data_2CCN
# 
_entry.id   2CCN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CCN         
PDBE  EBI-27250    
WWPDB D_1290027250 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2006-04-06 
_pdbx_database_PDB_obs_spr.pdb_id           2CCN 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1VZL 
_pdbx_database_PDB_obs_spr.details          ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1CE9 unspecified 'HELIX CAPPING IN THE GCN4 LEUCINE ZIPPER' 
PDB 1DGC unspecified 'GCN4 LEUCINE ZIPPER COMPLEXED WITH SPECIFIC ATF/CREB SITE DEOXYRIBONUCLEIC ACID' 
PDB 1ENV unspecified 'ATOMIC STRUCTURE OF THE ECTODOMAIN FROM HIV -1 GP41' 
PDB 1FAV unspecified 'THE STRUCTURE OF AN HIV-1 SPECIFIC CELL ENTRY INHIBITOR INCOMPLEX WITH THE HIV-1 GP41 TRIMERIC CORE' 
PDB 1GCL unspecified 'GCN4 LEUCINE ZIPPER CORE MUTANT P-LI' 
PDB 1GCM unspecified 'GCN4 LEUCINE ZIPPER CORE MUTANT P-LI' 
PDB 1GK6 unspecified 'HUMAN VIMENTIN COIL 2B FRAGMENT LINKED TO GCN4 LEUCINE ZIPPER (Z2B)' 
PDB 1GZL unspecified 
'CRYSTAL STRUCTURE OF C14LINKMID/IQN17: A CROSS-LINKED INHIBITOR OF HIV-1 ENTRY BOUND TO THE GP41 HYDROPHOBIC POCKET'          
PDB 1IHQ unspecified 
'GLYTM1BZIP: A CHIMERIC PEPTIDE MODEL OF THE N-TERMINUS OF ARAT SHORT ALPHA TROPOMYOSIN WITH THE N-TERMINUS ENCODED BYEXON 1B' 
PDB 1IJ0 unspecified 'COILED COIL TRIMER GCN4-PVLS SER AT BURIED D POSITION' 
PDB 1IJ1 unspecified 'GCN4-PVLT COILED-COIL TRIMER WITH THREONINE AT THE D(12)POSITION' 
PDB 1IJ2 unspecified 'GCN4-PVTL COILED-COIL TRIMER WITH THREONINE AT THE A(16)POSITION' 
PDB 1IJ3 unspecified 'GCN4-PVSL COILED-COIL TRIMER WITH SERINE AT THE A(16)POSITION' 
PDB 1KQL unspecified 'CRYSTAL STRUCTURE OF THE C-TERMINAL REGION OF STRIATEDMUSCLE ALPHA-TROPOMYOSIN AT 2.7 ANGSTROM RESOLUTION' 
PDB 1LD4 unspecified 'PLACEMENT OF THE STRUCTURAL PROTEINS IN SINDBIS VIRUS' 
PDB 1LLM unspecified 'CRYSTAL STRUCTURE OF A ZIF23-GCN4 CHIMERA BOUND TO DNA' 
PDB 1NKN unspecified 
'VISUALIZING AN UNSTABLE COILED COIL: THE CRYSTAL STRUCTUREOF AN N-TERMINAL SEGMENT OF THE SCALLOP MYOSIN ROD'                 
PDB 1PIQ unspecified 'CRYSTAL STRUCTURE OF GCN4-PIQ, A TRIMERIC COILED COIL WITH BURIED POLAR RESIDUES' 
PDB 1RB1 unspecified 'GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A TRIGONAL AUTOMATICSOLUTION' 
PDB 1RB4 unspecified 'ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT ASN16A TETRAGONAL AUTOMATIC SOLUTION' 
PDB 1RB5 unspecified 'ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT ASN16A TRIGONAL FORM' 
PDB 1RB6 unspecified 'ANTIPARALLEL TRIMER OF GCN4-LEUCINE ZIPPER CORE MUTANT ASN16A TETRAGONAL FORM' 
PDB 1SWI unspecified 'GCN4-LEUCINE ZIPPER CORE MUTANT AS N16A COMPLEXED WITH BENZENE' 
PDB 1TMZ unspecified 'TMZIP: A CHIMERIC PEPTIDE MODEL OF THE N- TERMINUS OF ALPHA TROPOMYOSIN, NMR, 15 STRUCTURES' 
PDB 1UNT unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UNU unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UNV unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UNW unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UNX unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UNY unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UNZ unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UO0 unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UO1 unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UO2 unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UO3 unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UO4 unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1UO5 unspecified 'STRUCTURE BASED ENGINEERING OF INTERNAL MOLECULAR SURFACES OF FOUR HELIX BUNDLES' 
PDB 1VZL unspecified 'AN ANTI-PARALLEL FOUR HELIX BUNDLE MUTANT PLI-E20C' 
PDB 1W5G unspecified 'AN ANTI-PARALLEL FOUR HELIX BUNDLE ( ACETIMIDE MODIFICATION).' 
PDB 1W5H unspecified 'AN ANTI-PARALLEL FOUR HELIX BUNDLE.' 
PDB 1W5I unspecified 'ABA DOES NOT AFFECT TOPOLOGY OF PLI.' 
PDB 1W5J unspecified 'AN ANTI-PARALLEL FOUR HELIX BUNDLE' 
PDB 1W5K unspecified 'AN ANTI-PARALLEL FOUR HELIX BUNDLE' 
PDB 1W5L unspecified 'AN ANTI-PARALLEL TO PARALLEL SWITCH.' 
PDB 1YSA unspecified 'GCN4 (BASIC REGION, LEUCINE ZIPPER) COMPLEX WITH AP-1 DEOXYRIBONUCLEIC ACID' 
PDB 1ZII unspecified 'GCN4-LEUCINE ZIPPER CORE MUTANT ASN16ABA IN THE DIMERIC STATE' 
PDB 1ZIJ unspecified 'GCN4-LEUCINE ZIPPER CORE MUTANT ASN16ABA IN THE TRIMERIC STATE' 
PDB 1ZIK unspecified 'GCN4-LEUCINE ZIPPER CORE MUTANT ASN16LYS IN THE DIMERIC STATE' 
PDB 1ZIL unspecified 'GCN4-LEUCINE ZIPPER CORE MUTANT ASN16GLN IN THE DIMERIC STATE' 
PDB 1ZIM unspecified 'GCN4-LEUCINE ZIPPER CORE MUTANT ASN16GLN IN THE TRIMERIC STATE' 
PDB 1ZTA unspecified 'LEUCINE ZIPPER MONOMER (NMR, 20 STRUCTURES)' 
PDB 2BNI unspecified 'PLI MUTANT E20C L16G Y17H, ANTIPARALLEL' 
PDB 2CCE unspecified 'PARALLEL CONFIGURATION OF PLI E20S' 
PDB 2CCF unspecified 'ANTIPARALLEL CONFIGURATION OF PLI E20S' 
PDB 2DGC unspecified 'GCN4 BASIC DOMAIN, LEUCINE ZIPPER COMPLEXED WITH ATF/CREB SITE DEOXYRIBONUCLEIC ACID' 
PDB 2ZTA unspecified 'GCN4 LEUCINE ZIPPER' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CCN 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-01-16 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yadav, M.K.'      1 ? 
'Leman, L.J.'      2 ? 
'Price, D.J.'      3 ? 
'Brooks 3rd, C.L.' 4 ? 
'Stout, C.D.'      5 ? 
'Ghadiri, M.R.'    6 ? 
# 
_citation.id                        primary 
_citation.title                     
;Coiled coils at the edge of configurational heterogeneity. Structural analyses of parallel and antiparallel homotetrameric coiled coils reveal configurational sensitivity to a single solvent-exposed amino acid substitution.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            45 
_citation.page_first                4463 
_citation.page_last                 4473 
_citation.year                      2006 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16584182 
_citation.pdbx_database_id_DOI      10.1021/bi060092q 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Yadav, M.K.'      1 ? 
primary 'Leman, L.J.'      2 ? 
primary 'Price, D.J.'      3 ? 
primary 'Brooks 3rd, C.L.' 4 ? 
primary 'Stout, C.D.'      5 ? 
primary 'Ghadiri, M.R.'    6 ? 
# 
_cell.entry_id           2CCN 
_cell.length_a           35.388 
_cell.length_b           35.384 
_cell.length_c           104.318 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2CCN 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'General control protein GCN4' 4046.866 2  ? YES 'RESIDUES 249-281' ? 
2 water   nat water                          18.015   83 ? ?   ?                  ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Amino acid biosynthesis regulatory protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       '(ACE)RMKQIEDKLEEILSKLYHICNELARIKKLLGER' 
_entity_poly.pdbx_seq_one_letter_code_can   XRMKQIEDKLEEILSKLYHICNELARIKKLLGER 
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ACE n 
1 2  ARG n 
1 3  MET n 
1 4  LYS n 
1 5  GLN n 
1 6  ILE n 
1 7  GLU n 
1 8  ASP n 
1 9  LYS n 
1 10 LEU n 
1 11 GLU n 
1 12 GLU n 
1 13 ILE n 
1 14 LEU n 
1 15 SER n 
1 16 LYS n 
1 17 LEU n 
1 18 TYR n 
1 19 HIS n 
1 20 ILE n 
1 21 CYS n 
1 22 ASN n 
1 23 GLU n 
1 24 LEU n 
1 25 ALA n 
1 26 ARG n 
1 27 ILE n 
1 28 LYS n 
1 29 LYS n 
1 30 LEU n 
1 31 LEU n 
1 32 GLY n 
1 33 GLU n 
1 34 ARG n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       34 
_pdbx_entity_src_syn.organism_scientific    'Saccharomyces cerevisiae' 
_pdbx_entity_src_syn.organism_common_name   
;Baker's yeast
;
_pdbx_entity_src_syn.ncbi_taxonomy_id       4932 
_pdbx_entity_src_syn.details                ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RMKQLEDKVEELLSKNYHLENEVARLKKLVGER 
_struct_ref.pdbx_align_begin           249 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2CCN A 2 ? 34 ? P03069 249 ? 281 ? 1 33 
2 1 2CCN B 2 ? 34 ? P03069 249 ? 281 ? 1 33 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2CCN ACE A 1  ? UNP P03069 ?   ?   'expression tag'      0  1  
1 2CCN ILE A 6  ? UNP P03069 LEU 253 'engineered mutation' 5  2  
1 2CCN LEU A 10 ? UNP P03069 VAL 257 'engineered mutation' 9  3  
1 2CCN ILE A 13 ? UNP P03069 LEU 260 'engineered mutation' 12 4  
1 2CCN LEU A 17 ? UNP P03069 ASN 264 'engineered mutation' 16 5  
1 2CCN ILE A 20 ? UNP P03069 LEU 267 'engineered mutation' 19 6  
1 2CCN CYS A 21 ? UNP P03069 GLU 268 'engineered mutation' 20 7  
1 2CCN LEU A 24 ? UNP P03069 VAL 271 'engineered mutation' 23 8  
1 2CCN ILE A 27 ? UNP P03069 LEU 274 'engineered mutation' 26 9  
1 2CCN LEU A 31 ? UNP P03069 VAL 278 'engineered mutation' 30 10 
2 2CCN ACE B 1  ? UNP P03069 ?   ?   'expression tag'      0  11 
2 2CCN ILE B 6  ? UNP P03069 LEU 253 'engineered mutation' 5  12 
2 2CCN LEU B 10 ? UNP P03069 VAL 257 'engineered mutation' 9  13 
2 2CCN ILE B 13 ? UNP P03069 LEU 260 'engineered mutation' 12 14 
2 2CCN LEU B 17 ? UNP P03069 ASN 264 'engineered mutation' 16 15 
2 2CCN ILE B 20 ? UNP P03069 LEU 267 'engineered mutation' 19 16 
2 2CCN CYS B 21 ? UNP P03069 GLU 268 'engineered mutation' 20 17 
2 2CCN LEU B 24 ? UNP P03069 VAL 271 'engineered mutation' 23 18 
2 2CCN ILE B 27 ? UNP P03069 LEU 274 'engineered mutation' 26 19 
2 2CCN LEU B 31 ? UNP P03069 VAL 278 'engineered mutation' 30 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2CCN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.93 
_exptl_crystal.density_percent_sol   35 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              10.50 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '100MM CAPS PH 10.5, 30% PEG 400' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           180.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2004-05-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2CCN 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             34.770 
_reflns.d_resolution_high            1.600 
_reflns.number_obs                   9395 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.03000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        27.1000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.290 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2CCN 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     8913 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             51.99 
_refine.ls_d_res_high                            1.60 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.219 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.217 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.800 
_refine.ls_number_reflns_R_free                  447 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.B_iso_mean                               17.75 
_refine.aniso_B[1][1]                            0.66000 
_refine.aniso_B[2][2]                            0.66000 
_refine.aniso_B[3][3]                            -1.32000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. N TERMINUS OF PEPTIDE IS ACETYLATED WITH ACETIC ANHYDRIDE.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.108 
_refine.pdbx_overall_ESU_R_Free                  0.110 
_refine.overall_SU_ML                            0.056 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             1.572 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        520 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             83 
_refine_hist.number_atoms_total               603 
_refine_hist.d_res_high                       1.60 
_refine_hist.d_res_low                        51.99 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.60 
_refine_ls_shell.d_res_low                        1.64 
_refine_ls_shell.number_reflns_R_work             605 
_refine_ls_shell.R_factor_R_work                  0.3770 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.4520 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             35 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  2CCN 
_struct.title                     'pLI E20C is antiparallel' 
_struct.pdbx_descriptor           'GENERAL CONTROL PROTEIN GCN4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CCN 
_struct_keywords.pdbx_keywords   'FOUR HELIX BUNDLE' 
_struct_keywords.text            
;FOUR HELIX BUNDLE, ANTIPARALLEL, PARALLEL, PLI, DNA-BINDING, NUCLEAR PROTEIN, TRANSCRIPTION, TRANSCRIPTION REGULATION, ACTIVATOR, AMINO-ACID BIOSYNTHESIS
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 3 ? GLU A 33 ? MET A 2 GLU A 32 1 ? 31 
HELX_P HELX_P2 2 ARG B 2 ? GLU B 33 ? ARG B 1 GLU B 32 1 ? 32 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2CCN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CCN 
_atom_sites.fract_transf_matrix[1][1]   0.028258 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.028261 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009586 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   C C   . ARG A 1 2  ? 27.908 16.466 24.996  1.00 32.09 ? 1    ARG A C   1 
ATOM   2   O O   . ARG A 1 2  ? 28.223 16.646 23.800  1.00 33.50 ? 1    ARG A O   1 
ATOM   3   N N   . MET A 1 3  ? 28.828 16.042 25.828  1.00 30.14 ? 2    MET A N   1 
ATOM   4   C CA  . MET A 1 3  ? 30.012 15.457 25.323  1.00 29.62 ? 2    MET A CA  1 
ATOM   5   C C   . MET A 1 3  ? 29.967 14.112 24.493  1.00 28.74 ? 2    MET A C   1 
ATOM   6   O O   . MET A 1 3  ? 30.638 13.850 23.472  1.00 25.23 ? 2    MET A O   1 
ATOM   7   C CB  . MET A 1 3  ? 30.752 15.043 26.449  1.00 27.01 ? 2    MET A CB  1 
ATOM   8   C CG  . MET A 1 3  ? 32.250 14.614 26.247  1.00 35.79 ? 2    MET A CG  1 
ATOM   9   S SD  . MET A 1 3  ? 33.414 16.190 26.055  1.00 52.51 ? 2    MET A SD  1 
ATOM   10  C CE  . MET A 1 3  ? 32.454 17.819 26.006  1.00 23.62 ? 2    MET A CE  1 
ATOM   11  N N   . LYS A 1 4  ? 29.225 13.182 25.054  1.00 27.99 ? 3    LYS A N   1 
ATOM   12  C CA  . LYS A 1 4  ? 28.870 12.064 24.153  1.00 26.92 ? 3    LYS A CA  1 
ATOM   13  C C   . LYS A 1 4  ? 28.122 12.568 22.919  1.00 23.61 ? 3    LYS A C   1 
ATOM   14  O O   . LYS A 1 4  ? 28.285 11.882 21.886  1.00 21.17 ? 3    LYS A O   1 
ATOM   15  C CB  . LYS A 1 4  ? 28.136 10.862 24.893  1.00 27.07 ? 3    LYS A CB  1 
ATOM   16  C CG  . LYS A 1 4  ? 27.729 9.585  24.090  1.00 29.75 ? 3    LYS A CG  1 
ATOM   17  N N   . GLN A 1 5  ? 27.288 13.645 22.945  1.00 21.02 ? 4    GLN A N   1 
ATOM   18  C CA  . GLN A 1 5  ? 26.526 14.177 21.835  1.00 20.89 ? 4    GLN A CA  1 
ATOM   19  C C   . GLN A 1 5  ? 27.616 14.612 20.776  1.00 19.52 ? 4    GLN A C   1 
ATOM   20  O O   . GLN A 1 5  ? 27.476 14.381 19.597  1.00 18.82 ? 4    GLN A O   1 
ATOM   21  C CB  . GLN A 1 5  ? 25.541 15.372 22.044  1.00 27.19 ? 4    GLN A CB  1 
ATOM   22  C CG  . GLN A 1 5  ? 24.041 15.171 22.489  1.00 26.63 ? 4    GLN A CG  1 
ATOM   23  N N   . ILE A 1 6  ? 28.711 15.183 21.289  1.00 19.90 ? 5    ILE A N   1 
ATOM   24  C CA  . ILE A 1 6  ? 29.828 15.577 20.397  1.00 18.75 ? 5    ILE A CA  1 
ATOM   25  C C   . ILE A 1 6  ? 30.478 14.405 19.747  1.00 17.31 ? 5    ILE A C   1 
ATOM   26  O O   . ILE A 1 6  ? 30.753 14.402 18.488  1.00 19.36 ? 5    ILE A O   1 
ATOM   27  C CB  . ILE A 1 6  ? 30.852 16.473 21.095  1.00 18.88 ? 5    ILE A CB  1 
ATOM   28  C CG1 . ILE A 1 6  ? 30.198 17.759 21.428  1.00 21.60 ? 5    ILE A CG1 1 
ATOM   29  C CG2 . ILE A 1 6  ? 32.159 16.664 20.248  1.00 18.57 ? 5    ILE A CG2 1 
ATOM   30  C CD1 . ILE A 1 6  ? 31.147 18.590 22.402  1.00 28.54 ? 5    ILE A CD1 1 
ATOM   31  N N   . GLU A 1 7  ? 30.767 13.319 20.508  1.00 17.61 ? 6    GLU A N   1 
ATOM   32  C CA  . GLU A 1 7  ? 31.365 12.133 19.957  1.00 16.58 ? 6    GLU A CA  1 
ATOM   33  C C   . GLU A 1 7  ? 30.408 11.577 18.849  1.00 16.02 ? 6    GLU A C   1 
ATOM   34  O O   . GLU A 1 7  ? 30.954 11.120 17.800  1.00 16.79 ? 6    GLU A O   1 
ATOM   35  C CB  . GLU A 1 7  ? 31.512 11.104 21.071  1.00 19.06 ? 6    GLU A CB  1 
ATOM   36  C CG  . GLU A 1 7  ? 31.938 9.782  20.661  1.00 26.93 ? 6    GLU A CG  1 
ATOM   37  C CD  . GLU A 1 7  ? 32.509 8.856  21.725  1.00 30.34 ? 6    GLU A CD  1 
ATOM   38  O OE1 . GLU A 1 7  ? 32.370 9.254  22.932  1.00 33.08 ? 6    GLU A OE1 1 
ATOM   39  O OE2 . GLU A 1 7  ? 33.211 7.905  21.244  1.00 39.74 ? 6    GLU A OE2 1 
ATOM   40  N N   . ASP A 1 8  ? 29.090 11.554 19.121  1.00 17.07 ? 7    ASP A N   1 
ATOM   41  C CA  . ASP A 1 8  ? 28.170 10.982 18.142  1.00 16.71 ? 7    ASP A CA  1 
ATOM   42  C C   . ASP A 1 8  ? 28.102 11.868 16.879  1.00 17.62 ? 7    ASP A C   1 
ATOM   43  O O   . ASP A 1 8  ? 28.078 11.312 15.745  1.00 16.08 ? 7    ASP A O   1 
ATOM   44  C CB  . ASP A 1 8  ? 26.848 10.874 18.723  1.00 20.18 ? 7    ASP A CB  1 
ATOM   45  C CG  . ASP A 1 8  ? 26.691 9.754  19.791  1.00 20.06 ? 7    ASP A CG  1 
ATOM   46  O OD1 . ASP A 1 8  ? 27.530 8.875  19.985  1.00 25.63 ? 7    ASP A OD1 1 
ATOM   47  O OD2 . ASP A 1 8  ? 25.641 9.879  20.481  1.00 31.81 ? 7    ASP A OD2 1 
ATOM   48  N N   . LYS A 1 9  ? 28.266 13.163 17.043  1.00 16.21 ? 8    LYS A N   1 
ATOM   49  C CA  . LYS A 1 9  ? 28.263 14.132 15.919  1.00 17.51 ? 8    LYS A CA  1 
ATOM   50  C C   . LYS A 1 9  ? 29.436 13.911 15.088  1.00 15.71 ? 8    LYS A C   1 
ATOM   51  O O   . LYS A 1 9  ? 29.414 13.958 13.865  1.00 15.82 ? 8    LYS A O   1 
ATOM   52  C CB  . LYS A 1 9  ? 28.072 15.539 16.376  1.00 15.72 ? 8    LYS A CB  1 
ATOM   53  C CG  . LYS A 1 9  ? 27.962 16.605 15.397  1.00 18.91 ? 8    LYS A CG  1 
ATOM   54  C CD  . LYS A 1 9  ? 26.960 16.365 14.337  1.00 28.99 ? 8    LYS A CD  1 
ATOM   55  C CE  . LYS A 1 9  ? 25.524 16.622 14.785  1.00 33.20 ? 8    LYS A CE  1 
ATOM   56  N NZ  . LYS A 1 9  ? 24.578 16.725 13.659  1.00 35.39 ? 8    LYS A NZ  1 
ATOM   57  N N   . LEU A 1 10 ? 30.579 13.670 15.678  1.00 15.02 ? 9    LEU A N   1 
ATOM   58  C CA  . LEU A 1 10 ? 31.826 13.375 14.938  1.00 14.87 ? 9    LEU A CA  1 
ATOM   59  C C   . LEU A 1 10 ? 31.677 12.125 14.144  1.00 15.81 ? 9    LEU A C   1 
ATOM   60  O O   . LEU A 1 10 ? 32.148 12.042 12.996  1.00 15.46 ? 9    LEU A O   1 
ATOM   61  C CB  . LEU A 1 10 ? 33.106 13.336 15.889  1.00 13.71 ? 9    LEU A CB  1 
ATOM   62  C CG  . LEU A 1 10 ? 33.403 14.686 16.456  1.00 16.50 ? 9    LEU A CG  1 
ATOM   63  C CD1 . LEU A 1 10 ? 34.359 14.439 17.615  1.00 19.81 ? 9    LEU A CD1 1 
ATOM   64  C CD2 . LEU A 1 10 ? 33.961 15.650 15.413  1.00 17.66 ? 9    LEU A CD2 1 
ATOM   65  N N   . GLU A 1 11 ? 31.148 11.037 14.671  1.00 15.24 ? 10   GLU A N   1 
ATOM   66  C CA  . GLU A 1 11 ? 30.904 9.827  13.876  1.00 13.50 ? 10   GLU A CA  1 
ATOM   67  C C   . GLU A 1 11 ? 30.015 10.162 12.697  1.00 13.04 ? 10   GLU A C   1 
ATOM   68  O O   . GLU A 1 11 ? 30.314 9.645  11.577  1.00 13.58 ? 10   GLU A O   1 
ATOM   69  C CB  . GLU A 1 11 ? 30.295 8.719  14.779  1.00 16.74 ? 10   GLU A CB  1 
ATOM   70  C CG  . GLU A 1 11 ? 30.164 7.390  14.000  1.00 18.38 ? 10   GLU A CG  1 
ATOM   71  C CD  . GLU A 1 11 ? 28.935 7.237  13.149  1.00 21.95 ? 10   GLU A CD  1 
ATOM   72  O OE1 . GLU A 1 11 ? 27.937 7.951  13.381  1.00 21.85 ? 10   GLU A OE1 1 
ATOM   73  O OE2 . GLU A 1 11 ? 29.020 6.405  12.143  1.00 20.12 ? 10   GLU A OE2 1 
ATOM   74  N N   . GLU A 1 12 ? 28.982 10.953 12.878  1.00 12.54 ? 11   GLU A N   1 
ATOM   75  C CA  . GLU A 1 12 ? 28.004 11.326 11.876  1.00 12.42 ? 11   GLU A CA  1 
ATOM   76  C C   . GLU A 1 12 ? 28.803 12.118 10.730  1.00 14.37 ? 11   GLU A C   1 
ATOM   77  O O   . GLU A 1 12 ? 28.711 11.780 9.527   1.00 14.15 ? 11   GLU A O   1 
ATOM   78  C CB  . GLU A 1 12 ? 26.974 12.180 12.401  1.00 15.28 ? 11   GLU A CB  1 
ATOM   79  C CG  . GLU A 1 12 ? 25.978 12.575 11.413  1.00 21.72 ? 11   GLU A CG  1 
ATOM   80  C CD  . GLU A 1 12 ? 25.102 13.725 11.900  1.00 28.69 ? 11   GLU A CD  1 
ATOM   81  O OE1 . GLU A 1 12 ? 24.643 14.418 10.978  1.00 36.34 ? 11   GLU A OE1 1 
ATOM   82  O OE2 . GLU A 1 12 ? 24.971 14.018 13.116  1.00 30.52 ? 11   GLU A OE2 1 
ATOM   83  N N   . ILE A 1 13 ? 29.563 13.110 11.161  1.00 12.52 ? 12   ILE A N   1 
ATOM   84  C CA  . ILE A 1 13 ? 30.347 13.901 10.227  1.00 12.66 ? 12   ILE A CA  1 
ATOM   85  C C   . ILE A 1 13 ? 31.305 13.070 9.482   1.00 12.89 ? 12   ILE A C   1 
ATOM   86  O O   . ILE A 1 13 ? 31.533 13.182 8.216   1.00 13.44 ? 12   ILE A O   1 
ATOM   87  C CB  . ILE A 1 13 ? 31.086 15.046 10.970  1.00 12.54 ? 12   ILE A CB  1 
ATOM   88  C CG1 . ILE A 1 13 ? 30.094 16.080 11.407  1.00 15.23 ? 12   ILE A CG1 1 
ATOM   89  C CG2 . ILE A 1 13 ? 32.205 15.676 10.096  1.00 12.96 ? 12   ILE A CG2 1 
ATOM   90  C CD1 . ILE A 1 13 ? 30.548 17.050 12.510  1.00 15.51 ? 12   ILE A CD1 1 
ATOM   91  N N   . LEU A 1 14 ? 32.023 12.132 10.085  1.00 10.65 ? 13   LEU A N   1 
ATOM   92  C CA  . LEU A 1 14 ? 32.910 11.222 9.428   1.00 10.96 ? 13   LEU A CA  1 
ATOM   93  C C   . LEU A 1 14 ? 32.195 10.386 8.369   1.00 13.81 ? 13   LEU A C   1 
ATOM   94  O O   . LEU A 1 14 ? 32.688 10.285 7.243   1.00 13.39 ? 13   LEU A O   1 
ATOM   95  C CB  . LEU A 1 14 ? 33.674 10.223 10.420  1.00 13.75 ? 13   LEU A CB  1 
ATOM   96  C CG  . LEU A 1 14 ? 34.793 10.876 11.207  1.00 14.72 ? 13   LEU A CG  1 
ATOM   97  C CD1 . LEU A 1 14 ? 35.182 10.013 12.512  1.00 21.65 ? 13   LEU A CD1 1 
ATOM   98  C CD2 . LEU A 1 14 ? 35.971 11.054 10.325  1.00 14.35 ? 13   LEU A CD2 1 
ATOM   99  N N   . SER A 1 15 ? 31.039 9.886  8.696   1.00 13.83 ? 14   SER A N   1 
ATOM   100 C CA  . SER A 1 15 ? 30.276 9.144  7.691   1.00 14.35 ? 14   SER A CA  1 
ATOM   101 C C   . SER A 1 15 ? 29.881 9.912  6.463   1.00 15.96 ? 14   SER A C   1 
ATOM   102 O O   . SER A 1 15 ? 30.099 9.449  5.305   1.00 15.14 ? 14   SER A O   1 
ATOM   103 C CB  . SER A 1 15 ? 29.012 8.572  8.395   1.00 15.00 ? 14   SER A CB  1 
ATOM   104 O OG  . SER A 1 15 ? 27.960 9.464  8.600   1.00 22.50 ? 14   SER A OG  1 
ATOM   105 N N   . LYS A 1 16 ? 29.535 11.145 6.731   1.00 12.86 ? 15   LYS A N   1 
ATOM   106 C CA  . LYS A 1 16 ? 29.196 12.073 5.604   1.00 12.07 ? 15   LYS A CA  1 
ATOM   107 C C   . LYS A 1 16 ? 30.447 12.338 4.799   1.00 14.01 ? 15   LYS A C   1 
ATOM   108 O O   . LYS A 1 16 ? 30.414 12.450 3.571   1.00 13.38 ? 15   LYS A O   1 
ATOM   109 C CB  . LYS A 1 16 ? 28.651 13.331 6.202   1.00 15.29 ? 15   LYS A CB  1 
ATOM   110 C CG  . LYS A 1 16 ? 27.253 13.301 6.765   1.00 16.20 ? 15   LYS A CG  1 
ATOM   111 C CD  . LYS A 1 16 ? 26.699 14.584 7.418   1.00 19.02 ? 15   LYS A CD  1 
ATOM   112 C CE  . LYS A 1 16 ? 25.275 14.534 8.063   1.00 28.64 ? 15   LYS A CE  1 
ATOM   113 N NZ  . LYS A 1 16 ? 24.577 15.722 8.736   1.00 40.85 ? 15   LYS A NZ  1 
ATOM   114 N N   . LEU A 1 17 ? 31.612 12.543 5.399   1.00 11.38 ? 16   LEU A N   1 
ATOM   115 C CA  . LEU A 1 17 ? 32.822 12.843 4.685   1.00 12.21 ? 16   LEU A CA  1 
ATOM   116 C C   . LEU A 1 17 ? 33.232 11.641 3.835   1.00 13.51 ? 16   LEU A C   1 
ATOM   117 O O   . LEU A 1 17 ? 33.729 11.744 2.752   1.00 12.70 ? 16   LEU A O   1 
ATOM   118 C CB  . LEU A 1 17 ? 33.986 13.282 5.622   1.00 12.90 ? 16   LEU A CB  1 
ATOM   119 C CG  . LEU A 1 17 ? 33.873 14.603 6.203   1.00 12.22 ? 16   LEU A CG  1 
ATOM   120 C CD1 . LEU A 1 17 ? 34.788 14.839 7.362   1.00 14.88 ? 16   LEU A CD1 1 
ATOM   121 C CD2 . LEU A 1 17 ? 34.098 15.684 5.103   1.00 13.40 ? 16   LEU A CD2 1 
ATOM   122 N N   . TYR A 1 18 ? 33.068 10.429 4.397   1.00 13.99 ? 17   TYR A N   1 
ATOM   123 C CA  . TYR A 1 18 ? 33.366 9.218  3.545   1.00 13.50 ? 17   TYR A CA  1 
ATOM   124 C C   . TYR A 1 18 ? 32.499 9.081  2.330   1.00 12.86 ? 17   TYR A C   1 
ATOM   125 O O   . TYR A 1 18 ? 33.112 8.781  1.263   1.00 14.48 ? 17   TYR A O   1 
ATOM   126 C CB  . TYR A 1 18 ? 33.225 7.966  4.394   1.00 17.03 ? 17   TYR A CB  1 
ATOM   127 C CG  . TYR A 1 18 ? 33.932 7.849  5.609   1.00 19.70 ? 17   TYR A CG  1 
ATOM   128 C CD1 . TYR A 1 18 ? 33.360 7.035  6.617   1.00 24.98 ? 17   TYR A CD1 1 
ATOM   129 C CD2 . TYR A 1 18 ? 35.092 8.373  5.805   1.00 20.22 ? 17   TYR A CD2 1 
ATOM   130 C CE1 . TYR A 1 18 ? 34.022 6.881  7.811   1.00 25.24 ? 17   TYR A CE1 1 
ATOM   131 C CE2 . TYR A 1 18 ? 35.751 8.239  7.045   1.00 22.08 ? 17   TYR A CE2 1 
ATOM   132 C CZ  . TYR A 1 18 ? 35.162 7.450  7.999   1.00 24.38 ? 17   TYR A CZ  1 
ATOM   133 O OH  . TYR A 1 18 ? 35.859 7.289  9.209   1.00 35.43 ? 17   TYR A OH  1 
ATOM   134 N N   . HIS A 1 19 ? 31.218 9.448  2.421   1.00 14.40 ? 18   HIS A N   1 
ATOM   135 C CA  . HIS A 1 19 ? 30.327 9.549  1.257   1.00 13.45 ? 18   HIS A CA  1 
ATOM   136 C C   . HIS A 1 19 ? 30.900 10.573 0.260   1.00 14.61 ? 18   HIS A C   1 
ATOM   137 O O   . HIS A 1 19 ? 30.998 10.246 -0.917  1.00 12.99 ? 18   HIS A O   1 
ATOM   138 C CB  . HIS A 1 19 ? 28.844 9.883  1.553   1.00 14.76 ? 18   HIS A CB  1 
ATOM   139 C CG  . HIS A 1 19 ? 28.183 8.788  2.322   1.00 19.57 ? 18   HIS A CG  1 
ATOM   140 N ND1 . HIS A 1 19 ? 27.958 7.535  1.773   1.00 26.39 ? 18   HIS A ND1 1 
ATOM   141 C CD2 . HIS A 1 19 ? 27.773 8.715  3.638   1.00 27.74 ? 18   HIS A CD2 1 
ATOM   142 C CE1 . HIS A 1 19 ? 27.649 6.680  2.815   1.00 24.39 ? 18   HIS A CE1 1 
ATOM   143 N NE2 . HIS A 1 19 ? 27.353 7.445  3.869   1.00 26.69 ? 18   HIS A NE2 1 
ATOM   144 N N   . ILE A 1 20 ? 31.328 11.702 0.731   1.00 12.56 ? 19   ILE A N   1 
ATOM   145 C CA  . ILE A 1 20 ? 31.889 12.749 -0.149  1.00 10.77 ? 19   ILE A CA  1 
ATOM   146 C C   . ILE A 1 20 ? 33.113 12.267 -0.810  1.00 10.56 ? 19   ILE A C   1 
ATOM   147 O O   . ILE A 1 20 ? 33.334 12.491 -2.013  1.00 12.08 ? 19   ILE A O   1 
ATOM   148 C CB  . ILE A 1 20 ? 32.118 14.112 0.644   1.00 10.39 ? 19   ILE A CB  1 
ATOM   149 C CG1 . ILE A 1 20 ? 30.745 14.724 0.946   1.00 12.51 ? 19   ILE A CG1 1 
ATOM   150 C CG2 . ILE A 1 20 ? 33.002 15.018 -0.100  1.00 11.85 ? 19   ILE A CG2 1 
ATOM   151 C CD1 . ILE A 1 20 ? 30.761 15.681 2.050   1.00 14.06 ? 19   ILE A CD1 1 
ATOM   152 N N   . CYS A 1 21 ? 34.018 11.628 -0.094  1.00 10.41 ? 20   CYS A N   1 
ATOM   153 C CA  . CYS A 1 21 ? 35.274 11.068 -0.690  1.00 10.26 ? 20   CYS A CA  1 
ATOM   154 C C   . CYS A 1 21 ? 34.904 10.073 -1.801  1.00 11.94 ? 20   CYS A C   1 
ATOM   155 O O   . CYS A 1 21 ? 35.514 10.111 -2.863  1.00 12.82 ? 20   CYS A O   1 
ATOM   156 C CB  . CYS A 1 21 ? 36.078 10.368 0.355   1.00 11.22 ? 20   CYS A CB  1 
ATOM   157 S SG  . CYS A 1 21 ? 36.908 11.552 1.471   1.00 15.09 ? 20   CYS A SG  1 
ATOM   158 N N   . ASN A 1 22 ? 33.911 9.215  -1.566  1.00 11.20 ? 21   ASN A N   1 
ATOM   159 C CA  . ASN A 1 22 ? 33.523 8.221  -2.547  1.00 11.93 ? 21   ASN A CA  1 
ATOM   160 C C   . ASN A 1 22 ? 32.994 8.905  -3.778  1.00 13.27 ? 21   ASN A C   1 
ATOM   161 O O   . ASN A 1 22 ? 33.315 8.489  -4.911  1.00 15.40 ? 21   ASN A O   1 
ATOM   162 C CB  . ASN A 1 22 ? 32.524 7.261  -1.936  1.00 15.47 ? 21   ASN A CB  1 
ATOM   163 C CG  . ASN A 1 22 ? 33.194 6.259  -0.957  1.00 18.97 ? 21   ASN A CG  1 
ATOM   164 O OD1 . ASN A 1 22 ? 34.371 5.929  -1.080  1.00 25.14 ? 21   ASN A OD1 1 
ATOM   165 N ND2 . ASN A 1 22 ? 32.414 5.755  0.002   1.00 23.67 ? 21   ASN A ND2 1 
ATOM   166 N N   . GLU A 1 23 ? 32.210 9.933  -3.566  1.00 13.05 ? 22   GLU A N   1 
ATOM   167 C CA  . GLU A 1 23 ? 31.640 10.632 -4.711  1.00 14.31 ? 22   GLU A CA  1 
ATOM   168 C C   . GLU A 1 23 ? 32.692 11.383 -5.481  1.00 13.44 ? 22   GLU A C   1 
ATOM   169 O O   . GLU A 1 23 ? 32.639 11.503 -6.668  1.00 14.26 ? 22   GLU A O   1 
ATOM   170 C CB  . GLU A 1 23 ? 30.529 11.553 -4.280  1.00 15.70 ? 22   GLU A CB  1 
ATOM   171 C CG  . GLU A 1 23 ? 29.697 11.999 -5.446  1.00 17.36 ? 22   GLU A CG  1 
ATOM   172 C CD  . GLU A 1 23 ? 28.879 10.868 -6.121  1.00 22.55 ? 22   GLU A CD  1 
ATOM   173 O OE1 . GLU A 1 23 ? 28.451 11.130 -7.266  1.00 27.61 ? 22   GLU A OE1 1 
ATOM   174 O OE2 . GLU A 1 23 ? 28.765 9.749  -5.688  1.00 21.13 ? 22   GLU A OE2 1 
ATOM   175 N N   . LEU A 1 24 ? 33.674 12.041 -4.844  1.00 12.38 ? 23   LEU A N   1 
ATOM   176 C CA  . LEU A 1 24 ? 34.770 12.750 -5.554  1.00 12.18 ? 23   LEU A CA  1 
ATOM   177 C C   . LEU A 1 24 ? 35.600 11.791 -6.373  1.00 14.07 ? 23   LEU A C   1 
ATOM   178 O O   . LEU A 1 24 ? 36.143 12.126 -7.442  1.00 15.78 ? 23   LEU A O   1 
ATOM   179 C CB  . LEU A 1 24 ? 35.591 13.509 -4.535  1.00 13.07 ? 23   LEU A CB  1 
ATOM   180 C CG  . LEU A 1 24 ? 34.950 14.747 -3.995  1.00 11.86 ? 23   LEU A CG  1 
ATOM   181 C CD1 . LEU A 1 24 ? 35.739 15.333 -2.840  1.00 14.28 ? 23   LEU A CD1 1 
ATOM   182 C CD2 . LEU A 1 24 ? 34.731 15.905 -5.028  1.00 12.74 ? 23   LEU A CD2 1 
ATOM   183 N N   . ALA A 1 25 ? 35.797 10.607 -5.802  1.00 13.22 ? 24   ALA A N   1 
ATOM   184 C CA  . ALA A 1 25 ? 36.516 9.552  -6.549  1.00 12.88 ? 24   ALA A CA  1 
ATOM   185 C C   . ALA A 1 25 ? 35.722 9.175  -7.697  1.00 13.74 ? 24   ALA A C   1 
ATOM   186 O O   . ALA A 1 25 ? 36.400 8.939  -8.799  1.00 16.05 ? 24   ALA A O   1 
ATOM   187 C CB  . ALA A 1 25 ? 36.861 8.315  -5.636  1.00 16.08 ? 24   ALA A CB  1 
ATOM   188 N N   . ARG A 1 26 ? 34.443 9.013  -7.605  1.00 13.18 ? 25   ARG A N   1 
ATOM   189 C CA  . ARG A 1 26 ? 33.595 8.743  -8.810  1.00 16.29 ? 25   ARG A CA  1 
ATOM   190 C C   . ARG A 1 26 ? 33.690 9.832  -9.872  1.00 16.59 ? 25   ARG A C   1 
ATOM   191 O O   . ARG A 1 26 ? 33.914 9.593  -11.049 1.00 16.97 ? 25   ARG A O   1 
ATOM   192 C CB  . ARG A 1 26 ? 32.178 8.610  -8.449  1.00 16.88 ? 25   ARG A CB  1 
ATOM   193 C CG  . ARG A 1 26 ? 31.191 8.646  -9.643  1.00 20.66 ? 25   ARG A CG  1 
ATOM   194 C CD  . ARG A 1 26 ? 29.773 8.496  -9.198  1.00 19.54 ? 25   ARG A CD  1 
ATOM   195 N NE  . ARG A 1 26 ? 28.862 8.516  -10.343 1.00 17.38 ? 25   ARG A NE  1 
ATOM   196 C CZ  . ARG A 1 26 ? 28.042 9.493  -10.594 1.00 21.90 ? 25   ARG A CZ  1 
ATOM   197 N NH1 . ARG A 1 26 ? 27.959 10.599 -9.845  1.00 27.47 ? 25   ARG A NH1 1 
ATOM   198 N NH2 . ARG A 1 26 ? 27.257 9.380  -11.705 1.00 23.64 ? 25   ARG A NH2 1 
ATOM   199 N N   . ILE A 1 27 ? 33.705 11.054 -9.445  1.00 13.37 ? 26   ILE A N   1 
ATOM   200 C CA  . ILE A 1 27 ? 33.828 12.224 -10.308 1.00 13.31 ? 26   ILE A CA  1 
ATOM   201 C C   . ILE A 1 27 ? 35.205 12.142 -10.987 1.00 13.54 ? 26   ILE A C   1 
ATOM   202 O O   . ILE A 1 27 ? 35.308 12.323 -12.244 1.00 15.57 ? 26   ILE A O   1 
ATOM   203 C CB  . ILE A 1 27 ? 33.581 13.563 -9.579  1.00 14.67 ? 26   ILE A CB  1 
ATOM   204 C CG1 . ILE A 1 27 ? 32.140 13.768 -9.295  1.00 16.47 ? 26   ILE A CG1 1 
ATOM   205 C CG2 . ILE A 1 27 ? 34.157 14.722 -10.460 1.00 17.22 ? 26   ILE A CG2 1 
ATOM   206 C CD1 . ILE A 1 27 ? 31.877 14.874 -8.291  1.00 17.76 ? 26   ILE A CD1 1 
ATOM   207 N N   . LYS A 1 28 ? 36.268 11.922 -10.272 1.00 16.37 ? 27   LYS A N   1 
ATOM   208 C CA  . LYS A 1 28 ? 37.632 11.808 -10.860 1.00 16.55 ? 27   LYS A CA  1 
ATOM   209 C C   . LYS A 1 28 ? 37.700 10.684 -11.879 1.00 19.41 ? 27   LYS A C   1 
ATOM   210 O O   . LYS A 1 28 ? 38.296 10.922 -12.993 1.00 18.71 ? 27   LYS A O   1 
ATOM   211 C CB  . LYS A 1 28 ? 38.691 11.687 -9.752  1.00 17.83 ? 27   LYS A CB  1 
ATOM   212 C CG  . LYS A 1 28 ? 40.099 11.652 -10.218 1.00 19.52 ? 27   LYS A CG  1 
ATOM   213 C CD  . LYS A 1 28 ? 41.067 11.550 -8.963  1.00 23.39 ? 27   LYS A CD  1 
ATOM   214 C CE  . LYS A 1 28 ? 40.993 10.346 -8.177  1.00 28.20 ? 27   LYS A CE  1 
ATOM   215 N NZ  . LYS A 1 28 ? 41.651 9.285  -8.977  1.00 32.64 ? 27   LYS A NZ  1 
ATOM   216 N N   . LYS A 1 29 ? 37.031 9.582  -11.618 1.00 17.08 ? 28   LYS A N   1 
ATOM   217 C CA  . LYS A 1 29 ? 36.919 8.467  -12.615 1.00 19.66 ? 28   LYS A CA  1 
ATOM   218 C C   . LYS A 1 29 ? 36.254 8.898  -13.892 1.00 21.00 ? 28   LYS A C   1 
ATOM   219 O O   . LYS A 1 29 ? 36.765 8.651  -14.999 1.00 21.61 ? 28   LYS A O   1 
ATOM   220 C CB  . LYS A 1 29 ? 36.250 7.278  -11.963 1.00 20.58 ? 28   LYS A CB  1 
ATOM   221 C CG  . LYS A 1 29 ? 36.117 5.997  -12.965 1.00 21.73 ? 28   LYS A CG  1 
ATOM   222 C CD  . LYS A 1 29 ? 35.583 4.961  -12.214 1.00 27.43 ? 28   LYS A CD  1 
ATOM   223 N N   . LEU A 1 30 ? 35.081 9.458  -13.767 1.00 18.54 ? 29   LEU A N   1 
ATOM   224 C CA  . LEU A 1 30 ? 34.213 9.907  -14.859 1.00 18.27 ? 29   LEU A CA  1 
ATOM   225 C C   . LEU A 1 30 ? 35.030 10.875 -15.676 1.00 20.03 ? 29   LEU A C   1 
ATOM   226 O O   . LEU A 1 30 ? 34.991 10.804 -16.970 1.00 22.07 ? 29   LEU A O   1 
ATOM   227 C CB  . LEU A 1 30 ? 32.911 10.479 -14.368 1.00 18.41 ? 29   LEU A CB  1 
ATOM   228 C CG  . LEU A 1 30 ? 31.855 9.561  -13.713 1.00 21.39 ? 29   LEU A CG  1 
ATOM   229 C CD1 . LEU A 1 30 ? 30.687 10.325 -13.331 1.00 20.15 ? 29   LEU A CD1 1 
ATOM   230 C CD2 . LEU A 1 30 ? 31.369 8.425  -14.700 1.00 27.75 ? 29   LEU A CD2 1 
ATOM   231 N N   . LEU A 1 31 ? 35.710 11.850 -15.073 1.00 20.41 ? 30   LEU A N   1 
ATOM   232 C CA  . LEU A 1 31 ? 36.475 12.864 -15.871 1.00 19.72 ? 30   LEU A CA  1 
ATOM   233 C C   . LEU A 1 31 ? 37.591 12.159 -16.600 1.00 23.71 ? 30   LEU A C   1 
ATOM   234 O O   . LEU A 1 31 ? 37.907 12.545 -17.738 1.00 24.34 ? 30   LEU A O   1 
ATOM   235 C CB  . LEU A 1 31 ? 37.022 13.954 -14.974 1.00 21.35 ? 30   LEU A CB  1 
ATOM   236 C CG  . LEU A 1 31 ? 35.964 14.819 -14.438 1.00 20.16 ? 30   LEU A CG  1 
ATOM   237 C CD1 . LEU A 1 31 ? 36.683 15.836 -13.481 1.00 23.20 ? 30   LEU A CD1 1 
ATOM   238 C CD2 . LEU A 1 31 ? 35.066 15.608 -15.490 1.00 21.13 ? 30   LEU A CD2 1 
ATOM   239 N N   . GLY A 1 32 ? 38.181 11.174 -15.963 1.00 24.60 ? 31   GLY A N   1 
ATOM   240 C CA  . GLY A 1 32 ? 39.288 10.430 -16.517 1.00 29.19 ? 31   GLY A CA  1 
ATOM   241 C C   . GLY A 1 32 ? 38.881 9.629  -17.763 1.00 30.06 ? 31   GLY A C   1 
ATOM   242 O O   . GLY A 1 32 ? 39.828 9.196  -18.504 1.00 32.18 ? 31   GLY A O   1 
ATOM   243 N N   . GLU A 1 33 ? 37.585 9.312  -17.905 1.00 32.82 ? 32   GLU A N   1 
ATOM   244 C CA  . GLU A 1 33 ? 37.006 8.384  -18.911 1.00 36.06 ? 32   GLU A CA  1 
ATOM   245 C C   . GLU A 1 33 ? 36.690 9.139  -20.112 1.00 40.45 ? 32   GLU A C   1 
ATOM   246 O O   . GLU A 1 33 ? 36.169 8.594  -21.086 1.00 43.00 ? 32   GLU A O   1 
ATOM   247 C CB  . GLU A 1 33 ? 35.669 7.747  -18.384 1.00 36.40 ? 32   GLU A CB  1 
ATOM   248 C CG  . GLU A 1 33 ? 35.958 6.600  -17.439 1.00 33.19 ? 32   GLU A CG  1 
ATOM   249 C CD  . GLU A 1 33 ? 34.731 5.930  -16.759 1.00 36.00 ? 32   GLU A CD  1 
ATOM   250 O OE1 . GLU A 1 33 ? 33.480 6.333  -16.951 1.00 42.58 ? 32   GLU A OE1 1 
ATOM   251 O OE2 . GLU A 1 33 ? 35.055 4.946  -16.038 1.00 45.87 ? 32   GLU A OE2 1 
ATOM   252 N N   . ARG A 1 34 ? 36.774 10.429 -19.933 1.00 41.83 ? 33   ARG A N   1 
ATOM   253 C CA  . ARG A 1 34 ? 36.945 11.431 -20.910 1.00 44.22 ? 33   ARG A CA  1 
ATOM   254 C C   . ARG A 1 34 ? 35.911 12.545 -21.026 1.00 46.62 ? 33   ARG A C   1 
ATOM   255 O O   . ARG A 1 34 ? 35.169 13.050 -20.099 1.00 46.36 ? 33   ARG A O   1 
ATOM   256 C CB  . ARG A 1 34 ? 37.362 10.807 -22.274 1.00 42.57 ? 33   ARG A CB  1 
ATOM   257 C CG  . ARG A 1 34 ? 38.778 10.634 -22.277 1.00 37.95 ? 33   ARG A CG  1 
ATOM   258 C CD  . ARG A 1 34 ? 39.568 11.881 -21.594 1.00 24.89 ? 33   ARG A CD  1 
ATOM   259 N NE  . ARG A 1 34 ? 40.358 11.481 -20.479 1.00 33.60 ? 33   ARG A NE  1 
ATOM   260 O OXT . ARG A 1 34 ? 36.089 12.894 -22.209 1.00 52.59 ? 33   ARG A OXT 1 
ATOM   261 N N   . ARG B 1 2  ? 26.444 15.074 -19.701 1.00 36.87 ? 1    ARG B N   1 
ATOM   262 C CA  . ARG B 1 2  ? 27.200 14.348 -18.616 1.00 34.47 ? 1    ARG B CA  1 
ATOM   263 C C   . ARG B 1 2  ? 28.042 15.336 -17.731 1.00 30.40 ? 1    ARG B C   1 
ATOM   264 O O   . ARG B 1 2  ? 28.137 15.214 -16.511 1.00 27.03 ? 1    ARG B O   1 
ATOM   265 C CB  . ARG B 1 2  ? 28.010 13.208 -19.144 1.00 38.17 ? 1    ARG B CB  1 
ATOM   266 C CG  . ARG B 1 2  ? 27.686 12.009 -18.396 1.00 43.42 ? 1    ARG B CG  1 
ATOM   267 C CD  . ARG B 1 2  ? 28.850 11.401 -17.597 1.00 48.88 ? 1    ARG B CD  1 
ATOM   268 N NE  . ARG B 1 2  ? 28.406 10.066 -17.202 1.00 51.47 ? 1    ARG B NE  1 
ATOM   269 C CZ  . ARG B 1 2  ? 29.042 8.934  -17.533 1.00 47.27 ? 1    ARG B CZ  1 
ATOM   270 N NH1 . ARG B 1 2  ? 28.527 7.737  -17.173 1.00 40.27 ? 1    ARG B NH1 1 
ATOM   271 N NH2 . ARG B 1 2  ? 30.233 9.023  -18.168 1.00 44.04 ? 1    ARG B NH2 1 
ATOM   272 N N   . MET B 1 3  ? 28.588 16.380 -18.342 1.00 28.37 ? 2    MET B N   1 
ATOM   273 C CA  . MET B 1 3  ? 29.478 17.251 -17.583 1.00 23.88 ? 2    MET B CA  1 
ATOM   274 C C   . MET B 1 3  ? 28.495 18.011 -16.638 1.00 23.11 ? 2    MET B C   1 
ATOM   275 O O   . MET B 1 3  ? 28.873 18.360 -15.517 1.00 20.44 ? 2    MET B O   1 
ATOM   276 C CB  . MET B 1 3  ? 30.195 18.280 -18.442 1.00 25.32 ? 2    MET B CB  1 
ATOM   277 C CG  . MET B 1 3  ? 31.184 19.152 -17.621 1.00 28.96 ? 2    MET B CG  1 
ATOM   278 S SD  . MET B 1 3  ? 32.477 18.096 -16.941 1.00 28.82 ? 2    MET B SD  1 
ATOM   279 C CE  . MET B 1 3  ? 33.237 17.611 -18.245 1.00 29.25 ? 2    MET B CE  1 
ATOM   280 N N   . LYS B 1 4  ? 27.271 18.350 -17.078 1.00 22.45 ? 3    LYS B N   1 
ATOM   281 C CA  . LYS B 1 4  ? 26.299 19.050 -16.213 1.00 23.03 ? 3    LYS B CA  1 
ATOM   282 C C   . LYS B 1 4  ? 25.997 18.171 -14.973 1.00 22.61 ? 3    LYS B C   1 
ATOM   283 O O   . LYS B 1 4  ? 25.899 18.734 -13.808 1.00 20.14 ? 3    LYS B O   1 
ATOM   284 C CB  . LYS B 1 4  ? 25.012 19.522 -16.940 1.00 27.31 ? 3    LYS B CB  1 
ATOM   285 C CG  . LYS B 1 4  ? 23.996 20.266 -15.981 1.00 29.28 ? 3    LYS B CG  1 
ATOM   286 C CD  . LYS B 1 4  ? 22.490 20.596 -16.398 1.00 33.27 ? 3    LYS B CD  1 
ATOM   287 C CE  . LYS B 1 4  ? 21.599 20.915 -15.052 1.00 31.75 ? 3    LYS B CE  1 
ATOM   288 N N   . GLN B 1 5  ? 25.953 16.866 -15.082 1.00 19.63 ? 4    GLN B N   1 
ATOM   289 C CA  . GLN B 1 5  ? 25.712 16.024 -13.925 1.00 20.30 ? 4    GLN B CA  1 
ATOM   290 C C   . GLN B 1 5  ? 26.869 16.169 -12.930 1.00 19.59 ? 4    GLN B C   1 
ATOM   291 O O   . GLN B 1 5  ? 26.526 16.219 -11.703 1.00 18.31 ? 4    GLN B O   1 
ATOM   292 C CB  . GLN B 1 5  ? 25.508 14.604 -14.337 1.00 23.76 ? 4    GLN B CB  1 
ATOM   293 N N   . ILE B 1 6  ? 28.123 16.233 -13.393 1.00 15.99 ? 5    ILE B N   1 
ATOM   294 C CA  . ILE B 1 6  ? 29.296 16.401 -12.517 1.00 16.80 ? 5    ILE B CA  1 
ATOM   295 C C   . ILE B 1 6  ? 29.188 17.730 -11.853 1.00 15.98 ? 5    ILE B C   1 
ATOM   296 O O   . ILE B 1 6  ? 29.434 17.851 -10.661 1.00 14.98 ? 5    ILE B O   1 
ATOM   297 C CB  . ILE B 1 6  ? 30.638 16.170 -13.316 1.00 19.74 ? 5    ILE B CB  1 
ATOM   298 C CG1 . ILE B 1 6  ? 30.664 14.663 -13.648 1.00 23.96 ? 5    ILE B CG1 1 
ATOM   299 C CG2 . ILE B 1 6  ? 31.837 16.645 -12.581 1.00 16.38 ? 5    ILE B CG2 1 
ATOM   300 C CD1 . ILE B 1 6  ? 31.802 14.314 -14.547 1.00 22.36 ? 5    ILE B CD1 1 
ATOM   301 N N   . GLU B 1 7  ? 28.995 18.797 -12.612 1.00 16.38 ? 6    GLU B N   1 
ATOM   302 C CA  . GLU B 1 7  ? 28.809 20.110 -12.005 1.00 14.53 ? 6    GLU B CA  1 
ATOM   303 C C   . GLU B 1 7  ? 27.737 20.203 -10.908 1.00 15.09 ? 6    GLU B C   1 
ATOM   304 O O   . GLU B 1 7  ? 27.984 20.715 -9.769  1.00 15.58 ? 6    GLU B O   1 
ATOM   305 C CB  . GLU B 1 7  ? 28.519 21.170 -13.131 1.00 15.19 ? 6    GLU B CB  1 
ATOM   306 C CG  . GLU B 1 7  ? 29.617 21.352 -14.124 1.00 16.69 ? 6    GLU B CG  1 
ATOM   307 C CD  . GLU B 1 7  ? 29.088 22.182 -15.351 1.00 24.12 ? 6    GLU B CD  1 
ATOM   308 O OE1 . GLU B 1 7  ? 28.540 23.207 -15.104 1.00 27.93 ? 6    GLU B OE1 1 
ATOM   309 O OE2 . GLU B 1 7  ? 29.190 21.682 -16.446 1.00 33.30 ? 6    GLU B OE2 1 
ATOM   310 N N   . ASP B 1 8  ? 26.563 19.567 -11.194 1.00 14.73 ? 7    ASP B N   1 
ATOM   311 C CA  . ASP B 1 8  ? 25.520 19.526 -10.235 1.00 15.01 ? 7    ASP B CA  1 
ATOM   312 C C   . ASP B 1 8  ? 25.930 18.722 -8.963  1.00 15.94 ? 7    ASP B C   1 
ATOM   313 O O   . ASP B 1 8  ? 25.628 19.134 -7.849  1.00 16.22 ? 7    ASP B O   1 
ATOM   314 C CB  . ASP B 1 8  ? 24.214 18.958 -10.798 1.00 16.30 ? 7    ASP B CB  1 
ATOM   315 C CG  . ASP B 1 8  ? 23.554 19.915 -11.799 1.00 20.70 ? 7    ASP B CG  1 
ATOM   316 O OD1 . ASP B 1 8  ? 23.994 21.072 -11.916 1.00 27.51 ? 7    ASP B OD1 1 
ATOM   317 O OD2 . ASP B 1 8  ? 22.697 19.302 -12.535 1.00 30.83 ? 7    ASP B OD2 1 
ATOM   318 N N   . LYS B 1 9  ? 26.655 17.651 -9.141  1.00 14.34 ? 8    LYS B N   1 
ATOM   319 C CA  . LYS B 1 9  ? 27.150 16.867 -7.980  1.00 15.15 ? 8    LYS B CA  1 
ATOM   320 C C   . LYS B 1 9  ? 28.165 17.690 -7.186  1.00 12.84 ? 8    LYS B C   1 
ATOM   321 O O   . LYS B 1 9  ? 28.175 17.637 -5.964  1.00 13.18 ? 8    LYS B O   1 
ATOM   322 C CB  . LYS B 1 9  ? 27.730 15.545 -8.362  1.00 13.95 ? 8    LYS B CB  1 
ATOM   323 C CG  . LYS B 1 9  ? 28.095 14.591 -7.197  1.00 16.88 ? 8    LYS B CG  1 
ATOM   324 C CD  . LYS B 1 9  ? 27.033 14.316 -6.226  1.00 21.51 ? 8    LYS B CD  1 
ATOM   325 C CE  . LYS B 1 9  ? 26.019 13.475 -6.816  1.00 20.00 ? 8    LYS B CE  1 
ATOM   326 N NZ  . LYS B 1 9  ? 24.938 12.990 -5.772  1.00 22.76 ? 8    LYS B NZ  1 
ATOM   327 N N   . LEU B 1 10 ? 29.033 18.456 -7.845  1.00 13.44 ? 9    LEU B N   1 
ATOM   328 C CA  . LEU B 1 10 ? 29.973 19.329 -7.088  1.00 11.77 ? 9    LEU B CA  1 
ATOM   329 C C   . LEU B 1 10 ? 29.240 20.304 -6.294  1.00 13.20 ? 9    LEU B C   1 
ATOM   330 O O   . LEU B 1 10 ? 29.594 20.671 -5.193  1.00 11.42 ? 9    LEU B O   1 
ATOM   331 C CB  . LEU B 1 10 ? 30.991 20.003 -8.030  1.00 13.10 ? 9    LEU B CB  1 
ATOM   332 C CG  . LEU B 1 10 ? 31.977 18.997 -8.651  1.00 13.71 ? 9    LEU B CG  1 
ATOM   333 C CD1 . LEU B 1 10 ? 32.776 19.706 -9.743  1.00 15.94 ? 9    LEU B CD1 1 
ATOM   334 C CD2 . LEU B 1 10 ? 33.004 18.548 -7.672  1.00 16.72 ? 9    LEU B CD2 1 
ATOM   335 N N   . GLU B 1 11 ? 28.177 20.903 -6.881  1.00 11.47 ? 10   GLU B N   1 
ATOM   336 C CA  . GLU B 1 11 ? 27.286 21.836 -6.128  1.00 12.91 ? 10   GLU B CA  1 
ATOM   337 C C   . GLU B 1 11 ? 26.704 21.144 -4.927  1.00 12.85 ? 10   GLU B C   1 
ATOM   338 O O   . GLU B 1 11 ? 26.724 21.823 -3.791  1.00 13.69 ? 10   GLU B O   1 
ATOM   339 C CB  . GLU B 1 11 ? 26.140 22.404 -7.013  1.00 13.32 ? 10   GLU B CB  1 
ATOM   340 C CG  . GLU B 1 11 ? 25.165 23.314 -6.304  1.00 18.30 ? 10   GLU B CG  1 
ATOM   341 C CD  . GLU B 1 11 ? 23.944 23.604 -7.178  1.00 24.14 ? 10   GLU B CD  1 
ATOM   342 O OE1 . GLU B 1 11 ? 24.164 24.524 -7.927  1.00 24.95 ? 10   GLU B OE1 1 
ATOM   343 O OE2 . GLU B 1 11 ? 22.913 22.886 -7.067  1.00 26.78 ? 10   GLU B OE2 1 
ATOM   344 N N   . GLU B 1 12 ? 26.234 19.902 -4.997  1.00 11.74 ? 11   GLU B N   1 
ATOM   345 C CA  . GLU B 1 12 ? 25.651 19.205 -3.920  1.00 11.83 ? 11   GLU B CA  1 
ATOM   346 C C   . GLU B 1 12 ? 26.745 18.912 -2.842  1.00 12.07 ? 11   GLU B C   1 
ATOM   347 O O   . GLU B 1 12 ? 26.468 19.056 -1.591  1.00 12.99 ? 11   GLU B O   1 
ATOM   348 C CB  . GLU B 1 12 ? 25.152 17.847 -4.408  1.00 15.01 ? 11   GLU B CB  1 
ATOM   349 C CG  . GLU B 1 12 ? 24.480 17.067 -3.357  1.00 19.08 ? 11   GLU B CG  1 
ATOM   350 C CD  . GLU B 1 12 ? 23.845 15.780 -3.864  1.00 27.86 ? 11   GLU B CD  1 
ATOM   351 O OE1 . GLU B 1 12 ? 23.137 15.127 -2.989  1.00 34.90 ? 11   GLU B OE1 1 
ATOM   352 O OE2 . GLU B 1 12 ? 24.042 15.455 -5.054  1.00 24.63 ? 11   GLU B OE2 1 
ATOM   353 N N   . ILE B 1 13 ? 27.924 18.480 -3.299  1.00 12.81 ? 12   ILE B N   1 
ATOM   354 C CA  . ILE B 1 13 ? 29.020 18.198 -2.374  1.00 10.40 ? 12   ILE B CA  1 
ATOM   355 C C   . ILE B 1 13 ? 29.417 19.473 -1.640  1.00 10.47 ? 12   ILE B C   1 
ATOM   356 O O   . ILE B 1 13 ? 29.682 19.459 -0.426  1.00 12.13 ? 12   ILE B O   1 
ATOM   357 C CB  . ILE B 1 13 ? 30.294 17.656 -3.178  1.00 13.20 ? 12   ILE B CB  1 
ATOM   358 C CG1 . ILE B 1 13 ? 29.967 16.224 -3.606  1.00 13.67 ? 12   ILE B CG1 1 
ATOM   359 C CG2 . ILE B 1 13 ? 31.566 17.768 -2.326  1.00 12.04 ? 12   ILE B CG2 1 
ATOM   360 C CD1 . ILE B 1 13 ? 30.973 15.688 -4.552  1.00 14.54 ? 12   ILE B CD1 1 
ATOM   361 N N   . LEU B 1 14 ? 29.518 20.644 -2.334  1.00 12.00 ? 13   LEU B N   1 
ATOM   362 C CA  . LEU B 1 14 ? 29.834 21.944 -1.655  1.00 10.63 ? 13   LEU B CA  1 
ATOM   363 C C   . LEU B 1 14 ? 28.814 22.221 -0.599  1.00 10.82 ? 13   LEU B C   1 
ATOM   364 O O   . LEU B 1 14 ? 29.160 22.523 0.553   1.00 12.25 ? 13   LEU B O   1 
ATOM   365 C CB  . LEU B 1 14 ? 29.903 23.116 -2.656  1.00 11.53 ? 13   LEU B CB  1 
ATOM   366 C CG  . LEU B 1 14 ? 31.252 23.099 -3.351  1.00 13.80 ? 13   LEU B CG  1 
ATOM   367 C CD1 . LEU B 1 14 ? 31.208 23.896 -4.654  1.00 16.19 ? 13   LEU B CD1 1 
ATOM   368 C CD2 . LEU B 1 14 ? 32.371 23.605 -2.462  1.00 14.08 ? 13   LEU B CD2 1 
ATOM   369 N N   . SER B 1 15 ? 27.496 22.039 -0.846  1.00 12.24 ? 14   SER B N   1 
ATOM   370 C CA  . SER B 1 15 ? 26.497 22.345 0.217   1.00 12.01 ? 14   SER B CA  1 
ATOM   371 C C   . SER B 1 15 ? 26.646 21.460 1.359   1.00 13.44 ? 14   SER B C   1 
ATOM   372 O O   . SER B 1 15 ? 26.545 21.898 2.544   1.00 12.73 ? 14   SER B O   1 
ATOM   373 C CB  . SER B 1 15 ? 25.112 22.063 -0.456  1.00 15.70 ? 14   SER B CB  1 
ATOM   374 O OG  . SER B 1 15 ? 24.056 22.111 0.580   1.00 23.71 ? 14   SER B OG  1 
ATOM   375 N N   . LYS B 1 16 ? 26.998 20.170 1.137   1.00 12.42 ? 15   LYS B N   1 
ATOM   376 C CA  . LYS B 1 16 ? 27.233 19.219 2.237   1.00 13.34 ? 15   LYS B CA  1 
ATOM   377 C C   . LYS B 1 16 ? 28.432 19.609 3.011   1.00 12.95 ? 15   LYS B C   1 
ATOM   378 O O   . LYS B 1 16 ? 28.389 19.472 4.259   1.00 12.48 ? 15   LYS B O   1 
ATOM   379 C CB  . LYS B 1 16 ? 27.284 17.812 1.764   1.00 14.59 ? 15   LYS B CB  1 
ATOM   380 C CG  . LYS B 1 16 ? 25.986 17.228 1.205   1.00 15.26 ? 15   LYS B CG  1 
ATOM   381 C CD  . LYS B 1 16 ? 26.006 15.842 0.502   1.00 19.99 ? 15   LYS B CD  1 
ATOM   382 C CE  . LYS B 1 16 ? 24.742 14.875 0.598   1.00 29.45 ? 15   LYS B CE  1 
ATOM   383 N NZ  . LYS B 1 16 ? 23.886 15.263 -0.455  1.00 39.31 ? 15   LYS B NZ  1 
ATOM   384 N N   . LEU B 1 17 ? 29.506 20.051 2.392   1.00 10.66 ? 16   LEU B N   1 
ATOM   385 C CA  . LEU B 1 17 ? 30.656 20.513 3.088   1.00 10.01 ? 16   LEU B CA  1 
ATOM   386 C C   . LEU B 1 17 ? 30.427 21.777 3.900   1.00 11.48 ? 16   LEU B C   1 
ATOM   387 O O   . LEU B 1 17 ? 30.942 21.887 5.018   1.00 11.32 ? 16   LEU B O   1 
ATOM   388 C CB  . LEU B 1 17 ? 31.821 20.701 2.135   1.00 9.98  ? 16   LEU B CB  1 
ATOM   389 C CG  . LEU B 1 17 ? 32.477 19.464 1.574   1.00 10.30 ? 16   LEU B CG  1 
ATOM   390 C CD1 . LEU B 1 17 ? 33.411 19.839 0.422   1.00 14.40 ? 16   LEU B CD1 1 
ATOM   391 C CD2 . LEU B 1 17 ? 33.224 18.648 2.666   1.00 13.16 ? 16   LEU B CD2 1 
ATOM   392 N N   . TYR B 1 18 ? 29.601 22.670 3.365   1.00 10.90 ? 17   TYR B N   1 
ATOM   393 C CA  . TYR B 1 18 ? 29.239 23.879 4.210   1.00 11.21 ? 17   TYR B CA  1 
ATOM   394 C C   . TYR B 1 18 ? 28.513 23.414 5.445   1.00 12.48 ? 17   TYR B C   1 
ATOM   395 O O   . TYR B 1 18 ? 28.819 23.943 6.520   1.00 13.25 ? 17   TYR B O   1 
ATOM   396 C CB  . TYR B 1 18 ? 28.418 24.846 3.375   1.00 12.50 ? 17   TYR B CB  1 
ATOM   397 C CG  . TYR B 1 18 ? 28.977 25.283 2.116   1.00 16.38 ? 17   TYR B CG  1 
ATOM   398 C CD1 . TYR B 1 18 ? 30.189 25.509 1.933   1.00 17.01 ? 17   TYR B CD1 1 
ATOM   399 C CD2 . TYR B 1 18 ? 28.036 25.617 1.047   1.00 25.56 ? 17   TYR B CD2 1 
ATOM   400 C CE1 . TYR B 1 18 ? 30.689 26.007 0.644   1.00 16.78 ? 17   TYR B CE1 1 
ATOM   401 C CE2 . TYR B 1 18 ? 28.433 26.097 -0.177  1.00 28.13 ? 17   TYR B CE2 1 
ATOM   402 C CZ  . TYR B 1 18 ? 29.763 26.195 -0.398  1.00 23.51 ? 17   TYR B CZ  1 
ATOM   403 O OH  . TYR B 1 18 ? 30.213 26.628 -1.655  1.00 24.68 ? 17   TYR B OH  1 
ATOM   404 N N   . HIS B 1 19 ? 27.593 22.454 5.323   1.00 12.56 ? 18   HIS B N   1 
ATOM   405 C CA  . HIS B 1 19 ? 26.845 21.946 6.491   1.00 13.55 ? 18   HIS B CA  1 
ATOM   406 C C   . HIS B 1 19 ? 27.841 21.345 7.481   1.00 14.54 ? 18   HIS B C   1 
ATOM   407 O O   . HIS B 1 19 ? 27.828 21.604 8.677   1.00 13.80 ? 18   HIS B O   1 
ATOM   408 C CB  . HIS B 1 19 ? 25.850 20.960 6.079   1.00 16.18 ? 18   HIS B CB  1 
ATOM   409 C CG  . HIS B 1 19 ? 25.154 20.262 7.239   1.00 15.15 ? 18   HIS B CG  1 
ATOM   410 N ND1 . HIS B 1 19 ? 24.269 20.901 8.090   1.00 19.78 ? 18   HIS B ND1 1 
ATOM   411 C CD2 . HIS B 1 19 ? 25.359 19.033 7.740   1.00 19.67 ? 18   HIS B CD2 1 
ATOM   412 C CE1 . HIS B 1 19 ? 23.827 20.000 8.978   1.00 17.46 ? 18   HIS B CE1 1 
ATOM   413 N NE2 . HIS B 1 19 ? 24.577 18.908 8.883   1.00 20.93 ? 18   HIS B NE2 1 
ATOM   414 N N   . ILE B 1 20 ? 28.791 20.562 7.018   1.00 12.85 ? 19   ILE B N   1 
ATOM   415 C CA  . ILE B 1 20 ? 29.798 20.003 7.904   1.00 11.78 ? 19   ILE B CA  1 
ATOM   416 C C   . ILE B 1 20 ? 30.632 21.002 8.653   1.00 12.39 ? 19   ILE B C   1 
ATOM   417 O O   . ILE B 1 20 ? 30.895 20.893 9.866   1.00 12.25 ? 19   ILE B O   1 
ATOM   418 C CB  . ILE B 1 20 ? 30.692 19.008 7.090   1.00 10.71 ? 19   ILE B CB  1 
ATOM   419 C CG1 . ILE B 1 20 ? 29.884 17.755 6.803   1.00 11.84 ? 19   ILE B CG1 1 
ATOM   420 C CG2 . ILE B 1 20 ? 31.996 18.699 7.721   1.00 14.75 ? 19   ILE B CG2 1 
ATOM   421 C CD1 . ILE B 1 20 ? 30.478 16.952 5.631   1.00 14.27 ? 19   ILE B CD1 1 
ATOM   422 N N   . CYS B 1 21 ? 30.997 22.050 7.914   1.00 10.99 ? 20   CYS B N   1 
ATOM   423 C CA  . CYS B 1 21 ? 31.760 23.172 8.492   1.00 10.74 ? 20   CYS B CA  1 
ATOM   424 C C   . CYS B 1 21 ? 30.902 23.781 9.628   1.00 13.52 ? 20   CYS B C   1 
ATOM   425 O O   . CYS B 1 21 ? 31.431 24.050 10.730  1.00 15.54 ? 20   CYS B O   1 
ATOM   426 C CB  . CYS B 1 21 ? 32.184 24.238 7.497   1.00 11.67 ? 20   CYS B CB  1 
ATOM   427 S SG  . CYS B 1 21 ? 33.478 23.656 6.386   1.00 14.84 ? 20   CYS B SG  1 
ATOM   428 N N   . ASN B 1 22 ? 29.629 24.043 9.359   1.00 13.67 ? 21   ASN B N   1 
ATOM   429 C CA  . ASN B 1 22 ? 28.753 24.671 10.435  1.00 12.39 ? 21   ASN B CA  1 
ATOM   430 C C   . ASN B 1 22 ? 28.723 23.722 11.593  1.00 11.99 ? 21   ASN B C   1 
ATOM   431 O O   . ASN B 1 22 ? 28.662 24.213 12.752  1.00 16.02 ? 21   ASN B O   1 
ATOM   432 C CB  . ASN B 1 22 ? 27.410 24.916 9.822   1.00 14.11 ? 21   ASN B CB  1 
ATOM   433 C CG  . ASN B 1 22 ? 27.382 26.057 8.836   1.00 18.80 ? 21   ASN B CG  1 
ATOM   434 O OD1 . ASN B 1 22 ? 28.125 26.973 8.954   1.00 20.59 ? 21   ASN B OD1 1 
ATOM   435 N ND2 . ASN B 1 22 ? 26.523 25.982 7.829   1.00 21.91 ? 21   ASN B ND2 1 
ATOM   436 N N   . GLU B 1 23 ? 28.574 22.435 11.420  1.00 12.64 ? 22   GLU B N   1 
ATOM   437 C CA  . GLU B 1 23 ? 28.504 21.470 12.550  1.00 13.70 ? 22   GLU B CA  1 
ATOM   438 C C   . GLU B 1 23 ? 29.783 21.438 13.282  1.00 14.32 ? 22   GLU B C   1 
ATOM   439 O O   . GLU B 1 23 ? 29.818 21.372 14.527  1.00 15.29 ? 22   GLU B O   1 
ATOM   440 C CB  . GLU B 1 23 ? 28.150 20.113 12.078  1.00 16.00 ? 22   GLU B CB  1 
ATOM   441 C CG  . GLU B 1 23 ? 26.809 19.950 11.414  1.00 15.38 ? 22   GLU B CG  1 
ATOM   442 C CD  . GLU B 1 23 ? 25.676 19.756 12.423  1.00 31.47 ? 22   GLU B CD  1 
ATOM   443 O OE1 . GLU B 1 23 ? 25.652 20.125 13.660  1.00 33.34 ? 22   GLU B OE1 1 
ATOM   444 O OE2 . GLU B 1 23 ? 24.772 18.971 12.004  1.00 52.06 ? 22   GLU B OE2 1 
ATOM   445 N N   . LEU B 1 24 ? 30.948 21.509 12.627  1.00 14.07 ? 23   LEU B N   1 
ATOM   446 C CA  . LEU B 1 24 ? 32.235 21.440 13.327  1.00 12.59 ? 23   LEU B CA  1 
ATOM   447 C C   . LEU B 1 24 ? 32.447 22.751 14.087  1.00 14.56 ? 23   LEU B C   1 
ATOM   448 O O   . LEU B 1 24 ? 33.034 22.785 15.128  1.00 14.67 ? 23   LEU B O   1 
ATOM   449 C CB  . LEU B 1 24 ? 33.386 21.272 12.262  1.00 12.87 ? 23   LEU B CB  1 
ATOM   450 C CG  . LEU B 1 24 ? 33.475 19.912 11.739  1.00 11.73 ? 23   LEU B CG  1 
ATOM   451 C CD1 . LEU B 1 24 ? 34.521 19.919 10.630  1.00 14.82 ? 23   LEU B CD1 1 
ATOM   452 C CD2 . LEU B 1 24 ? 33.904 18.893 12.679  1.00 15.05 ? 23   LEU B CD2 1 
ATOM   453 N N   . ALA B 1 25 ? 31.970 23.874 13.566  1.00 14.33 ? 24   ALA B N   1 
ATOM   454 C CA  . ALA B 1 25 ? 32.051 25.238 14.215  1.00 14.10 ? 24   ALA B CA  1 
ATOM   455 C C   . ALA B 1 25 ? 31.214 25.167 15.481  1.00 15.64 ? 24   ALA B C   1 
ATOM   456 O O   . ALA B 1 25 ? 31.698 25.708 16.521  1.00 17.14 ? 24   ALA B O   1 
ATOM   457 C CB  . ALA B 1 25 ? 31.628 26.329 13.272  1.00 14.30 ? 24   ALA B CB  1 
ATOM   458 N N   . ARG B 1 26 ? 30.111 24.501 15.431  1.00 15.17 ? 25   ARG B N   1 
ATOM   459 C CA  . ARG B 1 26 ? 29.121 24.344 16.572  1.00 16.85 ? 25   ARG B CA  1 
ATOM   460 C C   . ARG B 1 26 ? 29.851 23.519 17.626  1.00 18.46 ? 25   ARG B C   1 
ATOM   461 O O   . ARG B 1 26 ? 29.827 23.858 18.838  1.00 21.03 ? 25   ARG B O   1 
ATOM   462 C CB  . ARG B 1 26 ? 27.874 23.784 16.119  1.00 20.06 ? 25   ARG B CB  1 
ATOM   463 C CG  . ARG B 1 26 ? 26.988 23.509 17.276  1.00 27.82 ? 25   ARG B CG  1 
ATOM   464 N N   . ILE B 1 27 ? 30.516 22.433 17.276  1.00 18.45 ? 26   ILE B N   1 
ATOM   465 C CA  . ILE B 1 27 ? 31.326 21.652 18.215  1.00 17.65 ? 26   ILE B CA  1 
ATOM   466 C C   . ILE B 1 27 ? 32.392 22.494 18.831  1.00 18.59 ? 26   ILE B C   1 
ATOM   467 O O   . ILE B 1 27 ? 32.683 22.425 20.036  1.00 19.29 ? 26   ILE B O   1 
ATOM   468 C CB  . ILE B 1 27 ? 31.871 20.395 17.528  1.00 17.46 ? 26   ILE B CB  1 
ATOM   469 C CG1 . ILE B 1 27 ? 30.752 19.485 17.092  1.00 18.58 ? 26   ILE B CG1 1 
ATOM   470 C CG2 . ILE B 1 27 ? 32.801 19.714 18.438  1.00 20.93 ? 26   ILE B CG2 1 
ATOM   471 C CD1 . ILE B 1 27 ? 31.311 18.258 16.268  1.00 21.65 ? 26   ILE B CD1 1 
ATOM   472 N N   . LYS B 1 28 ? 33.163 23.183 18.046  1.00 16.90 ? 27   LYS B N   1 
ATOM   473 C CA  . LYS B 1 28 ? 34.224 24.034 18.519  1.00 19.13 ? 27   LYS B CA  1 
ATOM   474 C C   . LYS B 1 28 ? 33.669 24.979 19.571  1.00 20.44 ? 27   LYS B C   1 
ATOM   475 O O   . LYS B 1 28 ? 34.452 25.205 20.574  1.00 21.99 ? 27   LYS B O   1 
ATOM   476 C CB  . LYS B 1 28 ? 34.923 24.809 17.406  1.00 20.65 ? 27   LYS B CB  1 
ATOM   477 C CG  . LYS B 1 28 ? 36.176 25.527 17.933  1.00 26.95 ? 27   LYS B CG  1 
ATOM   478 C CD  . LYS B 1 28 ? 36.865 26.270 17.012  1.00 28.29 ? 27   LYS B CD  1 
ATOM   479 C CE  . LYS B 1 28 ? 37.901 27.271 17.699  1.00 30.01 ? 27   LYS B CE  1 
ATOM   480 N NZ  . LYS B 1 28 ? 37.983 28.387 16.672  1.00 37.71 ? 27   LYS B NZ  1 
ATOM   481 N N   . LYS B 1 29 ? 32.530 25.585 19.310  1.00 21.95 ? 28   LYS B N   1 
ATOM   482 C CA  . LYS B 1 29 ? 31.946 26.579 20.296  1.00 24.61 ? 28   LYS B CA  1 
ATOM   483 C C   . LYS B 1 29 ? 31.659 25.788 21.598  1.00 23.08 ? 28   LYS B C   1 
ATOM   484 O O   . LYS B 1 29 ? 31.957 26.308 22.686  1.00 28.74 ? 28   LYS B O   1 
ATOM   485 C CB  . LYS B 1 29 ? 30.708 27.155 19.644  1.00 24.10 ? 28   LYS B CB  1 
ATOM   486 C CG  . LYS B 1 29 ? 29.785 28.203 20.452  1.00 26.34 ? 28   LYS B CG  1 
ATOM   487 N N   . LEU B 1 30 ? 31.078 24.611 21.528  1.00 24.56 ? 29   LEU B N   1 
ATOM   488 C CA  . LEU B 1 30 ? 30.684 23.828 22.698  1.00 23.93 ? 29   LEU B CA  1 
ATOM   489 C C   . LEU B 1 30 ? 32.032 23.480 23.443  1.00 27.02 ? 29   LEU B C   1 
ATOM   490 O O   . LEU B 1 30 ? 32.141 23.688 24.698  1.00 29.79 ? 29   LEU B O   1 
ATOM   491 C CB  . LEU B 1 30 ? 29.857 22.702 22.198  1.00 25.59 ? 29   LEU B CB  1 
ATOM   492 C CG  . LEU B 1 30 ? 28.378 22.426 22.076  1.00 25.94 ? 29   LEU B CG  1 
ATOM   493 C CD1 . LEU B 1 30 ? 27.621 23.549 22.794  1.00 33.26 ? 29   LEU B CD1 1 
ATOM   494 C CD2 . LEU B 1 30 ? 27.710 21.968 20.857  1.00 31.81 ? 29   LEU B CD2 1 
ATOM   495 N N   . LEU B 1 31 ? 33.129 23.159 22.781  1.00 27.62 ? 30   LEU B N   1 
ATOM   496 C CA  . LEU B 1 31 ? 34.421 22.904 23.454  1.00 28.40 ? 30   LEU B CA  1 
ATOM   497 C C   . LEU B 1 31 ? 35.016 24.164 24.100  1.00 32.47 ? 30   LEU B C   1 
ATOM   498 O O   . LEU B 1 31 ? 35.760 24.066 25.056  1.00 34.04 ? 30   LEU B O   1 
ATOM   499 C CB  . LEU B 1 31 ? 35.498 22.310 22.545  1.00 28.00 ? 30   LEU B CB  1 
ATOM   500 C CG  . LEU B 1 31 ? 34.973 20.880 22.248  1.00 25.38 ? 30   LEU B CG  1 
ATOM   501 C CD1 . LEU B 1 31 ? 36.038 20.404 21.330  1.00 27.70 ? 30   LEU B CD1 1 
ATOM   502 C CD2 . LEU B 1 31 ? 34.724 19.938 23.414  1.00 34.00 ? 30   LEU B CD2 1 
ATOM   503 N N   . GLY B 1 32 ? 34.720 25.322 23.556  1.00 32.29 ? 31   GLY B N   1 
ATOM   504 C CA  . GLY B 1 32 ? 35.194 26.573 24.169  1.00 35.44 ? 31   GLY B CA  1 
ATOM   505 C C   . GLY B 1 32 ? 34.360 26.903 25.399  1.00 36.24 ? 31   GLY B C   1 
ATOM   506 O O   . GLY B 1 32 ? 34.765 27.719 26.213  1.00 40.38 ? 31   GLY B O   1 
ATOM   507 N N   . GLU B 1 33 ? 33.213 26.288 25.535  1.00 38.92 ? 32   GLU B N   1 
ATOM   508 C CA  . GLU B 1 33 ? 32.373 26.411 26.719  1.00 41.47 ? 32   GLU B CA  1 
ATOM   509 C C   . GLU B 1 33 ? 32.700 25.334 27.780  1.00 42.15 ? 32   GLU B C   1 
ATOM   510 O O   . GLU B 1 33 ? 31.943 25.195 28.724  1.00 45.16 ? 32   GLU B O   1 
ATOM   511 C CB  . GLU B 1 33 ? 30.923 26.343 26.320  1.00 41.55 ? 32   GLU B CB  1 
ATOM   512 C CG  . GLU B 1 33 ? 30.547 27.527 25.449  1.00 44.47 ? 32   GLU B CG  1 
ATOM   513 C CD  . GLU B 1 33 ? 29.134 27.468 24.919  1.00 47.50 ? 32   GLU B CD  1 
ATOM   514 O OE1 . GLU B 1 33 ? 28.423 26.459 24.994  1.00 46.24 ? 32   GLU B OE1 1 
ATOM   515 O OE2 . GLU B 1 33 ? 28.745 28.518 24.404  1.00 47.85 ? 32   GLU B OE2 1 
ATOM   516 N N   . ARG B 1 34 ? 33.881 24.701 27.674  1.00 42.75 ? 33   ARG B N   1 
ATOM   517 C CA  . ARG B 1 34 ? 34.215 23.542 28.479  1.00 42.57 ? 33   ARG B CA  1 
ATOM   518 C C   . ARG B 1 34 ? 34.129 24.039 29.895  1.00 42.60 ? 33   ARG B C   1 
ATOM   519 O O   . ARG B 1 34 ? 33.753 23.376 30.848  1.00 45.19 ? 33   ARG B O   1 
ATOM   520 O OXT . ARG B 1 34 ? 34.483 25.126 30.222  1.00 39.33 ? 33   ARG B OXT 1 
HETATM 521 O O   . HOH C 2 .  ? 25.878 19.442 24.898  1.00 50.94 ? 2001 HOH A O   1 
HETATM 522 O O   . HOH C 2 .  ? 20.888 12.017 22.926  1.00 47.35 ? 2002 HOH A O   1 
HETATM 523 O O   . HOH C 2 .  ? 24.957 14.350 18.288  1.00 30.67 ? 2003 HOH A O   1 
HETATM 524 O O   . HOH C 2 .  ? 22.773 11.563 23.195  1.00 44.78 ? 2004 HOH A O   1 
HETATM 525 O O   . HOH C 2 .  ? 32.346 11.010 24.961  1.00 50.11 ? 2005 HOH A O   1 
HETATM 526 O O   . HOH C 2 .  ? 23.628 10.034 14.104  1.00 39.51 ? 2006 HOH A O   1 
HETATM 527 O O   . HOH C 2 .  ? 29.821 7.906  19.120  1.00 36.39 ? 2007 HOH A O   1 
HETATM 528 O O   . HOH C 2 .  ? 23.845 11.920 19.940  1.00 38.94 ? 2008 HOH A O   1 
HETATM 529 O O   . HOH C 2 .  ? 25.719 11.779 1.305   1.00 33.15 ? 2009 HOH A O   1 
HETATM 530 O O   . HOH C 2 .  ? 26.668 9.013  15.444  1.00 22.98 ? 2010 HOH A O   1 
HETATM 531 O O   . HOH C 2 .  ? 31.276 6.993  10.601  1.00 26.28 ? 2011 HOH A O   1 
HETATM 532 O O   . HOH C 2 .  ? 29.938 3.811  12.216  1.00 32.96 ? 2012 HOH A O   1 
HETATM 533 O O   . HOH C 2 .  ? 32.746 5.212  -9.980  1.00 33.69 ? 2013 HOH A O   1 
HETATM 534 O O   . HOH C 2 .  ? 24.957 12.899 15.914  1.00 33.94 ? 2014 HOH A O   1 
HETATM 535 O O   . HOH C 2 .  ? 26.115 9.328  6.615   1.00 23.83 ? 2015 HOH A O   1 
HETATM 536 O O   . HOH C 2 .  ? 27.766 13.260 2.598   1.00 21.95 ? 2016 HOH A O   1 
HETATM 537 O O   . HOH C 2 .  ? 33.708 6.413  11.477  1.00 39.68 ? 2017 HOH A O   1 
HETATM 538 O O   . HOH C 2 .  ? 35.438 6.989  1.782   1.00 35.36 ? 2018 HOH A O   1 
HETATM 539 O O   . HOH C 2 .  ? 38.505 8.068  9.948   1.00 38.06 ? 2019 HOH A O   1 
HETATM 540 O O   . HOH C 2 .  ? 29.470 5.933  0.060   0.50 36.71 ? 2020 HOH A O   1 
HETATM 541 O O   . HOH C 2 .  ? 28.431 5.630  5.618   1.00 40.53 ? 2021 HOH A O   1 
HETATM 542 O O   . HOH C 2 .  ? 33.730 5.939  -5.662  1.00 27.14 ? 2022 HOH A O   1 
HETATM 543 O O   . HOH C 2 .  ? 30.738 5.471  3.076   1.00 53.90 ? 2023 HOH A O   1 
HETATM 544 O O   . HOH C 2 .  ? 38.818 7.676  -8.979  1.00 24.49 ? 2024 HOH A O   1 
HETATM 545 O O   . HOH C 2 .  ? 34.614 5.691  -8.172  1.00 34.33 ? 2025 HOH A O   1 
HETATM 546 O O   . HOH C 2 .  ? 25.067 12.482 -10.080 1.00 32.99 ? 2026 HOH A O   1 
HETATM 547 O O   . HOH C 2 .  ? 42.870 10.538 -10.715 1.00 46.11 ? 2027 HOH A O   1 
HETATM 548 O O   . HOH C 2 .  ? 40.291 8.221  -6.387  1.00 47.64 ? 2028 HOH A O   1 
HETATM 549 O O   . HOH C 2 .  ? 38.750 7.228  -15.648 1.00 38.63 ? 2029 HOH A O   1 
HETATM 550 O O   . HOH C 2 .  ? 41.725 8.195  -21.088 1.00 46.56 ? 2030 HOH A O   1 
HETATM 551 O O   . HOH C 2 .  ? 35.735 11.053 -23.974 1.00 48.38 ? 2031 HOH A O   1 
HETATM 552 O O   . HOH C 2 .  ? 41.130 12.783 -18.843 1.00 30.30 ? 2032 HOH A O   1 
HETATM 553 O O   . HOH D 2 .  ? 25.288 15.897 -18.121 1.00 42.10 ? 2001 HOH B O   1 
HETATM 554 O O   . HOH D 2 .  ? 30.274 5.220  -16.788 1.00 36.06 ? 2002 HOH B O   1 
HETATM 555 O O   . HOH D 2 .  ? 28.513 12.658 -15.930 1.00 40.52 ? 2003 HOH B O   1 
HETATM 556 O O   . HOH D 2 .  ? 26.667 18.600 -19.926 1.00 28.09 ? 2004 HOH B O   1 
HETATM 557 O O   . HOH D 2 .  ? 24.396 12.425 -17.243 1.00 39.70 ? 2005 HOH B O   1 
HETATM 558 O O   . HOH D 2 .  ? 24.525 15.095 -10.183 1.00 26.69 ? 2006 HOH B O   1 
HETATM 559 O O   . HOH D 2 .  ? 23.568 15.068 -16.539 1.00 39.51 ? 2007 HOH B O   1 
HETATM 560 O O   . HOH D 2 .  ? 24.957 24.425 -14.828 1.00 40.48 ? 2008 HOH B O   1 
HETATM 561 O O   . HOH D 2 .  ? 26.008 11.393 -1.648  1.00 30.46 ? 2009 HOH B O   1 
HETATM 562 O O   . HOH D 2 .  ? 28.310 13.154 -2.477  1.00 25.12 ? 2010 HOH B O   1 
HETATM 563 O O   . HOH D 2 .  ? 27.349 13.496 -0.875  1.00 28.03 ? 2011 HOH B O   1 
HETATM 564 O O   . HOH D 2 .  ? 27.155 24.542 -16.906 1.00 34.57 ? 2012 HOH B O   1 
HETATM 565 O O   . HOH D 2 .  ? 29.540 24.751 -13.357 1.00 30.78 ? 2013 HOH B O   1 
HETATM 566 O O   . HOH D 2 .  ? 30.824 31.026 18.884  1.00 37.78 ? 2014 HOH B O   1 
HETATM 567 O O   . HOH D 2 .  ? 22.456 16.830 -14.085 1.00 46.75 ? 2015 HOH B O   1 
HETATM 568 O O   . HOH D 2 .  ? 25.493 23.401 -10.599 1.00 41.37 ? 2016 HOH B O   1 
HETATM 569 O O   . HOH D 2 .  ? 20.913 22.118 -12.080 1.00 36.11 ? 2017 HOH B O   1 
HETATM 570 O O   . HOH D 2 .  ? 23.987 18.433 4.450   1.00 32.47 ? 2018 HOH B O   1 
HETATM 571 O O   . HOH D 2 .  ? 26.153 15.039 3.890   1.00 22.36 ? 2019 HOH B O   1 
HETATM 572 O O   . HOH D 2 .  ? 26.567 11.729 -3.530  1.00 23.69 ? 2020 HOH B O   1 
HETATM 573 O O   . HOH D 2 .  ? 22.121 11.127 -4.726  1.00 32.07 ? 2021 HOH B O   1 
HETATM 574 O O   . HOH D 2 .  ? 23.985 11.073 -7.715  1.00 29.19 ? 2022 HOH B O   1 
HETATM 575 O O   . HOH D 2 .  ? 24.624 9.674  -4.487  1.00 28.98 ? 2023 HOH B O   1 
HETATM 576 O O   . HOH D 2 .  ? 27.672 27.367 16.041  1.00 45.70 ? 2024 HOH B O   1 
HETATM 577 O O   . HOH D 2 .  ? 32.956 27.511 5.847   1.00 53.29 ? 2025 HOH B O   1 
HETATM 578 O O   . HOH D 2 .  ? 26.372 20.340 18.282  1.00 43.85 ? 2026 HOH B O   1 
HETATM 579 O O   . HOH D 2 .  ? 27.424 18.312 18.594  1.00 43.81 ? 2027 HOH B O   1 
HETATM 580 O O   . HOH D 2 .  ? 26.304 24.583 -3.102  1.00 19.05 ? 2028 HOH B O   1 
HETATM 581 O O   . HOH D 2 .  ? 23.082 24.360 -10.478 1.00 34.42 ? 2029 HOH B O   1 
HETATM 582 O O   . HOH D 2 .  ? 34.276 28.465 14.217  1.00 39.46 ? 2030 HOH B O   1 
HETATM 583 O O   . HOH D 2 .  ? 23.697 16.252 -7.597  1.00 29.79 ? 2031 HOH B O   1 
HETATM 584 O O   . HOH D 2 .  ? 22.906 12.459 -2.315  1.00 36.39 ? 2032 HOH B O   1 
HETATM 585 O O   . HOH D 2 .  ? 29.517 31.992 21.256  1.00 38.99 ? 2033 HOH B O   1 
HETATM 586 O O   . HOH D 2 .  ? 23.516 19.955 2.107   1.00 29.14 ? 2034 HOH B O   1 
HETATM 587 O O   . HOH D 2 .  ? 22.250 22.517 3.505   1.00 41.78 ? 2035 HOH B O   1 
HETATM 588 O O   . HOH D 2 .  ? 24.540 23.563 3.508   1.00 20.62 ? 2036 HOH B O   1 
HETATM 589 O O   . HOH D 2 .  ? 26.554 17.343 5.209   1.00 19.01 ? 2037 HOH B O   1 
HETATM 590 O O   . HOH D 2 .  ? 28.280 26.485 -3.510  1.00 25.84 ? 2038 HOH B O   1 
HETATM 591 O O   . HOH D 2 .  ? 32.950 27.248 -2.039  1.00 24.83 ? 2039 HOH B O   1 
HETATM 592 O O   . HOH D 2 .  ? 27.421 17.822 10.085  1.00 38.07 ? 2040 HOH B O   1 
HETATM 593 O O   . HOH D 2 .  ? 30.039 26.894 6.497   1.00 34.36 ? 2041 HOH B O   1 
HETATM 594 O O   . HOH D 2 .  ? 25.754 27.673 5.685   1.00 33.44 ? 2042 HOH B O   1 
HETATM 595 O O   . HOH D 2 .  ? 27.881 26.769 13.449  1.00 28.52 ? 2043 HOH B O   1 
HETATM 596 O O   . HOH D 2 .  ? 24.277 16.931 10.975  1.00 31.24 ? 2044 HOH B O   1 
HETATM 597 O O   . HOH D 2 .  ? 27.426 19.996 15.574  1.00 27.75 ? 2045 HOH B O   1 
HETATM 598 O O   . HOH D 2 .  ? 23.685 20.289 15.273  1.00 47.15 ? 2046 HOH B O   1 
HETATM 599 O O   . HOH D 2 .  ? 33.031 28.054 16.458  1.00 25.14 ? 2047 HOH B O   1 
HETATM 600 O O   . HOH D 2 .  ? 27.516 25.038 19.843  1.00 42.81 ? 2048 HOH B O   1 
HETATM 601 O O   . HOH D 2 .  ? 37.158 28.247 14.049  1.00 30.44 ? 2049 HOH B O   1 
HETATM 602 O O   . HOH D 2 .  ? 32.586 28.900 22.884  1.00 37.50 ? 2050 HOH B O   1 
HETATM 603 O O   . HOH D 2 .  ? 30.602 30.315 23.339  1.00 34.07 ? 2051 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ACE 1  0  ?  ?   ?   A . n 
A 1 2  ARG 2  1  1  ARG ARG A . n 
A 1 3  MET 3  2  2  MET MET A . n 
A 1 4  LYS 4  3  3  LYS LYS A . n 
A 1 5  GLN 5  4  4  GLN GLN A . n 
A 1 6  ILE 6  5  5  ILE ILE A . n 
A 1 7  GLU 7  6  6  GLU GLU A . n 
A 1 8  ASP 8  7  7  ASP ASP A . n 
A 1 9  LYS 9  8  8  LYS LYS A . n 
A 1 10 LEU 10 9  9  LEU LEU A . n 
A 1 11 GLU 11 10 10 GLU GLU A . n 
A 1 12 GLU 12 11 11 GLU GLU A . n 
A 1 13 ILE 13 12 12 ILE ILE A . n 
A 1 14 LEU 14 13 13 LEU LEU A . n 
A 1 15 SER 15 14 14 SER SER A . n 
A 1 16 LYS 16 15 15 LYS LYS A . n 
A 1 17 LEU 17 16 16 LEU LEU A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 HIS 19 18 18 HIS HIS A . n 
A 1 20 ILE 20 19 19 ILE ILE A . n 
A 1 21 CYS 21 20 20 CYS CYS A . n 
A 1 22 ASN 22 21 21 ASN ASN A . n 
A 1 23 GLU 23 22 22 GLU GLU A . n 
A 1 24 LEU 24 23 23 LEU LEU A . n 
A 1 25 ALA 25 24 24 ALA ALA A . n 
A 1 26 ARG 26 25 25 ARG ARG A . n 
A 1 27 ILE 27 26 26 ILE ILE A . n 
A 1 28 LYS 28 27 27 LYS LYS A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LEU 30 29 29 LEU LEU A . n 
A 1 31 LEU 31 30 30 LEU LEU A . n 
A 1 32 GLY 32 31 31 GLY GLY A . n 
A 1 33 GLU 33 32 32 GLU GLU A . n 
A 1 34 ARG 34 33 33 ARG ARG A . n 
B 1 1  ACE 1  0  ?  ?   ?   B . n 
B 1 2  ARG 2  1  1  ARG ARG B . n 
B 1 3  MET 3  2  2  MET MET B . n 
B 1 4  LYS 4  3  3  LYS LYS B . n 
B 1 5  GLN 5  4  4  GLN GLN B . n 
B 1 6  ILE 6  5  5  ILE ILE B . n 
B 1 7  GLU 7  6  6  GLU GLU B . n 
B 1 8  ASP 8  7  7  ASP ASP B . n 
B 1 9  LYS 9  8  8  LYS LYS B . n 
B 1 10 LEU 10 9  9  LEU LEU B . n 
B 1 11 GLU 11 10 10 GLU GLU B . n 
B 1 12 GLU 12 11 11 GLU GLU B . n 
B 1 13 ILE 13 12 12 ILE ILE B . n 
B 1 14 LEU 14 13 13 LEU LEU B . n 
B 1 15 SER 15 14 14 SER SER B . n 
B 1 16 LYS 16 15 15 LYS LYS B . n 
B 1 17 LEU 17 16 16 LEU LEU B . n 
B 1 18 TYR 18 17 17 TYR TYR B . n 
B 1 19 HIS 19 18 18 HIS HIS B . n 
B 1 20 ILE 20 19 19 ILE ILE B . n 
B 1 21 CYS 21 20 20 CYS CYS B . n 
B 1 22 ASN 22 21 21 ASN ASN B . n 
B 1 23 GLU 23 22 22 GLU GLU B . n 
B 1 24 LEU 24 23 23 LEU LEU B . n 
B 1 25 ALA 25 24 24 ALA ALA B . n 
B 1 26 ARG 26 25 25 ARG ARG B . n 
B 1 27 ILE 27 26 26 ILE ILE B . n 
B 1 28 LYS 28 27 27 LYS LYS B . n 
B 1 29 LYS 29 28 28 LYS LYS B . n 
B 1 30 LEU 30 29 29 LEU LEU B . n 
B 1 31 LEU 31 30 30 LEU LEU B . n 
B 1 32 GLY 32 31 31 GLY GLY B . n 
B 1 33 GLU 33 32 32 GLU GLU B . n 
B 1 34 ARG 34 33 33 ARG ARG B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  2001 2001 HOH HOH A . 
C 2 HOH 2  2002 2002 HOH HOH A . 
C 2 HOH 3  2003 2003 HOH HOH A . 
C 2 HOH 4  2004 2004 HOH HOH A . 
C 2 HOH 5  2005 2005 HOH HOH A . 
C 2 HOH 6  2006 2006 HOH HOH A . 
C 2 HOH 7  2007 2007 HOH HOH A . 
C 2 HOH 8  2008 2008 HOH HOH A . 
C 2 HOH 9  2009 2009 HOH HOH A . 
C 2 HOH 10 2010 2010 HOH HOH A . 
C 2 HOH 11 2011 2011 HOH HOH A . 
C 2 HOH 12 2012 2012 HOH HOH A . 
C 2 HOH 13 2013 2013 HOH HOH A . 
C 2 HOH 14 2014 2014 HOH HOH A . 
C 2 HOH 15 2015 2015 HOH HOH A . 
C 2 HOH 16 2016 2016 HOH HOH A . 
C 2 HOH 17 2017 2017 HOH HOH A . 
C 2 HOH 18 2018 2018 HOH HOH A . 
C 2 HOH 19 2019 2019 HOH HOH A . 
C 2 HOH 20 2020 2020 HOH HOH A . 
C 2 HOH 21 2021 2021 HOH HOH A . 
C 2 HOH 22 2022 2022 HOH HOH A . 
C 2 HOH 23 2023 2023 HOH HOH A . 
C 2 HOH 24 2024 2024 HOH HOH A . 
C 2 HOH 25 2025 2025 HOH HOH A . 
C 2 HOH 26 2026 2026 HOH HOH A . 
C 2 HOH 27 2027 2027 HOH HOH A . 
C 2 HOH 28 2028 2028 HOH HOH A . 
C 2 HOH 29 2029 2029 HOH HOH A . 
C 2 HOH 30 2030 2030 HOH HOH A . 
C 2 HOH 31 2031 2031 HOH HOH A . 
C 2 HOH 32 2032 2032 HOH HOH A . 
D 2 HOH 1  2001 2001 HOH HOH B . 
D 2 HOH 2  2002 2002 HOH HOH B . 
D 2 HOH 3  2003 2003 HOH HOH B . 
D 2 HOH 4  2004 2004 HOH HOH B . 
D 2 HOH 5  2005 2005 HOH HOH B . 
D 2 HOH 6  2006 2006 HOH HOH B . 
D 2 HOH 7  2007 2007 HOH HOH B . 
D 2 HOH 8  2008 2008 HOH HOH B . 
D 2 HOH 9  2009 2009 HOH HOH B . 
D 2 HOH 10 2010 2010 HOH HOH B . 
D 2 HOH 11 2011 2011 HOH HOH B . 
D 2 HOH 12 2012 2012 HOH HOH B . 
D 2 HOH 13 2013 2013 HOH HOH B . 
D 2 HOH 14 2014 2014 HOH HOH B . 
D 2 HOH 15 2015 2015 HOH HOH B . 
D 2 HOH 16 2016 2016 HOH HOH B . 
D 2 HOH 17 2017 2017 HOH HOH B . 
D 2 HOH 18 2018 2018 HOH HOH B . 
D 2 HOH 19 2019 2019 HOH HOH B . 
D 2 HOH 20 2020 2020 HOH HOH B . 
D 2 HOH 21 2021 2021 HOH HOH B . 
D 2 HOH 22 2022 2022 HOH HOH B . 
D 2 HOH 23 2023 2023 HOH HOH B . 
D 2 HOH 24 2024 2024 HOH HOH B . 
D 2 HOH 25 2025 2025 HOH HOH B . 
D 2 HOH 26 2026 2026 HOH HOH B . 
D 2 HOH 27 2027 2027 HOH HOH B . 
D 2 HOH 28 2028 2028 HOH HOH B . 
D 2 HOH 29 2029 2029 HOH HOH B . 
D 2 HOH 30 2030 2030 HOH HOH B . 
D 2 HOH 31 2031 2031 HOH HOH B . 
D 2 HOH 32 2032 2032 HOH HOH B . 
D 2 HOH 33 2033 2033 HOH HOH B . 
D 2 HOH 34 2034 2034 HOH HOH B . 
D 2 HOH 35 2035 2035 HOH HOH B . 
D 2 HOH 36 2036 2036 HOH HOH B . 
D 2 HOH 37 2037 2037 HOH HOH B . 
D 2 HOH 38 2038 2038 HOH HOH B . 
D 2 HOH 39 2039 2039 HOH HOH B . 
D 2 HOH 40 2040 2040 HOH HOH B . 
D 2 HOH 41 2041 2041 HOH HOH B . 
D 2 HOH 42 2042 2042 HOH HOH B . 
D 2 HOH 43 2043 2043 HOH HOH B . 
D 2 HOH 44 2044 2044 HOH HOH B . 
D 2 HOH 45 2045 2045 HOH HOH B . 
D 2 HOH 46 2046 2046 HOH HOH B . 
D 2 HOH 47 2047 2047 HOH HOH B . 
D 2 HOH 48 2048 2048 HOH HOH B . 
D 2 HOH 49 2049 2049 HOH HOH B . 
D 2 HOH 50 2050 2050 HOH HOH B . 
D 2 HOH 51 2051 2051 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000  
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_765 -x+2,-y+1,z -1.0000000000 0.0000000000 0.0000000000 70.7760000000 0.0000000000 -1.0000000000 
0.0000000000 35.3840000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     2020 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-04-06 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-09-19 
5 'Structure model' 1 4 2018-11-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Source and taxonomy'       
6 4 'Structure model' 'Structure summary'         
7 5 'Structure model' 'Data collection'           
8 5 'Structure model' 'Database references'       
9 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' citation            
2  4 'Structure model' citation_author     
3  4 'Structure model' entity              
4  4 'Structure model' entity_name_com     
5  4 'Structure model' entity_src_nat      
6  4 'Structure model' pdbx_entity_src_syn 
7  4 'Structure model' struct_ref          
8  4 'Structure model' struct_ref_seq      
9  4 'Structure model' struct_ref_seq_dif  
10 5 'Structure model' audit_author        
11 5 'Structure model' citation_author     
12 5 'Structure model' struct_ref_seq_dif  
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.page_last'            
2  4 'Structure model' '_citation.pdbx_database_id_DOI' 
3  4 'Structure model' '_citation.title'                
4  4 'Structure model' '_citation_author.name'          
5  4 'Structure model' '_entity.pdbx_description'       
6  4 'Structure model' '_entity.src_method'             
7  4 'Structure model' '_entity_name_com.name'          
8  5 'Structure model' '_audit_author.name'             
9  5 'Structure model' '_citation_author.name'          
10 5 'Structure model' '_struct_ref_seq_dif.details'    
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC       refinement       5.1.24 ? 1 
CrystalClear 'data reduction' .      ? 2 
CrystalClear 'data scaling'   .      ? 3 
# 
_pdbx_entry_details.entry_id             2CCN 
_pdbx_entry_details.compound_details     
;ENGINEERED RESIDUE IN CHAIN A, GLU 268 TO CYS
ENGINEERED RESIDUE IN CHAIN B, GLU 268 TO CYS
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  B HOH 2010 ? ? O B HOH 2011 ? ? 1.90 
2 1 O  A HOH 2002 ? ? O A HOH 2004 ? ? 1.96 
3 1 O  B HOH 2009 ? ? O B HOH 2020 ? ? 1.99 
4 1 CD B ARG 1    ? ? O B HOH 2003 ? ? 2.11 
5 1 N  B ARG 1    ? ? O B HOH 2001 ? ? 2.12 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG  A MET 2  ? ? SD  A MET 2  ? ? 1.969 1.807 0.162  0.026 N 
2 1 CB  A TYR 17 ? ? CG  A TYR 17 ? ? 1.411 1.512 -0.101 0.015 N 
3 1 CG  A TYR 17 ? ? CD2 A TYR 17 ? ? 1.288 1.387 -0.099 0.013 N 
4 1 CE1 A TYR 17 ? ? CZ  A TYR 17 ? ? 1.288 1.381 -0.093 0.013 N 
5 1 CD  A GLU 32 ? ? OE1 A GLU 32 ? ? 1.328 1.252 0.076  0.011 N 
6 1 CG  B TYR 17 ? ? CD1 B TYR 17 ? ? 1.246 1.387 -0.141 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CG A MET 2  ? ? SD A MET 2  ? ? CE  A MET 2  ? ? 113.07 100.20 12.87  1.60 N 
2  1 CB A ASP 7  ? ? CG A ASP 7  ? ? OD2 A ASP 7  ? ? 112.82 118.30 -5.48  0.90 N 
3  1 CB A TYR 17 ? ? CG A TYR 17 ? ? CD1 A TYR 17 ? ? 117.28 121.00 -3.72  0.60 N 
4  1 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH1 A ARG 25 ? ? 123.51 120.30 3.21   0.50 N 
5  1 NE A ARG 25 ? ? CZ A ARG 25 ? ? NH2 A ARG 25 ? ? 117.24 120.30 -3.06  0.50 N 
6  1 CB B ASP 7  ? ? CG B ASP 7  ? ? OD2 B ASP 7  ? ? 111.28 118.30 -7.02  0.90 N 
7  1 CB B TYR 17 ? ? CG B TYR 17 ? ? CD2 B TYR 17 ? ? 117.18 121.00 -3.82  0.60 N 
8  1 CA B LEU 29 ? ? CB B LEU 29 ? ? CG  B LEU 29 ? ? 135.40 115.30 20.10  2.30 N 
9  1 CB B LEU 29 ? ? CG B LEU 29 ? ? CD2 B LEU 29 ? ? 124.87 111.00 13.87  1.70 N 
10 1 CB B LEU 30 ? ? CG B LEU 30 ? ? CD1 B LEU 30 ? ? 99.85  111.00 -11.15 1.70 N 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    HIS 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     18 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.076 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 1  ? N   ? A ARG 2  N   
2  1 Y 1 A ARG 1  ? CA  ? A ARG 2  CA  
3  1 Y 1 A ARG 1  ? CB  ? A ARG 2  CB  
4  1 Y 1 A ARG 1  ? CG  ? A ARG 2  CG  
5  1 Y 1 A ARG 1  ? CD  ? A ARG 2  CD  
6  1 Y 1 A ARG 1  ? NE  ? A ARG 2  NE  
7  1 Y 1 A ARG 1  ? CZ  ? A ARG 2  CZ  
8  1 Y 1 A ARG 1  ? NH1 ? A ARG 2  NH1 
9  1 Y 1 A ARG 1  ? NH2 ? A ARG 2  NH2 
10 1 Y 1 A LYS 3  ? CD  ? A LYS 4  CD  
11 1 Y 1 A LYS 3  ? CE  ? A LYS 4  CE  
12 1 Y 1 A LYS 3  ? NZ  ? A LYS 4  NZ  
13 1 Y 1 A GLN 4  ? CD  ? A GLN 5  CD  
14 1 Y 1 A GLN 4  ? OE1 ? A GLN 5  OE1 
15 1 Y 1 A GLN 4  ? NE2 ? A GLN 5  NE2 
16 1 Y 1 A LYS 28 ? CE  ? A LYS 29 CE  
17 1 Y 1 A LYS 28 ? NZ  ? A LYS 29 NZ  
18 1 Y 1 A ARG 33 ? CZ  ? A ARG 34 CZ  
19 1 Y 1 A ARG 33 ? NH1 ? A ARG 34 NH1 
20 1 Y 1 A ARG 33 ? NH2 ? A ARG 34 NH2 
21 1 Y 1 B LYS 3  ? NZ  ? B LYS 4  NZ  
22 1 Y 1 B GLN 4  ? CG  ? B GLN 5  CG  
23 1 Y 1 B GLN 4  ? CD  ? B GLN 5  CD  
24 1 Y 1 B GLN 4  ? OE1 ? B GLN 5  OE1 
25 1 Y 1 B GLN 4  ? NE2 ? B GLN 5  NE2 
26 1 Y 1 B ARG 25 ? CD  ? B ARG 26 CD  
27 1 Y 1 B ARG 25 ? NE  ? B ARG 26 NE  
28 1 Y 1 B ARG 25 ? CZ  ? B ARG 26 CZ  
29 1 Y 1 B ARG 25 ? NH1 ? B ARG 26 NH1 
30 1 Y 1 B ARG 25 ? NH2 ? B ARG 26 NH2 
31 1 Y 1 B LYS 28 ? CD  ? B LYS 29 CD  
32 1 Y 1 B LYS 28 ? CE  ? B LYS 29 CE  
33 1 Y 1 B LYS 28 ? NZ  ? B LYS 29 NZ  
34 1 Y 1 B ARG 33 ? CB  ? B ARG 34 CB  
35 1 Y 1 B ARG 33 ? CG  ? B ARG 34 CG  
36 1 Y 1 B ARG 33 ? CD  ? B ARG 34 CD  
37 1 Y 1 B ARG 33 ? NE  ? B ARG 34 NE  
38 1 Y 1 B ARG 33 ? CZ  ? B ARG 34 CZ  
39 1 Y 1 B ARG 33 ? NH1 ? B ARG 34 NH1 
40 1 Y 1 B ARG 33 ? NH2 ? B ARG 34 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ACE 0 ? A ACE 1 
2 1 Y 1 B ACE 0 ? B ACE 1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#