? 8.18  .    
51 1 O ? A HOH 2279 ? 8.86  .    
52 1 O ? A HOH 2306 ? .     8.47 
53 1 O ? A HOH 2355 ? 5.81  .    
54 1 O ? A HOH 2369 ? 6.12  .    
55 1 O ? A HOH 2429 ? 6.10  .    
56 1 O ? A HOH 2553 ? 6.18  .    
57 1 O ? A HOH 2561 ? 6.28  .    
58 1 O ? A HOH 2568 ? 5.85  .    
59 1 O ? A HOH 2647 ? 5.93  .    
60 1 O ? A HOH 2659 ? 6.32  .    
61 1 O ? A HOH 2720 ? 5.81  .    
62 1 O ? A HOH 2727 ? 6.46  .    
63 1 O ? A HOH 2731 ? .     7.14 
64 1 O ? A HOH 2732 ? .     6.38 
65 1 O ? A HOH 2733 ? .     7.12 
66 1 O ? A HOH 3321 ? .     5.95 
67 1 O ? A HOH 3331 ? .     7.00 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ALA 536 ? CA ? A ALA 536 CA 
2 1 Y 1 A ALA 536 ? C  ? A ALA 536 C  
3 1 Y 1 A ALA 536 ? O  ? A ALA 536 O  
4 1 Y 1 A ALA 536 ? CB ? A ALA 536 CB 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A CYS 537 ? A CYS 537 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-(TRIMETHYLAMMONIUM)ETHYL THIOL'       ETM 
3 'CHLORIDE ION'                           CL  
4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
5 'TRIETHYLENE GLYCOL'                     PGE 
6 water                                    HOH 
#