data_2CD0
# 
_entry.id   2CD0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CD0         
RCSB  RCSB000601   
WWPDB D_1000000601 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CD0 
_pdbx_database_status.recvd_initial_deposition_date   1999-03-08 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pokkuluri, P.R.' 1 
'Solomon, A.'     2 
'Weiss, D.T.'     3 
'Stevens, F.J.'   4 
'Schiffer, M.'    5 
# 
_citation.id                        primary 
_citation.title                     'Tertiary structure of human lambda 6 light chains.' 
_citation.journal_abbrev            Amyloid 
_citation.journal_volume            6 
_citation.page_first                165 
_citation.page_last                 171 
_citation.year                      1999 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1350-6129 
_citation.journal_id_CSD            9999 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10524280 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pokkuluri, P.R.' 1 
primary 'Solomon, A.'     2 
primary 'Weiss, D.T.'     3 
primary 'Stevens, F.J.'   4 
primary 'Schiffer, M.'    5 
# 
_cell.entry_id           2CD0 
_cell.length_a           147.900 
_cell.length_b           147.900 
_cell.length_c           46.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2CD0 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'PROTEIN (BENCE-JONES PROTEIN WIL, A VARIABLE DOMAIN FROM LAMBDA-6 TYPE IMMUNOGLOBULIN LIGHT CHAIN)' 12001.915 2   ? 
? 'VARIABLE DOMAIN' ? 
2 water   nat water                                                                                                18.015    112 ? 
? ?                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGVPDRFSGSVDTSSNSASLTISG
LKTEDEADYYCQSYDHNNQVFGGGTKLTVLG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;NFLLTQPHSVSESPGKTVTISCTRSSGSIANNYVHWYQQRPGSSPTTVIFEDDHRPSGVPDRFSGSVDTSSNSASLTISG
LKTEDEADYYCQSYDHNNQVFGGGTKLTVLG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASN n 
1 2   PHE n 
1 3   LEU n 
1 4   LEU n 
1 5   THR n 
1 6   GLN n 
1 7   PRO n 
1 8   HIS n 
1 9   SER n 
1 10  VAL n 
1 11  SER n 
1 12  GLU n 
1 13  SER n 
1 14  PRO n 
1 15  GLY n 
1 16  LYS n 
1 17  THR n 
1 18  VAL n 
1 19  THR n 
1 20  ILE n 
1 21  SER n 
1 22  CYS n 
1 23  THR n 
1 24  ARG n 
1 25  SER n 
1 26  SER n 
1 27  GLY n 
1 28  SER n 
1 29  ILE n 
1 30  ALA n 
1 31  ASN n 
1 32  ASN n 
1 33  TYR n 
1 34  VAL n 
1 35  HIS n 
1 36  TRP n 
1 37  TYR n 
1 38  GLN n 
1 39  GLN n 
1 40  ARG n 
1 41  PRO n 
1 42  GLY n 
1 43  SER n 
1 44  SER n 
1 45  PRO n 
1 46  THR n 
1 47  THR n 
1 48  VAL n 
1 49  ILE n 
1 50  PHE n 
1 51  GLU n 
1 52  ASP n 
1 53  ASP n 
1 54  HIS n 
1 55  ARG n 
1 56  PRO n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  PRO n 
1 61  ASP n 
1 62  ARG n 
1 63  PHE n 
1 64  SER n 
1 65  GLY n 
1 66  SER n 
1 67  VAL n 
1 68  ASP n 
1 69  THR n 
1 70  SER n 
1 71  SER n 
1 72  ASN n 
1 73  SER n 
1 74  ALA n 
1 75  SER n 
1 76  LEU n 
1 77  THR n 
1 78  ILE n 
1 79  SER n 
1 80  GLY n 
1 81  LEU n 
1 82  LYS n 
1 83  THR n 
1 84  GLU n 
1 85  ASP n 
1 86  GLU n 
1 87  ALA n 
1 88  ASP n 
1 89  TYR n 
1 90  TYR n 
1 91  CYS n 
1 92  GLN n 
1 93  SER n 
1 94  TYR n 
1 95  ASP n 
1 96  HIS n 
1 97  ASN n 
1 98  ASN n 
1 99  GLN n 
1 100 VAL n 
1 101 PHE n 
1 102 GLY n 
1 103 GLY n 
1 104 GLY n 
1 105 THR n 
1 106 LYS n 
1 107 LEU n 
1 108 THR n 
1 109 VAL n 
1 110 LEU n 
1 111 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DH5LAMBDA 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'PET-27B(+)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    Z37375 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          587410 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2CD0 A 1 ? 111 ? 587410 1 ? 111 ? 1 108 
2 1 2CD0 B 1 ? 111 ? 587410 1 ? 111 ? 1 108 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2CD0 LEU A 3  ? GB 587410 MET 3  CONFLICT 3  1  
1 2CD0 ASN A 31 ? GB 587410 SER 31 CONFLICT 30 2  
1 2CD0 HIS A 35 ? GB 587410 GLN 35 CONFLICT 34 3  
1 2CD0 SER A 44 ? GB 587410 ALA 44 CONFLICT 43 4  
1 2CD0 PHE A 50 ? GB 587410 TYR 50 CONFLICT 49 5  
1 2CD0 ASP A 53 ? GB 587410 ASN 53 CONFLICT 52 6  
1 2CD0 HIS A 54 ? GB 587410 GLN 54 CONFLICT 53 7  
1 2CD0 VAL A 67 ? GB 587410 ILE 67 CONFLICT 66 8  
1 2CD0 THR A 69 B GB 587410 SER 69 CONFLICT 66 9  
1 2CD0 HIS A 96 ? GB 587410 SER 96 CONFLICT 93 10 
1 2CD0 ASN A 97 ? GB 587410 SER 97 CONFLICT 94 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2CD0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.0 
_exptl_crystal.density_percent_sol   38.5 
_exptl_crystal.description           
;CONSTANT DOMAINS WERE ALSO REMOVED FROM MCG MODEL PRIOR TO MOLECULAR 
REPLACEMENT.
;
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_details    
;1.8M AMMONIUM SULPHATE, 0.1 M SODIUM CITRATE PH 5.6,                 
0.01 M CADMIUM CHLORIDE
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   1998-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             1.033 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2CD0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            1.70 
_reflns.number_obs                   21478 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.6 
_reflns.pdbx_Rmerge_I_obs            0.04 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        48 
_reflns.B_iso_Wilson_estimate        16.0 
_reflns.pdbx_redundancy              21.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   96.4 
_reflns_shell.Rmerge_I_obs           0.232 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    19 
_reflns_shell.pdbx_redundancy        9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2CD0 
_refine.ls_number_reflns_obs                     17271 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           1379583.80 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    96.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.289 
_refine.ls_R_factor_R_free                       0.351 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.8 
_refine.ls_number_reflns_R_free                  1689 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               25.1 
_refine.aniso_B[1][1]                            -2.28 
_refine.aniso_B[2][2]                            -2.28 
_refine.aniso_B[3][3]                            4.56 
_refine.aniso_B[1][2]                            -2.21 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.49 
_refine.solvent_model_param_bsol                 65.0 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      'MCG (1DCL): USED ONLY VL DIMER WITH CDR LOOPS DELETED.' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2CD0 
_refine_analyze.Luzzati_coordinate_error_obs    0.32 
_refine_analyze.Luzzati_sigma_a_obs             0.26 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.43 
_refine_analyze.Luzzati_sigma_a_free            0.41 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1612 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             112 
_refine_hist.number_atoms_total               1724 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.5   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.78  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.02  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            1.74  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             1.16  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            1.68  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   33 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.82 
_refine_ls_shell.number_reflns_R_work             431 
_refine_ls_shell.R_factor_R_work                  0.363 
_refine_ls_shell.percent_reflns_obs               91.1 
_refine_ls_shell.R_factor_R_free                  0.41 
_refine_ls_shell.R_factor_R_free_error            0.054 
_refine_ls_shell.percent_reflns_R_free            11.9 
_refine_ls_shell.number_reflns_R_free             58 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2CD0 
_struct.title                     'STRUCTURE OF HUMAN LAMBDA-6 LIGHT CHAIN DIMER WIL' 
_struct.pdbx_descriptor           'BENCE-JONES PROTEIN WIL (LAMBDA-6 VL-DIMER)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CD0 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'IMMUNOGLOBULIN, BENCE-JONES PROTEIN, LAMBDA-6, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;THE BIOLOGICALLY ACTIVE MOLECULE IS A HOMODIMER. THE
ASYMMETRIC UNIT CONTAINS BOTH MONOMERS, CHAINS A AND B.
BOTH MONOMERS REFINED INDEPENDENTLY.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 82 ? GLU A 86 ? LYS A 79 GLU A 83 5 ? 5 
HELX_P HELX_P2 2 LYS B 82 ? GLU B 86 ? LYS B 79 GLU B 83 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 91 SG ? ? A CYS 23 A CYS 88 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf2 disulf ? ? B CYS 22 SG ? ? ? 1_555 B CYS 91 SG ? ? B CYS 23 B CYS 88 1_555 ? ? ? ? ? ? ? 2.038 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 4   ? THR A 5   ? LEU A 4   THR A 5   
A 2 VAL A 18  ? ARG A 24  ? VAL A 19  ARG A 25  
A 3 SER A 73  ? ILE A 78  ? SER A 70  ILE A 75  
A 4 PHE A 63  ? ASP A 68  A PHE A 62  ASP A 66  
B 1 SER A 9   ? GLU A 12  ? SER A 9   GLU A 13  
B 2 THR A 105 ? VAL A 109 ? THR A 102 VAL A 106 
B 3 ALA A 87  ? ASP A 95  ? ALA A 84  ASP A 92  
B 4 HIS A 35  ? GLN A 39  ? HIS A 34  GLN A 38  
B 5 THR A 46  ? ILE A 49  ? THR A 45  ILE A 48  
C 1 SER A 9   ? GLU A 12  ? SER A 9   GLU A 13  
C 2 THR A 105 ? VAL A 109 ? THR A 102 VAL A 106 
C 3 ALA A 87  ? ASP A 95  ? ALA A 84  ASP A 92  
C 4 ASN A 98  ? PHE A 101 ? ASN A 95  PHE A 98  
D 1 LEU B 4   ? THR B 5   ? LEU B 4   THR B 5   
D 2 VAL B 18  ? ARG B 24  ? VAL B 19  ARG B 25  
D 3 SER B 73  ? ILE B 78  ? SER B 70  ILE B 75  
D 4 PHE B 63  ? ASP B 68  A PHE B 62  ASP B 66  
E 1 THR B 46  ? ILE B 49  ? THR B 45  ILE B 48  
E 2 VAL B 34  ? GLN B 39  ? VAL B 33  GLN B 38  
E 3 ALA B 87  ? ASP B 95  ? ALA B 84  ASP B 92  
E 4 ASN B 98  ? PHE B 101 ? ASN B 95  PHE B 98  
F 1 THR B 46  ? ILE B 49  ? THR B 45  ILE B 48  
F 2 VAL B 34  ? GLN B 39  ? VAL B 33  GLN B 38  
F 3 ALA B 87  ? ASP B 95  ? ALA B 84  ASP B 92  
F 4 THR B 105 ? VAL B 109 ? THR B 102 VAL B 106 
F 5 SER B 9   ? GLU B 12  ? SER B 9   GLU B 13  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 5   ? N THR A 5   O THR A 23  ? O THR A 24  
A 2 3 N CYS A 22  ? N CYS A 23  O ALA A 74  ? O ALA A 71  
A 3 4 N THR A 77  ? N THR A 74  O SER A 64  ? O SER A 63  
B 1 2 N VAL A 10  ? N VAL A 11  O LYS A 106 ? O LYS A 103 
B 2 3 N LEU A 107 ? N LEU A 104 O ALA A 87  ? O ALA A 84  
B 3 4 N GLN A 92  ? N GLN A 89  O HIS A 35  ? O HIS A 34  
B 4 5 N GLN A 38  ? N GLN A 37  O THR A 46  ? O THR A 45  
C 1 2 N VAL A 10  ? N VAL A 11  O LYS A 106 ? O LYS A 103 
C 2 3 N LEU A 107 ? N LEU A 104 O ALA A 87  ? O ALA A 84  
C 3 4 N ASP A 95  ? N ASP A 92  O ASN A 98  ? O ASN A 95  
D 1 2 O THR B 5   ? O THR B 5   N THR B 23  ? N THR B 24  
D 2 3 N CYS B 22  ? N CYS B 23  O ALA B 74  ? O ALA B 71  
D 3 4 N THR B 77  ? N THR B 74  O SER B 64  ? O SER B 63  
E 1 2 N VAL B 48  ? N VAL B 47  O TRP B 36  ? O TRP B 35  
E 2 3 N GLN B 39  ? N GLN B 38  O ASP B 88  ? O ASP B 85  
E 3 4 N ASP B 95  ? N ASP B 92  O ASN B 98  ? O ASN B 95  
F 1 2 N VAL B 48  ? N VAL B 47  O TRP B 36  ? O TRP B 35  
F 2 3 N GLN B 39  ? N GLN B 38  O ASP B 88  ? O ASP B 85  
F 3 4 N TYR B 89  ? N TYR B 86  O THR B 105 ? O THR B 102 
F 4 5 O LYS B 106 ? O LYS B 103 N VAL B 10  ? N VAL B 11  
# 
_database_PDB_matrix.entry_id          2CD0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CD0 
_atom_sites.fract_transf_matrix[1][1]   0.006761 
_atom_sites.fract_transf_matrix[1][2]   0.003904 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007807 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.021459 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 1   ? 23.111 27.738  5.107   1.00 38.07 ? 1   ASN A N   1 
ATOM   2    C CA  . ASN A 1 1   ? 21.698 28.001  5.516   1.00 37.66 ? 1   ASN A CA  1 
ATOM   3    C C   . ASN A 1 1   ? 20.734 27.137  4.714   1.00 36.49 ? 1   ASN A C   1 
ATOM   4    O O   . ASN A 1 1   ? 20.533 27.365  3.525   1.00 36.75 ? 1   ASN A O   1 
ATOM   5    C CB  . ASN A 1 1   ? 21.361 29.486  5.312   1.00 38.55 ? 1   ASN A CB  1 
ATOM   6    C CG  . ASN A 1 1   ? 19.972 29.859  5.828   1.00 40.38 ? 1   ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 1   ? 19.582 31.032  5.809   1.00 41.43 ? 1   ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 1   ? 19.221 28.865  6.290   1.00 41.21 ? 1   ASN A ND2 1 
ATOM   9    N N   . PHE A 1 2   ? 20.152 26.140  5.376   1.00 34.98 ? 2   PHE A N   1 
ATOM   10   C CA  . PHE A 1 2   ? 19.186 25.242  4.754   1.00 33.08 ? 2   PHE A CA  1 
ATOM   11   C C   . PHE A 1 2   ? 18.596 24.341  5.828   1.00 32.09 ? 2   PHE A C   1 
ATOM   12   O O   . PHE A 1 2   ? 19.064 24.337  6.969   1.00 32.81 ? 2   PHE A O   1 
ATOM   13   C CB  . PHE A 1 2   ? 19.846 24.418  3.639   1.00 33.00 ? 2   PHE A CB  1 
ATOM   14   C CG  . PHE A 1 2   ? 20.910 23.471  4.118   1.00 32.21 ? 2   PHE A CG  1 
ATOM   15   C CD1 . PHE A 1 2   ? 20.569 22.268  4.731   1.00 31.44 ? 2   PHE A CD1 1 
ATOM   16   C CD2 . PHE A 1 2   ? 22.256 23.787  3.964   1.00 32.06 ? 2   PHE A CD2 1 
ATOM   17   C CE1 . PHE A 1 2   ? 21.555 21.395  5.179   1.00 30.43 ? 2   PHE A CE1 1 
ATOM   18   C CE2 . PHE A 1 2   ? 23.250 22.914  4.414   1.00 32.00 ? 2   PHE A CE2 1 
ATOM   19   C CZ  . PHE A 1 2   ? 22.892 21.717  5.022   1.00 30.44 ? 2   PHE A CZ  1 
ATOM   20   N N   . LEU A 1 3   ? 17.576 23.576  5.462   1.00 30.73 ? 3   LEU A N   1 
ATOM   21   C CA  . LEU A 1 3   ? 16.892 22.703  6.401   1.00 28.65 ? 3   LEU A CA  1 
ATOM   22   C C   . LEU A 1 3   ? 16.799 21.271  5.844   1.00 26.92 ? 3   LEU A C   1 
ATOM   23   O O   . LEU A 1 3   ? 16.744 21.076  4.632   1.00 25.55 ? 3   LEU A O   1 
ATOM   24   C CB  . LEU A 1 3   ? 15.486 23.276  6.632   1.00 29.92 ? 3   LEU A CB  1 
ATOM   25   C CG  . LEU A 1 3   ? 14.579 22.896  7.801   1.00 31.18 ? 3   LEU A CG  1 
ATOM   26   C CD1 . LEU A 1 3   ? 15.205 23.344  9.118   1.00 30.89 ? 3   LEU A CD1 1 
ATOM   27   C CD2 . LEU A 1 3   ? 13.226 23.584  7.622   1.00 31.26 ? 3   LEU A CD2 1 
ATOM   28   N N   . LEU A 1 4   ? 16.801 20.272  6.721   1.00 24.24 ? 4   LEU A N   1 
ATOM   29   C CA  . LEU A 1 4   ? 16.662 18.886  6.277   1.00 23.01 ? 4   LEU A CA  1 
ATOM   30   C C   . LEU A 1 4   ? 15.360 18.343  6.853   1.00 23.71 ? 4   LEU A C   1 
ATOM   31   O O   . LEU A 1 4   ? 15.195 18.268  8.076   1.00 23.70 ? 4   LEU A O   1 
ATOM   32   C CB  . LEU A 1 4   ? 17.859 18.035  6.735   1.00 21.75 ? 4   LEU A CB  1 
ATOM   33   C CG  . LEU A 1 4   ? 19.202 18.489  6.148   1.00 19.81 ? 4   LEU A CG  1 
ATOM   34   C CD1 . LEU A 1 4   ? 20.353 17.704  6.775   1.00 19.79 ? 4   LEU A CD1 1 
ATOM   35   C CD2 . LEU A 1 4   ? 19.192 18.316  4.638   1.00 20.18 ? 4   LEU A CD2 1 
ATOM   36   N N   . THR A 1 5   ? 14.436 17.971  5.969   1.00 23.00 ? 5   THR A N   1 
ATOM   37   C CA  . THR A 1 5   ? 13.128 17.461  6.371   1.00 23.54 ? 5   THR A CA  1 
ATOM   38   C C   . THR A 1 5   ? 12.953 15.951  6.246   1.00 23.49 ? 5   THR A C   1 
ATOM   39   O O   . THR A 1 5   ? 13.177 15.384  5.179   1.00 24.15 ? 5   THR A O   1 
ATOM   40   C CB  . THR A 1 5   ? 12.019 18.108  5.529   1.00 23.17 ? 5   THR A CB  1 
ATOM   41   O OG1 . THR A 1 5   ? 12.094 19.530  5.656   1.00 22.58 ? 5   THR A OG1 1 
ATOM   42   C CG2 . THR A 1 5   ? 10.656 17.612  5.972   1.00 21.96 ? 5   THR A CG2 1 
ATOM   43   N N   . GLN A 1 6   ? 12.514 15.315  7.326   1.00 24.39 ? 6   GLN A N   1 
ATOM   44   C CA  . GLN A 1 6   ? 12.279 13.870  7.331   1.00 23.96 ? 6   GLN A CA  1 
ATOM   45   C C   . GLN A 1 6   ? 10.876 13.630  7.876   1.00 24.59 ? 6   GLN A C   1 
ATOM   46   O O   . GLN A 1 6   ? 10.319 14.482  8.577   1.00 24.28 ? 6   GLN A O   1 
ATOM   47   C CB  . GLN A 1 6   ? 13.256 13.160  8.271   1.00 23.79 ? 6   GLN A CB  1 
ATOM   48   C CG  . GLN A 1 6   ? 14.668 13.677  8.233   1.00 24.12 ? 6   GLN A CG  1 
ATOM   49   C CD  . GLN A 1 6   ? 15.563 13.010  9.264   1.00 23.81 ? 6   GLN A CD  1 
ATOM   50   O OE1 . GLN A 1 6   ? 16.583 13.574  9.654   1.00 23.64 ? 6   GLN A OE1 1 
ATOM   51   N NE2 . GLN A 1 6   ? 15.199 11.800  9.694   1.00 21.89 ? 6   GLN A NE2 1 
ATOM   52   N N   . PRO A 1 7   ? 10.273 12.479  7.548   1.00 24.65 ? 7   PRO A N   1 
ATOM   53   C CA  . PRO A 1 7   ? 8.932  12.201  8.069   1.00 24.14 ? 7   PRO A CA  1 
ATOM   54   C C   . PRO A 1 7   ? 9.018  12.083  9.600   1.00 24.74 ? 7   PRO A C   1 
ATOM   55   O O   . PRO A 1 7   ? 10.052 11.670  10.132  1.00 23.71 ? 7   PRO A O   1 
ATOM   56   C CB  . PRO A 1 7   ? 8.582  10.871  7.400   1.00 24.17 ? 7   PRO A CB  1 
ATOM   57   C CG  . PRO A 1 7   ? 9.964  10.207  7.230   1.00 23.90 ? 7   PRO A CG  1 
ATOM   58   C CD  . PRO A 1 7   ? 10.707 11.394  6.645   1.00 23.75 ? 7   PRO A CD  1 
ATOM   59   N N   . HIS A 1 8   ? 7.939  12.425  10.302  1.00 23.33 ? 8   HIS A N   1 
ATOM   60   C CA  . HIS A 1 8   ? 7.929  12.366  11.756  1.00 23.74 ? 8   HIS A CA  1 
ATOM   61   C C   . HIS A 1 8   ? 8.123  10.941  12.258  1.00 23.32 ? 8   HIS A C   1 
ATOM   62   O O   . HIS A 1 8   ? 8.887  10.702  13.196  1.00 22.96 ? 8   HIS A O   1 
ATOM   63   C CB  . HIS A 1 8   ? 6.608  12.911  12.304  1.00 26.36 ? 8   HIS A CB  1 
ATOM   64   C CG  . HIS A 1 8   ? 6.587  13.051  13.792  1.00 27.52 ? 8   HIS A CG  1 
ATOM   65   N ND1 . HIS A 1 8   ? 7.193  14.102  14.451  1.00 29.21 ? 8   HIS A ND1 1 
ATOM   66   C CD2 . HIS A 1 8   ? 6.083  12.247  14.758  1.00 29.45 ? 8   HIS A CD2 1 
ATOM   67   C CE1 . HIS A 1 8   ? 7.064  13.938  15.753  1.00 28.97 ? 8   HIS A CE1 1 
ATOM   68   N NE2 . HIS A 1 8   ? 6.393  12.819  15.968  1.00 30.42 ? 8   HIS A NE2 1 
ATOM   69   N N   . SER A 1 9   ? 7.425  9.989   11.637  1.00 22.39 ? 9   SER A N   1 
ATOM   70   C CA  . SER A 1 9   ? 7.536  8.593   12.051  1.00 22.68 ? 9   SER A CA  1 
ATOM   71   C C   . SER A 1 9   ? 7.089  7.586   10.991  1.00 21.44 ? 9   SER A C   1 
ATOM   72   O O   . SER A 1 9   ? 6.464  7.949   9.996   1.00 19.55 ? 9   SER A O   1 
ATOM   73   C CB  . SER A 1 9   ? 6.741  8.363   13.346  1.00 23.47 ? 9   SER A CB  1 
ATOM   74   O OG  . SER A 1 9   ? 5.387  8.731   13.180  1.00 24.39 ? 9   SER A OG  1 
ATOM   75   N N   . VAL A 1 10  ? 7.440  6.321   11.225  1.00 21.19 ? 11  VAL A N   1 
ATOM   76   C CA  . VAL A 1 10  ? 7.087  5.217   10.339  1.00 21.59 ? 11  VAL A CA  1 
ATOM   77   C C   . VAL A 1 10  ? 6.954  3.970   11.202  1.00 21.96 ? 11  VAL A C   1 
ATOM   78   O O   . VAL A 1 10  ? 7.749  3.754   12.122  1.00 21.57 ? 11  VAL A O   1 
ATOM   79   C CB  . VAL A 1 10  ? 8.176  4.971   9.259   1.00 21.32 ? 11  VAL A CB  1 
ATOM   80   C CG1 . VAL A 1 10  ? 7.717  3.872   8.301   1.00 21.53 ? 11  VAL A CG1 1 
ATOM   81   C CG2 . VAL A 1 10  ? 8.454  6.250   8.491   1.00 21.72 ? 11  VAL A CG2 1 
ATOM   82   N N   . SER A 1 11  ? 5.936  3.158   10.924  1.00 22.36 ? 12  SER A N   1 
ATOM   83   C CA  . SER A 1 11  ? 5.714  1.930   11.680  1.00 23.67 ? 12  SER A CA  1 
ATOM   84   C C   . SER A 1 11  ? 5.413  0.813   10.693  1.00 23.31 ? 12  SER A C   1 
ATOM   85   O O   . SER A 1 11  ? 4.427  0.880   9.966   1.00 23.09 ? 12  SER A O   1 
ATOM   86   C CB  . SER A 1 11  ? 4.540  2.107   12.650  1.00 24.71 ? 12  SER A CB  1 
ATOM   87   O OG  . SER A 1 11  ? 4.780  3.196   13.528  1.00 28.21 ? 12  SER A OG  1 
ATOM   88   N N   . GLU A 1 12  ? 6.264  -0.209  10.667  1.00 23.42 ? 13  GLU A N   1 
ATOM   89   C CA  . GLU A 1 12  ? 6.093  -1.325  9.741   1.00 23.90 ? 13  GLU A CA  1 
ATOM   90   C C   . GLU A 1 12  ? 6.422  -2.665  10.401  1.00 23.55 ? 13  GLU A C   1 
ATOM   91   O O   . GLU A 1 12  ? 7.125  -2.729  11.417  1.00 22.40 ? 13  GLU A O   1 
ATOM   92   C CB  . GLU A 1 12  ? 7.004  -1.151  8.523   1.00 27.22 ? 13  GLU A CB  1 
ATOM   93   C CG  . GLU A 1 12  ? 6.803  0.123   7.706   1.00 30.27 ? 13  GLU A CG  1 
ATOM   94   C CD  . GLU A 1 12  ? 5.452  0.194   7.018   1.00 32.79 ? 13  GLU A CD  1 
ATOM   95   O OE1 . GLU A 1 12  ? 5.060  -0.796  6.353   1.00 33.92 ? 13  GLU A OE1 1 
ATOM   96   O OE2 . GLU A 1 12  ? 4.792  1.254   7.120   1.00 33.33 ? 13  GLU A OE2 1 
ATOM   97   N N   . SER A 1 13  ? 5.924  -3.737  9.798   1.00 22.09 ? 14  SER A N   1 
ATOM   98   C CA  . SER A 1 13  ? 6.149  -5.071  10.323  1.00 21.26 ? 14  SER A CA  1 
ATOM   99   C C   . SER A 1 13  ? 7.523  -5.582  9.925   1.00 20.71 ? 14  SER A C   1 
ATOM   100  O O   . SER A 1 13  ? 8.058  -5.197  8.895   1.00 21.35 ? 14  SER A O   1 
ATOM   101  C CB  . SER A 1 13  ? 5.070  -6.027  9.799   1.00 22.38 ? 14  SER A CB  1 
ATOM   102  O OG  . SER A 1 13  ? 3.776  -5.638  10.247  1.00 23.17 ? 14  SER A OG  1 
ATOM   103  N N   . PRO A 1 14  ? 8.110  -6.463  10.744  1.00 20.69 ? 15  PRO A N   1 
ATOM   104  C CA  . PRO A 1 14  ? 9.426  -7.017  10.446  1.00 20.77 ? 15  PRO A CA  1 
ATOM   105  C C   . PRO A 1 14  ? 9.389  -7.665  9.070   1.00 21.50 ? 15  PRO A C   1 
ATOM   106  O O   . PRO A 1 14  ? 8.330  -8.122  8.612   1.00 20.27 ? 15  PRO A O   1 
ATOM   107  C CB  . PRO A 1 14  ? 9.621  -8.032  11.570  1.00 20.71 ? 15  PRO A CB  1 
ATOM   108  C CG  . PRO A 1 14  ? 8.876  -7.374  12.719  1.00 21.69 ? 15  PRO A CG  1 
ATOM   109  C CD  . PRO A 1 14  ? 7.594  -7.034  11.997  1.00 21.41 ? 15  PRO A CD  1 
ATOM   110  N N   . GLY A 1 15  ? 10.543 -7.692  8.413   1.00 21.62 ? 16  GLY A N   1 
ATOM   111  C CA  . GLY A 1 15  ? 10.630 -8.289  7.099   1.00 22.70 ? 16  GLY A CA  1 
ATOM   112  C C   . GLY A 1 15  ? 10.367 -7.330  5.960   1.00 22.89 ? 16  GLY A C   1 
ATOM   113  O O   . GLY A 1 15  ? 10.746 -7.614  4.825   1.00 24.35 ? 16  GLY A O   1 
ATOM   114  N N   . LYS A 1 16  ? 9.722  -6.203  6.249   1.00 23.33 ? 17  LYS A N   1 
ATOM   115  C CA  . LYS A 1 16  ? 9.417  -5.209  5.221   1.00 23.48 ? 17  LYS A CA  1 
ATOM   116  C C   . LYS A 1 16  ? 10.521 -4.155  5.019   1.00 23.15 ? 17  LYS A C   1 
ATOM   117  O O   . LYS A 1 16  ? 11.419 -4.017  5.839   1.00 22.74 ? 17  LYS A O   1 
ATOM   118  C CB  . LYS A 1 16  ? 8.096  -4.509  5.544   1.00 24.45 ? 17  LYS A CB  1 
ATOM   119  C CG  . LYS A 1 16  ? 6.867  -5.427  5.463   1.00 26.51 ? 17  LYS A CG  1 
ATOM   120  C CD  . LYS A 1 16  ? 6.697  -5.989  4.053   1.00 27.27 ? 17  LYS A CD  1 
ATOM   121  C CE  . LYS A 1 16  ? 5.474  -6.887  3.937   1.00 29.07 ? 17  LYS A CE  1 
ATOM   122  N NZ  . LYS A 1 16  ? 5.309  -7.412  2.547   1.00 29.00 ? 17  LYS A NZ  1 
ATOM   123  N N   . THR A 1 17  ? 10.432 -3.412  3.922   1.00 21.84 ? 18  THR A N   1 
ATOM   124  C CA  . THR A 1 17  ? 11.413 -2.385  3.602   1.00 21.45 ? 18  THR A CA  1 
ATOM   125  C C   . THR A 1 17  ? 10.858 -0.992  3.816   1.00 21.00 ? 18  THR A C   1 
ATOM   126  O O   . THR A 1 17  ? 9.721  -0.712  3.449   1.00 20.81 ? 18  THR A O   1 
ATOM   127  C CB  . THR A 1 17  ? 11.865 -2.484  2.139   1.00 20.57 ? 18  THR A CB  1 
ATOM   128  O OG1 . THR A 1 17  ? 12.479 -3.754  1.923   1.00 20.78 ? 18  THR A OG1 1 
ATOM   129  C CG2 . THR A 1 17  ? 12.852 -1.368  1.805   1.00 21.30 ? 18  THR A CG2 1 
ATOM   130  N N   . VAL A 1 18  ? 11.672 -0.118  4.397   1.00 21.34 ? 19  VAL A N   1 
ATOM   131  C CA  . VAL A 1 18  ? 11.263 1.260   4.659   1.00 20.97 ? 19  VAL A CA  1 
ATOM   132  C C   . VAL A 1 18  ? 12.262 2.267   4.080   1.00 20.72 ? 19  VAL A C   1 
ATOM   133  O O   . VAL A 1 18  ? 13.458 2.005   4.049   1.00 19.95 ? 19  VAL A O   1 
ATOM   134  C CB  . VAL A 1 18  ? 11.115 1.500   6.173   1.00 21.55 ? 19  VAL A CB  1 
ATOM   135  C CG1 . VAL A 1 18  ? 12.405 1.154   6.883   1.00 22.56 ? 19  VAL A CG1 1 
ATOM   136  C CG2 . VAL A 1 18  ? 10.751 2.945   6.432   1.00 23.42 ? 19  VAL A CG2 1 
ATOM   137  N N   . THR A 1 19  ? 11.760 3.409   3.621   1.00 20.59 ? 20  THR A N   1 
ATOM   138  C CA  . THR A 1 19  ? 12.604 4.454   3.044   1.00 20.83 ? 20  THR A CA  1 
ATOM   139  C C   . THR A 1 19  ? 12.431 5.804   3.745   1.00 21.20 ? 20  THR A C   1 
ATOM   140  O O   . THR A 1 19  ? 11.482 6.536   3.471   1.00 21.56 ? 20  THR A O   1 
ATOM   141  C CB  . THR A 1 19  ? 12.301 4.654   1.561   1.00 20.86 ? 20  THR A CB  1 
ATOM   142  O OG1 . THR A 1 19  ? 12.505 3.420   0.865   1.00 20.25 ? 20  THR A OG1 1 
ATOM   143  C CG2 . THR A 1 19  ? 13.208 5.721   0.975   1.00 19.04 ? 20  THR A CG2 1 
ATOM   144  N N   . ILE A 1 20  ? 13.353 6.129   4.647   1.00 20.15 ? 21  ILE A N   1 
ATOM   145  C CA  . ILE A 1 20  ? 13.287 7.399   5.366   1.00 20.18 ? 21  ILE A CA  1 
ATOM   146  C C   . ILE A 1 20  ? 13.980 8.437   4.497   1.00 20.21 ? 21  ILE A C   1 
ATOM   147  O O   . ILE A 1 20  ? 15.163 8.301   4.177   1.00 21.07 ? 21  ILE A O   1 
ATOM   148  C CB  . ILE A 1 20  ? 14.010 7.318   6.728   1.00 18.96 ? 21  ILE A CB  1 
ATOM   149  C CG1 . ILE A 1 20  ? 13.352 6.258   7.606   1.00 18.62 ? 21  ILE A CG1 1 
ATOM   150  C CG2 . ILE A 1 20  ? 13.973 8.682   7.416   1.00 18.73 ? 21  ILE A CG2 1 
ATOM   151  C CD1 . ILE A 1 20  ? 14.114 5.924   8.870   1.00 17.35 ? 21  ILE A CD1 1 
ATOM   152  N N   . SER A 1 21  ? 13.236 9.461   4.093   1.00 20.89 ? 22  SER A N   1 
ATOM   153  C CA  . SER A 1 21  ? 13.774 10.512  3.245   1.00 20.49 ? 22  SER A CA  1 
ATOM   154  C C   . SER A 1 21  ? 14.345 11.676  4.049   1.00 20.96 ? 22  SER A C   1 
ATOM   155  O O   . SER A 1 21  ? 14.022 11.858  5.215   1.00 21.02 ? 22  SER A O   1 
ATOM   156  C CB  . SER A 1 21  ? 12.691 11.006  2.280   1.00 22.32 ? 22  SER A CB  1 
ATOM   157  O OG  . SER A 1 21  ? 11.483 11.297  2.969   1.00 24.70 ? 22  SER A OG  1 
ATOM   158  N N   . CYS A 1 22  ? 15.221 12.436  3.410   1.00 20.23 ? 23  CYS A N   1 
ATOM   159  C CA  . CYS A 1 22  ? 15.879 13.585  4.022   1.00 20.75 ? 23  CYS A CA  1 
ATOM   160  C C   . CYS A 1 22  ? 16.014 14.642  2.944   1.00 21.21 ? 23  CYS A C   1 
ATOM   161  O O   . CYS A 1 22  ? 17.034 14.723  2.250   1.00 19.79 ? 23  CYS A O   1 
ATOM   162  C CB  . CYS A 1 22  ? 17.270 13.198  4.538   1.00 19.06 ? 23  CYS A CB  1 
ATOM   163  S SG  . CYS A 1 22  ? 18.286 14.585  5.154   1.00 18.62 ? 23  CYS A SG  1 
ATOM   164  N N   . THR A 1 23  ? 14.981 15.456  2.782   1.00 21.61 ? 24  THR A N   1 
ATOM   165  C CA  . THR A 1 23  ? 15.043 16.477  1.753   1.00 23.27 ? 24  THR A CA  1 
ATOM   166  C C   . THR A 1 23  ? 15.588 17.805  2.231   1.00 23.48 ? 24  THR A C   1 
ATOM   167  O O   . THR A 1 23  ? 15.177 18.336  3.260   1.00 23.75 ? 24  THR A O   1 
ATOM   168  C CB  . THR A 1 23  ? 13.677 16.716  1.111   1.00 23.04 ? 24  THR A CB  1 
ATOM   169  O OG1 . THR A 1 23  ? 13.272 15.527  0.424   1.00 24.60 ? 24  THR A OG1 1 
ATOM   170  C CG2 . THR A 1 23  ? 13.745 17.890  0.132   1.00 23.38 ? 24  THR A CG2 1 
ATOM   171  N N   . ARG A 1 24  ? 16.520 18.331  1.450   1.00 23.95 ? 25  ARG A N   1 
ATOM   172  C CA  . ARG A 1 24  ? 17.170 19.589  1.731   1.00 25.14 ? 25  ARG A CA  1 
ATOM   173  C C   . ARG A 1 24  ? 16.465 20.765  1.051   1.00 26.30 ? 25  ARG A C   1 
ATOM   174  O O   . ARG A 1 24  ? 16.291 20.783  -0.166  1.00 25.97 ? 25  ARG A O   1 
ATOM   175  C CB  . ARG A 1 24  ? 18.630 19.495  1.288   1.00 24.31 ? 25  ARG A CB  1 
ATOM   176  C CG  . ARG A 1 24  ? 19.369 20.799  1.255   1.00 23.19 ? 25  ARG A CG  1 
ATOM   177  C CD  . ARG A 1 24  ? 20.857 20.549  1.126   1.00 23.06 ? 25  ARG A CD  1 
ATOM   178  N NE  . ARG A 1 24  ? 21.607 21.788  0.998   1.00 23.77 ? 25  ARG A NE  1 
ATOM   179  C CZ  . ARG A 1 24  ? 22.905 21.896  1.259   1.00 24.25 ? 25  ARG A CZ  1 
ATOM   180  N NH1 . ARG A 1 24  ? 23.592 20.837  1.666   1.00 24.12 ? 25  ARG A NH1 1 
ATOM   181  N NH2 . ARG A 1 24  ? 23.517 23.059  1.119   1.00 23.70 ? 25  ARG A NH2 1 
ATOM   182  N N   . SER A 1 25  ? 16.065 21.744  1.858   1.00 27.32 ? 26  SER A N   1 
ATOM   183  C CA  . SER A 1 25  ? 15.366 22.928  1.370   1.00 29.01 ? 26  SER A CA  1 
ATOM   184  C C   . SER A 1 25  ? 16.080 23.643  0.232   1.00 29.67 ? 26  SER A C   1 
ATOM   185  O O   . SER A 1 25  ? 15.549 23.728  -0.874  1.00 31.31 ? 26  SER A O   1 
ATOM   186  C CB  . SER A 1 25  ? 15.163 23.926  2.505   1.00 27.81 ? 26  SER A CB  1 
ATOM   187  O OG  . SER A 1 25  ? 16.410 24.451  2.915   1.00 28.68 ? 26  SER A OG  1 
ATOM   188  N N   . SER A 1 26  ? 17.266 24.179  0.512   1.00 30.82 ? 27  SER A N   1 
ATOM   189  C CA  . SER A 1 26  ? 18.044 24.910  -0.490  1.00 30.93 ? 27  SER A CA  1 
ATOM   190  C C   . SER A 1 26  ? 19.478 24.411  -0.534  1.00 30.69 ? 27  SER A C   1 
ATOM   191  O O   . SER A 1 26  ? 19.921 23.699  0.366   1.00 31.18 ? 27  SER A O   1 
ATOM   192  C CB  . SER A 1 26  ? 18.067 26.411  -0.175  1.00 32.04 ? 27  SER A CB  1 
ATOM   193  O OG  . SER A 1 26  ? 18.894 26.693  0.950   1.00 33.92 ? 27  SER A OG  1 
ATOM   194  N N   . GLY A 1 27  A 20.207 24.812  -1.575  1.00 29.75 ? 27  GLY A N   1 
ATOM   195  C CA  . GLY A 1 27  A 21.586 24.387  -1.733  1.00 28.72 ? 27  GLY A CA  1 
ATOM   196  C C   . GLY A 1 27  A 21.660 22.962  -2.259  1.00 27.90 ? 27  GLY A C   1 
ATOM   197  O O   . GLY A 1 27  A 20.797 22.144  -1.948  1.00 28.22 ? 27  GLY A O   1 
ATOM   198  N N   . SER A 1 28  B 22.684 22.660  -3.056  1.00 27.85 ? 27  SER A N   1 
ATOM   199  C CA  . SER A 1 28  B 22.848 21.319  -3.621  1.00 27.44 ? 27  SER A CA  1 
ATOM   200  C C   . SER A 1 28  B 23.174 20.275  -2.564  1.00 27.09 ? 27  SER A C   1 
ATOM   201  O O   . SER A 1 28  B 24.161 20.405  -1.850  1.00 27.02 ? 27  SER A O   1 
ATOM   202  C CB  . SER A 1 28  B 23.956 21.307  -4.668  1.00 27.01 ? 27  SER A CB  1 
ATOM   203  O OG  . SER A 1 28  B 24.241 19.970  -5.043  1.00 27.60 ? 27  SER A OG  1 
ATOM   204  N N   . ILE A 1 29  ? 22.369 19.222  -2.486  1.00 26.77 ? 28  ILE A N   1 
ATOM   205  C CA  . ILE A 1 29  ? 22.609 18.192  -1.480  1.00 27.64 ? 28  ILE A CA  1 
ATOM   206  C C   . ILE A 1 29  ? 23.862 17.356  -1.749  1.00 28.32 ? 28  ILE A C   1 
ATOM   207  O O   . ILE A 1 29  ? 24.227 16.513  -0.935  1.00 28.64 ? 28  ILE A O   1 
ATOM   208  C CB  . ILE A 1 29  ? 21.399 17.256  -1.349  1.00 26.71 ? 28  ILE A CB  1 
ATOM   209  C CG1 . ILE A 1 29  ? 21.469 16.506  -0.012  1.00 26.95 ? 28  ILE A CG1 1 
ATOM   210  C CG2 . ILE A 1 29  ? 21.374 16.266  -2.517  1.00 27.27 ? 28  ILE A CG2 1 
ATOM   211  C CD1 . ILE A 1 29  ? 20.239 15.672  0.295   1.00 25.83 ? 28  ILE A CD1 1 
ATOM   212  N N   . ALA A 1 30  ? 24.528 17.606  -2.876  1.00 29.60 ? 29  ALA A N   1 
ATOM   213  C CA  . ALA A 1 30  ? 25.734 16.868  -3.247  1.00 30.29 ? 29  ALA A CA  1 
ATOM   214  C C   . ALA A 1 30  ? 27.034 17.545  -2.822  1.00 31.25 ? 29  ALA A C   1 
ATOM   215  O O   . ALA A 1 30  ? 28.060 16.875  -2.674  1.00 31.44 ? 29  ALA A O   1 
ATOM   216  C CB  . ALA A 1 30  ? 25.752 16.628  -4.750  1.00 31.58 ? 29  ALA A CB  1 
ATOM   217  N N   . ASN A 1 31  ? 26.992 18.862  -2.629  1.00 31.35 ? 30  ASN A N   1 
ATOM   218  C CA  . ASN A 1 31  ? 28.181 19.621  -2.230  1.00 32.10 ? 30  ASN A CA  1 
ATOM   219  C C   . ASN A 1 31  ? 28.665 19.293  -0.829  1.00 30.94 ? 30  ASN A C   1 
ATOM   220  O O   . ASN A 1 31  ? 29.679 19.821  -0.372  1.00 32.06 ? 30  ASN A O   1 
ATOM   221  C CB  . ASN A 1 31  ? 27.921 21.126  -2.339  1.00 33.32 ? 30  ASN A CB  1 
ATOM   222  C CG  . ASN A 1 31  ? 27.694 21.571  -3.769  1.00 35.15 ? 30  ASN A CG  1 
ATOM   223  O OD1 . ASN A 1 31  ? 27.584 22.766  -4.052  1.00 36.18 ? 30  ASN A OD1 1 
ATOM   224  N ND2 . ASN A 1 31  ? 27.616 20.608  -4.683  1.00 36.40 ? 30  ASN A ND2 1 
ATOM   225  N N   . ASN A 1 32  ? 27.926 18.434  -0.143  1.00 29.73 ? 31  ASN A N   1 
ATOM   226  C CA  . ASN A 1 32  ? 28.292 18.018  1.202   1.00 28.02 ? 31  ASN A CA  1 
ATOM   227  C C   . ASN A 1 32  ? 27.856 16.597  1.477   1.00 26.56 ? 31  ASN A C   1 
ATOM   228  O O   . ASN A 1 32  ? 26.885 16.103  0.898   1.00 26.36 ? 31  ASN A O   1 
ATOM   229  C CB  . ASN A 1 32  ? 27.685 18.950  2.251   1.00 28.75 ? 31  ASN A CB  1 
ATOM   230  C CG  . ASN A 1 32  ? 28.389 20.279  2.312   1.00 29.41 ? 31  ASN A CG  1 
ATOM   231  O OD1 . ASN A 1 32  ? 29.586 20.340  2.590   1.00 30.98 ? 31  ASN A OD1 1 
ATOM   232  N ND2 . ASN A 1 32  ? 27.656 21.357  2.050   1.00 30.31 ? 31  ASN A ND2 1 
ATOM   233  N N   . TYR A 1 33  ? 28.600 15.943  2.358   1.00 24.82 ? 32  TYR A N   1 
ATOM   234  C CA  . TYR A 1 33  ? 28.313 14.576  2.742   1.00 22.86 ? 32  TYR A CA  1 
ATOM   235  C C   . TYR A 1 33  ? 27.054 14.532  3.582   1.00 21.50 ? 32  TYR A C   1 
ATOM   236  O O   . TYR A 1 33  ? 26.701 15.502  4.256   1.00 21.11 ? 32  TYR A O   1 
ATOM   237  C CB  . TYR A 1 33  ? 29.472 13.999  3.560   1.00 23.74 ? 32  TYR A CB  1 
ATOM   238  C CG  . TYR A 1 33  ? 30.703 13.689  2.743   1.00 23.84 ? 32  TYR A CG  1 
ATOM   239  C CD1 . TYR A 1 33  ? 30.627 12.845  1.638   1.00 23.79 ? 32  TYR A CD1 1 
ATOM   240  C CD2 . TYR A 1 33  ? 31.943 14.227  3.079   1.00 23.59 ? 32  TYR A CD2 1 
ATOM   241  C CE1 . TYR A 1 33  ? 31.753 12.546  0.884   1.00 24.46 ? 32  TYR A CE1 1 
ATOM   242  C CE2 . TYR A 1 33  ? 33.080 13.934  2.328   1.00 24.38 ? 32  TYR A CE2 1 
ATOM   243  C CZ  . TYR A 1 33  ? 32.977 13.093  1.235   1.00 24.08 ? 32  TYR A CZ  1 
ATOM   244  O OH  . TYR A 1 33  ? 34.091 12.800  0.482   1.00 26.02 ? 32  TYR A OH  1 
ATOM   245  N N   . VAL A 1 34  ? 26.362 13.408  3.515   1.00 19.53 ? 33  VAL A N   1 
ATOM   246  C CA  . VAL A 1 34  ? 25.168 13.223  4.324   1.00 16.64 ? 33  VAL A CA  1 
ATOM   247  C C   . VAL A 1 34  ? 25.483 11.991  5.140   1.00 14.34 ? 33  VAL A C   1 
ATOM   248  O O   . VAL A 1 34  ? 25.913 10.983  4.591   1.00 13.91 ? 33  VAL A O   1 
ATOM   249  C CB  . VAL A 1 34  ? 23.902 12.926  3.489   1.00 16.34 ? 33  VAL A CB  1 
ATOM   250  C CG1 . VAL A 1 34  ? 22.727 12.615  4.436   1.00 16.09 ? 33  VAL A CG1 1 
ATOM   251  C CG2 . VAL A 1 34  ? 23.560 14.114  2.599   1.00 15.76 ? 33  VAL A CG2 1 
ATOM   252  N N   . HIS A 1 35  ? 25.291 12.094  6.444   1.00 12.99 ? 34  HIS A N   1 
ATOM   253  C CA  . HIS A 1 35  ? 25.517 10.989  7.356   1.00 12.39 ? 34  HIS A CA  1 
ATOM   254  C C   . HIS A 1 35  ? 24.158 10.655  7.969   1.00 12.57 ? 34  HIS A C   1 
ATOM   255  O O   . HIS A 1 35  ? 23.270 11.506  7.999   1.00 10.33 ? 34  HIS A O   1 
ATOM   256  C CB  . HIS A 1 35  ? 26.468 11.409  8.473   1.00 15.16 ? 34  HIS A CB  1 
ATOM   257  C CG  . HIS A 1 35  ? 27.822 11.838  7.999   1.00 17.20 ? 34  HIS A CG  1 
ATOM   258  N ND1 . HIS A 1 35  ? 28.686 12.560  8.795   1.00 19.30 ? 34  HIS A ND1 1 
ATOM   259  C CD2 . HIS A 1 35  ? 28.485 11.602  6.843   1.00 16.76 ? 34  HIS A CD2 1 
ATOM   260  C CE1 . HIS A 1 35  ? 29.820 12.753  8.148   1.00 18.77 ? 34  HIS A CE1 1 
ATOM   261  N NE2 . HIS A 1 35  ? 29.726 12.181  6.962   1.00 16.96 ? 34  HIS A NE2 1 
ATOM   262  N N   . TRP A 1 36  ? 24.001 9.424   8.440   1.00 10.68 ? 35  TRP A N   1 
ATOM   263  C CA  . TRP A 1 36  ? 22.755 8.998   9.074   1.00 11.38 ? 35  TRP A CA  1 
ATOM   264  C C   . TRP A 1 36  ? 23.061 8.299   10.382  1.00 10.05 ? 35  TRP A C   1 
ATOM   265  O O   . TRP A 1 36  ? 23.919 7.430   10.426  1.00 11.09 ? 35  TRP A O   1 
ATOM   266  C CB  . TRP A 1 36  ? 21.969 7.999   8.202   1.00 10.23 ? 35  TRP A CB  1 
ATOM   267  C CG  . TRP A 1 36  ? 21.365 8.542   6.970   1.00 12.07 ? 35  TRP A CG  1 
ATOM   268  C CD1 . TRP A 1 36  ? 21.958 8.673   5.751   1.00 12.07 ? 35  TRP A CD1 1 
ATOM   269  C CD2 . TRP A 1 36  ? 20.026 9.045   6.823   1.00 13.57 ? 35  TRP A CD2 1 
ATOM   270  N NE1 . TRP A 1 36  ? 21.073 9.218   4.847   1.00 14.22 ? 35  TRP A NE1 1 
ATOM   271  C CE2 . TRP A 1 36  ? 19.881 9.459   5.479   1.00 13.49 ? 35  TRP A CE2 1 
ATOM   272  C CE3 . TRP A 1 36  ? 18.938 9.186   7.696   1.00 12.46 ? 35  TRP A CE3 1 
ATOM   273  C CZ2 . TRP A 1 36  ? 18.687 10.006  4.985   1.00 14.18 ? 35  TRP A CZ2 1 
ATOM   274  C CZ3 . TRP A 1 36  ? 17.756 9.724   7.204   1.00 13.40 ? 35  TRP A CZ3 1 
ATOM   275  C CH2 . TRP A 1 36  ? 17.639 10.127  5.861   1.00 13.11 ? 35  TRP A CH2 1 
ATOM   276  N N   . TYR A 1 37  ? 22.376 8.649   11.462  1.00 10.70 ? 36  TYR A N   1 
ATOM   277  C CA  . TYR A 1 37  ? 22.654 7.910   12.669  1.00 11.32 ? 36  TYR A CA  1 
ATOM   278  C C   . TYR A 1 37  ? 21.381 7.385   13.305  1.00 12.22 ? 36  TYR A C   1 
ATOM   279  O O   . TYR A 1 37  ? 20.283 7.910   13.070  1.00 11.46 ? 36  TYR A O   1 
ATOM   280  C CB  . TYR A 1 37  ? 23.499 8.732   13.649  1.00 14.70 ? 36  TYR A CB  1 
ATOM   281  C CG  . TYR A 1 37  ? 22.815 9.867   14.334  1.00 14.26 ? 36  TYR A CG  1 
ATOM   282  C CD1 . TYR A 1 37  ? 22.023 9.647   15.463  1.00 17.12 ? 36  TYR A CD1 1 
ATOM   283  C CD2 . TYR A 1 37  ? 22.986 11.172  13.883  1.00 17.39 ? 36  TYR A CD2 1 
ATOM   284  C CE1 . TYR A 1 37  ? 21.418 10.698  16.140  1.00 16.16 ? 36  TYR A CE1 1 
ATOM   285  C CE2 . TYR A 1 37  ? 22.384 12.240  14.550  1.00 17.97 ? 36  TYR A CE2 1 
ATOM   286  C CZ  . TYR A 1 37  ? 21.605 11.996  15.678  1.00 18.59 ? 36  TYR A CZ  1 
ATOM   287  O OH  . TYR A 1 37  ? 21.026 13.042  16.351  1.00 18.31 ? 36  TYR A OH  1 
ATOM   288  N N   . GLN A 1 38  ? 21.555 6.311   14.062  1.00 11.80 ? 37  GLN A N   1 
ATOM   289  C CA  . GLN A 1 38  ? 20.481 5.614   14.753  1.00 13.32 ? 37  GLN A CA  1 
ATOM   290  C C   . GLN A 1 38  ? 20.600 5.837   16.251  1.00 14.22 ? 37  GLN A C   1 
ATOM   291  O O   . GLN A 1 38  ? 21.690 5.723   16.827  1.00 13.77 ? 37  GLN A O   1 
ATOM   292  C CB  . GLN A 1 38  ? 20.601 4.122   14.476  1.00 11.93 ? 37  GLN A CB  1 
ATOM   293  C CG  . GLN A 1 38  ? 19.551 3.228   15.134  1.00 12.83 ? 37  GLN A CG  1 
ATOM   294  C CD  . GLN A 1 38  ? 19.949 1.774   15.046  1.00 12.48 ? 37  GLN A CD  1 
ATOM   295  O OE1 . GLN A 1 38  ? 20.898 1.330   15.715  1.00 11.24 ? 37  GLN A OE1 1 
ATOM   296  N NE2 . GLN A 1 38  ? 19.254 1.021   14.193  1.00 10.28 ? 37  GLN A NE2 1 
ATOM   297  N N   . GLN A 1 39  ? 19.466 6.124   16.876  1.00 16.41 ? 38  GLN A N   1 
ATOM   298  C CA  . GLN A 1 39  ? 19.425 6.344   18.303  1.00 18.94 ? 38  GLN A CA  1 
ATOM   299  C C   . GLN A 1 39  ? 18.284 5.547   18.915  1.00 20.58 ? 38  GLN A C   1 
ATOM   300  O O   . GLN A 1 39  ? 17.122 5.898   18.745  1.00 20.87 ? 38  GLN A O   1 
ATOM   301  C CB  . GLN A 1 39  ? 19.242 7.834   18.580  1.00 19.02 ? 38  GLN A CB  1 
ATOM   302  C CG  . GLN A 1 39  ? 19.145 8.201   20.039  1.00 20.65 ? 38  GLN A CG  1 
ATOM   303  C CD  . GLN A 1 39  ? 19.153 9.704   20.236  1.00 20.08 ? 38  GLN A CD  1 
ATOM   304  O OE1 . GLN A 1 39  ? 18.383 10.432  19.609  1.00 22.28 ? 38  GLN A OE1 1 
ATOM   305  N NE2 . GLN A 1 39  ? 20.020 10.173  21.114  1.00 21.93 ? 38  GLN A NE2 1 
ATOM   306  N N   . ARG A 1 40  ? 18.632 4.469   19.610  1.00 24.08 ? 39  ARG A N   1 
ATOM   307  C CA  . ARG A 1 40  ? 17.632 3.627   20.267  1.00 27.21 ? 39  ARG A CA  1 
ATOM   308  C C   . ARG A 1 40  ? 16.826 4.474   21.250  1.00 28.41 ? 39  ARG A C   1 
ATOM   309  O O   . ARG A 1 40  ? 17.194 5.611   21.544  1.00 27.96 ? 39  ARG A O   1 
ATOM   310  C CB  . ARG A 1 40  ? 18.311 2.473   21.004  1.00 28.07 ? 39  ARG A CB  1 
ATOM   311  C CG  . ARG A 1 40  ? 18.868 1.380   20.109  1.00 28.52 ? 39  ARG A CG  1 
ATOM   312  C CD  . ARG A 1 40  ? 17.771 0.670   19.322  1.00 29.50 ? 39  ARG A CD  1 
ATOM   313  N NE  . ARG A 1 40  ? 18.225 -0.585  18.726  1.00 29.23 ? 39  ARG A NE  1 
ATOM   314  C CZ  . ARG A 1 40  ? 19.305 -0.708  17.960  1.00 31.48 ? 39  ARG A CZ  1 
ATOM   315  N NH1 . ARG A 1 40  ? 20.048 0.357   17.696  1.00 32.74 ? 39  ARG A NH1 1 
ATOM   316  N NH2 . ARG A 1 40  ? 19.641 -1.889  17.446  1.00 31.44 ? 39  ARG A NH2 1 
ATOM   317  N N   . PRO A 1 41  ? 15.732 3.916   21.798  1.00 30.02 ? 40  PRO A N   1 
ATOM   318  C CA  . PRO A 1 41  ? 14.869 4.623   22.751  1.00 30.48 ? 40  PRO A CA  1 
ATOM   319  C C   . PRO A 1 41  ? 15.644 5.448   23.776  1.00 30.80 ? 40  PRO A C   1 
ATOM   320  O O   . PRO A 1 41  ? 15.716 6.675   23.670  1.00 31.14 ? 40  PRO A O   1 
ATOM   321  C CB  . PRO A 1 41  ? 14.053 3.479   23.381  1.00 30.86 ? 40  PRO A CB  1 
ATOM   322  C CG  . PRO A 1 41  ? 14.910 2.215   23.076  1.00 30.54 ? 40  PRO A CG  1 
ATOM   323  C CD  . PRO A 1 41  ? 15.264 2.530   21.644  1.00 30.41 ? 40  PRO A CD  1 
ATOM   324  N N   . GLY A 1 42  ? 16.215 4.777   24.768  1.00 30.62 ? 41  GLY A N   1 
ATOM   325  C CA  . GLY A 1 42  ? 16.995 5.484   25.769  1.00 30.86 ? 41  GLY A CA  1 
ATOM   326  C C   . GLY A 1 42  ? 18.434 5.092   25.518  1.00 30.88 ? 41  GLY A C   1 
ATOM   327  O O   . GLY A 1 42  ? 19.014 4.298   26.266  1.00 31.32 ? 41  GLY A O   1 
ATOM   328  N N   . SER A 1 43  ? 19.013 5.637   24.451  1.00 30.27 ? 42  SER A N   1 
ATOM   329  C CA  . SER A 1 43  ? 20.383 5.295   24.085  1.00 29.34 ? 42  SER A CA  1 
ATOM   330  C C   . SER A 1 43  ? 21.117 6.418   23.359  1.00 28.12 ? 42  SER A C   1 
ATOM   331  O O   . SER A 1 43  ? 20.517 7.414   22.963  1.00 28.02 ? 42  SER A O   1 
ATOM   332  C CB  . SER A 1 43  ? 20.374 4.031   23.225  1.00 29.53 ? 42  SER A CB  1 
ATOM   333  N N   . SER A 1 44  ? 22.427 6.248   23.194  1.00 28.24 ? 43  SER A N   1 
ATOM   334  C CA  . SER A 1 44  ? 23.251 7.247   22.520  1.00 27.70 ? 43  SER A CA  1 
ATOM   335  C C   . SER A 1 44  ? 23.303 6.940   21.029  1.00 26.84 ? 43  SER A C   1 
ATOM   336  O O   . SER A 1 44  ? 23.261 5.776   20.618  1.00 27.81 ? 43  SER A O   1 
ATOM   337  C CB  . SER A 1 44  ? 24.670 7.255   23.089  1.00 27.87 ? 43  SER A CB  1 
ATOM   338  O OG  . SER A 1 44  ? 25.308 6.015   22.866  1.00 27.42 ? 43  SER A OG  1 
ATOM   339  N N   . PRO A 1 45  ? 23.443 7.980   20.201  1.00 25.69 ? 44  PRO A N   1 
ATOM   340  C CA  . PRO A 1 45  ? 23.496 7.831   18.748  1.00 23.16 ? 44  PRO A CA  1 
ATOM   341  C C   . PRO A 1 45  ? 24.684 7.020   18.248  1.00 22.20 ? 44  PRO A C   1 
ATOM   342  O O   . PRO A 1 45  ? 25.744 6.993   18.869  1.00 20.82 ? 44  PRO A O   1 
ATOM   343  C CB  . PRO A 1 45  ? 23.569 9.281   18.273  1.00 23.85 ? 44  PRO A CB  1 
ATOM   344  C CG  . PRO A 1 45  ? 22.905 10.053  19.422  1.00 24.26 ? 44  PRO A CG  1 
ATOM   345  C CD  . PRO A 1 45  ? 23.622 9.395   20.550  1.00 24.19 ? 44  PRO A CD  1 
ATOM   346  N N   . THR A 1 46  ? 24.479 6.352   17.117  1.00 20.43 ? 45  THR A N   1 
ATOM   347  C CA  . THR A 1 46  ? 25.521 5.581   16.461  1.00 18.59 ? 45  THR A CA  1 
ATOM   348  C C   . THR A 1 46  ? 25.309 5.789   14.971  1.00 15.79 ? 45  THR A C   1 
ATOM   349  O O   . THR A 1 46  ? 24.182 5.883   14.509  1.00 13.60 ? 45  THR A O   1 
ATOM   350  C CB  . THR A 1 46  ? 25.432 4.081   16.759  1.00 21.07 ? 45  THR A CB  1 
ATOM   351  O OG1 . THR A 1 46  ? 26.537 3.420   16.129  1.00 22.98 ? 45  THR A OG1 1 
ATOM   352  C CG2 . THR A 1 46  ? 24.141 3.496   16.196  1.00 20.09 ? 45  THR A CG2 1 
ATOM   353  N N   . THR A 1 47  ? 26.396 5.870   14.218  1.00 13.55 ? 46  THR A N   1 
ATOM   354  C CA  . THR A 1 47  ? 26.302 6.082   12.785  1.00 13.56 ? 46  THR A CA  1 
ATOM   355  C C   . THR A 1 47  ? 25.907 4.795   12.053  1.00 12.72 ? 46  THR A C   1 
ATOM   356  O O   . THR A 1 47  ? 26.442 3.740   12.359  1.00 12.09 ? 46  THR A O   1 
ATOM   357  C CB  . THR A 1 47  ? 27.671 6.517   12.209  1.00 12.77 ? 46  THR A CB  1 
ATOM   358  O OG1 . THR A 1 47  ? 28.136 7.699   12.880  1.00 13.53 ? 46  THR A OG1 1 
ATOM   359  C CG2 . THR A 1 47  ? 27.553 6.775   10.714  1.00 14.12 ? 46  THR A CG2 1 
ATOM   360  N N   . VAL A 1 48  ? 24.969 4.877   11.103  1.00 12.42 ? 47  VAL A N   1 
ATOM   361  C CA  . VAL A 1 48  ? 24.619 3.702   10.309  1.00 12.10 ? 47  VAL A CA  1 
ATOM   362  C C   . VAL A 1 48  ? 25.092 3.906   8.873   1.00 11.67 ? 47  VAL A C   1 
ATOM   363  O O   . VAL A 1 48  ? 25.304 2.931   8.141   1.00 12.21 ? 47  VAL A O   1 
ATOM   364  C CB  . VAL A 1 48  ? 23.092 3.357   10.319  1.00 12.14 ? 47  VAL A CB  1 
ATOM   365  C CG1 . VAL A 1 48  ? 22.707 2.757   11.655  1.00 12.33 ? 47  VAL A CG1 1 
ATOM   366  C CG2 . VAL A 1 48  ? 22.259 4.589   10.022  1.00 12.48 ? 47  VAL A CG2 1 
ATOM   367  N N   . ILE A 1 49  ? 25.240 5.167   8.468   1.00 11.99 ? 48  ILE A N   1 
ATOM   368  C CA  . ILE A 1 49  ? 25.732 5.516   7.126   1.00 12.75 ? 48  ILE A CA  1 
ATOM   369  C C   . ILE A 1 49  ? 26.629 6.733   7.201   1.00 13.11 ? 48  ILE A C   1 
ATOM   370  O O   . ILE A 1 49  ? 26.254 7.762   7.759   1.00 11.70 ? 48  ILE A O   1 
ATOM   371  C CB  . ILE A 1 49  ? 24.588 5.799   6.139   1.00 12.02 ? 48  ILE A CB  1 
ATOM   372  C CG1 . ILE A 1 49  ? 23.832 4.497   5.881   1.00 13.65 ? 48  ILE A CG1 1 
ATOM   373  C CG2 . ILE A 1 49  ? 25.129 6.324   4.811   1.00 12.80 ? 48  ILE A CG2 1 
ATOM   374  C CD1 . ILE A 1 49  ? 22.583 4.697   5.105   1.00 13.60 ? 48  ILE A CD1 1 
ATOM   375  N N   . PHE A 1 50  ? 27.817 6.594   6.617   1.00 12.88 ? 49  PHE A N   1 
ATOM   376  C CA  . PHE A 1 50  ? 28.816 7.645   6.615   1.00 14.65 ? 49  PHE A CA  1 
ATOM   377  C C   . PHE A 1 50  ? 29.087 8.074   5.173   1.00 14.43 ? 49  PHE A C   1 
ATOM   378  O O   . PHE A 1 50  ? 29.103 7.239   4.261   1.00 13.65 ? 49  PHE A O   1 
ATOM   379  C CB  . PHE A 1 50  ? 30.099 7.099   7.254   1.00 17.14 ? 49  PHE A CB  1 
ATOM   380  C CG  . PHE A 1 50  ? 31.172 8.125   7.459   1.00 19.80 ? 49  PHE A CG  1 
ATOM   381  C CD1 . PHE A 1 50  ? 30.935 9.257   8.237   1.00 20.85 ? 49  PHE A CD1 1 
ATOM   382  C CD2 . PHE A 1 50  ? 32.429 7.961   6.884   1.00 21.12 ? 49  PHE A CD2 1 
ATOM   383  C CE1 . PHE A 1 50  ? 31.940 10.219  8.437   1.00 21.10 ? 49  PHE A CE1 1 
ATOM   384  C CE2 . PHE A 1 50  ? 33.434 8.918   7.082   1.00 21.76 ? 49  PHE A CE2 1 
ATOM   385  C CZ  . PHE A 1 50  ? 33.187 10.043  7.857   1.00 21.90 ? 49  PHE A CZ  1 
ATOM   386  N N   . GLU A 1 51  ? 29.264 9.370   4.968   1.00 13.97 ? 50  GLU A N   1 
ATOM   387  C CA  . GLU A 1 51  ? 29.592 9.912   3.657   1.00 15.11 ? 50  GLU A CA  1 
ATOM   388  C C   . GLU A 1 51  ? 28.692 9.440   2.531   1.00 15.30 ? 50  GLU A C   1 
ATOM   389  O O   . GLU A 1 51  ? 29.137 8.783   1.584   1.00 13.60 ? 50  GLU A O   1 
ATOM   390  C CB  . GLU A 1 51  ? 31.061 9.593   3.340   1.00 17.44 ? 50  GLU A CB  1 
ATOM   391  C CG  . GLU A 1 51  ? 32.016 10.188  4.373   1.00 21.52 ? 50  GLU A CG  1 
ATOM   392  C CD  . GLU A 1 51  ? 33.486 10.002  4.017   1.00 23.25 ? 50  GLU A CD  1 
ATOM   393  O OE1 . GLU A 1 51  ? 33.939 8.850   3.842   1.00 25.89 ? 50  GLU A OE1 1 
ATOM   394  O OE2 . GLU A 1 51  ? 34.190 11.020  3.920   1.00 25.48 ? 50  GLU A OE2 1 
ATOM   395  N N   . ASP A 1 52  ? 27.419 9.802   2.664   1.00 13.54 ? 51  ASP A N   1 
ATOM   396  C CA  . ASP A 1 52  ? 26.352 9.494   1.716   1.00 14.68 ? 51  ASP A CA  1 
ATOM   397  C C   . ASP A 1 52  ? 25.865 8.051   1.643   1.00 13.95 ? 51  ASP A C   1 
ATOM   398  O O   . ASP A 1 52  ? 24.671 7.801   1.761   1.00 14.14 ? 51  ASP A O   1 
ATOM   399  C CB  . ASP A 1 52  ? 26.728 9.921   0.290   1.00 16.08 ? 51  ASP A CB  1 
ATOM   400  C CG  . ASP A 1 52  ? 27.087 11.385  0.185   1.00 18.43 ? 51  ASP A CG  1 
ATOM   401  O OD1 . ASP A 1 52  ? 26.362 12.235  0.756   1.00 19.76 ? 51  ASP A OD1 1 
ATOM   402  O OD2 . ASP A 1 52  ? 28.081 11.695  -0.508  1.00 18.90 ? 51  ASP A OD2 1 
ATOM   403  N N   . ASP A 1 53  ? 26.782 7.107   1.450   1.00 12.64 ? 52  ASP A N   1 
ATOM   404  C CA  . ASP A 1 53  ? 26.379 5.714   1.272   1.00 13.51 ? 52  ASP A CA  1 
ATOM   405  C C   . ASP A 1 53  ? 27.341 4.647   1.806   1.00 13.77 ? 52  ASP A C   1 
ATOM   406  O O   . ASP A 1 53  ? 27.259 3.479   1.419   1.00 13.08 ? 52  ASP A O   1 
ATOM   407  C CB  . ASP A 1 53  ? 26.136 5.523   -0.226  1.00 13.25 ? 52  ASP A CB  1 
ATOM   408  C CG  . ASP A 1 53  ? 27.304 6.067   -1.067  1.00 15.72 ? 52  ASP A CG  1 
ATOM   409  O OD1 . ASP A 1 53  ? 28.469 5.915   -0.628  1.00 12.46 ? 52  ASP A OD1 1 
ATOM   410  O OD2 . ASP A 1 53  ? 27.063 6.645   -2.149  1.00 15.95 ? 52  ASP A OD2 1 
ATOM   411  N N   . HIS A 1 54  ? 28.252 5.036   2.691   1.00 13.75 ? 53  HIS A N   1 
ATOM   412  C CA  . HIS A 1 54  ? 29.187 4.072   3.257   1.00 15.80 ? 53  HIS A CA  1 
ATOM   413  C C   . HIS A 1 54  ? 28.611 3.499   4.529   1.00 15.30 ? 53  HIS A C   1 
ATOM   414  O O   . HIS A 1 54  ? 28.051 4.213   5.347   1.00 14.33 ? 53  HIS A O   1 
ATOM   415  C CB  . HIS A 1 54  ? 30.543 4.720   3.548   1.00 17.97 ? 53  HIS A CB  1 
ATOM   416  C CG  . HIS A 1 54  ? 31.257 5.201   2.326   1.00 21.27 ? 53  HIS A CG  1 
ATOM   417  N ND1 . HIS A 1 54  ? 30.820 6.276   1.581   1.00 23.34 ? 53  HIS A ND1 1 
ATOM   418  C CD2 . HIS A 1 54  ? 32.361 4.732   1.699   1.00 23.55 ? 53  HIS A CD2 1 
ATOM   419  C CE1 . HIS A 1 54  ? 31.624 6.449   0.547   1.00 24.51 ? 53  HIS A CE1 1 
ATOM   420  N NE2 . HIS A 1 54  ? 32.568 5.524   0.595   1.00 25.75 ? 53  HIS A NE2 1 
ATOM   421  N N   . ARG A 1 55  ? 28.740 2.194   4.691   1.00 15.67 ? 54  ARG A N   1 
ATOM   422  C CA  . ARG A 1 55  ? 28.216 1.548   5.875   1.00 16.28 ? 54  ARG A CA  1 
ATOM   423  C C   . ARG A 1 55  ? 29.386 1.175   6.776   1.00 16.77 ? 54  ARG A C   1 
ATOM   424  O O   . ARG A 1 55  ? 30.233 0.337   6.426   1.00 16.83 ? 54  ARG A O   1 
ATOM   425  C CB  . ARG A 1 55  ? 27.382 0.341   5.432   1.00 18.30 ? 54  ARG A CB  1 
ATOM   426  C CG  . ARG A 1 55  ? 26.714 -0.478  6.511   1.00 20.73 ? 54  ARG A CG  1 
ATOM   427  C CD  . ARG A 1 55  ? 25.708 -1.427  5.840   1.00 18.74 ? 54  ARG A CD  1 
ATOM   428  N NE  . ARG A 1 55  ? 26.283 -2.023  4.636   1.00 20.84 ? 54  ARG A NE  1 
ATOM   429  C CZ  . ARG A 1 55  ? 27.224 -2.962  4.627   1.00 21.61 ? 54  ARG A CZ  1 
ATOM   430  N NH1 . ARG A 1 55  ? 27.715 -3.443  5.760   1.00 21.92 ? 54  ARG A NH1 1 
ATOM   431  N NH2 . ARG A 1 55  ? 27.697 -3.408  3.473   1.00 22.01 ? 54  ARG A NH2 1 
ATOM   432  N N   . PRO A 1 56  ? 29.484 1.831   7.938   1.00 16.90 ? 55  PRO A N   1 
ATOM   433  C CA  . PRO A 1 56  ? 30.588 1.516   8.846   1.00 18.69 ? 55  PRO A CA  1 
ATOM   434  C C   . PRO A 1 56  ? 30.569 0.049   9.258   1.00 19.25 ? 55  PRO A C   1 
ATOM   435  O O   . PRO A 1 56  ? 29.499 -0.567  9.376   1.00 18.26 ? 55  PRO A O   1 
ATOM   436  C CB  . PRO A 1 56  ? 30.351 2.478   10.017  1.00 18.50 ? 55  PRO A CB  1 
ATOM   437  C CG  . PRO A 1 56  ? 28.836 2.651   9.997   1.00 19.64 ? 55  PRO A CG  1 
ATOM   438  C CD  . PRO A 1 56  ? 28.633 2.887   8.516   1.00 17.45 ? 55  PRO A CD  1 
ATOM   439  N N   . SER A 1 57  ? 31.763 -0.503  9.469   1.00 20.58 ? 56  SER A N   1 
ATOM   440  C CA  . SER A 1 57  ? 31.923 -1.899  9.869   1.00 21.22 ? 56  SER A CA  1 
ATOM   441  C C   . SER A 1 57  ? 31.012 -2.236  11.046  1.00 21.45 ? 56  SER A C   1 
ATOM   442  O O   . SER A 1 57  ? 30.922 -1.478  12.005  1.00 21.67 ? 56  SER A O   1 
ATOM   443  C CB  . SER A 1 57  ? 33.385 -2.167  10.247  1.00 22.02 ? 56  SER A CB  1 
ATOM   444  O OG  . SER A 1 57  ? 33.548 -3.481  10.750  1.00 23.33 ? 56  SER A OG  1 
ATOM   445  N N   . GLY A 1 58  ? 30.338 -3.379  10.960  1.00 21.57 ? 57  GLY A N   1 
ATOM   446  C CA  . GLY A 1 58  ? 29.437 -3.787  12.020  1.00 20.67 ? 57  GLY A CA  1 
ATOM   447  C C   . GLY A 1 58  ? 27.968 -3.534  11.711  1.00 19.83 ? 57  GLY A C   1 
ATOM   448  O O   . GLY A 1 58  ? 27.097 -4.252  12.202  1.00 19.82 ? 57  GLY A O   1 
ATOM   449  N N   . VAL A 1 59  ? 27.678 -2.504  10.921  1.00 18.14 ? 58  VAL A N   1 
ATOM   450  C CA  . VAL A 1 59  ? 26.292 -2.188  10.569  1.00 17.22 ? 58  VAL A CA  1 
ATOM   451  C C   . VAL A 1 59  ? 25.820 -3.149  9.456   1.00 17.13 ? 58  VAL A C   1 
ATOM   452  O O   . VAL A 1 59  ? 26.455 -3.252  8.408   1.00 17.41 ? 58  VAL A O   1 
ATOM   453  C CB  . VAL A 1 59  ? 26.157 -0.713  10.081  1.00 16.05 ? 58  VAL A CB  1 
ATOM   454  C CG1 . VAL A 1 59  ? 24.707 -0.399  9.757   1.00 13.96 ? 58  VAL A CG1 1 
ATOM   455  C CG2 . VAL A 1 59  ? 26.676 0.252   11.159  1.00 13.95 ? 58  VAL A CG2 1 
ATOM   456  N N   . PRO A 1 60  ? 24.710 -3.868  9.685   1.00 17.55 ? 59  PRO A N   1 
ATOM   457  C CA  . PRO A 1 60  ? 24.122 -4.831  8.742   1.00 16.99 ? 59  PRO A CA  1 
ATOM   458  C C   . PRO A 1 60  ? 23.813 -4.250  7.375   1.00 16.28 ? 59  PRO A C   1 
ATOM   459  O O   . PRO A 1 60  ? 23.342 -3.112  7.278   1.00 15.50 ? 59  PRO A O   1 
ATOM   460  C CB  . PRO A 1 60  ? 22.868 -5.299  9.481   1.00 18.10 ? 59  PRO A CB  1 
ATOM   461  C CG  . PRO A 1 60  ? 22.552 -4.107  10.387  1.00 19.20 ? 59  PRO A CG  1 
ATOM   462  C CD  . PRO A 1 60  ? 23.913 -3.836  10.920  1.00 17.96 ? 59  PRO A CD  1 
ATOM   463  N N   . ASP A 1 61  ? 24.059 -5.021  6.310   1.00 15.70 ? 60  ASP A N   1 
ATOM   464  C CA  . ASP A 1 61  ? 23.806 -4.481  4.971   1.00 14.75 ? 60  ASP A CA  1 
ATOM   465  C C   . ASP A 1 61  ? 22.351 -4.222  4.617   1.00 14.61 ? 60  ASP A C   1 
ATOM   466  O O   . ASP A 1 61  ? 22.072 -3.789  3.508   1.00 13.32 ? 60  ASP A O   1 
ATOM   467  C CB  . ASP A 1 61  ? 24.458 -5.316  3.846   1.00 13.60 ? 60  ASP A CB  1 
ATOM   468  C CG  . ASP A 1 61  ? 23.971 -6.747  3.779   1.00 13.04 ? 60  ASP A CG  1 
ATOM   469  O OD1 . ASP A 1 61  ? 22.837 -7.052  4.198   1.00 13.91 ? 60  ASP A OD1 1 
ATOM   470  O OD2 . ASP A 1 61  ? 24.738 -7.577  3.246   1.00 13.86 ? 60  ASP A OD2 1 
ATOM   471  N N   . ARG A 1 62  ? 21.433 -4.470  5.551   1.00 15.28 ? 61  ARG A N   1 
ATOM   472  C CA  . ARG A 1 62  ? 20.019 -4.197  5.302   1.00 15.07 ? 61  ARG A CA  1 
ATOM   473  C C   . ARG A 1 62  ? 19.849 -2.663  5.288   1.00 14.14 ? 61  ARG A C   1 
ATOM   474  O O   . ARG A 1 62  ? 18.850 -2.143  4.805   1.00 13.70 ? 61  ARG A O   1 
ATOM   475  C CB  . ARG A 1 62  ? 19.108 -4.831  6.388   1.00 16.15 ? 61  ARG A CB  1 
ATOM   476  C CG  . ARG A 1 62  ? 18.881 -3.973  7.642   1.00 18.91 ? 61  ARG A CG  1 
ATOM   477  C CD  . ARG A 1 62  ? 17.985 -4.656  8.692   1.00 20.35 ? 61  ARG A CD  1 
ATOM   478  N NE  . ARG A 1 62  ? 18.664 -5.833  9.214   1.00 21.44 ? 61  ARG A NE  1 
ATOM   479  C CZ  . ARG A 1 62  ? 19.180 -5.955  10.433  1.00 20.04 ? 61  ARG A CZ  1 
ATOM   480  N NH1 . ARG A 1 62  ? 19.108 -4.971  11.317  1.00 21.17 ? 61  ARG A NH1 1 
ATOM   481  N NH2 . ARG A 1 62  ? 19.826 -7.064  10.741  1.00 19.85 ? 61  ARG A NH2 1 
ATOM   482  N N   . PHE A 1 63  ? 20.837 -1.952  5.834   1.00 14.07 ? 62  PHE A N   1 
ATOM   483  C CA  . PHE A 1 63  ? 20.838 -0.482  5.858   1.00 12.47 ? 62  PHE A CA  1 
ATOM   484  C C   . PHE A 1 63  ? 21.598 0.082   4.659   1.00 12.45 ? 62  PHE A C   1 
ATOM   485  O O   . PHE A 1 63  ? 22.743 -0.317  4.418   1.00 13.01 ? 62  PHE A O   1 
ATOM   486  C CB  . PHE A 1 63  ? 21.543 0.069   7.105   1.00 12.09 ? 62  PHE A CB  1 
ATOM   487  C CG  . PHE A 1 63  ? 20.794 -0.148  8.370   1.00 11.81 ? 62  PHE A CG  1 
ATOM   488  C CD1 . PHE A 1 63  ? 20.856 -1.370  9.032   1.00 12.55 ? 62  PHE A CD1 1 
ATOM   489  C CD2 . PHE A 1 63  ? 19.995 0.865   8.885   1.00 11.82 ? 62  PHE A CD2 1 
ATOM   490  C CE1 . PHE A 1 63  ? 20.124 -1.581  10.200  1.00 13.89 ? 62  PHE A CE1 1 
ATOM   491  C CE2 . PHE A 1 63  ? 19.255 0.672   10.051  1.00 12.83 ? 62  PHE A CE2 1 
ATOM   492  C CZ  . PHE A 1 63  ? 19.318 -0.552  10.710  1.00 12.87 ? 62  PHE A CZ  1 
ATOM   493  N N   . SER A 1 64  ? 20.992 1.021   3.932   1.00 9.97  ? 63  SER A N   1 
ATOM   494  C CA  . SER A 1 64  ? 21.686 1.617   2.795   1.00 10.67 ? 63  SER A CA  1 
ATOM   495  C C   . SER A 1 64  ? 21.359 3.100   2.640   1.00 10.29 ? 63  SER A C   1 
ATOM   496  O O   . SER A 1 64  ? 20.263 3.547   2.935   1.00 9.10  ? 63  SER A O   1 
ATOM   497  C CB  . SER A 1 64  ? 21.370 0.859   1.495   1.00 10.69 ? 63  SER A CB  1 
ATOM   498  O OG  . SER A 1 64  ? 20.027 1.054   1.088   1.00 14.06 ? 63  SER A OG  1 
ATOM   499  N N   . GLY A 1 65  ? 22.344 3.874   2.210   1.00 10.66 ? 64  GLY A N   1 
ATOM   500  C CA  . GLY A 1 65  ? 22.098 5.286   2.028   1.00 11.17 ? 64  GLY A CA  1 
ATOM   501  C C   . GLY A 1 65  ? 22.222 5.639   0.563   1.00 11.96 ? 64  GLY A C   1 
ATOM   502  O O   . GLY A 1 65  ? 22.989 5.016   -0.162  1.00 10.97 ? 64  GLY A O   1 
ATOM   503  N N   . SER A 1 66  ? 21.447 6.622   0.124   1.00 13.19 ? 65  SER A N   1 
ATOM   504  C CA  . SER A 1 66  ? 21.498 7.087   -1.257  1.00 14.35 ? 65  SER A CA  1 
ATOM   505  C C   . SER A 1 66  ? 21.245 8.587   -1.304  1.00 15.74 ? 65  SER A C   1 
ATOM   506  O O   . SER A 1 66  ? 20.721 9.174   -0.350  1.00 14.85 ? 65  SER A O   1 
ATOM   507  C CB  . SER A 1 66  ? 20.480 6.345   -2.143  1.00 14.46 ? 65  SER A CB  1 
ATOM   508  O OG  . SER A 1 66  ? 19.142 6.543   -1.719  1.00 14.47 ? 65  SER A OG  1 
ATOM   509  N N   . VAL A 1 67  ? 21.656 9.192   -2.417  1.00 17.19 ? 66  VAL A N   1 
ATOM   510  C CA  . VAL A 1 67  ? 21.510 10.620  -2.660  1.00 18.63 ? 66  VAL A CA  1 
ATOM   511  C C   . VAL A 1 67  ? 20.870 10.792  -4.030  1.00 19.28 ? 66  VAL A C   1 
ATOM   512  O O   . VAL A 1 67  ? 21.362 10.254  -5.018  1.00 19.83 ? 66  VAL A O   1 
ATOM   513  C CB  . VAL A 1 67  ? 22.883 11.333  -2.661  1.00 18.83 ? 66  VAL A CB  1 
ATOM   514  C CG1 . VAL A 1 67  ? 22.713 12.802  -3.027  1.00 19.70 ? 66  VAL A CG1 1 
ATOM   515  C CG2 . VAL A 1 67  ? 23.545 11.208  -1.288  1.00 18.15 ? 66  VAL A CG2 1 
ATOM   516  N N   . ASP A 1 68  A 19.763 11.516  -4.091  1.00 20.15 ? 66  ASP A N   1 
ATOM   517  C CA  . ASP A 1 68  A 19.101 11.749  -5.367  1.00 21.82 ? 66  ASP A CA  1 
ATOM   518  C C   . ASP A 1 68  A 19.271 13.214  -5.771  1.00 21.83 ? 66  ASP A C   1 
ATOM   519  O O   . ASP A 1 68  A 18.642 14.108  -5.210  1.00 22.27 ? 66  ASP A O   1 
ATOM   520  C CB  . ASP A 1 68  A 17.617 11.389  -5.281  1.00 23.31 ? 66  ASP A CB  1 
ATOM   521  C CG  . ASP A 1 68  A 16.848 11.762  -6.546  1.00 24.75 ? 66  ASP A CG  1 
ATOM   522  O OD1 . ASP A 1 68  A 17.419 12.455  -7.416  1.00 26.11 ? 66  ASP A OD1 1 
ATOM   523  O OD2 . ASP A 1 68  A 15.667 11.376  -6.660  1.00 26.22 ? 66  ASP A OD2 1 
ATOM   524  N N   . THR A 1 69  B 20.130 13.453  -6.751  1.00 22.45 ? 66  THR A N   1 
ATOM   525  C CA  . THR A 1 69  B 20.389 14.811  -7.212  1.00 22.44 ? 66  THR A CA  1 
ATOM   526  C C   . THR A 1 69  B 19.137 15.565  -7.687  1.00 22.81 ? 66  THR A C   1 
ATOM   527  O O   . THR A 1 69  B 18.885 16.697  -7.260  1.00 23.55 ? 66  THR A O   1 
ATOM   528  C CB  . THR A 1 69  B 21.435 14.794  -8.348  1.00 22.21 ? 66  THR A CB  1 
ATOM   529  O OG1 . THR A 1 69  B 22.633 14.163  -7.875  1.00 21.63 ? 66  THR A OG1 1 
ATOM   530  C CG2 . THR A 1 69  B 21.763 16.211  -8.812  1.00 22.52 ? 66  THR A CG2 1 
ATOM   531  N N   . SER A 1 70  ? 18.350 14.946  -8.563  1.00 22.79 ? 67  SER A N   1 
ATOM   532  C CA  . SER A 1 70  ? 17.155 15.602  -9.098  1.00 22.05 ? 67  SER A CA  1 
ATOM   533  C C   . SER A 1 70  ? 16.144 16.076  -8.053  1.00 22.15 ? 67  SER A C   1 
ATOM   534  O O   . SER A 1 70  ? 15.506 17.119  -8.242  1.00 20.28 ? 67  SER A O   1 
ATOM   535  C CB  . SER A 1 70  ? 16.444 14.690  -10.101 1.00 22.13 ? 67  SER A CB  1 
ATOM   536  O OG  . SER A 1 70  ? 15.979 13.518  -9.463  1.00 22.76 ? 67  SER A OG  1 
ATOM   537  N N   . SER A 1 71  ? 15.985 15.330  -6.959  1.00 22.53 ? 68  SER A N   1 
ATOM   538  C CA  . SER A 1 71  ? 15.023 15.725  -5.918  1.00 23.11 ? 68  SER A CA  1 
ATOM   539  C C   . SER A 1 71  ? 15.702 16.461  -4.767  1.00 23.12 ? 68  SER A C   1 
ATOM   540  O O   . SER A 1 71  ? 15.048 16.849  -3.792  1.00 23.83 ? 68  SER A O   1 
ATOM   541  C CB  . SER A 1 71  ? 14.288 14.506  -5.357  1.00 23.79 ? 68  SER A CB  1 
ATOM   542  O OG  . SER A 1 71  ? 15.173 13.676  -4.616  1.00 26.16 ? 68  SER A OG  1 
ATOM   543  N N   . ASN A 1 72  ? 17.010 16.643  -4.907  1.00 22.06 ? 69  ASN A N   1 
ATOM   544  C CA  . ASN A 1 72  ? 17.860 17.303  -3.925  1.00 22.88 ? 69  ASN A CA  1 
ATOM   545  C C   . ASN A 1 72  ? 17.652 16.723  -2.520  1.00 22.54 ? 69  ASN A C   1 
ATOM   546  O O   . ASN A 1 72  ? 17.641 17.452  -1.519  1.00 23.03 ? 69  ASN A O   1 
ATOM   547  C CB  . ASN A 1 72  ? 17.600 18.813  -3.945  1.00 22.32 ? 69  ASN A CB  1 
ATOM   548  C CG  . ASN A 1 72  ? 18.646 19.595  -3.193  1.00 24.05 ? 69  ASN A CG  1 
ATOM   549  O OD1 . ASN A 1 72  ? 19.834 19.546  -3.519  1.00 23.91 ? 69  ASN A OD1 1 
ATOM   550  N ND2 . ASN A 1 72  ? 18.209 20.339  -2.178  1.00 24.84 ? 69  ASN A ND2 1 
ATOM   551  N N   . SER A 1 73  ? 17.507 15.404  -2.451  1.00 22.11 ? 70  SER A N   1 
ATOM   552  C CA  . SER A 1 73  ? 17.279 14.723  -1.177  1.00 21.50 ? 70  SER A CA  1 
ATOM   553  C C   . SER A 1 73  ? 18.204 13.524  -1.008  1.00 20.97 ? 70  SER A C   1 
ATOM   554  O O   . SER A 1 73  ? 18.883 13.124  -1.948  1.00 21.81 ? 70  SER A O   1 
ATOM   555  C CB  . SER A 1 73  ? 15.832 14.230  -1.096  1.00 21.31 ? 70  SER A CB  1 
ATOM   556  O OG  . SER A 1 73  ? 15.576 13.206  -2.051  1.00 21.22 ? 70  SER A OG  1 
ATOM   557  N N   . ALA A 1 74  ? 18.214 12.962  0.199   1.00 19.34 ? 71  ALA A N   1 
ATOM   558  C CA  . ALA A 1 74  ? 19.012 11.785  0.517   1.00 17.96 ? 71  ALA A CA  1 
ATOM   559  C C   . ALA A 1 74  ? 18.073 10.788  1.191   1.00 16.73 ? 71  ALA A C   1 
ATOM   560  O O   . ALA A 1 74  ? 17.056 11.180  1.776   1.00 16.89 ? 71  ALA A O   1 
ATOM   561  C CB  . ALA A 1 74  ? 20.140 12.148  1.461   1.00 15.08 ? 71  ALA A CB  1 
ATOM   562  N N   . SER A 1 75  ? 18.388 9.500   1.113   1.00 15.49 ? 72  SER A N   1 
ATOM   563  C CA  . SER A 1 75  ? 17.521 8.524   1.745   1.00 14.14 ? 72  SER A CA  1 
ATOM   564  C C   . SER A 1 75  ? 18.236 7.403   2.486   1.00 14.27 ? 72  SER A C   1 
ATOM   565  O O   . SER A 1 75  ? 19.305 6.951   2.071   1.00 13.85 ? 72  SER A O   1 
ATOM   566  C CB  . SER A 1 75  ? 16.601 7.883   0.710   1.00 15.77 ? 72  SER A CB  1 
ATOM   567  O OG  . SER A 1 75  ? 15.781 8.839   0.093   1.00 17.74 ? 72  SER A OG  1 
ATOM   568  N N   . LEU A 1 76  ? 17.631 6.975   3.590   1.00 12.99 ? 73  LEU A N   1 
ATOM   569  C CA  . LEU A 1 76  ? 18.117 5.852   4.376   1.00 14.60 ? 73  LEU A CA  1 
ATOM   570  C C   . LEU A 1 76  ? 17.096 4.728   4.161   1.00 15.41 ? 73  LEU A C   1 
ATOM   571  O O   . LEU A 1 76  ? 15.937 4.823   4.579   1.00 13.67 ? 73  LEU A O   1 
ATOM   572  C CB  . LEU A 1 76  ? 18.178 6.194   5.869   1.00 13.88 ? 73  LEU A CB  1 
ATOM   573  C CG  . LEU A 1 76  ? 18.519 5.030   6.802   1.00 14.43 ? 73  LEU A CG  1 
ATOM   574  C CD1 . LEU A 1 76  ? 19.885 4.456   6.480   1.00 11.85 ? 73  LEU A CD1 1 
ATOM   575  C CD2 . LEU A 1 76  ? 18.485 5.518   8.246   1.00 14.73 ? 73  LEU A CD2 1 
ATOM   576  N N   . THR A 1 77  ? 17.517 3.654   3.514   1.00 14.62 ? 74  THR A N   1 
ATOM   577  C CA  . THR A 1 77  ? 16.599 2.554   3.270   1.00 15.81 ? 74  THR A CA  1 
ATOM   578  C C   . THR A 1 77  ? 16.987 1.372   4.126   1.00 15.50 ? 74  THR A C   1 
ATOM   579  O O   . THR A 1 77  ? 18.164 1.081   4.309   1.00 15.59 ? 74  THR A O   1 
ATOM   580  C CB  . THR A 1 77  ? 16.603 2.140   1.783   1.00 15.26 ? 74  THR A CB  1 
ATOM   581  O OG1 . THR A 1 77  ? 16.259 3.276   0.965   1.00 15.71 ? 74  THR A OG1 1 
ATOM   582  C CG2 . THR A 1 77  ? 15.593 1.028   1.544   1.00 15.00 ? 74  THR A CG2 1 
ATOM   583  N N   . ILE A 1 78  ? 15.985 0.708   4.680   1.00 15.97 ? 75  ILE A N   1 
ATOM   584  C CA  . ILE A 1 78  ? 16.202 -0.457  5.506   1.00 16.56 ? 75  ILE A CA  1 
ATOM   585  C C   . ILE A 1 78  ? 15.387 -1.594  4.898   1.00 17.69 ? 75  ILE A C   1 
ATOM   586  O O   . ILE A 1 78  ? 14.157 -1.541  4.861   1.00 18.83 ? 75  ILE A O   1 
ATOM   587  C CB  . ILE A 1 78  ? 15.747 -0.221  6.975   1.00 16.30 ? 75  ILE A CB  1 
ATOM   588  C CG1 . ILE A 1 78  ? 16.523 0.945   7.592   1.00 16.44 ? 75  ILE A CG1 1 
ATOM   589  C CG2 . ILE A 1 78  ? 15.986 -1.462  7.780   1.00 16.02 ? 75  ILE A CG2 1 
ATOM   590  C CD1 . ILE A 1 78  ? 16.221 1.181   9.054   1.00 14.57 ? 75  ILE A CD1 1 
ATOM   591  N N   . SER A 1 79  ? 16.090 -2.610  4.418   1.00 19.00 ? 76  SER A N   1 
ATOM   592  C CA  . SER A 1 79  ? 15.472 -3.767  3.787   1.00 21.37 ? 76  SER A CA  1 
ATOM   593  C C   . SER A 1 79  ? 15.355 -4.909  4.780   1.00 21.85 ? 76  SER A C   1 
ATOM   594  O O   . SER A 1 79  ? 16.323 -5.243  5.468   1.00 24.85 ? 76  SER A O   1 
ATOM   595  C CB  . SER A 1 79  ? 16.329 -4.209  2.596   1.00 21.87 ? 76  SER A CB  1 
ATOM   596  O OG  . SER A 1 79  ? 16.561 -3.111  1.727   1.00 24.66 ? 76  SER A OG  1 
ATOM   597  N N   . GLY A 1 80  ? 14.172 -5.506  4.866   1.00 21.52 ? 77  GLY A N   1 
ATOM   598  C CA  . GLY A 1 80  ? 13.985 -6.616  5.785   1.00 21.41 ? 77  GLY A CA  1 
ATOM   599  C C   . GLY A 1 80  ? 14.102 -6.235  7.250   1.00 20.89 ? 77  GLY A C   1 
ATOM   600  O O   . GLY A 1 80  ? 14.900 -6.818  7.993   1.00 22.29 ? 77  GLY A O   1 
ATOM   601  N N   . LEU A 1 81  ? 13.303 -5.259  7.666   1.00 20.60 ? 78  LEU A N   1 
ATOM   602  C CA  . LEU A 1 81  ? 13.306 -4.802  9.056   1.00 20.70 ? 78  LEU A CA  1 
ATOM   603  C C   . LEU A 1 81  ? 13.341 -5.928  10.091  1.00 20.86 ? 78  LEU A C   1 
ATOM   604  O O   . LEU A 1 81  ? 12.772 -7.006  9.891   1.00 20.20 ? 78  LEU A O   1 
ATOM   605  C CB  . LEU A 1 81  ? 12.064 -3.958  9.346   1.00 20.49 ? 78  LEU A CB  1 
ATOM   606  C CG  . LEU A 1 81  ? 11.857 -2.549  8.804   1.00 21.24 ? 78  LEU A CG  1 
ATOM   607  C CD1 . LEU A 1 81  ? 10.459 -2.075  9.187   1.00 22.65 ? 78  LEU A CD1 1 
ATOM   608  C CD2 . LEU A 1 81  ? 12.910 -1.605  9.391   1.00 21.44 ? 78  LEU A CD2 1 
ATOM   609  N N   . LYS A 1 82  ? 14.007 -5.650  11.206  1.00 21.10 ? 79  LYS A N   1 
ATOM   610  C CA  . LYS A 1 82  ? 14.093 -6.568  12.332  1.00 20.98 ? 79  LYS A CA  1 
ATOM   611  C C   . LYS A 1 82  ? 13.650 -5.717  13.516  1.00 22.25 ? 79  LYS A C   1 
ATOM   612  O O   . LYS A 1 82  ? 13.738 -4.489  13.463  1.00 22.97 ? 79  LYS A O   1 
ATOM   613  C CB  . LYS A 1 82  ? 15.522 -7.078  12.522  1.00 21.92 ? 79  LYS A CB  1 
ATOM   614  C CG  . LYS A 1 82  ? 15.990 -8.057  11.438  1.00 21.22 ? 79  LYS A CG  1 
ATOM   615  C CD  . LYS A 1 82  ? 17.385 -8.605  11.769  1.00 21.92 ? 79  LYS A CD  1 
ATOM   616  C CE  . LYS A 1 82  ? 17.931 -9.543  10.682  1.00 20.72 ? 79  LYS A CE  1 
ATOM   617  N NZ  . LYS A 1 82  ? 17.123 -10.780 10.465  1.00 22.76 ? 79  LYS A NZ  1 
ATOM   618  N N   . THR A 1 83  ? 13.144 -6.341  14.575  1.00 22.75 ? 80  THR A N   1 
ATOM   619  C CA  . THR A 1 83  ? 12.683 -5.558  15.717  1.00 23.31 ? 80  THR A CA  1 
ATOM   620  C C   . THR A 1 83  ? 13.789 -4.683  16.304  1.00 23.12 ? 80  THR A C   1 
ATOM   621  O O   . THR A 1 83  ? 13.529 -3.570  16.748  1.00 22.34 ? 80  THR A O   1 
ATOM   622  C CB  . THR A 1 83  ? 12.074 -6.471  16.804  1.00 23.81 ? 80  THR A CB  1 
ATOM   623  O OG1 . THR A 1 83  ? 12.966 -7.558  17.087  1.00 24.11 ? 80  THR A OG1 1 
ATOM   624  C CG2 . THR A 1 83  ? 10.747 -7.029  16.321  1.00 23.92 ? 80  THR A CG2 1 
ATOM   625  N N   . GLU A 1 84  ? 15.019 -5.192  16.278  1.00 23.48 ? 81  GLU A N   1 
ATOM   626  C CA  . GLU A 1 84  ? 16.191 -4.478  16.786  1.00 23.36 ? 81  GLU A CA  1 
ATOM   627  C C   . GLU A 1 84  ? 16.388 -3.114  16.107  1.00 23.15 ? 81  GLU A C   1 
ATOM   628  O O   . GLU A 1 84  ? 17.084 -2.251  16.645  1.00 24.01 ? 81  GLU A O   1 
ATOM   629  C CB  . GLU A 1 84  ? 17.446 -5.332  16.562  1.00 24.21 ? 81  GLU A CB  1 
ATOM   630  C CG  . GLU A 1 84  ? 17.825 -5.477  15.095  1.00 26.85 ? 81  GLU A CG  1 
ATOM   631  C CD  . GLU A 1 84  ? 18.718 -6.672  14.817  1.00 28.92 ? 81  GLU A CD  1 
ATOM   632  O OE1 . GLU A 1 84  ? 18.296 -7.802  15.149  1.00 28.55 ? 81  GLU A OE1 1 
ATOM   633  O OE2 . GLU A 1 84  ? 19.830 -6.492  14.255  1.00 30.29 ? 81  GLU A OE2 1 
ATOM   634  N N   . ASP A 1 85  ? 15.777 -2.922  14.938  1.00 21.25 ? 82  ASP A N   1 
ATOM   635  C CA  . ASP A 1 85  ? 15.918 -1.670  14.190  1.00 19.82 ? 82  ASP A CA  1 
ATOM   636  C C   . ASP A 1 85  ? 14.991 -0.544  14.646  1.00 19.42 ? 82  ASP A C   1 
ATOM   637  O O   . ASP A 1 85  ? 15.032 0.560   14.098  1.00 18.64 ? 82  ASP A O   1 
ATOM   638  C CB  . ASP A 1 85  ? 15.715 -1.903  12.682  1.00 18.67 ? 82  ASP A CB  1 
ATOM   639  C CG  . ASP A 1 85  ? 16.567 -3.016  12.145  1.00 18.41 ? 82  ASP A CG  1 
ATOM   640  O OD1 . ASP A 1 85  ? 17.654 -3.251  12.720  1.00 17.71 ? 82  ASP A OD1 1 
ATOM   641  O OD2 . ASP A 1 85  ? 16.165 -3.645  11.129  1.00 16.30 ? 82  ASP A OD2 1 
ATOM   642  N N   . GLU A 1 86  ? 14.149 -0.818  15.637  1.00 19.07 ? 83  GLU A N   1 
ATOM   643  C CA  . GLU A 1 86  ? 13.241 0.202   16.139  1.00 19.13 ? 83  GLU A CA  1 
ATOM   644  C C   . GLU A 1 86  ? 14.084 1.323   16.761  1.00 18.78 ? 83  GLU A C   1 
ATOM   645  O O   . GLU A 1 86  ? 14.885 1.068   17.654  1.00 18.56 ? 83  GLU A O   1 
ATOM   646  C CB  . GLU A 1 86  ? 12.310 -0.406  17.189  1.00 19.48 ? 83  GLU A CB  1 
ATOM   647  C CG  . GLU A 1 86  ? 11.241 0.535   17.709  1.00 19.53 ? 83  GLU A CG  1 
ATOM   648  C CD  . GLU A 1 86  ? 10.168 -0.218  18.483  1.00 19.77 ? 83  GLU A CD  1 
ATOM   649  O OE1 . GLU A 1 86  ? 9.530  -1.108  17.879  1.00 18.74 ? 83  GLU A OE1 1 
ATOM   650  O OE2 . GLU A 1 86  ? 9.969  0.073   19.679  1.00 20.07 ? 83  GLU A OE2 1 
ATOM   651  N N   . ALA A 1 87  ? 13.906 2.550   16.290  1.00 19.05 ? 84  ALA A N   1 
ATOM   652  C CA  . ALA A 1 87  ? 14.693 3.670   16.817  1.00 19.23 ? 84  ALA A CA  1 
ATOM   653  C C   . ALA A 1 87  ? 14.366 4.989   16.136  1.00 18.54 ? 84  ALA A C   1 
ATOM   654  O O   . ALA A 1 87  ? 13.512 5.046   15.256  1.00 19.09 ? 84  ALA A O   1 
ATOM   655  C CB  . ALA A 1 87  ? 16.185 3.371   16.642  1.00 18.85 ? 84  ALA A CB  1 
ATOM   656  N N   . ASP A 1 88  ? 15.057 6.051   16.558  1.00 18.07 ? 85  ASP A N   1 
ATOM   657  C CA  . ASP A 1 88  ? 14.924 7.374   15.949  1.00 17.56 ? 85  ASP A CA  1 
ATOM   658  C C   . ASP A 1 88  ? 16.094 7.451   14.971  1.00 16.86 ? 85  ASP A C   1 
ATOM   659  O O   . ASP A 1 88  ? 17.190 6.991   15.293  1.00 16.39 ? 85  ASP A O   1 
ATOM   660  C CB  . ASP A 1 88  ? 15.097 8.510   16.969  1.00 19.01 ? 85  ASP A CB  1 
ATOM   661  C CG  . ASP A 1 88  ? 13.903 8.674   17.882  1.00 19.89 ? 85  ASP A CG  1 
ATOM   662  O OD1 . ASP A 1 88  ? 12.793 8.887   17.359  1.00 20.09 ? 85  ASP A OD1 1 
ATOM   663  O OD2 . ASP A 1 88  ? 14.090 8.606   19.118  1.00 21.01 ? 85  ASP A OD2 1 
ATOM   664  N N   . TYR A 1 89  ? 15.852 7.996   13.784  1.00 16.32 ? 86  TYR A N   1 
ATOM   665  C CA  . TYR A 1 89  ? 16.899 8.127   12.765  1.00 16.03 ? 86  TYR A CA  1 
ATOM   666  C C   . TYR A 1 89  ? 17.028 9.576   12.342  1.00 15.15 ? 86  TYR A C   1 
ATOM   667  O O   . TYR A 1 89  ? 16.022 10.238  12.060  1.00 15.64 ? 86  TYR A O   1 
ATOM   668  C CB  . TYR A 1 89  ? 16.589 7.279   11.513  1.00 15.51 ? 86  TYR A CB  1 
ATOM   669  C CG  . TYR A 1 89  ? 16.644 5.801   11.752  1.00 15.61 ? 86  TYR A CG  1 
ATOM   670  C CD1 . TYR A 1 89  ? 15.567 5.123   12.322  1.00 14.00 ? 86  TYR A CD1 1 
ATOM   671  C CD2 . TYR A 1 89  ? 17.809 5.081   11.496  1.00 15.13 ? 86  TYR A CD2 1 
ATOM   672  C CE1 . TYR A 1 89  ? 15.656 3.769   12.635  1.00 14.84 ? 86  TYR A CE1 1 
ATOM   673  C CE2 . TYR A 1 89  ? 17.905 3.730   11.809  1.00 15.65 ? 86  TYR A CE2 1 
ATOM   674  C CZ  . TYR A 1 89  ? 16.824 3.083   12.380  1.00 15.35 ? 86  TYR A CZ  1 
ATOM   675  O OH  . TYR A 1 89  ? 16.930 1.757   12.719  1.00 15.31 ? 86  TYR A OH  1 
ATOM   676  N N   . TYR A 1 90  ? 18.267 10.063  12.269  1.00 14.88 ? 87  TYR A N   1 
ATOM   677  C CA  . TYR A 1 90  ? 18.528 11.447  11.873  1.00 14.26 ? 87  TYR A CA  1 
ATOM   678  C C   . TYR A 1 90  ? 19.543 11.555  10.742  1.00 15.17 ? 87  TYR A C   1 
ATOM   679  O O   . TYR A 1 90  ? 20.580 10.895  10.785  1.00 14.09 ? 87  TYR A O   1 
ATOM   680  C CB  . TYR A 1 90  ? 19.093 12.265  13.043  1.00 14.50 ? 87  TYR A CB  1 
ATOM   681  C CG  . TYR A 1 90  ? 18.247 12.286  14.287  1.00 13.74 ? 87  TYR A CG  1 
ATOM   682  C CD1 . TYR A 1 90  ? 18.328 11.260  15.223  1.00 15.57 ? 87  TYR A CD1 1 
ATOM   683  C CD2 . TYR A 1 90  ? 17.376 13.347  14.539  1.00 14.20 ? 87  TYR A CD2 1 
ATOM   684  C CE1 . TYR A 1 90  ? 17.571 11.290  16.382  1.00 13.86 ? 87  TYR A CE1 1 
ATOM   685  C CE2 . TYR A 1 90  ? 16.605 13.386  15.697  1.00 14.09 ? 87  TYR A CE2 1 
ATOM   686  C CZ  . TYR A 1 90  ? 16.713 12.352  16.613  1.00 14.47 ? 87  TYR A CZ  1 
ATOM   687  O OH  . TYR A 1 90  ? 15.969 12.370  17.765  1.00 14.47 ? 87  TYR A OH  1 
ATOM   688  N N   . CYS A 1 91  ? 19.242 12.361  9.727   1.00 14.15 ? 88  CYS A N   1 
ATOM   689  C CA  . CYS A 1 91  ? 20.214 12.573  8.663   1.00 15.95 ? 88  CYS A CA  1 
ATOM   690  C C   . CYS A 1 91  ? 20.982 13.820  9.090   1.00 16.74 ? 88  CYS A C   1 
ATOM   691  O O   . CYS A 1 91  ? 20.487 14.618  9.891   1.00 17.72 ? 88  CYS A O   1 
ATOM   692  C CB  . CYS A 1 91  ? 19.547 12.801  7.299   1.00 16.02 ? 88  CYS A CB  1 
ATOM   693  S SG  . CYS A 1 91  ? 18.478 14.267  7.169   1.00 17.87 ? 88  CYS A SG  1 
ATOM   694  N N   . GLN A 1 92  ? 22.199 13.975  8.591   1.00 17.27 ? 89  GLN A N   1 
ATOM   695  C CA  . GLN A 1 92  ? 23.022 15.129  8.938   1.00 18.69 ? 89  GLN A CA  1 
ATOM   696  C C   . GLN A 1 92  ? 23.748 15.568  7.686   1.00 20.12 ? 89  GLN A C   1 
ATOM   697  O O   . GLN A 1 92  ? 24.158 14.737  6.887   1.00 19.05 ? 89  GLN A O   1 
ATOM   698  C CB  . GLN A 1 92  ? 24.108 14.756  9.946   1.00 18.93 ? 89  GLN A CB  1 
ATOM   699  C CG  . GLN A 1 92  ? 23.688 14.023  11.194  1.00 19.55 ? 89  GLN A CG  1 
ATOM   700  C CD  . GLN A 1 92  ? 24.911 13.572  11.981  1.00 20.42 ? 89  GLN A CD  1 
ATOM   701  O OE1 . GLN A 1 92  ? 25.695 14.402  12.451  1.00 22.42 ? 89  GLN A OE1 1 
ATOM   702  N NE2 . GLN A 1 92  ? 25.104 12.253  12.096  1.00 20.21 ? 89  GLN A NE2 1 
ATOM   703  N N   . SER A 1 93  ? 23.904 16.868  7.501   1.00 21.90 ? 90  SER A N   1 
ATOM   704  C CA  . SER A 1 93  ? 24.655 17.330  6.358   1.00 24.62 ? 90  SER A CA  1 
ATOM   705  C C   . SER A 1 93  ? 25.388 18.591  6.773   1.00 27.05 ? 90  SER A C   1 
ATOM   706  O O   . SER A 1 93  ? 25.341 18.987  7.943   1.00 26.87 ? 90  SER A O   1 
ATOM   707  C CB  . SER A 1 93  ? 23.755 17.578  5.154   1.00 24.07 ? 90  SER A CB  1 
ATOM   708  O OG  . SER A 1 93  ? 24.556 17.743  4.004   1.00 26.07 ? 90  SER A OG  1 
ATOM   709  N N   . TYR A 1 94  ? 26.051 19.245  5.830   1.00 30.14 ? 91  TYR A N   1 
ATOM   710  C CA  . TYR A 1 94  ? 26.829 20.409  6.205   1.00 32.34 ? 91  TYR A CA  1 
ATOM   711  C C   . TYR A 1 94  ? 26.729 21.611  5.299   1.00 34.12 ? 91  TYR A C   1 
ATOM   712  O O   . TYR A 1 94  ? 26.131 21.567  4.221   1.00 34.87 ? 91  TYR A O   1 
ATOM   713  C CB  . TYR A 1 94  ? 28.282 19.962  6.349   1.00 33.47 ? 91  TYR A CB  1 
ATOM   714  C CG  . TYR A 1 94  ? 28.398 18.832  7.341   1.00 34.04 ? 91  TYR A CG  1 
ATOM   715  C CD1 . TYR A 1 94  ? 28.356 19.079  8.710   1.00 35.09 ? 91  TYR A CD1 1 
ATOM   716  C CD2 . TYR A 1 94  ? 28.436 17.503  6.916   1.00 34.90 ? 91  TYR A CD2 1 
ATOM   717  C CE1 . TYR A 1 94  ? 28.343 18.036  9.635   1.00 34.99 ? 91  TYR A CE1 1 
ATOM   718  C CE2 . TYR A 1 94  ? 28.422 16.449  7.838   1.00 35.15 ? 91  TYR A CE2 1 
ATOM   719  C CZ  . TYR A 1 94  ? 28.372 16.728  9.197   1.00 35.05 ? 91  TYR A CZ  1 
ATOM   720  O OH  . TYR A 1 94  ? 28.331 15.713  10.125  1.00 35.45 ? 91  TYR A OH  1 
ATOM   721  N N   . ASP A 1 95  ? 27.325 22.693  5.773   1.00 35.89 ? 92  ASP A N   1 
ATOM   722  C CA  . ASP A 1 95  ? 27.353 23.961  5.069   1.00 37.31 ? 92  ASP A CA  1 
ATOM   723  C C   . ASP A 1 95  ? 28.679 24.607  5.463   1.00 37.35 ? 92  ASP A C   1 
ATOM   724  O O   . ASP A 1 95  ? 29.377 24.103  6.347   1.00 37.38 ? 92  ASP A O   1 
ATOM   725  C CB  . ASP A 1 95  ? 26.163 24.817  5.522   1.00 39.05 ? 92  ASP A CB  1 
ATOM   726  C CG  . ASP A 1 95  ? 26.089 26.139  4.802   1.00 40.62 ? 92  ASP A CG  1 
ATOM   727  O OD1 . ASP A 1 95  ? 26.048 26.125  3.551   1.00 41.77 ? 92  ASP A OD1 1 
ATOM   728  O OD2 . ASP A 1 95  ? 26.066 27.191  5.486   1.00 42.03 ? 92  ASP A OD2 1 
ATOM   729  N N   . HIS A 1 96  ? 29.032 25.710  4.812   1.00 37.22 ? 93  HIS A N   1 
ATOM   730  C CA  . HIS A 1 96  ? 30.285 26.398  5.103   1.00 37.78 ? 93  HIS A CA  1 
ATOM   731  C C   . HIS A 1 96  ? 30.704 26.272  6.567   1.00 37.83 ? 93  HIS A C   1 
ATOM   732  O O   . HIS A 1 96  ? 31.659 25.563  6.888   1.00 38.68 ? 93  HIS A O   1 
ATOM   733  C CB  . HIS A 1 96  ? 30.173 27.868  4.724   1.00 36.87 ? 93  HIS A CB  1 
ATOM   734  N N   . ASN A 1 97  ? 29.976 26.947  7.451   1.00 37.58 ? 94  ASN A N   1 
ATOM   735  C CA  . ASN A 1 97  ? 30.299 26.924  8.869   1.00 37.49 ? 94  ASN A CA  1 
ATOM   736  C C   . ASN A 1 97  ? 29.278 26.318  9.826   1.00 36.71 ? 94  ASN A C   1 
ATOM   737  O O   . ASN A 1 97  ? 29.002 26.892  10.884  1.00 37.38 ? 94  ASN A O   1 
ATOM   738  C CB  . ASN A 1 97  ? 30.653 28.339  9.336   1.00 38.76 ? 94  ASN A CB  1 
ATOM   739  C CG  . ASN A 1 97  ? 32.109 28.685  9.087   1.00 39.52 ? 94  ASN A CG  1 
ATOM   740  O OD1 . ASN A 1 97  ? 32.506 29.849  9.158   1.00 40.45 ? 94  ASN A OD1 1 
ATOM   741  N ND2 . ASN A 1 97  ? 32.920 27.666  8.821   1.00 40.31 ? 94  ASN A ND2 1 
ATOM   742  N N   . ASN A 1 98  ? 28.709 25.170  9.465   1.00 35.19 ? 95  ASN A N   1 
ATOM   743  C CA  . ASN A 1 98  ? 27.773 24.514  10.371  1.00 32.78 ? 95  ASN A CA  1 
ATOM   744  C C   . ASN A 1 98  ? 27.227 23.160  9.944   1.00 31.54 ? 95  ASN A C   1 
ATOM   745  O O   . ASN A 1 98  ? 27.144 22.832  8.756   1.00 31.45 ? 95  ASN A O   1 
ATOM   746  C CB  . ASN A 1 98  ? 26.605 25.434  10.710  1.00 32.85 ? 95  ASN A CB  1 
ATOM   747  C CG  . ASN A 1 98  ? 25.789 24.906  11.863  1.00 32.32 ? 95  ASN A CG  1 
ATOM   748  O OD1 . ASN A 1 98  ? 26.347 24.492  12.882  1.00 32.38 ? 95  ASN A OD1 1 
ATOM   749  N ND2 . ASN A 1 98  ? 24.469 24.931  11.727  1.00 32.44 ? 95  ASN A ND2 1 
ATOM   750  N N   . GLN A 1 99  ? 26.853 22.384  10.956  1.00 29.42 ? 96  GLN A N   1 
ATOM   751  C CA  . GLN A 1 99  ? 26.299 21.055  10.784  1.00 27.30 ? 96  GLN A CA  1 
ATOM   752  C C   . GLN A 1 99  ? 24.789 21.159  10.942  1.00 25.62 ? 96  GLN A C   1 
ATOM   753  O O   . GLN A 1 99  ? 24.288 21.748  11.896  1.00 25.05 ? 96  GLN A O   1 
ATOM   754  C CB  . GLN A 1 99  ? 26.884 20.132  11.843  1.00 27.07 ? 96  GLN A CB  1 
ATOM   755  C CG  . GLN A 1 99  ? 26.213 18.784  11.958  1.00 26.16 ? 96  GLN A CG  1 
ATOM   756  C CD  . GLN A 1 99  ? 26.893 17.919  13.000  1.00 26.20 ? 96  GLN A CD  1 
ATOM   757  O OE1 . GLN A 1 99  ? 27.070 18.332  14.152  1.00 25.21 ? 96  GLN A OE1 1 
ATOM   758  N NE2 . GLN A 1 99  ? 27.272 16.714  12.607  1.00 23.61 ? 96  GLN A NE2 1 
ATOM   759  N N   . VAL A 1 100 ? 24.065 20.589  9.995   1.00 23.72 ? 97  VAL A N   1 
ATOM   760  C CA  . VAL A 1 100 ? 22.614 20.636  10.027  1.00 21.52 ? 97  VAL A CA  1 
ATOM   761  C C   . VAL A 1 100 ? 22.044 19.243  10.199  1.00 20.68 ? 97  VAL A C   1 
ATOM   762  O O   . VAL A 1 100 ? 22.474 18.304  9.525   1.00 19.95 ? 97  VAL A O   1 
ATOM   763  C CB  . VAL A 1 100 ? 22.063 21.226  8.716   1.00 21.96 ? 97  VAL A CB  1 
ATOM   764  C CG1 . VAL A 1 100 ? 20.556 21.305  8.780   1.00 21.49 ? 97  VAL A CG1 1 
ATOM   765  C CG2 . VAL A 1 100 ? 22.691 22.587  8.457   1.00 21.89 ? 97  VAL A CG2 1 
ATOM   766  N N   . PHE A 1 101 ? 21.084 19.104  11.107  1.00 18.94 ? 98  PHE A N   1 
ATOM   767  C CA  . PHE A 1 101 ? 20.440 17.817  11.340  1.00 19.02 ? 98  PHE A CA  1 
ATOM   768  C C   . PHE A 1 101 ? 19.008 17.807  10.825  1.00 20.15 ? 98  PHE A C   1 
ATOM   769  O O   . PHE A 1 101 ? 18.326 18.840  10.818  1.00 21.00 ? 98  PHE A O   1 
ATOM   770  C CB  . PHE A 1 101 ? 20.364 17.470  12.837  1.00 17.91 ? 98  PHE A CB  1 
ATOM   771  C CG  . PHE A 1 101 ? 21.688 17.208  13.487  1.00 17.27 ? 98  PHE A CG  1 
ATOM   772  C CD1 . PHE A 1 101 ? 22.592 18.242  13.702  1.00 17.25 ? 98  PHE A CD1 1 
ATOM   773  C CD2 . PHE A 1 101 ? 22.021 15.921  13.904  1.00 16.98 ? 98  PHE A CD2 1 
ATOM   774  C CE1 . PHE A 1 101 ? 23.813 18.004  14.325  1.00 17.70 ? 98  PHE A CE1 1 
ATOM   775  C CE2 . PHE A 1 101 ? 23.237 15.663  14.528  1.00 16.36 ? 98  PHE A CE2 1 
ATOM   776  C CZ  . PHE A 1 101 ? 24.141 16.712  14.742  1.00 17.09 ? 98  PHE A CZ  1 
ATOM   777  N N   . GLY A 1 102 ? 18.552 16.628  10.417  1.00 20.10 ? 99  GLY A N   1 
ATOM   778  C CA  . GLY A 1 102 ? 17.176 16.482  9.981   1.00 21.56 ? 99  GLY A CA  1 
ATOM   779  C C   . GLY A 1 102 ? 16.355 16.424  11.261  1.00 21.80 ? 99  GLY A C   1 
ATOM   780  O O   . GLY A 1 102 ? 16.909 16.256  12.352  1.00 20.99 ? 99  GLY A O   1 
ATOM   781  N N   . GLY A 1 103 ? 15.038 16.544  11.139  1.00 22.43 ? 100 GLY A N   1 
ATOM   782  C CA  . GLY A 1 103 ? 14.181 16.521  12.313  1.00 22.69 ? 100 GLY A CA  1 
ATOM   783  C C   . GLY A 1 103 ? 14.087 15.210  13.061  1.00 23.02 ? 100 GLY A C   1 
ATOM   784  O O   . GLY A 1 103 ? 13.714 15.192  14.233  1.00 24.16 ? 100 GLY A O   1 
ATOM   785  N N   . GLY A 1 104 ? 14.413 14.112  12.390  1.00 22.04 ? 101 GLY A N   1 
ATOM   786  C CA  . GLY A 1 104 ? 14.358 12.810  13.024  1.00 22.14 ? 101 GLY A CA  1 
ATOM   787  C C   . GLY A 1 104 ? 13.132 12.021  12.615  1.00 21.67 ? 101 GLY A C   1 
ATOM   788  O O   . GLY A 1 104 ? 12.075 12.595  12.367  1.00 22.51 ? 101 GLY A O   1 
ATOM   789  N N   . THR A 1 105 ? 13.274 10.702  12.531  1.00 20.94 ? 102 THR A N   1 
ATOM   790  C CA  . THR A 1 105 ? 12.159 9.834   12.161  1.00 20.21 ? 102 THR A CA  1 
ATOM   791  C C   . THR A 1 105 ? 12.062 8.697   13.167  1.00 20.62 ? 102 THR A C   1 
ATOM   792  O O   . THR A 1 105 ? 13.023 7.947   13.360  1.00 20.49 ? 102 THR A O   1 
ATOM   793  C CB  . THR A 1 105 ? 12.348 9.237   10.727  1.00 19.20 ? 102 THR A CB  1 
ATOM   794  O OG1 . THR A 1 105 ? 12.319 10.288  9.752   1.00 16.50 ? 102 THR A OG1 1 
ATOM   795  C CG2 . THR A 1 105 ? 11.242 8.213   10.414  1.00 18.80 ? 102 THR A CG2 1 
ATOM   796  N N   . LYS A 1 106 ? 10.916 8.591   13.843  1.00 19.82 ? 103 LYS A N   1 
ATOM   797  C CA  . LYS A 1 106 ? 10.709 7.516   14.801  1.00 21.07 ? 103 LYS A CA  1 
ATOM   798  C C   . LYS A 1 106 ? 10.175 6.311   14.045  1.00 20.91 ? 103 LYS A C   1 
ATOM   799  O O   . LYS A 1 106 ? 9.067  6.337   13.508  1.00 22.35 ? 103 LYS A O   1 
ATOM   800  C CB  . LYS A 1 106 ? 9.700  7.916   15.878  1.00 20.81 ? 103 LYS A CB  1 
ATOM   801  C CG  . LYS A 1 106 ? 9.444  6.819   16.897  1.00 22.74 ? 103 LYS A CG  1 
ATOM   802  C CD  . LYS A 1 106 ? 8.482  7.268   17.989  1.00 25.33 ? 103 LYS A CD  1 
ATOM   803  C CE  . LYS A 1 106 ? 8.377  6.223   19.091  1.00 25.65 ? 103 LYS A CE  1 
ATOM   804  N NZ  . LYS A 1 106 ? 7.470  6.647   20.209  1.00 26.67 ? 103 LYS A NZ  1 
ATOM   805  N N   . LEU A 1 107 ? 10.971 5.259   14.002  1.00 21.59 ? 104 LEU A N   1 
ATOM   806  C CA  . LEU A 1 107 ? 10.577 4.046   13.319  1.00 20.91 ? 104 LEU A CA  1 
ATOM   807  C C   . LEU A 1 107 ? 10.181 3.013   14.350  1.00 20.53 ? 104 LEU A C   1 
ATOM   808  O O   . LEU A 1 107 ? 10.976 2.667   15.215  1.00 19.13 ? 104 LEU A O   1 
ATOM   809  C CB  . LEU A 1 107 ? 11.740 3.519   12.471  1.00 21.52 ? 104 LEU A CB  1 
ATOM   810  C CG  . LEU A 1 107 ? 11.621 2.117   11.866  1.00 21.16 ? 104 LEU A CG  1 
ATOM   811  C CD1 . LEU A 1 107 ? 10.379 2.018   10.988  1.00 21.83 ? 104 LEU A CD1 1 
ATOM   812  C CD2 . LEU A 1 107 ? 12.870 1.817   11.053  1.00 21.99 ? 104 LEU A CD2 1 
ATOM   813  N N   . THR A 1 108 ? 8.942  2.531   14.274  1.00 21.28 ? 105 THR A N   1 
ATOM   814  C CA  . THR A 1 108 ? 8.489  1.501   15.206  1.00 20.98 ? 105 THR A CA  1 
ATOM   815  C C   . THR A 1 108 ? 8.344  0.183   14.462  1.00 20.60 ? 105 THR A C   1 
ATOM   816  O O   . THR A 1 108 ? 7.795  0.149   13.366  1.00 19.95 ? 105 THR A O   1 
ATOM   817  C CB  . THR A 1 108 ? 7.123  1.838   15.842  1.00 21.92 ? 105 THR A CB  1 
ATOM   818  O OG1 . THR A 1 108 ? 7.252  2.977   16.709  1.00 21.98 ? 105 THR A OG1 1 
ATOM   819  C CG2 . THR A 1 108 ? 6.613  0.638   16.641  1.00 22.30 ? 105 THR A CG2 1 
ATOM   820  N N   . VAL A 1 109 ? 8.847  -0.892  15.062  1.00 21.38 ? 106 VAL A N   1 
ATOM   821  C CA  . VAL A 1 109 ? 8.768  -2.226  14.468  1.00 22.50 ? 106 VAL A CA  1 
ATOM   822  C C   . VAL A 1 109 ? 7.633  -3.016  15.133  1.00 23.34 ? 106 VAL A C   1 
ATOM   823  O O   . VAL A 1 109 ? 7.632  -3.226  16.353  1.00 23.71 ? 106 VAL A O   1 
ATOM   824  C CB  . VAL A 1 109 ? 10.096 -3.005  14.648  1.00 22.44 ? 106 VAL A CB  1 
ATOM   825  C CG1 . VAL A 1 109 ? 9.992  -4.380  13.985  1.00 22.00 ? 106 VAL A CG1 1 
ATOM   826  C CG2 . VAL A 1 109 ? 11.244 -2.210  14.047  1.00 21.47 ? 106 VAL A CG2 1 
ATOM   827  N N   . LEU A 1 110 ? 6.679  -3.455  14.314  1.00 23.95 ? 107 LEU A N   1 
ATOM   828  C CA  . LEU A 1 110 ? 5.503  -4.194  14.767  1.00 25.14 ? 107 LEU A CA  1 
ATOM   829  C C   . LEU A 1 110 ? 5.710  -5.706  14.744  1.00 26.75 ? 107 LEU A C   1 
ATOM   830  O O   . LEU A 1 110 ? 5.039  -6.409  13.987  1.00 26.98 ? 107 LEU A O   1 
ATOM   831  C CB  . LEU A 1 110 ? 4.325  -3.847  13.863  1.00 24.51 ? 107 LEU A CB  1 
ATOM   832  C CG  . LEU A 1 110 ? 4.074  -2.352  13.666  1.00 23.81 ? 107 LEU A CG  1 
ATOM   833  C CD1 . LEU A 1 110 ? 3.119  -2.149  12.507  1.00 23.68 ? 107 LEU A CD1 1 
ATOM   834  C CD2 . LEU A 1 110 ? 3.558  -1.729  14.960  1.00 23.69 ? 107 LEU A CD2 1 
ATOM   835  N N   . GLY A 1 111 ? 6.642  -6.214  15.547  1.00 28.24 ? 108 GLY A N   1 
ATOM   836  C CA  . GLY A 1 111 ? 6.857  -7.653  15.559  1.00 30.36 ? 108 GLY A CA  1 
ATOM   837  C C   . GLY A 1 111 ? 6.806  -8.277  16.944  1.00 32.01 ? 108 GLY A C   1 
ATOM   838  O O   . GLY A 1 111 ? 7.134  -7.581  17.937  1.00 33.27 ? 108 GLY A O   1 
ATOM   839  O OXT . GLY A 1 111 ? 6.459  -9.477  17.041  1.00 33.07 ? 108 GLY A OXT 1 
ATOM   840  N N   . ASN B 1 1   ? 38.572 0.616   17.048  1.00 42.00 ? 1   ASN B N   1 
ATOM   841  C CA  . ASN B 1 1   ? 37.885 1.936   16.994  1.00 41.71 ? 1   ASN B CA  1 
ATOM   842  C C   . ASN B 1 1   ? 38.095 2.628   18.347  1.00 41.42 ? 1   ASN B C   1 
ATOM   843  O O   . ASN B 1 1   ? 38.978 2.241   19.117  1.00 41.82 ? 1   ASN B O   1 
ATOM   844  C CB  . ASN B 1 1   ? 36.393 1.718   16.713  1.00 42.36 ? 1   ASN B CB  1 
ATOM   845  C CG  . ASN B 1 1   ? 35.697 2.968   16.210  1.00 43.33 ? 1   ASN B CG  1 
ATOM   846  O OD1 . ASN B 1 1   ? 34.504 2.943   15.906  1.00 43.67 ? 1   ASN B OD1 1 
ATOM   847  N ND2 . ASN B 1 1   ? 36.439 4.067   16.114  1.00 44.07 ? 1   ASN B ND2 1 
ATOM   848  N N   . PHE B 1 2   ? 37.296 3.649   18.639  1.00 40.57 ? 2   PHE B N   1 
ATOM   849  C CA  . PHE B 1 2   ? 37.430 4.357   19.904  1.00 38.96 ? 2   PHE B CA  1 
ATOM   850  C C   . PHE B 1 2   ? 36.079 4.717   20.508  1.00 37.80 ? 2   PHE B C   1 
ATOM   851  O O   . PHE B 1 2   ? 35.053 4.708   19.824  1.00 36.94 ? 2   PHE B O   1 
ATOM   852  C CB  . PHE B 1 2   ? 38.294 5.620   19.721  1.00 39.66 ? 2   PHE B CB  1 
ATOM   853  C CG  . PHE B 1 2   ? 37.688 6.669   18.822  1.00 40.64 ? 2   PHE B CG  1 
ATOM   854  C CD1 . PHE B 1 2   ? 36.683 7.510   19.283  1.00 41.29 ? 2   PHE B CD1 1 
ATOM   855  C CD2 . PHE B 1 2   ? 38.136 6.823   17.515  1.00 40.84 ? 2   PHE B CD2 1 
ATOM   856  C CE1 . PHE B 1 2   ? 36.136 8.496   18.453  1.00 42.18 ? 2   PHE B CE1 1 
ATOM   857  C CE2 . PHE B 1 2   ? 37.599 7.798   16.679  1.00 41.33 ? 2   PHE B CE2 1 
ATOM   858  C CZ  . PHE B 1 2   ? 36.597 8.638   17.147  1.00 42.10 ? 2   PHE B CZ  1 
ATOM   859  N N   . LEU B 1 3   ? 36.092 5.028   21.798  1.00 36.80 ? 3   LEU B N   1 
ATOM   860  C CA  . LEU B 1 3   ? 34.883 5.394   22.517  1.00 35.40 ? 3   LEU B CA  1 
ATOM   861  C C   . LEU B 1 3   ? 35.074 6.737   23.192  1.00 34.93 ? 3   LEU B C   1 
ATOM   862  O O   . LEU B 1 3   ? 36.187 7.100   23.570  1.00 34.71 ? 3   LEU B O   1 
ATOM   863  C CB  . LEU B 1 3   ? 34.552 4.332   23.560  1.00 35.71 ? 3   LEU B CB  1 
ATOM   864  N N   . LEU B 1 4   ? 33.977 7.474   23.330  1.00 33.26 ? 4   LEU B N   1 
ATOM   865  C CA  . LEU B 1 4   ? 33.984 8.778   23.978  1.00 31.65 ? 4   LEU B CA  1 
ATOM   866  C C   . LEU B 1 4   ? 33.079 8.649   25.196  1.00 30.90 ? 4   LEU B C   1 
ATOM   867  O O   . LEU B 1 4   ? 31.894 8.339   25.057  1.00 30.96 ? 4   LEU B O   1 
ATOM   868  C CB  . LEU B 1 4   ? 33.434 9.838   23.029  1.00 30.92 ? 4   LEU B CB  1 
ATOM   869  C CG  . LEU B 1 4   ? 34.211 10.022  21.725  1.00 30.56 ? 4   LEU B CG  1 
ATOM   870  C CD1 . LEU B 1 4   ? 33.442 10.917  20.779  1.00 30.14 ? 4   LEU B CD1 1 
ATOM   871  C CD2 . LEU B 1 4   ? 35.583 10.596  22.034  1.00 31.64 ? 4   LEU B CD2 1 
ATOM   872  N N   . THR B 1 5   ? 33.632 8.872   26.384  1.00 29.85 ? 5   THR B N   1 
ATOM   873  C CA  . THR B 1 5   ? 32.848 8.751   27.611  1.00 29.65 ? 5   THR B CA  1 
ATOM   874  C C   . THR B 1 5   ? 32.505 10.082  28.260  1.00 28.88 ? 5   THR B C   1 
ATOM   875  O O   . THR B 1 5   ? 33.389 10.886  28.535  1.00 29.12 ? 5   THR B O   1 
ATOM   876  C CB  . THR B 1 5   ? 33.577 7.900   28.660  1.00 29.42 ? 5   THR B CB  1 
ATOM   877  O OG1 . THR B 1 5   ? 33.780 6.577   28.153  1.00 29.53 ? 5   THR B OG1 1 
ATOM   878  C CG2 . THR B 1 5   ? 32.761 7.822   29.925  1.00 30.79 ? 5   THR B CG2 1 
ATOM   879  N N   . GLN B 1 6   ? 31.216 10.300  28.509  1.00 27.37 ? 6   GLN B N   1 
ATOM   880  C CA  . GLN B 1 6   ? 30.749 11.531  29.140  1.00 26.55 ? 6   GLN B CA  1 
ATOM   881  C C   . GLN B 1 6   ? 29.993 11.141  30.401  1.00 25.28 ? 6   GLN B C   1 
ATOM   882  O O   . GLN B 1 6   ? 29.531 10.008  30.529  1.00 25.12 ? 6   GLN B O   1 
ATOM   883  C CB  . GLN B 1 6   ? 29.770 12.290  28.231  1.00 25.97 ? 6   GLN B CB  1 
ATOM   884  C CG  . GLN B 1 6   ? 30.080 12.260  26.756  1.00 26.75 ? 6   GLN B CG  1 
ATOM   885  C CD  . GLN B 1 6   ? 29.063 13.030  25.939  1.00 25.85 ? 6   GLN B CD  1 
ATOM   886  O OE1 . GLN B 1 6   ? 28.960 12.843  24.729  1.00 25.39 ? 6   GLN B OE1 1 
ATOM   887  N NE2 . GLN B 1 6   ? 28.320 13.923  26.595  1.00 25.36 ? 6   GLN B NE2 1 
ATOM   888  N N   . PRO B 1 7   ? 29.860 12.078  31.356  1.00 25.24 ? 7   PRO B N   1 
ATOM   889  C CA  . PRO B 1 7   ? 29.139 11.798  32.599  1.00 24.94 ? 7   PRO B CA  1 
ATOM   890  C C   . PRO B 1 7   ? 27.664 11.677  32.215  1.00 24.75 ? 7   PRO B C   1 
ATOM   891  O O   . PRO B 1 7   ? 27.216 12.314  31.263  1.00 26.10 ? 7   PRO B O   1 
ATOM   892  C CB  . PRO B 1 7   ? 29.406 13.057  33.435  1.00 24.48 ? 7   PRO B CB  1 
ATOM   893  C CG  . PRO B 1 7   ? 30.690 13.589  32.841  1.00 24.94 ? 7   PRO B CG  1 
ATOM   894  C CD  . PRO B 1 7   ? 30.370 13.455  31.386  1.00 24.08 ? 7   PRO B CD  1 
ATOM   895  N N   . HIS B 1 8   ? 26.906 10.869  32.939  1.00 24.70 ? 8   HIS B N   1 
ATOM   896  C CA  . HIS B 1 8   ? 25.495 10.724  32.613  1.00 24.61 ? 8   HIS B CA  1 
ATOM   897  C C   . HIS B 1 8   ? 24.715 12.012  32.772  1.00 24.39 ? 8   HIS B C   1 
ATOM   898  O O   . HIS B 1 8   ? 23.737 12.233  32.061  1.00 24.24 ? 8   HIS B O   1 
ATOM   899  C CB  . HIS B 1 8   ? 24.839 9.651   33.483  1.00 25.93 ? 8   HIS B CB  1 
ATOM   900  C CG  . HIS B 1 8   ? 25.354 8.273   33.226  1.00 27.34 ? 8   HIS B CG  1 
ATOM   901  N ND1 . HIS B 1 8   ? 25.308 7.685   31.981  1.00 27.82 ? 8   HIS B ND1 1 
ATOM   902  C CD2 . HIS B 1 8   ? 25.923 7.366   34.054  1.00 27.30 ? 8   HIS B CD2 1 
ATOM   903  C CE1 . HIS B 1 8   ? 25.827 6.472   32.054  1.00 28.92 ? 8   HIS B CE1 1 
ATOM   904  N NE2 . HIS B 1 8   ? 26.207 6.255   33.300  1.00 28.06 ? 8   HIS B NE2 1 
ATOM   905  N N   . SER B 1 9   ? 25.153 12.879  33.682  1.00 24.40 ? 9   SER B N   1 
ATOM   906  C CA  . SER B 1 9   ? 24.414 14.111  33.929  1.00 23.36 ? 9   SER B CA  1 
ATOM   907  C C   . SER B 1 9   ? 25.185 15.200  34.650  1.00 22.12 ? 9   SER B C   1 
ATOM   908  O O   . SER B 1 9   ? 26.171 14.939  35.325  1.00 21.40 ? 9   SER B O   1 
ATOM   909  C CB  . SER B 1 9   ? 23.171 13.787  34.747  1.00 23.94 ? 9   SER B CB  1 
ATOM   910  O OG  . SER B 1 9   ? 23.549 13.200  35.979  1.00 26.88 ? 9   SER B OG  1 
ATOM   911  N N   . VAL B 1 10  ? 24.692 16.426  34.508  1.00 20.50 ? 11  VAL B N   1 
ATOM   912  C CA  . VAL B 1 10  ? 25.274 17.600  35.138  1.00 19.80 ? 11  VAL B CA  1 
ATOM   913  C C   . VAL B 1 10  ? 24.087 18.493  35.522  1.00 19.56 ? 11  VAL B C   1 
ATOM   914  O O   . VAL B 1 10  ? 23.013 18.377  34.936  1.00 18.74 ? 11  VAL B O   1 
ATOM   915  C CB  . VAL B 1 10  ? 26.216 18.346  34.146  1.00 19.52 ? 11  VAL B CB  1 
ATOM   916  C CG1 . VAL B 1 10  ? 25.443 18.797  32.923  1.00 19.55 ? 11  VAL B CG1 1 
ATOM   917  C CG2 . VAL B 1 10  ? 26.878 19.530  34.836  1.00 20.32 ? 11  VAL B CG2 1 
ATOM   918  N N   . SER B 1 11  ? 24.251 19.344  36.531  1.00 18.21 ? 12  SER B N   1 
ATOM   919  C CA  . SER B 1 11  ? 23.167 20.241  36.910  1.00 16.96 ? 12  SER B CA  1 
ATOM   920  C C   . SER B 1 11  ? 23.768 21.488  37.507  1.00 17.83 ? 12  SER B C   1 
ATOM   921  O O   . SER B 1 11  ? 24.880 21.468  38.041  1.00 17.32 ? 12  SER B O   1 
ATOM   922  C CB  . SER B 1 11  ? 22.202 19.601  37.922  1.00 18.26 ? 12  SER B CB  1 
ATOM   923  O OG  . SER B 1 11  ? 22.816 19.370  39.176  1.00 17.11 ? 12  SER B OG  1 
ATOM   924  N N   . GLU B 1 12  ? 23.036 22.583  37.409  1.00 17.71 ? 13  GLU B N   1 
ATOM   925  C CA  . GLU B 1 12  ? 23.529 23.823  37.951  1.00 19.13 ? 13  GLU B CA  1 
ATOM   926  C C   . GLU B 1 12  ? 22.372 24.808  37.987  1.00 19.42 ? 13  GLU B C   1 
ATOM   927  O O   . GLU B 1 12  ? 21.329 24.553  37.397  1.00 18.64 ? 13  GLU B O   1 
ATOM   928  C CB  . GLU B 1 12  ? 24.672 24.327  37.074  1.00 19.43 ? 13  GLU B CB  1 
ATOM   929  C CG  . GLU B 1 12  ? 25.388 25.471  37.665  1.00 23.04 ? 13  GLU B CG  1 
ATOM   930  C CD  . GLU B 1 12  ? 25.824 25.179  39.070  1.00 23.83 ? 13  GLU B CD  1 
ATOM   931  O OE1 . GLU B 1 12  ? 26.826 24.461  39.235  1.00 27.37 ? 13  GLU B OE1 1 
ATOM   932  O OE2 . GLU B 1 12  ? 25.146 25.645  40.009  1.00 23.86 ? 13  GLU B OE2 1 
ATOM   933  N N   . SER B 1 13  ? 22.560 25.912  38.700  1.00 20.22 ? 14  SER B N   1 
ATOM   934  C CA  . SER B 1 13  ? 21.541 26.957  38.839  1.00 21.07 ? 14  SER B CA  1 
ATOM   935  C C   . SER B 1 13  ? 21.609 27.966  37.694  1.00 20.66 ? 14  SER B C   1 
ATOM   936  O O   . SER B 1 13  ? 22.614 28.065  37.002  1.00 20.29 ? 14  SER B O   1 
ATOM   937  C CB  . SER B 1 13  ? 21.758 27.731  40.145  1.00 19.78 ? 14  SER B CB  1 
ATOM   938  O OG  . SER B 1 13  ? 21.806 26.876  41.270  1.00 22.60 ? 14  SER B OG  1 
ATOM   939  N N   . PRO B 1 14  ? 20.533 28.739  37.486  1.00 20.76 ? 15  PRO B N   1 
ATOM   940  C CA  . PRO B 1 14  ? 20.598 29.715  36.399  1.00 20.57 ? 15  PRO B CA  1 
ATOM   941  C C   . PRO B 1 14  ? 21.740 30.701  36.650  1.00 20.42 ? 15  PRO B C   1 
ATOM   942  O O   . PRO B 1 14  ? 22.069 30.991  37.798  1.00 21.99 ? 15  PRO B O   1 
ATOM   943  C CB  . PRO B 1 14  ? 19.228 30.379  36.466  1.00 20.16 ? 15  PRO B CB  1 
ATOM   944  C CG  . PRO B 1 14  ? 18.343 29.246  37.008  1.00 21.54 ? 15  PRO B CG  1 
ATOM   945  C CD  . PRO B 1 14  ? 19.223 28.810  38.156  1.00 20.90 ? 15  PRO B CD  1 
ATOM   946  N N   . GLY B 1 15  ? 22.357 31.191  35.580  1.00 20.33 ? 16  GLY B N   1 
ATOM   947  C CA  . GLY B 1 15  ? 23.450 32.140  35.726  1.00 19.58 ? 16  GLY B CA  1 
ATOM   948  C C   . GLY B 1 15  ? 24.793 31.495  36.021  1.00 18.87 ? 16  GLY B C   1 
ATOM   949  O O   . GLY B 1 15  ? 25.832 32.118  35.822  1.00 20.39 ? 16  GLY B O   1 
ATOM   950  N N   . LYS B 1 16  ? 24.772 30.251  36.487  1.00 17.96 ? 17  LYS B N   1 
ATOM   951  C CA  . LYS B 1 16  ? 25.988 29.512  36.820  1.00 17.86 ? 17  LYS B CA  1 
ATOM   952  C C   . LYS B 1 16  ? 26.634 28.917  35.571  1.00 17.73 ? 17  LYS B C   1 
ATOM   953  O O   . LYS B 1 16  ? 26.157 29.136  34.460  1.00 17.36 ? 17  LYS B O   1 
ATOM   954  C CB  . LYS B 1 16  ? 25.667 28.392  37.814  1.00 18.87 ? 17  LYS B CB  1 
ATOM   955  C CG  . LYS B 1 16  ? 25.153 28.823  39.188  1.00 21.04 ? 17  LYS B CG  1 
ATOM   956  C CD  . LYS B 1 16  ? 26.176 29.672  39.913  1.00 21.89 ? 17  LYS B CD  1 
ATOM   957  C CE  . LYS B 1 16  ? 25.832 29.862  41.387  1.00 22.34 ? 17  LYS B CE  1 
ATOM   958  N NZ  . LYS B 1 16  ? 25.939 28.579  42.168  1.00 23.60 ? 17  LYS B NZ  1 
ATOM   959  N N   . THR B 1 17  ? 27.717 28.166  35.761  1.00 17.91 ? 18  THR B N   1 
ATOM   960  C CA  . THR B 1 17  ? 28.434 27.556  34.651  1.00 18.64 ? 18  THR B CA  1 
ATOM   961  C C   . THR B 1 17  ? 28.664 26.061  34.843  1.00 18.72 ? 18  THR B C   1 
ATOM   962  O O   . THR B 1 17  ? 28.884 25.581  35.960  1.00 19.88 ? 18  THR B O   1 
ATOM   963  C CB  . THR B 1 17  ? 29.779 28.278  34.432  1.00 18.67 ? 18  THR B CB  1 
ATOM   964  O OG1 . THR B 1 17  ? 29.509 29.627  34.029  1.00 19.02 ? 18  THR B OG1 1 
ATOM   965  C CG2 . THR B 1 17  ? 30.618 27.579  33.361  1.00 17.35 ? 18  THR B CG2 1 
ATOM   966  N N   . VAL B 1 18  ? 28.605 25.318  33.747  1.00 19.00 ? 19  VAL B N   1 
ATOM   967  C CA  . VAL B 1 18  ? 28.796 23.880  33.812  1.00 19.13 ? 19  VAL B CA  1 
ATOM   968  C C   . VAL B 1 18  ? 29.821 23.443  32.777  1.00 19.33 ? 19  VAL B C   1 
ATOM   969  O O   . VAL B 1 18  ? 30.010 24.101  31.757  1.00 18.47 ? 19  VAL B O   1 
ATOM   970  C CB  . VAL B 1 18  ? 27.465 23.162  33.563  1.00 20.73 ? 19  VAL B CB  1 
ATOM   971  N N   . THR B 1 19  ? 30.484 22.327  33.051  1.00 20.04 ? 20  THR B N   1 
ATOM   972  C CA  . THR B 1 19  ? 31.479 21.796  32.140  1.00 20.72 ? 20  THR B CA  1 
ATOM   973  C C   . THR B 1 19  ? 31.301 20.302  31.949  1.00 21.17 ? 20  THR B C   1 
ATOM   974  O O   . THR B 1 19  ? 31.409 19.530  32.890  1.00 21.40 ? 20  THR B O   1 
ATOM   975  C CB  . THR B 1 19  ? 32.896 22.094  32.648  1.00 21.55 ? 20  THR B CB  1 
ATOM   976  O OG1 . THR B 1 19  ? 33.147 23.497  32.510  1.00 22.13 ? 20  THR B OG1 1 
ATOM   977  C CG2 . THR B 1 19  ? 33.932 21.306  31.858  1.00 21.89 ? 20  THR B CG2 1 
ATOM   978  N N   . ILE B 1 20  ? 31.019 19.918  30.710  1.00 22.54 ? 21  ILE B N   1 
ATOM   979  C CA  . ILE B 1 20  ? 30.801 18.527  30.327  1.00 23.55 ? 21  ILE B CA  1 
ATOM   980  C C   . ILE B 1 20  ? 32.040 17.948  29.637  1.00 24.51 ? 21  ILE B C   1 
ATOM   981  O O   . ILE B 1 20  ? 32.480 18.450  28.601  1.00 23.88 ? 21  ILE B O   1 
ATOM   982  C CB  . ILE B 1 20  ? 29.584 18.428  29.376  1.00 23.04 ? 21  ILE B CB  1 
ATOM   983  C CG1 . ILE B 1 20  ? 28.326 18.904  30.105  1.00 24.06 ? 21  ILE B CG1 1 
ATOM   984  C CG2 . ILE B 1 20  ? 29.407 17.000  28.868  1.00 23.12 ? 21  ILE B CG2 1 
ATOM   985  N N   . SER B 1 21  ? 32.589 16.885  30.216  1.00 26.05 ? 22  SER B N   1 
ATOM   986  C CA  . SER B 1 21  ? 33.773 16.237  29.668  1.00 27.40 ? 22  SER B CA  1 
ATOM   987  C C   . SER B 1 21  ? 33.447 15.123  28.676  1.00 29.31 ? 22  SER B C   1 
ATOM   988  O O   . SER B 1 21  ? 32.413 14.467  28.769  1.00 29.52 ? 22  SER B O   1 
ATOM   989  C CB  . SER B 1 21  ? 34.625 15.670  30.802  1.00 27.19 ? 22  SER B CB  1 
ATOM   990  O OG  . SER B 1 21  ? 33.868 14.778  31.606  1.00 26.60 ? 22  SER B OG  1 
ATOM   991  N N   . CYS B 1 22  ? 34.362 14.912  27.735  1.00 31.03 ? 23  CYS B N   1 
ATOM   992  C CA  . CYS B 1 22  ? 34.226 13.896  26.699  1.00 32.20 ? 23  CYS B CA  1 
ATOM   993  C C   . CYS B 1 22  ? 35.589 13.220  26.520  1.00 33.54 ? 23  CYS B C   1 
ATOM   994  O O   . CYS B 1 22  ? 36.423 13.700  25.765  1.00 34.13 ? 23  CYS B O   1 
ATOM   995  C CB  . CYS B 1 22  ? 33.772 14.569  25.402  1.00 31.25 ? 23  CYS B CB  1 
ATOM   996  S SG  . CYS B 1 22  ? 33.717 13.489  23.938  1.00 31.99 ? 23  CYS B SG  1 
ATOM   997  N N   . THR B 1 23  ? 35.798 12.110  27.226  1.00 35.99 ? 24  THR B N   1 
ATOM   998  C CA  . THR B 1 23  ? 37.056 11.355  27.201  1.00 37.91 ? 24  THR B CA  1 
ATOM   999  C C   . THR B 1 23  ? 37.175 10.391  26.014  1.00 39.45 ? 24  THR B C   1 
ATOM   1000 O O   . THR B 1 23  ? 36.169 9.938   25.462  1.00 39.10 ? 24  THR B O   1 
ATOM   1001 C CB  . THR B 1 23  ? 37.224 10.534  28.508  1.00 38.34 ? 24  THR B CB  1 
ATOM   1002 O OG1 . THR B 1 23  ? 37.204 11.415  29.638  1.00 39.51 ? 24  THR B OG1 1 
ATOM   1003 C CG2 . THR B 1 23  ? 38.536 9.760   28.501  1.00 38.46 ? 24  THR B CG2 1 
ATOM   1004 N N   . ARG B 1 24  ? 38.414 10.078  25.631  1.00 40.33 ? 25  ARG B N   1 
ATOM   1005 C CA  . ARG B 1 24  ? 38.675 9.165   24.520  1.00 41.00 ? 25  ARG B CA  1 
ATOM   1006 C C   . ARG B 1 24  ? 39.341 7.892   25.027  1.00 41.83 ? 25  ARG B C   1 
ATOM   1007 O O   . ARG B 1 24  ? 40.297 7.939   25.802  1.00 41.39 ? 25  ARG B O   1 
ATOM   1008 C CB  . ARG B 1 24  ? 39.557 9.837   23.484  1.00 40.84 ? 25  ARG B CB  1 
ATOM   1009 N N   . SER B 1 25  ? 38.826 6.753   24.580  1.00 42.75 ? 26  SER B N   1 
ATOM   1010 C CA  . SER B 1 25  ? 39.342 5.448   24.983  1.00 43.91 ? 26  SER B CA  1 
ATOM   1011 C C   . SER B 1 25  ? 40.807 5.240   24.612  1.00 44.49 ? 26  SER B C   1 
ATOM   1012 O O   . SER B 1 25  ? 41.636 4.930   25.473  1.00 44.92 ? 26  SER B O   1 
ATOM   1013 C CB  . SER B 1 25  ? 38.489 4.351   24.352  1.00 43.48 ? 26  SER B CB  1 
ATOM   1014 O OG  . SER B 1 25  ? 38.435 4.518   22.949  1.00 43.34 ? 26  SER B OG  1 
ATOM   1015 N N   . SER B 1 26  ? 41.117 5.406   23.329  1.00 45.14 ? 27  SER B N   1 
ATOM   1016 C CA  . SER B 1 26  ? 42.478 5.235   22.831  1.00 45.51 ? 27  SER B CA  1 
ATOM   1017 C C   . SER B 1 26  ? 42.779 6.304   21.793  1.00 45.93 ? 27  SER B C   1 
ATOM   1018 O O   . SER B 1 26  ? 41.868 6.840   21.161  1.00 45.81 ? 27  SER B O   1 
ATOM   1019 C CB  . SER B 1 26  ? 42.641 3.853   22.215  1.00 45.48 ? 27  SER B CB  1 
ATOM   1020 N N   . GLY B 1 27  A 44.062 6.605   21.617  1.00 46.85 ? 27  GLY B N   1 
ATOM   1021 C CA  . GLY B 1 27  A 44.459 7.617   20.653  1.00 47.85 ? 27  GLY B CA  1 
ATOM   1022 C C   . GLY B 1 27  A 44.381 9.008   21.250  1.00 48.40 ? 27  GLY B C   1 
ATOM   1023 O O   . GLY B 1 27  A 43.616 9.232   22.188  1.00 48.76 ? 27  GLY B O   1 
ATOM   1024 N N   . SER B 1 28  B 45.167 9.939   20.714  1.00 48.60 ? 27  SER B N   1 
ATOM   1025 C CA  . SER B 1 28  B 45.181 11.313  21.210  1.00 48.71 ? 27  SER B CA  1 
ATOM   1026 C C   . SER B 1 28  B 43.968 12.081  20.693  1.00 48.57 ? 27  SER B C   1 
ATOM   1027 O O   . SER B 1 28  B 43.797 12.242  19.484  1.00 48.38 ? 27  SER B O   1 
ATOM   1028 C CB  . SER B 1 28  B 46.472 12.013  20.782  1.00 49.20 ? 27  SER B CB  1 
ATOM   1029 N N   . ILE B 1 29  ? 43.136 12.554  21.620  1.00 48.21 ? 28  ILE B N   1 
ATOM   1030 C CA  . ILE B 1 29  ? 41.920 13.295  21.289  1.00 47.71 ? 28  ILE B CA  1 
ATOM   1031 C C   . ILE B 1 29  ? 42.129 14.337  20.193  1.00 47.39 ? 28  ILE B C   1 
ATOM   1032 O O   . ILE B 1 29  ? 41.183 14.726  19.506  1.00 46.87 ? 28  ILE B O   1 
ATOM   1033 C CB  . ILE B 1 29  ? 41.364 13.964  22.546  1.00 47.93 ? 28  ILE B CB  1 
ATOM   1034 N N   . ALA B 1 30  ? 43.370 14.782  20.029  1.00 47.27 ? 29  ALA B N   1 
ATOM   1035 C CA  . ALA B 1 30  ? 43.695 15.786  19.021  1.00 47.00 ? 29  ALA B CA  1 
ATOM   1036 C C   . ALA B 1 30  ? 43.742 15.186  17.621  1.00 46.70 ? 29  ALA B C   1 
ATOM   1037 O O   . ALA B 1 30  ? 43.490 15.878  16.630  1.00 46.93 ? 29  ALA B O   1 
ATOM   1038 C CB  . ALA B 1 30  ? 45.029 16.445  19.355  1.00 47.40 ? 29  ALA B CB  1 
ATOM   1039 N N   . ASN B 1 31  ? 44.062 13.897  17.547  1.00 45.81 ? 30  ASN B N   1 
ATOM   1040 C CA  . ASN B 1 31  ? 44.146 13.197  16.270  1.00 45.05 ? 30  ASN B CA  1 
ATOM   1041 C C   . ASN B 1 31  ? 43.036 13.647  15.332  1.00 44.24 ? 30  ASN B C   1 
ATOM   1042 O O   . ASN B 1 31  ? 43.291 13.996  14.182  1.00 44.00 ? 30  ASN B O   1 
ATOM   1043 C CB  . ASN B 1 31  ? 44.065 11.690  16.492  1.00 44.93 ? 30  ASN B CB  1 
ATOM   1044 N N   . ASN B 1 32  ? 41.806 13.650  15.839  1.00 43.56 ? 31  ASN B N   1 
ATOM   1045 C CA  . ASN B 1 32  ? 40.646 14.057  15.050  1.00 42.18 ? 31  ASN B CA  1 
ATOM   1046 C C   . ASN B 1 32  ? 39.794 15.086  15.793  1.00 40.89 ? 31  ASN B C   1 
ATOM   1047 O O   . ASN B 1 32  ? 39.868 15.201  17.020  1.00 40.18 ? 31  ASN B O   1 
ATOM   1048 C CB  . ASN B 1 32  ? 39.803 12.831  14.692  1.00 43.03 ? 31  ASN B CB  1 
ATOM   1049 N N   . TYR B 1 33  ? 38.991 15.825  15.032  1.00 39.20 ? 32  TYR B N   1 
ATOM   1050 C CA  . TYR B 1 33  ? 38.117 16.861  15.568  1.00 37.87 ? 32  TYR B CA  1 
ATOM   1051 C C   . TYR B 1 33  ? 37.006 16.324  16.471  1.00 37.42 ? 32  TYR B C   1 
ATOM   1052 O O   . TYR B 1 33  ? 36.741 15.117  16.516  1.00 37.17 ? 32  TYR B O   1 
ATOM   1053 C CB  . TYR B 1 33  ? 37.501 17.655  14.424  1.00 38.00 ? 32  TYR B CB  1 
ATOM   1054 N N   . VAL B 1 34  ? 36.355 17.247  17.177  1.00 36.37 ? 33  VAL B N   1 
ATOM   1055 C CA  . VAL B 1 34  ? 35.264 16.924  18.095  1.00 34.86 ? 33  VAL B CA  1 
ATOM   1056 C C   . VAL B 1 34  ? 34.140 17.949  17.970  1.00 33.86 ? 33  VAL B C   1 
ATOM   1057 O O   . VAL B 1 34  ? 34.373 19.155  18.075  1.00 33.69 ? 33  VAL B O   1 
ATOM   1058 C CB  . VAL B 1 34  ? 35.757 16.910  19.559  1.00 34.03 ? 33  VAL B CB  1 
ATOM   1059 C CG1 . VAL B 1 34  ? 34.597 16.670  20.500  1.00 33.63 ? 33  VAL B CG1 1 
ATOM   1060 C CG2 . VAL B 1 34  ? 36.802 15.829  19.741  1.00 33.92 ? 33  VAL B CG2 1 
ATOM   1061 N N   . HIS B 1 35  ? 32.920 17.473  17.736  1.00 32.26 ? 34  HIS B N   1 
ATOM   1062 C CA  . HIS B 1 35  ? 31.778 18.370  17.613  1.00 30.75 ? 34  HIS B CA  1 
ATOM   1063 C C   . HIS B 1 35  ? 30.902 18.218  18.853  1.00 28.83 ? 34  HIS B C   1 
ATOM   1064 O O   . HIS B 1 35  ? 31.103 17.299  19.646  1.00 28.70 ? 34  HIS B O   1 
ATOM   1065 C CB  . HIS B 1 35  ? 30.927 18.032  16.383  1.00 31.67 ? 34  HIS B CB  1 
ATOM   1066 C CG  . HIS B 1 35  ? 31.697 17.953  15.101  1.00 33.16 ? 34  HIS B CG  1 
ATOM   1067 N ND1 . HIS B 1 35  ? 31.081 17.970  13.867  1.00 33.67 ? 34  HIS B ND1 1 
ATOM   1068 C CD2 . HIS B 1 35  ? 33.021 17.804  14.857  1.00 34.15 ? 34  HIS B CD2 1 
ATOM   1069 C CE1 . HIS B 1 35  ? 31.991 17.838  12.920  1.00 33.92 ? 34  HIS B CE1 1 
ATOM   1070 N NE2 . HIS B 1 35  ? 33.177 17.734  13.493  1.00 34.04 ? 34  HIS B NE2 1 
ATOM   1071 N N   . TRP B 1 36  ? 29.941 19.125  19.015  1.00 26.58 ? 35  TRP B N   1 
ATOM   1072 C CA  . TRP B 1 36  ? 28.999 19.070  20.136  1.00 24.47 ? 35  TRP B CA  1 
ATOM   1073 C C   . TRP B 1 36  ? 27.613 19.495  19.687  1.00 23.41 ? 35  TRP B C   1 
ATOM   1074 O O   . TRP B 1 36  ? 27.450 20.529  19.039  1.00 23.18 ? 35  TRP B O   1 
ATOM   1075 C CB  . TRP B 1 36  ? 29.400 19.995  21.295  1.00 23.63 ? 35  TRP B CB  1 
ATOM   1076 C CG  . TRP B 1 36  ? 30.663 19.651  22.021  1.00 22.28 ? 35  TRP B CG  1 
ATOM   1077 C CD1 . TRP B 1 36  ? 31.940 19.999  21.671  1.00 21.49 ? 35  TRP B CD1 1 
ATOM   1078 C CD2 . TRP B 1 36  ? 30.770 18.875  23.212  1.00 21.27 ? 35  TRP B CD2 1 
ATOM   1079 N NE1 . TRP B 1 36  ? 32.834 19.478  22.573  1.00 21.93 ? 35  TRP B NE1 1 
ATOM   1080 C CE2 . TRP B 1 36  ? 32.140 18.784  23.531  1.00 21.42 ? 35  TRP B CE2 1 
ATOM   1081 C CE3 . TRP B 1 36  ? 29.838 18.241  24.045  1.00 20.99 ? 35  TRP B CE3 1 
ATOM   1082 C CZ2 . TRP B 1 36  ? 32.601 18.086  24.644  1.00 21.75 ? 35  TRP B CZ2 1 
ATOM   1083 C CZ3 . TRP B 1 36  ? 30.296 17.544  25.149  1.00 21.24 ? 35  TRP B CZ3 1 
ATOM   1084 C CH2 . TRP B 1 36  ? 31.667 17.473  25.441  1.00 21.86 ? 35  TRP B CH2 1 
ATOM   1085 N N   . TYR B 1 37  ? 26.599 18.698  20.003  1.00 22.92 ? 36  TYR B N   1 
ATOM   1086 C CA  . TYR B 1 37  ? 25.266 19.129  19.644  1.00 21.27 ? 36  TYR B CA  1 
ATOM   1087 C C   . TYR B 1 37  ? 24.315 19.036  20.823  1.00 19.49 ? 36  TYR B C   1 
ATOM   1088 O O   . TYR B 1 37  ? 24.513 18.253  21.755  1.00 19.35 ? 36  TYR B O   1 
ATOM   1089 C CB  . TYR B 1 37  ? 24.698 18.375  18.438  1.00 22.99 ? 36  TYR B CB  1 
ATOM   1090 C CG  . TYR B 1 37  ? 24.389 16.921  18.636  1.00 22.83 ? 36  TYR B CG  1 
ATOM   1091 C CD1 . TYR B 1 37  ? 25.360 15.942  18.441  1.00 25.07 ? 36  TYR B CD1 1 
ATOM   1092 C CD2 . TYR B 1 37  ? 23.088 16.514  18.941  1.00 24.54 ? 36  TYR B CD2 1 
ATOM   1093 C CE1 . TYR B 1 37  ? 25.038 14.580  18.528  1.00 24.62 ? 36  TYR B CE1 1 
ATOM   1094 C CE2 . TYR B 1 37  ? 22.756 15.165  19.031  1.00 25.40 ? 36  TYR B CE2 1 
ATOM   1095 C CZ  . TYR B 1 37  ? 23.729 14.205  18.821  1.00 25.33 ? 36  TYR B CZ  1 
ATOM   1096 O OH  . TYR B 1 37  ? 23.377 12.877  18.878  1.00 26.50 ? 36  TYR B OH  1 
ATOM   1097 N N   . GLN B 1 38  ? 23.300 19.881  20.759  1.00 19.07 ? 37  GLN B N   1 
ATOM   1098 C CA  . GLN B 1 38  ? 22.275 20.011  21.776  1.00 19.27 ? 37  GLN B CA  1 
ATOM   1099 C C   . GLN B 1 38  ? 20.975 19.412  21.271  1.00 19.91 ? 37  GLN B C   1 
ATOM   1100 O O   . GLN B 1 38  ? 20.541 19.697  20.159  1.00 18.51 ? 37  GLN B O   1 
ATOM   1101 C CB  . GLN B 1 38  ? 22.067 21.493  22.058  1.00 18.48 ? 37  GLN B CB  1 
ATOM   1102 C CG  . GLN B 1 38  ? 21.093 21.843  23.145  1.00 17.78 ? 37  GLN B CG  1 
ATOM   1103 C CD  . GLN B 1 38  ? 20.794 23.320  23.136  1.00 18.78 ? 37  GLN B CD  1 
ATOM   1104 O OE1 . GLN B 1 38  ? 20.198 23.825  22.188  1.00 18.05 ? 37  GLN B OE1 1 
ATOM   1105 N NE2 . GLN B 1 38  ? 21.223 24.030  24.180  1.00 18.29 ? 37  GLN B NE2 1 
ATOM   1106 N N   . GLN B 1 39  ? 20.342 18.607  22.114  1.00 19.97 ? 38  GLN B N   1 
ATOM   1107 C CA  . GLN B 1 39  ? 19.090 17.977  21.756  1.00 21.21 ? 38  GLN B CA  1 
ATOM   1108 C C   . GLN B 1 39  ? 18.124 18.150  22.909  1.00 21.29 ? 38  GLN B C   1 
ATOM   1109 O O   . GLN B 1 39  ? 18.217 17.444  23.904  1.00 22.32 ? 38  GLN B O   1 
ATOM   1110 C CB  . GLN B 1 39  ? 19.325 16.486  21.470  1.00 20.19 ? 38  GLN B CB  1 
ATOM   1111 C CG  . GLN B 1 39  ? 18.076 15.702  21.142  1.00 23.05 ? 38  GLN B CG  1 
ATOM   1112 C CD  . GLN B 1 39  ? 18.384 14.285  20.694  1.00 21.56 ? 38  GLN B CD  1 
ATOM   1113 O OE1 . GLN B 1 39  ? 19.139 13.548  21.348  1.00 24.19 ? 38  GLN B OE1 1 
ATOM   1114 N NE2 . GLN B 1 39  ? 17.789 13.888  19.588  1.00 24.14 ? 38  GLN B NE2 1 
ATOM   1115 N N   . ARG B 1 40  ? 17.215 19.111  22.791  1.00 23.05 ? 39  ARG B N   1 
ATOM   1116 C CA  . ARG B 1 40  ? 16.243 19.312  23.849  1.00 24.68 ? 39  ARG B CA  1 
ATOM   1117 C C   . ARG B 1 40  ? 15.353 18.082  23.856  1.00 26.62 ? 39  ARG B C   1 
ATOM   1118 O O   . ARG B 1 40  ? 15.175 17.436  22.818  1.00 27.28 ? 39  ARG B O   1 
ATOM   1119 C CB  . ARG B 1 40  ? 15.421 20.585  23.620  1.00 24.61 ? 39  ARG B CB  1 
ATOM   1120 C CG  . ARG B 1 40  ? 16.250 21.853  23.685  1.00 24.23 ? 39  ARG B CG  1 
ATOM   1121 C CD  . ARG B 1 40  ? 15.400 23.089  23.954  1.00 24.30 ? 39  ARG B CD  1 
ATOM   1122 N NE  . ARG B 1 40  ? 16.245 24.265  24.132  1.00 24.62 ? 39  ARG B NE  1 
ATOM   1123 C CZ  . ARG B 1 40  ? 16.774 24.980  23.141  1.00 25.23 ? 39  ARG B CZ  1 
ATOM   1124 N NH1 . ARG B 1 40  ? 16.547 24.657  21.870  1.00 22.56 ? 39  ARG B NH1 1 
ATOM   1125 N NH2 . ARG B 1 40  ? 17.560 26.012  23.427  1.00 26.00 ? 39  ARG B NH2 1 
ATOM   1126 N N   . PRO B 1 41  ? 14.777 17.743  25.017  1.00 28.18 ? 40  PRO B N   1 
ATOM   1127 C CA  . PRO B 1 41  ? 13.909 16.569  25.122  1.00 29.40 ? 40  PRO B CA  1 
ATOM   1128 C C   . PRO B 1 41  ? 12.944 16.456  23.956  1.00 30.53 ? 40  PRO B C   1 
ATOM   1129 O O   . PRO B 1 41  ? 12.456 17.460  23.444  1.00 31.21 ? 40  PRO B O   1 
ATOM   1130 C CB  . PRO B 1 41  ? 13.225 16.789  26.463  1.00 29.24 ? 40  PRO B CB  1 
ATOM   1131 C CG  . PRO B 1 41  ? 14.374 17.371  27.276  1.00 29.05 ? 40  PRO B CG  1 
ATOM   1132 C CD  . PRO B 1 41  ? 14.812 18.457  26.307  1.00 28.73 ? 40  PRO B CD  1 
ATOM   1133 N N   . GLY B 1 42  ? 12.698 15.221  23.521  1.00 32.04 ? 41  GLY B N   1 
ATOM   1134 C CA  . GLY B 1 42  ? 11.801 14.986  22.404  1.00 32.78 ? 41  GLY B CA  1 
ATOM   1135 C C   . GLY B 1 42  ? 12.028 15.911  21.220  1.00 33.31 ? 41  GLY B C   1 
ATOM   1136 O O   . GLY B 1 42  ? 11.076 16.492  20.692  1.00 33.21 ? 41  GLY B O   1 
ATOM   1137 N N   . SER B 1 43  ? 13.279 16.050  20.786  1.00 33.46 ? 42  SER B N   1 
ATOM   1138 C CA  . SER B 1 43  ? 13.574 16.929  19.655  1.00 33.98 ? 42  SER B CA  1 
ATOM   1139 C C   . SER B 1 43  ? 14.807 16.580  18.831  1.00 33.80 ? 42  SER B C   1 
ATOM   1140 O O   . SER B 1 43  ? 15.582 15.679  19.170  1.00 32.76 ? 42  SER B O   1 
ATOM   1141 C CB  . SER B 1 43  ? 13.694 18.381  20.127  1.00 34.70 ? 42  SER B CB  1 
ATOM   1142 O OG  . SER B 1 43  ? 13.944 19.245  19.028  1.00 36.05 ? 42  SER B OG  1 
ATOM   1143 N N   . SER B 1 44  ? 14.967 17.325  17.738  1.00 33.91 ? 43  SER B N   1 
ATOM   1144 C CA  . SER B 1 44  ? 16.069 17.154  16.799  1.00 34.03 ? 43  SER B CA  1 
ATOM   1145 C C   . SER B 1 44  ? 17.313 17.962  17.177  1.00 33.46 ? 43  SER B C   1 
ATOM   1146 O O   . SER B 1 44  ? 17.226 19.140  17.529  1.00 34.09 ? 43  SER B O   1 
ATOM   1147 C CB  . SER B 1 44  ? 15.603 17.548  15.396  1.00 33.89 ? 43  SER B CB  1 
ATOM   1148 O OG  . SER B 1 44  ? 14.996 18.829  15.410  1.00 34.00 ? 43  SER B OG  1 
ATOM   1149 N N   . PRO B 1 45  ? 18.492 17.333  17.082  1.00 32.70 ? 44  PRO B N   1 
ATOM   1150 C CA  . PRO B 1 45  ? 19.788 17.935  17.402  1.00 32.03 ? 44  PRO B CA  1 
ATOM   1151 C C   . PRO B 1 45  ? 20.083 19.255  16.696  1.00 31.45 ? 44  PRO B C   1 
ATOM   1152 O O   . PRO B 1 45  ? 19.450 19.601  15.696  1.00 31.15 ? 44  PRO B O   1 
ATOM   1153 C CB  . PRO B 1 45  ? 20.765 16.840  16.996  1.00 32.13 ? 44  PRO B CB  1 
ATOM   1154 C CG  . PRO B 1 45  ? 19.973 15.589  17.299  1.00 32.91 ? 44  PRO B CG  1 
ATOM   1155 C CD  . PRO B 1 45  ? 18.694 15.957  16.601  1.00 32.18 ? 44  PRO B CD  1 
ATOM   1156 N N   . THR B 1 46  ? 21.044 19.991  17.250  1.00 30.37 ? 45  THR B N   1 
ATOM   1157 C CA  . THR B 1 46  ? 21.497 21.263  16.693  1.00 28.59 ? 45  THR B CA  1 
ATOM   1158 C C   . THR B 1 46  ? 22.916 21.424  17.193  1.00 27.85 ? 45  THR B C   1 
ATOM   1159 O O   . THR B 1 46  ? 23.187 21.253  18.379  1.00 27.24 ? 45  THR B O   1 
ATOM   1160 C CB  . THR B 1 46  ? 20.704 22.463  17.206  1.00 29.18 ? 45  THR B CB  1 
ATOM   1161 O OG1 . THR B 1 46  ? 20.972 22.638  18.600  1.00 29.62 ? 45  THR B OG1 1 
ATOM   1162 C CG2 . THR B 1 46  ? 19.217 22.264  16.987  1.00 29.70 ? 45  THR B CG2 1 
ATOM   1163 N N   . THR B 1 47  ? 23.830 21.744  16.289  1.00 26.22 ? 46  THR B N   1 
ATOM   1164 C CA  . THR B 1 47  ? 25.212 21.917  16.670  1.00 25.24 ? 46  THR B CA  1 
ATOM   1165 C C   . THR B 1 47  ? 25.386 23.173  17.517  1.00 24.97 ? 46  THR B C   1 
ATOM   1166 O O   . THR B 1 47  ? 24.780 24.213  17.247  1.00 24.79 ? 46  THR B O   1 
ATOM   1167 C CB  . THR B 1 47  ? 26.098 22.028  15.426  1.00 24.74 ? 46  THR B CB  1 
ATOM   1168 O OG1 . THR B 1 47  ? 25.835 20.913  14.568  1.00 23.49 ? 46  THR B OG1 1 
ATOM   1169 C CG2 . THR B 1 47  ? 27.560 22.036  15.813  1.00 24.07 ? 46  THR B CG2 1 
ATOM   1170 N N   . VAL B 1 48  ? 26.203 23.061  18.555  1.00 26.07 ? 47  VAL B N   1 
ATOM   1171 C CA  . VAL B 1 48  ? 26.488 24.196  19.416  1.00 26.69 ? 47  VAL B CA  1 
ATOM   1172 C C   . VAL B 1 48  ? 27.974 24.528  19.325  1.00 27.85 ? 47  VAL B C   1 
ATOM   1173 O O   . VAL B 1 48  ? 28.360 25.690  19.439  1.00 27.55 ? 47  VAL B O   1 
ATOM   1174 C CB  . VAL B 1 48  ? 26.090 23.923  20.888  1.00 25.90 ? 47  VAL B CB  1 
ATOM   1175 C CG1 . VAL B 1 48  ? 24.595 23.961  21.022  1.00 25.39 ? 47  VAL B CG1 1 
ATOM   1176 C CG2 . VAL B 1 48  ? 26.621 22.568  21.340  1.00 24.74 ? 47  VAL B CG2 1 
ATOM   1177 N N   . ILE B 1 49  ? 28.796 23.507  19.089  1.00 28.93 ? 48  ILE B N   1 
ATOM   1178 C CA  . ILE B 1 49  ? 30.244 23.676  18.975  1.00 30.90 ? 48  ILE B CA  1 
ATOM   1179 C C   . ILE B 1 49  ? 30.824 22.788  17.867  1.00 32.52 ? 48  ILE B C   1 
ATOM   1180 O O   . ILE B 1 49  ? 30.434 21.622  17.720  1.00 32.59 ? 48  ILE B O   1 
ATOM   1181 C CB  . ILE B 1 49  ? 30.914 23.348  20.317  1.00 30.64 ? 48  ILE B CB  1 
ATOM   1182 N N   . PHE B 1 50  ? 31.759 23.340  17.094  1.00 33.78 ? 49  PHE B N   1 
ATOM   1183 C CA  . PHE B 1 50  ? 32.393 22.600  16.001  1.00 34.88 ? 49  PHE B CA  1 
ATOM   1184 C C   . PHE B 1 50  ? 33.923 22.729  16.010  1.00 35.90 ? 49  PHE B C   1 
ATOM   1185 O O   . PHE B 1 50  ? 34.494 23.430  16.844  1.00 36.11 ? 49  PHE B O   1 
ATOM   1186 C CB  . PHE B 1 50  ? 31.840 23.077  14.666  1.00 34.50 ? 49  PHE B CB  1 
ATOM   1187 N N   . GLU B 1 51  ? 34.577 22.046  15.077  1.00 37.13 ? 50  GLU B N   1 
ATOM   1188 C CA  . GLU B 1 51  ? 36.033 22.079  14.969  1.00 38.00 ? 50  GLU B CA  1 
ATOM   1189 C C   . GLU B 1 51  ? 36.698 22.014  16.342  1.00 38.86 ? 50  GLU B C   1 
ATOM   1190 O O   . GLU B 1 51  ? 37.772 22.580  16.548  1.00 38.23 ? 50  GLU B O   1 
ATOM   1191 C CB  . GLU B 1 51  ? 36.471 23.339  14.237  1.00 38.23 ? 50  GLU B CB  1 
ATOM   1192 N N   . ASP B 1 52  ? 36.048 21.326  17.277  1.00 39.12 ? 51  ASP B N   1 
ATOM   1193 C CA  . ASP B 1 52  ? 36.562 21.169  18.635  1.00 39.86 ? 51  ASP B CA  1 
ATOM   1194 C C   . ASP B 1 52  ? 36.373 22.407  19.515  1.00 39.78 ? 51  ASP B C   1 
ATOM   1195 O O   . ASP B 1 52  ? 36.366 22.298  20.746  1.00 39.57 ? 51  ASP B O   1 
ATOM   1196 C CB  . ASP B 1 52  ? 38.049 20.776  18.597  1.00 40.00 ? 51  ASP B CB  1 
ATOM   1197 N N   . ASP B 1 53  ? 36.210 23.576  18.902  1.00 39.67 ? 52  ASP B N   1 
ATOM   1198 C CA  . ASP B 1 53  ? 36.040 24.793  19.689  1.00 40.00 ? 52  ASP B CA  1 
ATOM   1199 C C   . ASP B 1 53  ? 35.540 26.013  18.926  1.00 39.55 ? 52  ASP B C   1 
ATOM   1200 O O   . ASP B 1 53  ? 35.984 27.125  19.194  1.00 39.42 ? 52  ASP B O   1 
ATOM   1201 C CB  . ASP B 1 53  ? 37.352 25.136  20.391  1.00 40.41 ? 52  ASP B CB  1 
ATOM   1202 N N   . HIS B 1 54  ? 34.615 25.809  17.992  1.00 39.62 ? 53  HIS B N   1 
ATOM   1203 C CA  . HIS B 1 54  ? 34.043 26.905  17.208  1.00 39.56 ? 53  HIS B CA  1 
ATOM   1204 C C   . HIS B 1 54  ? 32.533 26.999  17.448  1.00 39.87 ? 53  HIS B C   1 
ATOM   1205 O O   . HIS B 1 54  ? 31.896 26.005  17.800  1.00 39.71 ? 53  HIS B O   1 
ATOM   1206 C CB  . HIS B 1 54  ? 34.325 26.685  15.734  1.00 39.99 ? 53  HIS B CB  1 
ATOM   1207 N N   . ARG B 1 55  ? 31.961 28.187  17.255  1.00 39.79 ? 54  ARG B N   1 
ATOM   1208 C CA  . ARG B 1 55  ? 30.526 28.393  17.470  1.00 40.42 ? 54  ARG B CA  1 
ATOM   1209 C C   . ARG B 1 55  ? 29.756 28.835  16.221  1.00 41.05 ? 54  ARG B C   1 
ATOM   1210 O O   . ARG B 1 55  ? 29.896 29.967  15.757  1.00 41.14 ? 54  ARG B O   1 
ATOM   1211 C CB  . ARG B 1 55  ? 30.311 29.405  18.589  1.00 40.54 ? 54  ARG B CB  1 
ATOM   1212 N N   . PRO B 1 56  ? 28.906 27.948  15.678  1.00 41.15 ? 55  PRO B N   1 
ATOM   1213 C CA  . PRO B 1 56  ? 28.096 28.205  14.484  1.00 40.94 ? 55  PRO B CA  1 
ATOM   1214 C C   . PRO B 1 56  ? 27.165 29.408  14.570  1.00 41.10 ? 55  PRO B C   1 
ATOM   1215 O O   . PRO B 1 56  ? 26.763 29.837  15.655  1.00 41.48 ? 55  PRO B O   1 
ATOM   1216 C CB  . PRO B 1 56  ? 27.327 26.895  14.317  1.00 40.91 ? 55  PRO B CB  1 
ATOM   1217 C CG  . PRO B 1 56  ? 27.185 26.425  15.746  1.00 40.88 ? 55  PRO B CG  1 
ATOM   1218 C CD  . PRO B 1 56  ? 28.627 26.590  16.172  1.00 41.24 ? 55  PRO B CD  1 
ATOM   1219 N N   . SER B 1 57  ? 26.824 29.938  13.400  1.00 40.95 ? 56  SER B N   1 
ATOM   1220 C CA  . SER B 1 57  ? 25.937 31.086  13.277  1.00 40.38 ? 56  SER B CA  1 
ATOM   1221 C C   . SER B 1 57  ? 24.758 31.014  14.231  1.00 39.73 ? 56  SER B C   1 
ATOM   1222 O O   . SER B 1 57  ? 23.934 30.105  14.141  1.00 40.03 ? 56  SER B O   1 
ATOM   1223 C CB  . SER B 1 57  ? 25.416 31.182  11.841  1.00 40.55 ? 56  SER B CB  1 
ATOM   1224 O OG  . SER B 1 57  ? 24.460 32.221  11.709  1.00 41.49 ? 56  SER B OG  1 
ATOM   1225 N N   . GLY B 1 58  ? 24.680 31.970  15.151  1.00 38.69 ? 57  GLY B N   1 
ATOM   1226 C CA  . GLY B 1 58  ? 23.570 31.986  16.087  1.00 37.19 ? 57  GLY B CA  1 
ATOM   1227 C C   . GLY B 1 58  ? 23.827 31.542  17.516  1.00 35.89 ? 57  GLY B C   1 
ATOM   1228 O O   . GLY B 1 58  ? 23.252 32.107  18.440  1.00 36.66 ? 57  GLY B O   1 
ATOM   1229 N N   . VAL B 1 59  ? 24.677 30.538  17.716  1.00 34.95 ? 58  VAL B N   1 
ATOM   1230 C CA  . VAL B 1 59  ? 24.960 30.052  19.065  1.00 33.51 ? 58  VAL B CA  1 
ATOM   1231 C C   . VAL B 1 59  ? 25.653 31.124  19.910  1.00 32.65 ? 58  VAL B C   1 
ATOM   1232 O O   . VAL B 1 59  ? 26.682 31.666  19.520  1.00 32.74 ? 58  VAL B O   1 
ATOM   1233 C CB  . VAL B 1 59  ? 25.829 28.779  19.024  1.00 33.18 ? 58  VAL B CB  1 
ATOM   1234 C CG1 . VAL B 1 59  ? 26.156 28.315  20.440  1.00 32.30 ? 58  VAL B CG1 1 
ATOM   1235 C CG2 . VAL B 1 59  ? 25.097 27.685  18.269  1.00 32.62 ? 58  VAL B CG2 1 
ATOM   1236 N N   . PRO B 1 60  ? 25.094 31.428  21.092  1.00 31.89 ? 59  PRO B N   1 
ATOM   1237 C CA  . PRO B 1 60  ? 25.600 32.429  22.033  1.00 30.79 ? 59  PRO B CA  1 
ATOM   1238 C C   . PRO B 1 60  ? 27.028 32.226  22.536  1.00 30.29 ? 59  PRO B C   1 
ATOM   1239 O O   . PRO B 1 60  ? 27.565 31.117  22.515  1.00 29.40 ? 59  PRO B O   1 
ATOM   1240 C CB  . PRO B 1 60  ? 24.580 32.362  23.172  1.00 31.34 ? 59  PRO B CB  1 
ATOM   1241 C CG  . PRO B 1 60  ? 23.321 31.948  22.462  1.00 31.79 ? 59  PRO B CG  1 
ATOM   1242 C CD  . PRO B 1 60  ? 23.883 30.804  21.650  1.00 31.40 ? 59  PRO B CD  1 
ATOM   1243 N N   . ASP B 1 61  ? 27.624 33.327  22.994  1.00 29.53 ? 60  ASP B N   1 
ATOM   1244 C CA  . ASP B 1 61  ? 28.972 33.344  23.540  1.00 29.09 ? 60  ASP B CA  1 
ATOM   1245 C C   . ASP B 1 61  ? 29.012 32.431  24.758  1.00 27.44 ? 60  ASP B C   1 
ATOM   1246 O O   . ASP B 1 61  ? 30.084 32.033  25.211  1.00 28.07 ? 60  ASP B O   1 
ATOM   1247 C CB  . ASP B 1 61  ? 29.334 34.765  23.993  1.00 30.57 ? 60  ASP B CB  1 
ATOM   1248 C CG  . ASP B 1 61  ? 29.178 35.795  22.886  1.00 32.83 ? 60  ASP B CG  1 
ATOM   1249 O OD1 . ASP B 1 61  ? 29.994 35.796  21.939  1.00 35.05 ? 60  ASP B OD1 1 
ATOM   1250 O OD2 . ASP B 1 61  ? 28.227 36.602  22.958  1.00 33.07 ? 60  ASP B OD2 1 
ATOM   1251 N N   . ARG B 1 62  ? 27.837 32.120  25.298  1.00 26.59 ? 61  ARG B N   1 
ATOM   1252 C CA  . ARG B 1 62  ? 27.740 31.266  26.480  1.00 24.92 ? 61  ARG B CA  1 
ATOM   1253 C C   . ARG B 1 62  ? 28.312 29.864  26.298  1.00 24.09 ? 61  ARG B C   1 
ATOM   1254 O O   . ARG B 1 62  ? 28.720 29.236  27.270  1.00 23.38 ? 61  ARG B O   1 
ATOM   1255 C CB  . ARG B 1 62  ? 26.284 31.182  26.968  1.00 23.28 ? 61  ARG B CB  1 
ATOM   1256 C CG  . ARG B 1 62  ? 25.768 32.513  27.446  1.00 22.17 ? 61  ARG B CG  1 
ATOM   1257 C CD  . ARG B 1 62  ? 24.446 32.440  28.182  1.00 20.71 ? 61  ARG B CD  1 
ATOM   1258 N NE  . ARG B 1 62  ? 23.392 31.859  27.368  1.00 19.56 ? 61  ARG B NE  1 
ATOM   1259 C CZ  . ARG B 1 62  ? 22.975 30.607  27.474  1.00 19.65 ? 61  ARG B CZ  1 
ATOM   1260 N NH1 . ARG B 1 62  ? 23.524 29.796  28.369  1.00 18.88 ? 61  ARG B NH1 1 
ATOM   1261 N NH2 . ARG B 1 62  ? 22.007 30.168  26.681  1.00 19.70 ? 61  ARG B NH2 1 
ATOM   1262 N N   . PHE B 1 63  ? 28.339 29.371  25.061  1.00 24.07 ? 62  PHE B N   1 
ATOM   1263 C CA  . PHE B 1 63  ? 28.889 28.042  24.799  1.00 23.96 ? 62  PHE B CA  1 
ATOM   1264 C C   . PHE B 1 63  ? 30.324 28.143  24.298  1.00 24.01 ? 62  PHE B C   1 
ATOM   1265 O O   . PHE B 1 63  ? 30.652 29.048  23.547  1.00 25.24 ? 62  PHE B O   1 
ATOM   1266 C CB  . PHE B 1 63  ? 28.068 27.287  23.743  1.00 23.59 ? 62  PHE B CB  1 
ATOM   1267 C CG  . PHE B 1 63  ? 26.614 27.108  24.094  1.00 23.74 ? 62  PHE B CG  1 
ATOM   1268 C CD1 . PHE B 1 63  ? 25.718 28.163  23.975  1.00 23.33 ? 62  PHE B CD1 1 
ATOM   1269 C CD2 . PHE B 1 63  ? 26.143 25.877  24.550  1.00 22.62 ? 62  PHE B CD2 1 
ATOM   1270 C CE1 . PHE B 1 63  ? 24.374 28.002  24.303  1.00 23.15 ? 62  PHE B CE1 1 
ATOM   1271 C CE2 . PHE B 1 63  ? 24.807 25.706  24.881  1.00 23.23 ? 62  PHE B CE2 1 
ATOM   1272 C CZ  . PHE B 1 63  ? 23.918 26.773  24.757  1.00 23.00 ? 62  PHE B CZ  1 
ATOM   1273 N N   . SER B 1 64  ? 31.167 27.203  24.707  1.00 24.51 ? 63  SER B N   1 
ATOM   1274 C CA  . SER B 1 64  ? 32.565 27.171  24.279  1.00 25.75 ? 63  SER B CA  1 
ATOM   1275 C C   . SER B 1 64  ? 33.127 25.760  24.461  1.00 26.80 ? 63  SER B C   1 
ATOM   1276 O O   . SER B 1 64  ? 32.703 25.038  25.356  1.00 26.14 ? 63  SER B O   1 
ATOM   1277 C CB  . SER B 1 64  ? 33.404 28.166  25.098  1.00 24.76 ? 63  SER B CB  1 
ATOM   1278 O OG  . SER B 1 64  ? 33.390 27.847  26.483  1.00 23.58 ? 63  SER B OG  1 
ATOM   1279 N N   . GLY B 1 65  ? 34.081 25.376  23.613  1.00 28.02 ? 64  GLY B N   1 
ATOM   1280 C CA  . GLY B 1 65  ? 34.678 24.055  23.724  1.00 30.34 ? 64  GLY B CA  1 
ATOM   1281 C C   . GLY B 1 65  ? 36.194 24.057  23.809  1.00 31.94 ? 64  GLY B C   1 
ATOM   1282 O O   . GLY B 1 65  ? 36.840 24.980  23.326  1.00 32.12 ? 64  GLY B O   1 
ATOM   1283 N N   . SER B 1 66  ? 36.766 23.021  24.418  1.00 33.68 ? 65  SER B N   1 
ATOM   1284 C CA  . SER B 1 66  ? 38.214 22.923  24.552  1.00 35.89 ? 65  SER B CA  1 
ATOM   1285 C C   . SER B 1 66  ? 38.714 21.482  24.415  1.00 36.94 ? 65  SER B C   1 
ATOM   1286 O O   . SER B 1 66  ? 37.920 20.560  24.213  1.00 36.99 ? 65  SER B O   1 
ATOM   1287 C CB  . SER B 1 66  ? 38.656 23.513  25.893  1.00 35.77 ? 65  SER B CB  1 
ATOM   1288 O OG  . SER B 1 66  ? 38.051 22.832  26.976  1.00 35.24 ? 65  SER B OG  1 
ATOM   1289 N N   . VAL B 1 67  ? 40.030 21.300  24.519  1.00 38.28 ? 66  VAL B N   1 
ATOM   1290 C CA  . VAL B 1 67  ? 40.647 19.980  24.386  1.00 39.92 ? 66  VAL B CA  1 
ATOM   1291 C C   . VAL B 1 67  ? 41.865 19.820  25.302  1.00 40.84 ? 66  VAL B C   1 
ATOM   1292 O O   . VAL B 1 67  ? 42.851 20.542  25.163  1.00 41.02 ? 66  VAL B O   1 
ATOM   1293 C CB  . VAL B 1 67  ? 41.092 19.738  22.928  1.00 39.96 ? 66  VAL B CB  1 
ATOM   1294 C CG1 . VAL B 1 67  ? 41.616 18.315  22.768  1.00 40.16 ? 66  VAL B CG1 1 
ATOM   1295 C CG2 . VAL B 1 67  ? 39.929 19.997  21.983  1.00 39.21 ? 66  VAL B CG2 1 
ATOM   1296 N N   . ASP B 1 68  A 41.794 18.866  26.230  1.00 41.81 ? 66  ASP B N   1 
ATOM   1297 C CA  . ASP B 1 68  A 42.888 18.613  27.170  1.00 42.85 ? 66  ASP B CA  1 
ATOM   1298 C C   . ASP B 1 68  A 43.730 17.397  26.768  1.00 43.74 ? 66  ASP B C   1 
ATOM   1299 O O   . ASP B 1 68  A 43.365 16.248  27.048  1.00 43.92 ? 66  ASP B O   1 
ATOM   1300 C CB  . ASP B 1 68  A 42.329 18.413  28.583  1.00 42.37 ? 66  ASP B CB  1 
ATOM   1301 N N   . THR B 1 69  B 44.866 17.662  26.125  1.00 44.19 ? 66  THR B N   1 
ATOM   1302 C CA  . THR B 1 69  B 45.765 16.606  25.677  1.00 44.58 ? 66  THR B CA  1 
ATOM   1303 C C   . THR B 1 69  B 46.242 15.706  26.820  1.00 44.77 ? 66  THR B C   1 
ATOM   1304 O O   . THR B 1 69  B 46.265 14.481  26.687  1.00 45.35 ? 66  THR B O   1 
ATOM   1305 C CB  . THR B 1 69  B 46.961 17.222  24.957  1.00 44.54 ? 66  THR B CB  1 
ATOM   1306 N N   . SER B 1 70  ? 46.616 16.309  27.944  1.00 44.96 ? 67  SER B N   1 
ATOM   1307 C CA  . SER B 1 70  ? 47.101 15.543  29.092  1.00 45.00 ? 67  SER B CA  1 
ATOM   1308 C C   . SER B 1 70  ? 46.082 14.515  29.592  1.00 44.78 ? 67  SER B C   1 
ATOM   1309 O O   . SER B 1 70  ? 46.444 13.393  29.957  1.00 44.80 ? 67  SER B O   1 
ATOM   1310 C CB  . SER B 1 70  ? 47.492 16.491  30.226  1.00 45.33 ? 67  SER B CB  1 
ATOM   1311 N N   . SER B 1 71  ? 44.810 14.904  29.605  1.00 44.16 ? 68  SER B N   1 
ATOM   1312 C CA  . SER B 1 71  ? 43.737 14.023  30.060  1.00 43.30 ? 68  SER B CA  1 
ATOM   1313 C C   . SER B 1 71  ? 43.105 13.266  28.893  1.00 42.32 ? 68  SER B C   1 
ATOM   1314 O O   . SER B 1 71  ? 42.422 12.262  29.094  1.00 42.09 ? 68  SER B O   1 
ATOM   1315 C CB  . SER B 1 71  ? 42.665 14.839  30.795  1.00 43.28 ? 68  SER B CB  1 
ATOM   1316 N N   . ASN B 1 72  ? 43.340 13.756  27.678  1.00 40.98 ? 69  ASN B N   1 
ATOM   1317 C CA  . ASN B 1 72  ? 42.790 13.142  26.474  1.00 39.91 ? 69  ASN B CA  1 
ATOM   1318 C C   . ASN B 1 72  ? 41.270 13.293  26.483  1.00 39.02 ? 69  ASN B C   1 
ATOM   1319 O O   . ASN B 1 72  ? 40.541 12.346  26.177  1.00 39.05 ? 69  ASN B O   1 
ATOM   1320 C CB  . ASN B 1 72  ? 43.177 11.656  26.411  1.00 39.55 ? 69  ASN B CB  1 
ATOM   1321 N N   . SER B 1 73  ? 40.794 14.487  26.831  1.00 37.67 ? 70  SER B N   1 
ATOM   1322 C CA  . SER B 1 73  ? 39.354 14.727  26.899  1.00 35.99 ? 70  SER B CA  1 
ATOM   1323 C C   . SER B 1 73  ? 38.913 16.135  26.509  1.00 34.91 ? 70  SER B C   1 
ATOM   1324 O O   . SER B 1 73  ? 39.428 17.131  27.026  1.00 34.15 ? 70  SER B O   1 
ATOM   1325 C CB  . SER B 1 73  ? 38.849 14.405  28.303  1.00 36.12 ? 70  SER B CB  1 
ATOM   1326 N N   . ALA B 1 74  ? 37.947 16.203  25.596  1.00 32.70 ? 71  ALA B N   1 
ATOM   1327 C CA  . ALA B 1 74  ? 37.403 17.475  25.140  1.00 30.66 ? 71  ALA B CA  1 
ATOM   1328 C C   . ALA B 1 74  ? 36.305 17.854  26.123  1.00 29.19 ? 71  ALA B C   1 
ATOM   1329 O O   . ALA B 1 74  ? 35.784 16.999  26.846  1.00 28.14 ? 71  ALA B O   1 
ATOM   1330 C CB  . ALA B 1 74  ? 36.831 17.341  23.730  1.00 29.95 ? 71  ALA B CB  1 
ATOM   1331 N N   . SER B 1 75  ? 35.956 19.133  26.160  1.00 27.78 ? 72  SER B N   1 
ATOM   1332 C CA  . SER B 1 75  ? 34.927 19.579  27.082  1.00 26.72 ? 72  SER B CA  1 
ATOM   1333 C C   . SER B 1 75  ? 34.088 20.741  26.591  1.00 25.12 ? 72  SER B C   1 
ATOM   1334 O O   . SER B 1 75  ? 34.585 21.687  25.994  1.00 24.14 ? 72  SER B O   1 
ATOM   1335 C CB  . SER B 1 75  ? 35.545 19.946  28.433  1.00 27.84 ? 72  SER B CB  1 
ATOM   1336 O OG  . SER B 1 75  ? 36.040 18.796  29.086  1.00 30.15 ? 72  SER B OG  1 
ATOM   1337 N N   . LEU B 1 76  ? 32.793 20.641  26.850  1.00 22.95 ? 73  LEU B N   1 
ATOM   1338 C CA  . LEU B 1 76  ? 31.857 21.682  26.487  1.00 21.64 ? 73  LEU B CA  1 
ATOM   1339 C C   . LEU B 1 76  ? 31.537 22.478  27.750  1.00 21.18 ? 73  LEU B C   1 
ATOM   1340 O O   . LEU B 1 76  ? 31.225 21.898  28.800  1.00 20.04 ? 73  LEU B O   1 
ATOM   1341 C CB  . LEU B 1 76  ? 30.560 21.078  25.955  1.00 21.59 ? 73  LEU B CB  1 
ATOM   1342 C CG  . LEU B 1 76  ? 29.427 22.063  25.668  1.00 21.00 ? 73  LEU B CG  1 
ATOM   1343 C CD1 . LEU B 1 76  ? 29.824 23.013  24.549  1.00 19.81 ? 73  LEU B CD1 1 
ATOM   1344 C CD2 . LEU B 1 76  ? 28.164 21.286  25.303  1.00 21.72 ? 73  LEU B CD2 1 
ATOM   1345 N N   . THR B 1 77  ? 31.620 23.799  27.652  1.00 20.15 ? 74  THR B N   1 
ATOM   1346 C CA  . THR B 1 77  ? 31.296 24.653  28.784  1.00 18.95 ? 74  THR B CA  1 
ATOM   1347 C C   . THR B 1 77  ? 30.129 25.567  28.446  1.00 19.01 ? 74  THR B C   1 
ATOM   1348 O O   . THR B 1 77  ? 30.078 26.169  27.372  1.00 20.22 ? 74  THR B O   1 
ATOM   1349 C CB  . THR B 1 77  ? 32.505 25.535  29.229  1.00 19.68 ? 74  THR B CB  1 
ATOM   1350 O OG1 . THR B 1 77  ? 33.541 24.699  29.765  1.00 20.19 ? 74  THR B OG1 1 
ATOM   1351 C CG2 . THR B 1 77  ? 32.062 26.542  30.296  1.00 18.29 ? 74  THR B CG2 1 
ATOM   1352 N N   . ILE B 1 78  ? 29.174 25.646  29.365  1.00 17.84 ? 75  ILE B N   1 
ATOM   1353 C CA  . ILE B 1 78  ? 28.023 26.507  29.186  1.00 15.94 ? 75  ILE B CA  1 
ATOM   1354 C C   . ILE B 1 78  ? 27.978 27.432  30.392  1.00 15.81 ? 75  ILE B C   1 
ATOM   1355 O O   . ILE B 1 78  ? 27.789 26.982  31.522  1.00 14.13 ? 75  ILE B O   1 
ATOM   1356 C CB  . ILE B 1 78  ? 26.696 25.709  29.104  1.00 15.85 ? 75  ILE B CB  1 
ATOM   1357 C CG1 . ILE B 1 78  ? 26.710 24.785  27.879  1.00 16.13 ? 75  ILE B CG1 1 
ATOM   1358 C CG2 . ILE B 1 78  ? 25.529 26.673  29.011  1.00 16.47 ? 75  ILE B CG2 1 
ATOM   1359 C CD1 . ILE B 1 78  ? 25.519 23.818  27.786  1.00 15.72 ? 75  ILE B CD1 1 
ATOM   1360 N N   . SER B 1 79  ? 28.201 28.720  30.152  1.00 15.88 ? 76  SER B N   1 
ATOM   1361 C CA  . SER B 1 79  ? 28.161 29.704  31.229  1.00 17.14 ? 76  SER B CA  1 
ATOM   1362 C C   . SER B 1 79  ? 26.851 30.488  31.149  1.00 16.38 ? 76  SER B C   1 
ATOM   1363 O O   . SER B 1 79  ? 26.124 30.383  30.161  1.00 17.32 ? 76  SER B O   1 
ATOM   1364 C CB  . SER B 1 79  ? 29.361 30.657  31.123  1.00 16.70 ? 76  SER B CB  1 
ATOM   1365 O OG  . SER B 1 79  ? 29.349 31.338  29.884  1.00 18.01 ? 76  SER B OG  1 
ATOM   1366 N N   . GLY B 1 80  ? 26.553 31.260  32.192  1.00 15.93 ? 77  GLY B N   1 
ATOM   1367 C CA  . GLY B 1 80  ? 25.330 32.050  32.227  1.00 16.08 ? 77  GLY B CA  1 
ATOM   1368 C C   . GLY B 1 80  ? 24.102 31.197  31.948  1.00 16.35 ? 77  GLY B C   1 
ATOM   1369 O O   . GLY B 1 80  ? 23.238 31.599  31.169  1.00 15.86 ? 77  GLY B O   1 
ATOM   1370 N N   . LEU B 1 81  ? 24.014 30.041  32.604  1.00 16.03 ? 78  LEU B N   1 
ATOM   1371 C CA  . LEU B 1 81  ? 22.909 29.105  32.380  1.00 16.05 ? 78  LEU B CA  1 
ATOM   1372 C C   . LEU B 1 81  ? 21.505 29.683  32.360  1.00 15.99 ? 78  LEU B C   1 
ATOM   1373 O O   . LEU B 1 81  ? 21.104 30.454  33.235  1.00 15.38 ? 78  LEU B O   1 
ATOM   1374 C CB  . LEU B 1 81  ? 22.976 27.945  33.383  1.00 16.63 ? 78  LEU B CB  1 
ATOM   1375 C CG  . LEU B 1 81  ? 24.097 26.925  33.115  1.00 17.43 ? 78  LEU B CG  1 
ATOM   1376 C CD1 . LEU B 1 81  ? 24.302 26.013  34.318  1.00 18.73 ? 78  LEU B CD1 1 
ATOM   1377 C CD2 . LEU B 1 81  ? 23.772 26.119  31.856  1.00 16.60 ? 78  LEU B CD2 1 
ATOM   1378 N N   . LYS B 1 82  ? 20.772 29.284  31.327  1.00 16.79 ? 79  LYS B N   1 
ATOM   1379 C CA  . LYS B 1 82  ? 19.390 29.689  31.110  1.00 16.64 ? 79  LYS B CA  1 
ATOM   1380 C C   . LYS B 1 82  ? 18.544 28.421  31.083  1.00 17.24 ? 79  LYS B C   1 
ATOM   1381 O O   . LYS B 1 82  ? 19.039 27.341  30.748  1.00 15.63 ? 79  LYS B O   1 
ATOM   1382 C CB  . LYS B 1 82  ? 19.245 30.418  29.768  1.00 17.67 ? 79  LYS B CB  1 
ATOM   1383 C CG  . LYS B 1 82  ? 19.661 31.883  29.762  1.00 20.72 ? 79  LYS B CG  1 
ATOM   1384 C CD  . LYS B 1 82  ? 19.321 32.496  28.412  1.00 21.61 ? 79  LYS B CD  1 
ATOM   1385 C CE  . LYS B 1 82  ? 19.253 34.017  28.461  1.00 23.39 ? 79  LYS B CE  1 
ATOM   1386 N NZ  . LYS B 1 82  ? 20.534 34.679  28.854  1.00 23.38 ? 79  LYS B NZ  1 
ATOM   1387 N N   . THR B 1 83  ? 17.270 28.562  31.419  1.00 18.19 ? 80  THR B N   1 
ATOM   1388 C CA  . THR B 1 83  ? 16.356 27.427  31.427  1.00 19.53 ? 80  THR B CA  1 
ATOM   1389 C C   . THR B 1 83  ? 16.370 26.662  30.105  1.00 19.29 ? 80  THR B C   1 
ATOM   1390 O O   . THR B 1 83  ? 16.276 25.437  30.092  1.00 19.48 ? 80  THR B O   1 
ATOM   1391 C CB  . THR B 1 83  ? 14.920 27.894  31.704  1.00 19.68 ? 80  THR B CB  1 
ATOM   1392 O OG1 . THR B 1 83  ? 14.891 28.609  32.946  1.00 20.71 ? 80  THR B OG1 1 
ATOM   1393 C CG2 . THR B 1 83  ? 13.980 26.704  31.787  1.00 20.96 ? 80  THR B CG2 1 
ATOM   1394 N N   . GLU B 1 84  ? 16.507 27.385  28.998  1.00 19.86 ? 81  GLU B N   1 
ATOM   1395 C CA  . GLU B 1 84  ? 16.499 26.778  27.670  1.00 20.70 ? 81  GLU B CA  1 
ATOM   1396 C C   . GLU B 1 84  ? 17.678 25.858  27.391  1.00 19.78 ? 81  GLU B C   1 
ATOM   1397 O O   . GLU B 1 84  ? 17.648 25.081  26.443  1.00 19.31 ? 81  GLU B O   1 
ATOM   1398 C CB  . GLU B 1 84  ? 16.435 27.872  26.605  1.00 22.12 ? 81  GLU B CB  1 
ATOM   1399 C CG  . GLU B 1 84  ? 17.648 28.765  26.572  1.00 24.75 ? 81  GLU B CG  1 
ATOM   1400 C CD  . GLU B 1 84  ? 17.430 29.995  25.729  1.00 27.29 ? 81  GLU B CD  1 
ATOM   1401 O OE1 . GLU B 1 84  ? 16.628 30.868  26.139  1.00 27.68 ? 81  GLU B OE1 1 
ATOM   1402 O OE2 . GLU B 1 84  ? 18.047 30.080  24.647  1.00 27.26 ? 81  GLU B OE2 1 
ATOM   1403 N N   . ASP B 1 85  ? 18.712 25.947  28.226  1.00 18.95 ? 82  ASP B N   1 
ATOM   1404 C CA  . ASP B 1 85  ? 19.890 25.116  28.067  1.00 17.87 ? 82  ASP B CA  1 
ATOM   1405 C C   . ASP B 1 85  ? 19.644 23.680  28.528  1.00 16.69 ? 82  ASP B C   1 
ATOM   1406 O O   . ASP B 1 85  ? 20.471 22.802  28.284  1.00 16.36 ? 82  ASP B O   1 
ATOM   1407 C CB  . ASP B 1 85  ? 21.075 25.702  28.844  1.00 18.52 ? 82  ASP B CB  1 
ATOM   1408 C CG  . ASP B 1 85  ? 21.467 27.082  28.365  1.00 19.34 ? 82  ASP B CG  1 
ATOM   1409 O OD1 . ASP B 1 85  ? 21.444 27.310  27.134  1.00 19.75 ? 82  ASP B OD1 1 
ATOM   1410 O OD2 . ASP B 1 85  ? 21.831 27.930  29.215  1.00 19.86 ? 82  ASP B OD2 1 
ATOM   1411 N N   . GLU B 1 86  ? 18.523 23.436  29.206  1.00 16.14 ? 83  GLU B N   1 
ATOM   1412 C CA  . GLU B 1 86  ? 18.223 22.075  29.654  1.00 14.90 ? 83  GLU B CA  1 
ATOM   1413 C C   . GLU B 1 86  ? 18.071 21.215  28.397  1.00 15.38 ? 83  GLU B C   1 
ATOM   1414 O O   . GLU B 1 86  ? 17.226 21.486  27.520  1.00 14.40 ? 83  GLU B O   1 
ATOM   1415 C CB  . GLU B 1 86  ? 16.952 22.044  30.511  1.00 16.37 ? 83  GLU B CB  1 
ATOM   1416 C CG  . GLU B 1 86  ? 16.629 20.661  31.078  1.00 18.61 ? 83  GLU B CG  1 
ATOM   1417 C CD  . GLU B 1 86  ? 15.746 20.715  32.321  1.00 21.00 ? 83  GLU B CD  1 
ATOM   1418 O OE1 . GLU B 1 86  ? 16.150 21.372  33.319  1.00 20.70 ? 83  GLU B OE1 1 
ATOM   1419 O OE2 . GLU B 1 86  ? 14.657 20.095  32.304  1.00 21.21 ? 83  GLU B OE2 1 
ATOM   1420 N N   . ALA B 1 87  ? 18.920 20.201  28.307  1.00 14.34 ? 84  ALA B N   1 
ATOM   1421 C CA  . ALA B 1 87  ? 18.941 19.318  27.154  1.00 15.73 ? 84  ALA B CA  1 
ATOM   1422 C C   . ALA B 1 87  ? 19.982 18.234  27.336  1.00 15.57 ? 84  ALA B C   1 
ATOM   1423 O O   . ALA B 1 87  ? 20.699 18.193  28.345  1.00 16.17 ? 84  ALA B O   1 
ATOM   1424 C CB  . ALA B 1 87  ? 19.274 20.132  25.891  1.00 15.07 ? 84  ALA B CB  1 
ATOM   1425 N N   . ASP B 1 88  ? 20.049 17.335  26.360  1.00 16.45 ? 85  ASP B N   1 
ATOM   1426 C CA  . ASP B 1 88  ? 21.055 16.283  26.358  1.00 16.83 ? 85  ASP B CA  1 
ATOM   1427 C C   . ASP B 1 88  ? 22.159 16.817  25.447  1.00 16.92 ? 85  ASP B C   1 
ATOM   1428 O O   . ASP B 1 88  ? 21.865 17.405  24.411  1.00 18.42 ? 85  ASP B O   1 
ATOM   1429 C CB  . ASP B 1 88  ? 20.516 14.984  25.748  1.00 17.97 ? 85  ASP B CB  1 
ATOM   1430 C CG  . ASP B 1 88  ? 19.599 14.226  26.683  1.00 19.77 ? 85  ASP B CG  1 
ATOM   1431 O OD1 . ASP B 1 88  ? 20.081 13.748  27.746  1.00 19.18 ? 85  ASP B OD1 1 
ATOM   1432 O OD2 . ASP B 1 88  ? 18.401 14.105  26.347  1.00 19.69 ? 85  ASP B OD2 1 
ATOM   1433 N N   . TYR B 1 89  ? 23.413 16.637  25.838  1.00 17.76 ? 86  TYR B N   1 
ATOM   1434 C CA  . TYR B 1 89  ? 24.526 17.092  25.013  1.00 17.68 ? 86  TYR B CA  1 
ATOM   1435 C C   . TYR B 1 89  ? 25.418 15.942  24.606  1.00 17.20 ? 86  TYR B C   1 
ATOM   1436 O O   . TYR B 1 89  ? 25.825 15.132  25.442  1.00 17.42 ? 86  TYR B O   1 
ATOM   1437 C CB  . TYR B 1 89  ? 25.365 18.144  25.740  1.00 16.81 ? 86  TYR B CB  1 
ATOM   1438 C CG  . TYR B 1 89  ? 24.633 19.436  25.961  1.00 15.85 ? 86  TYR B CG  1 
ATOM   1439 C CD1 . TYR B 1 89  ? 23.753 19.587  27.027  1.00 16.83 ? 86  TYR B CD1 1 
ATOM   1440 C CD2 . TYR B 1 89  ? 24.761 20.483  25.058  1.00 15.02 ? 86  TYR B CD2 1 
ATOM   1441 C CE1 . TYR B 1 89  ? 23.011 20.748  27.187  1.00 14.37 ? 86  TYR B CE1 1 
ATOM   1442 C CE2 . TYR B 1 89  ? 24.019 21.650  25.207  1.00 15.41 ? 86  TYR B CE2 1 
ATOM   1443 C CZ  . TYR B 1 89  ? 23.145 21.769  26.275  1.00 14.85 ? 86  TYR B CZ  1 
ATOM   1444 O OH  . TYR B 1 89  ? 22.395 22.896  26.414  1.00 13.66 ? 86  TYR B OH  1 
ATOM   1445 N N   . TYR B 1 90  ? 25.738 15.879  23.318  1.00 18.66 ? 87  TYR B N   1 
ATOM   1446 C CA  . TYR B 1 90  ? 26.583 14.804  22.821  1.00 19.82 ? 87  TYR B CA  1 
ATOM   1447 C C   . TYR B 1 90  ? 27.820 15.320  22.124  1.00 20.70 ? 87  TYR B C   1 
ATOM   1448 O O   . TYR B 1 90  ? 27.746 16.273  21.352  1.00 20.75 ? 87  TYR B O   1 
ATOM   1449 C CB  . TYR B 1 90  ? 25.836 13.924  21.805  1.00 19.42 ? 87  TYR B CB  1 
ATOM   1450 C CG  . TYR B 1 90  ? 24.544 13.320  22.311  1.00 17.58 ? 87  TYR B CG  1 
ATOM   1451 C CD1 . TYR B 1 90  ? 23.342 14.020  22.228  1.00 18.59 ? 87  TYR B CD1 1 
ATOM   1452 C CD2 . TYR B 1 90  ? 24.533 12.058  22.882  1.00 17.72 ? 87  TYR B CD2 1 
ATOM   1453 C CE1 . TYR B 1 90  ? 22.154 13.463  22.703  1.00 16.89 ? 87  TYR B CE1 1 
ATOM   1454 C CE2 . TYR B 1 90  ? 23.353 11.494  23.362  1.00 18.42 ? 87  TYR B CE2 1 
ATOM   1455 C CZ  . TYR B 1 90  ? 22.173 12.203  23.265  1.00 16.06 ? 87  TYR B CZ  1 
ATOM   1456 O OH  . TYR B 1 90  ? 21.007 11.629  23.723  1.00 16.09 ? 87  TYR B OH  1 
ATOM   1457 N N   . CYS B 1 91  ? 28.953 14.692  22.400  1.00 21.93 ? 88  CYS B N   1 
ATOM   1458 C CA  . CYS B 1 91  ? 30.168 15.069  21.707  1.00 24.48 ? 88  CYS B CA  1 
ATOM   1459 C C   . CYS B 1 91  ? 30.251 14.124  20.514  1.00 24.44 ? 88  CYS B C   1 
ATOM   1460 O O   . CYS B 1 91  ? 29.818 12.976  20.603  1.00 23.72 ? 88  CYS B O   1 
ATOM   1461 C CB  . CYS B 1 91  ? 31.414 14.937  22.598  1.00 25.39 ? 88  CYS B CB  1 
ATOM   1462 S SG  . CYS B 1 91  ? 31.758 13.343  23.397  1.00 29.91 ? 88  CYS B SG  1 
ATOM   1463 N N   . GLN B 1 92  ? 30.772 14.626  19.396  1.00 25.64 ? 89  GLN B N   1 
ATOM   1464 C CA  . GLN B 1 92  ? 30.913 13.838  18.171  1.00 26.64 ? 89  GLN B CA  1 
ATOM   1465 C C   . GLN B 1 92  ? 32.402 13.828  17.811  1.00 28.10 ? 89  GLN B C   1 
ATOM   1466 O O   . GLN B 1 92  ? 33.097 14.821  18.021  1.00 27.46 ? 89  GLN B O   1 
ATOM   1467 C CB  . GLN B 1 92  ? 30.134 14.490  17.016  1.00 25.75 ? 89  GLN B CB  1 
ATOM   1468 C CG  . GLN B 1 92  ? 28.660 14.847  17.299  1.00 25.91 ? 89  GLN B CG  1 
ATOM   1469 C CD  . GLN B 1 92  ? 28.035 15.666  16.169  1.00 23.88 ? 89  GLN B CD  1 
ATOM   1470 O OE1 . GLN B 1 92  ? 27.912 15.193  15.048  1.00 26.36 ? 89  GLN B OE1 1 
ATOM   1471 N NE2 . GLN B 1 92  ? 27.655 16.904  16.464  1.00 25.53 ? 89  GLN B NE2 1 
ATOM   1472 N N   . SER B 1 93  ? 32.886 12.714  17.274  1.00 29.80 ? 90  SER B N   1 
ATOM   1473 C CA  . SER B 1 93  ? 34.284 12.607  16.874  1.00 31.71 ? 90  SER B CA  1 
ATOM   1474 C C   . SER B 1 93  ? 34.384 11.713  15.635  1.00 32.88 ? 90  SER B C   1 
ATOM   1475 O O   . SER B 1 93  ? 33.570 10.808  15.450  1.00 32.57 ? 90  SER B O   1 
ATOM   1476 C CB  . SER B 1 93  ? 35.113 12.034  18.022  1.00 31.42 ? 90  SER B CB  1 
ATOM   1477 O OG  . SER B 1 93  ? 36.494 12.080  17.720  1.00 33.00 ? 90  SER B OG  1 
ATOM   1478 N N   . TYR B 1 94  ? 35.377 11.964  14.785  1.00 34.12 ? 91  TYR B N   1 
ATOM   1479 C CA  . TYR B 1 94  ? 35.525 11.174  13.567  1.00 36.39 ? 91  TYR B CA  1 
ATOM   1480 C C   . TYR B 1 94  ? 36.682 10.187  13.559  1.00 37.90 ? 91  TYR B C   1 
ATOM   1481 O O   . TYR B 1 94  ? 37.706 10.381  14.220  1.00 37.35 ? 91  TYR B O   1 
ATOM   1482 C CB  . TYR B 1 94  ? 35.642 12.092  12.346  1.00 36.64 ? 91  TYR B CB  1 
ATOM   1483 C CG  . TYR B 1 94  ? 34.437 12.963  12.120  1.00 37.93 ? 91  TYR B CG  1 
ATOM   1484 C CD1 . TYR B 1 94  ? 34.098 13.957  13.034  1.00 38.29 ? 91  TYR B CD1 1 
ATOM   1485 C CD2 . TYR B 1 94  ? 33.638 12.791  10.991  1.00 38.29 ? 91  TYR B CD2 1 
ATOM   1486 C CE1 . TYR B 1 94  ? 32.981 14.766  12.828  1.00 38.58 ? 91  TYR B CE1 1 
ATOM   1487 C CE2 . TYR B 1 94  ? 32.520 13.593  10.776  1.00 38.93 ? 91  TYR B CE2 1 
ATOM   1488 C CZ  . TYR B 1 94  ? 32.190 14.583  11.695  1.00 39.20 ? 91  TYR B CZ  1 
ATOM   1489 N N   . ASP B 1 95  ? 36.491 9.122   12.788  1.00 39.35 ? 92  ASP B N   1 
ATOM   1490 C CA  . ASP B 1 95  ? 37.472 8.056   12.631  1.00 41.60 ? 92  ASP B CA  1 
ATOM   1491 C C   . ASP B 1 95  ? 37.362 7.643   11.165  1.00 42.16 ? 92  ASP B C   1 
ATOM   1492 O O   . ASP B 1 95  ? 36.258 7.625   10.620  1.00 42.67 ? 92  ASP B O   1 
ATOM   1493 C CB  . ASP B 1 95  ? 37.102 6.871   13.522  1.00 41.65 ? 92  ASP B CB  1 
ATOM   1494 C CG  . ASP B 1 95  ? 38.202 5.842   13.603  1.00 42.12 ? 92  ASP B CG  1 
ATOM   1495 O OD1 . ASP B 1 95  ? 39.327 6.144   13.160  1.00 42.77 ? 92  ASP B OD1 1 
ATOM   1496 O OD2 . ASP B 1 95  ? 37.949 4.738   14.124  1.00 42.30 ? 92  ASP B OD2 1 
ATOM   1497 N N   . HIS B 1 96  ? 38.480 7.313   10.525  1.00 43.10 ? 93  HIS B N   1 
ATOM   1498 C CA  . HIS B 1 96  ? 38.431 6.921   9.116   1.00 43.75 ? 93  HIS B CA  1 
ATOM   1499 C C   . HIS B 1 96  ? 37.229 6.016   8.821   1.00 42.89 ? 93  HIS B C   1 
ATOM   1500 O O   . HIS B 1 96  ? 37.101 4.916   9.371   1.00 43.27 ? 93  HIS B O   1 
ATOM   1501 C CB  . HIS B 1 96  ? 39.744 6.234   8.690   1.00 45.31 ? 93  HIS B CB  1 
ATOM   1502 C CG  . HIS B 1 96  ? 40.094 5.023   9.497   1.00 46.87 ? 93  HIS B CG  1 
ATOM   1503 N ND1 . HIS B 1 96  ? 40.342 5.077   10.852  1.00 47.44 ? 93  HIS B ND1 1 
ATOM   1504 C CD2 . HIS B 1 96  ? 40.244 3.726   9.138   1.00 47.37 ? 93  HIS B CD2 1 
ATOM   1505 C CE1 . HIS B 1 96  ? 40.630 3.865   11.294  1.00 48.08 ? 93  HIS B CE1 1 
ATOM   1506 N NE2 . HIS B 1 96  ? 40.578 3.027   10.274  1.00 48.40 ? 93  HIS B NE2 1 
ATOM   1507 N N   . ASN B 1 97  ? 36.340 6.510   7.963   1.00 41.83 ? 94  ASN B N   1 
ATOM   1508 C CA  . ASN B 1 97  ? 35.136 5.785   7.574   1.00 40.11 ? 94  ASN B CA  1 
ATOM   1509 C C   . ASN B 1 97  ? 34.131 5.590   8.710   1.00 38.40 ? 94  ASN B C   1 
ATOM   1510 O O   . ASN B 1 97  ? 33.406 4.594   8.732   1.00 38.59 ? 94  ASN B O   1 
ATOM   1511 C CB  . ASN B 1 97  ? 35.515 4.424   6.982   1.00 41.53 ? 94  ASN B CB  1 
ATOM   1512 C CG  . ASN B 1 97  ? 36.319 4.553   5.704   1.00 42.64 ? 94  ASN B CG  1 
ATOM   1513 O OD1 . ASN B 1 97  ? 37.333 5.253   5.668   1.00 43.87 ? 94  ASN B OD1 1 
ATOM   1514 N ND2 . ASN B 1 97  ? 35.877 3.874   4.651   1.00 43.21 ? 94  ASN B ND2 1 
ATOM   1515 N N   . ASN B 1 98  ? 34.081 6.532   9.652   1.00 36.16 ? 95  ASN B N   1 
ATOM   1516 C CA  . ASN B 1 98  ? 33.136 6.418   10.755  1.00 33.45 ? 95  ASN B CA  1 
ATOM   1517 C C   . ASN B 1 98  ? 33.044 7.607   11.712  1.00 31.95 ? 95  ASN B C   1 
ATOM   1518 O O   . ASN B 1 98  ? 34.044 8.225   12.073  1.00 30.80 ? 95  ASN B O   1 
ATOM   1519 C CB  . ASN B 1 98  ? 33.413 5.147   11.561  1.00 33.73 ? 95  ASN B CB  1 
ATOM   1520 C CG  . ASN B 1 98  ? 32.391 4.925   12.659  1.00 34.00 ? 95  ASN B CG  1 
ATOM   1521 O OD1 . ASN B 1 98  ? 31.184 5.000   12.418  1.00 33.57 ? 95  ASN B OD1 1 
ATOM   1522 N ND2 . ASN B 1 98  ? 32.869 4.637   13.869  1.00 34.15 ? 95  ASN B ND2 1 
ATOM   1523 N N   . GLN B 1 99  ? 31.811 7.886   12.123  1.00 29.31 ? 96  GLN B N   1 
ATOM   1524 C CA  . GLN B 1 99  ? 31.473 8.967   13.036  1.00 27.48 ? 96  GLN B CA  1 
ATOM   1525 C C   . GLN B 1 99  ? 31.094 8.360   14.390  1.00 26.59 ? 96  GLN B C   1 
ATOM   1526 O O   . GLN B 1 99  ? 30.168 7.549   14.477  1.00 26.24 ? 96  GLN B O   1 
ATOM   1527 C CB  . GLN B 1 99  ? 30.293 9.741   12.454  1.00 25.98 ? 96  GLN B CB  1 
ATOM   1528 C CG  . GLN B 1 99  ? 29.699 10.787  13.356  1.00 25.30 ? 96  GLN B CG  1 
ATOM   1529 C CD  . GLN B 1 99  ? 28.464 11.425  12.737  1.00 24.03 ? 96  GLN B CD  1 
ATOM   1530 O OE1 . GLN B 1 99  ? 27.501 10.733  12.377  1.00 23.87 ? 96  GLN B OE1 1 
ATOM   1531 N NE2 . GLN B 1 99  ? 28.479 12.738  12.614  1.00 22.54 ? 96  GLN B NE2 1 
ATOM   1532 N N   . VAL B 1 100 ? 31.803 8.760   15.444  1.00 25.66 ? 97  VAL B N   1 
ATOM   1533 C CA  . VAL B 1 100 ? 31.557 8.233   16.789  1.00 25.35 ? 97  VAL B CA  1 
ATOM   1534 C C   . VAL B 1 100 ? 30.895 9.238   17.735  1.00 24.38 ? 97  VAL B C   1 
ATOM   1535 O O   . VAL B 1 100 ? 31.245 10.421  17.739  1.00 24.37 ? 97  VAL B O   1 
ATOM   1536 C CB  . VAL B 1 100 ? 32.881 7.766   17.428  1.00 25.17 ? 97  VAL B CB  1 
ATOM   1537 C CG1 . VAL B 1 100 ? 32.625 7.198   18.813  1.00 25.48 ? 97  VAL B CG1 1 
ATOM   1538 C CG2 . VAL B 1 100 ? 33.552 6.737   16.528  1.00 27.01 ? 97  VAL B CG2 1 
ATOM   1539 N N   . PHE B 1 101 ? 29.944 8.768   18.540  1.00 23.32 ? 98  PHE B N   1 
ATOM   1540 C CA  . PHE B 1 101 ? 29.254 9.642   19.491  1.00 22.30 ? 98  PHE B CA  1 
ATOM   1541 C C   . PHE B 1 101 ? 29.576 9.324   20.947  1.00 22.16 ? 98  PHE B C   1 
ATOM   1542 O O   . PHE B 1 101 ? 29.911 8.189   21.301  1.00 22.22 ? 98  PHE B O   1 
ATOM   1543 C CB  . PHE B 1 101 ? 27.736 9.553   19.332  1.00 21.89 ? 98  PHE B CB  1 
ATOM   1544 C CG  . PHE B 1 101 ? 27.227 10.024  18.011  1.00 20.88 ? 98  PHE B CG  1 
ATOM   1545 C CD1 . PHE B 1 101 ? 27.450 9.284   16.855  1.00 20.94 ? 98  PHE B CD1 1 
ATOM   1546 C CD2 . PHE B 1 101 ? 26.504 11.204  17.923  1.00 20.79 ? 98  PHE B CD2 1 
ATOM   1547 C CE1 . PHE B 1 101 ? 26.954 9.717   15.623  1.00 21.57 ? 98  PHE B CE1 1 
ATOM   1548 C CE2 . PHE B 1 101 ? 26.002 11.651  16.697  1.00 21.05 ? 98  PHE B CE2 1 
ATOM   1549 C CZ  . PHE B 1 101 ? 26.226 10.907  15.543  1.00 20.69 ? 98  PHE B CZ  1 
ATOM   1550 N N   . GLY B 1 102 ? 29.467 10.342  21.792  1.00 21.74 ? 99  GLY B N   1 
ATOM   1551 C CA  . GLY B 1 102 ? 29.693 10.144  23.204  1.00 21.62 ? 99  GLY B CA  1 
ATOM   1552 C C   . GLY B 1 102 ? 28.398 9.590   23.762  1.00 21.25 ? 99  GLY B C   1 
ATOM   1553 O O   . GLY B 1 102 ? 27.387 9.589   23.074  1.00 20.99 ? 99  GLY B O   1 
ATOM   1554 N N   . GLY B 1 103 ? 28.414 9.128   25.003  1.00 22.33 ? 100 GLY B N   1 
ATOM   1555 C CA  . GLY B 1 103 ? 27.207 8.576   25.596  1.00 22.13 ? 100 GLY B CA  1 
ATOM   1556 C C   . GLY B 1 103 ? 26.155 9.642   25.827  1.00 22.04 ? 100 GLY B C   1 
ATOM   1557 O O   . GLY B 1 103 ? 24.962 9.352   25.891  1.00 21.86 ? 100 GLY B O   1 
ATOM   1558 N N   . GLY B 1 104 ? 26.596 10.886  25.967  1.00 21.25 ? 101 GLY B N   1 
ATOM   1559 C CA  . GLY B 1 104 ? 25.651 11.970  26.174  1.00 20.63 ? 101 GLY B CA  1 
ATOM   1560 C C   . GLY B 1 104 ? 25.486 12.357  27.629  1.00 19.48 ? 101 GLY B C   1 
ATOM   1561 O O   . GLY B 1 104 ? 25.548 11.511  28.522  1.00 21.03 ? 101 GLY B O   1 
ATOM   1562 N N   . THR B 1 105 ? 25.290 13.644  27.871  1.00 18.46 ? 102 THR B N   1 
ATOM   1563 C CA  . THR B 1 105 ? 25.111 14.125  29.224  1.00 16.72 ? 102 THR B CA  1 
ATOM   1564 C C   . THR B 1 105 ? 23.819 14.921  29.315  1.00 15.90 ? 102 THR B C   1 
ATOM   1565 O O   . THR B 1 105 ? 23.525 15.766  28.462  1.00 16.23 ? 102 THR B O   1 
ATOM   1566 C CB  . THR B 1 105 ? 26.281 15.016  29.663  1.00 17.32 ? 102 THR B CB  1 
ATOM   1567 O OG1 . THR B 1 105 ? 27.515 14.292  29.529  1.00 17.03 ? 102 THR B OG1 1 
ATOM   1568 C CG2 . THR B 1 105 ? 26.094 15.428  31.116  1.00 15.83 ? 102 THR B CG2 1 
ATOM   1569 N N   . LYS B 1 106 ? 23.028 14.637  30.338  1.00 15.28 ? 103 LYS B N   1 
ATOM   1570 C CA  . LYS B 1 106 ? 21.776 15.353  30.522  1.00 14.85 ? 103 LYS B CA  1 
ATOM   1571 C C   . LYS B 1 106 ? 22.017 16.511  31.472  1.00 14.35 ? 103 LYS B C   1 
ATOM   1572 O O   . LYS B 1 106 ? 22.399 16.303  32.614  1.00 15.16 ? 103 LYS B O   1 
ATOM   1573 C CB  . LYS B 1 106 ? 20.694 14.435  31.099  1.00 15.44 ? 103 LYS B CB  1 
ATOM   1574 C CG  . LYS B 1 106 ? 19.369 15.144  31.326  1.00 16.31 ? 103 LYS B CG  1 
ATOM   1575 C CD  . LYS B 1 106 ? 18.860 15.749  30.017  1.00 18.09 ? 103 LYS B CD  1 
ATOM   1576 C CE  . LYS B 1 106 ? 17.619 16.604  30.224  1.00 20.22 ? 103 LYS B CE  1 
ATOM   1577 N NZ  . LYS B 1 106 ? 16.465 15.847  30.779  1.00 19.58 ? 103 LYS B NZ  1 
ATOM   1578 N N   . LEU B 1 107 ? 21.816 17.724  30.980  1.00 15.05 ? 104 LEU B N   1 
ATOM   1579 C CA  . LEU B 1 107 ? 21.989 18.920  31.787  1.00 15.56 ? 104 LEU B CA  1 
ATOM   1580 C C   . LEU B 1 107 ? 20.648 19.349  32.370  1.00 15.35 ? 104 LEU B C   1 
ATOM   1581 O O   . LEU B 1 107 ? 19.674 19.540  31.627  1.00 15.31 ? 104 LEU B O   1 
ATOM   1582 C CB  . LEU B 1 107 ? 22.564 20.059  30.929  1.00 15.36 ? 104 LEU B CB  1 
ATOM   1583 C CG  . LEU B 1 107 ? 22.835 21.441  31.543  1.00 16.28 ? 104 LEU B CG  1 
ATOM   1584 C CD1 . LEU B 1 107 ? 23.624 22.281  30.551  1.00 16.13 ? 104 LEU B CD1 1 
ATOM   1585 C CD2 . LEU B 1 107 ? 21.527 22.152  31.917  1.00 14.85 ? 104 LEU B CD2 1 
ATOM   1586 N N   . THR B 1 108 ? 20.594 19.481  33.692  1.00 15.03 ? 105 THR B N   1 
ATOM   1587 C CA  . THR B 1 108 ? 19.381 19.942  34.365  1.00 15.69 ? 105 THR B CA  1 
ATOM   1588 C C   . THR B 1 108 ? 19.671 21.339  34.894  1.00 16.18 ? 105 THR B C   1 
ATOM   1589 O O   . THR B 1 108 ? 20.632 21.535  35.644  1.00 16.94 ? 105 THR B O   1 
ATOM   1590 C CB  . THR B 1 108 ? 18.973 19.064  35.587  1.00 15.37 ? 105 THR B CB  1 
ATOM   1591 O OG1 . THR B 1 108 ? 18.638 17.742  35.153  1.00 15.52 ? 105 THR B OG1 1 
ATOM   1592 C CG2 . THR B 1 108 ? 17.742 19.670  36.286  1.00 14.82 ? 105 THR B CG2 1 
ATOM   1593 N N   . VAL B 1 109 ? 18.867 22.313  34.479  1.00 17.53 ? 106 VAL B N   1 
ATOM   1594 C CA  . VAL B 1 109 ? 19.043 23.670  34.973  1.00 18.51 ? 106 VAL B CA  1 
ATOM   1595 C C   . VAL B 1 109 ? 18.074 23.796  36.144  1.00 20.33 ? 106 VAL B C   1 
ATOM   1596 O O   . VAL B 1 109 ? 16.875 23.564  35.997  1.00 19.96 ? 106 VAL B O   1 
ATOM   1597 C CB  . VAL B 1 109 ? 18.721 24.742  33.905  1.00 18.30 ? 106 VAL B CB  1 
ATOM   1598 C CG1 . VAL B 1 109 ? 18.930 26.114  34.497  1.00 16.96 ? 106 VAL B CG1 1 
ATOM   1599 C CG2 . VAL B 1 109 ? 19.614 24.569  32.674  1.00 17.49 ? 106 VAL B CG2 1 
ATOM   1600 N N   . LEU B 1 110 ? 18.605 24.151  37.306  1.00 21.82 ? 107 LEU B N   1 
ATOM   1601 C CA  . LEU B 1 110 ? 17.810 24.263  38.522  1.00 24.19 ? 107 LEU B CA  1 
ATOM   1602 C C   . LEU B 1 110 ? 17.132 25.611  38.733  1.00 25.17 ? 107 LEU B C   1 
ATOM   1603 O O   . LEU B 1 110 ? 17.125 26.142  39.841  1.00 26.09 ? 107 LEU B O   1 
ATOM   1604 C CB  . LEU B 1 110 ? 18.684 23.917  39.733  1.00 24.23 ? 107 LEU B CB  1 
ATOM   1605 C CG  . LEU B 1 110 ? 19.210 22.475  39.748  1.00 25.63 ? 107 LEU B CG  1 
ATOM   1606 C CD1 . LEU B 1 110 ? 20.188 22.280  40.903  1.00 26.72 ? 107 LEU B CD1 1 
ATOM   1607 C CD2 . LEU B 1 110 ? 18.035 21.504  39.862  1.00 25.40 ? 107 LEU B CD2 1 
ATOM   1608 N N   . GLY B 1 111 ? 16.539 26.142  37.668  1.00 26.47 ? 108 GLY B N   1 
ATOM   1609 C CA  . GLY B 1 111 ? 15.846 27.415  37.748  1.00 27.33 ? 108 GLY B CA  1 
ATOM   1610 C C   . GLY B 1 111 ? 15.215 27.774  36.417  1.00 27.88 ? 108 GLY B C   1 
ATOM   1611 O O   . GLY B 1 111 ? 15.372 26.992  35.454  1.00 28.33 ? 108 GLY B O   1 
ATOM   1612 O OXT . GLY B 1 111 ? 14.563 28.837  36.328  1.00 28.42 ? 108 GLY B OXT 1 
HETATM 1613 O O   . HOH C 2 .   ? 22.130 9.101   2.176   1.00 10.30 ? 501 HOH A O   1 
HETATM 1614 O O   . HOH C 2 .   ? 13.648 20.541  3.992   1.00 28.30 ? 502 HOH A O   1 
HETATM 1615 O O   . HOH C 2 .   ? 11.854 20.241  8.618   1.00 23.76 ? 503 HOH A O   1 
HETATM 1616 O O   . HOH C 2 .   ? 12.860 17.532  9.497   1.00 24.23 ? 504 HOH A O   1 
HETATM 1617 O O   . HOH C 2 .   ? 10.020 12.138  15.183  1.00 17.65 ? 505 HOH A O   1 
HETATM 1618 O O   . HOH C 2 .   ? 7.865  14.884  9.535   1.00 44.86 ? 506 HOH A O   1 
HETATM 1619 O O   . HOH C 2 .   ? 12.058 14.187  2.957   1.00 25.40 ? 507 HOH A O   1 
HETATM 1620 O O   . HOH C 2 .   ? 27.119 14.421  -1.228  1.00 43.81 ? 508 HOH A O   1 
HETATM 1621 O O   . HOH C 2 .   ? 19.443 -1.640  13.974  1.00 21.76 ? 509 HOH A O   1 
HETATM 1622 O O   . HOH C 2 .   ? 22.743 -1.105  16.867  1.00 30.13 ? 510 HOH A O   1 
HETATM 1623 O O   . HOH C 2 .   ? 22.158 2.472   17.758  1.00 14.55 ? 511 HOH A O   1 
HETATM 1624 O O   . HOH C 2 .   ? 21.206 3.907   19.846  1.00 24.20 ? 512 HOH A O   1 
HETATM 1625 O O   . HOH C 2 .   ? 25.379 1.684   13.960  1.00 19.69 ? 513 HOH A O   1 
HETATM 1626 O O   . HOH C 2 .   ? 28.970 2.825   13.412  1.00 19.20 ? 514 HOH A O   1 
HETATM 1627 O O   . HOH C 2 .   ? 20.177 -3.008  0.986   1.00 14.23 ? 515 HOH A O   1 
HETATM 1628 O O   . HOH C 2 .   ? 18.511 -1.173  2.062   1.00 12.37 ? 516 HOH A O   1 
HETATM 1629 O O   . HOH C 2 .   ? 18.719 -4.680  -0.427  1.00 12.69 ? 517 HOH A O   1 
HETATM 1630 O O   . HOH C 2 .   ? 18.031 8.464   -3.224  1.00 25.22 ? 518 HOH A O   1 
HETATM 1631 O O   . HOH C 2 .   ? 17.278 7.908   -6.255  1.00 26.16 ? 519 HOH A O   1 
HETATM 1632 O O   . HOH C 2 .   ? 16.779 10.493  -1.711  1.00 19.49 ? 520 HOH A O   1 
HETATM 1633 O O   . HOH C 2 .   ? 5.708  7.613   7.475   1.00 27.35 ? 528 HOH A O   1 
HETATM 1634 O O   . HOH C 2 .   ? 2.810  -6.440  12.594  1.00 22.97 ? 529 HOH A O   1 
HETATM 1635 O O   . HOH C 2 .   ? 9.729  2.437   0.647   1.00 37.90 ? 530 HOH A O   1 
HETATM 1636 O O   . HOH C 2 .   ? 24.255 18.440  1.480   1.00 24.45 ? 531 HOH A O   1 
HETATM 1637 O O   . HOH C 2 .   ? 32.786 11.905  -2.690  1.00 30.81 ? 532 HOH A O   1 
HETATM 1638 O O   . HOH C 2 .   ? 33.764 13.176  5.606   1.00 46.76 ? 533 HOH A O   1 
HETATM 1639 O O   . HOH C 2 .   ? 24.699 2.314   1.561   1.00 15.53 ? 535 HOH A O   1 
HETATM 1640 O O   . HOH C 2 .   ? 23.425 2.834   -1.609  1.00 25.70 ? 536 HOH A O   1 
HETATM 1641 O O   . HOH C 2 .   ? 26.852 2.065   -1.285  1.00 32.84 ? 537 HOH A O   1 
HETATM 1642 O O   . HOH C 2 .   ? 24.574 -0.245  2.480   1.00 20.57 ? 538 HOH A O   1 
HETATM 1643 O O   . HOH C 2 .   ? 30.159 -2.357  7.317   1.00 33.65 ? 539 HOH A O   1 
HETATM 1644 O O   . HOH C 2 .   ? 31.753 0.026   13.855  1.00 26.88 ? 540 HOH A O   1 
HETATM 1645 O O   . HOH C 2 .   ? 25.421 -7.375  6.634   1.00 19.06 ? 541 HOH A O   1 
HETATM 1646 O O   . HOH C 2 .   ? 21.852 -8.867  11.471  1.00 26.49 ? 542 HOH A O   1 
HETATM 1647 O O   . HOH C 2 .   ? 13.733 13.629  17.282  1.00 25.49 ? 544 HOH A O   1 
HETATM 1648 O O   . HOH C 2 .   ? 12.385 10.965  16.087  1.00 30.54 ? 545 HOH A O   1 
HETATM 1649 O O   . HOH C 2 .   ? 6.755  5.073   14.924  1.00 18.62 ? 551 HOH A O   1 
HETATM 1650 O O   . HOH C 2 .   ? 10.628 -3.326  18.061  1.00 26.14 ? 552 HOH A O   1 
HETATM 1651 O O   . HOH C 2 .   ? 4.172  -3.604  8.025   1.00 32.75 ? 553 HOH A O   1 
HETATM 1652 O O   . HOH C 2 .   ? 12.292 -6.580  2.813   1.00 40.80 ? 554 HOH A O   1 
HETATM 1653 O O   . HOH C 2 .   ? 8.588  -3.561  1.524   1.00 25.83 ? 555 HOH A O   1 
HETATM 1654 O O   . HOH C 2 .   ? 27.673 5.410   22.309  1.00 34.74 ? 556 HOH A O   1 
HETATM 1655 O O   . HOH C 2 .   ? 25.917 -2.859  14.448  1.00 42.67 ? 557 HOH A O   1 
HETATM 1656 O O   . HOH C 2 .   ? 23.195 -4.904  14.562  1.00 27.80 ? 558 HOH A O   1 
HETATM 1657 O O   . HOH C 2 .   ? 23.972 -8.644  9.545   1.00 35.73 ? 559 HOH A O   1 
HETATM 1658 O O   . HOH C 2 .   ? 21.870 10.771  -8.500  1.00 31.08 ? 560 HOH A O   1 
HETATM 1659 O O   . HOH C 2 .   ? 21.892 -7.612  6.447   1.00 13.30 ? 561 HOH A O   1 
HETATM 1660 O O   . HOH C 2 .   ? 5.515  10.383  9.484   1.00 26.79 ? 562 HOH A O   1 
HETATM 1661 O O   . HOH C 2 .   ? 4.437  3.438   8.764   1.00 37.55 ? 563 HOH A O   1 
HETATM 1662 O O   . HOH C 2 .   ? 10.474 8.874   3.807   1.00 33.75 ? 564 HOH A O   1 
HETATM 1663 O O   . HOH C 2 .   ? 11.825 20.411  1.584   1.00 20.05 ? 565 HOH A O   1 
HETATM 1664 O O   . HOH C 2 .   ? 11.460 24.584  3.392   1.00 22.73 ? 566 HOH A O   1 
HETATM 1665 O O   . HOH C 2 .   ? 33.036 15.193  -0.875  1.00 35.77 ? 567 HOH A O   1 
HETATM 1666 O O   . HOH C 2 .   ? 30.088 16.001  -0.487  1.00 28.18 ? 568 HOH A O   1 
HETATM 1667 O O   . HOH C 2 .   ? 24.560 -0.608  14.059  1.00 40.26 ? 569 HOH A O   1 
HETATM 1668 O O   . HOH C 2 .   ? 27.443 0.374   15.094  1.00 38.46 ? 570 HOH A O   1 
HETATM 1669 O O   . HOH C 2 .   ? 30.246 7.892   -2.097  1.00 26.63 ? 574 HOH A O   1 
HETATM 1670 O O   . HOH C 2 .   ? 30.024 0.375   2.899   1.00 26.79 ? 575 HOH A O   1 
HETATM 1671 O O   . HOH C 2 .   ? 19.828 -8.437  7.661   1.00 25.17 ? 576 HOH A O   1 
HETATM 1672 O O   . HOH C 2 .   ? 23.818 -9.909  5.921   1.00 23.88 ? 577 HOH A O   1 
HETATM 1673 O O   . HOH C 2 .   ? 20.995 18.296  -5.982  1.00 25.87 ? 578 HOH A O   1 
HETATM 1674 O O   . HOH C 2 .   ? 20.681 16.094  -11.767 1.00 15.55 ? 579 HOH A O   1 
HETATM 1675 O O   . HOH C 2 .   ? 19.287 11.920  -9.628  1.00 38.12 ? 580 HOH A O   1 
HETATM 1676 O O   . HOH C 2 .   ? 12.945 11.343  -7.054  1.00 30.87 ? 581 HOH A O   1 
HETATM 1677 O O   . HOH C 2 .   ? 15.251 -9.913  9.065   1.00 32.23 ? 582 HOH A O   1 
HETATM 1678 O O   . HOH C 2 .   ? 12.978 -9.088  14.212  1.00 25.72 ? 583 HOH A O   1 
HETATM 1679 O O   . HOH C 2 .   ? 15.727 -7.445  15.743  1.00 29.24 ? 584 HOH A O   1 
HETATM 1680 O O   . HOH C 2 .   ? 7.057  -1.847  19.010  1.00 31.02 ? 585 HOH A O   1 
HETATM 1681 O O   . HOH C 2 .   ? 12.370 12.689  19.505  1.00 24.73 ? 586 HOH A O   1 
HETATM 1682 O O   . HOH C 2 .   ? 8.549  3.029   19.045  1.00 33.12 ? 587 HOH A O   1 
HETATM 1683 O O   . HOH C 2 .   ? 22.925 22.023  13.885  1.00 27.40 ? 605 HOH A O   1 
HETATM 1684 O O   . HOH D 2 .   ? 28.225 31.884  34.492  1.00 15.71 ? 521 HOH B O   1 
HETATM 1685 O O   . HOH D 2 .   ? 34.574 12.404  30.443  1.00 27.32 ? 522 HOH B O   1 
HETATM 1686 O O   . HOH D 2 .   ? 20.031 26.951  24.800  1.00 23.15 ? 523 HOH B O   1 
HETATM 1687 O O   . HOH D 2 .   ? 18.769 22.720  20.132  1.00 17.81 ? 524 HOH B O   1 
HETATM 1688 O O   . HOH D 2 .   ? 18.999 26.902  21.217  1.00 52.10 ? 525 HOH B O   1 
HETATM 1689 O O   . HOH D 2 .   ? 19.979 33.473  22.513  1.00 27.39 ? 526 HOH B O   1 
HETATM 1690 O O   . HOH D 2 .   ? 20.723 32.281  25.437  1.00 26.40 ? 527 HOH B O   1 
HETATM 1691 O O   . HOH D 2 .   ? 33.862 5.552   4.141   1.00 31.32 ? 534 HOH B O   1 
HETATM 1692 O O   . HOH D 2 .   ? 35.921 20.153  22.320  1.00 30.46 ? 543 HOH B O   1 
HETATM 1693 O O   . HOH D 2 .   ? 18.170 12.936  23.601  1.00 23.29 ? 546 HOH B O   1 
HETATM 1694 O O   . HOH D 2 .   ? 34.015 28.219  21.206  1.00 31.97 ? 547 HOH B O   1 
HETATM 1695 O O   . HOH D 2 .   ? 35.619 31.207  23.517  1.00 24.69 ? 548 HOH B O   1 
HETATM 1696 O O   . HOH D 2 .   ? 19.820 32.607  33.686  1.00 31.81 ? 549 HOH B O   1 
HETATM 1697 O O   . HOH D 2 .   ? 15.823 30.144  29.023  1.00 20.21 ? 550 HOH B O   1 
HETATM 1698 O O   . HOH D 2 .   ? 28.812 5.574   15.473  1.00 17.03 ? 571 HOH B O   1 
HETATM 1699 O O   . HOH D 2 .   ? 28.983 6.013   18.411  1.00 28.71 ? 572 HOH B O   1 
HETATM 1700 O O   . HOH D 2 .   ? 30.490 4.892   20.031  1.00 21.80 ? 573 HOH B O   1 
HETATM 1701 O O   . HOH D 2 .   ? 29.469 8.457   27.509  1.00 17.13 ? 588 HOH B O   1 
HETATM 1702 O O   . HOH D 2 .   ? 26.758 9.332   29.137  1.00 31.94 ? 589 HOH B O   1 
HETATM 1703 O O   . HOH D 2 .   ? 22.277 10.790  30.486  1.00 35.19 ? 590 HOH B O   1 
HETATM 1704 O O   . HOH D 2 .   ? 22.307 11.976  27.623  1.00 29.11 ? 591 HOH B O   1 
HETATM 1705 O O   . HOH D 2 .   ? 19.142 11.750  28.740  1.00 23.49 ? 592 HOH B O   1 
HETATM 1706 O O   . HOH D 2 .   ? 16.991 15.017  24.299  1.00 22.04 ? 593 HOH B O   1 
HETATM 1707 O O   . HOH D 2 .   ? 26.302 11.812  35.478  1.00 21.06 ? 594 HOH B O   1 
HETATM 1708 O O   . HOH D 2 .   ? 18.904 26.238  42.844  1.00 22.48 ? 595 HOH B O   1 
HETATM 1709 O O   . HOH D 2 .   ? 23.225 32.916  39.307  1.00 36.77 ? 596 HOH B O   1 
HETATM 1710 O O   . HOH D 2 .   ? 20.568 31.334  40.086  1.00 26.29 ? 597 HOH B O   1 
HETATM 1711 O O   . HOH D 2 .   ? 20.489 33.887  36.259  1.00 27.76 ? 598 HOH B O   1 
HETATM 1712 O O   . HOH D 2 .   ? 17.518 24.526  18.767  1.00 27.70 ? 599 HOH B O   1 
HETATM 1713 O O   . HOH D 2 .   ? 14.841 23.279  20.308  1.00 34.34 ? 600 HOH B O   1 
HETATM 1714 O O   . HOH D 2 .   ? 14.944 23.214  27.603  1.00 33.95 ? 601 HOH B O   1 
HETATM 1715 O O   . HOH D 2 .   ? 20.321 12.750  19.028  1.00 15.37 ? 602 HOH B O   1 
HETATM 1716 O O   . HOH D 2 .   ? 22.750 25.165  18.707  1.00 29.50 ? 603 HOH B O   1 
HETATM 1717 O O   . HOH D 2 .   ? 21.138 25.926  20.706  1.00 20.88 ? 604 HOH B O   1 
HETATM 1718 O O   . HOH D 2 .   ? 25.607 34.446  10.429  1.00 41.20 ? 606 HOH B O   1 
HETATM 1719 O O   . HOH D 2 .   ? 23.908 32.726  8.444   1.00 31.35 ? 607 HOH B O   1 
HETATM 1720 O O   . HOH D 2 .   ? 28.238 33.981  30.174  1.00 26.55 ? 608 HOH B O   1 
HETATM 1721 O O   . HOH D 2 .   ? 25.980 35.301  30.446  1.00 26.63 ? 609 HOH B O   1 
HETATM 1722 O O   . HOH D 2 .   ? 32.854 30.345  21.583  1.00 34.75 ? 610 HOH B O   1 
HETATM 1723 O O   . HOH D 2 .   ? 16.815 30.975  32.480  1.00 29.04 ? 611 HOH B O   1 
HETATM 1724 O O   . HOH D 2 .   ? 19.383 30.933  23.306  1.00 4.68  ? 612 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASN 1   1   1   ASN ASN A . n 
A 1 2   PHE 2   2   2   PHE PHE A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   GLN 6   6   6   GLN GLN A . n 
A 1 7   PRO 7   7   7   PRO PRO A . n 
A 1 8   HIS 8   8   8   HIS HIS A . n 
A 1 9   SER 9   9   9   SER SER A . n 
A 1 10  VAL 10  11  11  VAL VAL A . n 
A 1 11  SER 11  12  12  SER SER A . n 
A 1 12  GLU 12  13  13  GLU GLU A . n 
A 1 13  SER 13  14  14  SER SER A . n 
A 1 14  PRO 14  15  15  PRO PRO A . n 
A 1 15  GLY 15  16  16  GLY GLY A . n 
A 1 16  LYS 16  17  17  LYS LYS A . n 
A 1 17  THR 17  18  18  THR THR A . n 
A 1 18  VAL 18  19  19  VAL VAL A . n 
A 1 19  THR 19  20  20  THR THR A . n 
A 1 20  ILE 20  21  21  ILE ILE A . n 
A 1 21  SER 21  22  22  SER SER A . n 
A 1 22  CYS 22  23  23  CYS CYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  ARG 24  25  25  ARG ARG A . n 
A 1 25  SER 25  26  26  SER SER A . n 
A 1 26  SER 26  27  27  SER SER A . n 
A 1 27  GLY 27  27  27  GLY GLY A A n 
A 1 28  SER 28  27  27  SER SER A B n 
A 1 29  ILE 29  28  28  ILE ILE A . n 
A 1 30  ALA 30  29  29  ALA ALA A . n 
A 1 31  ASN 31  30  30  ASN ASN A . n 
A 1 32  ASN 32  31  31  ASN ASN A . n 
A 1 33  TYR 33  32  32  TYR TYR A . n 
A 1 34  VAL 34  33  33  VAL VAL A . n 
A 1 35  HIS 35  34  34  HIS HIS A . n 
A 1 36  TRP 36  35  35  TRP TRP A . n 
A 1 37  TYR 37  36  36  TYR TYR A . n 
A 1 38  GLN 38  37  37  GLN GLN A . n 
A 1 39  GLN 39  38  38  GLN GLN A . n 
A 1 40  ARG 40  39  39  ARG ARG A . n 
A 1 41  PRO 41  40  40  PRO PRO A . n 
A 1 42  GLY 42  41  41  GLY GLY A . n 
A 1 43  SER 43  42  42  SER SER A . n 
A 1 44  SER 44  43  43  SER SER A . n 
A 1 45  PRO 45  44  44  PRO PRO A . n 
A 1 46  THR 46  45  45  THR THR A . n 
A 1 47  THR 47  46  46  THR THR A . n 
A 1 48  VAL 48  47  47  VAL VAL A . n 
A 1 49  ILE 49  48  48  ILE ILE A . n 
A 1 50  PHE 50  49  49  PHE PHE A . n 
A 1 51  GLU 51  50  50  GLU GLU A . n 
A 1 52  ASP 52  51  51  ASP ASP A . n 
A 1 53  ASP 53  52  52  ASP ASP A . n 
A 1 54  HIS 54  53  53  HIS HIS A . n 
A 1 55  ARG 55  54  54  ARG ARG A . n 
A 1 56  PRO 56  55  55  PRO PRO A . n 
A 1 57  SER 57  56  56  SER SER A . n 
A 1 58  GLY 58  57  57  GLY GLY A . n 
A 1 59  VAL 59  58  58  VAL VAL A . n 
A 1 60  PRO 60  59  59  PRO PRO A . n 
A 1 61  ASP 61  60  60  ASP ASP A . n 
A 1 62  ARG 62  61  61  ARG ARG A . n 
A 1 63  PHE 63  62  62  PHE PHE A . n 
A 1 64  SER 64  63  63  SER SER A . n 
A 1 65  GLY 65  64  64  GLY GLY A . n 
A 1 66  SER 66  65  65  SER SER A . n 
A 1 67  VAL 67  66  66  VAL VAL A . n 
A 1 68  ASP 68  66  66  ASP ASP A A n 
A 1 69  THR 69  66  66  THR THR A B n 
A 1 70  SER 70  67  67  SER SER A . n 
A 1 71  SER 71  68  68  SER SER A . n 
A 1 72  ASN 72  69  69  ASN ASN A . n 
A 1 73  SER 73  70  70  SER SER A . n 
A 1 74  ALA 74  71  71  ALA ALA A . n 
A 1 75  SER 75  72  72  SER SER A . n 
A 1 76  LEU 76  73  73  LEU LEU A . n 
A 1 77  THR 77  74  74  THR THR A . n 
A 1 78  ILE 78  75  75  ILE ILE A . n 
A 1 79  SER 79  76  76  SER SER A . n 
A 1 80  GLY 80  77  77  GLY GLY A . n 
A 1 81  LEU 81  78  78  LEU LEU A . n 
A 1 82  LYS 82  79  79  LYS LYS A . n 
A 1 83  THR 83  80  80  THR THR A . n 
A 1 84  GLU 84  81  81  GLU GLU A . n 
A 1 85  ASP 85  82  82  ASP ASP A . n 
A 1 86  GLU 86  83  83  GLU GLU A . n 
A 1 87  ALA 87  84  84  ALA ALA A . n 
A 1 88  ASP 88  85  85  ASP ASP A . n 
A 1 89  TYR 89  86  86  TYR TYR A . n 
A 1 90  TYR 90  87  87  TYR TYR A . n 
A 1 91  CYS 91  88  88  CYS CYS A . n 
A 1 92  GLN 92  89  89  GLN GLN A . n 
A 1 93  SER 93  90  90  SER SER A . n 
A 1 94  TYR 94  91  91  TYR TYR A . n 
A 1 95  ASP 95  92  92  ASP ASP A . n 
A 1 96  HIS 96  93  93  HIS HIS A . n 
A 1 97  ASN 97  94  94  ASN ASN A . n 
A 1 98  ASN 98  95  95  ASN ASN A . n 
A 1 99  GLN 99  96  96  GLN GLN A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 PHE 101 98  98  PHE PHE A . n 
A 1 102 GLY 102 99  99  GLY GLY A . n 
A 1 103 GLY 103 100 100 GLY GLY A . n 
A 1 104 GLY 104 101 101 GLY GLY A . n 
A 1 105 THR 105 102 102 THR THR A . n 
A 1 106 LYS 106 103 103 LYS LYS A . n 
A 1 107 LEU 107 104 104 LEU LEU A . n 
A 1 108 THR 108 105 105 THR THR A . n 
A 1 109 VAL 109 106 106 VAL VAL A . n 
A 1 110 LEU 110 107 107 LEU LEU A . n 
A 1 111 GLY 111 108 108 GLY GLY A . n 
B 1 1   ASN 1   1   1   ASN ASN B . n 
B 1 2   PHE 2   2   2   PHE PHE B . n 
B 1 3   LEU 3   3   3   LEU LEU B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   THR 5   5   5   THR THR B . n 
B 1 6   GLN 6   6   6   GLN GLN B . n 
B 1 7   PRO 7   7   7   PRO PRO B . n 
B 1 8   HIS 8   8   8   HIS HIS B . n 
B 1 9   SER 9   9   9   SER SER B . n 
B 1 10  VAL 10  11  11  VAL VAL B . n 
B 1 11  SER 11  12  12  SER SER B . n 
B 1 12  GLU 12  13  13  GLU GLU B . n 
B 1 13  SER 13  14  14  SER SER B . n 
B 1 14  PRO 14  15  15  PRO PRO B . n 
B 1 15  GLY 15  16  16  GLY GLY B . n 
B 1 16  LYS 16  17  17  LYS LYS B . n 
B 1 17  THR 17  18  18  THR THR B . n 
B 1 18  VAL 18  19  19  VAL VAL B . n 
B 1 19  THR 19  20  20  THR THR B . n 
B 1 20  ILE 20  21  21  ILE ILE B . n 
B 1 21  SER 21  22  22  SER SER B . n 
B 1 22  CYS 22  23  23  CYS CYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  ARG 24  25  25  ARG ARG B . n 
B 1 25  SER 25  26  26  SER SER B . n 
B 1 26  SER 26  27  27  SER SER B . n 
B 1 27  GLY 27  27  27  GLY GLY B A n 
B 1 28  SER 28  27  27  SER SER B B n 
B 1 29  ILE 29  28  28  ILE ILE B . n 
B 1 30  ALA 30  29  29  ALA ALA B . n 
B 1 31  ASN 31  30  30  ASN ASN B . n 
B 1 32  ASN 32  31  31  ASN ASN B . n 
B 1 33  TYR 33  32  32  TYR TYR B . n 
B 1 34  VAL 34  33  33  VAL VAL B . n 
B 1 35  HIS 35  34  34  HIS HIS B . n 
B 1 36  TRP 36  35  35  TRP TRP B . n 
B 1 37  TYR 37  36  36  TYR TYR B . n 
B 1 38  GLN 38  37  37  GLN GLN B . n 
B 1 39  GLN 39  38  38  GLN GLN B . n 
B 1 40  ARG 40  39  39  ARG ARG B . n 
B 1 41  PRO 41  40  40  PRO PRO B . n 
B 1 42  GLY 42  41  41  GLY GLY B . n 
B 1 43  SER 43  42  42  SER SER B . n 
B 1 44  SER 44  43  43  SER SER B . n 
B 1 45  PRO 45  44  44  PRO PRO B . n 
B 1 46  THR 46  45  45  THR THR B . n 
B 1 47  THR 47  46  46  THR THR B . n 
B 1 48  VAL 48  47  47  VAL VAL B . n 
B 1 49  ILE 49  48  48  ILE ILE B . n 
B 1 50  PHE 50  49  49  PHE PHE B . n 
B 1 51  GLU 51  50  50  GLU GLU B . n 
B 1 52  ASP 52  51  51  ASP ASP B . n 
B 1 53  ASP 53  52  52  ASP ASP B . n 
B 1 54  HIS 54  53  53  HIS HIS B . n 
B 1 55  ARG 55  54  54  ARG ARG B . n 
B 1 56  PRO 56  55  55  PRO PRO B . n 
B 1 57  SER 57  56  56  SER SER B . n 
B 1 58  GLY 58  57  57  GLY GLY B . n 
B 1 59  VAL 59  58  58  VAL VAL B . n 
B 1 60  PRO 60  59  59  PRO PRO B . n 
B 1 61  ASP 61  60  60  ASP ASP B . n 
B 1 62  ARG 62  61  61  ARG ARG B . n 
B 1 63  PHE 63  62  62  PHE PHE B . n 
B 1 64  SER 64  63  63  SER SER B . n 
B 1 65  GLY 65  64  64  GLY GLY B . n 
B 1 66  SER 66  65  65  SER SER B . n 
B 1 67  VAL 67  66  66  VAL VAL B . n 
B 1 68  ASP 68  66  66  ASP ASP B A n 
B 1 69  THR 69  66  66  THR THR B B n 
B 1 70  SER 70  67  67  SER SER B . n 
B 1 71  SER 71  68  68  SER SER B . n 
B 1 72  ASN 72  69  69  ASN ASN B . n 
B 1 73  SER 73  70  70  SER SER B . n 
B 1 74  ALA 74  71  71  ALA ALA B . n 
B 1 75  SER 75  72  72  SER SER B . n 
B 1 76  LEU 76  73  73  LEU LEU B . n 
B 1 77  THR 77  74  74  THR THR B . n 
B 1 78  ILE 78  75  75  ILE ILE B . n 
B 1 79  SER 79  76  76  SER SER B . n 
B 1 80  GLY 80  77  77  GLY GLY B . n 
B 1 81  LEU 81  78  78  LEU LEU B . n 
B 1 82  LYS 82  79  79  LYS LYS B . n 
B 1 83  THR 83  80  80  THR THR B . n 
B 1 84  GLU 84  81  81  GLU GLU B . n 
B 1 85  ASP 85  82  82  ASP ASP B . n 
B 1 86  GLU 86  83  83  GLU GLU B . n 
B 1 87  ALA 87  84  84  ALA ALA B . n 
B 1 88  ASP 88  85  85  ASP ASP B . n 
B 1 89  TYR 89  86  86  TYR TYR B . n 
B 1 90  TYR 90  87  87  TYR TYR B . n 
B 1 91  CYS 91  88  88  CYS CYS B . n 
B 1 92  GLN 92  89  89  GLN GLN B . n 
B 1 93  SER 93  90  90  SER SER B . n 
B 1 94  TYR 94  91  91  TYR TYR B . n 
B 1 95  ASP 95  92  92  ASP ASP B . n 
B 1 96  HIS 96  93  93  HIS HIS B . n 
B 1 97  ASN 97  94  94  ASN ASN B . n 
B 1 98  ASN 98  95  95  ASN ASN B . n 
B 1 99  GLN 99  96  96  GLN GLN B . n 
B 1 100 VAL 100 97  97  VAL VAL B . n 
B 1 101 PHE 101 98  98  PHE PHE B . n 
B 1 102 GLY 102 99  99  GLY GLY B . n 
B 1 103 GLY 103 100 100 GLY GLY B . n 
B 1 104 GLY 104 101 101 GLY GLY B . n 
B 1 105 THR 105 102 102 THR THR B . n 
B 1 106 LYS 106 103 103 LYS LYS B . n 
B 1 107 LEU 107 104 104 LEU LEU B . n 
B 1 108 THR 108 105 105 THR THR B . n 
B 1 109 VAL 109 106 106 VAL VAL B . n 
B 1 110 LEU 110 107 107 LEU LEU B . n 
B 1 111 GLY 111 108 108 GLY GLY B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-03-08 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       0.3 ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE2 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    81 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    612 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.08 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     526 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     526 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_556 
_pdbx_validate_symm_contact.dist              1.94 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 39  ? ? -58.19  170.27  
2  1 PRO A 40  ? ? -41.20  -76.68  
3  1 ASP A 51  ? ? 71.92   -53.10  
4  1 ASP A 52  ? ? -147.38 18.07   
5  1 ASP A 60  ? ? -67.41  1.67    
6  1 ALA A 84  ? ? 178.92  -179.34 
7  1 HIS A 93  ? ? -31.89  -70.84  
8  1 ASP B 51  ? ? 77.20   -22.00  
9  1 ASP B 52  ? ? -166.21 38.68   
10 1 ASN B 95  ? ? -173.95 141.15  
11 1 LEU B 107 ? ? -86.45  44.17   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 42 ? OG  ? A SER 43 OG  
2  1 Y 1 A HIS 93 ? CG  ? A HIS 96 CG  
3  1 Y 1 A HIS 93 ? ND1 ? A HIS 96 ND1 
4  1 Y 1 A HIS 93 ? CD2 ? A HIS 96 CD2 
5  1 Y 1 A HIS 93 ? CE1 ? A HIS 96 CE1 
6  1 Y 1 A HIS 93 ? NE2 ? A HIS 96 NE2 
7  1 Y 1 B LEU 3  ? CG  ? B LEU 3  CG  
8  1 Y 1 B LEU 3  ? CD1 ? B LEU 3  CD1 
9  1 Y 1 B LEU 3  ? CD2 ? B LEU 3  CD2 
10 1 Y 1 B VAL 19 ? CG1 ? B VAL 18 CG1 
11 1 Y 1 B VAL 19 ? CG2 ? B VAL 18 CG2 
12 1 Y 1 B ILE 21 ? CD1 ? B ILE 20 CD1 
13 1 Y 1 B ARG 25 ? CG  ? B ARG 24 CG  
14 1 Y 1 B ARG 25 ? CD  ? B ARG 24 CD  
15 1 Y 1 B ARG 25 ? NE  ? B ARG 24 NE  
16 1 Y 1 B ARG 25 ? CZ  ? B ARG 24 CZ  
17 1 Y 1 B ARG 25 ? NH1 ? B ARG 24 NH1 
18 1 Y 1 B ARG 25 ? NH2 ? B ARG 24 NH2 
19 1 Y 1 B SER 27 ? OG  ? B SER 26 OG  
20 1 Y 1 B SER 27 B OG  ? B SER 28 OG  
21 1 Y 1 B ILE 28 ? CG1 ? B ILE 29 CG1 
22 1 Y 1 B ILE 28 ? CG2 ? B ILE 29 CG2 
23 1 Y 1 B ILE 28 ? CD1 ? B ILE 29 CD1 
24 1 Y 1 B ASN 30 ? CG  ? B ASN 31 CG  
25 1 Y 1 B ASN 30 ? OD1 ? B ASN 31 OD1 
26 1 Y 1 B ASN 30 ? ND2 ? B ASN 31 ND2 
27 1 Y 1 B ASN 31 ? CG  ? B ASN 32 CG  
28 1 Y 1 B ASN 31 ? OD1 ? B ASN 32 OD1 
29 1 Y 1 B ASN 31 ? ND2 ? B ASN 32 ND2 
30 1 Y 1 B TYR 32 ? CG  ? B TYR 33 CG  
31 1 Y 1 B TYR 32 ? CD1 ? B TYR 33 CD1 
32 1 Y 1 B TYR 32 ? CD2 ? B TYR 33 CD2 
33 1 Y 1 B TYR 32 ? CE1 ? B TYR 33 CE1 
34 1 Y 1 B TYR 32 ? CE2 ? B TYR 33 CE2 
35 1 Y 1 B TYR 32 ? CZ  ? B TYR 33 CZ  
36 1 Y 1 B TYR 32 ? OH  ? B TYR 33 OH  
37 1 Y 1 B ILE 48 ? CG1 ? B ILE 49 CG1 
38 1 Y 1 B ILE 48 ? CG2 ? B ILE 49 CG2 
39 1 Y 1 B ILE 48 ? CD1 ? B ILE 49 CD1 
40 1 Y 1 B PHE 49 ? CG  ? B PHE 50 CG  
41 1 Y 1 B PHE 49 ? CD1 ? B PHE 50 CD1 
42 1 Y 1 B PHE 49 ? CD2 ? B PHE 50 CD2 
43 1 Y 1 B PHE 49 ? CE1 ? B PHE 50 CE1 
44 1 Y 1 B PHE 49 ? CE2 ? B PHE 50 CE2 
45 1 Y 1 B PHE 49 ? CZ  ? B PHE 50 CZ  
46 1 Y 1 B GLU 50 ? CG  ? B GLU 51 CG  
47 1 Y 1 B GLU 50 ? CD  ? B GLU 51 CD  
48 1 Y 1 B GLU 50 ? OE1 ? B GLU 51 OE1 
49 1 Y 1 B GLU 50 ? OE2 ? B GLU 51 OE2 
50 1 Y 1 B ASP 51 ? CG  ? B ASP 52 CG  
51 1 Y 1 B ASP 51 ? OD1 ? B ASP 52 OD1 
52 1 Y 1 B ASP 51 ? OD2 ? B ASP 52 OD2 
53 1 Y 1 B ASP 52 ? CG  ? B ASP 53 CG  
54 1 Y 1 B ASP 52 ? OD1 ? B ASP 53 OD1 
55 1 Y 1 B ASP 52 ? OD2 ? B ASP 53 OD2 
56 1 Y 1 B HIS 53 ? CG  ? B HIS 54 CG  
57 1 Y 1 B HIS 53 ? ND1 ? B HIS 54 ND1 
58 1 Y 1 B HIS 53 ? CD2 ? B HIS 54 CD2 
59 1 Y 1 B HIS 53 ? CE1 ? B HIS 54 CE1 
60 1 Y 1 B HIS 53 ? NE2 ? B HIS 54 NE2 
61 1 Y 1 B ARG 54 ? CG  ? B ARG 55 CG  
62 1 Y 1 B ARG 54 ? CD  ? B ARG 55 CD  
63 1 Y 1 B ARG 54 ? NE  ? B ARG 55 NE  
64 1 Y 1 B ARG 54 ? CZ  ? B ARG 55 CZ  
65 1 Y 1 B ARG 54 ? NH1 ? B ARG 55 NH1 
66 1 Y 1 B ARG 54 ? NH2 ? B ARG 55 NH2 
67 1 Y 1 B ASP 66 A CG  ? B ASP 68 CG  
68 1 Y 1 B ASP 66 A OD1 ? B ASP 68 OD1 
69 1 Y 1 B ASP 66 A OD2 ? B ASP 68 OD2 
70 1 Y 1 B THR 66 B OG1 ? B THR 69 OG1 
71 1 Y 1 B THR 66 B CG2 ? B THR 69 CG2 
72 1 Y 1 B SER 67 ? OG  ? B SER 70 OG  
73 1 Y 1 B SER 68 ? OG  ? B SER 71 OG  
74 1 Y 1 B ASN 69 ? CG  ? B ASN 72 CG  
75 1 Y 1 B ASN 69 ? OD1 ? B ASN 72 OD1 
76 1 Y 1 B ASN 69 ? ND2 ? B ASN 72 ND2 
77 1 Y 1 B SER 70 ? OG  ? B SER 73 OG  
78 1 Y 1 B TYR 91 ? OH  ? B TYR 94 OH  
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  501 501 HOH HOH A . 
C 2 HOH 2  502 502 HOH HOH A . 
C 2 HOH 3  503 503 HOH HOH A . 
C 2 HOH 4  504 504 HOH HOH A . 
C 2 HOH 5  505 505 HOH HOH A . 
C 2 HOH 6  506 506 HOH HOH A . 
C 2 HOH 7  507 507 HOH HOH A . 
C 2 HOH 8  508 508 HOH HOH A . 
C 2 HOH 9  509 509 HOH HOH A . 
C 2 HOH 10 510 510 HOH HOH A . 
C 2 HOH 11 511 511 HOH HOH A . 
C 2 HOH 12 512 512 HOH HOH A . 
C 2 HOH 13 513 513 HOH HOH A . 
C 2 HOH 14 514 514 HOH HOH A . 
C 2 HOH 15 515 515 HOH HOH A . 
C 2 HOH 16 516 516 HOH HOH A . 
C 2 HOH 17 517 517 HOH HOH A . 
C 2 HOH 18 518 518 HOH HOH A . 
C 2 HOH 19 519 519 HOH HOH A . 
C 2 HOH 20 520 520 HOH HOH A . 
C 2 HOH 21 528 528 HOH HOH A . 
C 2 HOH 22 529 529 HOH HOH A . 
C 2 HOH 23 530 530 HOH HOH A . 
C 2 HOH 24 531 531 HOH HOH A . 
C 2 HOH 25 532 532 HOH HOH A . 
C 2 HOH 26 533 533 HOH HOH A . 
C 2 HOH 27 535 535 HOH HOH A . 
C 2 HOH 28 536 536 HOH HOH A . 
C 2 HOH 29 537 537 HOH HOH A . 
C 2 HOH 30 538 538 HOH HOH A . 
C 2 HOH 31 539 539 HOH HOH A . 
C 2 HOH 32 540 540 HOH HOH A . 
C 2 HOH 33 541 541 HOH HOH A . 
C 2 HOH 34 542 542 HOH HOH A . 
C 2 HOH 35 544 544 HOH HOH A . 
C 2 HOH 36 545 545 HOH HOH A . 
C 2 HOH 37 551 551 HOH HOH A . 
C 2 HOH 38 552 552 HOH HOH A . 
C 2 HOH 39 553 553 HOH HOH A . 
C 2 HOH 40 554 554 HOH HOH A . 
C 2 HOH 41 555 555 HOH HOH A . 
C 2 HOH 42 556 556 HOH HOH A . 
C 2 HOH 43 557 557 HOH HOH A . 
C 2 HOH 44 558 558 HOH HOH A . 
C 2 HOH 45 559 559 HOH HOH A . 
C 2 HOH 46 560 560 HOH HOH A . 
C 2 HOH 47 561 561 HOH HOH A . 
C 2 HOH 48 562 562 HOH HOH A . 
C 2 HOH 49 563 563 HOH HOH A . 
C 2 HOH 50 564 564 HOH HOH A . 
C 2 HOH 51 565 565 HOH HOH A . 
C 2 HOH 52 566 566 HOH HOH A . 
C 2 HOH 53 567 567 HOH HOH A . 
C 2 HOH 54 568 568 HOH HOH A . 
C 2 HOH 55 569 569 HOH HOH A . 
C 2 HOH 56 570 570 HOH HOH A . 
C 2 HOH 57 574 574 HOH HOH A . 
C 2 HOH 58 575 575 HOH HOH A . 
C 2 HOH 59 576 576 HOH HOH A . 
C 2 HOH 60 577 577 HOH HOH A . 
C 2 HOH 61 578 578 HOH HOH A . 
C 2 HOH 62 579 579 HOH HOH A . 
C 2 HOH 63 580 580 HOH HOH A . 
C 2 HOH 64 581 581 HOH HOH A . 
C 2 HOH 65 582 582 HOH HOH A . 
C 2 HOH 66 583 583 HOH HOH A . 
C 2 HOH 67 584 584 HOH HOH A . 
C 2 HOH 68 585 585 HOH HOH A . 
C 2 HOH 69 586 586 HOH HOH A . 
C 2 HOH 70 587 587 HOH HOH A . 
C 2 HOH 71 605 605 HOH HOH A . 
D 2 HOH 1  521 521 HOH HOH B . 
D 2 HOH 2  522 522 HOH HOH B . 
D 2 HOH 3  523 523 HOH HOH B . 
D 2 HOH 4  524 524 HOH HOH B . 
D 2 HOH 5  525 525 HOH HOH B . 
D 2 HOH 6  526 526 HOH HOH B . 
D 2 HOH 7  527 527 HOH HOH B . 
D 2 HOH 8  534 534 HOH HOH B . 
D 2 HOH 9  543 543 HOH HOH B . 
D 2 HOH 10 546 546 HOH HOH B . 
D 2 HOH 11 547 547 HOH HOH B . 
D 2 HOH 12 548 548 HOH HOH B . 
D 2 HOH 13 549 549 HOH HOH B . 
D 2 HOH 14 550 550 HOH HOH B . 
D 2 HOH 15 571 571 HOH HOH B . 
D 2 HOH 16 572 572 HOH HOH B . 
D 2 HOH 17 573 573 HOH HOH B . 
D 2 HOH 18 588 588 HOH HOH B . 
D 2 HOH 19 589 589 HOH HOH B . 
D 2 HOH 20 590 590 HOH HOH B . 
D 2 HOH 21 591 591 HOH HOH B . 
D 2 HOH 22 592 592 HOH HOH B . 
D 2 HOH 23 593 593 HOH HOH B . 
D 2 HOH 24 594 594 HOH HOH B . 
D 2 HOH 25 595 595 HOH HOH B . 
D 2 HOH 26 596 596 HOH HOH B . 
D 2 HOH 27 597 597 HOH HOH B . 
D 2 HOH 28 598 598 HOH HOH B . 
D 2 HOH 29 599 599 HOH HOH B . 
D 2 HOH 30 600 600 HOH HOH B . 
D 2 HOH 31 601 601 HOH HOH B . 
D 2 HOH 32 602 602 HOH HOH B . 
D 2 HOH 33 603 603 HOH HOH B . 
D 2 HOH 34 604 604 HOH HOH B . 
D 2 HOH 35 606 606 HOH HOH B . 
D 2 HOH 36 607 607 HOH HOH B . 
D 2 HOH 37 608 608 HOH HOH B . 
D 2 HOH 38 609 609 HOH HOH B . 
D 2 HOH 39 610 610 HOH HOH B . 
D 2 HOH 40 611 611 HOH HOH B . 
D 2 HOH 41 612 612 HOH HOH B . 
#