data_2C7A
# 
_entry.id   2C7A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2C7A         
PDBE  EBI-26469    
WWPDB D_1290026469 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1A28 unspecified 'HORMONE-BOUND HUMAN PROGESTERONE RECEPTOR LIGAND-BINDING DOMAIN'                                 
PDB 1E3K unspecified 'HUMAN PROGESTERON RECEPTOR LIGAND BINDING DOMAIN IN COMPLEX WITH THE LIGAND METRIBOLONE (R1881)' 
PDB 1SQN unspecified 'PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN WITH BOUND NORETHINDRONE'                            
PDB 1SR7 unspecified 'PROGESTERONE RECEPTOR HORMONE BINDING DOMAIN WITH BOUNDMOMETASONE FUROATE'                       
PDB 1ZUC unspecified 'PROGESTERONE RECEPTOR LIGAND BINDING DOMAIN IN COMPLEX WITH THE NONSTEROIDAL AGONIST TANAPROGET' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2C7A 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2005-11-19 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Roemer, S.C.'      1 
'Donham, D.C.'      2 
'Sherman, L.'       3 
'Pon, V.H.'         4 
'Edwards, D.P.'     5 
'Churchill, M.E.A.' 6 
# 
_citation.id                        primary 
_citation.title                     
;Structure of the Progesterone Receptor-Deoxyribonucleic Acid Complex: Novel Interactions Required for Binding to Half-Site Response Elements.
;
_citation.journal_abbrev            Mol.Endocrinol. 
_citation.journal_volume            20 
_citation.page_first                3042 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           MOENEN 
_citation.country                   US 
_citation.journal_id_ISSN           0888-8809 
_citation.journal_id_CSD            2068 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16931575 
_citation.pdbx_database_id_DOI      10.1210/ME.2005-0511 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Roemer, S.C.'      1 
primary 'Donham, D.C.'      2 
primary 'Sherman, L.'       3 
primary 'Pon, V.H.'         4 
primary 'Edwards, D.P.'     5 
primary 'Churchill, M.E.A.' 6 
# 
_cell.entry_id           2C7A 
_cell.length_a           39.530 
_cell.length_b           107.850 
_cell.length_c           111.960 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2C7A 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROGESTERONE RECEPTOR'                                           8676.411 2   ? ? 
'DNA BINDING DOMAIN, RESIDUES 399-476' ? 
2 polymer     syn 
;5'-D(*CP*CP*AP*GP*AP*AP*CP*AP*GP*TP *TP*TP*GP*TP*TP*CP*TP*G)-3'
;
5506.577 1   ? ? ?                                      ? 
3 polymer     syn 
;5'-D(*CP*CP*AP*GP*AP*AP*CP*AP*AP*AP *CP*TP*GP*TP*TP*CP*TP*G)-3'
;
5484.581 1   ? ? ?                                      ? 
4 non-polymer syn 'ZINC ION'                                                        65.409   4   ? ? ? ? 
5 water       nat water                                                             18.015   148 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PR 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no PQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFK 
PQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFK A,B ? 
2 polydeoxyribonucleotide no no '(DC)(DC)(DA)(DG)(DA)(DA)(DC)(DA)(DG)(DT)(DT)(DT)(DG)(DT)(DT)(DC)(DT)(DG)'     CCAGAACAGTTTGTTCTG 
C   ? 
3 polydeoxyribonucleotide no no '(DC)(DC)(DA)(DG)(DA)(DA)(DC)(DA)(DA)(DA)(DC)(DT)(DG)(DT)(DT)(DC)(DT)(DG)'     CCAGAACAAACTGTTCTG 
D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  GLN n 
1 3  LYS n 
1 4  ILE n 
1 5  CYS n 
1 6  LEU n 
1 7  ILE n 
1 8  CYS n 
1 9  GLY n 
1 10 ASP n 
1 11 GLU n 
1 12 ALA n 
1 13 SER n 
1 14 GLY n 
1 15 CYS n 
1 16 HIS n 
1 17 TYR n 
1 18 GLY n 
1 19 VAL n 
1 20 LEU n 
1 21 THR n 
1 22 CYS n 
1 23 GLY n 
1 24 SER n 
1 25 CYS n 
1 26 LYS n 
1 27 VAL n 
1 28 PHE n 
1 29 PHE n 
1 30 LYS n 
1 31 ARG n 
1 32 ALA n 
1 33 MET n 
1 34 GLU n 
1 35 GLY n 
1 36 GLN n 
1 37 HIS n 
1 38 ASN n 
1 39 TYR n 
1 40 LEU n 
1 41 CYS n 
1 42 ALA n 
1 43 GLY n 
1 44 ARG n 
1 45 ASN n 
1 46 ASP n 
1 47 CYS n 
1 48 ILE n 
1 49 VAL n 
1 50 ASP n 
1 51 LYS n 
1 52 ILE n 
1 53 ARG n 
1 54 ARG n 
1 55 LYS n 
1 56 ASN n 
1 57 CYS n 
1 58 PRO n 
1 59 ALA n 
1 60 CYS n 
1 61 ARG n 
1 62 LEU n 
1 63 ARG n 
1 64 LYS n 
1 65 CYS n 
1 66 CYS n 
1 67 GLN n 
1 68 ALA n 
1 69 GLY n 
1 70 MET n 
1 71 VAL n 
1 72 LEU n 
1 73 GLY n 
1 74 GLY n 
1 75 ARG n 
1 76 LYS n 
1 77 PHE n 
1 78 LYS n 
2 1  DC  n 
2 2  DC  n 
2 3  DA  n 
2 4  DG  n 
2 5  DA  n 
2 6  DA  n 
2 7  DC  n 
2 8  DA  n 
2 9  DG  n 
2 10 DT  n 
2 11 DT  n 
2 12 DT  n 
2 13 DG  n 
2 14 DT  n 
2 15 DT  n 
2 16 DC  n 
2 17 DT  n 
2 18 DG  n 
3 1  DC  n 
3 2  DC  n 
3 3  DA  n 
3 4  DG  n 
3 5  DA  n 
3 6  DA  n 
3 7  DC  n 
3 8  DA  n 
3 9  DA  n 
3 10 DA  n 
3 11 DC  n 
3 12 DT  n 
3 13 DG  n 
3 14 DT  n 
3 15 DT  n 
3 16 DC  n 
3 17 DT  n 
3 18 DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'HOMO SAPIENS' HUMAN 9606 ? 
3 1 sample ? ? 'HOMO SAPIENS' HUMAN 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PRGR_HUMAN 1 ? ? P06401 ? 
2 PDB 2C7A       2 ? ? 2C7A   ? 
3 PDB 2C7A       3 ? ? 2C7A   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2C7A A 1 ? 78 ? P06401 399 ? 476 ? 563 640 
2 1 2C7A B 1 ? 78 ? P06401 399 ? 476 ? 563 640 
3 2 2C7A C 1 ? 18 ? 2C7A   1   ? 18  ? 1   18  
4 3 2C7A D 1 ? 18 ? 2C7A   1   ? 18  ? 1   18  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          2C7A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.21 
_exptl_crystal.density_percent_sol   70.78 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           77.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2C7A 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   16986 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.4 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.0000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.900 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2C7A 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     14739 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    95.2 
_refine.ls_R_factor_obs                          0.203 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.198 
_refine.ls_R_factor_R_free                       0.246 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.000 
_refine.ls_number_reflns_R_free                  1641 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.938 
_refine.correlation_coeff_Fo_to_Fc_free          0.898 
_refine.B_iso_mean                               42.38 
_refine.aniso_B[1][1]                            2.85000 
_refine.aniso_B[2][2]                            -0.31000 
_refine.aniso_B[3][3]                            -2.53000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.291 
_refine.pdbx_overall_ESU_R_Free                  0.242 
_refine.overall_SU_ML                            0.153 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             6.869 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1164 
_refine_hist.pdbx_number_atoms_nucleic_acid   729 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             148 
_refine_hist.number_atoms_total               2045 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010 0.021 ? 2011 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.706 2.427 ? 2836 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.026 5.000 ? 152  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.085 0.200 ? 272  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005 0.020 ? 1248 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.209 0.200 ? 809  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.152 0.200 ? 162  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.188 0.200 ? 23   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.192 0.200 ? 9    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.218 2.000 ? 756  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.219 2.500 ? 1190 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.657 3.000 ? 1255 'X-RAY DIFFRACTION' ? 
r_scbond_other               ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.488 3.500 ? 1646 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.57 
_refine_ls_shell.number_reflns_R_work             970 
_refine_ls_shell.R_factor_R_work                  0.2720 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3490 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             114 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2C7A 
_struct.title                     'STRUCTURE OF THE PROGESTERONE RECEPTOR-DNA COMPLEX' 
_struct.pdbx_descriptor           'PROGESTERONE RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2C7A 
_struct_keywords.pdbx_keywords   RECEPTOR/DNA 
_struct_keywords.text            
;RECEPTOR/DNA, PROGESTERONE RECEPTOR, DNA-BINDING, COMPLEX, METAL-BINDING, NUCLEAR PROTEIN, PHOSPHORYLATION, STEROID-BINDING, TRANSCRIPTION REGULATION, ZINC-FINGER, ZINC, RECEPTOR-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 CYS A 22 ? GLY A 35 ? CYS A 584 GLY A 597 1 ? 14 
HELX_P HELX_P2 2 CYS A 57 ? GLY A 69 ? CYS A 619 GLY A 631 1 ? 13 
HELX_P HELX_P3 3 CYS B 22 ? GLY B 35 ? CYS B 584 GLY B 597 1 ? 14 
HELX_P HELX_P4 4 CYS B 57 ? GLY B 69 ? CYS B 619 GLY B 631 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? E ZN .  ZN ? ? ? 1_555 A CYS 25 SG ? ? A ZN 1641 A CYS 587 1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc2  metalc ? ? E ZN .  ZN ? ? ? 1_555 A CYS 5  SG ? ? A ZN 1641 A CYS 567 1_555 ? ? ? ? ? ? ?            2.316 ? 
metalc3  metalc ? ? E ZN .  ZN ? ? ? 1_555 A CYS 8  SG ? ? A ZN 1641 A CYS 570 1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc4  metalc ? ? E ZN .  ZN ? ? ? 1_555 A CYS 22 SG ? ? A ZN 1641 A CYS 584 1_555 ? ? ? ? ? ? ?            2.346 ? 
metalc5  metalc ? ? F ZN .  ZN ? ? ? 1_555 A CYS 41 SG ? ? A ZN 1642 A CYS 603 1_555 ? ? ? ? ? ? ?            2.322 ? 
metalc6  metalc ? ? F ZN .  ZN ? ? ? 1_555 A CYS 47 SG ? ? A ZN 1642 A CYS 609 1_555 ? ? ? ? ? ? ?            2.339 ? 
metalc7  metalc ? ? F ZN .  ZN ? ? ? 1_555 A CYS 60 SG ? ? A ZN 1642 A CYS 622 1_555 ? ? ? ? ? ? ?            2.322 ? 
metalc8  metalc ? ? F ZN .  ZN ? ? ? 1_555 A CYS 57 SG ? ? A ZN 1642 A CYS 619 1_555 ? ? ? ? ? ? ?            2.319 ? 
metalc9  metalc ? ? G ZN .  ZN ? ? ? 1_555 B CYS 8  SG ? ? B ZN 1639 B CYS 570 1_555 ? ? ? ? ? ? ?            2.327 ? 
metalc10 metalc ? ? G ZN .  ZN ? ? ? 1_555 B CYS 22 SG ? ? B ZN 1639 B CYS 584 1_555 ? ? ? ? ? ? ?            2.338 ? 
metalc11 metalc ? ? G ZN .  ZN ? ? ? 1_555 B CYS 25 SG ? ? B ZN 1639 B CYS 587 1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc12 metalc ? ? G ZN .  ZN ? ? ? 1_555 B CYS 5  SG ? ? B ZN 1639 B CYS 567 1_555 ? ? ? ? ? ? ?            2.341 ? 
metalc13 metalc ? ? H ZN .  ZN ? ? ? 1_555 B CYS 47 SG ? ? B ZN 1640 B CYS 609 1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc14 metalc ? ? H ZN .  ZN ? ? ? 1_555 B CYS 60 SG ? ? B ZN 1640 B CYS 622 1_555 ? ? ? ? ? ? ?            2.333 ? 
metalc15 metalc ? ? H ZN .  ZN ? ? ? 1_555 B CYS 57 SG ? ? B ZN 1640 B CYS 619 1_555 ? ? ? ? ? ? ?            2.341 ? 
metalc16 metalc ? ? H ZN .  ZN ? ? ? 1_555 B CYS 41 SG ? ? B ZN 1640 B CYS 603 1_555 ? ? ? ? ? ? ?            2.317 ? 
hydrog1  hydrog ? ? C DC 2  N3 ? ? ? 1_555 D DG  18 N1 ? ? C DC 2    D DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DC 2  N4 ? ? ? 1_555 D DG  18 O6 ? ? C DC 2    D DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DC 2  O2 ? ? ? 1_555 D DG  18 N2 ? ? C DC 2    D DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT  17 N3 ? ? C DA 3    D DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT  17 O4 ? ? C DA 3    D DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DG 4  N1 ? ? ? 1_555 D DC  16 N3 ? ? C DG 4    D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DG 4  N2 ? ? ? 1_555 D DC  16 O2 ? ? C DG 4    D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DG 4  O6 ? ? ? 1_555 D DC  16 N4 ? ? C DG 4    D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DA 5  N1 ? ? ? 1_555 D DT  15 N3 ? ? C DA 5    D DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DA 5  N6 ? ? ? 1_555 D DT  15 O4 ? ? C DA 5    D DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DA 6  N1 ? ? ? 1_555 D DT  14 N3 ? ? C DA 6    D DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DA 6  N6 ? ? ? 1_555 D DT  14 O4 ? ? C DA 6    D DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DC 7  N3 ? ? ? 1_555 D DG  13 N1 ? ? C DC 7    D DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DC 7  N4 ? ? ? 1_555 D DG  13 O6 ? ? C DC 7    D DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DC 7  O2 ? ? ? 1_555 D DG  13 N2 ? ? C DC 7    D DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT  12 N3 ? ? C DA 8    D DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DA 8  N6 ? ? ? 1_555 D DT  12 O4 ? ? C DA 8    D DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG 9  N1 ? ? ? 1_555 D DC  11 N3 ? ? C DG 9    D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DG 9  N2 ? ? ? 1_555 D DC  11 O2 ? ? C DG 9    D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DG 9  O6 ? ? ? 1_555 D DC  11 N4 ? ? C DG 9    D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DT 10 N3 ? ? ? 1_555 D DA  10 N1 ? ? C DT 10   D DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DT 10 O4 ? ? ? 1_555 D DA  10 N6 ? ? C DT 10   D DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA  9  N1 ? ? C DT 11   D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT 11 O4 ? ? ? 1_555 D DA  9  N6 ? ? C DT 11   D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA  8  N1 ? ? C DT 12   D DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA  8  N6 ? ? C DT 12   D DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DG 13 N1 ? ? ? 1_555 D DC  7  N3 ? ? C DG 13   D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DG 13 N2 ? ? ? 1_555 D DC  7  O2 ? ? C DG 13   D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DG 13 O6 ? ? ? 1_555 D DC  7  N4 ? ? C DG 13   D DC  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DT 14 N3 ? ? ? 1_555 D DA  6  N1 ? ? C DT 14   D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DT 14 O4 ? ? ? 1_555 D DA  6  N6 ? ? C DT 14   D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DT 15 N3 ? ? ? 1_555 D DA  5  N1 ? ? C DT 15   D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DT 15 O4 ? ? ? 1_555 D DA  5  N6 ? ? C DT 15   D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DC 16 N3 ? ? ? 1_555 D DG  4  N1 ? ? C DC 16   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DC 16 N4 ? ? ? 1_555 D DG  4  O6 ? ? C DC 16   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DC 16 O2 ? ? ? 1_555 D DG  4  N2 ? ? C DC 16   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DT 17 N3 ? ? ? 1_555 D DA  3  N1 ? ? C DT 17   D DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DT 17 O4 ? ? ? 1_555 D DA  3  N6 ? ? C DT 17   D DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DG 18 N1 ? ? ? 1_555 D DC  2  N3 ? ? C DG 18   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DG 18 N2 ? ? ? 1_555 D DC  2  O2 ? ? C DG 18   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DG 18 O6 ? ? ? 1_555 D DC  2  N4 ? ? C DG 18   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 2 ? 
BA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
BA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLY A 14 ? HIS A 16 ? GLY A 576 HIS A 578 
AA 2 VAL A 19 ? THR A 21 ? VAL A 581 THR A 583 
BA 1 GLY B 14 ? HIS B 16 ? GLY B 576 HIS B 578 
BA 2 VAL B 19 ? THR B 21 ? VAL B 581 THR B 583 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N HIS A 16 ? N HIS A 578 O VAL A 19 ? O VAL A 581 
BA 1 2 N HIS B 16 ? N HIS B 578 O VAL B 19 ? O VAL B 581 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A1641' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A1642' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B1639' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B1640' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 5  ? CYS A 567 . ? 1_555 ? 
2  AC1 4 CYS A 8  ? CYS A 570 . ? 1_555 ? 
3  AC1 4 CYS A 22 ? CYS A 584 . ? 1_555 ? 
4  AC1 4 CYS A 25 ? CYS A 587 . ? 1_555 ? 
5  AC2 4 CYS A 41 ? CYS A 603 . ? 1_555 ? 
6  AC2 4 CYS A 47 ? CYS A 609 . ? 1_555 ? 
7  AC2 4 CYS A 57 ? CYS A 619 . ? 1_555 ? 
8  AC2 4 CYS A 60 ? CYS A 622 . ? 1_555 ? 
9  AC3 4 CYS B 5  ? CYS B 567 . ? 1_555 ? 
10 AC3 4 CYS B 8  ? CYS B 570 . ? 1_555 ? 
11 AC3 4 CYS B 22 ? CYS B 584 . ? 1_555 ? 
12 AC3 4 CYS B 25 ? CYS B 587 . ? 1_555 ? 
13 AC4 4 CYS B 41 ? CYS B 603 . ? 1_555 ? 
14 AC4 4 CYS B 47 ? CYS B 609 . ? 1_555 ? 
15 AC4 4 CYS B 57 ? CYS B 619 . ? 1_555 ? 
16 AC4 4 CYS B 60 ? CYS B 622 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2C7A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2C7A 
_atom_sites.fract_transf_matrix[1][1]   0.025297 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009272 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008932 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PRO A 1 1  ? 26.678 38.844 78.376 1.00 74.41  ? 563  PRO A N     1 
ATOM   2    C  CA    . PRO A 1 1  ? 25.852 40.073 78.632 1.00 73.74  ? 563  PRO A CA    1 
ATOM   3    C  C     . PRO A 1 1  ? 24.896 40.470 77.484 1.00 72.16  ? 563  PRO A C     1 
ATOM   4    O  O     . PRO A 1 1  ? 23.825 41.008 77.787 1.00 72.66  ? 563  PRO A O     1 
ATOM   5    C  CB    . PRO A 1 1  ? 26.906 41.173 78.886 1.00 73.97  ? 563  PRO A CB    1 
ATOM   6    C  CG    . PRO A 1 1  ? 28.238 40.566 78.465 1.00 74.71  ? 563  PRO A CG    1 
ATOM   7    C  CD    . PRO A 1 1  ? 28.101 39.069 78.691 1.00 74.99  ? 563  PRO A CD    1 
ATOM   8    N  N     . GLN A 1 2  ? 25.261 40.238 76.220 1.00 69.90  ? 564  GLN A N     1 
ATOM   9    C  CA    . GLN A 1 2  ? 24.346 40.519 75.102 1.00 67.23  ? 564  GLN A CA    1 
ATOM   10   C  C     . GLN A 1 2  ? 23.230 39.471 75.057 1.00 64.71  ? 564  GLN A C     1 
ATOM   11   O  O     . GLN A 1 2  ? 23.491 38.267 75.094 1.00 64.51  ? 564  GLN A O     1 
ATOM   12   C  CB    . GLN A 1 2  ? 25.088 40.587 73.760 1.00 67.75  ? 564  GLN A CB    1 
ATOM   13   C  CG    . GLN A 1 2  ? 24.672 41.770 72.871 1.00 69.16  ? 564  GLN A CG    1 
ATOM   14   C  CD    . GLN A 1 2  ? 24.890 41.538 71.363 1.00 70.37  ? 564  GLN A CD    1 
ATOM   15   O  OE1   . GLN A 1 2  ? 25.527 40.564 70.951 1.00 71.14  ? 564  GLN A OE1   1 
ATOM   16   N  NE2   . GLN A 1 2  ? 24.363 42.443 70.546 1.00 70.00  ? 564  GLN A NE2   1 
ATOM   17   N  N     . LYS A 1 3  ? 21.987 39.938 75.019 1.00 61.19  ? 565  LYS A N     1 
ATOM   18   C  CA    . LYS A 1 3  ? 20.836 39.048 74.911 1.00 58.02  ? 565  LYS A CA    1 
ATOM   19   C  C     . LYS A 1 3  ? 20.517 38.740 73.437 1.00 55.00  ? 565  LYS A C     1 
ATOM   20   O  O     . LYS A 1 3  ? 20.441 39.644 72.598 1.00 54.62  ? 565  LYS A O     1 
ATOM   21   C  CB    . LYS A 1 3  ? 19.627 39.643 75.641 1.00 58.80  ? 565  LYS A CB    1 
ATOM   22   C  CG    . LYS A 1 3  ? 19.928 40.089 77.077 1.00 60.64  ? 565  LYS A CG    1 
ATOM   23   C  CD    . LYS A 1 3  ? 18.976 39.463 78.101 1.00 62.05  ? 565  LYS A CD    1 
ATOM   24   C  CE    . LYS A 1 3  ? 18.632 40.442 79.229 1.00 62.36  ? 565  LYS A CE    1 
ATOM   25   N  NZ    . LYS A 1 3  ? 17.845 41.624 78.752 1.00 61.14  ? 565  LYS A NZ    1 
ATOM   26   N  N     . ILE A 1 4  ? 20.347 37.455 73.136 1.00 51.06  ? 566  ILE A N     1 
ATOM   27   C  CA    . ILE A 1 4  ? 20.168 36.974 71.764 1.00 47.31  ? 566  ILE A CA    1 
ATOM   28   C  C     . ILE A 1 4  ? 18.700 36.638 71.468 1.00 44.19  ? 566  ILE A C     1 
ATOM   29   O  O     . ILE A 1 4  ? 18.080 35.854 72.181 1.00 43.12  ? 566  ILE A O     1 
ATOM   30   C  CB    . ILE A 1 4  ? 21.100 35.740 71.519 1.00 47.92  ? 566  ILE A CB    1 
ATOM   31   C  CG1   . ILE A 1 4  ? 22.566 36.131 71.720 1.00 48.77  ? 566  ILE A CG1   1 
ATOM   32   C  CG2   . ILE A 1 4  ? 20.916 35.120 70.135 1.00 46.21  ? 566  ILE A CG2   1 
ATOM   33   C  CD1   . ILE A 1 4  ? 23.226 35.331 72.838 1.00 52.73  ? 566  ILE A CD1   1 
ATOM   34   N  N     . CYS A 1 5  ? 18.158 37.247 70.415 1.00 40.77  ? 567  CYS A N     1 
ATOM   35   C  CA    . CYS A 1 5  ? 16.845 36.885 69.885 1.00 37.46  ? 567  CYS A CA    1 
ATOM   36   C  C     . CYS A 1 5  ? 16.742 35.394 69.633 1.00 36.23  ? 567  CYS A C     1 
ATOM   37   O  O     . CYS A 1 5  ? 17.578 34.819 68.941 1.00 35.77  ? 567  CYS A O     1 
ATOM   38   C  CB    . CYS A 1 5  ? 16.589 37.612 68.570 1.00 37.03  ? 567  CYS A CB    1 
ATOM   39   S  SG    . CYS A 1 5  ? 15.019 37.149 67.805 1.00 35.07  ? 567  CYS A SG    1 
ATOM   40   N  N     . LEU A 1 6  ? 15.709 34.768 70.184 1.00 35.04  ? 568  LEU A N     1 
ATOM   41   C  CA    . LEU A 1 6  ? 15.557 33.321 70.067 1.00 34.36  ? 568  LEU A CA    1 
ATOM   42   C  C     . LEU A 1 6  ? 15.023 32.914 68.680 1.00 33.60  ? 568  LEU A C     1 
ATOM   43   O  O     . LEU A 1 6  ? 15.061 31.746 68.301 1.00 33.67  ? 568  LEU A O     1 
ATOM   44   C  CB    . LEU A 1 6  ? 14.690 32.768 71.211 1.00 33.64  ? 568  LEU A CB    1 
ATOM   45   C  CG    . LEU A 1 6  ? 15.404 32.576 72.563 1.00 33.93  ? 568  LEU A CG    1 
ATOM   46   C  CD1   . LEU A 1 6  ? 14.459 32.090 73.653 1.00 31.35  ? 568  LEU A CD1   1 
ATOM   47   C  CD2   . LEU A 1 6  ? 16.627 31.618 72.475 1.00 33.82  ? 568  LEU A CD2   1 
ATOM   48   N  N     . ILE A 1 7  ? 14.575 33.892 67.906 1.00 32.67  ? 569  ILE A N     1 
ATOM   49   C  CA    . ILE A 1 7  ? 14.024 33.614 66.593 1.00 31.90  ? 569  ILE A CA    1 
ATOM   50   C  C     . ILE A 1 7  ? 15.085 33.737 65.512 1.00 32.45  ? 569  ILE A C     1 
ATOM   51   O  O     . ILE A 1 7  ? 15.217 32.859 64.657 1.00 32.57  ? 569  ILE A O     1 
ATOM   52   C  CB    . ILE A 1 7  ? 12.840 34.561 66.280 1.00 31.91  ? 569  ILE A CB    1 
ATOM   53   C  CG1   . ILE A 1 7  ? 11.871 34.649 67.469 1.00 30.07  ? 569  ILE A CG1   1 
ATOM   54   C  CG2   . ILE A 1 7  ? 12.156 34.149 64.953 1.00 30.08  ? 569  ILE A CG2   1 
ATOM   55   C  CD1   . ILE A 1 7  ? 11.341 33.300 67.961 1.00 28.36  ? 569  ILE A CD1   1 
ATOM   56   N  N     . CYS A 1 8  ? 15.837 34.826 65.534 1.00 32.32  ? 570  CYS A N     1 
ATOM   57   C  CA    . CYS A 1 8  ? 16.751 35.078 64.436 1.00 33.80  ? 570  CYS A CA    1 
ATOM   58   C  C     . CYS A 1 8  ? 18.210 35.228 64.857 1.00 35.21  ? 570  CYS A C     1 
ATOM   59   O  O     . CYS A 1 8  ? 19.080 35.340 64.000 1.00 35.96  ? 570  CYS A O     1 
ATOM   60   C  CB    . CYS A 1 8  ? 16.323 36.326 63.683 1.00 33.33  ? 570  CYS A CB    1 
ATOM   61   S  SG    . CYS A 1 8  ? 16.739 37.795 64.637 1.00 31.59  ? 570  CYS A SG    1 
ATOM   62   N  N     . GLY A 1 9  ? 18.485 35.257 66.156 1.00 36.47  ? 571  GLY A N     1 
ATOM   63   C  CA    . GLY A 1 9  ? 19.858 35.371 66.626 1.00 38.31  ? 571  GLY A CA    1 
ATOM   64   C  C     . GLY A 1 9  ? 20.480 36.767 66.613 1.00 39.55  ? 571  GLY A C     1 
ATOM   65   O  O     . GLY A 1 9  ? 21.651 36.914 66.942 1.00 40.42  ? 571  GLY A O     1 
ATOM   66   N  N     . ASP A 1 10 ? 19.714 37.780 66.219 1.00 39.78  ? 572  ASP A N     1 
ATOM   67   C  CA    . ASP A 1 10 ? 20.108 39.175 66.372 1.00 41.03  ? 572  ASP A CA    1 
ATOM   68   C  C     . ASP A 1 10 ? 20.182 39.507 67.864 1.00 42.08  ? 572  ASP A C     1 
ATOM   69   O  O     . ASP A 1 10 ? 19.867 38.675 68.736 1.00 42.42  ? 572  ASP A O     1 
ATOM   70   C  CB    . ASP A 1 10 ? 19.064 40.072 65.675 1.00 41.83  ? 572  ASP A CB    1 
ATOM   71   C  CG    . ASP A 1 10 ? 19.526 41.523 65.485 1.00 43.25  ? 572  ASP A CG    1 
ATOM   72   O  OD1   . ASP A 1 10 ? 20.640 41.868 65.922 1.00 44.03  ? 572  ASP A OD1   1 
ATOM   73   O  OD2   . ASP A 1 10 ? 18.825 42.394 64.911 1.00 42.87  ? 572  ASP A OD2   1 
ATOM   74   N  N     . GLU A 1 11 ? 20.597 40.728 68.170 1.00 42.56  ? 573  GLU A N     1 
ATOM   75   C  CA    . GLU A 1 11 ? 20.559 41.197 69.540 1.00 43.49  ? 573  GLU A CA    1 
ATOM   76   C  C     . GLU A 1 11 ? 19.103 41.367 69.970 1.00 42.12  ? 573  GLU A C     1 
ATOM   77   O  O     . GLU A 1 11 ? 18.316 42.010 69.269 1.00 41.01  ? 573  GLU A O     1 
ATOM   78   C  CB    . GLU A 1 11 ? 21.291 42.529 69.668 1.00 44.75  ? 573  GLU A CB    1 
ATOM   79   C  CG    . GLU A 1 11 ? 21.123 43.139 71.048 1.00 49.97  ? 573  GLU A CG    1 
ATOM   80   C  CD    . GLU A 1 11 ? 21.666 44.541 71.143 1.00 54.00  ? 573  GLU A CD    1 
ATOM   81   O  OE1   . GLU A 1 11 ? 20.847 45.473 71.304 1.00 57.93  ? 573  GLU A OE1   1 
ATOM   82   O  OE2   . GLU A 1 11 ? 22.902 44.702 71.075 1.00 54.64  ? 573  GLU A OE2   1 
ATOM   83   N  N     . ALA A 1 12 ? 18.756 40.803 71.121 1.00 40.86  ? 574  ALA A N     1 
ATOM   84   C  CA    . ALA A 1 12 ? 17.394 40.916 71.631 1.00 41.17  ? 574  ALA A CA    1 
ATOM   85   C  C     . ALA A 1 12 ? 17.181 42.208 72.432 1.00 41.09  ? 574  ALA A C     1 
ATOM   86   O  O     . ALA A 1 12 ? 18.082 42.660 73.130 1.00 40.71  ? 574  ALA A O     1 
ATOM   87   C  CB    . ALA A 1 12 ? 17.037 39.712 72.453 1.00 39.98  ? 574  ALA A CB    1 
ATOM   88   N  N     . SER A 1 13 ? 15.986 42.790 72.320 1.00 41.27  ? 575  SER A N     1 
ATOM   89   C  CA    . SER A 1 13 ? 15.670 44.045 72.996 1.00 41.30  ? 575  SER A CA    1 
ATOM   90   C  C     . SER A 1 13 ? 14.905 43.837 74.293 1.00 41.45  ? 575  SER A C     1 
ATOM   91   O  O     . SER A 1 13 ? 15.025 44.630 75.233 1.00 42.78  ? 575  SER A O     1 
ATOM   92   C  CB    . SER A 1 13 ? 14.892 44.990 72.078 1.00 40.29  ? 575  SER A CB    1 
ATOM   93   O  OG    . SER A 1 13 ? 13.696 44.392 71.628 1.00 40.67  ? 575  SER A OG    1 
ATOM   94   N  N     . GLY A 1 14 ? 14.105 42.783 74.339 1.00 41.23  ? 576  GLY A N     1 
ATOM   95   C  CA    . GLY A 1 14 ? 13.340 42.484 75.534 1.00 40.34  ? 576  GLY A CA    1 
ATOM   96   C  C     . GLY A 1 14 ? 12.645 41.146 75.438 1.00 40.52  ? 576  GLY A C     1 
ATOM   97   O  O     . GLY A 1 14 ? 12.931 40.337 74.545 1.00 40.65  ? 576  GLY A O     1 
ATOM   98   N  N     . CYS A 1 15 ? 11.733 40.906 76.370 1.00 40.47  ? 577  CYS A N     1 
ATOM   99   C  CA    . CYS A 1 15 ? 10.878 39.731 76.315 1.00 40.49  ? 577  CYS A CA    1 
ATOM   100  C  C     . CYS A 1 15 ? 9.547  40.142 75.667 1.00 39.38  ? 577  CYS A C     1 
ATOM   101  O  O     . CYS A 1 15 ? 8.763  40.890 76.253 1.00 38.49  ? 577  CYS A O     1 
ATOM   102  C  CB    . CYS A 1 15 ? 10.706 39.158 77.717 1.00 40.38  ? 577  CYS A CB    1 
ATOM   103  S  SG    . CYS A 1 15 ? 9.614  37.732 77.838 1.00 45.51  ? 577  CYS A SG    1 
ATOM   104  N  N     . HIS A 1 16 ? 9.313  39.689 74.437 1.00 38.46  ? 578  HIS A N     1 
ATOM   105  C  CA    . HIS A 1 16 ? 8.125  40.121 73.691 1.00 38.52  ? 578  HIS A CA    1 
ATOM   106  C  C     . HIS A 1 16 ? 7.196  38.969 73.360 1.00 38.09  ? 578  HIS A C     1 
ATOM   107  O  O     . HIS A 1 16 ? 7.644  37.909 72.909 1.00 38.65  ? 578  HIS A O     1 
ATOM   108  C  CB    . HIS A 1 16 ? 8.512  40.838 72.402 1.00 38.13  ? 578  HIS A CB    1 
ATOM   109  C  CG    . HIS A 1 16 ? 9.518  41.928 72.597 1.00 38.91  ? 578  HIS A CG    1 
ATOM   110  N  ND1   . HIS A 1 16 ? 9.204  43.135 73.184 1.00 38.42  ? 578  HIS A ND1   1 
ATOM   111  C  CD2   . HIS A 1 16 ? 10.831 41.998 72.270 1.00 38.73  ? 578  HIS A CD2   1 
ATOM   112  C  CE1   . HIS A 1 16 ? 10.279 43.904 73.204 1.00 39.21  ? 578  HIS A CE1   1 
ATOM   113  N  NE2   . HIS A 1 16 ? 11.280 43.237 72.658 1.00 39.08  ? 578  HIS A NE2   1 
ATOM   114  N  N     . TYR A 1 17 ? 5.902  39.200 73.570 1.00 37.50  ? 579  TYR A N     1 
ATOM   115  C  CA    . TYR A 1 17 ? 4.864  38.166 73.459 1.00 37.38  ? 579  TYR A CA    1 
ATOM   116  C  C     . TYR A 1 17 ? 5.269  36.847 74.093 1.00 37.83  ? 579  TYR A C     1 
ATOM   117  O  O     . TYR A 1 17 ? 4.876  35.782 73.617 1.00 39.16  ? 579  TYR A O     1 
ATOM   118  C  CB    . TYR A 1 17 ? 4.438  37.968 71.999 1.00 36.03  ? 579  TYR A CB    1 
ATOM   119  C  CG    . TYR A 1 17 ? 3.989  39.258 71.380 1.00 35.42  ? 579  TYR A CG    1 
ATOM   120  C  CD1   . TYR A 1 17 ? 4.786  39.897 70.433 1.00 34.88  ? 579  TYR A CD1   1 
ATOM   121  C  CD2   . TYR A 1 17 ? 2.784  39.869 71.768 1.00 33.61  ? 579  TYR A CD2   1 
ATOM   122  C  CE1   . TYR A 1 17 ? 4.402  41.099 69.861 1.00 34.21  ? 579  TYR A CE1   1 
ATOM   123  C  CE2   . TYR A 1 17 ? 2.380  41.085 71.198 1.00 33.80  ? 579  TYR A CE2   1 
ATOM   124  C  CZ    . TYR A 1 17 ? 3.205  41.695 70.249 1.00 35.06  ? 579  TYR A CZ    1 
ATOM   125  O  OH    . TYR A 1 17 ? 2.859  42.887 69.655 1.00 35.71  ? 579  TYR A OH    1 
ATOM   126  N  N     . GLY A 1 18 ? 6.099  36.924 75.134 1.00 38.07  ? 580  GLY A N     1 
ATOM   127  C  CA    . GLY A 1 18 ? 6.464  35.761 75.916 1.00 37.05  ? 580  GLY A CA    1 
ATOM   128  C  C     . GLY A 1 18 ? 7.841  35.172 75.698 1.00 37.12  ? 580  GLY A C     1 
ATOM   129  O  O     . GLY A 1 18 ? 8.236  34.293 76.467 1.00 37.80  ? 580  GLY A O     1 
ATOM   130  N  N     . VAL A 1 19 ? 8.572  35.600 74.667 1.00 36.30  ? 581  VAL A N     1 
ATOM   131  C  CA    . VAL A 1 19 ? 9.946  35.099 74.489 1.00 35.30  ? 581  VAL A CA    1 
ATOM   132  C  C     . VAL A 1 19 ? 10.985 36.198 74.236 1.00 34.99  ? 581  VAL A C     1 
ATOM   133  O  O     . VAL A 1 19 ? 10.637 37.329 73.907 1.00 35.17  ? 581  VAL A O     1 
ATOM   134  C  CB    . VAL A 1 19 ? 10.064 33.863 73.503 1.00 35.85  ? 581  VAL A CB    1 
ATOM   135  C  CG1   . VAL A 1 19 ? 8.721  33.362 73.040 1.00 34.94  ? 581  VAL A CG1   1 
ATOM   136  C  CG2   . VAL A 1 19 ? 10.991 34.111 72.323 1.00 34.85  ? 581  VAL A CG2   1 
ATOM   137  N  N     . LEU A 1 20 ? 12.252 35.859 74.457 1.00 34.55  ? 582  LEU A N     1 
ATOM   138  C  CA    . LEU A 1 20 ? 13.381 36.754 74.192 1.00 34.19  ? 582  LEU A CA    1 
ATOM   139  C  C     . LEU A 1 20 ? 13.510 37.013 72.694 1.00 33.65  ? 582  LEU A C     1 
ATOM   140  O  O     . LEU A 1 20 ? 13.940 36.120 71.953 1.00 33.21  ? 582  LEU A O     1 
ATOM   141  C  CB    . LEU A 1 20 ? 14.683 36.134 74.720 1.00 33.74  ? 582  LEU A CB    1 
ATOM   142  C  CG    . LEU A 1 20 ? 15.619 36.899 75.673 1.00 35.03  ? 582  LEU A CG    1 
ATOM   143  C  CD1   . LEU A 1 20 ? 17.069 36.513 75.415 1.00 34.36  ? 582  LEU A CD1   1 
ATOM   144  C  CD2   . LEU A 1 20 ? 15.483 38.410 75.567 1.00 35.74  ? 582  LEU A CD2   1 
ATOM   145  N  N     . THR A 1 21 ? 13.108 38.206 72.243 1.00 32.67  ? 583  THR A N     1 
ATOM   146  C  CA    . THR A 1 21 ? 13.316 38.581 70.843 1.00 32.79  ? 583  THR A CA    1 
ATOM   147  C  C     . THR A 1 21 ? 13.916 39.959 70.592 1.00 33.39  ? 583  THR A C     1 
ATOM   148  O  O     . THR A 1 21 ? 13.964 40.814 71.470 1.00 34.89  ? 583  THR A O     1 
ATOM   149  C  CB    . THR A 1 21 ? 12.031 38.415 69.963 1.00 33.02  ? 583  THR A CB    1 
ATOM   150  O  OG1   . THR A 1 21 ? 11.177 39.574 70.077 1.00 32.80  ? 583  THR A OG1   1 
ATOM   151  C  CG2   . THR A 1 21 ? 11.185 37.235 70.399 1.00 31.55  ? 583  THR A CG2   1 
ATOM   152  N  N     . CYS A 1 22 ? 14.378 40.144 69.363 1.00 33.29  ? 584  CYS A N     1 
ATOM   153  C  CA    . CYS A 1 22 ? 14.681 41.447 68.817 1.00 33.72  ? 584  CYS A CA    1 
ATOM   154  C  C     . CYS A 1 22 ? 13.381 42.161 68.425 1.00 34.26  ? 584  CYS A C     1 
ATOM   155  O  O     . CYS A 1 22 ? 12.312 41.542 68.324 1.00 34.28  ? 584  CYS A O     1 
ATOM   156  C  CB    . CYS A 1 22 ? 15.570 41.280 67.583 1.00 33.31  ? 584  CYS A CB    1 
ATOM   157  S  SG    . CYS A 1 22 ? 14.660 40.741 66.127 1.00 32.51  ? 584  CYS A SG    1 
ATOM   158  N  N     . GLY A 1 23 ? 13.476 43.467 68.190 1.00 34.47  ? 585  GLY A N     1 
ATOM   159  C  CA    . GLY A 1 23 ? 12.305 44.254 67.846 1.00 33.65  ? 585  GLY A CA    1 
ATOM   160  C  C     . GLY A 1 23 ? 11.740 43.940 66.471 1.00 33.55  ? 585  GLY A C     1 
ATOM   161  O  O     . GLY A 1 23 ? 10.562 44.155 66.231 1.00 34.01  ? 585  GLY A O     1 
ATOM   162  N  N     . SER A 1 24 ? 12.565 43.435 65.559 1.00 33.39  ? 586  SER A N     1 
ATOM   163  C  CA    . SER A 1 24 ? 12.086 43.146 64.207 1.00 32.54  ? 586  SER A CA    1 
ATOM   164  C  C     . SER A 1 24 ? 11.195 41.908 64.205 1.00 32.66  ? 586  SER A C     1 
ATOM   165  O  O     . SER A 1 24 ? 10.126 41.903 63.567 1.00 33.48  ? 586  SER A O     1 
ATOM   166  C  CB    . SER A 1 24 ? 13.241 42.983 63.226 1.00 32.48  ? 586  SER A CB    1 
ATOM   167  O  OG    . SER A 1 24 ? 13.966 41.799 63.499 1.00 31.76  ? 586  SER A OG    1 
ATOM   168  N  N     . CYS A 1 25 ? 11.615 40.877 64.934 1.00 31.17  ? 587  CYS A N     1 
ATOM   169  C  CA    . CYS A 1 25 ? 10.793 39.683 65.101 1.00 31.63  ? 587  CYS A CA    1 
ATOM   170  C  C     . CYS A 1 25 ? 9.513  39.970 65.886 1.00 31.35  ? 587  CYS A C     1 
ATOM   171  O  O     . CYS A 1 25 ? 8.439  39.469 65.544 1.00 31.67  ? 587  CYS A O     1 
ATOM   172  C  CB    . CYS A 1 25 ? 11.595 38.563 65.745 1.00 31.43  ? 587  CYS A CB    1 
ATOM   173  S  SG    . CYS A 1 25 ? 12.931 38.020 64.677 1.00 31.31  ? 587  CYS A SG    1 
ATOM   174  N  N     . LYS A 1 26 ? 9.639  40.793 66.920 1.00 31.94  ? 588  LYS A N     1 
ATOM   175  C  CA    . LYS A 1 26 ? 8.486  41.276 67.679 1.00 32.40  ? 588  LYS A CA    1 
ATOM   176  C  C     . LYS A 1 26 ? 7.371  41.784 66.783 1.00 31.74  ? 588  LYS A C     1 
ATOM   177  O  O     . LYS A 1 26 ? 6.265  41.271 66.887 1.00 31.17  ? 588  LYS A O     1 
ATOM   178  C  CB    . LYS A 1 26 ? 8.876  42.383 68.666 1.00 33.20  ? 588  LYS A CB    1 
ATOM   179  C  CG    . LYS A 1 26 ? 7.685  42.927 69.442 1.00 34.99  ? 588  LYS A CG    1 
ATOM   180  C  CD    . LYS A 1 26 ? 7.833  44.396 69.809 1.00 38.50  ? 588  LYS A CD    1 
ATOM   181  C  CE    . LYS A 1 26 ? 6.460  45.019 70.050 1.00 39.19  ? 588  LYS A CE    1 
ATOM   182  N  NZ    . LYS A 1 26 ? 6.407  46.442 69.617 1.00 39.14  ? 588  LYS A NZ    1 
ATOM   183  N  N     . VAL A 1 27 ? 7.643  42.790 65.934 1.00 30.83  ? 589  VAL A N     1 
ATOM   184  C  CA    . VAL A 1 27 ? 6.601  43.330 65.039 1.00 30.53  ? 589  VAL A CA    1 
ATOM   185  C  C     . VAL A 1 27 ? 6.234  42.352 63.937 1.00 30.73  ? 589  VAL A C     1 
ATOM   186  O  O     . VAL A 1 27 ? 5.073  42.297 63.511 1.00 31.39  ? 589  VAL A O     1 
ATOM   187  C  CB    . VAL A 1 27 ? 6.996  44.605 64.247 1.00 30.33  ? 589  VAL A CB    1 
ATOM   188  C  CG1   . VAL A 1 27 ? 6.117  45.764 64.599 1.00 33.11  ? 589  VAL A CG1   1 
ATOM   189  C  CG2   . VAL A 1 27 ? 8.432  44.922 64.362 1.00 31.01  ? 589  VAL A CG2   1 
ATOM   190  N  N     . PHE A 1 28 ? 7.234  41.629 63.427 1.00 30.27  ? 590  PHE A N     1 
ATOM   191  C  CA    . PHE A 1 28 ? 6.973  40.688 62.361 1.00 29.18  ? 590  PHE A CA    1 
ATOM   192  C  C     . PHE A 1 28 ? 5.877  39.753 62.846 1.00 29.92  ? 590  PHE A C     1 
ATOM   193  O  O     . PHE A 1 28 ? 4.901  39.485 62.120 1.00 29.08  ? 590  PHE A O     1 
ATOM   194  C  CB    . PHE A 1 28 ? 8.192  39.846 61.986 1.00 28.00  ? 590  PHE A CB    1 
ATOM   195  C  CG    . PHE A 1 28 ? 7.819  38.630 61.207 1.00 26.21  ? 590  PHE A CG    1 
ATOM   196  C  CD1   . PHE A 1 28 ? 7.549  38.734 59.844 1.00 23.28  ? 590  PHE A CD1   1 
ATOM   197  C  CD2   . PHE A 1 28 ? 7.619  37.409 61.853 1.00 24.29  ? 590  PHE A CD2   1 
ATOM   198  C  CE1   . PHE A 1 28 ? 7.128  37.643 59.115 1.00 22.14  ? 590  PHE A CE1   1 
ATOM   199  C  CE2   . PHE A 1 28 ? 7.213  36.302 61.132 1.00 24.97  ? 590  PHE A CE2   1 
ATOM   200  C  CZ    . PHE A 1 28 ? 6.966  36.419 59.749 1.00 24.66  ? 590  PHE A CZ    1 
ATOM   201  N  N     . PHE A 1 29 ? 6.053  39.269 64.080 1.00 30.32  ? 591  PHE A N     1 
ATOM   202  C  CA    . PHE A 1 29 ? 5.138  38.281 64.650 1.00 30.61  ? 591  PHE A CA    1 
ATOM   203  C  C     . PHE A 1 29 ? 3.713  38.832 64.709 1.00 30.33  ? 591  PHE A C     1 
ATOM   204  O  O     . PHE A 1 29 ? 2.792  38.169 64.262 1.00 30.31  ? 591  PHE A O     1 
ATOM   205  C  CB    . PHE A 1 29 ? 5.620  37.773 66.017 1.00 29.54  ? 591  PHE A CB    1 
ATOM   206  C  CG    . PHE A 1 29 ? 4.589  36.977 66.748 1.00 29.90  ? 591  PHE A CG    1 
ATOM   207  C  CD1   . PHE A 1 29 ? 4.323  35.652 66.382 1.00 29.51  ? 591  PHE A CD1   1 
ATOM   208  C  CD2   . PHE A 1 29 ? 3.834  37.557 67.764 1.00 28.71  ? 591  PHE A CD2   1 
ATOM   209  C  CE1   . PHE A 1 29 ? 3.335  34.906 67.041 1.00 27.42  ? 591  PHE A CE1   1 
ATOM   210  C  CE2   . PHE A 1 29 ? 2.842  36.807 68.435 1.00 28.98  ? 591  PHE A CE2   1 
ATOM   211  C  CZ    . PHE A 1 29 ? 2.595  35.482 68.071 1.00 26.43  ? 591  PHE A CZ    1 
ATOM   212  N  N     . LYS A 1 30 ? 3.556  40.056 65.216 1.00 30.88  ? 592  LYS A N     1 
ATOM   213  C  CA    . LYS A 1 30 ? 2.248  40.708 65.296 1.00 31.51  ? 592  LYS A CA    1 
ATOM   214  C  C     . LYS A 1 30 ? 1.648  41.010 63.925 1.00 30.57  ? 592  LYS A C     1 
ATOM   215  O  O     . LYS A 1 30 ? 0.486  40.708 63.691 1.00 30.04  ? 592  LYS A O     1 
ATOM   216  C  CB    . LYS A 1 30 ? 2.300  41.985 66.155 1.00 33.27  ? 592  LYS A CB    1 
ATOM   217  C  CG    . LYS A 1 30 ? 0.991  42.804 66.177 1.00 34.80  ? 592  LYS A CG    1 
ATOM   218  C  CD    . LYS A 1 30 ? 0.449  43.001 67.595 1.00 39.65  ? 592  LYS A CD    1 
ATOM   219  C  CE    . LYS A 1 30 ? -0.915 43.753 67.636 1.00 42.41  ? 592  LYS A CE    1 
ATOM   220  N  NZ    . LYS A 1 30 ? -0.897 45.130 66.998 1.00 43.18  ? 592  LYS A NZ    1 
ATOM   221  N  N     . ARG A 1 31 ? 2.428  41.601 63.023 1.00 29.52  ? 593  ARG A N     1 
ATOM   222  C  CA    . ARG A 1 31 ? 1.939  41.791 61.662 1.00 29.39  ? 593  ARG A CA    1 
ATOM   223  C  C     . ARG A 1 31 ? 1.516  40.473 61.002 1.00 28.57  ? 593  ARG A C     1 
ATOM   224  O  O     . ARG A 1 31 ? 0.469  40.406 60.371 1.00 28.75  ? 593  ARG A O     1 
ATOM   225  C  CB    . ARG A 1 31 ? 2.964  42.523 60.795 1.00 29.50  ? 593  ARG A CB    1 
ATOM   226  C  CG    . ARG A 1 31 ? 3.303  43.900 61.308 1.00 28.25  ? 593  ARG A CG    1 
ATOM   227  C  CD    . ARG A 1 31 ? 4.410  44.559 60.547 1.00 28.87  ? 593  ARG A CD    1 
ATOM   228  N  NE    . ARG A 1 31 ? 4.461  45.995 60.817 1.00 31.08  ? 593  ARG A NE    1 
ATOM   229  C  CZ    . ARG A 1 31 ? 5.570  46.728 60.780 1.00 34.12  ? 593  ARG A CZ    1 
ATOM   230  N  NH1   . ARG A 1 31 ? 6.753  46.180 60.475 1.00 33.19  ? 593  ARG A NH1   1 
ATOM   231  N  NH2   . ARG A 1 31 ? 5.502  48.025 61.052 1.00 35.63  ? 593  ARG A NH2   1 
ATOM   232  N  N     . ALA A 1 32 ? 2.312  39.425 61.172 1.00 28.51  ? 594  ALA A N     1 
ATOM   233  C  CA    . ALA A 1 32 ? 2.044  38.161 60.513 1.00 28.57  ? 594  ALA A CA    1 
ATOM   234  C  C     . ALA A 1 32 ? 0.758  37.550 61.014 1.00 29.61  ? 594  ALA A C     1 
ATOM   235  O  O     . ALA A 1 32 ? -0.070 37.112 60.223 1.00 28.86  ? 594  ALA A O     1 
ATOM   236  C  CB    . ALA A 1 32 ? 3.198  37.205 60.710 1.00 28.87  ? 594  ALA A CB    1 
ATOM   237  N  N     . MET A 1 33 ? 0.583  37.549 62.332 1.00 31.69  ? 595  MET A N     1 
ATOM   238  C  CA    . MET A 1 33 ? -0.588 36.947 62.951 1.00 33.64  ? 595  MET A CA    1 
ATOM   239  C  C     . MET A 1 33 ? -1.866 37.715 62.657 1.00 35.33  ? 595  MET A C     1 
ATOM   240  O  O     . MET A 1 33 ? -2.952 37.128 62.627 1.00 36.07  ? 595  MET A O     1 
ATOM   241  C  CB    . MET A 1 33 ? -0.395 36.827 64.455 1.00 33.48  ? 595  MET A CB    1 
ATOM   242  C  CG    . MET A 1 33 ? 0.601  35.770 64.853 1.00 34.58  ? 595  MET A CG    1 
ATOM   243  S  SD    . MET A 1 33 ? 0.090  34.132 64.386 1.00 37.85  ? 595  MET A SD    1 
ATOM   244  C  CE    . MET A 1 33 ? -0.999 33.702 65.762 1.00 33.48  ? 595  MET A CE    1 
ATOM   245  N  N     . GLU A 1 34 ? -1.738 39.016 62.432 1.00 36.41  ? 596  GLU A N     1 
ATOM   246  C  CA    . GLU A 1 34 ? -2.901 39.861 62.196 1.00 39.47  ? 596  GLU A CA    1 
ATOM   247  C  C     . GLU A 1 34 ? -3.173 40.157 60.725 1.00 39.50  ? 596  GLU A C     1 
ATOM   248  O  O     . GLU A 1 34 ? -4.266 40.616 60.376 1.00 39.84  ? 596  GLU A O     1 
ATOM   249  C  CB    . GLU A 1 34 ? -2.759 41.175 62.961 1.00 40.73  ? 596  GLU A CB    1 
ATOM   250  C  CG    . GLU A 1 34 ? -3.648 41.223 64.189 1.00 45.77  ? 596  GLU A CG    1 
ATOM   251  C  CD    . GLU A 1 34 ? -3.026 42.007 65.316 1.00 50.85  ? 596  GLU A CD    1 
ATOM   252  O  OE1   . GLU A 1 34 ? -2.302 43.001 65.024 1.00 51.89  ? 596  GLU A OE1   1 
ATOM   253  O  OE2   . GLU A 1 34 ? -3.267 41.616 66.486 1.00 53.34  ? 596  GLU A OE2   1 
ATOM   254  N  N     . GLY A 1 35 ? -2.189 39.893 59.867 1.00 38.97  ? 597  GLY A N     1 
ATOM   255  C  CA    . GLY A 1 35 ? -2.318 40.184 58.455 1.00 38.68  ? 597  GLY A CA    1 
ATOM   256  C  C     . GLY A 1 35 ? -3.242 39.226 57.737 1.00 38.85  ? 597  GLY A C     1 
ATOM   257  O  O     . GLY A 1 35 ? -3.777 38.294 58.322 1.00 38.29  ? 597  GLY A O     1 
ATOM   258  N  N     . GLN A 1 36 ? -3.418 39.457 56.448 1.00 39.80  ? 598  GLN A N     1 
ATOM   259  C  CA    . GLN A 1 36 ? -4.310 38.636 55.649 1.00 40.90  ? 598  GLN A CA    1 
ATOM   260  C  C     . GLN A 1 36 ? -3.583 37.455 54.986 1.00 39.81  ? 598  GLN A C     1 
ATOM   261  O  O     . GLN A 1 36 ? -4.183 36.747 54.185 1.00 39.45  ? 598  GLN A O     1 
ATOM   262  C  CB    . GLN A 1 36 ? -5.030 39.497 54.588 1.00 42.19  ? 598  GLN A CB    1 
ATOM   263  C  CG    . GLN A 1 36 ? -6.070 40.536 55.103 1.00 47.50  ? 598  GLN A CG    1 
ATOM   264  C  CD    . GLN A 1 36 ? -6.861 40.090 56.351 1.00 52.50  ? 598  GLN A CD    1 
ATOM   265  O  OE1   . GLN A 1 36 ? -7.696 39.177 56.278 1.00 56.36  ? 598  GLN A OE1   1 
ATOM   266  N  NE2   . GLN A 1 36 ? -6.605 40.746 57.490 1.00 53.68  ? 598  GLN A NE2   1 
ATOM   267  N  N     . HIS A 1 37 ? -2.314 37.223 55.322 1.00 38.91  ? 599  HIS A N     1 
ATOM   268  C  CA    . HIS A 1 37 ? -1.502 36.254 54.563 1.00 37.85  ? 599  HIS A CA    1 
ATOM   269  C  C     . HIS A 1 37 ? -1.083 35.025 55.359 1.00 36.91  ? 599  HIS A C     1 
ATOM   270  O  O     . HIS A 1 37 ? -0.423 35.130 56.405 1.00 38.44  ? 599  HIS A O     1 
ATOM   271  C  CB    . HIS A 1 37 ? -0.242 36.931 54.015 1.00 38.46  ? 599  HIS A CB    1 
ATOM   272  C  CG    . HIS A 1 37 ? -0.504 37.912 52.914 1.00 40.79  ? 599  HIS A CG    1 
ATOM   273  N  ND1   . HIS A 1 37 ? -0.368 39.274 53.082 1.00 41.91  ? 599  HIS A ND1   1 
ATOM   274  C  CD2   . HIS A 1 37 ? -0.877 37.728 51.623 1.00 41.16  ? 599  HIS A CD2   1 
ATOM   275  C  CE1   . HIS A 1 37 ? -0.645 39.884 51.941 1.00 43.72  ? 599  HIS A CE1   1 
ATOM   276  N  NE2   . HIS A 1 37 ? -0.960 38.968 51.041 1.00 40.00  ? 599  HIS A NE2   1 
ATOM   277  N  N     . ASN A 1 38 ? -1.452 33.850 54.872 1.00 35.10  ? 600  ASN A N     1 
ATOM   278  C  CA    . ASN A 1 38 ? -0.915 32.631 55.448 1.00 33.31  ? 600  ASN A CA    1 
ATOM   279  C  C     . ASN A 1 38 ? 0.225  32.249 54.531 1.00 32.55  ? 600  ASN A C     1 
ATOM   280  O  O     . ASN A 1 38 ? 0.005  31.774 53.410 1.00 32.33  ? 600  ASN A O     1 
ATOM   281  C  CB    . ASN A 1 38 ? -1.982 31.543 55.547 1.00 33.31  ? 600  ASN A CB    1 
ATOM   282  C  CG    . ASN A 1 38 ? -1.446 30.211 56.109 1.00 34.40  ? 600  ASN A CG    1 
ATOM   283  O  OD1   . ASN A 1 38 ? -0.447 30.163 56.839 1.00 33.17  ? 600  ASN A OD1   1 
ATOM   284  N  ND2   . ASN A 1 38 ? -2.134 29.120 55.770 1.00 33.39  ? 600  ASN A ND2   1 
ATOM   285  N  N     . TYR A 1 39 ? 1.438  32.507 55.001 1.00 30.61  ? 601  TYR A N     1 
ATOM   286  C  CA    . TYR A 1 39 ? 2.618  32.429 54.162 1.00 30.38  ? 601  TYR A CA    1 
ATOM   287  C  C     . TYR A 1 39 ? 2.889  30.987 53.799 1.00 30.21  ? 601  TYR A C     1 
ATOM   288  O  O     . TYR A 1 39 ? 2.741  30.107 54.642 1.00 30.08  ? 601  TYR A O     1 
ATOM   289  C  CB    . TYR A 1 39 ? 3.834  32.999 54.896 1.00 30.34  ? 601  TYR A CB    1 
ATOM   290  C  CG    . TYR A 1 39 ? 3.735  34.441 55.332 1.00 29.05  ? 601  TYR A CG    1 
ATOM   291  C  CD1   . TYR A 1 39 ? 3.703  35.480 54.391 1.00 29.86  ? 601  TYR A CD1   1 
ATOM   292  C  CD2   . TYR A 1 39 ? 3.706  34.771 56.687 1.00 30.93  ? 601  TYR A CD2   1 
ATOM   293  C  CE1   . TYR A 1 39 ? 3.630  36.814 54.785 1.00 30.49  ? 601  TYR A CE1   1 
ATOM   294  C  CE2   . TYR A 1 39 ? 3.628  36.104 57.107 1.00 33.02  ? 601  TYR A CE2   1 
ATOM   295  C  CZ    . TYR A 1 39 ? 3.599  37.119 56.145 1.00 34.08  ? 601  TYR A CZ    1 
ATOM   296  O  OH    . TYR A 1 39 ? 3.537  38.432 56.549 1.00 37.06  ? 601  TYR A OH    1 
ATOM   297  N  N     . LEU A 1 40 ? 3.272  30.747 52.545 1.00 29.89  ? 602  LEU A N     1 
ATOM   298  C  CA    . LEU A 1 40 ? 3.629  29.409 52.091 1.00 29.35  ? 602  LEU A CA    1 
ATOM   299  C  C     . LEU A 1 40 ? 5.139  29.339 51.887 1.00 29.63  ? 602  LEU A C     1 
ATOM   300  O  O     . LEU A 1 40 ? 5.693  30.038 51.028 1.00 29.87  ? 602  LEU A O     1 
ATOM   301  C  CB    . LEU A 1 40 ? 2.904  29.072 50.776 1.00 29.64  ? 602  LEU A CB    1 
ATOM   302  C  CG    . LEU A 1 40 ? 2.309  27.667 50.493 1.00 29.09  ? 602  LEU A CG    1 
ATOM   303  C  CD1   . LEU A 1 40 ? 2.463  27.264 49.037 1.00 28.56  ? 602  LEU A CD1   1 
ATOM   304  C  CD2   . LEU A 1 40 ? 2.831  26.564 51.382 1.00 27.35  ? 602  LEU A CD2   1 
ATOM   305  N  N     . CYS A 1 41 ? 5.812  28.508 52.677 1.00 29.46  ? 603  CYS A N     1 
ATOM   306  C  CA    . CYS A 1 41 ? 7.256  28.320 52.528 1.00 28.24  ? 603  CYS A CA    1 
ATOM   307  C  C     . CYS A 1 41 ? 7.546  27.759 51.137 1.00 29.04  ? 603  CYS A C     1 
ATOM   308  O  O     . CYS A 1 41 ? 7.009  26.711 50.762 1.00 28.94  ? 603  CYS A O     1 
ATOM   309  C  CB    . CYS A 1 41 ? 7.781  27.353 53.590 1.00 27.70  ? 603  CYS A CB    1 
ATOM   310  S  SG    . CYS A 1 41 ? 9.520  26.892 53.346 1.00 27.12  ? 603  CYS A SG    1 
ATOM   311  N  N     . ALA A 1 42 ? 8.390  28.445 50.365 1.00 29.16  ? 604  ALA A N     1 
ATOM   312  C  CA    . ALA A 1 42 ? 8.740  27.964 49.023 1.00 28.58  ? 604  ALA A CA    1 
ATOM   313  C  C     . ALA A 1 42 ? 9.766  26.799 49.031 1.00 29.16  ? 604  ALA A C     1 
ATOM   314  O  O     . ALA A 1 42 ? 10.017 26.170 47.988 1.00 30.04  ? 604  ALA A O     1 
ATOM   315  C  CB    . ALA A 1 42 ? 9.210  29.104 48.152 1.00 26.87  ? 604  ALA A CB    1 
ATOM   316  N  N     . GLY A 1 43 ? 10.355 26.520 50.196 1.00 28.57  ? 605  GLY A N     1 
ATOM   317  C  CA    . GLY A 1 43 ? 11.279 25.407 50.348 1.00 27.93  ? 605  GLY A CA    1 
ATOM   318  C  C     . GLY A 1 43 ? 10.586 24.196 50.955 1.00 28.37  ? 605  GLY A C     1 
ATOM   319  O  O     . GLY A 1 43 ? 9.646  23.655 50.364 1.00 27.32  ? 605  GLY A O     1 
ATOM   320  N  N     . ARG A 1 44 ? 11.035 23.787 52.142 1.00 28.07  ? 606  ARG A N     1 
ATOM   321  C  CA    . ARG A 1 44 ? 10.490 22.606 52.816 1.00 29.00  ? 606  ARG A CA    1 
ATOM   322  C  C     . ARG A 1 44 ? 10.040 22.825 54.242 1.00 28.49  ? 606  ARG A C     1 
ATOM   323  O  O     . ARG A 1 44 ? 10.066 21.886 55.020 1.00 28.51  ? 606  ARG A O     1 
ATOM   324  C  CB    . ARG A 1 44 ? 11.541 21.496 52.884 1.00 29.49  ? 606  ARG A CB    1 
ATOM   325  C  CG    . ARG A 1 44 ? 11.986 20.944 51.558 1.00 34.36  ? 606  ARG A CG    1 
ATOM   326  C  CD    . ARG A 1 44 ? 12.996 19.814 51.691 1.00 38.12  ? 606  ARG A CD    1 
ATOM   327  N  NE    . ARG A 1 44 ? 13.870 19.763 50.524 1.00 40.45  ? 606  ARG A NE    1 
ATOM   328  C  CZ    . ARG A 1 44 ? 14.618 18.723 50.196 1.00 42.14  ? 606  ARG A CZ    1 
ATOM   329  N  NH1   . ARG A 1 44 ? 14.618 17.629 50.947 1.00 41.85  ? 606  ARG A NH1   1 
ATOM   330  N  NH2   . ARG A 1 44 ? 15.386 18.784 49.118 1.00 43.58  ? 606  ARG A NH2   1 
ATOM   331  N  N     . ASN A 1 45 ? 9.663  24.045 54.607 1.00 29.01  ? 607  ASN A N     1 
ATOM   332  C  CA    . ASN A 1 45 ? 9.261  24.355 56.002 1.00 29.60  ? 607  ASN A CA    1 
ATOM   333  C  C     . ASN A 1 45 ? 10.355 24.148 57.042 1.00 29.17  ? 607  ASN A C     1 
ATOM   334  O  O     . ASN A 1 45 ? 10.079 23.857 58.206 1.00 29.08  ? 607  ASN A O     1 
ATOM   335  C  CB    . ASN A 1 45 ? 7.993  23.594 56.384 1.00 28.36  ? 607  ASN A CB    1 
ATOM   336  C  CG    . ASN A 1 45 ? 6.791  24.115 55.646 1.00 28.04  ? 607  ASN A CG    1 
ATOM   337  O  OD1   . ASN A 1 45 ? 6.422  25.281 55.790 1.00 27.64  ? 607  ASN A OD1   1 
ATOM   338  N  ND2   . ASN A 1 45 ? 6.191  23.272 54.826 1.00 26.82  ? 607  ASN A ND2   1 
ATOM   339  N  N     . ASP A 1 46 ? 11.574 24.334 56.542 1.00 28.78  ? 608  ASP A N     1 
ATOM   340  C  CA    . ASP A 1 46 ? 12.854 24.005 57.134 1.00 28.90  ? 608  ASP A CA    1 
ATOM   341  C  C     . ASP A 1 46 ? 13.803 25.185 57.295 1.00 28.02  ? 608  ASP A C     1 
ATOM   342  O  O     . ASP A 1 46 ? 14.899 25.022 57.830 1.00 28.27  ? 608  ASP A O     1 
ATOM   343  C  CB    . ASP A 1 46 ? 13.582 23.207 56.053 1.00 30.96  ? 608  ASP A CB    1 
ATOM   344  C  CG    . ASP A 1 46 ? 13.970 21.853 56.500 1.00 33.68  ? 608  ASP A CG    1 
ATOM   345  O  OD1   . ASP A 1 46 ? 13.646 21.492 57.651 1.00 38.47  ? 608  ASP A OD1   1 
ATOM   346  O  OD2   . ASP A 1 46 ? 14.604 21.099 55.738 1.00 33.33  ? 608  ASP A OD2   1 
ATOM   347  N  N     . CYS A 1 47 ? 13.414 26.342 56.775 1.00 25.42  ? 609  CYS A N     1 
ATOM   348  C  CA    . CYS A 1 47 ? 14.377 27.381 56.440 1.00 25.39  ? 609  CYS A CA    1 
ATOM   349  C  C     . CYS A 1 47 ? 15.148 27.859 57.653 1.00 24.90  ? 609  CYS A C     1 
ATOM   350  O  O     . CYS A 1 47 ? 14.641 27.831 58.771 1.00 26.29  ? 609  CYS A O     1 
ATOM   351  C  CB    . CYS A 1 47 ? 13.670 28.577 55.809 1.00 25.58  ? 609  CYS A CB    1 
ATOM   352  S  SG    . CYS A 1 47 ? 12.904 28.224 54.221 1.00 25.26  ? 609  CYS A SG    1 
ATOM   353  N  N     . ILE A 1 48 ? 16.374 28.300 57.440 1.00 23.59  ? 610  ILE A N     1 
ATOM   354  C  CA    . ILE A 1 48 ? 17.149 28.857 58.539 1.00 23.65  ? 610  ILE A CA    1 
ATOM   355  C  C     . ILE A 1 48 ? 16.692 30.291 58.765 1.00 23.13  ? 610  ILE A C     1 
ATOM   356  O  O     . ILE A 1 48 ? 16.516 31.044 57.812 1.00 22.19  ? 610  ILE A O     1 
ATOM   357  C  CB    . ILE A 1 48 ? 18.672 28.758 58.246 1.00 23.70  ? 610  ILE A CB    1 
ATOM   358  C  CG1   . ILE A 1 48 ? 19.115 27.308 58.472 1.00 24.56  ? 610  ILE A CG1   1 
ATOM   359  C  CG2   . ILE A 1 48 ? 19.482 29.712 59.131 1.00 21.46  ? 610  ILE A CG2   1 
ATOM   360  C  CD1   . ILE A 1 48 ? 20.132 26.814 57.439 1.00 27.06  ? 610  ILE A CD1   1 
ATOM   361  N  N     . VAL A 1 49 ? 16.448 30.646 60.021 1.00 23.36  ? 611  VAL A N     1 
ATOM   362  C  CA    . VAL A 1 49 ? 16.058 32.008 60.334 1.00 24.37  ? 611  VAL A CA    1 
ATOM   363  C  C     . VAL A 1 49 ? 17.213 32.650 61.082 1.00 25.51  ? 611  VAL A C     1 
ATOM   364  O  O     . VAL A 1 49 ? 17.389 32.415 62.263 1.00 26.46  ? 611  VAL A O     1 
ATOM   365  C  CB    . VAL A 1 49 ? 14.745 32.054 61.142 1.00 24.28  ? 611  VAL A CB    1 
ATOM   366  C  CG1   . VAL A 1 49 ? 14.332 33.487 61.416 1.00 22.00  ? 611  VAL A CG1   1 
ATOM   367  C  CG2   . VAL A 1 49 ? 13.616 31.308 60.378 1.00 24.69  ? 611  VAL A CG2   1 
ATOM   368  N  N     . ASP A 1 50 ? 18.038 33.414 60.383 1.00 26.70  ? 612  ASP A N     1 
ATOM   369  C  CA    . ASP A 1 50 ? 19.127 34.121 61.059 1.00 28.90  ? 612  ASP A CA    1 
ATOM   370  C  C     . ASP A 1 50 ? 19.032 35.586 60.704 1.00 30.13  ? 612  ASP A C     1 
ATOM   371  O  O     . ASP A 1 50 ? 18.124 35.991 59.996 1.00 31.19  ? 612  ASP A O     1 
ATOM   372  C  CB    . ASP A 1 50 ? 20.506 33.546 60.703 1.00 27.12  ? 612  ASP A CB    1 
ATOM   373  C  CG    . ASP A 1 50 ? 20.758 33.521 59.208 1.00 28.54  ? 612  ASP A CG    1 
ATOM   374  O  OD1   . ASP A 1 50 ? 20.077 34.273 58.475 1.00 30.37  ? 612  ASP A OD1   1 
ATOM   375  O  OD2   . ASP A 1 50 ? 21.607 32.784 58.659 1.00 28.42  ? 612  ASP A OD2   1 
ATOM   376  N  N     . LYS A 1 51 ? 19.979 36.374 61.182 1.00 32.38  ? 613  LYS A N     1 
ATOM   377  C  CA    . LYS A 1 51 ? 19.876 37.812 61.082 1.00 34.24  ? 613  LYS A CA    1 
ATOM   378  C  C     . LYS A 1 51 ? 19.769 38.297 59.629 1.00 33.75  ? 613  LYS A C     1 
ATOM   379  O  O     . LYS A 1 51 ? 18.882 39.083 59.314 1.00 34.82  ? 613  LYS A O     1 
ATOM   380  C  CB    . LYS A 1 51 ? 21.056 38.470 61.812 1.00 35.58  ? 613  LYS A CB    1 
ATOM   381  C  CG    . LYS A 1 51 ? 20.913 39.971 62.030 1.00 39.40  ? 613  LYS A CG    1 
ATOM   382  C  CD    . LYS A 1 51 ? 22.290 40.608 62.045 1.00 45.92  ? 613  LYS A CD    1 
ATOM   383  C  CE    . LYS A 1 51 ? 22.406 41.669 63.128 1.00 50.66  ? 613  LYS A CE    1 
ATOM   384  N  NZ    . LYS A 1 51 ? 21.448 42.800 62.889 1.00 54.19  ? 613  LYS A NZ    1 
ATOM   385  N  N     . ILE A 1 52 ? 20.658 37.831 58.757 1.00 32.78  ? 614  ILE A N     1 
ATOM   386  C  CA    . ILE A 1 52 ? 20.702 38.334 57.386 1.00 31.91  ? 614  ILE A CA    1 
ATOM   387  C  C     . ILE A 1 52 ? 19.466 37.904 56.600 1.00 30.92  ? 614  ILE A C     1 
ATOM   388  O  O     . ILE A 1 52 ? 18.997 38.633 55.738 1.00 28.81  ? 614  ILE A O     1 
ATOM   389  C  CB    . ILE A 1 52 ? 22.029 37.904 56.659 1.00 32.70  ? 614  ILE A CB    1 
ATOM   390  C  CG1   . ILE A 1 52 ? 23.242 38.656 57.248 1.00 32.90  ? 614  ILE A CG1   1 
ATOM   391  C  CG2   . ILE A 1 52 ? 21.963 38.149 55.125 1.00 27.98  ? 614  ILE A CG2   1 
ATOM   392  C  CD1   . ILE A 1 52 ? 24.604 37.974 56.986 1.00 30.71  ? 614  ILE A CD1   1 
ATOM   393  N  N     . ARG A 1 53 ? 18.942 36.719 56.914 1.00 30.71  ? 615  ARG A N     1 
ATOM   394  C  CA    . ARG A 1 53 ? 17.927 36.106 56.070 1.00 30.35  ? 615  ARG A CA    1 
ATOM   395  C  C     . ARG A 1 53 ? 16.539 35.996 56.687 1.00 31.20  ? 615  ARG A C     1 
ATOM   396  O  O     . ARG A 1 53 ? 15.651 35.396 56.085 1.00 31.39  ? 615  ARG A O     1 
ATOM   397  C  CB    . ARG A 1 53 ? 18.396 34.742 55.580 1.00 29.88  ? 615  ARG A CB    1 
ATOM   398  C  CG    . ARG A 1 53 ? 19.685 34.797 54.795 1.00 26.02  ? 615  ARG A CG    1 
ATOM   399  C  CD    . ARG A 1 53 ? 20.216 33.428 54.435 1.00 26.21  ? 615  ARG A CD    1 
ATOM   400  N  NE    . ARG A 1 53 ? 20.704 32.660 55.595 1.00 25.30  ? 615  ARG A NE    1 
ATOM   401  C  CZ    . ARG A 1 53 ? 21.270 31.472 55.468 1.00 23.43  ? 615  ARG A CZ    1 
ATOM   402  N  NH1   . ARG A 1 53 ? 21.408 30.955 54.254 1.00 23.88  ? 615  ARG A NH1   1 
ATOM   403  N  NH2   . ARG A 1 53 ? 21.705 30.808 56.526 1.00 21.52  ? 615  ARG A NH2   1 
ATOM   404  N  N     . ARG A 1 54 ? 16.327 36.596 57.856 1.00 31.67  ? 616  ARG A N     1 
ATOM   405  C  CA    . ARG A 1 54 ? 15.049 36.415 58.539 1.00 31.90  ? 616  ARG A CA    1 
ATOM   406  C  C     . ARG A 1 54 ? 13.881 36.817 57.646 1.00 31.67  ? 616  ARG A C     1 
ATOM   407  O  O     . ARG A 1 54 ? 12.809 36.223 57.733 1.00 32.67  ? 616  ARG A O     1 
ATOM   408  C  CB    . ARG A 1 54 ? 15.004 37.163 59.871 1.00 32.53  ? 616  ARG A CB    1 
ATOM   409  C  CG    . ARG A 1 54 ? 15.355 38.634 59.787 1.00 33.75  ? 616  ARG A CG    1 
ATOM   410  C  CD    . ARG A 1 54 ? 15.757 39.230 61.099 1.00 33.25  ? 616  ARG A CD    1 
ATOM   411  N  NE    . ARG A 1 54 ? 16.018 40.651 60.959 1.00 34.20  ? 616  ARG A NE    1 
ATOM   412  C  CZ    . ARG A 1 54 ? 16.598 41.405 61.882 1.00 35.03  ? 616  ARG A CZ    1 
ATOM   413  N  NH1   . ARG A 1 54 ? 16.997 40.885 63.044 1.00 35.47  ? 616  ARG A NH1   1 
ATOM   414  N  NH2   . ARG A 1 54 ? 16.773 42.693 61.645 1.00 34.12  ? 616  ARG A NH2   1 
ATOM   415  N  N     . LYS A 1 55 ? 14.110 37.797 56.769 1.00 30.51  ? 617  LYS A N     1 
ATOM   416  C  CA    . LYS A 1 55 ? 13.064 38.313 55.895 1.00 28.98  ? 617  LYS A CA    1 
ATOM   417  C  C     . LYS A 1 55 ? 12.739 37.352 54.758 1.00 30.10  ? 617  LYS A C     1 
ATOM   418  O  O     . LYS A 1 55 ? 11.652 37.424 54.162 1.00 29.39  ? 617  LYS A O     1 
ATOM   419  C  CB    . LYS A 1 55 ? 13.445 39.704 55.365 1.00 28.38  ? 617  LYS A CB    1 
ATOM   420  C  CG    . LYS A 1 55 ? 14.058 39.748 53.971 1.00 27.49  ? 617  LYS A CG    1 
ATOM   421  C  CD    . LYS A 1 55 ? 14.491 41.163 53.564 1.00 26.95  ? 617  LYS A CD    1 
ATOM   422  C  CE    . LYS A 1 55 ? 15.264 41.145 52.218 1.00 28.51  ? 617  LYS A CE    1 
ATOM   423  N  NZ    . LYS A 1 55 ? 14.367 40.782 51.016 1.00 26.20  ? 617  LYS A NZ    1 
ATOM   424  N  N     . ASN A 1 56 ? 13.692 36.455 54.463 1.00 29.91  ? 618  ASN A N     1 
ATOM   425  C  CA    . ASN A 1 56 ? 13.605 35.540 53.325 1.00 29.43  ? 618  ASN A CA    1 
ATOM   426  C  C     . ASN A 1 56 ? 12.317 34.720 53.316 1.00 29.54  ? 618  ASN A C     1 
ATOM   427  O  O     . ASN A 1 56 ? 11.602 34.690 52.316 1.00 30.09  ? 618  ASN A O     1 
ATOM   428  C  CB    . ASN A 1 56 ? 14.807 34.582 53.284 1.00 30.25  ? 618  ASN A CB    1 
ATOM   429  C  CG    . ASN A 1 56 ? 16.060 35.214 52.686 1.00 30.62  ? 618  ASN A CG    1 
ATOM   430  O  OD1   . ASN A 1 56 ? 16.963 34.509 52.211 1.00 32.01  ? 618  ASN A OD1   1 
ATOM   431  N  ND2   . ASN A 1 56 ? 16.135 36.528 52.725 1.00 30.81  ? 618  ASN A ND2   1 
ATOM   432  N  N     . CYS A 1 57 ? 12.030 34.035 54.418 1.00 28.81  ? 619  CYS A N     1 
ATOM   433  C  CA    . CYS A 1 57 ? 10.853 33.169 54.465 1.00 28.21  ? 619  CYS A CA    1 
ATOM   434  C  C     . CYS A 1 57 ? 9.934  33.443 55.653 1.00 26.98  ? 619  CYS A C     1 
ATOM   435  O  O     . CYS A 1 57 ? 10.110 32.847 56.710 1.00 28.28  ? 619  CYS A O     1 
ATOM   436  C  CB    . CYS A 1 57 ? 11.276 31.699 54.471 1.00 27.82  ? 619  CYS A CB    1 
ATOM   437  S  SG    . CYS A 1 57 ? 9.856  30.572 54.464 1.00 29.59  ? 619  CYS A SG    1 
ATOM   438  N  N     . PRO A 1 58 ? 8.951  34.319 55.487 1.00 26.32  ? 620  PRO A N     1 
ATOM   439  C  CA    . PRO A 1 58 ? 8.026  34.644 56.583 1.00 25.26  ? 620  PRO A CA    1 
ATOM   440  C  C     . PRO A 1 58 ? 7.314  33.420 57.119 1.00 25.02  ? 620  PRO A C     1 
ATOM   441  O  O     . PRO A 1 58 ? 7.112  33.343 58.338 1.00 26.69  ? 620  PRO A O     1 
ATOM   442  C  CB    . PRO A 1 58 ? 7.044  35.650 55.961 1.00 24.34  ? 620  PRO A CB    1 
ATOM   443  C  CG    . PRO A 1 58 ? 7.176  35.468 54.486 1.00 25.75  ? 620  PRO A CG    1 
ATOM   444  C  CD    . PRO A 1 58 ? 8.654  35.082 54.257 1.00 27.45  ? 620  PRO A CD    1 
ATOM   445  N  N     . ALA A 1 59 ? 6.993  32.448 56.275 1.00 24.42  ? 621  ALA A N     1 
ATOM   446  C  CA    . ALA A 1 59 ? 6.365  31.232 56.798 1.00 25.23  ? 621  ALA A CA    1 
ATOM   447  C  C     . ALA A 1 59 ? 7.203  30.627 57.930 1.00 26.17  ? 621  ALA A C     1 
ATOM   448  O  O     . ALA A 1 59 ? 6.685  30.424 59.031 1.00 26.33  ? 621  ALA A O     1 
ATOM   449  C  CB    . ALA A 1 59 ? 6.103  30.201 55.698 1.00 24.09  ? 621  ALA A CB    1 
ATOM   450  N  N     . CYS A 1 60 ? 8.491  30.377 57.664 1.00 26.37  ? 622  CYS A N     1 
ATOM   451  C  CA    . CYS A 1 60 ? 9.366  29.701 58.629 1.00 26.26  ? 622  CYS A CA    1 
ATOM   452  C  C     . CYS A 1 60 ? 9.702  30.559 59.833 1.00 27.03  ? 622  CYS A C     1 
ATOM   453  O  O     . CYS A 1 60 ? 9.876  30.056 60.951 1.00 26.16  ? 622  CYS A O     1 
ATOM   454  C  CB    . CYS A 1 60 ? 10.659 29.236 57.958 1.00 26.06  ? 622  CYS A CB    1 
ATOM   455  S  SG    . CYS A 1 60 ? 10.441 27.763 56.948 1.00 22.66  ? 622  CYS A SG    1 
ATOM   456  N  N     . ARG A 1 61 ? 9.795  31.861 59.603 1.00 27.38  ? 623  ARG A N     1 
ATOM   457  C  CA    . ARG A 1 61 ? 10.055 32.776 60.701 1.00 28.55  ? 623  ARG A CA    1 
ATOM   458  C  C     . ARG A 1 61 ? 8.864  32.756 61.664 1.00 28.67  ? 623  ARG A C     1 
ATOM   459  O  O     . ARG A 1 61 ? 9.052  32.742 62.890 1.00 29.07  ? 623  ARG A O     1 
ATOM   460  C  CB    . ARG A 1 61 ? 10.297 34.184 60.164 1.00 28.83  ? 623  ARG A CB    1 
ATOM   461  C  CG    . ARG A 1 61 ? 10.556 35.231 61.212 1.00 29.27  ? 623  ARG A CG    1 
ATOM   462  C  CD    . ARG A 1 61 ? 10.697 36.611 60.599 1.00 33.51  ? 623  ARG A CD    1 
ATOM   463  N  NE    . ARG A 1 61 ? 11.401 37.542 61.470 1.00 33.57  ? 623  ARG A NE    1 
ATOM   464  C  CZ    . ARG A 1 61 ? 11.606 38.813 61.177 1.00 33.76  ? 623  ARG A CZ    1 
ATOM   465  N  NH1   . ARG A 1 61 ? 11.182 39.318 60.026 1.00 33.66  ? 623  ARG A NH1   1 
ATOM   466  N  NH2   . ARG A 1 61 ? 12.252 39.584 62.034 1.00 35.61  ? 623  ARG A NH2   1 
ATOM   467  N  N     . LEU A 1 62 ? 7.650  32.768 61.109 1.00 27.67  ? 624  LEU A N     1 
ATOM   468  C  CA    . LEU A 1 62 ? 6.455  32.752 61.933 1.00 27.65  ? 624  LEU A CA    1 
ATOM   469  C  C     . LEU A 1 62 ? 6.357  31.413 62.664 1.00 27.25  ? 624  LEU A C     1 
ATOM   470  O  O     . LEU A 1 62 ? 6.114  31.365 63.867 1.00 28.09  ? 624  LEU A O     1 
ATOM   471  C  CB    . LEU A 1 62 ? 5.188  33.038 61.103 1.00 28.31  ? 624  LEU A CB    1 
ATOM   472  C  CG    . LEU A 1 62 ? 3.828  32.830 61.809 1.00 27.20  ? 624  LEU A CG    1 
ATOM   473  C  CD1   . LEU A 1 62 ? 3.659  33.804 62.941 1.00 25.46  ? 624  LEU A CD1   1 
ATOM   474  C  CD2   . LEU A 1 62 ? 2.699  32.995 60.829 1.00 26.64  ? 624  LEU A CD2   1 
ATOM   475  N  N     . ARG A 1 63 ? 6.576  30.329 61.942 1.00 27.06  ? 625  ARG A N     1 
ATOM   476  C  CA    . ARG A 1 63 ? 6.627  29.015 62.564 1.00 27.97  ? 625  ARG A CA    1 
ATOM   477  C  C     . ARG A 1 63 ? 7.585  28.998 63.766 1.00 27.95  ? 625  ARG A C     1 
ATOM   478  O  O     . ARG A 1 63 ? 7.222  28.538 64.868 1.00 28.02  ? 625  ARG A O     1 
ATOM   479  C  CB    . ARG A 1 63 ? 7.040  27.977 61.533 1.00 28.28  ? 625  ARG A CB    1 
ATOM   480  C  CG    . ARG A 1 63 ? 6.871  26.554 61.976 1.00 30.79  ? 625  ARG A CG    1 
ATOM   481  C  CD    . ARG A 1 63 ? 7.788  25.618 61.232 1.00 33.38  ? 625  ARG A CD    1 
ATOM   482  N  NE    . ARG A 1 63 ? 9.173  25.867 61.613 1.00 37.48  ? 625  ARG A NE    1 
ATOM   483  C  CZ    . ARG A 1 63 ? 10.105 26.219 60.755 1.00 38.00  ? 625  ARG A CZ    1 
ATOM   484  N  NH1   . ARG A 1 63 ? 9.774  26.346 59.478 1.00 39.37  ? 625  ARG A NH1   1 
ATOM   485  N  NH2   . ARG A 1 63 ? 11.352 26.423 61.154 1.00 35.13  ? 625  ARG A NH2   1 
ATOM   486  N  N     . LYS A 1 64 ? 8.794  29.519 63.554 1.00 26.82  ? 626  LYS A N     1 
ATOM   487  C  CA    . LYS A 1 64 ? 9.793  29.585 64.602 1.00 26.43  ? 626  LYS A CA    1 
ATOM   488  C  C     . LYS A 1 64 ? 9.298  30.444 65.779 1.00 27.65  ? 626  LYS A C     1 
ATOM   489  O  O     . LYS A 1 64 ? 9.488  30.051 66.947 1.00 26.16  ? 626  LYS A O     1 
ATOM   490  C  CB    . LYS A 1 64 ? 11.122 30.075 64.029 1.00 26.58  ? 626  LYS A CB    1 
ATOM   491  C  CG    . LYS A 1 64 ? 12.305 29.919 64.938 1.00 27.05  ? 626  LYS A CG    1 
ATOM   492  C  CD    . LYS A 1 64 ? 13.588 29.761 64.178 1.00 28.40  ? 626  LYS A CD    1 
ATOM   493  C  CE    . LYS A 1 64 ? 14.775 29.851 65.149 1.00 29.78  ? 626  LYS A CE    1 
ATOM   494  N  NZ    . LYS A 1 64 ? 16.094 30.096 64.461 1.00 29.44  ? 626  LYS A NZ    1 
ATOM   495  N  N     . CYS A 1 65 ? 8.615  31.563 65.485 1.00 27.91  ? 627  CYS A N     1 
ATOM   496  C  CA    . CYS A 1 65 ? 8.025  32.374 66.548 1.00 28.98  ? 627  CYS A CA    1 
ATOM   497  C  C     . CYS A 1 65 ? 7.053  31.560 67.380 1.00 31.50  ? 627  CYS A C     1 
ATOM   498  O  O     . CYS A 1 65 ? 7.166  31.549 68.612 1.00 32.25  ? 627  CYS A O     1 
ATOM   499  C  CB    . CYS A 1 65 ? 7.273  33.592 66.030 1.00 28.54  ? 627  CYS A CB    1 
ATOM   500  S  SG    . CYS A 1 65 ? 8.252  34.902 65.297 1.00 25.76  ? 627  CYS A SG    1 
ATOM   501  N  N     . CYS A 1 66 ? 6.097  30.894 66.725 1.00 32.65  ? 628  CYS A N     1 
ATOM   502  C  CA    . CYS A 1 66 ? 5.070  30.176 67.466 1.00 34.49  ? 628  CYS A CA    1 
ATOM   503  C  C     . CYS A 1 66 ? 5.705  29.004 68.246 1.00 34.00  ? 628  CYS A C     1 
ATOM   504  O  O     . CYS A 1 66 ? 5.437  28.808 69.434 1.00 33.51  ? 628  CYS A O     1 
ATOM   505  C  CB    . CYS A 1 66 ? 3.881  29.776 66.550 1.00 35.63  ? 628  CYS A CB    1 
ATOM   506  S  SG    . CYS A 1 66 ? 2.940  31.190 65.781 1.00 41.80  ? 628  CYS A SG    1 
ATOM   507  N  N     . GLN A 1 67 ? 6.598  28.261 67.606 1.00 33.86  ? 629  GLN A N     1 
ATOM   508  C  CA    . GLN A 1 67 ? 7.262  27.148 68.282 1.00 33.73  ? 629  GLN A CA    1 
ATOM   509  C  C     . GLN A 1 67 ? 8.077  27.567 69.505 1.00 33.93  ? 629  GLN A C     1 
ATOM   510  O  O     . GLN A 1 67 ? 8.256  26.788 70.442 1.00 34.56  ? 629  GLN A O     1 
ATOM   511  C  CB    . GLN A 1 67 ? 8.123  26.361 67.299 1.00 33.52  ? 629  GLN A CB    1 
ATOM   512  C  CG    . GLN A 1 67 ? 7.275  25.394 66.463 1.00 34.40  ? 629  GLN A CG    1 
ATOM   513  C  CD    . GLN A 1 67 ? 7.998  24.817 65.264 1.00 34.85  ? 629  GLN A CD    1 
ATOM   514  O  OE1   . GLN A 1 67 ? 9.074  25.276 64.900 1.00 34.07  ? 629  GLN A OE1   1 
ATOM   515  N  NE2   . GLN A 1 67 ? 7.397  23.814 64.643 1.00 35.36  ? 629  GLN A NE2   1 
ATOM   516  N  N     . ALA A 1 68 ? 8.553  28.807 69.504 1.00 33.95  ? 630  ALA A N     1 
ATOM   517  C  CA    . ALA A 1 68 ? 9.369  29.320 70.605 1.00 33.74  ? 630  ALA A CA    1 
ATOM   518  C  C     . ALA A 1 68 ? 8.526  29.710 71.820 1.00 33.64  ? 630  ALA A C     1 
ATOM   519  O  O     . ALA A 1 68 ? 9.061  29.904 72.913 1.00 33.07  ? 630  ALA A O     1 
ATOM   520  C  CB    . ALA A 1 68 ? 10.237 30.497 70.131 1.00 32.59  ? 630  ALA A CB    1 
ATOM   521  N  N     . GLY A 1 69 ? 7.212  29.810 71.622 1.00 33.57  ? 631  GLY A N     1 
ATOM   522  C  CA    . GLY A 1 69 ? 6.290  30.163 72.686 1.00 33.79  ? 631  GLY A CA    1 
ATOM   523  C  C     . GLY A 1 69 ? 5.613  31.516 72.520 1.00 34.41  ? 631  GLY A C     1 
ATOM   524  O  O     . GLY A 1 69 ? 4.836  31.905 73.391 1.00 34.77  ? 631  GLY A O     1 
ATOM   525  N  N     . MET A 1 70 ? 5.893  32.233 71.428 1.00 34.06  ? 632  MET A N     1 
ATOM   526  C  CA    . MET A 1 70 ? 5.294  33.553 71.204 1.00 35.05  ? 632  MET A CA    1 
ATOM   527  C  C     . MET A 1 70 ? 3.786  33.436 71.043 1.00 37.13  ? 632  MET A C     1 
ATOM   528  O  O     . MET A 1 70 ? 3.297  32.541 70.368 1.00 37.75  ? 632  MET A O     1 
ATOM   529  C  CB    . MET A 1 70 ? 5.906  34.250 69.991 1.00 33.18  ? 632  MET A CB    1 
ATOM   530  C  CG    . MET A 1 70 ? 7.306  34.796 70.243 1.00 30.81  ? 632  MET A CG    1 
ATOM   531  S  SD    . MET A 1 70 ? 8.071  35.545 68.816 1.00 31.63  ? 632  MET A SD    1 
ATOM   532  C  CE    . MET A 1 70 ? 7.224  37.139 68.778 1.00 27.37  ? 632  MET A CE    1 
ATOM   533  N  N     . VAL A 1 71 ? 3.054  34.336 71.679 1.00 40.04  ? 633  VAL A N     1 
ATOM   534  C  CA    . VAL A 1 71 ? 1.601  34.254 71.723 1.00 42.76  ? 633  VAL A CA    1 
ATOM   535  C  C     . VAL A 1 71 ? 1.105  35.673 71.701 1.00 44.78  ? 633  VAL A C     1 
ATOM   536  O  O     . VAL A 1 71 ? 1.617  36.519 72.415 1.00 44.85  ? 633  VAL A O     1 
ATOM   537  C  CB    . VAL A 1 71 ? 1.096  33.528 73.025 1.00 42.60  ? 633  VAL A CB    1 
ATOM   538  C  CG1   . VAL A 1 71 ? -0.383 33.825 73.317 1.00 43.42  ? 633  VAL A CG1   1 
ATOM   539  C  CG2   . VAL A 1 71 ? 1.293  32.023 72.922 1.00 40.73  ? 633  VAL A CG2   1 
ATOM   540  N  N     . LEU A 1 72 ? 0.117  35.934 70.863 1.00 48.89  ? 634  LEU A N     1 
ATOM   541  C  CA    . LEU A 1 72 ? -0.550 37.218 70.863 1.00 53.70  ? 634  LEU A CA    1 
ATOM   542  C  C     . LEU A 1 72 ? -1.232 37.504 72.203 1.00 57.32  ? 634  LEU A C     1 
ATOM   543  O  O     . LEU A 1 72 ? -1.799 36.604 72.837 1.00 58.02  ? 634  LEU A O     1 
ATOM   544  C  CB    . LEU A 1 72 ? -1.574 37.268 69.734 1.00 53.75  ? 634  LEU A CB    1 
ATOM   545  C  CG    . LEU A 1 72 ? -1.050 37.735 68.376 1.00 54.57  ? 634  LEU A CG    1 
ATOM   546  C  CD1   . LEU A 1 72 ? -2.197 38.201 67.497 1.00 55.29  ? 634  LEU A CD1   1 
ATOM   547  C  CD2   . LEU A 1 72 ? -0.033 38.852 68.549 1.00 55.30  ? 634  LEU A CD2   1 
ATOM   548  N  N     . GLY A 1 73 ? -1.153 38.760 72.630 1.00 60.81  ? 635  GLY A N     1 
ATOM   549  C  CA    . GLY A 1 73 ? -1.902 39.250 73.769 1.00 65.91  ? 635  GLY A CA    1 
ATOM   550  C  C     . GLY A 1 73 ? -1.887 40.770 73.786 1.00 69.58  ? 635  GLY A C     1 
ATOM   551  O  O     . GLY A 1 73 ? -1.015 41.396 73.167 1.00 69.44  ? 635  GLY A O     1 
ATOM   552  N  N     . GLY A 1 74 ? -2.859 41.363 74.481 1.00 72.70  ? 636  GLY A N     1 
ATOM   553  C  CA    . GLY A 1 74 ? -2.848 42.791 74.766 1.00 76.59  ? 636  GLY A CA    1 
ATOM   554  C  C     . GLY A 1 74 ? -1.797 43.138 75.818 1.00 79.42  ? 636  GLY A C     1 
ATOM   555  O  O     . GLY A 1 74 ? -0.980 42.287 76.207 1.00 79.29  ? 636  GLY A O     1 
ATOM   556  N  N     . ARG A 1 75 ? -1.810 44.390 76.274 1.00 82.21  ? 637  ARG A N     1 
ATOM   557  C  CA    . ARG A 1 75 ? -0.901 44.823 77.335 1.00 85.08  ? 637  ARG A CA    1 
ATOM   558  C  C     . ARG A 1 75 ? -1.379 44.321 78.699 1.00 87.28  ? 637  ARG A C     1 
ATOM   559  O  O     . ARG A 1 75 ? -2.345 44.842 79.267 1.00 87.69  ? 637  ARG A O     1 
ATOM   560  C  CB    . ARG A 1 75 ? -0.717 46.348 77.333 1.00 84.82  ? 637  ARG A CB    1 
ATOM   561  C  CG    . ARG A 1 75 ? 0.738  46.812 77.469 1.00 84.31  ? 637  ARG A CG    1 
ATOM   562  C  CD    . ARG A 1 75 ? 1.680  45.794 78.116 1.00 83.53  ? 637  ARG A CD    1 
ATOM   563  N  NE    . ARG A 1 75 ? 2.957  46.373 78.526 1.00 83.46  ? 637  ARG A NE    1 
ATOM   564  C  CZ    . ARG A 1 75 ? 3.654  45.973 79.587 1.00 83.61  ? 637  ARG A CZ    1 
ATOM   565  N  NH1   . ARG A 1 75 ? 3.202  44.988 80.349 1.00 83.75  ? 637  ARG A NH1   1 
ATOM   566  N  NH2   . ARG A 1 75 ? 4.806  46.557 79.891 1.00 83.30  ? 637  ARG A NH2   1 
ATOM   567  N  N     . LYS A 1 76 ? -0.688 43.296 79.196 1.00 90.13  ? 638  LYS A N     1 
ATOM   568  C  CA    . LYS A 1 76 ? -1.037 42.599 80.437 1.00 92.65  ? 638  LYS A CA    1 
ATOM   569  C  C     . LYS A 1 76 ? -0.379 43.242 81.667 1.00 94.42  ? 638  LYS A C     1 
ATOM   570  O  O     . LYS A 1 76 ? 0.614  43.968 81.540 1.00 94.48  ? 638  LYS A O     1 
ATOM   571  C  CB    . LYS A 1 76 ? -0.683 41.102 80.332 1.00 92.64  ? 638  LYS A CB    1 
ATOM   572  C  CG    . LYS A 1 76 ? 0.817  40.774 80.313 1.00 92.86  ? 638  LYS A CG    1 
ATOM   573  C  CD    . LYS A 1 76 ? 1.353  40.634 78.891 1.00 93.02  ? 638  LYS A CD    1 
ATOM   574  C  CE    . LYS A 1 76 ? 2.613  41.473 78.679 1.00 92.38  ? 638  LYS A CE    1 
ATOM   575  N  NZ    . LYS A 1 76 ? 3.392  41.016 77.488 1.00 92.24  ? 638  LYS A NZ    1 
ATOM   576  N  N     . PHE A 1 77 ? -0.941 42.973 82.848 1.00 96.52  ? 639  PHE A N     1 
ATOM   577  C  CA    . PHE A 1 77 ? -0.497 43.613 84.094 1.00 98.30  ? 639  PHE A CA    1 
ATOM   578  C  C     . PHE A 1 77 ? 0.049  42.599 85.111 1.00 98.89  ? 639  PHE A C     1 
ATOM   579  O  O     . PHE A 1 77 ? -0.350 41.428 85.115 1.00 98.98  ? 639  PHE A O     1 
ATOM   580  C  CB    . PHE A 1 77 ? -1.621 44.474 84.716 1.00 98.85  ? 639  PHE A CB    1 
ATOM   581  C  CG    . PHE A 1 77 ? -2.679 44.935 83.724 1.00 100.58 ? 639  PHE A CG    1 
ATOM   582  C  CD1   . PHE A 1 77 ? -3.932 44.310 83.677 1.00 101.71 ? 639  PHE A CD1   1 
ATOM   583  C  CD2   . PHE A 1 77 ? -2.429 45.994 82.846 1.00 101.07 ? 639  PHE A CD2   1 
ATOM   584  C  CE1   . PHE A 1 77 ? -4.918 44.727 82.766 1.00 102.12 ? 639  PHE A CE1   1 
ATOM   585  C  CE2   . PHE A 1 77 ? -3.407 46.419 81.931 1.00 101.85 ? 639  PHE A CE2   1 
ATOM   586  C  CZ    . PHE A 1 77 ? -4.653 45.784 81.892 1.00 102.09 ? 639  PHE A CZ    1 
ATOM   587  N  N     . LYS A 1 78 ? 0.970  43.057 85.958 1.00 99.55  ? 640  LYS A N     1 
ATOM   588  C  CA    . LYS A 1 78 ? 1.576  42.211 86.987 1.00 100.06 ? 640  LYS A CA    1 
ATOM   589  C  C     . LYS A 1 78 ? 0.960  42.468 88.367 1.00 100.28 ? 640  LYS A C     1 
ATOM   590  O  O     . LYS A 1 78 ? 0.105  43.341 88.548 1.00 100.28 ? 640  LYS A O     1 
ATOM   591  C  CB    . LYS A 1 78 ? 3.095  42.413 87.023 1.00 100.06 ? 640  LYS A CB    1 
ATOM   592  O  OXT   . LYS A 1 78 ? 1.291  41.804 89.354 1.00 100.52 ? 640  LYS A OXT   1 
ATOM   593  N  N     . PRO B 1 1  ? -2.003 35.629 23.593 1.00 76.29  ? 563  PRO B N     1 
ATOM   594  C  CA    . PRO B 1 1  ? -2.353 34.765 24.764 1.00 75.71  ? 563  PRO B CA    1 
ATOM   595  C  C     . PRO B 1 1  ? -1.786 35.330 26.072 1.00 74.99  ? 563  PRO B C     1 
ATOM   596  O  O     . PRO B 1 1  ? -2.592 35.653 26.951 1.00 75.24  ? 563  PRO B O     1 
ATOM   597  C  CB    . PRO B 1 1  ? -1.716 33.411 24.416 1.00 76.17  ? 563  PRO B CB    1 
ATOM   598  C  CG    . PRO B 1 1  ? -0.961 33.625 23.106 1.00 76.97  ? 563  PRO B CG    1 
ATOM   599  C  CD    . PRO B 1 1  ? -1.528 34.846 22.442 1.00 76.63  ? 563  PRO B CD    1 
ATOM   600  N  N     . GLN B 1 2  ? -0.454 35.435 26.184 1.00 73.21  ? 564  GLN B N     1 
ATOM   601  C  CA    . GLN B 1 2  ? 0.252  36.128 27.282 1.00 71.31  ? 564  GLN B CA    1 
ATOM   602  C  C     . GLN B 1 2  ? 1.681  35.620 27.437 1.00 69.05  ? 564  GLN B C     1 
ATOM   603  O  O     . GLN B 1 2  ? 1.888  34.426 27.654 1.00 68.96  ? 564  GLN B O     1 
ATOM   604  C  CB    . GLN B 1 2  ? -0.468 35.982 28.625 1.00 71.82  ? 564  GLN B CB    1 
ATOM   605  C  CG    . GLN B 1 2  ? -0.339 37.200 29.520 1.00 74.33  ? 564  GLN B CG    1 
ATOM   606  C  CD    . GLN B 1 2  ? -1.614 37.490 30.299 1.00 77.09  ? 564  GLN B CD    1 
ATOM   607  O  OE1   . GLN B 1 2  ? -2.611 37.959 29.727 1.00 76.52  ? 564  GLN B OE1   1 
ATOM   608  N  NE2   . GLN B 1 2  ? -1.591 37.209 31.606 1.00 77.27  ? 564  GLN B NE2   1 
ATOM   609  N  N     . LYS B 1 3  ? 2.662  36.514 27.339 1.00 66.01  ? 565  LYS B N     1 
ATOM   610  C  CA    . LYS B 1 3  ? 4.055  36.113 27.546 1.00 63.18  ? 565  LYS B CA    1 
ATOM   611  C  C     . LYS B 1 3  ? 4.323  35.909 29.041 1.00 60.51  ? 565  LYS B C     1 
ATOM   612  O  O     . LYS B 1 3  ? 3.999  36.774 29.867 1.00 59.53  ? 565  LYS B O     1 
ATOM   613  C  CB    . LYS B 1 3  ? 5.036  37.132 26.958 1.00 64.01  ? 565  LYS B CB    1 
ATOM   614  C  CG    . LYS B 1 3  ? 4.815  37.495 25.488 1.00 66.09  ? 565  LYS B CG    1 
ATOM   615  C  CD    . LYS B 1 3  ? 5.225  38.954 25.232 1.00 68.56  ? 565  LYS B CD    1 
ATOM   616  C  CE    . LYS B 1 3  ? 5.335  39.277 23.746 1.00 70.23  ? 565  LYS B CE    1 
ATOM   617  N  NZ    . LYS B 1 3  ? 6.570  38.689 23.145 1.00 70.86  ? 565  LYS B NZ    1 
ATOM   618  N  N     . ILE B 1 4  ? 4.898  34.756 29.384 1.00 56.81  ? 566  ILE B N     1 
ATOM   619  C  CA    . ILE B 1 4  ? 5.192  34.440 30.784 1.00 53.27  ? 566  ILE B CA    1 
ATOM   620  C  C     . ILE B 1 4  ? 6.696  34.420 31.106 1.00 49.62  ? 566  ILE B C     1 
ATOM   621  O  O     . ILE B 1 4  ? 7.478  33.765 30.424 1.00 47.99  ? 566  ILE B O     1 
ATOM   622  C  CB    . ILE B 1 4  ? 4.442  33.149 31.261 1.00 53.77  ? 566  ILE B CB    1 
ATOM   623  C  CG1   . ILE B 1 4  ? 4.879  31.912 30.465 1.00 55.98  ? 566  ILE B CG1   1 
ATOM   624  C  CG2   . ILE B 1 4  ? 2.926  33.364 31.180 1.00 53.98  ? 566  ILE B CG2   1 
ATOM   625  C  CD1   . ILE B 1 4  ? 3.925  30.677 30.534 1.00 59.11  ? 566  ILE B CD1   1 
ATOM   626  N  N     . CYS B 1 5  ? 7.077  35.175 32.135 1.00 45.62  ? 567  CYS B N     1 
ATOM   627  C  CA    . CYS B 1 5  ? 8.453  35.208 32.651 1.00 42.45  ? 567  CYS B CA    1 
ATOM   628  C  C     . CYS B 1 5  ? 8.968  33.810 33.009 1.00 40.69  ? 567  CYS B C     1 
ATOM   629  O  O     . CYS B 1 5  ? 8.349  33.086 33.785 1.00 38.64  ? 567  CYS B O     1 
ATOM   630  C  CB    . CYS B 1 5  ? 8.530  36.133 33.878 1.00 42.07  ? 567  CYS B CB    1 
ATOM   631  S  SG    . CYS B 1 5  ? 10.102 36.160 34.786 1.00 38.75  ? 567  CYS B SG    1 
ATOM   632  N  N     . LEU B 1 6  ? 10.106 33.450 32.430 1.00 39.49  ? 568  LEU B N     1 
ATOM   633  C  CA    . LEU B 1 6  ? 10.693 32.132 32.626 1.00 38.79  ? 568  LEU B CA    1 
ATOM   634  C  C     . LEU B 1 6  ? 11.334 31.946 34.007 1.00 38.42  ? 568  LEU B C     1 
ATOM   635  O  O     . LEU B 1 6  ? 11.622 30.818 34.415 1.00 38.25  ? 568  LEU B O     1 
ATOM   636  C  CB    . LEU B 1 6  ? 11.694 31.828 31.513 1.00 39.20  ? 568  LEU B CB    1 
ATOM   637  C  CG    . LEU B 1 6  ? 11.048 31.395 30.190 1.00 38.83  ? 568  LEU B CG    1 
ATOM   638  C  CD1   . LEU B 1 6  ? 12.083 31.347 29.071 1.00 38.06  ? 568  LEU B CD1   1 
ATOM   639  C  CD2   . LEU B 1 6  ? 10.378 30.045 30.364 1.00 38.80  ? 568  LEU B CD2   1 
ATOM   640  N  N     . ILE B 1 7  ? 11.525 33.053 34.724 1.00 37.39  ? 569  ILE B N     1 
ATOM   641  C  CA    . ILE B 1 7  ? 11.995 33.014 36.103 1.00 35.12  ? 569  ILE B CA    1 
ATOM   642  C  C     . ILE B 1 7  ? 10.858 32.798 37.087 1.00 35.78  ? 569  ILE B C     1 
ATOM   643  O  O     . ILE B 1 7  ? 10.866 31.806 37.838 1.00 35.53  ? 569  ILE B O     1 
ATOM   644  C  CB    . ILE B 1 7  ? 12.788 34.290 36.467 1.00 34.52  ? 569  ILE B CB    1 
ATOM   645  C  CG1   . ILE B 1 7  ? 13.750 34.674 35.342 1.00 32.66  ? 569  ILE B CG1   1 
ATOM   646  C  CG2   . ILE B 1 7  ? 13.559 34.092 37.764 1.00 32.79  ? 569  ILE B CG2   1 
ATOM   647  C  CD1   . ILE B 1 7  ? 14.641 33.521 34.847 1.00 32.80  ? 569  ILE B CD1   1 
ATOM   648  N  N     . CYS B 1 8  ? 9.874  33.697 37.088 1.00 35.17  ? 570  CYS B N     1 
ATOM   649  C  CA    . CYS B 1 8  ? 8.874  33.670 38.153 1.00 35.80  ? 570  CYS B CA    1 
ATOM   650  C  C     . CYS B 1 8  ? 7.428  33.346 37.753 1.00 36.20  ? 570  CYS B C     1 
ATOM   651  O  O     . CYS B 1 8  ? 6.582  33.110 38.617 1.00 35.59  ? 570  CYS B O     1 
ATOM   652  C  CB    . CYS B 1 8  ? 8.918  34.984 38.923 1.00 36.06  ? 570  CYS B CB    1 
ATOM   653  S  SG    . CYS B 1 8  ? 8.124  36.317 38.008 1.00 37.02  ? 570  CYS B SG    1 
ATOM   654  N  N     . GLY B 1 9  ? 7.128  33.339 36.461 1.00 37.45  ? 571  GLY B N     1 
ATOM   655  C  CA    . GLY B 1 9  ? 5.786  33.010 36.024 1.00 38.86  ? 571  GLY B CA    1 
ATOM   656  C  C     . GLY B 1 9  ? 4.847  34.210 35.969 1.00 40.13  ? 571  GLY B C     1 
ATOM   657  O  O     . GLY B 1 9  ? 3.692  34.065 35.573 1.00 39.80  ? 571  GLY B O     1 
ATOM   658  N  N     . ASP B 1 10 ? 5.341  35.382 36.368 1.00 40.95  ? 572  ASP B N     1 
ATOM   659  C  CA    . ASP B 1 10 ? 4.631  36.646 36.184 1.00 42.53  ? 572  ASP B CA    1 
ATOM   660  C  C     . ASP B 1 10 ? 4.543  36.920 34.686 1.00 43.22  ? 572  ASP B C     1 
ATOM   661  O  O     . ASP B 1 10 ? 5.165  36.211 33.877 1.00 42.38  ? 572  ASP B O     1 
ATOM   662  C  CB    . ASP B 1 10 ? 5.390  37.798 36.867 1.00 43.06  ? 572  ASP B CB    1 
ATOM   663  C  CG    . ASP B 1 10 ? 4.520  39.031 37.130 1.00 44.61  ? 572  ASP B CG    1 
ATOM   664  O  OD1   . ASP B 1 10 ? 3.296  38.961 36.864 1.00 46.60  ? 572  ASP B OD1   1 
ATOM   665  O  OD2   . ASP B 1 10 ? 4.977  40.104 37.618 1.00 41.76  ? 572  ASP B OD2   1 
ATOM   666  N  N     . GLU B 1 11 ? 3.770  37.945 34.330 1.00 43.78  ? 573  GLU B N     1 
ATOM   667  C  CA    . GLU B 1 11 ? 3.656  38.378 32.947 1.00 44.80  ? 573  GLU B CA    1 
ATOM   668  C  C     . GLU B 1 11 ? 4.970  39.008 32.524 1.00 43.67  ? 573  GLU B C     1 
ATOM   669  O  O     . GLU B 1 11 ? 5.452  39.941 33.164 1.00 44.49  ? 573  GLU B O     1 
ATOM   670  C  CB    . GLU B 1 11 ? 2.497  39.368 32.782 1.00 45.27  ? 573  GLU B CB    1 
ATOM   671  C  CG    . GLU B 1 11 ? 2.445  40.066 31.429 1.00 48.92  ? 573  GLU B CG    1 
ATOM   672  C  CD    . GLU B 1 11 ? 1.166  40.855 31.243 1.00 52.93  ? 573  GLU B CD    1 
ATOM   673  O  OE1   . GLU B 1 11 ? 1.006  41.899 31.920 1.00 55.10  ? 573  GLU B OE1   1 
ATOM   674  O  OE2   . GLU B 1 11 ? 0.316  40.422 30.435 1.00 54.84  ? 573  GLU B OE2   1 
ATOM   675  N  N     . ALA B 1 12 ? 5.550  38.483 31.452 1.00 43.53  ? 574  ALA B N     1 
ATOM   676  C  CA    . ALA B 1 12 ? 6.815  39.001 30.942 1.00 43.62  ? 574  ALA B CA    1 
ATOM   677  C  C     . ALA B 1 12 ? 6.621  40.331 30.207 1.00 43.55  ? 574  ALA B C     1 
ATOM   678  O  O     . ALA B 1 12 ? 5.561  40.587 29.635 1.00 43.53  ? 574  ALA B O     1 
ATOM   679  C  CB    . ALA B 1 12 ? 7.452  37.992 30.050 1.00 43.19  ? 574  ALA B CB    1 
ATOM   680  N  N     . SER B 1 13 ? 7.648  41.171 30.237 1.00 43.55  ? 575  SER B N     1 
ATOM   681  C  CA    . SER B 1 13 ? 7.601  42.472 29.582 1.00 43.47  ? 575  SER B CA    1 
ATOM   682  C  C     . SER B 1 13 ? 8.397  42.501 28.280 1.00 44.27  ? 575  SER B C     1 
ATOM   683  O  O     . SER B 1 13 ? 8.190  43.393 27.453 1.00 44.85  ? 575  SER B O     1 
ATOM   684  C  CB    . SER B 1 13 ? 8.094  43.573 30.523 1.00 43.14  ? 575  SER B CB    1 
ATOM   685  O  OG    . SER B 1 13 ? 9.462  43.398 30.835 1.00 41.47  ? 575  SER B OG    1 
ATOM   686  N  N     . GLY B 1 14 ? 9.302  41.536 28.107 1.00 44.85  ? 576  GLY B N     1 
ATOM   687  C  CA    . GLY B 1 14 ? 10.144 41.437 26.924 1.00 44.77  ? 576  GLY B CA    1 
ATOM   688  C  C     . GLY B 1 14 ? 11.370 40.565 27.148 1.00 45.68  ? 576  GLY B C     1 
ATOM   689  O  O     . GLY B 1 14 ? 11.500 39.904 28.187 1.00 45.81  ? 576  GLY B O     1 
ATOM   690  N  N     . CYS B 1 15 ? 12.276 40.550 26.177 1.00 45.49  ? 577  CYS B N     1 
ATOM   691  C  CA    . CYS B 1 15 ? 13.480 39.735 26.286 1.00 45.75  ? 577  CYS B CA    1 
ATOM   692  C  C     . CYS B 1 15 ? 14.592 40.556 26.952 1.00 45.17  ? 577  CYS B C     1 
ATOM   693  O  O     . CYS B 1 15 ? 15.099 41.509 26.367 1.00 45.14  ? 577  CYS B O     1 
ATOM   694  C  CB    . CYS B 1 15 ? 13.875 39.205 24.897 1.00 46.24  ? 577  CYS B CB    1 
ATOM   695  S  SG    . CYS B 1 15 ? 15.356 38.166 24.828 1.00 48.20  ? 577  CYS B SG    1 
ATOM   696  N  N     . HIS B 1 16 ? 14.956 40.200 28.186 1.00 44.62  ? 578  HIS B N     1 
ATOM   697  C  CA    . HIS B 1 16 ? 15.891 41.009 28.980 1.00 43.43  ? 578  HIS B CA    1 
ATOM   698  C  C     . HIS B 1 16 ? 17.147 40.237 29.356 1.00 43.20  ? 578  HIS B C     1 
ATOM   699  O  O     . HIS B 1 16 ? 17.073 39.167 29.949 1.00 43.10  ? 578  HIS B O     1 
ATOM   700  C  CB    . HIS B 1 16 ? 15.216 41.521 30.249 1.00 42.83  ? 578  HIS B CB    1 
ATOM   701  C  CG    . HIS B 1 16 ? 13.915 42.214 30.008 1.00 42.36  ? 578  HIS B CG    1 
ATOM   702  N  ND1   . HIS B 1 16 ? 13.831 43.456 29.422 1.00 42.87  ? 578  HIS B ND1   1 
ATOM   703  C  CD2   . HIS B 1 16 ? 12.642 41.846 30.289 1.00 43.35  ? 578  HIS B CD2   1 
ATOM   704  C  CE1   . HIS B 1 16 ? 12.564 43.823 29.345 1.00 43.03  ? 578  HIS B CE1   1 
ATOM   705  N  NE2   . HIS B 1 16 ? 11.821 42.861 29.859 1.00 43.24  ? 578  HIS B NE2   1 
ATOM   706  N  N     . TYR B 1 17 ? 18.306 40.778 29.010 1.00 43.45  ? 579  TYR B N     1 
ATOM   707  C  CA    . TYR B 1 17 ? 19.565 40.064 29.218 1.00 43.59  ? 579  TYR B CA    1 
ATOM   708  C  C     . TYR B 1 17 ? 19.542 38.633 28.622 1.00 43.93  ? 579  TYR B C     1 
ATOM   709  O  O     . TYR B 1 17 ? 20.257 37.741 29.101 1.00 44.47  ? 579  TYR B O     1 
ATOM   710  C  CB    . TYR B 1 17 ? 19.903 40.047 30.713 1.00 43.59  ? 579  TYR B CB    1 
ATOM   711  C  CG    . TYR B 1 17 ? 19.936 41.434 31.330 1.00 43.94  ? 579  TYR B CG    1 
ATOM   712  C  CD1   . TYR B 1 17 ? 18.999 41.828 32.295 1.00 42.86  ? 579  TYR B CD1   1 
ATOM   713  C  CD2   . TYR B 1 17 ? 20.894 42.356 30.936 1.00 43.17  ? 579  TYR B CD2   1 
ATOM   714  C  CE1   . TYR B 1 17 ? 19.032 43.105 32.841 1.00 42.83  ? 579  TYR B CE1   1 
ATOM   715  C  CE2   . TYR B 1 17 ? 20.936 43.628 31.478 1.00 44.13  ? 579  TYR B CE2   1 
ATOM   716  C  CZ    . TYR B 1 17 ? 20.011 44.000 32.427 1.00 44.15  ? 579  TYR B CZ    1 
ATOM   717  O  OH    . TYR B 1 17 ? 20.095 45.275 32.947 1.00 45.53  ? 579  TYR B OH    1 
ATOM   718  N  N     . GLY B 1 18 ? 18.698 38.420 27.607 1.00 42.93  ? 580  GLY B N     1 
ATOM   719  C  CA    . GLY B 1 18 ? 18.688 37.189 26.831 1.00 42.41  ? 580  GLY B CA    1 
ATOM   720  C  C     . GLY B 1 18 ? 17.458 36.306 26.977 1.00 42.23  ? 580  GLY B C     1 
ATOM   721  O  O     . GLY B 1 18 ? 17.225 35.384 26.188 1.00 41.75  ? 580  GLY B O     1 
ATOM   722  N  N     . VAL B 1 19 ? 16.656 36.584 27.997 1.00 42.31  ? 581  VAL B N     1 
ATOM   723  C  CA    . VAL B 1 19 ? 15.594 35.668 28.384 1.00 41.63  ? 581  VAL B CA    1 
ATOM   724  C  C     . VAL B 1 19 ? 14.290 36.431 28.561 1.00 41.38  ? 581  VAL B C     1 
ATOM   725  O  O     . VAL B 1 19 ? 14.291 37.578 29.023 1.00 41.34  ? 581  VAL B O     1 
ATOM   726  C  CB    . VAL B 1 19 ? 15.975 34.906 29.696 1.00 41.47  ? 581  VAL B CB    1 
ATOM   727  C  CG1   . VAL B 1 19 ? 14.829 34.031 30.189 1.00 41.18  ? 581  VAL B CG1   1 
ATOM   728  C  CG2   . VAL B 1 19 ? 17.225 34.058 29.488 1.00 41.92  ? 581  VAL B CG2   1 
ATOM   729  N  N     . LEU B 1 20 ? 13.194 35.786 28.170 1.00 40.75  ? 582  LEU B N     1 
ATOM   730  C  CA    . LEU B 1 20 ? 11.850 36.281 28.410 1.00 40.65  ? 582  LEU B CA    1 
ATOM   731  C  C     . LEU B 1 20 ? 11.628 36.397 29.912 1.00 41.11  ? 582  LEU B C     1 
ATOM   732  O  O     . LEU B 1 20 ? 11.479 35.376 30.600 1.00 41.55  ? 582  LEU B O     1 
ATOM   733  C  CB    . LEU B 1 20 ? 10.840 35.279 27.850 1.00 40.70  ? 582  LEU B CB    1 
ATOM   734  C  CG    . LEU B 1 20 ? 9.610  35.644 27.015 1.00 41.03  ? 582  LEU B CG    1 
ATOM   735  C  CD1   . LEU B 1 20 ? 8.583  34.520 27.102 1.00 39.12  ? 582  LEU B CD1   1 
ATOM   736  C  CD2   . LEU B 1 20 ? 8.979  36.971 27.387 1.00 39.71  ? 582  LEU B CD2   1 
ATOM   737  N  N     . THR B 1 21 ? 11.609 37.628 30.422 1.00 40.46  ? 583  THR B N     1 
ATOM   738  C  CA    . THR B 1 21 ? 11.314 37.866 31.833 1.00 40.29  ? 583  THR B CA    1 
ATOM   739  C  C     . THR B 1 21 ? 10.386 39.044 32.077 1.00 41.18  ? 583  THR B C     1 
ATOM   740  O  O     . THR B 1 21 ? 10.117 39.858 31.184 1.00 42.55  ? 583  THR B O     1 
ATOM   741  C  CB    . THR B 1 21 ? 12.579 38.151 32.641 1.00 39.96  ? 583  THR B CB    1 
ATOM   742  O  OG1   . THR B 1 21 ? 12.939 39.521 32.435 1.00 38.42  ? 583  THR B OG1   1 
ATOM   743  C  CG2   . THR B 1 21 ? 13.775 37.337 32.156 1.00 39.02  ? 583  THR B CG2   1 
ATOM   744  N  N     . CYS B 1 22 ? 9.946  39.151 33.327 1.00 40.33  ? 584  CYS B N     1 
ATOM   745  C  CA    . CYS B 1 22 ? 9.096  40.239 33.763 1.00 39.48  ? 584  CYS B CA    1 
ATOM   746  C  C     . CYS B 1 22 ? 10.021 41.400 34.123 1.00 39.36  ? 584  CYS B C     1 
ATOM   747  O  O     . CYS B 1 22 ? 11.248 41.244 34.107 1.00 39.73  ? 584  CYS B O     1 
ATOM   748  C  CB    . CYS B 1 22 ? 8.248  39.793 34.960 1.00 38.50  ? 584  CYS B CB    1 
ATOM   749  S  SG    . CYS B 1 22 ? 9.188  39.572 36.491 1.00 37.76  ? 584  CYS B SG    1 
ATOM   750  N  N     . GLY B 1 23 ? 9.441  42.559 34.437 1.00 38.66  ? 585  GLY B N     1 
ATOM   751  C  CA    . GLY B 1 23 ? 10.226 43.724 34.813 1.00 37.09  ? 585  GLY B CA    1 
ATOM   752  C  C     . GLY B 1 23 ? 11.005 43.540 36.104 1.00 36.24  ? 585  GLY B C     1 
ATOM   753  O  O     . GLY B 1 23 ? 12.146 43.975 36.192 1.00 35.72  ? 585  GLY B O     1 
ATOM   754  N  N     . SER B 1 24 ? 10.409 42.875 37.092 1.00 35.97  ? 586  SER B N     1 
ATOM   755  C  CA    . SER B 1 24 ? 11.083 42.666 38.377 1.00 35.57  ? 586  SER B CA    1 
ATOM   756  C  C     . SER B 1 24 ? 12.303 41.742 38.292 1.00 35.65  ? 586  SER B C     1 
ATOM   757  O  O     . SER B 1 24 ? 13.345 42.036 38.875 1.00 34.91  ? 586  SER B O     1 
ATOM   758  C  CB    . SER B 1 24 ? 10.114 42.217 39.486 1.00 35.77  ? 586  SER B CB    1 
ATOM   759  O  OG    . SER B 1 24 ? 9.522  40.957 39.217 1.00 34.28  ? 586  SER B OG    1 
ATOM   760  N  N     . CYS B 1 25 ? 12.197 40.643 37.556 1.00 35.40  ? 587  CYS B N     1 
ATOM   761  C  CA    . CYS B 1 25 ? 13.367 39.782 37.421 1.00 35.63  ? 587  CYS B CA    1 
ATOM   762  C  C     . CYS B 1 25 ? 14.486 40.495 36.630 1.00 36.19  ? 587  CYS B C     1 
ATOM   763  O  O     . CYS B 1 25 ? 15.684 40.250 36.853 1.00 35.45  ? 587  CYS B O     1 
ATOM   764  C  CB    . CYS B 1 25 ? 12.974 38.433 36.828 1.00 35.44  ? 587  CYS B CB    1 
ATOM   765  S  SG    . CYS B 1 25 ? 11.843 37.545 37.926 1.00 34.93  ? 587  CYS B SG    1 
ATOM   766  N  N     . LYS B 1 26 ? 14.086 41.409 35.745 1.00 35.76  ? 588  LYS B N     1 
ATOM   767  C  CA    . LYS B 1 26 ? 15.044 42.209 35.013 1.00 36.19  ? 588  LYS B CA    1 
ATOM   768  C  C     . LYS B 1 26 ? 15.916 43.009 35.965 1.00 35.70  ? 588  LYS B C     1 
ATOM   769  O  O     . LYS B 1 26 ? 17.123 42.818 35.984 1.00 35.94  ? 588  LYS B O     1 
ATOM   770  C  CB    . LYS B 1 26 ? 14.353 43.113 33.984 1.00 37.02  ? 588  LYS B CB    1 
ATOM   771  C  CG    . LYS B 1 26 ? 15.315 43.978 33.165 1.00 37.17  ? 588  LYS B CG    1 
ATOM   772  C  CD    . LYS B 1 26 ? 14.603 45.183 32.553 1.00 38.19  ? 588  LYS B CD    1 
ATOM   773  C  CE    . LYS B 1 26 ? 15.591 46.253 32.127 1.00 38.25  ? 588  LYS B CE    1 
ATOM   774  N  NZ    . LYS B 1 26 ? 15.605 47.377 33.102 1.00 37.62  ? 588  LYS B NZ    1 
ATOM   775  N  N     . VAL B 1 27 ? 15.326 43.900 36.760 1.00 36.11  ? 589  VAL B N     1 
ATOM   776  C  CA    . VAL B 1 27 ? 16.129 44.666 37.723 1.00 35.62  ? 589  VAL B CA    1 
ATOM   777  C  C     . VAL B 1 27 ? 16.806 43.777 38.734 1.00 35.54  ? 589  VAL B C     1 
ATOM   778  O  O     . VAL B 1 27 ? 17.903 44.096 39.211 1.00 36.17  ? 589  VAL B O     1 
ATOM   779  C  CB    . VAL B 1 27 ? 15.331 45.662 38.606 1.00 35.81  ? 589  VAL B CB    1 
ATOM   780  C  CG1   . VAL B 1 27 ? 16.005 47.035 38.573 1.00 35.83  ? 589  VAL B CG1   1 
ATOM   781  C  CG2   . VAL B 1 27 ? 13.878 45.710 38.262 1.00 34.75  ? 589  VAL B CG2   1 
ATOM   782  N  N     . PHE B 1 28 ? 16.119 42.706 39.121 1.00 35.46  ? 590  PHE B N     1 
ATOM   783  C  CA    . PHE B 1 28 ? 16.659 41.830 40.144 1.00 35.55  ? 590  PHE B CA    1 
ATOM   784  C  C     . PHE B 1 28 ? 18.001 41.288 39.680 1.00 36.61  ? 590  PHE B C     1 
ATOM   785  O  O     . PHE B 1 28 ? 19.007 41.408 40.388 1.00 37.19  ? 590  PHE B O     1 
ATOM   786  C  CB    . PHE B 1 28 ? 15.741 40.663 40.514 1.00 33.52  ? 590  PHE B CB    1 
ATOM   787  C  CG    . PHE B 1 28 ? 16.436 39.641 41.346 1.00 31.71  ? 590  PHE B CG    1 
ATOM   788  C  CD1   . PHE B 1 28 ? 16.637 39.863 42.706 1.00 29.80  ? 590  PHE B CD1   1 
ATOM   789  C  CD2   . PHE B 1 28 ? 16.989 38.510 40.765 1.00 29.37  ? 590  PHE B CD2   1 
ATOM   790  C  CE1   . PHE B 1 28 ? 17.318 38.955 43.482 1.00 28.23  ? 590  PHE B CE1   1 
ATOM   791  C  CE2   . PHE B 1 28 ? 17.673 37.590 41.541 1.00 29.89  ? 590  PHE B CE2   1 
ATOM   792  C  CZ    . PHE B 1 28 ? 17.834 37.813 42.905 1.00 27.75  ? 590  PHE B CZ    1 
ATOM   793  N  N     . PHE B 1 29 ? 18.003 40.699 38.492 1.00 37.32  ? 591  PHE B N     1 
ATOM   794  C  CA    . PHE B 1 29 ? 19.205 40.090 37.966 1.00 38.84  ? 591  PHE B CA    1 
ATOM   795  C  C     . PHE B 1 29 ? 20.287 41.136 37.910 1.00 39.52  ? 591  PHE B C     1 
ATOM   796  O  O     . PHE B 1 29 ? 21.382 40.918 38.428 1.00 39.92  ? 591  PHE B O     1 
ATOM   797  C  CB    . PHE B 1 29 ? 18.940 39.502 36.586 1.00 39.19  ? 591  PHE B CB    1 
ATOM   798  C  CG    . PHE B 1 29 ? 20.160 38.960 35.904 1.00 39.19  ? 591  PHE B CG    1 
ATOM   799  C  CD1   . PHE B 1 29 ? 20.698 37.731 36.278 1.00 39.42  ? 591  PHE B CD1   1 
ATOM   800  C  CD2   . PHE B 1 29 ? 20.744 39.658 34.853 1.00 39.54  ? 591  PHE B CD2   1 
ATOM   801  C  CE1   . PHE B 1 29 ? 21.803 37.208 35.616 1.00 40.09  ? 591  PHE B CE1   1 
ATOM   802  C  CE2   . PHE B 1 29 ? 21.848 39.144 34.180 1.00 39.11  ? 591  PHE B CE2   1 
ATOM   803  C  CZ    . PHE B 1 29 ? 22.383 37.920 34.562 1.00 40.04  ? 591  PHE B CZ    1 
ATOM   804  N  N     . LYS B 1 30 ? 19.972 42.285 37.317 1.00 40.40  ? 592  LYS B N     1 
ATOM   805  C  CA    . LYS B 1 30 ? 20.963 43.346 37.199 1.00 41.08  ? 592  LYS B CA    1 
ATOM   806  C  C     . LYS B 1 30 ? 21.548 43.695 38.559 1.00 41.55  ? 592  LYS B C     1 
ATOM   807  O  O     . LYS B 1 30 ? 22.772 43.661 38.725 1.00 41.65  ? 592  LYS B O     1 
ATOM   808  C  CB    . LYS B 1 30 ? 20.407 44.581 36.479 1.00 41.49  ? 592  LYS B CB    1 
ATOM   809  C  CG    . LYS B 1 30 ? 21.399 45.758 36.387 1.00 42.15  ? 592  LYS B CG    1 
ATOM   810  C  CD    . LYS B 1 30 ? 22.577 45.447 35.449 1.00 41.63  ? 592  LYS B CD    1 
ATOM   811  C  CE    . LYS B 1 30 ? 23.403 46.692 35.080 1.00 43.47  ? 592  LYS B CE    1 
ATOM   812  N  NZ    . LYS B 1 30 ? 22.710 47.997 35.285 1.00 42.90  ? 592  LYS B NZ    1 
ATOM   813  N  N     . ARG B 1 31 ? 20.685 43.984 39.536 1.00 41.89  ? 593  ARG B N     1 
ATOM   814  C  CA    . ARG B 1 31 ? 21.149 44.317 40.893 1.00 42.74  ? 593  ARG B CA    1 
ATOM   815  C  C     . ARG B 1 31 ? 21.927 43.186 41.563 1.00 43.26  ? 593  ARG B C     1 
ATOM   816  O  O     . ARG B 1 31 ? 22.926 43.435 42.239 1.00 42.49  ? 593  ARG B O     1 
ATOM   817  C  CB    . ARG B 1 31 ? 19.990 44.737 41.795 1.00 42.65  ? 593  ARG B CB    1 
ATOM   818  C  CG    . ARG B 1 31 ? 19.415 46.112 41.491 1.00 43.07  ? 593  ARG B CG    1 
ATOM   819  C  CD    . ARG B 1 31 ? 17.976 46.280 41.948 1.00 43.66  ? 593  ARG B CD    1 
ATOM   820  N  NE    . ARG B 1 31 ? 17.522 47.655 41.796 1.00 42.83  ? 593  ARG B NE    1 
ATOM   821  C  CZ    . ARG B 1 31 ? 16.250 48.017 41.798 1.00 42.43  ? 593  ARG B CZ    1 
ATOM   822  N  NH1   . ARG B 1 31 ? 15.290 47.109 41.942 1.00 41.43  ? 593  ARG B NH1   1 
ATOM   823  N  NH2   . ARG B 1 31 ? 15.936 49.293 41.639 1.00 41.47  ? 593  ARG B NH2   1 
ATOM   824  N  N     . ALA B 1 32 ? 21.472 41.949 41.364 1.00 44.32  ? 594  ALA B N     1 
ATOM   825  C  CA    . ALA B 1 32 ? 22.112 40.795 41.994 1.00 46.73  ? 594  ALA B CA    1 
ATOM   826  C  C     . ALA B 1 32 ? 23.545 40.545 41.512 1.00 47.79  ? 594  ALA B C     1 
ATOM   827  O  O     . ALA B 1 32 ? 24.441 40.366 42.338 1.00 47.37  ? 594  ALA B O     1 
ATOM   828  C  CB    . ALA B 1 32 ? 21.250 39.522 41.866 1.00 45.94  ? 594  ALA B CB    1 
ATOM   829  N  N     . MET B 1 33 ? 23.749 40.535 40.193 1.00 49.59  ? 595  MET B N     1 
ATOM   830  C  CA    . MET B 1 33 ? 25.073 40.331 39.603 1.00 51.44  ? 595  MET B CA    1 
ATOM   831  C  C     . MET B 1 33 ? 25.998 41.493 39.930 1.00 53.51  ? 595  MET B C     1 
ATOM   832  O  O     . MET B 1 33 ? 27.202 41.305 40.086 1.00 53.80  ? 595  MET B O     1 
ATOM   833  C  CB    . MET B 1 33 ? 24.985 40.202 38.080 1.00 51.09  ? 595  MET B CB    1 
ATOM   834  C  CG    . MET B 1 33 ? 24.203 39.013 37.559 1.00 51.40  ? 595  MET B CG    1 
ATOM   835  S  SD    . MET B 1 33 ? 24.872 37.451 38.158 1.00 53.75  ? 595  MET B SD    1 
ATOM   836  C  CE    . MET B 1 33 ? 25.973 36.988 36.825 1.00 51.04  ? 595  MET B CE    1 
ATOM   837  N  N     . GLU B 1 34 ? 25.422 42.690 40.035 1.00 55.86  ? 596  GLU B N     1 
ATOM   838  C  CA    . GLU B 1 34 ? 26.190 43.928 40.120 1.00 58.47  ? 596  GLU B CA    1 
ATOM   839  C  C     . GLU B 1 34 ? 26.828 44.160 41.480 1.00 59.19  ? 596  GLU B C     1 
ATOM   840  O  O     . GLU B 1 34 ? 28.039 44.339 41.564 1.00 59.51  ? 596  GLU B O     1 
ATOM   841  C  CB    . GLU B 1 34 ? 25.320 45.130 39.730 1.00 59.69  ? 596  GLU B CB    1 
ATOM   842  C  CG    . GLU B 1 34 ? 26.015 46.160 38.854 1.00 63.24  ? 596  GLU B CG    1 
ATOM   843  C  CD    . GLU B 1 34 ? 26.417 45.614 37.491 1.00 66.22  ? 596  GLU B CD    1 
ATOM   844  O  OE1   . GLU B 1 34 ? 27.235 44.661 37.436 1.00 67.49  ? 596  GLU B OE1   1 
ATOM   845  O  OE2   . GLU B 1 34 ? 25.923 46.149 36.469 1.00 67.63  ? 596  GLU B OE2   1 
ATOM   846  N  N     . GLY B 1 35 ? 26.015 44.186 42.535 1.00 60.34  ? 597  GLY B N     1 
ATOM   847  C  CA    . GLY B 1 35 ? 26.526 44.282 43.893 1.00 61.80  ? 597  GLY B CA    1 
ATOM   848  C  C     . GLY B 1 35 ? 27.014 42.903 44.279 1.00 62.96  ? 597  GLY B C     1 
ATOM   849  O  O     . GLY B 1 35 ? 26.556 41.910 43.709 1.00 63.98  ? 597  GLY B O     1 
ATOM   850  N  N     . GLN B 1 36 ? 27.959 42.799 45.198 1.00 63.25  ? 598  GLN B N     1 
ATOM   851  C  CA    . GLN B 1 36 ? 28.333 41.453 45.611 1.00 64.50  ? 598  GLN B CA    1 
ATOM   852  C  C     . GLN B 1 36 ? 27.626 41.155 46.920 1.00 62.88  ? 598  GLN B C     1 
ATOM   853  O  O     . GLN B 1 36 ? 27.999 41.656 47.984 1.00 63.77  ? 598  GLN B O     1 
ATOM   854  C  CB    . GLN B 1 36 ? 29.856 41.230 45.650 1.00 66.12  ? 598  GLN B CB    1 
ATOM   855  C  CG    . GLN B 1 36 ? 30.342 39.823 45.151 1.00 71.17  ? 598  GLN B CG    1 
ATOM   856  C  CD    . GLN B 1 36 ? 29.492 39.196 44.015 1.00 75.31  ? 598  GLN B CD    1 
ATOM   857  O  OE1   . GLN B 1 36 ? 29.692 39.506 42.831 1.00 77.12  ? 598  GLN B OE1   1 
ATOM   858  N  NE2   . GLN B 1 36 ? 28.566 38.299 44.382 1.00 76.14  ? 598  GLN B NE2   1 
ATOM   859  N  N     . HIS B 1 37 ? 26.560 40.376 46.809 1.00 60.40  ? 599  HIS B N     1 
ATOM   860  C  CA    . HIS B 1 37 ? 25.645 40.184 47.919 1.00 57.97  ? 599  HIS B CA    1 
ATOM   861  C  C     . HIS B 1 37 ? 25.912 38.862 48.595 1.00 55.44  ? 599  HIS B C     1 
ATOM   862  O  O     . HIS B 1 37 ? 25.517 38.669 49.747 1.00 55.61  ? 599  HIS B O     1 
ATOM   863  C  CB    . HIS B 1 37 ? 24.203 40.187 47.423 1.00 58.96  ? 599  HIS B CB    1 
ATOM   864  C  CG    . HIS B 1 37 ? 23.748 41.496 46.860 1.00 60.04  ? 599  HIS B CG    1 
ATOM   865  N  ND1   . HIS B 1 37 ? 23.536 42.610 47.644 1.00 60.97  ? 599  HIS B ND1   1 
ATOM   866  C  CD2   . HIS B 1 37 ? 23.433 41.858 45.595 1.00 60.58  ? 599  HIS B CD2   1 
ATOM   867  C  CE1   . HIS B 1 37 ? 23.123 43.608 46.883 1.00 62.20  ? 599  HIS B CE1   1 
ATOM   868  N  NE2   . HIS B 1 37 ? 23.049 43.176 45.636 1.00 62.60  ? 599  HIS B NE2   1 
ATOM   869  N  N     . ASN B 1 38 ? 26.565 37.959 47.863 1.00 51.81  ? 600  ASN B N     1 
ATOM   870  C  CA    . ASN B 1 38 ? 26.809 36.586 48.305 1.00 48.55  ? 600  ASN B CA    1 
ATOM   871  C  C     . ASN B 1 38 ? 25.556 35.962 48.927 1.00 45.40  ? 600  ASN B C     1 
ATOM   872  O  O     . ASN B 1 38 ? 25.527 35.586 50.100 1.00 45.11  ? 600  ASN B O     1 
ATOM   873  C  CB    . ASN B 1 38 ? 28.036 36.522 49.241 1.00 48.66  ? 600  ASN B CB    1 
ATOM   874  C  CG    . ASN B 1 38 ? 28.408 35.092 49.644 1.00 48.80  ? 600  ASN B CG    1 
ATOM   875  O  OD1   . ASN B 1 38 ? 28.584 34.810 50.832 1.00 48.89  ? 600  ASN B OD1   1 
ATOM   876  N  ND2   . ASN B 1 38 ? 28.510 34.186 48.664 1.00 47.73  ? 600  ASN B ND2   1 
ATOM   877  N  N     . TYR B 1 39 ? 24.501 35.889 48.130 1.00 41.98  ? 601  TYR B N     1 
ATOM   878  C  CA    . TYR B 1 39 ? 23.229 35.387 48.623 1.00 39.29  ? 601  TYR B CA    1 
ATOM   879  C  C     . TYR B 1 39 ? 23.326 33.887 48.920 1.00 37.05  ? 601  TYR B C     1 
ATOM   880  O  O     . TYR B 1 39 ? 23.802 33.112 48.079 1.00 34.91  ? 601  TYR B O     1 
ATOM   881  C  CB    . TYR B 1 39 ? 22.146 35.590 47.581 1.00 39.07  ? 601  TYR B CB    1 
ATOM   882  C  CG    . TYR B 1 39 ? 21.716 37.005 47.300 1.00 39.89  ? 601  TYR B CG    1 
ATOM   883  C  CD1   . TYR B 1 39 ? 21.309 37.863 48.318 1.00 40.33  ? 601  TYR B CD1   1 
ATOM   884  C  CD2   . TYR B 1 39 ? 21.660 37.468 45.986 1.00 41.20  ? 601  TYR B CD2   1 
ATOM   885  C  CE1   . TYR B 1 39 ? 20.873 39.149 48.028 1.00 41.06  ? 601  TYR B CE1   1 
ATOM   886  C  CE2   . TYR B 1 39 ? 21.229 38.742 45.686 1.00 42.28  ? 601  TYR B CE2   1 
ATOM   887  C  CZ    . TYR B 1 39 ? 20.834 39.574 46.707 1.00 41.91  ? 601  TYR B CZ    1 
ATOM   888  O  OH    . TYR B 1 39 ? 20.418 40.834 46.381 1.00 44.15  ? 601  TYR B OH    1 
ATOM   889  N  N     . LEU B 1 40 ? 22.881 33.484 50.106 1.00 34.14  ? 602  LEU B N     1 
ATOM   890  C  CA    . LEU B 1 40 ? 22.834 32.054 50.419 1.00 33.53  ? 602  LEU B CA    1 
ATOM   891  C  C     . LEU B 1 40 ? 21.434 31.594 50.743 1.00 32.37  ? 602  LEU B C     1 
ATOM   892  O  O     . LEU B 1 40 ? 20.753 32.166 51.594 1.00 32.23  ? 602  LEU B O     1 
ATOM   893  C  CB    . LEU B 1 40 ? 23.784 31.648 51.557 1.00 32.42  ? 602  LEU B CB    1 
ATOM   894  C  CG    . LEU B 1 40 ? 25.159 32.298 51.666 1.00 32.52  ? 602  LEU B CG    1 
ATOM   895  C  CD1   . LEU B 1 40 ? 25.757 32.082 53.057 1.00 32.05  ? 602  LEU B CD1   1 
ATOM   896  C  CD2   . LEU B 1 40 ? 26.078 31.772 50.595 1.00 32.73  ? 602  LEU B CD2   1 
ATOM   897  N  N     . CYS B 1 41 ? 21.025 30.537 50.061 1.00 31.77  ? 603  CYS B N     1 
ATOM   898  C  CA    . CYS B 1 41 ? 19.732 29.931 50.310 1.00 30.40  ? 603  CYS B CA    1 
ATOM   899  C  C     . CYS B 1 41 ? 19.677 29.496 51.768 1.00 30.61  ? 603  CYS B C     1 
ATOM   900  O  O     . CYS B 1 41 ? 20.621 28.882 52.281 1.00 30.94  ? 603  CYS B O     1 
ATOM   901  C  CB    . CYS B 1 41 ? 19.528 28.748 49.376 1.00 28.81  ? 603  CYS B CB    1 
ATOM   902  S  SG    . CYS B 1 41 ? 17.925 27.983 49.598 1.00 29.15  ? 603  CYS B SG    1 
ATOM   903  N  N     . ALA B 1 42 ? 18.587 29.854 52.442 1.00 30.96  ? 604  ALA B N     1 
ATOM   904  C  CA    . ALA B 1 42 ? 18.391 29.484 53.836 1.00 30.67  ? 604  ALA B CA    1 
ATOM   905  C  C     . ALA B 1 42 ? 17.767 28.085 53.920 1.00 31.66  ? 604  ALA B C     1 
ATOM   906  O  O     . ALA B 1 42 ? 17.685 27.486 55.006 1.00 31.41  ? 604  ALA B O     1 
ATOM   907  C  CB    . ALA B 1 42 ? 17.548 30.509 54.540 1.00 29.33  ? 604  ALA B CB    1 
ATOM   908  N  N     . GLY B 1 43 ? 17.339 27.568 52.774 1.00 31.67  ? 605  GLY B N     1 
ATOM   909  C  CA    . GLY B 1 43 ? 16.873 26.197 52.694 1.00 34.13  ? 605  GLY B CA    1 
ATOM   910  C  C     . GLY B 1 43 ? 17.902 25.336 51.985 1.00 35.73  ? 605  GLY B C     1 
ATOM   911  O  O     . GLY B 1 43 ? 19.096 25.357 52.328 1.00 36.99  ? 605  GLY B O     1 
ATOM   912  N  N     . ARG B 1 44 ? 17.460 24.603 50.969 1.00 35.32  ? 606  ARG B N     1 
ATOM   913  C  CA    . ARG B 1 44 ? 18.355 23.677 50.287 1.00 36.20  ? 606  ARG B CA    1 
ATOM   914  C  C     . ARG B 1 44 ? 18.512 23.929 48.797 1.00 36.14  ? 606  ARG B C     1 
ATOM   915  O  O     . ARG B 1 44 ? 18.568 22.987 48.014 1.00 36.37  ? 606  ARG B O     1 
ATOM   916  C  CB    . ARG B 1 44 ? 17.903 22.235 50.519 1.00 36.08  ? 606  ARG B CB    1 
ATOM   917  C  CG    . ARG B 1 44 ? 18.881 21.483 51.391 1.00 35.09  ? 606  ARG B CG    1 
ATOM   918  C  CD    . ARG B 1 44 ? 18.404 20.131 51.814 1.00 34.89  ? 606  ARG B CD    1 
ATOM   919  N  NE    . ARG B 1 44 ? 17.371 20.201 52.841 1.00 34.36  ? 606  ARG B NE    1 
ATOM   920  C  CZ    . ARG B 1 44 ? 16.700 19.150 53.287 1.00 32.35  ? 606  ARG B CZ    1 
ATOM   921  N  NH1   . ARG B 1 44 ? 16.972 17.950 52.796 1.00 32.32  ? 606  ARG B NH1   1 
ATOM   922  N  NH2   . ARG B 1 44 ? 15.770 19.294 54.224 1.00 27.62  ? 606  ARG B NH2   1 
ATOM   923  N  N     . ASN B 1 45 ? 18.560 25.197 48.410 1.00 35.80  ? 607  ASN B N     1 
ATOM   924  C  CA    . ASN B 1 45 ? 18.721 25.578 47.007 1.00 35.43  ? 607  ASN B CA    1 
ATOM   925  C  C     . ASN B 1 45 ? 17.641 25.033 46.097 1.00 34.93  ? 607  ASN B C     1 
ATOM   926  O  O     . ASN B 1 45 ? 17.836 24.900 44.893 1.00 34.27  ? 607  ASN B O     1 
ATOM   927  C  CB    . ASN B 1 45 ? 20.105 25.188 46.531 1.00 34.20  ? 607  ASN B CB    1 
ATOM   928  C  CG    . ASN B 1 45 ? 21.147 25.695 47.447 1.00 31.99  ? 607  ASN B CG    1 
ATOM   929  O  OD1   . ASN B 1 45 ? 21.457 26.885 47.445 1.00 30.33  ? 607  ASN B OD1   1 
ATOM   930  N  ND2   . ASN B 1 45 ? 21.675 24.818 48.275 1.00 31.89  ? 607  ASN B ND2   1 
ATOM   931  N  N     . ASP B 1 46 ? 16.498 24.823 46.734 1.00 35.16  ? 608  ASP B N     1 
ATOM   932  C  CA    . ASP B 1 46 ? 15.333 24.061 46.300 1.00 36.67  ? 608  ASP B CA    1 
ATOM   933  C  C     . ASP B 1 46 ? 14.134 24.959 45.955 1.00 34.51  ? 608  ASP B C     1 
ATOM   934  O  O     . ASP B 1 46 ? 13.136 24.479 45.441 1.00 34.20  ? 608  ASP B O     1 
ATOM   935  C  CB    . ASP B 1 46 ? 14.873 23.278 47.554 1.00 38.53  ? 608  ASP B CB    1 
ATOM   936  C  CG    . ASP B 1 46 ? 14.841 21.798 47.346 1.00 42.87  ? 608  ASP B CG    1 
ATOM   937  O  OD1   . ASP B 1 46 ? 14.907 21.367 46.178 1.00 48.78  ? 608  ASP B OD1   1 
ATOM   938  O  OD2   . ASP B 1 46 ? 14.745 20.983 48.290 1.00 46.62  ? 608  ASP B OD2   1 
ATOM   939  N  N     . CYS B 1 47 ? 14.212 26.237 46.320 1.00 32.60  ? 609  CYS B N     1 
ATOM   940  C  CA    . CYS B 1 47 ? 13.031 27.094 46.444 1.00 31.02  ? 609  CYS B CA    1 
ATOM   941  C  C     . CYS B 1 47 ? 12.233 27.271 45.155 1.00 30.85  ? 609  CYS B C     1 
ATOM   942  O  O     . CYS B 1 47 ? 12.795 27.489 44.079 1.00 30.62  ? 609  CYS B O     1 
ATOM   943  C  CB    . CYS B 1 47 ? 13.443 28.470 46.976 1.00 30.73  ? 609  CYS B CB    1 
ATOM   944  S  SG    . CYS B 1 47 ? 14.293 28.397 48.557 1.00 26.96  ? 609  CYS B SG    1 
ATOM   945  N  N     . ILE B 1 48 ? 10.917 27.173 45.265 1.00 30.40  ? 610  ILE B N     1 
ATOM   946  C  CA    . ILE B 1 48 ? 10.076 27.564 44.161 1.00 30.84  ? 610  ILE B CA    1 
ATOM   947  C  C     . ILE B 1 48 ? 10.134 29.071 44.024 1.00 30.96  ? 610  ILE B C     1 
ATOM   948  O  O     . ILE B 1 48 ? 9.880  29.799 44.974 1.00 29.97  ? 610  ILE B O     1 
ATOM   949  C  CB    . ILE B 1 48 ? 8.641  27.072 44.372 1.00 32.40  ? 610  ILE B CB    1 
ATOM   950  C  CG1   . ILE B 1 48 ? 8.559  25.587 43.999 1.00 31.75  ? 610  ILE B CG1   1 
ATOM   951  C  CG2   . ILE B 1 48 ? 7.635  27.907 43.539 1.00 29.99  ? 610  ILE B CG2   1 
ATOM   952  C  CD1   . ILE B 1 48 ? 7.732  24.792 44.966 1.00 36.48  ? 610  ILE B CD1   1 
ATOM   953  N  N     . VAL B 1 49 ? 10.494 29.523 42.830 1.00 32.22  ? 611  VAL B N     1 
ATOM   954  C  CA    . VAL B 1 49 ? 10.512 30.938 42.499 1.00 32.95  ? 611  VAL B CA    1 
ATOM   955  C  C     . VAL B 1 49 ? 9.242  31.274 41.723 1.00 33.39  ? 611  VAL B C     1 
ATOM   956  O  O     . VAL B 1 49 ? 9.179  31.062 40.518 1.00 34.63  ? 611  VAL B O     1 
ATOM   957  C  CB    . VAL B 1 49 ? 11.771 31.270 41.673 1.00 33.51  ? 611  VAL B CB    1 
ATOM   958  C  CG1   . VAL B 1 49 ? 11.916 32.767 41.472 1.00 33.94  ? 611  VAL B CG1   1 
ATOM   959  C  CG2   . VAL B 1 49 ? 13.029 30.723 42.371 1.00 33.91  ? 611  VAL B CG2   1 
ATOM   960  N  N     . ASP B 1 50 ? 8.205  31.749 42.408 1.00 33.88  ? 612  ASP B N     1 
ATOM   961  C  CA    . ASP B 1 50 ? 6.965  32.114 41.716 1.00 34.78  ? 612  ASP B CA    1 
ATOM   962  C  C     . ASP B 1 50 ? 6.585  33.578 41.958 1.00 35.00  ? 612  ASP B C     1 
ATOM   963  O  O     . ASP B 1 50 ? 7.335  34.299 42.590 1.00 35.98  ? 612  ASP B O     1 
ATOM   964  C  CB    . ASP B 1 50 ? 5.820  31.121 42.004 1.00 34.23  ? 612  ASP B CB    1 
ATOM   965  C  CG    . ASP B 1 50 ? 5.434  31.058 43.471 1.00 36.02  ? 612  ASP B CG    1 
ATOM   966  O  OD1   . ASP B 1 50 ? 6.039  31.795 44.291 1.00 35.15  ? 612  ASP B OD1   1 
ATOM   967  O  OD2   . ASP B 1 50 ? 4.524  30.294 43.893 1.00 34.27  ? 612  ASP B OD2   1 
ATOM   968  N  N     . LYS B 1 51 ? 5.440  34.021 41.450 1.00 35.99  ? 613  LYS B N     1 
ATOM   969  C  CA    . LYS B 1 51 ? 5.132  35.454 41.422 1.00 35.79  ? 613  LYS B CA    1 
ATOM   970  C  C     . LYS B 1 51 ? 5.045  36.054 42.821 1.00 34.41  ? 613  LYS B C     1 
ATOM   971  O  O     . LYS B 1 51 ? 5.618  37.098 43.084 1.00 34.52  ? 613  LYS B O     1 
ATOM   972  C  CB    . LYS B 1 51 ? 3.843  35.711 40.625 1.00 37.09  ? 613  LYS B CB    1 
ATOM   973  C  CG    . LYS B 1 51 ? 3.113  37.023 40.963 1.00 40.08  ? 613  LYS B CG    1 
ATOM   974  C  CD    . LYS B 1 51 ? 3.122  37.965 39.780 1.00 44.41  ? 613  LYS B CD    1 
ATOM   975  C  CE    . LYS B 1 51 ? 2.105  39.095 39.931 1.00 46.79  ? 613  LYS B CE    1 
ATOM   976  N  NZ    . LYS B 1 51 ? 0.694  38.618 39.839 1.00 49.15  ? 613  LYS B NZ    1 
ATOM   977  N  N     . ILE B 1 52 ? 4.349  35.370 43.716 1.00 32.98  ? 614  ILE B N     1 
ATOM   978  C  CA    . ILE B 1 52 ? 4.167  35.855 45.067 1.00 32.72  ? 614  ILE B CA    1 
ATOM   979  C  C     . ILE B 1 52 ? 5.437  35.771 45.915 1.00 32.39  ? 614  ILE B C     1 
ATOM   980  O  O     . ILE B 1 52 ? 5.668  36.651 46.750 1.00 31.63  ? 614  ILE B O     1 
ATOM   981  C  CB    . ILE B 1 52 ? 2.970  35.123 45.761 1.00 33.64  ? 614  ILE B CB    1 
ATOM   982  C  CG1   . ILE B 1 52 ? 1.642  35.509 45.071 1.00 35.34  ? 614  ILE B CG1   1 
ATOM   983  C  CG2   . ILE B 1 52 ? 2.914  35.441 47.265 1.00 30.52  ? 614  ILE B CG2   1 
ATOM   984  C  CD1   . ILE B 1 52 ? 0.450  34.526 45.298 1.00 35.48  ? 614  ILE B CD1   1 
ATOM   985  N  N     . ARG B 1 53 ? 6.251  34.728 45.724 1.00 31.55  ? 615  ARG B N     1 
ATOM   986  C  CA    . ARG B 1 53 ? 7.385  34.507 46.631 1.00 30.57  ? 615  ARG B CA    1 
ATOM   987  C  C     . ARG B 1 53 ? 8.730  34.796 46.027 1.00 30.40  ? 615  ARG B C     1 
ATOM   988  O  O     . ARG B 1 53 ? 9.743  34.496 46.656 1.00 31.13  ? 615  ARG B O     1 
ATOM   989  C  CB    . ARG B 1 53 ? 7.457  33.073 47.141 1.00 30.60  ? 615  ARG B CB    1 
ATOM   990  C  CG    . ARG B 1 53 ? 6.376  32.636 48.055 1.00 30.35  ? 615  ARG B CG    1 
ATOM   991  C  CD    . ARG B 1 53 ? 5.600  31.542 47.427 1.00 31.48  ? 615  ARG B CD    1 
ATOM   992  N  NE    . ARG B 1 53 ? 5.693  30.296 48.153 1.00 31.82  ? 615  ARG B NE    1 
ATOM   993  C  CZ    . ARG B 1 53 ? 5.529  29.107 47.591 1.00 32.64  ? 615  ARG B CZ    1 
ATOM   994  N  NH1   . ARG B 1 53 ? 5.312  28.996 46.284 1.00 26.61  ? 615  ARG B NH1   1 
ATOM   995  N  NH2   . ARG B 1 53 ? 5.613  28.021 48.348 1.00 35.78  ? 615  ARG B NH2   1 
ATOM   996  N  N     . ARG B 1 54 ? 8.772  35.346 44.820 1.00 29.72  ? 616  ARG B N     1 
ATOM   997  C  CA    . ARG B 1 54 ? 10.067 35.515 44.151 1.00 30.07  ? 616  ARG B CA    1 
ATOM   998  C  C     . ARG B 1 54 ? 11.143 36.220 45.001 1.00 29.32  ? 616  ARG B C     1 
ATOM   999  O  O     . ARG B 1 54 ? 12.303 35.904 44.880 1.00 29.79  ? 616  ARG B O     1 
ATOM   1000 C  CB    . ARG B 1 54 ? 9.910  36.204 42.791 1.00 30.43  ? 616  ARG B CB    1 
ATOM   1001 C  CG    . ARG B 1 54 ? 9.402  37.647 42.855 1.00 31.43  ? 616  ARG B CG    1 
ATOM   1002 C  CD    . ARG B 1 54 ? 8.629  38.073 41.621 1.00 31.44  ? 616  ARG B CD    1 
ATOM   1003 N  NE    . ARG B 1 54 ? 8.019  39.393 41.771 1.00 32.48  ? 616  ARG B NE    1 
ATOM   1004 C  CZ    . ARG B 1 54 ? 7.236  39.968 40.860 1.00 33.82  ? 616  ARG B CZ    1 
ATOM   1005 N  NH1   . ARG B 1 54 ? 6.971  39.362 39.703 1.00 33.18  ? 616  ARG B NH1   1 
ATOM   1006 N  NH2   . ARG B 1 54 ? 6.731  41.168 41.100 1.00 33.94  ? 616  ARG B NH2   1 
ATOM   1007 N  N     . LYS B 1 55 ? 10.753 37.154 45.862 1.00 28.97  ? 617  LYS B N     1 
ATOM   1008 C  CA    . LYS B 1 55 ? 11.698 37.940 46.656 1.00 28.78  ? 617  LYS B CA    1 
ATOM   1009 C  C     . LYS B 1 55 ? 12.220 37.169 47.861 1.00 29.10  ? 617  LYS B C     1 
ATOM   1010 O  O     . LYS B 1 55 ? 13.127 37.635 48.563 1.00 29.19  ? 617  LYS B O     1 
ATOM   1011 C  CB    . LYS B 1 55 ? 11.023 39.231 47.149 1.00 29.29  ? 617  LYS B CB    1 
ATOM   1012 C  CG    . LYS B 1 55 ? 9.986  39.025 48.270 1.00 29.96  ? 617  LYS B CG    1 
ATOM   1013 C  CD    . LYS B 1 55 ? 9.457  40.347 48.807 1.00 33.03  ? 617  LYS B CD    1 
ATOM   1014 C  CE    . LYS B 1 55 ? 8.647  40.150 50.092 1.00 34.41  ? 617  LYS B CE    1 
ATOM   1015 N  NZ    . LYS B 1 55 ? 9.521  40.301 51.320 1.00 37.48  ? 617  LYS B NZ    1 
ATOM   1016 N  N     . ASN B 1 56 ? 11.606 36.017 48.120 1.00 29.05  ? 618  ASN B N     1 
ATOM   1017 C  CA    . ASN B 1 56 ? 11.894 35.209 49.295 1.00 29.05  ? 618  ASN B CA    1 
ATOM   1018 C  C     . ASN B 1 56 ? 13.360 34.783 49.315 1.00 29.47  ? 618  ASN B C     1 
ATOM   1019 O  O     . ASN B 1 56 ? 14.062 35.001 50.295 1.00 30.61  ? 618  ASN B O     1 
ATOM   1020 C  CB    . ASN B 1 56 ? 10.997 33.954 49.324 1.00 28.84  ? 618  ASN B CB    1 
ATOM   1021 C  CG    . ASN B 1 56 ? 9.618  34.212 49.897 1.00 27.36  ? 618  ASN B CG    1 
ATOM   1022 O  OD1   . ASN B 1 56 ? 8.869  33.275 50.187 1.00 28.38  ? 618  ASN B OD1   1 
ATOM   1023 N  ND2   . ASN B 1 56 ? 9.268  35.467 50.052 1.00 25.66  ? 618  ASN B ND2   1 
ATOM   1024 N  N     . CYS B 1 57 ? 13.812 34.169 48.229 1.00 28.76  ? 619  CYS B N     1 
ATOM   1025 C  CA    . CYS B 1 57 ? 15.164 33.652 48.157 1.00 28.75  ? 619  CYS B CA    1 
ATOM   1026 C  C     . CYS B 1 57 ? 15.918 34.196 46.928 1.00 28.82  ? 619  CYS B C     1 
ATOM   1027 O  O     . CYS B 1 57 ? 15.764 33.701 45.801 1.00 28.75  ? 619  CYS B O     1 
ATOM   1028 C  CB    . CYS B 1 57 ? 15.134 32.135 48.141 1.00 28.41  ? 619  CYS B CB    1 
ATOM   1029 S  SG    . CYS B 1 57 ? 16.749 31.398 48.427 1.00 29.35  ? 619  CYS B SG    1 
ATOM   1030 N  N     . PRO B 1 58 ? 16.699 35.247 47.145 1.00 28.69  ? 620  PRO B N     1 
ATOM   1031 C  CA    . PRO B 1 58 ? 17.510 35.824 46.070 1.00 28.33  ? 620  PRO B CA    1 
ATOM   1032 C  C     . PRO B 1 58 ? 18.526 34.824 45.525 1.00 28.06  ? 620  PRO B C     1 
ATOM   1033 O  O     . PRO B 1 58 ? 18.760 34.790 44.328 1.00 29.30  ? 620  PRO B O     1 
ATOM   1034 C  CB    . PRO B 1 58 ? 18.193 37.033 46.716 1.00 27.81  ? 620  PRO B CB    1 
ATOM   1035 C  CG    . PRO B 1 58 ? 17.762 37.098 48.123 1.00 28.10  ? 620  PRO B CG    1 
ATOM   1036 C  CD    . PRO B 1 58 ? 16.815 35.982 48.418 1.00 28.72  ? 620  PRO B CD    1 
ATOM   1037 N  N     . ALA B 1 59 ? 19.101 33.994 46.376 1.00 28.60  ? 621  ALA B N     1 
ATOM   1038 C  CA    . ALA B 1 59 ? 20.041 32.978 45.912 1.00 28.11  ? 621  ALA B CA    1 
ATOM   1039 C  C     . ALA B 1 59 ? 19.401 32.076 44.836 1.00 28.48  ? 621  ALA B C     1 
ATOM   1040 O  O     . ALA B 1 59 ? 19.950 31.931 43.736 1.00 29.28  ? 621  ALA B O     1 
ATOM   1041 C  CB    . ALA B 1 59 ? 20.567 32.161 47.093 1.00 27.27  ? 621  ALA B CB    1 
ATOM   1042 N  N     . CYS B 1 60 ? 18.232 31.514 45.132 1.00 28.25  ? 622  CYS B N     1 
ATOM   1043 C  CA    . CYS B 1 60 ? 17.542 30.629 44.200 1.00 29.20  ? 622  CYS B CA    1 
ATOM   1044 C  C     . CYS B 1 60 ? 16.985 31.357 42.963 1.00 30.95  ? 622  CYS B C     1 
ATOM   1045 O  O     . CYS B 1 60 ? 16.970 30.785 41.860 1.00 30.52  ? 622  CYS B O     1 
ATOM   1046 C  CB    . CYS B 1 60 ? 16.411 29.885 44.914 1.00 29.77  ? 622  CYS B CB    1 
ATOM   1047 S  SG    . CYS B 1 60 ? 16.886 28.474 45.965 1.00 28.33  ? 622  CYS B SG    1 
ATOM   1048 N  N     . ARG B 1 61 ? 16.520 32.599 43.150 1.00 31.27  ? 623  ARG B N     1 
ATOM   1049 C  CA    . ARG B 1 61 ? 15.999 33.404 42.051 1.00 31.69  ? 623  ARG B CA    1 
ATOM   1050 C  C     . ARG B 1 61 ? 17.125 33.769 41.070 1.00 33.31  ? 623  ARG B C     1 
ATOM   1051 O  O     . ARG B 1 61 ? 16.950 33.709 39.846 1.00 32.50  ? 623  ARG B O     1 
ATOM   1052 C  CB    . ARG B 1 61 ? 15.355 34.664 42.611 1.00 32.03  ? 623  ARG B CB    1 
ATOM   1053 C  CG    . ARG B 1 61 ? 14.599 35.522 41.593 1.00 32.58  ? 623  ARG B CG    1 
ATOM   1054 C  CD    . ARG B 1 61 ? 14.294 36.920 42.092 1.00 32.99  ? 623  ARG B CD    1 
ATOM   1055 N  NE    . ARG B 1 61 ? 13.384 37.646 41.211 1.00 34.77  ? 623  ARG B NE    1 
ATOM   1056 C  CZ    . ARG B 1 61 ? 12.735 38.767 41.545 1.00 35.06  ? 623  ARG B CZ    1 
ATOM   1057 N  NH1   . ARG B 1 61 ? 12.905 39.315 42.743 1.00 32.21  ? 623  ARG B NH1   1 
ATOM   1058 N  NH2   . ARG B 1 61 ? 11.916 39.348 40.670 1.00 35.08  ? 623  ARG B NH2   1 
ATOM   1059 N  N     . LEU B 1 62 ? 18.281 34.135 41.630 1.00 33.91  ? 624  LEU B N     1 
ATOM   1060 C  CA    . LEU B 1 62 ? 19.486 34.419 40.856 1.00 34.09  ? 624  LEU B CA    1 
ATOM   1061 C  C     . LEU B 1 62 ? 19.988 33.167 40.129 1.00 34.70  ? 624  LEU B C     1 
ATOM   1062 O  O     . LEU B 1 62 ? 20.322 33.218 38.941 1.00 35.16  ? 624  LEU B O     1 
ATOM   1063 C  CB    . LEU B 1 62 ? 20.581 34.995 41.763 1.00 33.17  ? 624  LEU B CB    1 
ATOM   1064 C  CG    . LEU B 1 62 ? 21.917 35.340 41.112 1.00 31.58  ? 624  LEU B CG    1 
ATOM   1065 C  CD1   . LEU B 1 62 ? 21.697 36.344 39.983 1.00 31.65  ? 624  LEU B CD1   1 
ATOM   1066 C  CD2   . LEU B 1 62 ? 22.890 35.886 42.133 1.00 27.98  ? 624  LEU B CD2   1 
ATOM   1067 N  N     . ARG B 1 63 ? 20.004 32.039 40.827 1.00 35.44  ? 625  ARG B N     1 
ATOM   1068 C  CA    . ARG B 1 63 ? 20.443 30.789 40.220 1.00 36.20  ? 625  ARG B CA    1 
ATOM   1069 C  C     . ARG B 1 63 ? 19.566 30.453 39.014 1.00 36.28  ? 625  ARG B C     1 
ATOM   1070 O  O     . ARG B 1 63 ? 20.093 30.167 37.926 1.00 37.62  ? 625  ARG B O     1 
ATOM   1071 C  CB    . ARG B 1 63 ? 20.463 29.664 41.259 1.00 37.24  ? 625  ARG B CB    1 
ATOM   1072 C  CG    . ARG B 1 63 ? 21.170 28.365 40.859 1.00 39.73  ? 625  ARG B CG    1 
ATOM   1073 C  CD    . ARG B 1 63 ? 21.835 27.662 42.055 1.00 45.19  ? 625  ARG B CD    1 
ATOM   1074 N  NE    . ARG B 1 63 ? 23.080 28.345 42.432 1.00 50.21  ? 625  ARG B NE    1 
ATOM   1075 C  CZ    . ARG B 1 63 ? 23.294 29.034 43.564 1.00 50.80  ? 625  ARG B CZ    1 
ATOM   1076 N  NH1   . ARG B 1 63 ? 22.362 29.151 44.508 1.00 50.59  ? 625  ARG B NH1   1 
ATOM   1077 N  NH2   . ARG B 1 63 ? 24.473 29.614 43.750 1.00 51.21  ? 625  ARG B NH2   1 
ATOM   1078 N  N     . LYS B 1 64 ? 18.243 30.515 39.199 1.00 35.71  ? 626  LYS B N     1 
ATOM   1079 C  CA    . LYS B 1 64 ? 17.265 30.347 38.115 1.00 34.41  ? 626  LYS B CA    1 
ATOM   1080 C  C     . LYS B 1 64 ? 17.495 31.286 36.921 1.00 35.28  ? 626  LYS B C     1 
ATOM   1081 O  O     . LYS B 1 64 ? 17.423 30.848 35.764 1.00 34.05  ? 626  LYS B O     1 
ATOM   1082 C  CB    . LYS B 1 64 ? 15.853 30.552 38.638 1.00 34.05  ? 626  LYS B CB    1 
ATOM   1083 C  CG    . LYS B 1 64 ? 14.840 29.731 37.914 1.00 33.94  ? 626  LYS B CG    1 
ATOM   1084 C  CD    . LYS B 1 64 ? 13.469 29.870 38.497 1.00 34.38  ? 626  LYS B CD    1 
ATOM   1085 C  CE    . LYS B 1 64 ? 12.448 29.325 37.495 1.00 36.01  ? 626  LYS B CE    1 
ATOM   1086 N  NZ    . LYS B 1 64 ? 11.074 29.205 38.084 1.00 35.35  ? 626  LYS B NZ    1 
ATOM   1087 N  N     . CYS B 1 65 ? 17.753 32.569 37.200 1.00 35.24  ? 627  CYS B N     1 
ATOM   1088 C  CA    . CYS B 1 65 ? 18.137 33.522 36.153 1.00 36.03  ? 627  CYS B CA    1 
ATOM   1089 C  C     . CYS B 1 65 ? 19.363 33.011 35.387 1.00 36.89  ? 627  CYS B C     1 
ATOM   1090 O  O     . CYS B 1 65 ? 19.363 32.987 34.153 1.00 36.47  ? 627  CYS B O     1 
ATOM   1091 C  CB    . CYS B 1 65 ? 18.456 34.910 36.724 1.00 35.57  ? 627  CYS B CB    1 
ATOM   1092 S  SG    . CYS B 1 65 ? 17.063 35.872 37.368 1.00 35.43  ? 627  CYS B SG    1 
ATOM   1093 N  N     . CYS B 1 66 ? 20.399 32.598 36.115 1.00 37.46  ? 628  CYS B N     1 
ATOM   1094 C  CA    . CYS B 1 66 ? 21.633 32.145 35.466 1.00 38.70  ? 628  CYS B CA    1 
ATOM   1095 C  C     . CYS B 1 66 ? 21.461 30.875 34.615 1.00 39.41  ? 628  CYS B C     1 
ATOM   1096 O  O     . CYS B 1 66 ? 22.062 30.762 33.559 1.00 39.93  ? 628  CYS B O     1 
ATOM   1097 C  CB    . CYS B 1 66 ? 22.770 32.022 36.477 1.00 38.02  ? 628  CYS B CB    1 
ATOM   1098 S  SG    . CYS B 1 66 ? 23.246 33.635 37.151 1.00 38.45  ? 628  CYS B SG    1 
ATOM   1099 N  N     . GLN B 1 67 ? 20.616 29.952 35.057 1.00 40.94  ? 629  GLN B N     1 
ATOM   1100 C  CA    . GLN B 1 67 ? 20.314 28.734 34.308 1.00 43.25  ? 629  GLN B CA    1 
ATOM   1101 C  C     . GLN B 1 67 ? 19.381 28.982 33.111 1.00 44.07  ? 629  GLN B C     1 
ATOM   1102 O  O     . GLN B 1 67 ? 19.388 28.210 32.144 1.00 44.76  ? 629  GLN B O     1 
ATOM   1103 C  CB    . GLN B 1 67 ? 19.703 27.666 35.236 1.00 44.21  ? 629  GLN B CB    1 
ATOM   1104 C  CG    . GLN B 1 67 ? 20.673 27.139 36.321 1.00 49.23  ? 629  GLN B CG    1 
ATOM   1105 C  CD    . GLN B 1 67 ? 19.982 26.392 37.476 1.00 53.87  ? 629  GLN B CD    1 
ATOM   1106 O  OE1   . GLN B 1 67 ? 18.761 26.480 37.654 1.00 56.25  ? 629  GLN B OE1   1 
ATOM   1107 N  NE2   . GLN B 1 67 ? 20.772 25.662 38.265 1.00 55.35  ? 629  GLN B NE2   1 
ATOM   1108 N  N     . ALA B 1 68 ? 18.570 30.039 33.167 1.00 43.81  ? 630  ALA B N     1 
ATOM   1109 C  CA    . ALA B 1 68 ? 17.662 30.325 32.060 1.00 44.21  ? 630  ALA B CA    1 
ATOM   1110 C  C     . ALA B 1 68 ? 18.451 30.903 30.890 1.00 44.49  ? 630  ALA B C     1 
ATOM   1111 O  O     . ALA B 1 68 ? 17.993 30.882 29.738 1.00 44.17  ? 630  ALA B O     1 
ATOM   1112 C  CB    . ALA B 1 68 ? 16.557 31.273 32.484 1.00 43.35  ? 630  ALA B CB    1 
ATOM   1113 N  N     . GLY B 1 69 ? 19.641 31.403 31.207 1.00 44.45  ? 631  GLY B N     1 
ATOM   1114 C  CA    . GLY B 1 69 ? 20.547 31.932 30.212 1.00 46.09  ? 631  GLY B CA    1 
ATOM   1115 C  C     . GLY B 1 69 ? 20.822 33.417 30.329 1.00 47.36  ? 631  GLY B C     1 
ATOM   1116 O  O     . GLY B 1 69 ? 21.542 33.963 29.497 1.00 47.75  ? 631  GLY B O     1 
ATOM   1117 N  N     . MET B 1 70 ? 20.267 34.070 31.350 1.00 48.16  ? 632  MET B N     1 
ATOM   1118 C  CA    . MET B 1 70 ? 20.458 35.508 31.524 1.00 48.86  ? 632  MET B CA    1 
ATOM   1119 C  C     . MET B 1 70 ? 21.937 35.848 31.660 1.00 50.56  ? 632  MET B C     1 
ATOM   1120 O  O     . MET B 1 70 ? 22.661 35.209 32.417 1.00 50.37  ? 632  MET B O     1 
ATOM   1121 C  CB    . MET B 1 70 ? 19.660 36.036 32.716 1.00 47.60  ? 632  MET B CB    1 
ATOM   1122 C  CG    . MET B 1 70 ? 18.198 36.155 32.418 1.00 46.21  ? 632  MET B CG    1 
ATOM   1123 S  SD    . MET B 1 70 ? 17.191 36.631 33.808 1.00 43.77  ? 632  MET B SD    1 
ATOM   1124 C  CE    . MET B 1 70 ? 17.088 38.375 33.606 1.00 46.25  ? 632  MET B CE    1 
ATOM   1125 N  N     . VAL B 1 71 ? 22.377 36.841 30.897 1.00 52.93  ? 633  VAL B N     1 
ATOM   1126 C  CA    . VAL B 1 71 ? 23.779 37.249 30.875 1.00 55.65  ? 633  VAL B CA    1 
ATOM   1127 C  C     . VAL B 1 71 ? 23.840 38.758 30.940 1.00 57.24  ? 633  VAL B C     1 
ATOM   1128 O  O     . VAL B 1 71 ? 23.079 39.435 30.250 1.00 57.71  ? 633  VAL B O     1 
ATOM   1129 C  CB    . VAL B 1 71 ? 24.509 36.793 29.572 1.00 55.61  ? 633  VAL B CB    1 
ATOM   1130 C  CG1   . VAL B 1 71 ? 25.962 37.251 29.586 1.00 55.46  ? 633  VAL B CG1   1 
ATOM   1131 C  CG2   . VAL B 1 71 ? 24.436 35.276 29.388 1.00 55.95  ? 633  VAL B CG2   1 
ATOM   1132 N  N     . LEU B 1 72 ? 24.756 39.282 31.747 1.00 59.60  ? 634  LEU B N     1 
ATOM   1133 C  CA    . LEU B 1 72 ? 24.943 40.721 31.842 1.00 62.66  ? 634  LEU B CA    1 
ATOM   1134 C  C     . LEU B 1 72 ? 25.556 41.313 30.566 1.00 65.85  ? 634  LEU B C     1 
ATOM   1135 O  O     . LEU B 1 72 ? 26.276 40.626 29.835 1.00 65.99  ? 634  LEU B O     1 
ATOM   1136 C  CB    . LEU B 1 72 ? 25.790 41.055 33.064 1.00 61.96  ? 634  LEU B CB    1 
ATOM   1137 C  CG    . LEU B 1 72 ? 25.270 42.193 33.942 1.00 61.70  ? 634  LEU B CG    1 
ATOM   1138 C  CD1   . LEU B 1 72 ? 23.751 42.146 34.124 1.00 61.41  ? 634  LEU B CD1   1 
ATOM   1139 C  CD2   . LEU B 1 72 ? 25.972 42.187 35.286 1.00 60.77  ? 634  LEU B CD2   1 
ATOM   1140 N  N     . GLY B 1 73 ? 25.250 42.582 30.298 1.00 69.63  ? 635  GLY B N     1 
ATOM   1141 C  CA    . GLY B 1 73 ? 25.714 43.268 29.100 1.00 73.97  ? 635  GLY B CA    1 
ATOM   1142 C  C     . GLY B 1 73 ? 24.845 44.467 28.739 1.00 77.15  ? 635  GLY B C     1 
ATOM   1143 O  O     . GLY B 1 73 ? 23.614 44.342 28.645 1.00 77.27  ? 635  GLY B O     1 
ATOM   1144 N  N     . GLY B 1 74 ? 25.490 45.616 28.510 1.00 79.62  ? 636  GLY B N     1 
ATOM   1145 C  CA    . GLY B 1 74 ? 24.802 46.888 28.334 1.00 82.79  ? 636  GLY B CA    1 
ATOM   1146 C  C     . GLY B 1 74 ? 24.537 47.419 26.932 1.00 85.11  ? 636  GLY B C     1 
ATOM   1147 O  O     . GLY B 1 74 ? 25.377 48.126 26.364 1.00 85.62  ? 636  GLY B O     1 
ATOM   1148 N  N     . ARG B 1 75 ? 23.355 47.094 26.399 1.00 87.12  ? 637  ARG B N     1 
ATOM   1149 C  CA    . ARG B 1 75 ? 22.820 47.637 25.133 1.00 89.40  ? 637  ARG B CA    1 
ATOM   1150 C  C     . ARG B 1 75 ? 23.565 47.187 23.862 1.00 90.82  ? 637  ARG B C     1 
ATOM   1151 O  O     . ARG B 1 75 ? 24.353 47.954 23.287 1.00 91.07  ? 637  ARG B O     1 
ATOM   1152 C  CB    . ARG B 1 75 ? 22.644 49.170 25.191 1.00 89.18  ? 637  ARG B CB    1 
ATOM   1153 C  CG    . ARG B 1 75 ? 21.310 49.674 24.632 1.00 89.94  ? 637  ARG B CG    1 
ATOM   1154 C  CD    . ARG B 1 75 ? 20.100 48.800 24.988 1.00 90.88  ? 637  ARG B CD    1 
ATOM   1155 N  NE    . ARG B 1 75 ? 19.023 48.808 23.994 1.00 92.19  ? 637  ARG B NE    1 
ATOM   1156 C  CZ    . ARG B 1 75 ? 18.811 47.855 23.083 1.00 92.89  ? 637  ARG B CZ    1 
ATOM   1157 N  NH1   . ARG B 1 75 ? 19.610 46.794 23.007 1.00 93.39  ? 637  ARG B NH1   1 
ATOM   1158 N  NH2   . ARG B 1 75 ? 17.794 47.968 22.235 1.00 92.56  ? 637  ARG B NH2   1 
ATOM   1159 N  N     . LYS B 1 76 ? 23.275 45.957 23.424 1.00 92.36  ? 638  LYS B N     1 
ATOM   1160 C  CA    . LYS B 1 76 ? 23.985 45.292 22.318 1.00 93.41  ? 638  LYS B CA    1 
ATOM   1161 C  C     . LYS B 1 76 ? 23.707 45.896 20.931 1.00 93.98  ? 638  LYS B C     1 
ATOM   1162 O  O     . LYS B 1 76 ? 24.539 46.617 20.359 1.00 94.08  ? 638  LYS B O     1 
ATOM   1163 C  CB    . LYS B 1 76 ? 23.688 43.777 22.321 1.00 93.27  ? 638  LYS B CB    1 
ATOM   1164 N  N     . PHE B 1 77 ? 22.662 45.645 20.309 1.00 94.87  ? 639  PHE B N     1 
ATOM   1165 O  "O5'" . DC  C 2 1  ? 13.389 47.041 80.993 1.00 53.66  ? 1    DC  C "O5'" 1 
ATOM   1166 C  "C5'" . DC  C 2 1  ? 13.009 46.040 81.915 1.00 53.01  ? 1    DC  C "C5'" 1 
ATOM   1167 C  "C4'" . DC  C 2 1  ? 11.546 45.709 81.698 1.00 54.28  ? 1    DC  C "C4'" 1 
ATOM   1168 O  "O4'" . DC  C 2 1  ? 10.718 46.834 82.082 1.00 53.60  ? 1    DC  C "O4'" 1 
ATOM   1169 C  "C3'" . DC  C 2 1  ? 11.188 45.370 80.255 1.00 54.41  ? 1    DC  C "C3'" 1 
ATOM   1170 O  "O3'" . DC  C 2 1  ? 10.529 44.136 80.260 1.00 55.90  ? 1    DC  C "O3'" 1 
ATOM   1171 C  "C2'" . DC  C 2 1  ? 10.216 46.447 79.787 1.00 54.10  ? 1    DC  C "C2'" 1 
ATOM   1172 C  "C1'" . DC  C 2 1  ? 9.776  47.137 81.069 1.00 52.58  ? 1    DC  C "C1'" 1 
ATOM   1173 N  N1    . DC  C 2 1  ? 9.700  48.616 80.877 1.00 50.37  ? 1    DC  C N1    1 
ATOM   1174 C  C2    . DC  C 2 1  ? 8.431  49.187 80.750 1.00 49.55  ? 1    DC  C C2    1 
ATOM   1175 O  O2    . DC  C 2 1  ? 7.443  48.442 80.816 1.00 48.61  ? 1    DC  C O2    1 
ATOM   1176 N  N3    . DC  C 2 1  ? 8.327  50.533 80.565 1.00 48.23  ? 1    DC  C N3    1 
ATOM   1177 C  C4    . DC  C 2 1  ? 9.432  51.286 80.505 1.00 47.87  ? 1    DC  C C4    1 
ATOM   1178 N  N4    . DC  C 2 1  ? 9.269  52.601 80.332 1.00 45.24  ? 1    DC  C N4    1 
ATOM   1179 C  C5    . DC  C 2 1  ? 10.746 50.718 80.627 1.00 48.07  ? 1    DC  C C5    1 
ATOM   1180 C  C6    . DC  C 2 1  ? 10.831 49.391 80.807 1.00 48.89  ? 1    DC  C C6    1 
ATOM   1181 P  P     . DC  C 2 2  ? 10.444 43.235 78.938 1.00 56.16  ? 2    DC  C P     1 
ATOM   1182 O  OP1   . DC  C 2 2  ? 10.191 41.859 79.437 1.00 55.84  ? 2    DC  C OP1   1 
ATOM   1183 O  OP2   . DC  C 2 2  ? 11.584 43.600 78.065 1.00 53.49  ? 2    DC  C OP2   1 
ATOM   1184 O  "O5'" . DC  C 2 2  ? 9.072  43.750 78.319 1.00 53.05  ? 2    DC  C "O5'" 1 
ATOM   1185 C  "C5'" . DC  C 2 2  ? 7.865  43.422 78.961 1.00 48.56  ? 2    DC  C "C5'" 1 
ATOM   1186 C  "C4'" . DC  C 2 2  ? 6.752  44.007 78.126 1.00 47.40  ? 2    DC  C "C4'" 1 
ATOM   1187 O  "O4'" . DC  C 2 2  ? 6.722  45.450 78.275 1.00 46.97  ? 2    DC  C "O4'" 1 
ATOM   1188 C  "C3'" . DC  C 2 2  ? 6.897  43.740 76.632 1.00 47.04  ? 2    DC  C "C3'" 1 
ATOM   1189 O  "O3'" . DC  C 2 2  ? 5.617  43.435 76.159 1.00 47.16  ? 2    DC  C "O3'" 1 
ATOM   1190 C  "C2'" . DC  C 2 2  ? 7.378  45.070 76.051 1.00 47.32  ? 2    DC  C "C2'" 1 
ATOM   1191 C  "C1'" . DC  C 2 2  ? 6.684  46.048 76.993 1.00 47.54  ? 2    DC  C "C1'" 1 
ATOM   1192 N  N1    . DC  C 2 2  ? 7.285  47.417 77.060 1.00 46.57  ? 2    DC  C N1    1 
ATOM   1193 C  C2    . DC  C 2 2  ? 6.436  48.507 77.309 1.00 45.92  ? 2    DC  C C2    1 
ATOM   1194 O  O2    . DC  C 2 2  ? 5.222  48.297 77.462 1.00 46.18  ? 2    DC  C O2    1 
ATOM   1195 N  N3    . DC  C 2 2  ? 6.970  49.756 77.368 1.00 44.77  ? 2    DC  C N3    1 
ATOM   1196 C  C4    . DC  C 2 2  ? 8.286  49.922 77.199 1.00 46.03  ? 2    DC  C C4    1 
ATOM   1197 N  N4    . DC  C 2 2  ? 8.770  51.160 77.268 1.00 45.65  ? 2    DC  C N4    1 
ATOM   1198 C  C5    . DC  C 2 2  ? 9.174  48.828 76.947 1.00 46.24  ? 2    DC  C C5    1 
ATOM   1199 C  C6    . DC  C 2 2  ? 8.631  47.604 76.883 1.00 47.08  ? 2    DC  C C6    1 
ATOM   1200 P  P     . DA  C 2 3  ? 5.377  42.735 74.751 1.00 45.24  ? 3    DA  C P     1 
ATOM   1201 O  OP1   . DA  C 2 3  ? 4.996  41.334 75.047 1.00 45.89  ? 3    DA  C OP1   1 
ATOM   1202 O  OP2   . DA  C 2 3  ? 6.468  43.091 73.815 1.00 44.71  ? 3    DA  C OP2   1 
ATOM   1203 O  "O5'" . DA  C 2 3  ? 4.080  43.544 74.345 1.00 45.09  ? 3    DA  C "O5'" 1 
ATOM   1204 C  "C5'" . DA  C 2 3  ? 2.920  43.552 75.150 1.00 43.48  ? 3    DA  C "C5'" 1 
ATOM   1205 C  "C4'" . DA  C 2 3  ? 1.978  44.567 74.527 1.00 44.64  ? 3    DA  C "C4'" 1 
ATOM   1206 O  "O4'" . DA  C 2 3  ? 2.552  45.894 74.637 1.00 43.83  ? 3    DA  C "O4'" 1 
ATOM   1207 C  "C3'" . DA  C 2 3  ? 1.699  44.381 73.045 1.00 45.24  ? 3    DA  C "C3'" 1 
ATOM   1208 O  "O3'" . DA  C 2 3  ? 0.346  44.654 72.875 1.00 47.00  ? 3    DA  C "O3'" 1 
ATOM   1209 C  "C2'" . DA  C 2 3  ? 2.597  45.408 72.354 1.00 44.09  ? 3    DA  C "C2'" 1 
ATOM   1210 C  "C1'" . DA  C 2 3  ? 2.697  46.514 73.388 1.00 43.16  ? 3    DA  C "C1'" 1 
ATOM   1211 N  N9    . DA  C 2 3  ? 3.990  47.155 73.508 1.00 44.48  ? 3    DA  C N9    1 
ATOM   1212 C  C8    . DA  C 2 3  ? 5.225  46.576 73.442 1.00 44.51  ? 3    DA  C C8    1 
ATOM   1213 N  N7    . DA  C 2 3  ? 6.216  47.422 73.609 1.00 45.34  ? 3    DA  C N7    1 
ATOM   1214 C  C5    . DA  C 2 3  ? 5.582  48.634 73.818 1.00 44.37  ? 3    DA  C C5    1 
ATOM   1215 C  C6    . DA  C 2 3  ? 6.062  49.931 74.064 1.00 44.84  ? 3    DA  C C6    1 
ATOM   1216 N  N6    . DA  C 2 3  ? 7.362  50.229 74.142 1.00 44.15  ? 3    DA  C N6    1 
ATOM   1217 N  N1    . DA  C 2 3  ? 5.156  50.923 74.219 1.00 45.53  ? 3    DA  C N1    1 
ATOM   1218 C  C2    . DA  C 2 3  ? 3.855  50.631 74.145 1.00 45.06  ? 3    DA  C C2    1 
ATOM   1219 N  N3    . DA  C 2 3  ? 3.289  49.446 73.923 1.00 45.27  ? 3    DA  C N3    1 
ATOM   1220 C  C4    . DA  C 2 3  ? 4.212  48.485 73.764 1.00 45.06  ? 3    DA  C C4    1 
ATOM   1221 P  P     . DG  C 2 4  ? -0.380 44.527 71.466 1.00 50.34  ? 4    DG  C P     1 
ATOM   1222 O  OP1   . DG  C 2 4  ? -1.811 44.217 71.729 1.00 50.75  ? 4    DG  C OP1   1 
ATOM   1223 O  OP2   . DG  C 2 4  ? 0.436  43.666 70.589 1.00 50.63  ? 4    DG  C OP2   1 
ATOM   1224 O  "O5'" . DG  C 2 4  ? -0.340 46.026 70.918 1.00 51.50  ? 4    DG  C "O5'" 1 
ATOM   1225 C  "C5'" . DG  C 2 4  ? -1.104 47.032 71.589 1.00 50.53  ? 4    DG  C "C5'" 1 
ATOM   1226 C  "C4'" . DG  C 2 4  ? -0.767 48.364 70.969 1.00 51.15  ? 4    DG  C "C4'" 1 
ATOM   1227 O  "O4'" . DG  C 2 4  ? 0.628  48.594 71.238 1.00 49.84  ? 4    DG  C "O4'" 1 
ATOM   1228 C  "C3'" . DG  C 2 4  ? -0.897 48.416 69.448 1.00 53.11  ? 4    DG  C "C3'" 1 
ATOM   1229 O  "O3'" . DG  C 2 4  ? -1.815 49.456 69.096 1.00 57.60  ? 4    DG  C "O3'" 1 
ATOM   1230 C  "C2'" . DG  C 2 4  ? 0.523  48.679 68.941 1.00 49.99  ? 4    DG  C "C2'" 1 
ATOM   1231 C  "C1'" . DG  C 2 4  ? 1.166  49.313 70.165 1.00 48.44  ? 4    DG  C "C1'" 1 
ATOM   1232 N  N9    . DG  C 2 4  ? 2.612  49.171 70.250 1.00 46.59  ? 4    DG  C N9    1 
ATOM   1233 C  C8    . DG  C 2 4  ? 3.351  48.015 70.096 1.00 46.55  ? 4    DG  C C8    1 
ATOM   1234 N  N7    . DG  C 2 4  ? 4.635  48.190 70.220 1.00 45.08  ? 4    DG  C N7    1 
ATOM   1235 C  C5    . DG  C 2 4  ? 4.757  49.552 70.480 1.00 44.16  ? 4    DG  C C5    1 
ATOM   1236 C  C6    . DG  C 2 4  ? 5.907  50.337 70.712 1.00 42.53  ? 4    DG  C C6    1 
ATOM   1237 O  O6    . DG  C 2 4  ? 7.087  49.992 70.745 1.00 40.81  ? 4    DG  C O6    1 
ATOM   1238 N  N1    . DG  C 2 4  ? 5.592  51.678 70.937 1.00 44.75  ? 4    DG  C N1    1 
ATOM   1239 C  C2    . DG  C 2 4  ? 4.317  52.201 70.941 1.00 43.44  ? 4    DG  C C2    1 
ATOM   1240 N  N2    . DG  C 2 4  ? 4.234  53.520 71.169 1.00 42.72  ? 4    DG  C N2    1 
ATOM   1241 N  N3    . DG  C 2 4  ? 3.224  51.478 70.719 1.00 43.42  ? 4    DG  C N3    1 
ATOM   1242 C  C4    . DG  C 2 4  ? 3.518  50.171 70.501 1.00 45.09  ? 4    DG  C C4    1 
ATOM   1243 P  P     . DA  C 2 5  ? -1.987 49.993 67.586 1.00 59.80  ? 5    DA  C P     1 
ATOM   1244 O  OP1   . DA  C 2 5  ? -3.438 50.281 67.452 1.00 60.01  ? 5    DA  C OP1   1 
ATOM   1245 O  OP2   . DA  C 2 5  ? -1.261 49.159 66.588 1.00 57.51  ? 5    DA  C OP2   1 
ATOM   1246 O  "O5'" . DA  C 2 5  ? -1.175 51.365 67.625 1.00 57.85  ? 5    DA  C "O5'" 1 
ATOM   1247 C  "C5'" . DA  C 2 5  ? -1.233 52.265 68.719 1.00 54.47  ? 5    DA  C "C5'" 1 
ATOM   1248 C  "C4'" . DA  C 2 5  ? -0.363 53.454 68.356 1.00 52.21  ? 5    DA  C "C4'" 1 
ATOM   1249 O  "O4'" . DA  C 2 5  ? 1.029  53.098 68.546 1.00 50.99  ? 5    DA  C "O4'" 1 
ATOM   1250 C  "C3'" . DA  C 2 5  ? -0.501 53.919 66.903 1.00 51.66  ? 5    DA  C "C3'" 1 
ATOM   1251 O  "O3'" . DA  C 2 5  ? -0.638 55.352 66.876 1.00 52.19  ? 5    DA  C "O3'" 1 
ATOM   1252 C  "C2'" . DA  C 2 5  ? 0.755  53.381 66.216 1.00 49.35  ? 5    DA  C "C2'" 1 
ATOM   1253 C  "C1'" . DA  C 2 5  ? 1.765  53.357 67.359 1.00 48.96  ? 5    DA  C "C1'" 1 
ATOM   1254 N  N9    . DA  C 2 5  ? 2.821  52.340 67.271 1.00 46.00  ? 5    DA  C N9    1 
ATOM   1255 C  C8    . DA  C 2 5  ? 2.691  51.001 67.004 1.00 44.68  ? 5    DA  C C8    1 
ATOM   1256 N  N7    . DA  C 2 5  ? 3.836  50.350 67.015 1.00 42.56  ? 5    DA  C N7    1 
ATOM   1257 C  C5    . DA  C 2 5  ? 4.776  51.319 67.315 1.00 40.75  ? 5    DA  C C5    1 
ATOM   1258 C  C6    . DA  C 2 5  ? 6.173  51.282 67.477 1.00 39.35  ? 5    DA  C C6    1 
ATOM   1259 N  N6    . DA  C 2 5  ? 6.920  50.178 67.352 1.00 36.47  ? 5    DA  C N6    1 
ATOM   1260 N  N1    . DA  C 2 5  ? 6.796  52.441 67.777 1.00 40.51  ? 5    DA  C N1    1 
ATOM   1261 C  C2    . DA  C 2 5  ? 6.074  53.558 67.908 1.00 41.24  ? 5    DA  C C2    1 
ATOM   1262 N  N3    . DA  C 2 5  ? 4.757  53.710 67.776 1.00 42.09  ? 5    DA  C N3    1 
ATOM   1263 C  C4    . DA  C 2 5  ? 4.165  52.547 67.478 1.00 42.66  ? 5    DA  C C4    1 
ATOM   1264 P  P     . DA  C 2 6  ? -0.710 56.236 65.533 1.00 53.05  ? 6    DA  C P     1 
ATOM   1265 O  OP1   . DA  C 2 6  ? -1.565 57.401 65.836 1.00 53.41  ? 6    DA  C OP1   1 
ATOM   1266 O  OP2   . DA  C 2 6  ? -0.992 55.375 64.355 1.00 52.06  ? 6    DA  C OP2   1 
ATOM   1267 O  "O5'" . DA  C 2 6  ? 0.785  56.773 65.352 1.00 51.35  ? 6    DA  C "O5'" 1 
ATOM   1268 C  "C5'" . DA  C 2 6  ? 1.481  57.438 66.382 1.00 49.21  ? 6    DA  C "C5'" 1 
ATOM   1269 C  "C4'" . DA  C 2 6  ? 2.886  57.668 65.874 1.00 49.64  ? 6    DA  C "C4'" 1 
ATOM   1270 O  "O4'" . DA  C 2 6  ? 3.562  56.387 65.816 1.00 49.40  ? 6    DA  C "O4'" 1 
ATOM   1271 C  "C3'" . DA  C 2 6  ? 2.967  58.264 64.466 1.00 49.52  ? 6    DA  C "C3'" 1 
ATOM   1272 O  "O3'" . DA  C 2 6  ? 3.743  59.461 64.531 1.00 50.66  ? 6    DA  C "O3'" 1 
ATOM   1273 C  "C2'" . DA  C 2 6  ? 3.614  57.177 63.597 1.00 48.03  ? 6    DA  C "C2'" 1 
ATOM   1274 C  "C1'" . DA  C 2 6  ? 4.339  56.324 64.632 1.00 47.91  ? 6    DA  C "C1'" 1 
ATOM   1275 N  N9    . DA  C 2 6  ? 4.504  54.901 64.329 1.00 45.43  ? 6    DA  C N9    1 
ATOM   1276 C  C8    . DA  C 2 6  ? 3.570  54.005 63.893 1.00 44.27  ? 6    DA  C C8    1 
ATOM   1277 N  N7    . DA  C 2 6  ? 4.032  52.779 63.749 1.00 44.43  ? 6    DA  C N7    1 
ATOM   1278 C  C5    . DA  C 2 6  ? 5.364  52.885 64.119 1.00 43.49  ? 6    DA  C C5    1 
ATOM   1279 C  C6    . DA  C 2 6  ? 6.425  51.954 64.190 1.00 42.82  ? 6    DA  C C6    1 
ATOM   1280 N  N6    . DA  C 2 6  ? 6.297  50.664 63.869 1.00 40.24  ? 6    DA  C N6    1 
ATOM   1281 N  N1    . DA  C 2 6  ? 7.635  52.398 64.616 1.00 43.36  ? 6    DA  C N1    1 
ATOM   1282 C  C2    . DA  C 2 6  ? 7.777  53.692 64.930 1.00 42.58  ? 6    DA  C C2    1 
ATOM   1283 N  N3    . DA  C 2 6  ? 6.848  54.654 64.897 1.00 42.98  ? 6    DA  C N3    1 
ATOM   1284 C  C4    . DA  C 2 6  ? 5.665  54.184 64.479 1.00 43.43  ? 6    DA  C C4    1 
ATOM   1285 P  P     . DC  C 2 7  ? 4.148  60.330 63.242 1.00 50.61  ? 7    DC  C P     1 
ATOM   1286 O  OP1   . DC  C 2 7  ? 4.289  61.727 63.682 1.00 50.92  ? 7    DC  C OP1   1 
ATOM   1287 O  OP2   . DC  C 2 7  ? 3.252  59.988 62.111 1.00 50.62  ? 7    DC  C OP2   1 
ATOM   1288 O  "O5'" . DC  C 2 7  ? 5.600  59.767 62.935 1.00 49.78  ? 7    DC  C "O5'" 1 
ATOM   1289 C  "C5'" . DC  C 2 7  ? 6.556  59.764 63.970 1.00 48.39  ? 7    DC  C "C5'" 1 
ATOM   1290 C  "C4'" . DC  C 2 7  ? 7.757  59.021 63.434 1.00 48.19  ? 7    DC  C "C4'" 1 
ATOM   1291 O  "O4'" . DC  C 2 7  ? 7.410  57.623 63.248 1.00 47.44  ? 7    DC  C "O4'" 1 
ATOM   1292 C  "C3'" . DC  C 2 7  ? 8.246  59.524 62.083 1.00 47.80  ? 7    DC  C "C3'" 1 
ATOM   1293 O  "O3'" . DC  C 2 7  ? 9.585  59.919 62.310 1.00 51.04  ? 7    DC  C "O3'" 1 
ATOM   1294 C  "C2'" . DC  C 2 7  ? 8.115  58.301 61.170 1.00 47.21  ? 7    DC  C "C2'" 1 
ATOM   1295 C  "C1'" . DC  C 2 7  ? 8.154  57.138 62.161 1.00 44.94  ? 7    DC  C "C1'" 1 
ATOM   1296 N  N1    . DC  C 2 7  ? 7.542  55.847 61.728 1.00 41.43  ? 7    DC  C N1    1 
ATOM   1297 C  C2    . DC  C 2 7  ? 8.288  54.648 61.743 1.00 40.09  ? 7    DC  C C2    1 
ATOM   1298 O  O2    . DC  C 2 7  ? 9.477  54.622 62.111 1.00 37.17  ? 7    DC  C O2    1 
ATOM   1299 N  N3    . DC  C 2 7  ? 7.662  53.506 61.345 1.00 40.34  ? 7    DC  C N3    1 
ATOM   1300 C  C4    . DC  C 2 7  ? 6.377  53.521 60.948 1.00 41.37  ? 7    DC  C C4    1 
ATOM   1301 N  N4    . DC  C 2 7  ? 5.824  52.369 60.555 1.00 39.12  ? 7    DC  C N4    1 
ATOM   1302 C  C5    . DC  C 2 7  ? 5.601  54.725 60.934 1.00 40.27  ? 7    DC  C C5    1 
ATOM   1303 C  C6    . DC  C 2 7  ? 6.228  55.845 61.325 1.00 41.75  ? 7    DC  C C6    1 
ATOM   1304 P  P     . DA  C 2 8  ? 10.585 60.498 61.193 1.00 54.19  ? 8    DA  C P     1 
ATOM   1305 O  OP1   . DA  C 2 8  ? 11.647 61.199 61.962 1.00 53.15  ? 8    DA  C OP1   1 
ATOM   1306 O  OP2   . DA  C 2 8  ? 9.773  61.146 60.135 1.00 52.99  ? 8    DA  C OP2   1 
ATOM   1307 O  "O5'" . DA  C 2 8  ? 11.252 59.207 60.523 1.00 53.51  ? 8    DA  C "O5'" 1 
ATOM   1308 C  "C5'" . DA  C 2 8  ? 11.972 58.329 61.392 1.00 53.30  ? 8    DA  C "C5'" 1 
ATOM   1309 C  "C4'" . DA  C 2 8  ? 12.759 57.305 60.600 1.00 52.21  ? 8    DA  C "C4'" 1 
ATOM   1310 O  "O4'" . DA  C 2 8  ? 11.941 56.128 60.358 1.00 50.65  ? 8    DA  C "O4'" 1 
ATOM   1311 C  "C3'" . DA  C 2 8  ? 13.260 57.810 59.254 1.00 50.89  ? 8    DA  C "C3'" 1 
ATOM   1312 O  "O3'" . DA  C 2 8  ? 14.639 57.493 59.244 1.00 51.22  ? 8    DA  C "O3'" 1 
ATOM   1313 C  "C2'" . DA  C 2 8  ? 12.392 57.067 58.228 1.00 50.46  ? 8    DA  C "C2'" 1 
ATOM   1314 C  "C1'" . DA  C 2 8  ? 11.950 55.806 58.982 1.00 49.07  ? 8    DA  C "C1'" 1 
ATOM   1315 N  N9    . DA  C 2 8  ? 10.641 55.221 58.657 1.00 45.12  ? 8    DA  C N9    1 
ATOM   1316 C  C8    . DA  C 2 8  ? 9.420  55.825 58.495 1.00 43.27  ? 8    DA  C C8    1 
ATOM   1317 N  N7    . DA  C 2 8  ? 8.437  54.990 58.220 1.00 42.36  ? 8    DA  C N7    1 
ATOM   1318 C  C5    . DA  C 2 8  ? 9.061  53.745 58.198 1.00 42.56  ? 8    DA  C C5    1 
ATOM   1319 C  C6    . DA  C 2 8  ? 8.600  52.422 57.959 1.00 40.98  ? 8    DA  C C6    1 
ATOM   1320 N  N6    . DA  C 2 8  ? 7.327  52.098 57.683 1.00 38.09  ? 8    DA  C N6    1 
ATOM   1321 N  N1    . DA  C 2 8  ? 9.517  51.428 58.013 1.00 39.33  ? 8    DA  C N1    1 
ATOM   1322 C  C2    . DA  C 2 8  ? 10.793 51.718 58.280 1.00 39.77  ? 8    DA  C C2    1 
ATOM   1323 N  N3    . DA  C 2 8  ? 11.344 52.906 58.529 1.00 41.30  ? 8    DA  C N3    1 
ATOM   1324 C  C4    . DA  C 2 8  ? 10.420 53.879 58.467 1.00 43.14  ? 8    DA  C C4    1 
ATOM   1325 P  P     . DG  C 2 9  ? 15.614 57.751 58.001 1.00 52.23  ? 9    DG  C P     1 
ATOM   1326 O  OP1   . DG  C 2 9  ? 16.909 58.282 58.488 1.00 51.02  ? 9    DG  C OP1   1 
ATOM   1327 O  OP2   . DG  C 2 9  ? 14.860 58.386 56.901 1.00 50.59  ? 9    DG  C OP2   1 
ATOM   1328 O  "O5'" . DG  C 2 9  ? 15.917 56.250 57.598 1.00 51.78  ? 9    DG  C "O5'" 1 
ATOM   1329 C  "C5'" . DG  C 2 9  ? 16.573 55.389 58.521 1.00 49.79  ? 9    DG  C "C5'" 1 
ATOM   1330 C  "C4'" . DG  C 2 9  ? 16.659 54.033 57.857 1.00 48.92  ? 9    DG  C "C4'" 1 
ATOM   1331 O  "O4'" . DG  C 2 9  ? 15.323 53.527 57.586 1.00 47.88  ? 9    DG  C "O4'" 1 
ATOM   1332 C  "C3'" . DG  C 2 9  ? 17.394 54.062 56.522 1.00 48.18  ? 9    DG  C "C3'" 1 
ATOM   1333 O  "O3'" . DG  C 2 9  ? 18.272 52.971 56.628 1.00 48.98  ? 9    DG  C "O3'" 1 
ATOM   1334 C  "C2'" . DG  C 2 9  ? 16.288 53.925 55.469 1.00 46.34  ? 9    DG  C "C2'" 1 
ATOM   1335 C  "C1'" . DG  C 2 9  ? 15.206 53.151 56.225 1.00 45.55  ? 9    DG  C "C1'" 1 
ATOM   1336 N  N9    . DG  C 2 9  ? 13.830 53.424 55.819 1.00 43.00  ? 9    DG  C N9    1 
ATOM   1337 C  C8    . DG  C 2 9  ? 13.234 54.655 55.705 1.00 43.30  ? 9    DG  C C8    1 
ATOM   1338 N  N7    . DG  C 2 9  ? 11.983 54.604 55.330 1.00 42.43  ? 9    DG  C N7    1 
ATOM   1339 C  C5    . DG  C 2 9  ? 11.727 53.253 55.189 1.00 41.49  ? 9    DG  C C5    1 
ATOM   1340 C  C6    . DG  C 2 9  ? 10.529 52.600 54.806 1.00 43.20  ? 9    DG  C C6    1 
ATOM   1341 O  O6    . DG  C 2 9  ? 9.434  53.121 54.502 1.00 43.48  ? 9    DG  C O6    1 
ATOM   1342 N  N1    . DG  C 2 9  ? 10.683 51.207 54.786 1.00 40.97  ? 9    DG  C N1    1 
ATOM   1343 C  C2    . DG  C 2 9  ? 11.854 50.567 55.110 1.00 40.87  ? 9    DG  C C2    1 
ATOM   1344 N  N2    . DG  C 2 9  ? 11.824 49.238 55.042 1.00 42.85  ? 9    DG  C N2    1 
ATOM   1345 N  N3    . DG  C 2 9  ? 12.983 51.165 55.468 1.00 41.06  ? 9    DG  C N3    1 
ATOM   1346 C  C4    . DG  C 2 9  ? 12.851 52.513 55.484 1.00 41.86  ? 9    DG  C C4    1 
ATOM   1347 P  P     . DT  C 2 10 ? 19.078 52.333 55.413 1.00 50.78  ? 10   DT  C P     1 
ATOM   1348 O  OP1   . DT  C 2 10 ? 20.276 51.662 55.974 1.00 50.01  ? 10   DT  C OP1   1 
ATOM   1349 O  OP2   . DT  C 2 10 ? 19.207 53.303 54.311 1.00 49.06  ? 10   DT  C OP2   1 
ATOM   1350 O  "O5'" . DT  C 2 10 ? 18.019 51.236 54.959 1.00 48.94  ? 10   DT  C "O5'" 1 
ATOM   1351 C  "C5'" . DT  C 2 10 ? 17.737 50.114 55.762 1.00 46.79  ? 10   DT  C "C5'" 1 
ATOM   1352 C  "C4'" . DT  C 2 10 ? 16.999 49.132 54.873 1.00 46.08  ? 10   DT  C "C4'" 1 
ATOM   1353 O  "O4'" . DT  C 2 10 ? 15.698 49.640 54.471 1.00 45.35  ? 10   DT  C "O4'" 1 
ATOM   1354 C  "C3'" . DT  C 2 10 ? 17.729 48.788 53.577 1.00 45.19  ? 10   DT  C "C3'" 1 
ATOM   1355 O  "O3'" . DT  C 2 10 ? 17.676 47.375 53.523 1.00 44.76  ? 10   DT  C "O3'" 1 
ATOM   1356 C  "C2'" . DT  C 2 10 ? 16.902 49.448 52.472 1.00 43.67  ? 10   DT  C "C2'" 1 
ATOM   1357 C  "C1'" . DT  C 2 10 ? 15.506 49.387 53.091 1.00 43.79  ? 10   DT  C "C1'" 1 
ATOM   1358 N  N1    . DT  C 2 10 ? 14.481 50.356 52.590 1.00 43.18  ? 10   DT  C N1    1 
ATOM   1359 C  C2    . DT  C 2 10 ? 13.239 49.878 52.222 1.00 44.18  ? 10   DT  C C2    1 
ATOM   1360 O  O2    . DT  C 2 10 ? 12.886 48.713 52.254 1.00 48.64  ? 10   DT  C O2    1 
ATOM   1361 N  N3    . DT  C 2 10 ? 12.362 50.825 51.794 1.00 43.82  ? 10   DT  C N3    1 
ATOM   1362 C  C4    . DT  C 2 10 ? 12.584 52.174 51.698 1.00 42.83  ? 10   DT  C C4    1 
ATOM   1363 O  O4    . DT  C 2 10 ? 11.691 52.911 51.291 1.00 43.42  ? 10   DT  C O4    1 
ATOM   1364 C  C5    . DT  C 2 10 ? 13.896 52.621 52.099 1.00 43.53  ? 10   DT  C C5    1 
ATOM   1365 C  C7    . DT  C 2 10 ? 14.260 54.090 52.028 1.00 46.54  ? 10   DT  C C7    1 
ATOM   1366 C  C6    . DT  C 2 10 ? 14.770 51.702 52.526 1.00 41.69  ? 10   DT  C C6    1 
ATOM   1367 P  P     . DT  C 2 11 ? 18.527 46.499 52.508 1.00 42.51  ? 11   DT  C P     1 
ATOM   1368 O  OP1   . DT  C 2 11 ? 19.014 45.365 53.320 1.00 43.16  ? 11   DT  C OP1   1 
ATOM   1369 O  OP2   . DT  C 2 11 ? 19.447 47.372 51.741 1.00 42.16  ? 11   DT  C OP2   1 
ATOM   1370 O  "O5'" . DT  C 2 11 ? 17.385 46.040 51.515 1.00 39.50  ? 11   DT  C "O5'" 1 
ATOM   1371 C  "C5'" . DT  C 2 11 ? 16.202 45.524 52.041 1.00 38.93  ? 11   DT  C "C5'" 1 
ATOM   1372 C  "C4'" . DT  C 2 11 ? 15.155 45.427 50.955 1.00 36.92  ? 11   DT  C "C4'" 1 
ATOM   1373 O  "O4'" . DT  C 2 11 ? 14.604 46.743 50.746 1.00 34.45  ? 11   DT  C "O4'" 1 
ATOM   1374 C  "C3'" . DT  C 2 11 ? 15.645 44.942 49.595 1.00 36.76  ? 11   DT  C "C3'" 1 
ATOM   1375 O  "O3'" . DT  C 2 11 ? 15.130 43.623 49.397 1.00 36.29  ? 11   DT  C "O3'" 1 
ATOM   1376 C  "C2'" . DT  C 2 11 ? 15.046 45.958 48.616 1.00 35.81  ? 11   DT  C "C2'" 1 
ATOM   1377 C  "C1'" . DT  C 2 11 ? 14.053 46.740 49.460 1.00 35.53  ? 11   DT  C "C1'" 1 
ATOM   1378 N  N1    . DT  C 2 11 ? 13.870 48.176 49.177 1.00 36.96  ? 11   DT  C N1    1 
ATOM   1379 C  C2    . DT  C 2 11 ? 12.608 48.621 48.833 1.00 36.55  ? 11   DT  C C2    1 
ATOM   1380 O  O2    . DT  C 2 11 ? 11.652 47.877 48.728 1.00 36.99  ? 11   DT  C O2    1 
ATOM   1381 N  N3    . DT  C 2 11 ? 12.501 49.975 48.609 1.00 36.86  ? 11   DT  C N3    1 
ATOM   1382 C  C4    . DT  C 2 11 ? 13.533 50.892 48.703 1.00 38.23  ? 11   DT  C C4    1 
ATOM   1383 O  O4    . DT  C 2 11 ? 13.344 52.085 48.498 1.00 40.29  ? 11   DT  C O4    1 
ATOM   1384 C  C5    . DT  C 2 11 ? 14.831 50.363 49.073 1.00 38.74  ? 11   DT  C C5    1 
ATOM   1385 C  C7    . DT  C 2 11 ? 16.015 51.285 49.208 1.00 41.33  ? 11   DT  C C7    1 
ATOM   1386 C  C6    . DT  C 2 11 ? 14.948 49.044 49.297 1.00 37.36  ? 11   DT  C C6    1 
ATOM   1387 P  P     . DT  C 2 12 ? 15.200 42.817 48.008 1.00 35.26  ? 12   DT  C P     1 
ATOM   1388 O  OP1   . DT  C 2 12 ? 15.086 41.389 48.388 1.00 33.85  ? 12   DT  C OP1   1 
ATOM   1389 O  OP2   . DT  C 2 12 ? 16.366 43.257 47.204 1.00 32.65  ? 12   DT  C OP2   1 
ATOM   1390 O  "O5'" . DT  C 2 12 ? 13.890 43.351 47.272 1.00 32.97  ? 12   DT  C "O5'" 1 
ATOM   1391 C  "C5'" . DT  C 2 12 ? 12.624 43.073 47.767 1.00 33.20  ? 12   DT  C "C5'" 1 
ATOM   1392 C  "C4'" . DT  C 2 12 ? 11.604 43.568 46.770 1.00 33.12  ? 12   DT  C "C4'" 1 
ATOM   1393 O  "O4'" . DT  C 2 12 ? 11.693 45.012 46.702 1.00 35.61  ? 12   DT  C "O4'" 1 
ATOM   1394 C  "C3'" . DT  C 2 12 ? 11.751 43.056 45.349 1.00 32.77  ? 12   DT  C "C3'" 1 
ATOM   1395 O  "O3'" . DT  C 2 12 ? 10.506 42.452 45.036 1.00 32.09  ? 12   DT  C "O3'" 1 
ATOM   1396 C  "C2'" . DT  C 2 12 ? 12.062 44.302 44.504 1.00 34.06  ? 12   DT  C "C2'" 1 
ATOM   1397 C  "C1'" . DT  C 2 12 ? 11.559 45.455 45.367 1.00 33.64  ? 12   DT  C "C1'" 1 
ATOM   1398 N  N1    . DT  C 2 12 ? 12.335 46.722 45.328 1.00 32.57  ? 12   DT  C N1    1 
ATOM   1399 C  C2    . DT  C 2 12 ? 11.661 47.895 45.091 1.00 33.74  ? 12   DT  C C2    1 
ATOM   1400 O  O2    . DT  C 2 12 ? 10.459 47.894 44.889 1.00 34.62  ? 12   DT  C O2    1 
ATOM   1401 N  N3    . DT  C 2 12 ? 12.448 49.036 45.090 1.00 33.59  ? 12   DT  C N3    1 
ATOM   1402 C  C4    . DT  C 2 12 ? 13.829 49.091 45.309 1.00 34.49  ? 12   DT  C C4    1 
ATOM   1403 O  O4    . DT  C 2 12 ? 14.498 50.135 45.298 1.00 37.63  ? 12   DT  C O4    1 
ATOM   1404 C  C5    . DT  C 2 12 ? 14.463 47.820 45.550 1.00 32.49  ? 12   DT  C C5    1 
ATOM   1405 C  C7    . DT  C 2 12 ? 15.937 47.759 45.787 1.00 29.89  ? 12   DT  C C7    1 
ATOM   1406 C  C6    . DT  C 2 12 ? 13.701 46.718 45.552 1.00 32.83  ? 12   DT  C C6    1 
ATOM   1407 P  P     . DG  C 2 13 ? 10.084 42.006 43.556 1.00 33.99  ? 13   DG  C P     1 
ATOM   1408 O  OP1   . DG  C 2 13 ? 8.955  41.041 43.627 1.00 31.08  ? 13   DG  C OP1   1 
ATOM   1409 O  OP2   . DG  C 2 13 ? 11.329 41.678 42.827 1.00 33.19  ? 13   DG  C OP2   1 
ATOM   1410 O  "O5'" . DG  C 2 13 ? 9.504  43.370 42.931 1.00 33.65  ? 13   DG  C "O5'" 1 
ATOM   1411 C  "C5'" . DG  C 2 13 ? 8.232  43.847 43.328 1.00 34.36  ? 13   DG  C "C5'" 1 
ATOM   1412 C  "C4'" . DG  C 2 13 ? 7.840  45.075 42.527 1.00 36.05  ? 13   DG  C "C4'" 1 
ATOM   1413 O  "O4'" . DG  C 2 13 ? 8.828  46.121 42.690 1.00 37.48  ? 13   DG  C "O4'" 1 
ATOM   1414 C  "C3'" . DG  C 2 13 ? 7.739  44.865 41.015 1.00 36.84  ? 13   DG  C "C3'" 1 
ATOM   1415 O  "O3'" . DG  C 2 13 ? 6.500  45.397 40.597 1.00 35.90  ? 13   DG  C "O3'" 1 
ATOM   1416 C  "C2'" . DG  C 2 13 ? 8.929  45.630 40.421 1.00 35.80  ? 13   DG  C "C2'" 1 
ATOM   1417 C  "C1'" . DG  C 2 13 ? 9.065  46.744 41.438 1.00 34.89  ? 13   DG  C "C1'" 1 
ATOM   1418 N  N9    . DG  C 2 13 ? 10.352 47.395 41.560 1.00 32.82  ? 13   DG  C N9    1 
ATOM   1419 C  C8    . DG  C 2 13 ? 11.572 46.839 41.851 1.00 33.70  ? 13   DG  C C8    1 
ATOM   1420 N  N7    . DG  C 2 13 ? 12.536 47.720 41.924 1.00 33.26  ? 13   DG  C N7    1 
ATOM   1421 C  C5    . DG  C 2 13 ? 11.905 48.941 41.670 1.00 33.41  ? 13   DG  C C5    1 
ATOM   1422 C  C6    . DG  C 2 13 ? 12.419 50.272 41.601 1.00 34.15  ? 13   DG  C C6    1 
ATOM   1423 O  O6    . DG  C 2 13 ? 13.599 50.671 41.757 1.00 32.96  ? 13   DG  C O6    1 
ATOM   1424 N  N1    . DG  C 2 13 ? 11.403 51.193 41.316 1.00 32.31  ? 13   DG  C N1    1 
ATOM   1425 C  C2    . DG  C 2 13 ? 10.085 50.878 41.114 1.00 31.74  ? 13   DG  C C2    1 
ATOM   1426 N  N2    . DG  C 2 13 ? 9.240  51.884 40.837 1.00 28.77  ? 13   DG  C N2    1 
ATOM   1427 N  N3    . DG  C 2 13 ? 9.611  49.641 41.178 1.00 32.76  ? 13   DG  C N3    1 
ATOM   1428 C  C4    . DG  C 2 13 ? 10.565 48.738 41.453 1.00 32.40  ? 13   DG  C C4    1 
ATOM   1429 P  P     . DT  C 2 14 ? 6.115  45.427 39.054 1.00 37.69  ? 14   DT  C P     1 
ATOM   1430 O  OP1   . DT  C 2 14 ? 4.751  44.851 38.853 1.00 35.86  ? 14   DT  C OP1   1 
ATOM   1431 O  OP2   . DT  C 2 14 ? 7.255  44.866 38.309 1.00 38.51  ? 14   DT  C OP2   1 
ATOM   1432 O  "O5'" . DT  C 2 14 ? 6.167  47.000 38.773 1.00 38.58  ? 14   DT  C "O5'" 1 
ATOM   1433 C  "C5'" . DT  C 2 14 ? 5.589  47.975 39.642 1.00 38.33  ? 14   DT  C "C5'" 1 
ATOM   1434 C  "C4'" . DT  C 2 14 ? 5.440  49.290 38.894 1.00 40.30  ? 14   DT  C "C4'" 1 
ATOM   1435 O  "O4'" . DT  C 2 14 ? 6.666  50.065 38.878 1.00 39.88  ? 14   DT  C "O4'" 1 
ATOM   1436 C  "C3'" . DT  C 2 14 ? 5.014  49.198 37.433 1.00 41.59  ? 14   DT  C "C3'" 1 
ATOM   1437 O  "O3'" . DT  C 2 14 ? 4.145  50.314 37.242 1.00 43.75  ? 14   DT  C "O3'" 1 
ATOM   1438 C  "C2'" . DT  C 2 14 ? 6.349  49.261 36.676 1.00 39.91  ? 14   DT  C "C2'" 1 
ATOM   1439 C  "C1'" . DT  C 2 14 ? 7.155  50.210 37.558 1.00 39.72  ? 14   DT  C "C1'" 1 
ATOM   1440 N  N1    . DT  C 2 14 ? 8.619  49.970 37.672 1.00 40.19  ? 14   DT  C N1    1 
ATOM   1441 C  C2    . DT  C 2 14 ? 9.453  51.062 37.745 1.00 39.86  ? 14   DT  C C2    1 
ATOM   1442 O  O2    . DT  C 2 14 ? 9.070  52.205 37.700 1.00 43.17  ? 14   DT  C O2    1 
ATOM   1443 N  N3    . DT  C 2 14 ? 10.785 50.787 37.873 1.00 40.41  ? 14   DT  C N3    1 
ATOM   1444 C  C4    . DT  C 2 14 ? 11.365 49.535 37.937 1.00 39.98  ? 14   DT  C C4    1 
ATOM   1445 O  O4    . DT  C 2 14 ? 12.577 49.398 38.055 1.00 42.50  ? 14   DT  C O4    1 
ATOM   1446 C  C5    . DT  C 2 14 ? 10.450 48.422 37.859 1.00 40.20  ? 14   DT  C C5    1 
ATOM   1447 C  C7    . DT  C 2 14 ? 10.982 47.020 37.903 1.00 39.11  ? 14   DT  C C7    1 
ATOM   1448 C  C6    . DT  C 2 14 ? 9.134  48.683 37.740 1.00 40.28  ? 14   DT  C C6    1 
ATOM   1449 P  P     . DT  C 2 15 ? 3.519  50.739 35.835 1.00 45.82  ? 15   DT  C P     1 
ATOM   1450 O  OP1   . DT  C 2 15 ? 2.180  51.268 36.168 1.00 46.68  ? 15   DT  C OP1   1 
ATOM   1451 O  OP2   . DT  C 2 15 ? 3.663  49.614 34.885 1.00 46.03  ? 15   DT  C OP2   1 
ATOM   1452 O  "O5'" . DT  C 2 15 ? 4.479  51.940 35.400 1.00 45.86  ? 15   DT  C "O5'" 1 
ATOM   1453 C  "C5'" . DT  C 2 15 ? 4.575  53.041 36.303 1.00 46.46  ? 15   DT  C "C5'" 1 
ATOM   1454 C  "C4'" . DT  C 2 15 ? 5.405  54.187 35.757 1.00 46.44  ? 15   DT  C "C4'" 1 
ATOM   1455 O  "O4'" . DT  C 2 15 ? 6.827  53.891 35.844 1.00 45.02  ? 15   DT  C "O4'" 1 
ATOM   1456 C  "C3'" . DT  C 2 15 ? 5.117  54.577 34.312 1.00 46.49  ? 15   DT  C "C3'" 1 
ATOM   1457 O  "O3'" . DT  C 2 15 ? 5.127  55.997 34.303 1.00 48.16  ? 15   DT  C "O3'" 1 
ATOM   1458 C  "C2'" . DT  C 2 15 ? 6.286  53.943 33.553 1.00 46.37  ? 15   DT  C "C2'" 1 
ATOM   1459 C  "C1'" . DT  C 2 15 ? 7.426  54.029 34.571 1.00 43.94  ? 15   DT  C "C1'" 1 
ATOM   1460 N  N1    . DT  C 2 15 ? 8.455  52.963 34.509 1.00 40.92  ? 15   DT  C N1    1 
ATOM   1461 C  C2    . DT  C 2 15 ? 9.754  53.305 34.785 1.00 40.07  ? 15   DT  C C2    1 
ATOM   1462 O  O2    . DT  C 2 15 ? 10.113 54.433 35.046 1.00 40.90  ? 15   DT  C O2    1 
ATOM   1463 N  N3    . DT  C 2 15 ? 10.642 52.270 34.730 1.00 40.22  ? 15   DT  C N3    1 
ATOM   1464 C  C4    . DT  C 2 15 ? 10.357 50.944 34.454 1.00 39.39  ? 15   DT  C C4    1 
ATOM   1465 O  O4    . DT  C 2 15 ? 11.236 50.094 34.448 1.00 40.95  ? 15   DT  C O4    1 
ATOM   1466 C  C5    . DT  C 2 15 ? 8.976  50.637 34.181 1.00 38.70  ? 15   DT  C C5    1 
ATOM   1467 C  C7    . DT  C 2 15 ? 8.562  49.232 33.846 1.00 36.43  ? 15   DT  C C7    1 
ATOM   1468 C  C6    . DT  C 2 15 ? 8.098  51.654 34.227 1.00 39.99  ? 15   DT  C C6    1 
ATOM   1469 P  P     . DC  C 2 16 ? 5.196  56.925 33.001 1.00 48.02  ? 16   DC  C P     1 
ATOM   1470 O  OP1   . DC  C 2 16 ? 4.441  58.136 33.368 1.00 49.23  ? 16   DC  C OP1   1 
ATOM   1471 O  OP2   . DC  C 2 16 ? 4.823  56.135 31.800 1.00 47.87  ? 16   DC  C OP2   1 
ATOM   1472 O  "O5'" . DC  C 2 16 ? 6.751  57.289 32.893 1.00 46.32  ? 16   DC  C "O5'" 1 
ATOM   1473 C  "C5'" . DC  C 2 16 ? 7.328  58.216 33.769 1.00 45.31  ? 16   DC  C "C5'" 1 
ATOM   1474 C  "C4'" . DC  C 2 16 ? 8.794  58.417 33.421 1.00 45.70  ? 16   DC  C "C4'" 1 
ATOM   1475 O  "O4'" . DC  C 2 16 ? 9.522  57.159 33.412 1.00 45.48  ? 16   DC  C "O4'" 1 
ATOM   1476 C  "C3'" . DC  C 2 16 ? 9.071  59.062 32.068 1.00 45.57  ? 16   DC  C "C3'" 1 
ATOM   1477 O  "O3'" . DC  C 2 16 ? 10.103 60.011 32.260 1.00 45.93  ? 16   DC  C "O3'" 1 
ATOM   1478 C  "C2'" . DC  C 2 16 ? 9.590  57.910 31.211 1.00 45.33  ? 16   DC  C "C2'" 1 
ATOM   1479 C  "C1'" . DC  C 2 16 ? 10.339 57.104 32.261 1.00 44.39  ? 16   DC  C "C1'" 1 
ATOM   1480 N  N1    . DC  C 2 16 ? 10.514 55.684 31.923 1.00 42.57  ? 16   DC  C N1    1 
ATOM   1481 C  C2    . DC  C 2 16 ? 11.803 55.135 31.821 1.00 42.31  ? 16   DC  C C2    1 
ATOM   1482 O  O2    . DC  C 2 16 ? 12.807 55.855 32.014 1.00 38.73  ? 16   DC  C O2    1 
ATOM   1483 N  N3    . DC  C 2 16 ? 11.906 53.808 31.513 1.00 41.99  ? 16   DC  C N3    1 
ATOM   1484 C  C4    . DC  C 2 16 ? 10.804 53.069 31.323 1.00 42.12  ? 16   DC  C C4    1 
ATOM   1485 N  N4    . DC  C 2 16 ? 10.946 51.765 31.038 1.00 43.02  ? 16   DC  C N4    1 
ATOM   1486 C  C5    . DC  C 2 16 ? 9.495  53.622 31.424 1.00 42.05  ? 16   DC  C C5    1 
ATOM   1487 C  C6    . DC  C 2 16 ? 9.397  54.918 31.726 1.00 42.78  ? 16   DC  C C6    1 
ATOM   1488 P  P     . DT  C 2 17 ? 10.539 61.023 31.098 1.00 46.29  ? 17   DT  C P     1 
ATOM   1489 O  OP1   . DT  C 2 17 ? 11.014 62.254 31.784 1.00 43.16  ? 17   DT  C OP1   1 
ATOM   1490 O  OP2   . DT  C 2 17 ? 9.449  60.996 30.079 1.00 41.00  ? 17   DT  C OP2   1 
ATOM   1491 O  "O5'" . DT  C 2 17 ? 11.838 60.351 30.458 1.00 43.82  ? 17   DT  C "O5'" 1 
ATOM   1492 C  "C5'" . DT  C 2 17 ? 12.979 60.154 31.258 1.00 45.31  ? 17   DT  C "C5'" 1 
ATOM   1493 C  "C4'" . DT  C 2 17 ? 14.126 59.665 30.404 1.00 46.17  ? 17   DT  C "C4'" 1 
ATOM   1494 O  "O4'" . DT  C 2 17 ? 13.941 58.258 30.131 1.00 45.70  ? 17   DT  C "O4'" 1 
ATOM   1495 C  "C3'" . DT  C 2 17 ? 14.276 60.335 29.037 1.00 47.91  ? 17   DT  C "C3'" 1 
ATOM   1496 O  "O3'" . DT  C 2 17 ? 15.627 60.741 28.953 1.00 48.75  ? 17   DT  C "O3'" 1 
ATOM   1497 C  "C2'" . DT  C 2 17 ? 13.913 59.241 28.019 1.00 46.56  ? 17   DT  C "C2'" 1 
ATOM   1498 C  "C1'" . DT  C 2 17 ? 14.302 57.986 28.798 1.00 44.35  ? 17   DT  C "C1'" 1 
ATOM   1499 N  N1    . DT  C 2 17 ? 13.589 56.721 28.539 1.00 41.34  ? 17   DT  C N1    1 
ATOM   1500 C  C2    . DT  C 2 17 ? 14.369 55.605 28.358 1.00 40.45  ? 17   DT  C C2    1 
ATOM   1501 O  O2    . DT  C 2 17 ? 15.591 55.630 28.357 1.00 39.60  ? 17   DT  C O2    1 
ATOM   1502 N  N3    . DT  C 2 17 ? 13.664 54.450 28.149 1.00 39.10  ? 17   DT  C N3    1 
ATOM   1503 C  C4    . DT  C 2 17 ? 12.297 54.299 28.112 1.00 40.47  ? 17   DT  C C4    1 
ATOM   1504 O  O4    . DT  C 2 17 ? 11.782 53.193 27.923 1.00 42.35  ? 17   DT  C O4    1 
ATOM   1505 C  C5    . DT  C 2 17 ? 11.535 55.507 28.320 1.00 39.81  ? 17   DT  C C5    1 
ATOM   1506 C  C7    . DT  C 2 17 ? 10.046 55.452 28.301 1.00 39.12  ? 17   DT  C C7    1 
ATOM   1507 C  C6    . DT  C 2 17 ? 12.201 56.653 28.529 1.00 40.81  ? 17   DT  C C6    1 
ATOM   1508 P  P     . DG  C 2 18 ? 16.195 61.648 27.774 1.00 48.22  ? 18   DG  C P     1 
ATOM   1509 O  OP1   . DG  C 2 18 ? 17.046 62.670 28.417 1.00 49.09  ? 18   DG  C OP1   1 
ATOM   1510 O  OP2   . DG  C 2 18 ? 15.101 62.048 26.864 1.00 49.88  ? 18   DG  C OP2   1 
ATOM   1511 O  "O5'" . DG  C 2 18 ? 17.091 60.606 26.967 1.00 49.33  ? 18   DG  C "O5'" 1 
ATOM   1512 C  "C5'" . DG  C 2 18 ? 18.230 59.961 27.539 1.00 48.43  ? 18   DG  C "C5'" 1 
ATOM   1513 C  "C4'" . DG  C 2 18 ? 18.825 58.996 26.519 1.00 48.84  ? 18   DG  C "C4'" 1 
ATOM   1514 O  "O4'" . DG  C 2 18 ? 18.031 57.780 26.439 1.00 47.90  ? 18   DG  C "O4'" 1 
ATOM   1515 C  "C3'" . DG  C 2 18 ? 18.902 59.506 25.082 1.00 48.66  ? 18   DG  C "C3'" 1 
ATOM   1516 O  "O3'" . DG  C 2 18 ? 20.145 59.090 24.524 1.00 51.30  ? 18   DG  C "O3'" 1 
ATOM   1517 C  "C2'" . DG  C 2 18 ? 17.727 58.820 24.391 1.00 47.65  ? 18   DG  C "C2'" 1 
ATOM   1518 C  "C1'" . DG  C 2 18 ? 17.716 57.468 25.096 1.00 46.36  ? 18   DG  C "C1'" 1 
ATOM   1519 N  N9    . DG  C 2 18 ? 16.426 56.770 25.049 1.00 44.15  ? 18   DG  C N9    1 
ATOM   1520 C  C8    . DG  C 2 18 ? 15.188 57.366 24.975 1.00 43.37  ? 18   DG  C C8    1 
ATOM   1521 N  N7    . DG  C 2 18 ? 14.195 56.522 24.933 1.00 42.61  ? 18   DG  C N7    1 
ATOM   1522 C  C5    . DG  C 2 18 ? 14.810 55.275 25.001 1.00 41.93  ? 18   DG  C C5    1 
ATOM   1523 C  C6    . DG  C 2 18 ? 14.227 53.979 25.002 1.00 40.66  ? 18   DG  C C6    1 
ATOM   1524 O  O6    . DG  C 2 18 ? 13.032 53.661 24.948 1.00 39.31  ? 18   DG  C O6    1 
ATOM   1525 N  N1    . DG  C 2 18 ? 15.187 52.981 25.066 1.00 40.46  ? 18   DG  C N1    1 
ATOM   1526 C  C2    . DG  C 2 18 ? 16.543 53.202 25.129 1.00 40.42  ? 18   DG  C C2    1 
ATOM   1527 N  N2    . DG  C 2 18 ? 17.284 52.088 25.194 1.00 38.32  ? 18   DG  C N2    1 
ATOM   1528 N  N3    . DG  C 2 18 ? 17.111 54.410 25.135 1.00 41.01  ? 18   DG  C N3    1 
ATOM   1529 C  C4    . DG  C 2 18 ? 16.185 55.406 25.073 1.00 41.86  ? 18   DG  C C4    1 
ATOM   1530 O  "O5'" . DC  D 3 1  ? 8.558  45.975 21.447 1.00 61.79  ? 1    DC  D "O5'" 1 
ATOM   1531 C  "C5'" . DC  D 3 1  ? 9.270  45.161 20.512 1.00 60.00  ? 1    DC  D "C5'" 1 
ATOM   1532 C  "C4'" . DC  D 3 1  ? 10.766 45.215 20.777 1.00 59.09  ? 1    DC  D "C4'" 1 
ATOM   1533 O  "O4'" . DC  D 3 1  ? 11.259 46.553 20.506 1.00 56.53  ? 1    DC  D "O4'" 1 
ATOM   1534 C  "C3'" . DC  D 3 1  ? 11.143 44.895 22.219 1.00 58.85  ? 1    DC  D "C3'" 1 
ATOM   1535 O  "O3'" . DC  D 3 1  ? 12.290 44.049 22.288 1.00 60.02  ? 1    DC  D "O3'" 1 
ATOM   1536 C  "C2'" . DC  D 3 1  ? 11.434 46.260 22.837 1.00 58.06  ? 1    DC  D "C2'" 1 
ATOM   1537 C  "C1'" . DC  D 3 1  ? 11.936 47.055 21.642 1.00 56.07  ? 1    DC  D "C1'" 1 
ATOM   1538 N  N1    . DC  D 3 1  ? 11.697 48.534 21.803 1.00 53.46  ? 1    DC  D N1    1 
ATOM   1539 C  C2    . DC  D 3 1  ? 12.801 49.394 21.808 1.00 51.74  ? 1    DC  D C2    1 
ATOM   1540 O  O2    . DC  D 3 1  ? 13.941 48.935 21.673 1.00 49.03  ? 1    DC  D O2    1 
ATOM   1541 N  N3    . DC  D 3 1  ? 12.587 50.724 21.960 1.00 51.49  ? 1    DC  D N3    1 
ATOM   1542 C  C4    . DC  D 3 1  ? 11.357 51.213 22.099 1.00 51.05  ? 1    DC  D C4    1 
ATOM   1543 N  N4    . DC  D 3 1  ? 11.243 52.539 22.238 1.00 50.30  ? 1    DC  D N4    1 
ATOM   1544 C  C5    . DC  D 3 1  ? 10.215 50.356 22.102 1.00 51.26  ? 1    DC  D C5    1 
ATOM   1545 C  C6    . DC  D 3 1  ? 10.433 49.039 21.954 1.00 52.03  ? 1    DC  D C6    1 
ATOM   1546 P  P     . DC  D 3 2  ? 12.656 43.318 23.674 1.00 58.55  ? 2    DC  D P     1 
ATOM   1547 O  OP1   . DC  D 3 2  ? 13.240 42.012 23.312 1.00 60.69  ? 2    DC  D OP1   1 
ATOM   1548 O  OP2   . DC  D 3 2  ? 11.510 43.456 24.610 1.00 57.00  ? 2    DC  D OP2   1 
ATOM   1549 O  "O5'" . DC  D 3 2  ? 13.875 44.184 24.211 1.00 56.00  ? 2    DC  D "O5'" 1 
ATOM   1550 C  "C5'" . DC  D 3 2  ? 15.129 44.165 23.571 1.00 51.60  ? 2    DC  D "C5'" 1 
ATOM   1551 C  "C4'" . DC  D 3 2  ? 16.032 45.054 24.401 1.00 51.31  ? 2    DC  D "C4'" 1 
ATOM   1552 O  "O4'" . DC  D 3 2  ? 15.640 46.445 24.256 1.00 50.47  ? 2    DC  D "O4'" 1 
ATOM   1553 C  "C3'" . DC  D 3 2  ? 15.960 44.783 25.898 1.00 50.73  ? 2    DC  D "C3'" 1 
ATOM   1554 O  "O3'" . DC  D 3 2  ? 17.228 44.974 26.454 1.00 51.05  ? 2    DC  D "O3'" 1 
ATOM   1555 C  "C2'" . DC  D 3 2  ? 15.023 45.873 26.398 1.00 50.25  ? 2    DC  D "C2'" 1 
ATOM   1556 C  "C1'" . DC  D 3 2  ? 15.504 47.031 25.531 1.00 48.33  ? 2    DC  D "C1'" 1 
ATOM   1557 N  N1    . DC  D 3 2  ? 14.533 48.156 25.458 1.00 46.14  ? 2    DC  D N1    1 
ATOM   1558 C  C2    . DC  D 3 2  ? 14.967 49.485 25.360 1.00 46.07  ? 2    DC  D C2    1 
ATOM   1559 O  O2    . DC  D 3 2  ? 16.181 49.739 25.331 1.00 44.90  ? 2    DC  D O2    1 
ATOM   1560 N  N3    . DC  D 3 2  ? 14.025 50.467 25.297 1.00 45.79  ? 2    DC  D N3    1 
ATOM   1561 C  C4    . DC  D 3 2  ? 12.717 50.165 25.333 1.00 46.65  ? 2    DC  D C4    1 
ATOM   1562 N  N4    . DC  D 3 2  ? 11.812 51.156 25.275 1.00 46.22  ? 2    DC  D N4    1 
ATOM   1563 C  C5    . DC  D 3 2  ? 12.267 48.817 25.436 1.00 45.61  ? 2    DC  D C5    1 
ATOM   1564 C  C6    . DC  D 3 2  ? 13.202 47.869 25.487 1.00 45.49  ? 2    DC  D C6    1 
ATOM   1565 P  P     . DA  D 3 3  ? 17.634 44.341 27.865 1.00 51.57  ? 3    DA  D P     1 
ATOM   1566 O  OP1   . DA  D 3 3  ? 18.466 43.147 27.587 1.00 51.44  ? 3    DA  D OP1   1 
ATOM   1567 O  OP2   . DA  D 3 3  ? 16.477 44.284 28.797 1.00 50.08  ? 3    DA  D OP2   1 
ATOM   1568 O  "O5'" . DA  D 3 3  ? 18.588 45.516 28.339 1.00 50.46  ? 3    DA  D "O5'" 1 
ATOM   1569 C  "C5'" . DA  D 3 3  ? 19.779 45.751 27.611 1.00 49.74  ? 3    DA  D "C5'" 1 
ATOM   1570 C  "C4'" . DA  D 3 3  ? 20.344 47.049 28.120 1.00 48.71  ? 3    DA  D "C4'" 1 
ATOM   1571 O  "O4'" . DA  D 3 3  ? 19.375 48.088 27.871 1.00 48.43  ? 3    DA  D "O4'" 1 
ATOM   1572 C  "C3'" . DA  D 3 3  ? 20.628 47.055 29.610 1.00 49.40  ? 3    DA  D "C3'" 1 
ATOM   1573 O  "O3'" . DA  D 3 3  ? 21.932 47.573 29.756 1.00 50.87  ? 3    DA  D "O3'" 1 
ATOM   1574 C  "C2'" . DA  D 3 3  ? 19.514 47.915 30.215 1.00 48.59  ? 3    DA  D "C2'" 1 
ATOM   1575 C  "C1'" . DA  D 3 3  ? 19.016 48.772 29.053 1.00 48.14  ? 3    DA  D "C1'" 1 
ATOM   1576 N  N9    . DA  D 3 3  ? 17.565 48.962 28.963 1.00 46.23  ? 3    DA  D N9    1 
ATOM   1577 C  C8    . DA  D 3 3  ? 16.599 47.992 28.989 1.00 46.37  ? 3    DA  D C8    1 
ATOM   1578 N  N7    . DA  D 3 3  ? 15.367 48.443 28.870 1.00 44.54  ? 3    DA  D N7    1 
ATOM   1579 C  C5    . DA  D 3 3  ? 15.537 49.802 28.744 1.00 43.77  ? 3    DA  D C5    1 
ATOM   1580 C  C6    . DA  D 3 3  ? 14.615 50.848 28.582 1.00 43.58  ? 3    DA  D C6    1 
ATOM   1581 N  N6    . DA  D 3 3  ? 13.298 50.658 28.527 1.00 43.99  ? 3    DA  D N6    1 
ATOM   1582 N  N1    . DA  D 3 3  ? 15.092 52.104 28.491 1.00 44.54  ? 3    DA  D N1    1 
ATOM   1583 C  C2    . DA  D 3 3  ? 16.420 52.294 28.557 1.00 45.32  ? 3    DA  D C2    1 
ATOM   1584 N  N3    . DA  D 3 3  ? 17.391 51.382 28.704 1.00 46.08  ? 3    DA  D N3    1 
ATOM   1585 C  C4    . DA  D 3 3  ? 16.879 50.142 28.794 1.00 44.87  ? 3    DA  D C4    1 
ATOM   1586 P  P     . DG  D 3 4  ? 22.599 47.830 31.174 1.00 53.23  ? 4    DG  D P     1 
ATOM   1587 O  OP1   . DG  D 3 4  ? 24.065 48.054 31.067 1.00 52.60  ? 4    DG  D OP1   1 
ATOM   1588 O  OP2   . DG  D 3 4  ? 22.052 46.850 32.140 1.00 53.71  ? 4    DG  D OP2   1 
ATOM   1589 O  "O5'" . DG  D 3 4  ? 21.911 49.232 31.464 1.00 53.97  ? 4    DG  D "O5'" 1 
ATOM   1590 C  "C5'" . DG  D 3 4  ? 22.389 50.426 30.889 1.00 54.02  ? 4    DG  D "C5'" 1 
ATOM   1591 C  "C4'" . DG  D 3 4  ? 21.604 51.536 31.551 1.00 54.39  ? 4    DG  D "C4'" 1 
ATOM   1592 O  "O4'" . DG  D 3 4  ? 20.194 51.402 31.235 1.00 52.36  ? 4    DG  D "O4'" 1 
ATOM   1593 C  "C3'" . DG  D 3 4  ? 21.687 51.564 33.071 1.00 55.21  ? 4    DG  D "C3'" 1 
ATOM   1594 O  "O3'" . DG  D 3 4  ? 21.928 52.905 33.377 1.00 59.92  ? 4    DG  D "O3'" 1 
ATOM   1595 C  "C2'" . DG  D 3 4  ? 20.296 51.137 33.520 1.00 52.66  ? 4    DG  D "C2'" 1 
ATOM   1596 C  "C1'" . DG  D 3 4  ? 19.465 51.730 32.391 1.00 50.89  ? 4    DG  D "C1'" 1 
ATOM   1597 N  N9    . DG  D 3 4  ? 18.115 51.192 32.287 1.00 48.40  ? 4    DG  D N9    1 
ATOM   1598 C  C8    . DG  D 3 4  ? 17.747 49.872 32.396 1.00 47.32  ? 4    DG  D C8    1 
ATOM   1599 N  N7    . DG  D 3 4  ? 16.467 49.680 32.254 1.00 47.36  ? 4    DG  D N7    1 
ATOM   1600 C  C5    . DG  D 3 4  ? 15.941 50.951 32.043 1.00 45.57  ? 4    DG  D C5    1 
ATOM   1601 C  C6    . DG  D 3 4  ? 14.605 51.363 31.834 1.00 44.50  ? 4    DG  D C6    1 
ATOM   1602 O  O6    . DG  D 3 4  ? 13.593 50.649 31.796 1.00 43.29  ? 4    DG  D O6    1 
ATOM   1603 N  N1    . DG  D 3 4  ? 14.494 52.747 31.662 1.00 44.87  ? 4    DG  D N1    1 
ATOM   1604 C  C2    . DG  D 3 4  ? 15.570 53.615 31.685 1.00 45.38  ? 4    DG  D C2    1 
ATOM   1605 N  N2    . DG  D 3 4  ? 15.311 54.921 31.504 1.00 44.28  ? 4    DG  D N2    1 
ATOM   1606 N  N3    . DG  D 3 4  ? 16.827 53.232 31.880 1.00 45.46  ? 4    DG  D N3    1 
ATOM   1607 C  C4    . DG  D 3 4  ? 16.946 51.894 32.059 1.00 46.74  ? 4    DG  D C4    1 
ATOM   1608 P  P     . DA  D 3 5  ? 22.330 53.436 34.833 1.00 63.94  ? 5    DA  D P     1 
ATOM   1609 O  OP1   . DA  D 3 5  ? 23.617 54.149 34.619 1.00 63.32  ? 5    DA  D OP1   1 
ATOM   1610 O  OP2   . DA  D 3 5  ? 22.181 52.382 35.868 1.00 63.10  ? 5    DA  D OP2   1 
ATOM   1611 O  "O5'" . DA  D 3 5  ? 21.164 54.503 35.031 1.00 61.56  ? 5    DA  D "O5'" 1 
ATOM   1612 C  "C5'" . DA  D 3 5  ? 21.065 55.526 34.042 1.00 59.62  ? 5    DA  D "C5'" 1 
ATOM   1613 C  "C4'" . DA  D 3 5  ? 19.810 56.332 34.271 1.00 57.55  ? 5    DA  D "C4'" 1 
ATOM   1614 O  "O4'" . DA  D 3 5  ? 18.661 55.488 34.037 1.00 55.68  ? 5    DA  D "O4'" 1 
ATOM   1615 C  "C3'" . DA  D 3 5  ? 19.696 56.850 35.695 1.00 57.55  ? 5    DA  D "C3'" 1 
ATOM   1616 O  "O3'" . DA  D 3 5  ? 19.385 58.226 35.622 1.00 58.84  ? 5    DA  D "O3'" 1 
ATOM   1617 C  "C2'" . DA  D 3 5  ? 18.586 56.013 36.332 1.00 55.25  ? 5    DA  D "C2'" 1 
ATOM   1618 C  "C1'" . DA  D 3 5  ? 17.763 55.588 35.120 1.00 54.04  ? 5    DA  D "C1'" 1 
ATOM   1619 N  N9    . DA  D 3 5  ? 17.100 54.292 35.247 1.00 51.75  ? 5    DA  D N9    1 
ATOM   1620 C  C8    . DA  D 3 5  ? 17.671 53.084 35.547 1.00 49.76  ? 5    DA  D C8    1 
ATOM   1621 N  N7    . DA  D 3 5  ? 16.814 52.094 35.583 1.00 49.38  ? 5    DA  D N7    1 
ATOM   1622 C  C5    . DA  D 3 5  ? 15.599 52.688 35.283 1.00 48.62  ? 5    DA  D C5    1 
ATOM   1623 C  C6    . DA  D 3 5  ? 14.289 52.183 35.164 1.00 47.99  ? 5    DA  D C6    1 
ATOM   1624 N  N6    . DA  D 3 5  ? 13.966 50.898 35.337 1.00 47.77  ? 5    DA  D N6    1 
ATOM   1625 N  N1    . DA  D 3 5  ? 13.306 53.057 34.854 1.00 48.15  ? 5    DA  D N1    1 
ATOM   1626 C  C2    . DA  D 3 5  ? 13.618 54.347 34.678 1.00 48.35  ? 5    DA  D C2    1 
ATOM   1627 N  N3    . DA  D 3 5  ? 14.807 54.940 34.768 1.00 48.31  ? 5    DA  D N3    1 
ATOM   1628 C  C4    . DA  D 3 5  ? 15.759 54.045 35.076 1.00 49.69  ? 5    DA  D C4    1 
ATOM   1629 P  P     . DA  D 3 6  ? 19.316 59.092 36.958 1.00 60.72  ? 6    DA  D P     1 
ATOM   1630 O  OP1   . DA  D 3 6  ? 19.822 60.446 36.630 1.00 60.90  ? 6    DA  D OP1   1 
ATOM   1631 O  OP2   . DA  D 3 6  ? 19.908 58.327 38.088 1.00 59.82  ? 6    DA  D OP2   1 
ATOM   1632 O  "O5'" . DA  D 3 6  ? 17.737 59.153 37.187 1.00 58.15  ? 6    DA  D "O5'" 1 
ATOM   1633 C  "C5'" . DA  D 3 6  ? 16.897 59.652 36.169 1.00 54.74  ? 6    DA  D "C5'" 1 
ATOM   1634 C  "C4'" . DA  D 3 6  ? 15.468 59.449 36.619 1.00 52.68  ? 6    DA  D "C4'" 1 
ATOM   1635 O  "O4'" . DA  D 3 6  ? 15.176 58.031 36.694 1.00 51.30  ? 6    DA  D "O4'" 1 
ATOM   1636 C  "C3'" . DA  D 3 6  ? 15.181 60.016 37.998 1.00 51.90  ? 6    DA  D "C3'" 1 
ATOM   1637 O  "O3'" . DA  D 3 6  ? 14.146 60.989 37.837 1.00 51.40  ? 6    DA  D "O3'" 1 
ATOM   1638 C  "C2'" . DA  D 3 6  ? 14.805 58.795 38.861 1.00 51.77  ? 6    DA  D "C2'" 1 
ATOM   1639 C  "C1'" . DA  D 3 6  ? 14.380 57.747 37.833 1.00 50.69  ? 6    DA  D "C1'" 1 
ATOM   1640 N  N9    . DA  D 3 6  ? 14.613 56.328 38.151 1.00 48.48  ? 6    DA  D N9    1 
ATOM   1641 C  C8    . DA  D 3 6  ? 15.790 55.779 38.579 1.00 46.60  ? 6    DA  D C8    1 
ATOM   1642 N  N7    . DA  D 3 6  ? 15.735 54.481 38.752 1.00 46.10  ? 6    DA  D N7    1 
ATOM   1643 C  C5    . DA  D 3 6  ? 14.431 54.142 38.415 1.00 45.19  ? 6    DA  D C5    1 
ATOM   1644 C  C6    . DA  D 3 6  ? 13.735 52.909 38.394 1.00 44.35  ? 6    DA  D C6    1 
ATOM   1645 N  N6    . DA  D 3 6  ? 14.302 51.751 38.740 1.00 42.27  ? 6    DA  D N6    1 
ATOM   1646 N  N1    . DA  D 3 6  ? 12.431 52.906 38.012 1.00 44.74  ? 6    DA  D N1    1 
ATOM   1647 C  C2    . DA  D 3 6  ? 11.868 54.072 37.668 1.00 44.75  ? 6    DA  D C2    1 
ATOM   1648 N  N3    . DA  D 3 6  ? 12.436 55.288 37.648 1.00 45.43  ? 6    DA  D N3    1 
ATOM   1649 C  C4    . DA  D 3 6  ? 13.724 55.267 38.038 1.00 45.77  ? 6    DA  D C4    1 
ATOM   1650 P  P     . DC  D 3 7  ? 13.370 61.550 39.119 1.00 51.87  ? 7    DC  D P     1 
ATOM   1651 O  OP1   . DC  D 3 7  ? 12.526 62.691 38.710 1.00 52.23  ? 7    DC  D OP1   1 
ATOM   1652 O  OP2   . DC  D 3 7  ? 14.339 61.684 40.234 1.00 50.68  ? 7    DC  D OP2   1 
ATOM   1653 O  "O5'" . DC  D 3 7  ? 12.358 60.356 39.440 1.00 51.87  ? 7    DC  D "O5'" 1 
ATOM   1654 C  "C5'" . DC  D 3 7  ? 11.159 60.277 38.682 1.00 51.07  ? 7    DC  D "C5'" 1 
ATOM   1655 C  "C4'" . DC  D 3 7  ? 10.332 59.110 39.162 1.00 50.52  ? 7    DC  D "C4'" 1 
ATOM   1656 O  "O4'" . DC  D 3 7  ? 11.206 57.983 39.377 1.00 49.08  ? 7    DC  D "O4'" 1 
ATOM   1657 C  "C3'" . DC  D 3 7  ? 9.655  59.362 40.500 1.00 50.90  ? 7    DC  D "C3'" 1 
ATOM   1658 O  "O3'" . DC  D 3 7  ? 8.264  59.454 40.244 1.00 52.83  ? 7    DC  D "O3'" 1 
ATOM   1659 C  "C2'" . DC  D 3 7  ? 10.057 58.165 41.375 1.00 48.96  ? 7    DC  D "C2'" 1 
ATOM   1660 C  "C1'" . DC  D 3 7  ? 10.585 57.174 40.345 1.00 47.58  ? 7    DC  D "C1'" 1 
ATOM   1661 N  N1    . DC  D 3 7  ? 11.603 56.159 40.784 1.00 45.86  ? 7    DC  D N1    1 
ATOM   1662 C  C2    . DC  D 3 7  ? 11.283 54.783 40.749 1.00 45.07  ? 7    DC  D C2    1 
ATOM   1663 O  O2    . DC  D 3 7  ? 10.158 54.413 40.371 1.00 44.48  ? 7    DC  D O2    1 
ATOM   1664 N  N3    . DC  D 3 7  ? 12.225 53.880 41.127 1.00 43.27  ? 7    DC  D N3    1 
ATOM   1665 C  C4    . DC  D 3 7  ? 13.435 54.300 41.521 1.00 44.58  ? 7    DC  D C4    1 
ATOM   1666 N  N4    . DC  D 3 7  ? 14.337 53.382 41.891 1.00 40.98  ? 7    DC  D N4    1 
ATOM   1667 C  C5    . DC  D 3 7  ? 13.780 55.695 41.561 1.00 45.40  ? 7    DC  D C5    1 
ATOM   1668 C  C6    . DC  D 3 7  ? 12.845 56.576 41.183 1.00 45.22  ? 7    DC  D C6    1 
ATOM   1669 P  P     . DA  D 3 8  ? 7.232  59.706 41.439 1.00 57.17  ? 8    DA  D P     1 
ATOM   1670 O  OP1   . DA  D 3 8  ? 5.963  60.178 40.827 1.00 56.83  ? 8    DA  D OP1   1 
ATOM   1671 O  OP2   . DA  D 3 8  ? 7.904  60.444 42.542 1.00 54.73  ? 8    DA  D OP2   1 
ATOM   1672 O  "O5'" . DA  D 3 8  ? 6.961  58.232 41.991 1.00 57.03  ? 8    DA  D "O5'" 1 
ATOM   1673 C  "C5'" . DA  D 3 8  ? 6.255  57.262 41.220 1.00 56.05  ? 8    DA  D "C5'" 1 
ATOM   1674 C  "C4'" . DA  D 3 8  ? 6.079  56.041 42.096 1.00 55.32  ? 8    DA  D "C4'" 1 
ATOM   1675 O  "O4'" . DA  D 3 8  ? 7.353  55.383 42.296 1.00 54.18  ? 8    DA  D "O4'" 1 
ATOM   1676 C  "C3'" . DA  D 3 8  ? 5.556  56.345 43.494 1.00 54.86  ? 8    DA  D "C3'" 1 
ATOM   1677 O  "O3'" . DA  D 3 8  ? 4.534  55.429 43.734 1.00 55.79  ? 8    DA  D "O3'" 1 
ATOM   1678 C  "C2'" . DA  D 3 8  ? 6.728  56.052 44.420 1.00 54.94  ? 8    DA  D "C2'" 1 
ATOM   1679 C  "C1'" . DA  D 3 8  ? 7.418  54.948 43.633 1.00 53.69  ? 8    DA  D "C1'" 1 
ATOM   1680 N  N9    . DA  D 3 8  ? 8.818  54.718 43.969 1.00 52.65  ? 8    DA  D N9    1 
ATOM   1681 C  C8    . DA  D 3 8  ? 9.818  55.637 44.149 1.00 52.00  ? 8    DA  D C8    1 
ATOM   1682 N  N7    . DA  D 3 8  ? 10.984 55.100 44.432 1.00 52.33  ? 8    DA  D N7    1 
ATOM   1683 C  C5    . DA  D 3 8  ? 10.724 53.729 44.445 1.00 51.94  ? 8    DA  D C5    1 
ATOM   1684 C  C6    . DA  D 3 8  ? 11.530 52.583 44.680 1.00 51.78  ? 8    DA  D C6    1 
ATOM   1685 N  N6    . DA  D 3 8  ? 12.834 52.634 44.980 1.00 49.48  ? 8    DA  D N6    1 
ATOM   1686 N  N1    . DA  D 3 8  ? 10.937 51.364 44.601 1.00 51.95  ? 8    DA  D N1    1 
ATOM   1687 C  C2    . DA  D 3 8  ? 9.626  51.290 44.314 1.00 51.08  ? 8    DA  D C2    1 
ATOM   1688 N  N3    . DA  D 3 8  ? 8.775  52.288 44.073 1.00 50.77  ? 8    DA  D N3    1 
ATOM   1689 C  C4    . DA  D 3 8  ? 9.390  53.483 44.157 1.00 51.90  ? 8    DA  D C4    1 
ATOM   1690 P  P     . DA  D 3 9  ? 3.252  55.792 44.608 1.00 55.51  ? 9    DA  D P     1 
ATOM   1691 O  OP1   . DA  D 3 9  ? 2.236  56.383 43.701 1.00 55.35  ? 9    DA  D OP1   1 
ATOM   1692 O  OP2   . DA  D 3 9  ? 3.702  56.472 45.844 1.00 53.86  ? 9    DA  D OP2   1 
ATOM   1693 O  "O5'" . DA  D 3 9  ? 2.777  54.317 44.973 1.00 53.90  ? 9    DA  D "O5'" 1 
ATOM   1694 C  "C5'" . DA  D 3 9  ? 2.901  53.277 44.005 1.00 52.24  ? 9    DA  D "C5'" 1 
ATOM   1695 C  "C4'" . DA  D 3 9  ? 3.391  52.009 44.679 1.00 50.22  ? 9    DA  D "C4'" 1 
ATOM   1696 O  "O4'" . DA  D 3 9  ? 4.818  52.046 44.966 1.00 48.47  ? 9    DA  D "O4'" 1 
ATOM   1697 C  "C3'" . DA  D 3 9  ? 2.694  51.716 46.002 1.00 49.14  ? 9    DA  D "C3'" 1 
ATOM   1698 O  "O3'" . DA  D 3 9  ? 2.330  50.356 45.923 1.00 49.46  ? 9    DA  D "O3'" 1 
ATOM   1699 C  "C2'" . DA  D 3 9  ? 3.776  51.990 47.044 1.00 47.04  ? 9    DA  D "C2'" 1 
ATOM   1700 C  "C1'" . DA  D 3 9  ? 5.012  51.541 46.274 1.00 46.27  ? 9    DA  D "C1'" 1 
ATOM   1701 N  N9    . DA  D 3 9  ? 6.278  52.075 46.752 1.00 43.07  ? 9    DA  D N9    1 
ATOM   1702 C  C8    . DA  D 3 9  ? 6.532  53.400 46.951 1.00 42.33  ? 9    DA  D C8    1 
ATOM   1703 N  N7    . DA  D 3 9  ? 7.750  53.637 47.360 1.00 42.66  ? 9    DA  D N7    1 
ATOM   1704 C  C5    . DA  D 3 9  ? 8.335  52.388 47.429 1.00 41.47  ? 9    DA  D C5    1 
ATOM   1705 C  C6    . DA  D 3 9  ? 9.628  51.981 47.800 1.00 41.69  ? 9    DA  D C6    1 
ATOM   1706 N  N6    . DA  D 3 9  ? 10.530 52.880 48.174 1.00 41.38  ? 9    DA  D N6    1 
ATOM   1707 N  N1    . DA  D 3 9  ? 9.938  50.652 47.794 1.00 41.80  ? 9    DA  D N1    1 
ATOM   1708 C  C2    . DA  D 3 9  ? 8.982  49.792 47.397 1.00 41.18  ? 9    DA  D C2    1 
ATOM   1709 N  N3    . DA  D 3 9  ? 7.722  50.071 47.015 1.00 40.53  ? 9    DA  D N3    1 
ATOM   1710 C  C4    . DA  D 3 9  ? 7.447  51.397 47.057 1.00 41.71  ? 9    DA  D C4    1 
ATOM   1711 P  P     . DA  D 3 10 ? 1.470  49.594 47.030 1.00 48.74  ? 10   DA  D P     1 
ATOM   1712 O  OP1   . DA  D 3 10 ? 0.531  48.747 46.264 1.00 50.13  ? 10   DA  D OP1   1 
ATOM   1713 O  OP2   . DA  D 3 10 ? 1.014  50.534 48.084 1.00 47.30  ? 10   DA  D OP2   1 
ATOM   1714 O  "O5'" . DA  D 3 10 ? 2.585  48.636 47.649 1.00 48.19  ? 10   DA  D "O5'" 1 
ATOM   1715 C  "C5'" . DA  D 3 10 ? 3.358  47.778 46.820 1.00 45.26  ? 10   DA  D "C5'" 1 
ATOM   1716 C  "C4'" . DA  D 3 10 ? 4.390  47.097 47.693 1.00 43.29  ? 10   DA  D "C4'" 1 
ATOM   1717 O  "O4'" . DA  D 3 10 ? 5.396  48.048 48.125 1.00 44.09  ? 10   DA  D "O4'" 1 
ATOM   1718 C  "C3'" . DA  D 3 10 ? 3.806  46.506 48.966 1.00 41.63  ? 10   DA  D "C3'" 1 
ATOM   1719 O  "O3'" . DA  D 3 10 ? 4.302  45.155 49.013 1.00 39.52  ? 10   DA  D "O3'" 1 
ATOM   1720 C  "C2'" . DA  D 3 10 ? 4.278  47.469 50.075 1.00 40.99  ? 10   DA  D "C2'" 1 
ATOM   1721 C  "C1'" . DA  D 3 10 ? 5.620  47.957 49.527 1.00 42.16  ? 10   DA  D "C1'" 1 
ATOM   1722 N  N9    . DA  D 3 10 ? 6.235  49.236 49.930 1.00 40.89  ? 10   DA  D N9    1 
ATOM   1723 C  C8    . DA  D 3 10 ? 5.709  50.502 49.954 1.00 41.22  ? 10   DA  D C8    1 
ATOM   1724 N  N7    . DA  D 3 10 ? 6.573  51.446 50.325 1.00 41.62  ? 10   DA  D N7    1 
ATOM   1725 C  C5    . DA  D 3 10 ? 7.753  50.762 50.541 1.00 41.91  ? 10   DA  D C5    1 
ATOM   1726 C  C6    . DA  D 3 10 ? 9.066  51.164 50.945 1.00 44.46  ? 10   DA  D C6    1 
ATOM   1727 N  N6    . DA  D 3 10 ? 9.426  52.427 51.219 1.00 42.75  ? 10   DA  D N6    1 
ATOM   1728 N  N1    . DA  D 3 10 ? 10.030 50.213 51.067 1.00 43.80  ? 10   DA  D N1    1 
ATOM   1729 C  C2    . DA  D 3 10 ? 9.681  48.948 50.784 1.00 45.24  ? 10   DA  D C2    1 
ATOM   1730 N  N3    . DA  D 3 10 ? 8.489  48.457 50.389 1.00 43.32  ? 10   DA  D N3    1 
ATOM   1731 C  C4    . DA  D 3 10 ? 7.553  49.411 50.292 1.00 41.27  ? 10   DA  D C4    1 
ATOM   1732 P  P     . DC  D 3 11 ? 3.867  44.081 50.134 1.00 40.18  ? 11   DC  D P     1 
ATOM   1733 O  OP1   . DC  D 3 11 ? 3.694  42.809 49.394 1.00 40.28  ? 11   DC  D OP1   1 
ATOM   1734 O  OP2   . DC  D 3 11 ? 2.810  44.648 51.028 1.00 36.18  ? 11   DC  D OP2   1 
ATOM   1735 O  "O5'" . DC  D 3 11 ? 5.176  43.936 51.034 1.00 35.78  ? 11   DC  D "O5'" 1 
ATOM   1736 C  "C5'" . DC  D 3 11 ? 6.397  44.370 50.525 1.00 35.68  ? 11   DC  D "C5'" 1 
ATOM   1737 C  "C4'" . DC  D 3 11 ? 7.440  44.352 51.614 1.00 35.89  ? 11   DC  D "C4'" 1 
ATOM   1738 O  "O4'" . DC  D 3 11 ? 7.812  45.711 51.915 1.00 34.20  ? 11   DC  D "O4'" 1 
ATOM   1739 C  "C3'" . DC  D 3 11 ? 7.013  43.671 52.921 1.00 35.48  ? 11   DC  D "C3'" 1 
ATOM   1740 O  "O3'" . DC  D 3 11 ? 7.998  42.660 53.172 1.00 32.05  ? 11   DC  D "O3'" 1 
ATOM   1741 C  "C2'" . DC  D 3 11 ? 6.961  44.802 53.948 1.00 34.38  ? 11   DC  D "C2'" 1 
ATOM   1742 C  "C1'" . DC  D 3 11 ? 7.855  45.872 53.314 1.00 36.14  ? 11   DC  D "C1'" 1 
ATOM   1743 N  N1    . DC  D 3 11 ? 7.524  47.327 53.530 1.00 37.97  ? 11   DC  D N1    1 
ATOM   1744 C  C2    . DC  D 3 11 ? 8.601  48.147 53.835 1.00 37.37  ? 11   DC  D C2    1 
ATOM   1745 O  O2    . DC  D 3 11 ? 9.711  47.616 53.921 1.00 36.20  ? 11   DC  D O2    1 
ATOM   1746 N  N3    . DC  D 3 11 ? 8.390  49.476 54.026 1.00 39.82  ? 11   DC  D N3    1 
ATOM   1747 C  C4    . DC  D 3 11 ? 7.157  49.982 53.921 1.00 40.47  ? 11   DC  D C4    1 
ATOM   1748 N  N4    . DC  D 3 11 ? 7.041  51.292 54.118 1.00 41.22  ? 11   DC  D N4    1 
ATOM   1749 C  C5    . DC  D 3 11 ? 6.018  49.175 53.611 1.00 40.05  ? 11   DC  D C5    1 
ATOM   1750 C  C6    . DC  D 3 11 ? 6.255  47.858 53.418 1.00 40.10  ? 11   DC  D C6    1 
ATOM   1751 P  P     . DT  D 3 12 ? 8.117  41.836 54.531 1.00 30.91  ? 12   DT  D P     1 
ATOM   1752 O  OP1   . DT  D 3 12 ? 8.595  40.501 54.096 1.00 31.29  ? 12   DT  D OP1   1 
ATOM   1753 O  OP2   . DT  D 3 12 ? 6.875  41.880 55.316 1.00 29.96  ? 12   DT  D OP2   1 
ATOM   1754 O  "O5'" . DT  D 3 12 ? 9.228  42.649 55.367 1.00 29.76  ? 12   DT  D "O5'" 1 
ATOM   1755 C  "C5'" . DT  D 3 12 ? 10.467 42.977 54.763 1.00 30.33  ? 12   DT  D "C5'" 1 
ATOM   1756 C  "C4'" . DT  D 3 12 ? 11.433 43.589 55.761 1.00 31.51  ? 12   DT  D "C4'" 1 
ATOM   1757 O  "O4'" . DT  D 3 12 ? 11.149 45.009 55.875 1.00 33.28  ? 12   DT  D "O4'" 1 
ATOM   1758 C  "C3'" . DT  D 3 12 ? 11.402 43.044 57.189 1.00 31.84  ? 12   DT  D "C3'" 1 
ATOM   1759 O  "O3'" . DT  D 3 12 ? 12.764 42.937 57.594 1.00 32.09  ? 12   DT  D "O3'" 1 
ATOM   1760 C  "C2'" . DT  D 3 12 ? 10.629 44.082 58.012 1.00 31.82  ? 12   DT  D "C2'" 1 
ATOM   1761 C  "C1'" . DT  D 3 12 ? 10.864 45.370 57.223 1.00 32.92  ? 12   DT  D "C1'" 1 
ATOM   1762 N  N1    . DT  D 3 12 ? 9.728  46.368 57.228 1.00 34.09  ? 12   DT  D N1    1 
ATOM   1763 C  C2    . DT  D 3 12 ? 10.048 47.690 57.436 1.00 35.86  ? 12   DT  D C2    1 
ATOM   1764 O  O2    . DT  D 3 12 ? 11.184 48.081 57.630 1.00 38.86  ? 12   DT  D O2    1 
ATOM   1765 N  N3    . DT  D 3 12 ? 8.994  48.559 57.439 1.00 36.27  ? 12   DT  D N3    1 
ATOM   1766 C  C4    . DT  D 3 12 ? 7.669  48.251 57.249 1.00 36.73  ? 12   DT  D C4    1 
ATOM   1767 O  O4    . DT  D 3 12 ? 6.808  49.121 57.269 1.00 40.28  ? 12   DT  D O4    1 
ATOM   1768 C  C5    . DT  D 3 12 ? 7.380  46.856 57.028 1.00 35.87  ? 12   DT  D C5    1 
ATOM   1769 C  C7    . DT  D 3 12 ? 5.951  46.420 56.820 1.00 34.53  ? 12   DT  D C7    1 
ATOM   1770 C  C6    . DT  D 3 12 ? 8.412  45.991 57.030 1.00 33.53  ? 12   DT  D C6    1 
ATOM   1771 P  P     . DG  D 3 13 ? 13.252 42.665 59.099 1.00 34.31  ? 13   DG  D P     1 
ATOM   1772 O  OP1   . DG  D 3 13 ? 14.583 42.018 59.006 1.00 32.67  ? 13   DG  D OP1   1 
ATOM   1773 O  OP2   . DG  D 3 13 ? 12.183 41.980 59.868 1.00 31.87  ? 13   DG  D OP2   1 
ATOM   1774 O  "O5'" . DG  D 3 13 ? 13.404 44.177 59.601 1.00 32.87  ? 13   DG  D "O5'" 1 
ATOM   1775 C  "C5'" . DG  D 3 13 ? 14.426 45.032 59.061 1.00 33.93  ? 13   DG  D "C5'" 1 
ATOM   1776 C  "C4'" . DG  D 3 13 ? 14.616 46.288 59.907 1.00 34.25  ? 13   DG  D "C4'" 1 
ATOM   1777 O  "O4'" . DG  D 3 13 ? 13.451 47.156 59.828 1.00 35.34  ? 13   DG  D "O4'" 1 
ATOM   1778 C  "C3'" . DG  D 3 13 ? 14.772 46.029 61.398 1.00 36.01  ? 13   DG  D "C3'" 1 
ATOM   1779 O  "O3'" . DG  D 3 13 ? 15.665 47.007 61.867 1.00 37.16  ? 13   DG  D "O3'" 1 
ATOM   1780 C  "C2'" . DG  D 3 13 ? 13.343 46.202 61.936 1.00 34.77  ? 13   DG  D "C2'" 1 
ATOM   1781 C  "C1'" . DG  D 3 13 ? 12.986 47.446 61.144 1.00 34.83  ? 13   DG  D "C1'" 1 
ATOM   1782 N  N9    . DG  D 3 13 ? 11.581 47.788 61.032 1.00 33.85  ? 13   DG  D N9    1 
ATOM   1783 C  C8    . DG  D 3 13 ? 10.546 46.944 60.731 1.00 34.51  ? 13   DG  D C8    1 
ATOM   1784 N  N7    . DG  D 3 13 ? 9.386  47.537 60.661 1.00 34.72  ? 13   DG  D N7    1 
ATOM   1785 C  C5    . DG  D 3 13 ? 9.670  48.867 60.922 1.00 33.94  ? 13   DG  D C5    1 
ATOM   1786 C  C6    . DG  D 3 13 ? 8.803  49.983 60.990 1.00 33.69  ? 13   DG  D C6    1 
ATOM   1787 O  O6    . DG  D 3 13 ? 7.572  49.984 60.820 1.00 33.41  ? 13   DG  D O6    1 
ATOM   1788 N  N1    . DG  D 3 13 ? 9.490  51.168 61.289 1.00 33.27  ? 13   DG  D N1    1 
ATOM   1789 C  C2    . DG  D 3 13 ? 10.852 51.234 61.513 1.00 33.57  ? 13   DG  D C2    1 
ATOM   1790 N  N2    . DG  D 3 13 ? 11.378 52.430 61.804 1.00 31.44  ? 13   DG  D N2    1 
ATOM   1791 N  N3    . DG  D 3 13 ? 11.668 50.187 61.446 1.00 33.64  ? 13   DG  D N3    1 
ATOM   1792 C  C4    . DG  D 3 13 ? 11.018 49.037 61.147 1.00 34.12  ? 13   DG  D C4    1 
ATOM   1793 P  P     . DT  D 3 14 ? 16.030 47.226 63.415 1.00 40.07  ? 14   DT  D P     1 
ATOM   1794 O  OP1   . DT  D 3 14 ? 17.498 47.034 63.516 1.00 39.59  ? 14   DT  D OP1   1 
ATOM   1795 O  OP2   . DT  D 3 14 ? 15.151 46.427 64.309 1.00 38.62  ? 14   DT  D OP2   1 
ATOM   1796 O  "O5'" . DT  D 3 14 ? 15.663 48.763 63.686 1.00 39.32  ? 14   DT  D "O5'" 1 
ATOM   1797 C  "C5'" . DT  D 3 14 ? 15.885 49.864 62.817 1.00 38.85  ? 14   DT  D "C5'" 1 
ATOM   1798 C  "C4'" . DT  D 3 14 ? 15.475 51.139 63.543 1.00 39.43  ? 14   DT  D "C4'" 1 
ATOM   1799 O  "O4'" . DT  D 3 14 ? 14.032 51.298 63.597 1.00 38.44  ? 14   DT  D "O4'" 1 
ATOM   1800 C  "C3'" . DT  D 3 14 ? 15.918 51.252 64.999 1.00 41.21  ? 14   DT  D "C3'" 1 
ATOM   1801 O  "O3'" . DT  D 3 14 ? 16.346 52.588 65.192 1.00 43.02  ? 14   DT  D "O3'" 1 
ATOM   1802 C  "C2'" . DT  D 3 14 ? 14.661 50.911 65.819 1.00 39.76  ? 14   DT  D "C2'" 1 
ATOM   1803 C  "C1'" . DT  D 3 14 ? 13.557 51.463 64.929 1.00 37.77  ? 14   DT  D "C1'" 1 
ATOM   1804 N  N1    . DT  D 3 14 ? 12.229 50.782 64.867 1.00 36.53  ? 14   DT  D N1    1 
ATOM   1805 C  C2    . DT  D 3 14 ? 11.084 51.562 64.828 1.00 35.34  ? 14   DT  D C2    1 
ATOM   1806 O  O2    . DT  D 3 14 ? 11.065 52.776 64.909 1.00 35.66  ? 14   DT  D O2    1 
ATOM   1807 N  N3    . DT  D 3 14 ? 9.912  50.866 64.696 1.00 35.78  ? 14   DT  D N3    1 
ATOM   1808 C  C4    . DT  D 3 14 ? 9.758  49.491 64.599 1.00 35.26  ? 14   DT  D C4    1 
ATOM   1809 O  O4    . DT  D 3 14 ? 8.650  48.971 64.492 1.00 37.10  ? 14   DT  D O4    1 
ATOM   1810 C  C5    . DT  D 3 14 ? 10.983 48.726 64.641 1.00 35.22  ? 14   DT  D C5    1 
ATOM   1811 C  C7    . DT  D 3 14 ? 10.919 47.233 64.557 1.00 31.64  ? 14   DT  D C7    1 
ATOM   1812 C  C6    . DT  D 3 14 ? 12.153 49.397 64.753 1.00 35.40  ? 14   DT  D C6    1 
ATOM   1813 P  P     . DT  D 3 15 ? 16.860 53.155 66.601 1.00 44.14  ? 15   DT  D P     1 
ATOM   1814 O  OP1   . DT  D 3 15 ? 18.074 53.926 66.248 1.00 45.35  ? 15   DT  D OP1   1 
ATOM   1815 O  OP2   . DT  D 3 15 ? 16.956 52.120 67.656 1.00 42.50  ? 15   DT  D OP2   1 
ATOM   1816 O  "O5'" . DT  D 3 15 ? 15.649 54.114 67.003 1.00 43.04  ? 15   DT  D "O5'" 1 
ATOM   1817 C  "C5'" . DT  D 3 15 ? 15.143 55.064 66.093 1.00 42.68  ? 15   DT  D "C5'" 1 
ATOM   1818 C  "C4'" . DT  D 3 15 ? 14.034 55.865 66.758 1.00 44.01  ? 15   DT  D "C4'" 1 
ATOM   1819 O  "O4'" . DT  D 3 15 ? 12.793 55.115 66.724 1.00 45.31  ? 15   DT  D "O4'" 1 
ATOM   1820 C  "C3'" . DT  D 3 15 ? 14.206 56.278 68.221 1.00 44.36  ? 15   DT  D "C3'" 1 
ATOM   1821 O  "O3'" . DT  D 3 15 ? 13.569 57.541 68.284 1.00 45.70  ? 15   DT  D "O3'" 1 
ATOM   1822 C  "C2'" . DT  D 3 15 ? 13.428 55.192 68.966 1.00 44.89  ? 15   DT  D "C2'" 1 
ATOM   1823 C  "C1'" . DT  D 3 15 ? 12.249 54.970 68.021 1.00 44.21  ? 15   DT  D "C1'" 1 
ATOM   1824 N  N1    . DT  D 3 15 ? 11.524 53.639 68.068 1.00 43.11  ? 15   DT  D N1    1 
ATOM   1825 C  C2    . DT  D 3 15 ? 10.149 53.618 67.867 1.00 43.03  ? 15   DT  D C2    1 
ATOM   1826 O  O2    . DT  D 3 15 ? 9.475  54.613 67.670 1.00 44.66  ? 15   DT  D O2    1 
ATOM   1827 N  N3    . DT  D 3 15 ? 9.558  52.379 67.918 1.00 41.54  ? 15   DT  D N3    1 
ATOM   1828 C  C4    . DT  D 3 15 ? 10.190 51.172 68.123 1.00 40.44  ? 15   DT  D C4    1 
ATOM   1829 O  O4    . DT  D 3 15 ? 9.563  50.118 68.134 1.00 40.47  ? 15   DT  D O4    1 
ATOM   1830 C  C5    . DT  D 3 15 ? 11.620 51.246 68.320 1.00 40.58  ? 15   DT  D C5    1 
ATOM   1831 C  C7    . DT  D 3 15 ? 12.410 49.993 68.570 1.00 38.69  ? 15   DT  D C7    1 
ATOM   1832 C  C6    . DT  D 3 15 ? 12.214 52.458 68.283 1.00 41.67  ? 15   DT  D C6    1 
ATOM   1833 P  P     . DC  D 3 16 ? 13.337 58.476 69.564 1.00 45.29  ? 16   DC  D P     1 
ATOM   1834 O  OP1   . DC  D 3 16 ? 13.650 59.846 69.100 1.00 45.98  ? 16   DC  D OP1   1 
ATOM   1835 O  OP2   . DC  D 3 16 ? 14.004 57.901 70.744 1.00 44.00  ? 16   DC  D OP2   1 
ATOM   1836 O  "O5'" . DC  D 3 16 ? 11.759 58.402 69.784 1.00 44.49  ? 16   DC  D "O5'" 1 
ATOM   1837 C  "C5'" . DC  D 3 16 ? 10.911 58.969 68.794 1.00 42.67  ? 16   DC  D "C5'" 1 
ATOM   1838 C  "C4'" . DC  D 3 16 ? 9.440  58.814 69.158 1.00 43.19  ? 16   DC  D "C4'" 1 
ATOM   1839 O  "O4'" . DC  D 3 16 ? 9.017  57.418 69.163 1.00 43.65  ? 16   DC  D "O4'" 1 
ATOM   1840 C  "C3'" . DC  D 3 16 ? 9.026  59.361 70.513 1.00 43.29  ? 16   DC  D "C3'" 1 
ATOM   1841 O  "O3'" . DC  D 3 16 ? 7.773  59.962 70.282 1.00 44.87  ? 16   DC  D "O3'" 1 
ATOM   1842 C  "C2'" . DC  D 3 16 ? 8.890  58.118 71.396 1.00 42.86  ? 16   DC  D "C2'" 1 
ATOM   1843 C  "C1'" . DC  D 3 16 ? 8.374  57.104 70.381 1.00 42.75  ? 16   DC  D "C1'" 1 
ATOM   1844 N  N1    . DC  D 3 16 ? 8.661  55.668 70.670 1.00 42.60  ? 16   DC  D N1    1 
ATOM   1845 C  C2    . DC  D 3 16 ? 7.572  54.781 70.754 1.00 42.05  ? 16   DC  D C2    1 
ATOM   1846 O  O2    . DC  D 3 16 ? 6.428  55.219 70.594 1.00 40.44  ? 16   DC  D O2    1 
ATOM   1847 N  N3    . DC  D 3 16 ? 7.800  53.465 71.001 1.00 41.37  ? 16   DC  D N3    1 
ATOM   1848 C  C4    . DC  D 3 16 ? 9.058  53.030 71.161 1.00 42.37  ? 16   DC  D C4    1 
ATOM   1849 N  N4    . DC  D 3 16 ? 9.224  51.719 71.402 1.00 43.13  ? 16   DC  D N4    1 
ATOM   1850 C  C5    . DC  D 3 16 ? 10.185 53.914 71.085 1.00 40.46  ? 16   DC  D C5    1 
ATOM   1851 C  C6    . DC  D 3 16 ? 9.946  55.212 70.835 1.00 41.50  ? 16   DC  D C6    1 
ATOM   1852 P  P     . DT  D 3 17 ? 6.978  60.734 71.430 1.00 45.05  ? 17   DT  D P     1 
ATOM   1853 O  OP1   . DT  D 3 17 ? 6.063  61.684 70.745 1.00 46.82  ? 17   DT  D OP1   1 
ATOM   1854 O  OP2   . DT  D 3 17 ? 8.017  61.180 72.390 1.00 43.98  ? 17   DT  D OP2   1 
ATOM   1855 O  "O5'" . DT  D 3 17 ? 6.005  59.653 72.066 1.00 45.35  ? 17   DT  D "O5'" 1 
ATOM   1856 C  "C5'" . DT  D 3 17 ? 4.898  59.239 71.280 1.00 47.04  ? 17   DT  D "C5'" 1 
ATOM   1857 C  "C4'" . DT  D 3 17 ? 3.967  58.382 72.109 1.00 48.45  ? 17   DT  D "C4'" 1 
ATOM   1858 O  "O4'" . DT  D 3 17 ? 4.588  57.112 72.425 1.00 47.13  ? 17   DT  D "O4'" 1 
ATOM   1859 C  "C3'" . DT  D 3 17 ? 3.586  58.994 73.448 1.00 49.25  ? 17   DT  D "C3'" 1 
ATOM   1860 O  "O3'" . DT  D 3 17 ? 2.186  58.879 73.500 1.00 51.16  ? 17   DT  D "O3'" 1 
ATOM   1861 C  "C2'" . DT  D 3 17 ? 4.299  58.124 74.496 1.00 48.59  ? 17   DT  D "C2'" 1 
ATOM   1862 C  "C1'" . DT  D 3 17 ? 4.346  56.778 73.777 1.00 46.21  ? 17   DT  D "C1'" 1 
ATOM   1863 N  N1    . DT  D 3 17 ? 5.417  55.779 74.079 1.00 43.08  ? 17   DT  D N1    1 
ATOM   1864 C  C2    . DT  D 3 17 ? 5.023  54.467 74.249 1.00 42.06  ? 17   DT  D C2    1 
ATOM   1865 O  O2    . DT  D 3 17 ? 3.855  54.112 74.208 1.00 41.07  ? 17   DT  D O2    1 
ATOM   1866 N  N3    . DT  D 3 17 ? 6.050  53.582 74.483 1.00 41.24  ? 17   DT  D N3    1 
ATOM   1867 C  C4    . DT  D 3 17 ? 7.407  53.868 74.547 1.00 41.72  ? 17   DT  D C4    1 
ATOM   1868 O  O4    . DT  D 3 17 ? 8.257  52.991 74.753 1.00 40.96  ? 17   DT  D O4    1 
ATOM   1869 C  C5    . DT  D 3 17 ? 7.747  55.264 74.351 1.00 41.04  ? 17   DT  D C5    1 
ATOM   1870 C  C7    . DT  D 3 17 ? 9.183  55.701 74.421 1.00 39.94  ? 17   DT  D C7    1 
ATOM   1871 C  C6    . DT  D 3 17 ? 6.753  56.140 74.121 1.00 41.08  ? 17   DT  D C6    1 
ATOM   1872 P  P     . DG  D 3 18 ? 1.357  59.660 74.614 1.00 52.61  ? 18   DG  D P     1 
ATOM   1873 O  OP1   . DG  D 3 18 ? 0.217  60.285 73.901 1.00 50.76  ? 18   DG  D OP1   1 
ATOM   1874 O  OP2   . DG  D 3 18 ? 2.313  60.471 75.424 1.00 50.28  ? 18   DG  D OP2   1 
ATOM   1875 O  "O5'" . DG  D 3 18 ? 0.839  58.441 75.527 1.00 50.85  ? 18   DG  D "O5'" 1 
ATOM   1876 C  "C5'" . DG  D 3 18 ? -0.061 57.466 75.029 1.00 50.92  ? 18   DG  D "C5'" 1 
ATOM   1877 C  "C4'" . DG  D 3 18 ? -0.240 56.308 76.002 1.00 51.77  ? 18   DG  D "C4'" 1 
ATOM   1878 O  "O4'" . DG  D 3 18 ? 0.973  55.506 76.119 1.00 50.51  ? 18   DG  D "O4'" 1 
ATOM   1879 C  "C3'" . DG  D 3 18 ? -0.631 56.668 77.429 1.00 52.31  ? 18   DG  D "C3'" 1 
ATOM   1880 O  "O3'" . DG  D 3 18 ? -1.708 55.802 77.802 1.00 54.65  ? 18   DG  D "O3'" 1 
ATOM   1881 C  "C2'" . DG  D 3 18 ? 0.642  56.383 78.236 1.00 50.64  ? 18   DG  D "C2'" 1 
ATOM   1882 C  "C1'" . DG  D 3 18 ? 1.251  55.210 77.474 1.00 49.09  ? 18   DG  D "C1'" 1 
ATOM   1883 N  N9    . DG  D 3 18 ? 2.706  55.060 77.559 1.00 47.82  ? 18   DG  D N9    1 
ATOM   1884 C  C8    . DG  D 3 18 ? 3.647  56.068 77.621 1.00 46.44  ? 18   DG  D C8    1 
ATOM   1885 N  N7    . DG  D 3 18 ? 4.869  55.626 77.674 1.00 45.73  ? 18   DG  D N7    1 
ATOM   1886 C  C5    . DG  D 3 18 ? 4.746  54.239 77.626 1.00 44.79  ? 18   DG  D C5    1 
ATOM   1887 C  C6    . DG  D 3 18 ? 5.734  53.222 77.642 1.00 44.65  ? 18   DG  D C6    1 
ATOM   1888 O  O6    . DG  D 3 18 ? 6.973  53.351 77.706 1.00 43.91  ? 18   DG  D O6    1 
ATOM   1889 N  N1    . DG  D 3 18 ? 5.173  51.945 77.587 1.00 44.43  ? 18   DG  D N1    1 
ATOM   1890 C  C2    . DG  D 3 18 ? 3.829  51.686 77.516 1.00 44.53  ? 18   DG  D C2    1 
ATOM   1891 N  N2    . DG  D 3 18 ? 3.437  50.406 77.472 1.00 43.54  ? 18   DG  D N2    1 
ATOM   1892 N  N3    . DG  D 3 18 ? 2.909  52.636 77.499 1.00 46.11  ? 18   DG  D N3    1 
ATOM   1893 C  C4    . DG  D 3 18 ? 3.426  53.882 77.555 1.00 45.27  ? 18   DG  D C4    1 
HETATM 1894 ZN ZN    . ZN  E 4 .  ? 14.887 38.420 65.874 1.00 34.12  ? 1641 ZN  A ZN    1 
HETATM 1895 ZN ZN    . ZN  F 4 .  ? 10.626 28.400 54.723 1.00 26.97  ? 1642 ZN  A ZN    1 
HETATM 1896 ZN ZN    . ZN  G 4 .  ? 9.821  37.341 36.788 1.00 37.48  ? 1639 ZN  B ZN    1 
HETATM 1897 ZN ZN    . ZN  H 4 .  ? 16.467 29.088 48.176 1.00 30.22  ? 1640 ZN  B ZN    1 
HETATM 1898 O  O     . HOH I 5 .  ? 20.445 35.603 75.213 1.00 44.24  ? 2001 HOH A O     1 
HETATM 1899 O  O     . HOH I 5 .  ? 19.121 33.842 73.601 1.00 44.76  ? 2002 HOH A O     1 
HETATM 1900 O  O     . HOH I 5 .  ? 22.052 33.082 64.387 1.00 29.82  ? 2003 HOH A O     1 
HETATM 1901 O  O     . HOH I 5 .  ? 18.567 32.228 68.053 1.00 44.29  ? 2004 HOH A O     1 
HETATM 1902 O  O     . HOH I 5 .  ? 21.785 35.495 63.283 1.00 31.10  ? 2005 HOH A O     1 
HETATM 1903 O  O     . HOH I 5 .  ? 18.154 44.362 63.505 1.00 30.22  ? 2006 HOH A O     1 
HETATM 1904 O  O     . HOH I 5 .  ? 21.957 43.481 74.066 1.00 53.09  ? 2007 HOH A O     1 
HETATM 1905 O  O     . HOH I 5 .  ? 12.391 46.911 69.945 1.00 35.44  ? 2008 HOH A O     1 
HETATM 1906 O  O     . HOH I 5 .  ? 1.214  34.945 51.245 1.00 38.49  ? 2009 HOH A O     1 
HETATM 1907 O  O     . HOH I 5 .  ? 6.145  39.173 76.870 1.00 38.61  ? 2010 HOH A O     1 
HETATM 1908 O  O     . HOH I 5 .  ? 12.775 33.611 76.180 1.00 37.60  ? 2011 HOH A O     1 
HETATM 1909 O  O     . HOH I 5 .  ? 16.126 45.101 68.637 1.00 46.40  ? 2012 HOH A O     1 
HETATM 1910 O  O     . HOH I 5 .  ? 19.210 28.459 63.020 1.00 43.32  ? 2013 HOH A O     1 
HETATM 1911 O  O     . HOH I 5 .  ? -1.141 42.897 59.722 1.00 46.80  ? 2014 HOH A O     1 
HETATM 1912 O  O     . HOH I 5 .  ? 7.556  43.428 59.861 1.00 27.88  ? 2015 HOH A O     1 
HETATM 1913 O  O     . HOH I 5 .  ? 1.827  47.504 61.153 1.00 42.86  ? 2016 HOH A O     1 
HETATM 1914 O  O     . HOH I 5 .  ? -0.201 37.642 57.560 1.00 22.20  ? 2017 HOH A O     1 
HETATM 1915 O  O     . HOH I 5 .  ? -1.226 30.336 51.337 1.00 39.83  ? 2018 HOH A O     1 
HETATM 1916 O  O     . HOH I 5 .  ? -2.753 33.641 52.781 1.00 36.47  ? 2019 HOH A O     1 
HETATM 1917 O  O     . HOH I 5 .  ? 4.641  40.218 58.728 1.00 40.91  ? 2020 HOH A O     1 
HETATM 1918 O  O     . HOH I 5 .  ? 0.715  39.625 56.114 1.00 41.44  ? 2021 HOH A O     1 
HETATM 1919 O  O     . HOH I 5 .  ? 3.341  32.894 50.581 1.00 24.84  ? 2022 HOH A O     1 
HETATM 1920 O  O     . HOH I 5 .  ? 10.195 23.310 47.128 1.00 40.30  ? 2023 HOH A O     1 
HETATM 1921 O  O     . HOH I 5 .  ? 9.837  30.725 51.236 1.00 30.42  ? 2024 HOH A O     1 
HETATM 1922 O  O     . HOH I 5 .  ? 7.322  24.304 48.541 1.00 40.77  ? 2025 HOH A O     1 
HETATM 1923 O  O     . HOH I 5 .  ? 12.803 25.232 53.812 1.00 23.18  ? 2026 HOH A O     1 
HETATM 1924 O  O     . HOH I 5 .  ? 4.928  26.331 58.718 1.00 33.48  ? 2027 HOH A O     1 
HETATM 1925 O  O     . HOH I 5 .  ? 4.475  26.971 54.701 1.00 19.05  ? 2028 HOH A O     1 
HETATM 1926 O  O     . HOH I 5 .  ? 7.665  26.939 57.593 1.00 25.68  ? 2029 HOH A O     1 
HETATM 1927 O  O     . HOH I 5 .  ? 3.902  24.637 53.786 1.00 34.70  ? 2030 HOH A O     1 
HETATM 1928 O  O     . HOH I 5 .  ? 6.324  20.346 54.963 1.00 33.74  ? 2031 HOH A O     1 
HETATM 1929 O  O     . HOH I 5 .  ? 16.007 24.576 60.856 1.00 46.61  ? 2032 HOH A O     1 
HETATM 1930 O  O     . HOH I 5 .  ? 14.643 19.490 58.212 1.00 24.59  ? 2033 HOH A O     1 
HETATM 1931 O  O     . HOH I 5 .  ? 14.104 27.148 61.370 1.00 31.78  ? 2034 HOH A O     1 
HETATM 1932 O  O     . HOH I 5 .  ? 14.814 32.111 55.763 1.00 25.69  ? 2035 HOH A O     1 
HETATM 1933 O  O     . HOH I 5 .  ? 19.285 31.961 64.410 1.00 37.04  ? 2036 HOH A O     1 
HETATM 1934 O  O     . HOH I 5 .  ? 23.745 34.289 57.573 1.00 27.76  ? 2037 HOH A O     1 
HETATM 1935 O  O     . HOH I 5 .  ? 22.915 31.200 60.487 1.00 41.23  ? 2038 HOH A O     1 
HETATM 1936 O  O     . HOH I 5 .  ? 22.892 36.062 59.470 1.00 38.21  ? 2039 HOH A O     1 
HETATM 1937 O  O     . HOH I 5 .  ? 16.426 39.503 56.431 1.00 16.61  ? 2040 HOH A O     1 
HETATM 1938 O  O     . HOH I 5 .  ? 22.722 28.443 55.102 1.00 31.75  ? 2041 HOH A O     1 
HETATM 1939 O  O     . HOH I 5 .  ? 12.952 33.524 57.106 1.00 24.33  ? 2042 HOH A O     1 
HETATM 1940 O  O     . HOH I 5 .  ? 11.891 41.660 51.481 1.00 32.14  ? 2043 HOH A O     1 
HETATM 1941 O  O     . HOH I 5 .  ? 19.511 35.792 51.357 1.00 21.83  ? 2044 HOH A O     1 
HETATM 1942 O  O     . HOH I 5 .  ? 18.755 38.294 51.570 1.00 38.43  ? 2045 HOH A O     1 
HETATM 1943 O  O     . HOH I 5 .  ? 4.014  29.766 59.020 1.00 34.00  ? 2046 HOH A O     1 
HETATM 1944 O  O     . HOH I 5 .  ? 7.007  32.025 53.413 1.00 35.58  ? 2047 HOH A O     1 
HETATM 1945 O  O     . HOH I 5 .  ? 18.176 29.927 66.502 1.00 40.14  ? 2048 HOH A O     1 
HETATM 1946 O  O     . HOH I 5 .  ? 16.424 28.862 62.240 1.00 30.20  ? 2049 HOH A O     1 
HETATM 1947 O  O     . HOH I 5 .  ? 3.382  29.889 70.480 1.00 33.60  ? 2050 HOH A O     1 
HETATM 1948 O  O     . HOH I 5 .  ? 4.756  23.449 65.047 1.00 46.61  ? 2051 HOH A O     1 
HETATM 1949 O  O     . HOH I 5 .  ? 11.755 25.839 66.027 1.00 35.50  ? 2052 HOH A O     1 
HETATM 1950 O  O     . HOH J 5 .  ? 5.485  33.116 27.349 1.00 54.96  ? 2001 HOH B O     1 
HETATM 1951 O  O     . HOH J 5 .  ? 7.285  31.892 28.677 1.00 43.45  ? 2002 HOH B O     1 
HETATM 1952 O  O     . HOH J 5 .  ? 7.970  30.435 34.356 1.00 49.88  ? 2003 HOH B O     1 
HETATM 1953 O  O     . HOH J 5 .  ? 2.811  41.455 41.611 1.00 54.10  ? 2004 HOH B O     1 
HETATM 1954 O  O     . HOH J 5 .  ? 3.961  32.659 39.335 1.00 39.39  ? 2005 HOH B O     1 
HETATM 1955 O  O     . HOH J 5 .  ? 4.563  42.081 39.398 1.00 26.64  ? 2006 HOH B O     1 
HETATM 1956 O  O     . HOH J 5 .  ? 14.206 30.762 53.221 1.00 23.90  ? 2007 HOH B O     1 
HETATM 1957 O  O     . HOH J 5 .  ? 13.067 33.030 26.261 1.00 44.40  ? 2008 HOH B O     1 
HETATM 1958 O  O     . HOH J 5 .  ? 6.495  43.021 33.999 1.00 38.05  ? 2009 HOH B O     1 
HETATM 1959 O  O     . HOH J 5 .  ? 17.760 46.474 34.361 1.00 53.71  ? 2010 HOH B O     1 
HETATM 1960 O  O     . HOH J 5 .  ? 14.045 46.270 35.447 1.00 45.58  ? 2011 HOH B O     1 
HETATM 1961 O  O     . HOH J 5 .  ? 15.103 44.187 42.767 1.00 25.03  ? 2012 HOH B O     1 
HETATM 1962 O  O     . HOH J 5 .  ? 23.402 37.957 51.325 1.00 33.00  ? 2013 HOH B O     1 
HETATM 1963 O  O     . HOH J 5 .  ? 24.953 39.187 44.964 1.00 48.85  ? 2014 HOH B O     1 
HETATM 1964 O  O     . HOH J 5 .  ? 29.225 31.308 49.212 1.00 43.28  ? 2015 HOH B O     1 
HETATM 1965 O  O     . HOH J 5 .  ? 24.960 36.509 45.153 1.00 47.52  ? 2016 HOH B O     1 
HETATM 1966 O  O     . HOH J 5 .  ? 24.066 33.817 45.170 1.00 43.75  ? 2017 HOH B O     1 
HETATM 1967 O  O     . HOH J 5 .  ? 19.607 42.242 43.841 1.00 46.57  ? 2018 HOH B O     1 
HETATM 1968 O  O     . HOH J 5 .  ? 22.288 35.571 51.778 1.00 23.21  ? 2019 HOH B O     1 
HETATM 1969 O  O     . HOH J 5 .  ? 22.790 28.017 50.908 1.00 39.56  ? 2020 HOH B O     1 
HETATM 1970 O  O     . HOH J 5 .  ? 16.569 31.603 51.548 1.00 25.67  ? 2021 HOH B O     1 
HETATM 1971 O  O     . HOH J 5 .  ? 20.499 26.210 54.102 1.00 16.93  ? 2022 HOH B O     1 
HETATM 1972 O  O     . HOH J 5 .  ? 16.205 22.149 53.382 1.00 36.77  ? 2023 HOH B O     1 
HETATM 1973 O  O     . HOH J 5 .  ? 19.262 26.565 43.064 1.00 42.41  ? 2024 HOH B O     1 
HETATM 1974 O  O     . HOH J 5 .  ? 22.824 28.939 48.454 1.00 31.84  ? 2025 HOH B O     1 
HETATM 1975 O  O     . HOH J 5 .  ? 11.666 21.366 47.753 1.00 43.01  ? 2026 HOH B O     1 
HETATM 1976 O  O     . HOH J 5 .  ? 11.348 31.267 46.830 1.00 28.35  ? 2027 HOH B O     1 
HETATM 1977 O  O     . HOH J 5 .  ? 10.674 27.311 40.723 1.00 38.94  ? 2028 HOH B O     1 
HETATM 1978 O  O     . HOH J 5 .  ? 3.801  28.497 42.037 1.00 31.94  ? 2029 HOH B O     1 
HETATM 1979 O  O     . HOH J 5 .  ? 2.737  31.316 45.512 1.00 37.25  ? 2030 HOH B O     1 
HETATM 1980 O  O     . HOH J 5 .  ? 2.519  32.772 43.187 1.00 23.20  ? 2031 HOH B O     1 
HETATM 1981 O  O     . HOH J 5 .  ? 8.046  38.057 46.096 1.00 29.63  ? 2032 HOH B O     1 
HETATM 1982 O  O     . HOH J 5 .  ? 2.388  31.833 48.147 1.00 20.02  ? 2033 HOH B O     1 
HETATM 1983 O  O     . HOH J 5 .  ? 5.165  25.327 47.778 1.00 25.44  ? 2034 HOH B O     1 
HETATM 1984 O  O     . HOH J 5 .  ? 14.674 37.868 44.974 1.00 48.74  ? 2035 HOH B O     1 
HETATM 1985 O  O     . HOH J 5 .  ? 12.966 33.491 45.424 1.00 24.78  ? 2036 HOH B O     1 
HETATM 1986 O  O     . HOH J 5 .  ? 14.618 37.991 50.835 1.00 29.22  ? 2037 HOH B O     1 
HETATM 1987 O  O     . HOH J 5 .  ? 10.096 37.423 51.693 1.00 27.85  ? 2038 HOH B O     1 
HETATM 1988 O  O     . HOH J 5 .  ? 6.005  33.573 51.330 1.00 28.34  ? 2039 HOH B O     1 
HETATM 1989 O  O     . HOH J 5 .  ? 22.552 32.222 43.488 1.00 36.70  ? 2040 HOH B O     1 
HETATM 1990 O  O     . HOH J 5 .  ? 18.929 33.973 49.535 1.00 40.14  ? 2041 HOH B O     1 
HETATM 1991 O  O     . HOH J 5 .  ? 26.240 31.457 44.001 1.00 42.13  ? 2042 HOH B O     1 
HETATM 1992 O  O     . HOH J 5 .  ? 19.928 28.596 45.631 1.00 54.04  ? 2043 HOH B O     1 
HETATM 1993 O  O     . HOH J 5 .  ? 16.300 28.735 35.038 1.00 40.36  ? 2044 HOH B O     1 
HETATM 1994 O  O     . HOH J 5 .  ? 22.883 28.124 31.523 1.00 40.08  ? 2045 HOH B O     1 
HETATM 1995 O  O     . HOH J 5 .  ? 15.895 26.178 36.524 1.00 40.66  ? 2046 HOH B O     1 
HETATM 1996 O  O     . HOH J 5 .  ? 23.443 32.752 32.187 1.00 48.61  ? 2047 HOH B O     1 
HETATM 1997 O  O     . HOH K 5 .  ? 11.561 54.212 80.827 1.00 47.36  ? 2001 HOH C O     1 
HETATM 1998 O  O     . HOH K 5 .  ? 6.585  42.800 47.107 1.00 37.49  ? 2002 HOH C O     1 
HETATM 1999 O  O     . HOH K 5 .  ? 5.946  48.468 43.901 1.00 52.13  ? 2003 HOH C O     1 
HETATM 2000 O  O     . HOH K 5 .  ? 4.087  47.774 66.276 1.00 43.17  ? 2004 HOH C O     1 
HETATM 2001 O  O     . HOH K 5 .  ? 9.128  56.488 54.420 1.00 46.11  ? 2005 HOH C O     1 
HETATM 2002 O  O     . HOH K 5 .  ? 18.032 52.926 51.931 1.00 38.95  ? 2006 HOH C O     1 
HETATM 2003 O  O     . HOH K 5 .  ? 9.711  46.070 49.456 1.00 36.75  ? 2007 HOH C O     1 
HETATM 2004 O  O     . HOH K 5 .  ? 15.479 54.217 48.231 1.00 34.41  ? 2008 HOH C O     1 
HETATM 2005 O  O     . HOH K 5 .  ? 18.483 45.325 47.134 1.00 53.62  ? 2009 HOH C O     1 
HETATM 2006 O  O     . HOH K 5 .  ? 8.050  47.132 45.904 1.00 57.97  ? 2010 HOH C O     1 
HETATM 2007 O  O     . HOH K 5 .  ? 15.015 38.999 47.375 1.00 30.34  ? 2011 HOH C O     1 
HETATM 2008 O  O     . HOH K 5 .  ? 8.330  44.947 47.495 1.00 36.70  ? 2012 HOH C O     1 
HETATM 2009 O  O     . HOH K 5 .  ? 16.566 42.956 44.620 1.00 39.29  ? 2013 HOH C O     1 
HETATM 2010 O  O     . HOH K 5 .  ? 17.132 40.101 49.789 1.00 29.30  ? 2014 HOH C O     1 
HETATM 2011 O  O     . HOH K 5 .  ? 7.070  40.580 45.728 1.00 32.26  ? 2015 HOH C O     1 
HETATM 2012 O  O     . HOH K 5 .  ? 12.950 43.382 41.771 1.00 34.17  ? 2016 HOH C O     1 
HETATM 2013 O  O     . HOH K 5 .  ? 7.676  42.461 37.462 1.00 36.58  ? 2017 HOH C O     1 
HETATM 2014 O  O     . HOH K 5 .  ? 8.173  46.209 36.007 1.00 50.72  ? 2018 HOH C O     1 
HETATM 2015 O  O     . HOH K 5 .  ? 5.503  50.955 32.254 1.00 69.86  ? 2019 HOH C O     1 
HETATM 2016 O  O     . HOH K 5 .  ? 10.503 56.857 35.993 1.00 36.52  ? 2020 HOH C O     1 
HETATM 2017 O  O     . HOH K 5 .  ? 6.653  55.800 29.865 1.00 48.37  ? 2021 HOH C O     1 
HETATM 2018 O  O     . HOH K 5 .  ? 14.301 57.362 33.312 1.00 37.72  ? 2022 HOH C O     1 
HETATM 2019 O  O     . HOH K 5 .  ? 9.085  52.256 28.042 1.00 46.26  ? 2023 HOH C O     1 
HETATM 2020 O  O     . HOH K 5 .  ? 9.465  59.191 28.096 1.00 47.60  ? 2024 HOH C O     1 
HETATM 2021 O  O     . HOH L 5 .  ? 8.926  50.968 25.654 1.00 47.72  ? 2001 HOH D O     1 
HETATM 2022 O  O     . HOH L 5 .  ? 17.904 40.790 25.948 1.00 39.98  ? 2002 HOH D O     1 
HETATM 2023 O  O     . HOH L 5 .  ? 12.922 47.281 29.030 1.00 56.11  ? 2003 HOH D O     1 
HETATM 2024 O  O     . HOH L 5 .  ? 12.918 48.058 32.200 1.00 50.52  ? 2004 HOH D O     1 
HETATM 2025 O  O     . HOH L 5 .  ? 14.643 48.447 36.230 1.00 33.44  ? 2005 HOH D O     1 
HETATM 2026 O  O     . HOH L 5 .  ? 16.605 54.554 43.053 1.00 48.03  ? 2006 HOH D O     1 
HETATM 2027 O  O     . HOH L 5 .  ? 4.821  52.998 54.163 1.00 37.74  ? 2007 HOH D O     1 
HETATM 2028 O  O     . HOH L 5 .  ? 4.313  42.705 55.355 1.00 41.57  ? 2008 HOH D O     1 
HETATM 2029 O  O     . HOH L 5 .  ? 6.563  42.028 57.699 1.00 40.53  ? 2009 HOH D O     1 
HETATM 2030 O  O     . HOH L 5 .  ? 9.308  38.241 55.174 1.00 22.82  ? 2010 HOH D O     1 
HETATM 2031 O  O     . HOH L 5 .  ? 13.519 48.060 56.949 1.00 38.45  ? 2011 HOH D O     1 
HETATM 2032 O  O     . HOH L 5 .  ? 14.133 46.185 55.112 1.00 35.67  ? 2012 HOH D O     1 
HETATM 2033 O  O     . HOH L 5 .  ? 6.813  38.570 52.852 1.00 29.05  ? 2013 HOH D O     1 
HETATM 2034 O  O     . HOH L 5 .  ? 4.221  49.360 56.897 1.00 45.33  ? 2014 HOH D O     1 
HETATM 2035 O  O     . HOH L 5 .  ? 16.415 42.047 57.108 1.00 24.88  ? 2015 HOH D O     1 
HETATM 2036 O  O     . HOH L 5 .  ? 10.144 43.210 61.114 1.00 24.54  ? 2016 HOH D O     1 
HETATM 2037 O  O     . HOH L 5 .  ? 13.777 47.116 66.564 1.00 55.65  ? 2017 HOH D O     1 
HETATM 2038 O  O     . HOH L 5 .  ? 15.547 44.053 65.362 1.00 42.35  ? 2018 HOH D O     1 
HETATM 2039 O  O     . HOH L 5 .  ? 12.233 55.188 63.785 1.00 45.88  ? 2019 HOH D O     1 
HETATM 2040 O  O     . HOH L 5 .  ? 10.753 57.475 65.584 1.00 36.65  ? 2020 HOH D O     1 
HETATM 2041 O  O     . HOH L 5 .  ? 8.256  56.781 66.236 1.00 33.85  ? 2021 HOH D O     1 
HETATM 2042 O  O     . HOH L 5 .  ? 12.040 50.950 72.018 1.00 43.05  ? 2022 HOH D O     1 
HETATM 2043 O  O     . HOH L 5 .  ? 4.623  56.225 68.955 1.00 33.04  ? 2023 HOH D O     1 
HETATM 2044 O  O     . HOH L 5 .  ? 11.819 57.195 72.646 1.00 38.60  ? 2024 HOH D O     1 
HETATM 2045 O  O     . HOH L 5 .  ? 8.352  59.381 74.442 1.00 38.60  ? 2025 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  563 563 PRO PRO A . n 
A 1 2  GLN 2  564 564 GLN GLN A . n 
A 1 3  LYS 3  565 565 LYS LYS A . n 
A 1 4  ILE 4  566 566 ILE ILE A . n 
A 1 5  CYS 5  567 567 CYS CYS A . n 
A 1 6  LEU 6  568 568 LEU LEU A . n 
A 1 7  ILE 7  569 569 ILE ILE A . n 
A 1 8  CYS 8  570 570 CYS CYS A . n 
A 1 9  GLY 9  571 571 GLY GLY A . n 
A 1 10 ASP 10 572 572 ASP ASP A . n 
A 1 11 GLU 11 573 573 GLU GLU A . n 
A 1 12 ALA 12 574 574 ALA ALA A . n 
A 1 13 SER 13 575 575 SER SER A . n 
A 1 14 GLY 14 576 576 GLY GLY A . n 
A 1 15 CYS 15 577 577 CYS CYS A . n 
A 1 16 HIS 16 578 578 HIS HIS A . n 
A 1 17 TYR 17 579 579 TYR TYR A . n 
A 1 18 GLY 18 580 580 GLY GLY A . n 
A 1 19 VAL 19 581 581 VAL VAL A . n 
A 1 20 LEU 20 582 582 LEU LEU A . n 
A 1 21 THR 21 583 583 THR THR A . n 
A 1 22 CYS 22 584 584 CYS CYS A . n 
A 1 23 GLY 23 585 585 GLY GLY A . n 
A 1 24 SER 24 586 586 SER SER A . n 
A 1 25 CYS 25 587 587 CYS CYS A . n 
A 1 26 LYS 26 588 588 LYS LYS A . n 
A 1 27 VAL 27 589 589 VAL VAL A . n 
A 1 28 PHE 28 590 590 PHE PHE A . n 
A 1 29 PHE 29 591 591 PHE PHE A . n 
A 1 30 LYS 30 592 592 LYS LYS A . n 
A 1 31 ARG 31 593 593 ARG ARG A . n 
A 1 32 ALA 32 594 594 ALA ALA A . n 
A 1 33 MET 33 595 595 MET MET A . n 
A 1 34 GLU 34 596 596 GLU GLU A . n 
A 1 35 GLY 35 597 597 GLY GLY A . n 
A 1 36 GLN 36 598 598 GLN GLN A . n 
A 1 37 HIS 37 599 599 HIS HIS A . n 
A 1 38 ASN 38 600 600 ASN ASN A . n 
A 1 39 TYR 39 601 601 TYR TYR A . n 
A 1 40 LEU 40 602 602 LEU LEU A . n 
A 1 41 CYS 41 603 603 CYS CYS A . n 
A 1 42 ALA 42 604 604 ALA ALA A . n 
A 1 43 GLY 43 605 605 GLY GLY A . n 
A 1 44 ARG 44 606 606 ARG ARG A . n 
A 1 45 ASN 45 607 607 ASN ASN A . n 
A 1 46 ASP 46 608 608 ASP ASP A . n 
A 1 47 CYS 47 609 609 CYS CYS A . n 
A 1 48 ILE 48 610 610 ILE ILE A . n 
A 1 49 VAL 49 611 611 VAL VAL A . n 
A 1 50 ASP 50 612 612 ASP ASP A . n 
A 1 51 LYS 51 613 613 LYS LYS A . n 
A 1 52 ILE 52 614 614 ILE ILE A . n 
A 1 53 ARG 53 615 615 ARG ARG A . n 
A 1 54 ARG 54 616 616 ARG ARG A . n 
A 1 55 LYS 55 617 617 LYS LYS A . n 
A 1 56 ASN 56 618 618 ASN ASN A . n 
A 1 57 CYS 57 619 619 CYS CYS A . n 
A 1 58 PRO 58 620 620 PRO PRO A . n 
A 1 59 ALA 59 621 621 ALA ALA A . n 
A 1 60 CYS 60 622 622 CYS CYS A . n 
A 1 61 ARG 61 623 623 ARG ARG A . n 
A 1 62 LEU 62 624 624 LEU LEU A . n 
A 1 63 ARG 63 625 625 ARG ARG A . n 
A 1 64 LYS 64 626 626 LYS LYS A . n 
A 1 65 CYS 65 627 627 CYS CYS A . n 
A 1 66 CYS 66 628 628 CYS CYS A . n 
A 1 67 GLN 67 629 629 GLN GLN A . n 
A 1 68 ALA 68 630 630 ALA ALA A . n 
A 1 69 GLY 69 631 631 GLY GLY A . n 
A 1 70 MET 70 632 632 MET MET A . n 
A 1 71 VAL 71 633 633 VAL VAL A . n 
A 1 72 LEU 72 634 634 LEU LEU A . n 
A 1 73 GLY 73 635 635 GLY GLY A . n 
A 1 74 GLY 74 636 636 GLY GLY A . n 
A 1 75 ARG 75 637 637 ARG ARG A . n 
A 1 76 LYS 76 638 638 LYS LYS A . n 
A 1 77 PHE 77 639 639 PHE PHE A . n 
A 1 78 LYS 78 640 640 LYS LYS A . n 
B 1 1  PRO 1  563 563 PRO PRO B . n 
B 1 2  GLN 2  564 564 GLN GLN B . n 
B 1 3  LYS 3  565 565 LYS LYS B . n 
B 1 4  ILE 4  566 566 ILE ILE B . n 
B 1 5  CYS 5  567 567 CYS CYS B . n 
B 1 6  LEU 6  568 568 LEU LEU B . n 
B 1 7  ILE 7  569 569 ILE ILE B . n 
B 1 8  CYS 8  570 570 CYS CYS B . n 
B 1 9  GLY 9  571 571 GLY GLY B . n 
B 1 10 ASP 10 572 572 ASP ASP B . n 
B 1 11 GLU 11 573 573 GLU GLU B . n 
B 1 12 ALA 12 574 574 ALA ALA B . n 
B 1 13 SER 13 575 575 SER SER B . n 
B 1 14 GLY 14 576 576 GLY GLY B . n 
B 1 15 CYS 15 577 577 CYS CYS B . n 
B 1 16 HIS 16 578 578 HIS HIS B . n 
B 1 17 TYR 17 579 579 TYR TYR B . n 
B 1 18 GLY 18 580 580 GLY GLY B . n 
B 1 19 VAL 19 581 581 VAL VAL B . n 
B 1 20 LEU 20 582 582 LEU LEU B . n 
B 1 21 THR 21 583 583 THR THR B . n 
B 1 22 CYS 22 584 584 CYS CYS B . n 
B 1 23 GLY 23 585 585 GLY GLY B . n 
B 1 24 SER 24 586 586 SER SER B . n 
B 1 25 CYS 25 587 587 CYS CYS B . n 
B 1 26 LYS 26 588 588 LYS LYS B . n 
B 1 27 VAL 27 589 589 VAL VAL B . n 
B 1 28 PHE 28 590 590 PHE PHE B . n 
B 1 29 PHE 29 591 591 PHE PHE B . n 
B 1 30 LYS 30 592 592 LYS LYS B . n 
B 1 31 ARG 31 593 593 ARG ARG B . n 
B 1 32 ALA 32 594 594 ALA ALA B . n 
B 1 33 MET 33 595 595 MET MET B . n 
B 1 34 GLU 34 596 596 GLU GLU B . n 
B 1 35 GLY 35 597 597 GLY GLY B . n 
B 1 36 GLN 36 598 598 GLN GLN B . n 
B 1 37 HIS 37 599 599 HIS HIS B . n 
B 1 38 ASN 38 600 600 ASN ASN B . n 
B 1 39 TYR 39 601 601 TYR TYR B . n 
B 1 40 LEU 40 602 602 LEU LEU B . n 
B 1 41 CYS 41 603 603 CYS CYS B . n 
B 1 42 ALA 42 604 604 ALA ALA B . n 
B 1 43 GLY 43 605 605 GLY GLY B . n 
B 1 44 ARG 44 606 606 ARG ARG B . n 
B 1 45 ASN 45 607 607 ASN ASN B . n 
B 1 46 ASP 46 608 608 ASP ASP B . n 
B 1 47 CYS 47 609 609 CYS CYS B . n 
B 1 48 ILE 48 610 610 ILE ILE B . n 
B 1 49 VAL 49 611 611 VAL VAL B . n 
B 1 50 ASP 50 612 612 ASP ASP B . n 
B 1 51 LYS 51 613 613 LYS LYS B . n 
B 1 52 ILE 52 614 614 ILE ILE B . n 
B 1 53 ARG 53 615 615 ARG ARG B . n 
B 1 54 ARG 54 616 616 ARG ARG B . n 
B 1 55 LYS 55 617 617 LYS LYS B . n 
B 1 56 ASN 56 618 618 ASN ASN B . n 
B 1 57 CYS 57 619 619 CYS CYS B . n 
B 1 58 PRO 58 620 620 PRO PRO B . n 
B 1 59 ALA 59 621 621 ALA ALA B . n 
B 1 60 CYS 60 622 622 CYS CYS B . n 
B 1 61 ARG 61 623 623 ARG ARG B . n 
B 1 62 LEU 62 624 624 LEU LEU B . n 
B 1 63 ARG 63 625 625 ARG ARG B . n 
B 1 64 LYS 64 626 626 LYS LYS B . n 
B 1 65 CYS 65 627 627 CYS CYS B . n 
B 1 66 CYS 66 628 628 CYS CYS B . n 
B 1 67 GLN 67 629 629 GLN GLN B . n 
B 1 68 ALA 68 630 630 ALA ALA B . n 
B 1 69 GLY 69 631 631 GLY GLY B . n 
B 1 70 MET 70 632 632 MET MET B . n 
B 1 71 VAL 71 633 633 VAL VAL B . n 
B 1 72 LEU 72 634 634 LEU LEU B . n 
B 1 73 GLY 73 635 635 GLY GLY B . n 
B 1 74 GLY 74 636 636 GLY GLY B . n 
B 1 75 ARG 75 637 637 ARG ARG B . n 
B 1 76 LYS 76 638 638 LYS LYS B . n 
B 1 77 PHE 77 639 639 PHE PHE B . n 
B 1 78 LYS 78 640 ?   ?   ?   B . n 
C 2 1  DC  1  1   1   DC  DC  C . n 
C 2 2  DC  2  2   2   DC  DC  C . n 
C 2 3  DA  3  3   3   DA  DA  C . n 
C 2 4  DG  4  4   4   DG  DG  C . n 
C 2 5  DA  5  5   5   DA  DA  C . n 
C 2 6  DA  6  6   6   DA  DA  C . n 
C 2 7  DC  7  7   7   DC  DC  C . n 
C 2 8  DA  8  8   8   DA  DA  C . n 
C 2 9  DG  9  9   9   DG  DG  C . n 
C 2 10 DT  10 10  10  DT  DT  C . n 
C 2 11 DT  11 11  11  DT  DT  C . n 
C 2 12 DT  12 12  12  DT  DT  C . n 
C 2 13 DG  13 13  13  DG  DG  C . n 
C 2 14 DT  14 14  14  DT  DT  C . n 
C 2 15 DT  15 15  15  DT  DT  C . n 
C 2 16 DC  16 16  16  DC  DC  C . n 
C 2 17 DT  17 17  17  DT  DT  C . n 
C 2 18 DG  18 18  18  DG  DG  C . n 
D 3 1  DC  1  1   1   DC  DC  D . n 
D 3 2  DC  2  2   2   DC  DC  D . n 
D 3 3  DA  3  3   3   DA  DA  D . n 
D 3 4  DG  4  4   4   DG  DG  D . n 
D 3 5  DA  5  5   5   DA  DA  D . n 
D 3 6  DA  6  6   6   DA  DA  D . n 
D 3 7  DC  7  7   7   DC  DC  D . n 
D 3 8  DA  8  8   8   DA  DA  D . n 
D 3 9  DA  9  9   9   DA  DA  D . n 
D 3 10 DA  10 10  10  DA  DA  D . n 
D 3 11 DC  11 11  11  DC  DC  D . n 
D 3 12 DT  12 12  12  DT  DT  D . n 
D 3 13 DG  13 13  13  DG  DG  D . n 
D 3 14 DT  14 14  14  DT  DT  D . n 
D 3 15 DT  15 15  15  DT  DT  D . n 
D 3 16 DC  16 16  16  DC  DC  D . n 
D 3 17 DT  17 17  17  DT  DT  D . n 
D 3 18 DG  18 18  18  DG  DG  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 ZN  1  1641 1641 ZN  ZN  A . 
F 4 ZN  1  1642 1642 ZN  ZN  A . 
G 4 ZN  1  1639 1639 ZN  ZN  B . 
H 4 ZN  1  1640 1640 ZN  ZN  B . 
I 5 HOH 1  2001 2001 HOH HOH A . 
I 5 HOH 2  2002 2002 HOH HOH A . 
I 5 HOH 3  2003 2003 HOH HOH A . 
I 5 HOH 4  2004 2004 HOH HOH A . 
I 5 HOH 5  2005 2005 HOH HOH A . 
I 5 HOH 6  2006 2006 HOH HOH A . 
I 5 HOH 7  2007 2007 HOH HOH A . 
I 5 HOH 8  2008 2008 HOH HOH A . 
I 5 HOH 9  2009 2009 HOH HOH A . 
I 5 HOH 10 2010 2010 HOH HOH A . 
I 5 HOH 11 2011 2011 HOH HOH A . 
I 5 HOH 12 2012 2012 HOH HOH A . 
I 5 HOH 13 2013 2013 HOH HOH A . 
I 5 HOH 14 2014 2014 HOH HOH A . 
I 5 HOH 15 2015 2015 HOH HOH A . 
I 5 HOH 16 2016 2016 HOH HOH A . 
I 5 HOH 17 2017 2017 HOH HOH A . 
I 5 HOH 18 2018 2018 HOH HOH A . 
I 5 HOH 19 2019 2019 HOH HOH A . 
I 5 HOH 20 2020 2020 HOH HOH A . 
I 5 HOH 21 2021 2021 HOH HOH A . 
I 5 HOH 22 2022 2022 HOH HOH A . 
I 5 HOH 23 2023 2023 HOH HOH A . 
I 5 HOH 24 2024 2024 HOH HOH A . 
I 5 HOH 25 2025 2025 HOH HOH A . 
I 5 HOH 26 2026 2026 HOH HOH A . 
I 5 HOH 27 2027 2027 HOH HOH A . 
I 5 HOH 28 2028 2028 HOH HOH A . 
I 5 HOH 29 2029 2029 HOH HOH A . 
I 5 HOH 30 2030 2030 HOH HOH A . 
I 5 HOH 31 2031 2031 HOH HOH A . 
I 5 HOH 32 2032 2032 HOH HOH A . 
I 5 HOH 33 2033 2033 HOH HOH A . 
I 5 HOH 34 2034 2034 HOH HOH A . 
I 5 HOH 35 2035 2035 HOH HOH A . 
I 5 HOH 36 2036 2036 HOH HOH A . 
I 5 HOH 37 2037 2037 HOH HOH A . 
I 5 HOH 38 2038 2038 HOH HOH A . 
I 5 HOH 39 2039 2039 HOH HOH A . 
I 5 HOH 40 2040 2040 HOH HOH A . 
I 5 HOH 41 2041 2041 HOH HOH A . 
I 5 HOH 42 2042 2042 HOH HOH A . 
I 5 HOH 43 2043 2043 HOH HOH A . 
I 5 HOH 44 2044 2044 HOH HOH A . 
I 5 HOH 45 2045 2045 HOH HOH A . 
I 5 HOH 46 2046 2046 HOH HOH A . 
I 5 HOH 47 2047 2047 HOH HOH A . 
I 5 HOH 48 2048 2048 HOH HOH A . 
I 5 HOH 49 2049 2049 HOH HOH A . 
I 5 HOH 50 2050 2050 HOH HOH A . 
I 5 HOH 51 2051 2051 HOH HOH A . 
I 5 HOH 52 2052 2052 HOH HOH A . 
J 5 HOH 1  2001 2001 HOH HOH B . 
J 5 HOH 2  2002 2002 HOH HOH B . 
J 5 HOH 3  2003 2003 HOH HOH B . 
J 5 HOH 4  2004 2004 HOH HOH B . 
J 5 HOH 5  2005 2005 HOH HOH B . 
J 5 HOH 6  2006 2006 HOH HOH B . 
J 5 HOH 7  2007 2007 HOH HOH B . 
J 5 HOH 8  2008 2008 HOH HOH B . 
J 5 HOH 9  2009 2009 HOH HOH B . 
J 5 HOH 10 2010 2010 HOH HOH B . 
J 5 HOH 11 2011 2011 HOH HOH B . 
J 5 HOH 12 2012 2012 HOH HOH B . 
J 5 HOH 13 2013 2013 HOH HOH B . 
J 5 HOH 14 2014 2014 HOH HOH B . 
J 5 HOH 15 2015 2015 HOH HOH B . 
J 5 HOH 16 2016 2016 HOH HOH B . 
J 5 HOH 17 2017 2017 HOH HOH B . 
J 5 HOH 18 2018 2018 HOH HOH B . 
J 5 HOH 19 2019 2019 HOH HOH B . 
J 5 HOH 20 2020 2020 HOH HOH B . 
J 5 HOH 21 2021 2021 HOH HOH B . 
J 5 HOH 22 2022 2022 HOH HOH B . 
J 5 HOH 23 2023 2023 HOH HOH B . 
J 5 HOH 24 2024 2024 HOH HOH B . 
J 5 HOH 25 2025 2025 HOH HOH B . 
J 5 HOH 26 2026 2026 HOH HOH B . 
J 5 HOH 27 2027 2027 HOH HOH B . 
J 5 HOH 28 2028 2028 HOH HOH B . 
J 5 HOH 29 2029 2029 HOH HOH B . 
J 5 HOH 30 2030 2030 HOH HOH B . 
J 5 HOH 31 2031 2031 HOH HOH B . 
J 5 HOH 32 2032 2032 HOH HOH B . 
J 5 HOH 33 2033 2033 HOH HOH B . 
J 5 HOH 34 2034 2034 HOH HOH B . 
J 5 HOH 35 2035 2035 HOH HOH B . 
J 5 HOH 36 2036 2036 HOH HOH B . 
J 5 HOH 37 2037 2037 HOH HOH B . 
J 5 HOH 38 2038 2038 HOH HOH B . 
J 5 HOH 39 2039 2039 HOH HOH B . 
J 5 HOH 40 2040 2040 HOH HOH B . 
J 5 HOH 41 2041 2041 HOH HOH B . 
J 5 HOH 42 2042 2042 HOH HOH B . 
J 5 HOH 43 2043 2043 HOH HOH B . 
J 5 HOH 44 2044 2044 HOH HOH B . 
J 5 HOH 45 2045 2045 HOH HOH B . 
J 5 HOH 46 2046 2046 HOH HOH B . 
J 5 HOH 47 2047 2047 HOH HOH B . 
K 5 HOH 1  2001 2001 HOH HOH C . 
K 5 HOH 2  2002 2002 HOH HOH C . 
K 5 HOH 3  2003 2003 HOH HOH C . 
K 5 HOH 4  2004 2004 HOH HOH C . 
K 5 HOH 5  2005 2005 HOH HOH C . 
K 5 HOH 6  2006 2006 HOH HOH C . 
K 5 HOH 7  2007 2007 HOH HOH C . 
K 5 HOH 8  2008 2008 HOH HOH C . 
K 5 HOH 9  2009 2009 HOH HOH C . 
K 5 HOH 10 2010 2010 HOH HOH C . 
K 5 HOH 11 2011 2011 HOH HOH C . 
K 5 HOH 12 2012 2012 HOH HOH C . 
K 5 HOH 13 2013 2013 HOH HOH C . 
K 5 HOH 14 2014 2014 HOH HOH C . 
K 5 HOH 15 2015 2015 HOH HOH C . 
K 5 HOH 16 2016 2016 HOH HOH C . 
K 5 HOH 17 2017 2017 HOH HOH C . 
K 5 HOH 18 2018 2018 HOH HOH C . 
K 5 HOH 19 2019 2019 HOH HOH C . 
K 5 HOH 20 2020 2020 HOH HOH C . 
K 5 HOH 21 2021 2021 HOH HOH C . 
K 5 HOH 22 2022 2022 HOH HOH C . 
K 5 HOH 23 2023 2023 HOH HOH C . 
K 5 HOH 24 2024 2024 HOH HOH C . 
L 5 HOH 1  2001 2001 HOH HOH D . 
L 5 HOH 2  2002 2002 HOH HOH D . 
L 5 HOH 3  2003 2003 HOH HOH D . 
L 5 HOH 4  2004 2004 HOH HOH D . 
L 5 HOH 5  2005 2005 HOH HOH D . 
L 5 HOH 6  2006 2006 HOH HOH D . 
L 5 HOH 7  2007 2007 HOH HOH D . 
L 5 HOH 8  2008 2008 HOH HOH D . 
L 5 HOH 9  2009 2009 HOH HOH D . 
L 5 HOH 10 2010 2010 HOH HOH D . 
L 5 HOH 11 2011 2011 HOH HOH D . 
L 5 HOH 12 2012 2012 HOH HOH D . 
L 5 HOH 13 2013 2013 HOH HOH D . 
L 5 HOH 14 2014 2014 HOH HOH D . 
L 5 HOH 15 2015 2015 HOH HOH D . 
L 5 HOH 16 2016 2016 HOH HOH D . 
L 5 HOH 17 2017 2017 HOH HOH D . 
L 5 HOH 18 2018 2018 HOH HOH D . 
L 5 HOH 19 2019 2019 HOH HOH D . 
L 5 HOH 20 2020 2020 HOH HOH D . 
L 5 HOH 21 2021 2021 HOH HOH D . 
L 5 HOH 22 2022 2022 HOH HOH D . 
L 5 HOH 23 2023 2023 HOH HOH D . 
L 5 HOH 24 2024 2024 HOH HOH D . 
L 5 HOH 25 2025 2025 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 25 ? A CYS 587 ? 1_555 ZN ? E ZN . ? A ZN 1641 ? 1_555 SG ? A CYS 5  ? A CYS 567 ? 1_555 112.5 ? 
2  SG ? A CYS 25 ? A CYS 587 ? 1_555 ZN ? E ZN . ? A ZN 1641 ? 1_555 SG ? A CYS 8  ? A CYS 570 ? 1_555 110.6 ? 
3  SG ? A CYS 5  ? A CYS 567 ? 1_555 ZN ? E ZN . ? A ZN 1641 ? 1_555 SG ? A CYS 8  ? A CYS 570 ? 1_555 104.6 ? 
4  SG ? A CYS 25 ? A CYS 587 ? 1_555 ZN ? E ZN . ? A ZN 1641 ? 1_555 SG ? A CYS 22 ? A CYS 584 ? 1_555 98.3  ? 
5  SG ? A CYS 5  ? A CYS 567 ? 1_555 ZN ? E ZN . ? A ZN 1641 ? 1_555 SG ? A CYS 22 ? A CYS 584 ? 1_555 117.3 ? 
6  SG ? A CYS 8  ? A CYS 570 ? 1_555 ZN ? E ZN . ? A ZN 1641 ? 1_555 SG ? A CYS 22 ? A CYS 584 ? 1_555 113.7 ? 
7  SG ? A CYS 41 ? A CYS 603 ? 1_555 ZN ? F ZN . ? A ZN 1642 ? 1_555 SG ? A CYS 47 ? A CYS 609 ? 1_555 106.7 ? 
8  SG ? A CYS 41 ? A CYS 603 ? 1_555 ZN ? F ZN . ? A ZN 1642 ? 1_555 SG ? A CYS 60 ? A CYS 622 ? 1_555 110.6 ? 
9  SG ? A CYS 47 ? A CYS 609 ? 1_555 ZN ? F ZN . ? A ZN 1642 ? 1_555 SG ? A CYS 60 ? A CYS 622 ? 1_555 105.2 ? 
10 SG ? A CYS 41 ? A CYS 603 ? 1_555 ZN ? F ZN . ? A ZN 1642 ? 1_555 SG ? A CYS 57 ? A CYS 619 ? 1_555 112.6 ? 
11 SG ? A CYS 47 ? A CYS 609 ? 1_555 ZN ? F ZN . ? A ZN 1642 ? 1_555 SG ? A CYS 57 ? A CYS 619 ? 1_555 111.7 ? 
12 SG ? A CYS 60 ? A CYS 622 ? 1_555 ZN ? F ZN . ? A ZN 1642 ? 1_555 SG ? A CYS 57 ? A CYS 619 ? 1_555 109.7 ? 
13 SG ? B CYS 8  ? B CYS 570 ? 1_555 ZN ? G ZN . ? B ZN 1639 ? 1_555 SG ? B CYS 22 ? B CYS 584 ? 1_555 106.8 ? 
14 SG ? B CYS 8  ? B CYS 570 ? 1_555 ZN ? G ZN . ? B ZN 1639 ? 1_555 SG ? B CYS 25 ? B CYS 587 ? 1_555 114.5 ? 
15 SG ? B CYS 22 ? B CYS 584 ? 1_555 ZN ? G ZN . ? B ZN 1639 ? 1_555 SG ? B CYS 25 ? B CYS 587 ? 1_555 102.3 ? 
16 SG ? B CYS 8  ? B CYS 570 ? 1_555 ZN ? G ZN . ? B ZN 1639 ? 1_555 SG ? B CYS 5  ? B CYS 567 ? 1_555 108.3 ? 
17 SG ? B CYS 22 ? B CYS 584 ? 1_555 ZN ? G ZN . ? B ZN 1639 ? 1_555 SG ? B CYS 5  ? B CYS 567 ? 1_555 113.9 ? 
18 SG ? B CYS 25 ? B CYS 587 ? 1_555 ZN ? G ZN . ? B ZN 1639 ? 1_555 SG ? B CYS 5  ? B CYS 567 ? 1_555 111.0 ? 
19 SG ? B CYS 47 ? B CYS 609 ? 1_555 ZN ? H ZN . ? B ZN 1640 ? 1_555 SG ? B CYS 60 ? B CYS 622 ? 1_555 104.3 ? 
20 SG ? B CYS 47 ? B CYS 609 ? 1_555 ZN ? H ZN . ? B ZN 1640 ? 1_555 SG ? B CYS 57 ? B CYS 619 ? 1_555 113.0 ? 
21 SG ? B CYS 60 ? B CYS 622 ? 1_555 ZN ? H ZN . ? B ZN 1640 ? 1_555 SG ? B CYS 57 ? B CYS 619 ? 1_555 109.9 ? 
22 SG ? B CYS 47 ? B CYS 609 ? 1_555 ZN ? H ZN . ? B ZN 1640 ? 1_555 SG ? B CYS 41 ? B CYS 603 ? 1_555 110.4 ? 
23 SG ? B CYS 60 ? B CYS 622 ? 1_555 ZN ? H ZN . ? B ZN 1640 ? 1_555 SG ? B CYS 41 ? B CYS 603 ? 1_555 110.1 ? 
24 SG ? B CYS 57 ? B CYS 619 ? 1_555 ZN ? H ZN . ? B ZN 1640 ? 1_555 SG ? B CYS 41 ? B CYS 603 ? 1_555 109.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-08-30 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             REFMAC 
_software.classification   refinement 
_software.version          5.1.24 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB    A ASP 612 ? ? CG    A ASP 612 ? ? OD2   A ASP 612 ? ? 123.72 118.30 5.42  0.90 N 
2  1 "O4'" C DA  3   ? ? "C1'" C DA  3   ? ? N9    C DA  3   ? ? 102.37 108.00 -5.63 0.70 N 
3  1 "O4'" C DT  11  ? ? "C1'" C DT  11  ? ? N1    C DT  11  ? ? 102.89 108.00 -5.11 0.70 N 
4  1 N3    C DT  12  ? ? C4    C DT  12  ? ? O4    C DT  12  ? ? 124.34 119.90 4.44  0.60 N 
5  1 C5    C DT  12  ? ? C4    C DT  12  ? ? O4    C DT  12  ? ? 120.45 124.90 -4.45 0.70 N 
6  1 "O4'" C DT  17  ? ? "C1'" C DT  17  ? ? N1    C DT  17  ? ? 102.01 108.00 -5.99 0.70 N 
7  1 "O4'" D DC  1   ? ? "C1'" D DC  1   ? ? N1    D DC  1   ? ? 110.99 108.30 2.69  0.30 N 
8  1 N9    D DA  10  ? ? "C1'" D DA  10  ? ? "C2'" D DA  10  ? ? 122.99 114.30 8.69  1.40 N 
9  1 "C3'" D DG  13  ? ? "C2'" D DG  13  ? ? "C1'" D DG  13  ? ? 97.37  102.40 -5.03 0.80 N 
10 1 "O4'" D DT  14  ? ? "C1'" D DT  14  ? ? N1    D DT  14  ? ? 101.83 108.00 -6.17 0.70 N 
11 1 "C3'" D DT  15  ? ? "O3'" D DT  15  ? ? P     D DC  16  ? ? 128.41 119.70 8.71  1.20 Y 
12 1 "O4'" D DT  17  ? ? "C1'" D DT  17  ? ? N1    D DT  17  ? ? 103.20 108.00 -4.80 0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN B 564 ? ? 157.31 122.48 
2 1 ARG B 637 ? ? 68.63  78.47  
3 1 LYS B 638 ? ? -70.20 -78.49 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 640 ? CG  ? A LYS 78 CG  
2  1 Y 1 A LYS 640 ? CD  ? A LYS 78 CD  
3  1 Y 1 A LYS 640 ? CE  ? A LYS 78 CE  
4  1 Y 1 A LYS 640 ? NZ  ? A LYS 78 NZ  
5  1 Y 1 B LYS 638 ? CG  ? B LYS 76 CG  
6  1 Y 1 B LYS 638 ? CD  ? B LYS 76 CD  
7  1 Y 1 B LYS 638 ? CE  ? B LYS 76 CE  
8  1 Y 1 B LYS 638 ? NZ  ? B LYS 76 NZ  
9  1 Y 1 B PHE 639 ? CA  ? B PHE 77 CA  
10 1 Y 1 B PHE 639 ? C   ? B PHE 77 C   
11 1 Y 1 B PHE 639 ? O   ? B PHE 77 O   
12 1 Y 1 B PHE 639 ? CB  ? B PHE 77 CB  
13 1 Y 1 B PHE 639 ? CG  ? B PHE 77 CG  
14 1 Y 1 B PHE 639 ? CD1 ? B PHE 77 CD1 
15 1 Y 1 B PHE 639 ? CD2 ? B PHE 77 CD2 
16 1 Y 1 B PHE 639 ? CE1 ? B PHE 77 CE1 
17 1 Y 1 B PHE 639 ? CE2 ? B PHE 77 CE2 
18 1 Y 1 B PHE 639 ? CZ  ? B PHE 77 CZ  
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     LYS 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      640 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    B 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    LYS 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     78 
# 
_ndb_struct_conf_na.entry_id   2C7A 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DC 2  1_555 D DG 18 1_555 0.155  -0.154 -0.104 9.664   -6.957  0.009  1  C_DC2:DG18_D  C 2  ? D 18 ? 19 1 
1 C DA 3  1_555 D DT 17 1_555 -0.106 -0.135 0.542  18.697  -6.405  -0.259 2  C_DA3:DT17_D  C 3  ? D 17 ? 20 1 
1 C DG 4  1_555 D DC 16 1_555 -0.106 -0.157 0.250  15.502  -13.312 -1.264 3  C_DG4:DC16_D  C 4  ? D 16 ? 19 1 
1 C DA 5  1_555 D DT 15 1_555 -0.070 -0.246 -0.073 1.415   -16.540 -2.933 4  C_DA5:DT15_D  C 5  ? D 15 ? 20 1 
1 C DA 6  1_555 D DT 14 1_555 0.078  -0.179 0.124  5.302   -12.223 1.851  5  C_DA6:DT14_D  C 6  ? D 14 ? 20 1 
1 C DC 7  1_555 D DG 13 1_555 0.417  -0.111 -0.026 2.977   -7.964  -1.626 6  C_DC7:DG13_D  C 7  ? D 13 ? 19 1 
1 C DA 8  1_555 D DT 12 1_555 0.199  0.029  -0.095 0.537   -4.302  0.647  7  C_DA8:DT12_D  C 8  ? D 12 ? 20 1 
1 C DG 9  1_555 D DC 11 1_555 -0.095 -0.014 0.034  -0.739  -10.333 1.138  8  C_DG9:DC11_D  C 9  ? D 11 ? 19 1 
1 C DT 10 1_555 D DA 10 1_555 -0.297 -0.457 0.124  -2.024  -15.392 -8.443 9  C_DT10:DA10_D C 10 ? D 10 ? 20 1 
1 C DT 11 1_555 D DA 9  1_555 0.229  -0.221 0.029  -1.666  -14.049 -2.983 10 C_DT11:DA9_D  C 11 ? D 9  ? 20 1 
1 C DT 12 1_555 D DA 8  1_555 0.125  -0.136 0.060  -1.876  -4.590  0.892  11 C_DT12:DA8_D  C 12 ? D 8  ? 20 1 
1 C DG 13 1_555 D DC 7  1_555 -0.179 -0.195 -0.143 -4.202  -8.483  0.416  12 C_DG13:DC7_D  C 13 ? D 7  ? 19 1 
1 C DT 14 1_555 D DA 6  1_555 -0.106 -0.208 0.135  -1.868  -13.374 2.928  13 C_DT14:DA6_D  C 14 ? D 6  ? 20 1 
1 C DT 15 1_555 D DA 5  1_555 0.066  -0.186 -0.171 2.711   -19.529 1.900  14 C_DT15:DA5_D  C 15 ? D 5  ? 20 1 
1 C DC 16 1_555 D DG 4  1_555 0.170  -0.171 0.382  -15.460 -13.613 0.982  15 C_DC16:DG4_D  C 16 ? D 4  ? 19 1 
1 C DT 17 1_555 D DA 3  1_555 -0.162 -0.161 0.667  -15.258 -4.426  2.243  16 C_DT17:DA3_D  C 17 ? D 3  ? 20 1 
1 C DG 18 1_555 D DC 2  1_555 -0.418 -0.301 0.117  -3.351  -3.009  -0.243 17 C_DG18:DC2_D  C 18 ? D 2  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DC 2  1_555 D DG 18 1_555 C DA 3  1_555 D DT 17 1_555 -0.335 0.652  3.066 -4.442 5.005  38.503 0.399  -0.010 3.141 7.520   
6.674  39.059 1  CC_DC2DA3:DT17DG18_DD  C 2  ? D 18 ? C 3  ? D 17 ? 
1 C DA 3  1_555 D DT 17 1_555 C DG 4  1_555 D DC 16 1_555 0.208  -0.442 3.485 0.171  1.160  33.229 -0.978 -0.332 3.469 2.029   
-0.299 33.249 2  CC_DA3DG4:DC16DT17_DD  C 3  ? D 17 ? C 4  ? D 16 ? 
1 C DG 4  1_555 D DC 16 1_555 C DA 5  1_555 D DT 15 1_555 0.101  -0.488 3.509 4.152  -0.423 39.207 -0.669 0.377  3.506 -0.629  
-6.165 39.420 3  CC_DG4DA5:DT15DC16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 C DA 5  1_555 D DT 15 1_555 C DA 6  1_555 D DT 14 1_555 0.497  0.013  3.155 0.900  -5.518 37.543 0.702  -0.654 3.132 -8.515  
-1.389 37.942 4  CC_DA5DA6:DT14DT15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 C DA 6  1_555 D DT 14 1_555 C DC 7  1_555 D DG 13 1_555 0.481  -0.652 3.358 0.845  -3.732 38.460 -0.508 -0.618 3.413 -5.648  
-1.279 38.643 5  CC_DA6DC7:DG13DT14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 C DC 7  1_555 D DG 13 1_555 C DA 8  1_555 D DT 12 1_555 0.289  -0.825 3.308 2.175  4.536  31.117 -2.361 -0.128 3.171 8.387   
-4.021 31.511 6  CC_DC7DA8:DT12DG13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 C DA 8  1_555 D DT 12 1_555 C DG 9  1_555 D DC 11 1_555 -0.245 0.087  3.375 -1.075 -4.159 37.874 0.677  0.235  3.352 -6.382  
1.649  38.108 7  CC_DA8DG9:DC11DT12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 C DG 9  1_555 D DC 11 1_555 C DT 10 1_555 D DA 10 1_555 -0.535 -0.702 3.366 -1.491 -6.810 33.995 -0.077 0.656  3.457 -11.498 
2.518  34.682 8  CC_DG9DT10:DA10DC11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 C DT 10 1_555 D DA 10 1_555 C DT 11 1_555 D DA 9  1_555 0.337  -0.571 3.111 1.486  -2.418 36.651 -0.590 -0.340 3.152 -3.837  
-2.359 36.757 9  CC_DT10DT11:DA9DA10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 C DT 11 1_555 D DA 9  1_555 C DT 12 1_555 D DA 8  1_555 0.495  0.054  3.418 0.819  -5.082 38.187 0.740  -0.644 3.392 -7.724  
-1.245 38.520 10 CC_DT11DT12:DA8DA9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 C DT 12 1_555 D DA 8  1_555 C DG 13 1_555 D DC 7  1_555 -0.169 -0.693 3.394 -0.957 3.592  29.699 -2.105 0.125  3.293 6.973   
1.857  29.926 11 CC_DT12DG13:DC7DA8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 C DG 13 1_555 D DC 7  1_555 C DT 14 1_555 D DA 6  1_555 -0.679 -0.596 3.189 -1.049 -3.557 36.705 -0.467 0.933  3.248 -5.631  
1.661  36.885 12 CC_DG13DT14:DA6DC7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 C DT 14 1_555 D DA 6  1_555 C DT 15 1_555 D DA 5  1_555 -0.286 0.078  3.097 0.407  -4.850 39.143 0.656  0.469  3.063 -7.206  
-0.604 39.432 13 CC_DT14DT15:DA5DA6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 C DT 15 1_555 D DA 5  1_555 C DC 16 1_555 D DG 4  1_555 -0.025 -0.271 3.683 -5.485 -1.986 40.734 -0.142 -0.635 3.665 -2.836  
7.831  41.132 14 CC_DT15DC16:DG4DA5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 C DC 16 1_555 D DG 4  1_555 C DT 17 1_555 D DA 3  1_555 -0.203 -0.606 3.316 -0.611 2.224  29.799 -1.641 0.265  3.267 4.317   
1.186  29.886 15 CC_DC16DT17:DA3DG4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 C DT 17 1_555 D DA 3  1_555 C DG 18 1_555 D DC 2  1_555 0.168  0.477  2.999 4.584  1.574  37.705 0.548  0.281  3.015 2.424   
-7.056 38.004 16 CC_DT17DG18:DC2DA3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 water      HOH 
#