data_2CDZ
# 
_entry.id   2CDZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CDZ         
PDBE  EBI-27512    
WWPDB D_1290027512 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2BVA 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CRYSTAL STRUCTURE OF THE HUMAN P21-ACTIVATED KINASE 4' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CDZ 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-01-31 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Debreczeni, J.E.'    1  
'Ugochukwu, E.'       2  
'Eswaran, J.'         3  
'Filippakopoulos, P.' 4  
'Das, S.'             5  
'Fedorov, O.'         6  
'Sundstrom, M.'       7  
'Arrowsmith, C.'      8  
'Weigelt, J.'         9  
'Edwards, A.'         10 
'von Delft, F.'       11 
'Knapp, S.'           12 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structures of the P21-Activated Kinases Pak4, Pak5, and Pak6 Reveal Catalytic Domain Plasticity of Active Group II Paks.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            15 
_citation.page_first                201 
_citation.page_last                 ? 
_citation.year                      2007 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17292838 
_citation.pdbx_database_id_DOI      10.1016/J.STR.2007.01.001 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Eswaran, J.'         1 
primary 'Lee, W.H.'           2 
primary 'Debreczeni, J.E.'    3 
primary 'Filippakopoulos, P.' 4 
primary 'Turnbull, A.'        5 
primary 'Fedorov, O.'         6 
primary 'Deacon, S.W.'        7 
primary 'Peterson, J.R.'      8 
primary 'Knapp, S.'           9 
# 
_cell.entry_id           2CDZ 
_cell.length_a           145.817 
_cell.length_b           145.817 
_cell.length_c           42.382 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2CDZ 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SERINE/THREONINE-PROTEIN KINASE PAK 4'                                            34235.691 1   2.7.1.37 ? 
'KINASE DOMAIN, RESIDUES 291-591' ? 
2 non-polymer syn 'N2-[(1R,2S)-2-AMINOCYCLOHEXYL]-N6-(3-CHLOROPHENYL)-9-ETHYL-9H-PURINE-2,6-DIAMINE' 385.894   1   ?        ? ? ? 
3 non-polymer syn 'SULFATE ION'                                                                      96.063    2   ?        ? ? ? 
4 non-polymer syn 'CHLORIDE ION'                                                                     35.453    1   ?        ? ? ? 
5 water       nat water                                                                              18.015    117 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HUMAN P21-ACTIVATED KINASE 4' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GSSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVV
IMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILL
THDGRVKLSDFGFCAQVSKEVPRRK(SEP)LVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAM
KMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVV
IMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILL
THDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIR
DNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   SER n 
1 4   PRO n 
1 5   GLN n 
1 6   ARG n 
1 7   GLU n 
1 8   PRO n 
1 9   GLN n 
1 10  ARG n 
1 11  VAL n 
1 12  SER n 
1 13  HIS n 
1 14  GLU n 
1 15  GLN n 
1 16  PHE n 
1 17  ARG n 
1 18  ALA n 
1 19  ALA n 
1 20  LEU n 
1 21  GLN n 
1 22  LEU n 
1 23  VAL n 
1 24  VAL n 
1 25  ASP n 
1 26  PRO n 
1 27  GLY n 
1 28  ASP n 
1 29  PRO n 
1 30  ARG n 
1 31  SER n 
1 32  TYR n 
1 33  LEU n 
1 34  ASP n 
1 35  ASN n 
1 36  PHE n 
1 37  ILE n 
1 38  LYS n 
1 39  ILE n 
1 40  GLY n 
1 41  GLU n 
1 42  GLY n 
1 43  SER n 
1 44  THR n 
1 45  GLY n 
1 46  ILE n 
1 47  VAL n 
1 48  CYS n 
1 49  ILE n 
1 50  ALA n 
1 51  THR n 
1 52  VAL n 
1 53  ARG n 
1 54  SER n 
1 55  SER n 
1 56  GLY n 
1 57  LYS n 
1 58  LEU n 
1 59  VAL n 
1 60  ALA n 
1 61  VAL n 
1 62  LYS n 
1 63  LYS n 
1 64  MET n 
1 65  ASP n 
1 66  LEU n 
1 67  ARG n 
1 68  LYS n 
1 69  GLN n 
1 70  GLN n 
1 71  ARG n 
1 72  ARG n 
1 73  GLU n 
1 74  LEU n 
1 75  LEU n 
1 76  PHE n 
1 77  ASN n 
1 78  GLU n 
1 79  VAL n 
1 80  VAL n 
1 81  ILE n 
1 82  MET n 
1 83  ARG n 
1 84  ASP n 
1 85  TYR n 
1 86  GLN n 
1 87  HIS n 
1 88  GLU n 
1 89  ASN n 
1 90  VAL n 
1 91  VAL n 
1 92  GLU n 
1 93  MET n 
1 94  TYR n 
1 95  ASN n 
1 96  SER n 
1 97  TYR n 
1 98  LEU n 
1 99  VAL n 
1 100 GLY n 
1 101 ASP n 
1 102 GLU n 
1 103 LEU n 
1 104 TRP n 
1 105 VAL n 
1 106 VAL n 
1 107 MET n 
1 108 GLU n 
1 109 PHE n 
1 110 LEU n 
1 111 GLU n 
1 112 GLY n 
1 113 GLY n 
1 114 ALA n 
1 115 LEU n 
1 116 THR n 
1 117 ASP n 
1 118 ILE n 
1 119 VAL n 
1 120 THR n 
1 121 HIS n 
1 122 THR n 
1 123 ARG n 
1 124 MET n 
1 125 ASN n 
1 126 GLU n 
1 127 GLU n 
1 128 GLN n 
1 129 ILE n 
1 130 ALA n 
1 131 ALA n 
1 132 VAL n 
1 133 CYS n 
1 134 LEU n 
1 135 ALA n 
1 136 VAL n 
1 137 LEU n 
1 138 GLN n 
1 139 ALA n 
1 140 LEU n 
1 141 SER n 
1 142 VAL n 
1 143 LEU n 
1 144 HIS n 
1 145 ALA n 
1 146 GLN n 
1 147 GLY n 
1 148 VAL n 
1 149 ILE n 
1 150 HIS n 
1 151 ARG n 
1 152 ASP n 
1 153 ILE n 
1 154 LYS n 
1 155 SER n 
1 156 ASP n 
1 157 SER n 
1 158 ILE n 
1 159 LEU n 
1 160 LEU n 
1 161 THR n 
1 162 HIS n 
1 163 ASP n 
1 164 GLY n 
1 165 ARG n 
1 166 VAL n 
1 167 LYS n 
1 168 LEU n 
1 169 SER n 
1 170 ASP n 
1 171 PHE n 
1 172 GLY n 
1 173 PHE n 
1 174 CYS n 
1 175 ALA n 
1 176 GLN n 
1 177 VAL n 
1 178 SER n 
1 179 LYS n 
1 180 GLU n 
1 181 VAL n 
1 182 PRO n 
1 183 ARG n 
1 184 ARG n 
1 185 LYS n 
1 186 SEP n 
1 187 LEU n 
1 188 VAL n 
1 189 GLY n 
1 190 THR n 
1 191 PRO n 
1 192 TYR n 
1 193 TRP n 
1 194 MET n 
1 195 ALA n 
1 196 PRO n 
1 197 GLU n 
1 198 LEU n 
1 199 ILE n 
1 200 SER n 
1 201 ARG n 
1 202 LEU n 
1 203 PRO n 
1 204 TYR n 
1 205 GLY n 
1 206 PRO n 
1 207 GLU n 
1 208 VAL n 
1 209 ASP n 
1 210 ILE n 
1 211 TRP n 
1 212 SER n 
1 213 LEU n 
1 214 GLY n 
1 215 ILE n 
1 216 MET n 
1 217 VAL n 
1 218 ILE n 
1 219 GLU n 
1 220 MET n 
1 221 VAL n 
1 222 ASP n 
1 223 GLY n 
1 224 GLU n 
1 225 PRO n 
1 226 PRO n 
1 227 TYR n 
1 228 PHE n 
1 229 ASN n 
1 230 GLU n 
1 231 PRO n 
1 232 PRO n 
1 233 LEU n 
1 234 LYS n 
1 235 ALA n 
1 236 MET n 
1 237 LYS n 
1 238 MET n 
1 239 ILE n 
1 240 ARG n 
1 241 ASP n 
1 242 ASN n 
1 243 LEU n 
1 244 PRO n 
1 245 PRO n 
1 246 ARG n 
1 247 LEU n 
1 248 LYS n 
1 249 ASN n 
1 250 LEU n 
1 251 HIS n 
1 252 LYS n 
1 253 VAL n 
1 254 SER n 
1 255 PRO n 
1 256 SER n 
1 257 LEU n 
1 258 LYS n 
1 259 GLY n 
1 260 PHE n 
1 261 LEU n 
1 262 ASP n 
1 263 ARG n 
1 264 LEU n 
1 265 LEU n 
1 266 VAL n 
1 267 ARG n 
1 268 ASP n 
1 269 PRO n 
1 270 ALA n 
1 271 GLN n 
1 272 ARG n 
1 273 ALA n 
1 274 THR n 
1 275 ALA n 
1 276 ALA n 
1 277 GLU n 
1 278 LEU n 
1 279 LEU n 
1 280 LYS n 
1 281 HIS n 
1 282 PRO n 
1 283 PHE n 
1 284 LEU n 
1 285 ALA n 
1 286 LYS n 
1 287 ALA n 
1 288 GLY n 
1 289 PRO n 
1 290 PRO n 
1 291 ALA n 
1 292 SER n 
1 293 ILE n 
1 294 VAL n 
1 295 PRO n 
1 296 LEU n 
1 297 MET n 
1 298 ARG n 
1 299 GLN n 
1 300 ASN n 
1 301 ARG n 
1 302 THR n 
1 303 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PGEX-6P2 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX6B-C001 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2CDZ       1 ? ? 2CDZ   ? 
2 UNP PAK4_HUMAN 1 ? ? O96013 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2CDZ A 1 ? 2   ? 2CDZ   289 ? 290 ? 289 290 
2 2 2CDZ A 3 ? 303 ? O96013 291 ? 591 ? 291 591 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
23D non-polymer         . 'N2-[(1R,2S)-2-AMINOCYCLOHEXYL]-N6-(3-CHLOROPHENYL)-9-ETHYL-9H-PURINE-2,6-DIAMINE' ?               
'C19 H24 Cl N7'  385.894 
ALA 'L-peptide linking' y ALANINE                                                                            ?               
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                           ?               
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                         ?               
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                    ?               
'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                                     ?               
'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                                                                           ?               
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                          ?               
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                    ?               
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                            ?               
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                          ?               
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                              ?               
'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                         ?               
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                            ?               
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                             ?               
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                         ?               
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                      ?               
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                            ?               
'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE                                                                      PHOSPHONOSERINE 
'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE                                                                             ?               
'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                      ?               
'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE                                                                          ?               
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                         ?               
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                           ?               
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                             ?               
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2CDZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.5 
_exptl_crystal.density_percent_sol   64.8 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU IMAGE PLATE' 
_diffrn_detector.pdbx_collection_date   2005-11-17 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.542 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.542 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2CDZ 
_reflns.observed_criterion_sigma_I   3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   23590 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.90 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.76 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.30 
_reflns_shell.percent_possible_all   92.2 
_reflns_shell.Rmerge_I_obs           0.41 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.00 
_reflns_shell.pdbx_redundancy        5.67 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2CDZ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.ls_number_reflns_obs                     19821 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             103.14 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.202 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.200 
_refine.ls_R_factor_R_free                       0.248 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1060 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.949 
_refine.correlation_coeff_Fo_to_Fc_free          0.925 
_refine.B_iso_mean                               30.41 
_refine.aniso_B[1][1]                            -1.56000 
_refine.aniso_B[2][2]                            -1.56000 
_refine.aniso_B[3][3]                            3.12000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2BVA' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.229 
_refine.pdbx_overall_ESU_R_Free                  0.203 
_refine.overall_SU_ML                            0.141 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             11.088 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2246 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         38 
_refine_hist.number_atoms_solvent             117 
_refine_hist.number_atoms_total               2401 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        103.14 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 2356 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 1604 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.430  2.000  ? 3210 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.941  3.001  ? 3894 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.499  5.000  ? 296  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.360 23.367 ? 98   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.226 15.037 ? 401  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.733 15.000 ? 20   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.070  0.200  ? 368  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 2580 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 453  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.192  0.200  ? 484  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.197  0.200  ? 1696 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.170  0.200  ? 1135 'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.089  0.200  ? 1229 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.165  0.200  ? 94   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.191  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.284  0.200  ? 21   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.229  0.200  ? 3    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.713  3.000  ? 1601 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.558  5.000  ? 2370 'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.483  7.000  ? 973  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 6.170  11.000 ? 836  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.30 
_refine_ls_shell.d_res_low                        2.36 
_refine_ls_shell.number_reflns_R_work             1413 
_refine_ls_shell.R_factor_R_work                  0.2340 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3820 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2CDZ 
_struct.title                     'CRYSTAL STRUCTURE OF THE HUMAN P21-ACTIVATED KINASE 4 IN COMPLEX WITH CGP74514A' 
_struct.pdbx_descriptor           'SERINE/THREONINE-PROTEIN KINASE PAK 4 (E.C.2.7.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CDZ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, PROTEIN KINASE, STE20, PAK4, ATP-BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 12  ? VAL A 24  ? SER A 300 VAL A 312 1 ? 13 
HELX_P HELX_P2  2  ARG A 72  ? TYR A 85  ? ARG A 360 TYR A 373 1 ? 14 
HELX_P HELX_P3  3  ALA A 114 ? THR A 122 ? ALA A 402 THR A 410 1 ? 9  
HELX_P HELX_P4  4  ASN A 125 ? GLN A 146 ? ASN A 413 GLN A 434 1 ? 22 
HELX_P HELX_P5  5  LYS A 154 ? ASP A 156 ? LYS A 442 ASP A 444 5 ? 3  
HELX_P HELX_P6  6  THR A 190 ? MET A 194 ? THR A 478 MET A 482 5 ? 5  
HELX_P HELX_P7  7  ALA A 195 ? SER A 200 ? ALA A 483 SER A 488 1 ? 6  
HELX_P HELX_P8  8  PRO A 206 ? GLY A 223 ? PRO A 494 GLY A 511 1 ? 18 
HELX_P HELX_P9  9  PRO A 231 ? ASN A 242 ? PRO A 519 ASN A 530 1 ? 12 
HELX_P HELX_P10 10 SER A 254 ? LEU A 265 ? SER A 542 LEU A 553 1 ? 12 
HELX_P HELX_P11 11 THR A 274 ? LEU A 279 ? THR A 562 LEU A 567 1 ? 6  
HELX_P HELX_P12 12 LYS A 280 ? ALA A 287 ? LYS A 568 ALA A 575 5 ? 8  
HELX_P HELX_P13 13 PRO A 289 ? ILE A 293 ? PRO A 577 ILE A 581 5 ? 5  
HELX_P HELX_P14 14 ILE A 293 ? MET A 297 ? ILE A 581 MET A 585 5 ? 5  
HELX_P HELX_P15 15 MET A 297 ? ARG A 301 ? MET A 585 ARG A 589 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LYS 185 C ? ? ? 1_555 A SEP 186 N ? ? A LYS 473 A SEP 474 1_555 ? ? ? ? ? ? ? 1.338 ? 
covale2 covale ? ? A SEP 186 C ? ? ? 1_555 A LEU 187 N ? ? A SEP 474 A LEU 475 1_555 ? ? ? ? ? ? ? 1.333 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 2 ? 
AC ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 33  ? GLU A 41  ? LEU A 321 GLU A 329 
AA 2 ILE A 46  ? VAL A 52  ? ILE A 334 VAL A 340 
AA 3 LEU A 58  ? ASP A 65  ? LEU A 346 ASP A 353 
AA 4 GLU A 102 ? GLU A 108 ? GLU A 390 GLU A 396 
AA 5 MET A 93  ? VAL A 99  ? MET A 381 VAL A 387 
AB 1 VAL A 148 ? ILE A 149 ? VAL A 436 ILE A 437 
AB 2 ALA A 175 ? GLN A 176 ? ALA A 463 GLN A 464 
AC 1 ILE A 158 ? LEU A 160 ? ILE A 446 LEU A 448 
AC 2 VAL A 166 ? LEU A 168 ? VAL A 454 LEU A 456 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 39  ? N ILE A 327 O VAL A 47  ? O VAL A 335 
AA 2 3 N ALA A 50  ? N ALA A 338 O VAL A 59  ? O VAL A 347 
AA 3 4 N MET A 64  ? N MET A 352 O LEU A 103 ? O LEU A 391 
AA 4 5 O VAL A 106 ? O VAL A 394 N TYR A 94  ? N TYR A 382 
AB 1 2 N ILE A 149 ? N ILE A 437 O ALA A 175 ? O ALA A 463 
AC 1 2 N LEU A 159 ? N LEU A 447 O LYS A 167 ? O LYS A 455 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE 23D A1591' 
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 A1592' 
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE SO4 A1593' 
AC4 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A1594'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ILE A 39  ? ILE A 327  . ? 1_555 ? 
2  AC1 13 GLU A 41  ? GLU A 329  . ? 1_555 ? 
3  AC1 13 VAL A 47  ? VAL A 335  . ? 1_555 ? 
4  AC1 13 ALA A 60  ? ALA A 348  . ? 1_555 ? 
5  AC1 13 VAL A 91  ? VAL A 379  . ? 1_555 ? 
6  AC1 13 GLU A 108 ? GLU A 396  . ? 1_555 ? 
7  AC1 13 PHE A 109 ? PHE A 397  . ? 1_555 ? 
8  AC1 13 LEU A 110 ? LEU A 398  . ? 1_555 ? 
9  AC1 13 GLU A 111 ? GLU A 399  . ? 1_555 ? 
10 AC1 13 GLY A 113 ? GLY A 401  . ? 1_555 ? 
11 AC1 13 LEU A 159 ? LEU A 447  . ? 1_555 ? 
12 AC1 13 SER A 169 ? SER A 457  . ? 1_555 ? 
13 AC1 13 HOH F .   ? HOH A 2054 . ? 1_555 ? 
14 AC2 4  ARG A 71  ? ARG A 359  . ? 1_555 ? 
15 AC2 4  SEP A 186 ? SEP A 474  . ? 1_555 ? 
16 AC2 4  LEU A 187 ? LEU A 475  . ? 1_555 ? 
17 AC2 4  ARG A 201 ? ARG A 489  . ? 1_555 ? 
18 AC3 2  LYS A 237 ? LYS A 525  . ? 1_555 ? 
19 AC3 2  ARG A 240 ? ARG A 528  . ? 1_555 ? 
20 AC4 1  ARG A 263 ? ARG A 551  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2CDZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CDZ 
_atom_sites.fract_transf_matrix[1][1]   0.006858 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006858 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023595 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 11  ? 64.811 15.349 39.100 1.00 46.62 ? 299  VAL A N   1 
ATOM   2    C  CA  . VAL A 1 11  ? 65.492 16.616 38.684 1.00 45.74 ? 299  VAL A CA  1 
ATOM   3    C  C   . VAL A 1 11  ? 64.876 17.813 39.412 1.00 45.07 ? 299  VAL A C   1 
ATOM   4    O  O   . VAL A 1 11  ? 63.660 17.976 39.422 1.00 43.75 ? 299  VAL A O   1 
ATOM   5    C  CB  . VAL A 1 11  ? 65.371 16.862 37.165 1.00 46.98 ? 299  VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 11  ? 66.551 17.685 36.662 1.00 44.95 ? 299  VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 11  ? 65.263 15.543 36.408 1.00 49.20 ? 299  VAL A CG2 1 
ATOM   8    N  N   . SER A 1 12  ? 65.722 18.650 40.002 1.00 43.95 ? 300  SER A N   1 
ATOM   9    C  CA  . SER A 1 12  ? 65.277 19.791 40.797 1.00 43.86 ? 300  SER A CA  1 
ATOM   10   C  C   . SER A 1 12  ? 64.584 20.855 39.953 1.00 42.05 ? 300  SER A C   1 
ATOM   11   O  O   . SER A 1 12  ? 64.843 20.955 38.752 1.00 41.20 ? 300  SER A O   1 
ATOM   12   C  CB  . SER A 1 12  ? 66.489 20.424 41.489 1.00 44.73 ? 300  SER A CB  1 
ATOM   13   O  OG  . SER A 1 12  ? 66.103 21.487 42.345 1.00 51.76 ? 300  SER A OG  1 
ATOM   14   N  N   . HIS A 1 13  ? 63.724 21.654 40.592 1.00 41.27 ? 301  HIS A N   1 
ATOM   15   C  CA  . HIS A 1 13  ? 63.100 22.820 39.948 1.00 41.92 ? 301  HIS A CA  1 
ATOM   16   C  C   . HIS A 1 13  ? 64.160 23.859 39.569 1.00 41.93 ? 301  HIS A C   1 
ATOM   17   O  O   . HIS A 1 13  ? 64.129 24.421 38.475 1.00 43.26 ? 301  HIS A O   1 
ATOM   18   C  CB  . HIS A 1 13  ? 62.034 23.487 40.846 1.00 42.23 ? 301  HIS A CB  1 
ATOM   19   C  CG  . HIS A 1 13  ? 61.666 24.880 40.409 1.00 46.98 ? 301  HIS A CG  1 
ATOM   20   N  ND1 . HIS A 1 13  ? 62.278 26.005 40.924 1.00 53.26 ? 301  HIS A ND1 1 
ATOM   21   C  CD2 . HIS A 1 13  ? 60.788 25.328 39.473 1.00 47.94 ? 301  HIS A CD2 1 
ATOM   22   C  CE1 . HIS A 1 13  ? 61.777 27.085 40.345 1.00 46.60 ? 301  HIS A CE1 1 
ATOM   23   N  NE2 . HIS A 1 13  ? 60.868 26.704 39.465 1.00 44.14 ? 301  HIS A NE2 1 
ATOM   24   N  N   . GLU A 1 14  ? 65.089 24.109 40.482 1.00 41.09 ? 302  GLU A N   1 
ATOM   25   C  CA  . GLU A 1 14  ? 66.167 25.059 40.248 1.00 42.09 ? 302  GLU A CA  1 
ATOM   26   C  C   . GLU A 1 14  ? 67.048 24.615 39.055 1.00 40.62 ? 302  GLU A C   1 
ATOM   27   O  O   . GLU A 1 14  ? 67.429 25.437 38.221 1.00 38.62 ? 302  GLU A O   1 
ATOM   28   C  CB  . GLU A 1 14  ? 66.982 25.237 41.540 1.00 44.06 ? 302  GLU A CB  1 
ATOM   29   C  CG  . GLU A 1 14  ? 66.208 25.951 42.712 1.00 49.01 ? 302  GLU A CG  1 
ATOM   30   C  CD  . GLU A 1 14  ? 65.195 25.056 43.495 1.00 56.97 ? 302  GLU A CD  1 
ATOM   31   O  OE1 . GLU A 1 14  ? 65.366 23.809 43.568 1.00 52.54 ? 302  GLU A OE1 1 
ATOM   32   O  OE2 . GLU A 1 14  ? 64.219 25.623 44.058 1.00 60.63 ? 302  GLU A OE2 1 
ATOM   33   N  N   . GLN A 1 15  ? 67.313 23.312 38.965 1.00 40.04 ? 303  GLN A N   1 
ATOM   34   C  CA  . GLN A 1 15  ? 68.025 22.704 37.832 1.00 41.00 ? 303  GLN A CA  1 
ATOM   35   C  C   . GLN A 1 15  ? 67.234 22.676 36.516 1.00 39.76 ? 303  GLN A C   1 
ATOM   36   O  O   . GLN A 1 15  ? 67.809 22.870 35.434 1.00 39.56 ? 303  GLN A O   1 
ATOM   37   C  CB  . GLN A 1 15  ? 68.472 21.276 38.193 1.00 41.22 ? 303  GLN A CB  1 
ATOM   38   C  CG  . GLN A 1 15  ? 69.204 20.506 37.068 1.00 42.97 ? 303  GLN A CG  1 
ATOM   39   C  CD  . GLN A 1 15  ? 70.392 19.664 37.571 1.00 46.85 ? 303  GLN A CD  1 
ATOM   40   O  OE1 . GLN A 1 15  ? 70.491 19.346 38.765 1.00 60.64 ? 303  GLN A OE1 1 
ATOM   41   N  NE2 . GLN A 1 15  ? 71.300 19.307 36.659 1.00 49.87 ? 303  GLN A NE2 1 
ATOM   42   N  N   . PHE A 1 16  ? 65.930 22.416 36.599 1.00 38.41 ? 304  PHE A N   1 
ATOM   43   C  CA  . PHE A 1 16  ? 65.066 22.441 35.409 1.00 35.91 ? 304  PHE A CA  1 
ATOM   44   C  C   . PHE A 1 16  ? 64.967 23.868 34.847 1.00 34.60 ? 304  PHE A C   1 
ATOM   45   O  O   . PHE A 1 16  ? 65.102 24.091 33.635 1.00 30.75 ? 304  PHE A O   1 
ATOM   46   C  CB  . PHE A 1 16  ? 63.658 21.877 35.707 1.00 35.45 ? 304  PHE A CB  1 
ATOM   47   C  CG  . PHE A 1 16  ? 62.698 22.031 34.548 1.00 36.41 ? 304  PHE A CG  1 
ATOM   48   C  CD1 . PHE A 1 16  ? 62.677 21.107 33.529 1.00 36.31 ? 304  PHE A CD1 1 
ATOM   49   C  CD2 . PHE A 1 16  ? 61.874 23.138 34.448 1.00 34.86 ? 304  PHE A CD2 1 
ATOM   50   C  CE1 . PHE A 1 16  ? 61.844 21.273 32.441 1.00 32.99 ? 304  PHE A CE1 1 
ATOM   51   C  CE2 . PHE A 1 16  ? 61.038 23.300 33.368 1.00 36.78 ? 304  PHE A CE2 1 
ATOM   52   C  CZ  . PHE A 1 16  ? 61.030 22.372 32.363 1.00 35.21 ? 304  PHE A CZ  1 
ATOM   53   N  N   . ARG A 1 17  ? 64.731 24.827 35.738 1.00 33.81 ? 305  ARG A N   1 
ATOM   54   C  CA  . ARG A 1 17  ? 64.660 26.230 35.358 1.00 35.33 ? 305  ARG A CA  1 
ATOM   55   C  C   . ARG A 1 17  ? 65.998 26.687 34.755 1.00 35.63 ? 305  ARG A C   1 
ATOM   56   O  O   . ARG A 1 17  ? 66.016 27.488 33.813 1.00 37.17 ? 305  ARG A O   1 
ATOM   57   C  CB  . ARG A 1 17  ? 64.312 27.101 36.568 1.00 35.29 ? 305  ARG A CB  1 
ATOM   58   C  CG  . ARG A 1 17  ? 64.101 28.563 36.211 1.00 32.92 ? 305  ARG A CG  1 
ATOM   59   C  CD  . ARG A 1 17  ? 64.136 29.456 37.440 1.00 35.23 ? 305  ARG A CD  1 
ATOM   60   N  NE  . ARG A 1 17  ? 63.496 30.739 37.161 1.00 37.72 ? 305  ARG A NE  1 
ATOM   61   C  CZ  . ARG A 1 17  ? 64.098 31.813 36.640 1.00 42.72 ? 305  ARG A CZ  1 
ATOM   62   N  NH1 . ARG A 1 17  ? 63.392 32.918 36.432 1.00 42.19 ? 305  ARG A NH1 1 
ATOM   63   N  NH2 . ARG A 1 17  ? 65.393 31.809 36.320 1.00 42.74 ? 305  ARG A NH2 1 
ATOM   64   N  N   . ALA A 1 18  ? 67.092 26.158 35.306 1.00 33.99 ? 306  ALA A N   1 
ATOM   65   C  CA  . ALA A 1 18  ? 68.438 26.402 34.824 1.00 33.91 ? 306  ALA A CA  1 
ATOM   66   C  C   . ALA A 1 18  ? 68.647 25.948 33.392 1.00 32.78 ? 306  ALA A C   1 
ATOM   67   O  O   . ALA A 1 18  ? 69.198 26.702 32.577 1.00 33.33 ? 306  ALA A O   1 
ATOM   68   C  CB  . ALA A 1 18  ? 69.470 25.738 35.769 1.00 34.54 ? 306  ALA A CB  1 
ATOM   69   N  N   . ALA A 1 19  ? 68.214 24.729 33.077 1.00 33.99 ? 307  ALA A N   1 
ATOM   70   C  CA  . ALA A 1 19  ? 68.275 24.211 31.691 1.00 35.00 ? 307  ALA A CA  1 
ATOM   71   C  C   . ALA A 1 19  ? 67.475 25.058 30.726 1.00 34.95 ? 307  ALA A C   1 
ATOM   72   O  O   . ALA A 1 19  ? 67.931 25.377 29.638 1.00 37.31 ? 307  ALA A O   1 
ATOM   73   C  CB  . ALA A 1 19  ? 67.807 22.755 31.619 1.00 35.53 ? 307  ALA A CB  1 
ATOM   74   N  N   . LEU A 1 20  ? 66.281 25.441 31.140 1.00 37.53 ? 308  LEU A N   1 
ATOM   75   C  CA  . LEU A 1 20  ? 65.400 26.286 30.318 1.00 37.51 ? 308  LEU A CA  1 
ATOM   76   C  C   . LEU A 1 20  ? 65.987 27.680 30.106 1.00 37.40 ? 308  LEU A C   1 
ATOM   77   O  O   . LEU A 1 20  ? 65.812 28.267 29.042 1.00 37.68 ? 308  LEU A O   1 
ATOM   78   C  CB  . LEU A 1 20  ? 64.020 26.378 30.975 1.00 40.16 ? 308  LEU A CB  1 
ATOM   79   C  CG  . LEU A 1 20  ? 62.707 26.553 30.199 1.00 38.08 ? 308  LEU A CG  1 
ATOM   80   C  CD1 . LEU A 1 20  ? 62.619 25.737 28.926 1.00 31.06 ? 308  LEU A CD1 1 
ATOM   81   C  CD2 . LEU A 1 20  ? 61.608 26.168 31.151 1.00 33.46 ? 308  LEU A CD2 1 
ATOM   82   N  N   . GLN A 1 21  ? 66.685 28.197 31.112 1.00 37.27 ? 309  GLN A N   1 
ATOM   83   C  CA  . GLN A 1 21  ? 67.325 29.511 31.020 1.00 38.55 ? 309  GLN A CA  1 
ATOM   84   C  C   . GLN A 1 21  ? 68.416 29.581 29.947 1.00 38.03 ? 309  GLN A C   1 
ATOM   85   O  O   . GLN A 1 21  ? 68.671 30.646 29.395 1.00 38.82 ? 309  GLN A O   1 
ATOM   86   C  CB  . GLN A 1 21  ? 67.908 29.939 32.372 1.00 37.68 ? 309  GLN A CB  1 
ATOM   87   C  CG  . GLN A 1 21  ? 68.280 31.399 32.393 1.00 38.38 ? 309  GLN A CG  1 
ATOM   88   C  CD  . GLN A 1 21  ? 68.955 31.847 33.655 1.00 42.79 ? 309  GLN A CD  1 
ATOM   89   O  OE1 . GLN A 1 21  ? 68.874 31.197 34.711 1.00 54.73 ? 309  GLN A OE1 1 
ATOM   90   N  NE2 . GLN A 1 21  ? 69.625 32.983 33.568 1.00 43.52 ? 309  GLN A NE2 1 
ATOM   91   N  N   . LEU A 1 22  ? 69.058 28.452 29.664 1.00 38.07 ? 310  LEU A N   1 
ATOM   92   C  CA  . LEU A 1 22  ? 70.053 28.376 28.595 1.00 38.79 ? 310  LEU A CA  1 
ATOM   93   C  C   . LEU A 1 22  ? 69.428 28.565 27.219 1.00 37.65 ? 310  LEU A C   1 
ATOM   94   O  O   . LEU A 1 22  ? 70.093 29.025 26.300 1.00 39.87 ? 310  LEU A O   1 
ATOM   95   C  CB  . LEU A 1 22  ? 70.779 27.023 28.593 1.00 37.69 ? 310  LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 22  ? 71.885 26.721 29.600 1.00 40.25 ? 310  LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 22  ? 72.497 25.372 29.234 1.00 38.02 ? 310  LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 22  ? 72.951 27.808 29.628 1.00 38.85 ? 310  LEU A CD2 1 
ATOM   99   N  N   . VAL A 1 23  ? 68.165 28.177 27.103 1.00 36.65 ? 311  VAL A N   1 
ATOM   100  C  CA  . VAL A 1 23  ? 67.425 28.113 25.853 1.00 37.90 ? 311  VAL A CA  1 
ATOM   101  C  C   . VAL A 1 23  ? 66.653 29.405 25.527 1.00 38.11 ? 311  VAL A C   1 
ATOM   102  O  O   . VAL A 1 23  ? 66.607 29.831 24.386 1.00 40.20 ? 311  VAL A O   1 
ATOM   103  C  CB  . VAL A 1 23  ? 66.392 26.932 25.911 1.00 38.95 ? 311  VAL A CB  1 
ATOM   104  C  CG1 . VAL A 1 23  ? 65.574 26.873 24.634 1.00 42.62 ? 311  VAL A CG1 1 
ATOM   105  C  CG2 . VAL A 1 23  ? 67.103 25.604 26.154 1.00 35.77 ? 311  VAL A CG2 1 
ATOM   106  N  N   . VAL A 1 24  ? 66.035 30.010 26.531 1.00 38.90 ? 312  VAL A N   1 
ATOM   107  C  CA  . VAL A 1 24  ? 65.194 31.181 26.322 1.00 38.08 ? 312  VAL A CA  1 
ATOM   108  C  C   . VAL A 1 24  ? 66.059 32.444 26.186 1.00 39.16 ? 312  VAL A C   1 
ATOM   109  O  O   . VAL A 1 24  ? 67.247 32.452 26.517 1.00 38.65 ? 312  VAL A O   1 
ATOM   110  C  CB  . VAL A 1 24  ? 64.145 31.367 27.479 1.00 39.28 ? 312  VAL A CB  1 
ATOM   111  C  CG1 . VAL A 1 24  ? 63.322 30.091 27.701 1.00 32.25 ? 312  VAL A CG1 1 
ATOM   112  C  CG2 . VAL A 1 24  ? 64.809 31.831 28.790 1.00 33.48 ? 312  VAL A CG2 1 
ATOM   113  N  N   . ASP A 1 25  ? 65.445 33.493 25.655 1.00 38.05 ? 313  ASP A N   1 
ATOM   114  C  CA  . ASP A 1 25  ? 66.064 34.798 25.558 1.00 35.98 ? 313  ASP A CA  1 
ATOM   115  C  C   . ASP A 1 25  ? 66.243 35.355 26.943 1.00 33.70 ? 313  ASP A C   1 
ATOM   116  O  O   . ASP A 1 25  ? 65.341 35.250 27.768 1.00 34.95 ? 313  ASP A O   1 
ATOM   117  C  CB  . ASP A 1 25  ? 65.188 35.745 24.729 1.00 37.18 ? 313  ASP A CB  1 
ATOM   118  C  CG  . ASP A 1 25  ? 65.061 35.295 23.298 1.00 36.11 ? 313  ASP A CG  1 
ATOM   119  O  OD1 . ASP A 1 25  ? 66.099 35.227 22.640 1.00 40.26 ? 313  ASP A OD1 1 
ATOM   120  O  OD2 . ASP A 1 25  ? 63.945 34.983 22.841 1.00 35.44 ? 313  ASP A OD2 1 
ATOM   121  N  N   . PRO A 1 26  ? 67.430 35.910 27.235 1.00 34.64 ? 314  PRO A N   1 
ATOM   122  C  CA  . PRO A 1 26  ? 67.583 36.563 28.534 1.00 35.56 ? 314  PRO A CA  1 
ATOM   123  C  C   . PRO A 1 26  ? 66.748 37.841 28.689 1.00 38.01 ? 314  PRO A C   1 
ATOM   124  O  O   . PRO A 1 26  ? 66.360 38.468 27.708 1.00 37.75 ? 314  PRO A O   1 
ATOM   125  C  CB  . PRO A 1 26  ? 69.085 36.901 28.596 1.00 35.56 ? 314  PRO A CB  1 
ATOM   126  C  CG  . PRO A 1 26  ? 69.733 36.138 27.515 1.00 35.08 ? 314  PRO A CG  1 
ATOM   127  C  CD  . PRO A 1 26  ? 68.687 35.911 26.466 1.00 33.61 ? 314  PRO A CD  1 
ATOM   128  N  N   . GLY A 1 27  ? 66.516 38.237 29.932 1.00 40.85 ? 315  GLY A N   1 
ATOM   129  C  CA  . GLY A 1 27  ? 65.872 39.507 30.202 1.00 41.44 ? 315  GLY A CA  1 
ATOM   130  C  C   . GLY A 1 27  ? 64.421 39.396 30.614 1.00 40.64 ? 315  GLY A C   1 
ATOM   131  O  O   . GLY A 1 27  ? 63.845 38.301 30.677 1.00 38.39 ? 315  GLY A O   1 
ATOM   132  N  N   . ASP A 1 28  ? 63.857 40.563 30.902 1.00 40.59 ? 316  ASP A N   1 
ATOM   133  C  CA  . ASP A 1 28  ? 62.498 40.707 31.399 1.00 42.57 ? 316  ASP A CA  1 
ATOM   134  C  C   . ASP A 1 28  ? 61.702 41.387 30.292 1.00 41.56 ? 316  ASP A C   1 
ATOM   135  O  O   . ASP A 1 28  ? 61.938 42.545 29.983 1.00 44.15 ? 316  ASP A O   1 
ATOM   136  C  CB  . ASP A 1 28  ? 62.529 41.579 32.663 1.00 44.46 ? 316  ASP A CB  1 
ATOM   137  C  CG  . ASP A 1 28  ? 61.221 41.584 33.434 1.00 41.85 ? 316  ASP A CG  1 
ATOM   138  O  OD1 . ASP A 1 28  ? 60.175 41.144 32.917 1.00 39.27 ? 316  ASP A OD1 1 
ATOM   139  O  OD2 . ASP A 1 28  ? 61.257 42.059 34.587 1.00 45.89 ? 316  ASP A OD2 1 
ATOM   140  N  N   . PRO A 1 29  ? 60.758 40.669 29.685 1.00 42.09 ? 317  PRO A N   1 
ATOM   141  C  CA  . PRO A 1 29  ? 60.020 41.219 28.555 1.00 42.71 ? 317  PRO A CA  1 
ATOM   142  C  C   . PRO A 1 29  ? 58.910 42.185 28.957 1.00 43.66 ? 317  PRO A C   1 
ATOM   143  O  O   . PRO A 1 29  ? 58.189 42.677 28.093 1.00 42.33 ? 317  PRO A O   1 
ATOM   144  C  CB  . PRO A 1 29  ? 59.423 39.989 27.919 1.00 42.71 ? 317  PRO A CB  1 
ATOM   145  C  CG  . PRO A 1 29  ? 59.188 39.067 29.076 1.00 43.82 ? 317  PRO A CG  1 
ATOM   146  C  CD  . PRO A 1 29  ? 60.312 39.310 30.027 1.00 42.44 ? 317  PRO A CD  1 
ATOM   147  N  N   . ARG A 1 30  ? 58.769 42.442 30.255 1.00 45.17 ? 318  ARG A N   1 
ATOM   148  C  CA  . ARG A 1 30  ? 57.813 43.432 30.745 1.00 47.35 ? 318  ARG A CA  1 
ATOM   149  C  C   . ARG A 1 30  ? 58.374 44.839 30.497 1.00 49.12 ? 318  ARG A C   1 
ATOM   150  O  O   . ARG A 1 30  ? 57.652 45.825 30.565 1.00 48.56 ? 318  ARG A O   1 
ATOM   151  C  CB  . ARG A 1 30  ? 57.501 43.181 32.221 1.00 47.03 ? 318  ARG A CB  1 
ATOM   152  C  CG  . ARG A 1 30  ? 56.909 41.802 32.468 1.00 45.75 ? 318  ARG A CG  1 
ATOM   153  C  CD  . ARG A 1 30  ? 56.693 41.486 33.930 1.00 46.34 ? 318  ARG A CD  1 
ATOM   154  N  NE  . ARG A 1 30  ? 57.936 41.330 34.671 1.00 46.64 ? 318  ARG A NE  1 
ATOM   155  C  CZ  . ARG A 1 30  ? 58.001 40.954 35.951 1.00 51.94 ? 318  ARG A CZ  1 
ATOM   156  N  NH1 . ARG A 1 30  ? 56.892 40.705 36.642 1.00 52.09 ? 318  ARG A NH1 1 
ATOM   157  N  NH2 . ARG A 1 30  ? 59.180 40.846 36.557 1.00 47.05 ? 318  ARG A NH2 1 
ATOM   158  N  N   . SER A 1 31  ? 59.675 44.895 30.210 1.00 52.51 ? 319  SER A N   1 
ATOM   159  C  CA  . SER A 1 31  ? 60.318 46.039 29.563 1.00 53.78 ? 319  SER A CA  1 
ATOM   160  C  C   . SER A 1 31  ? 59.700 46.307 28.182 1.00 54.84 ? 319  SER A C   1 
ATOM   161  O  O   . SER A 1 31  ? 59.173 47.397 27.926 1.00 56.83 ? 319  SER A O   1 
ATOM   162  C  CB  . SER A 1 31  ? 61.823 45.757 29.402 1.00 52.98 ? 319  SER A CB  1 
ATOM   163  N  N   . TYR A 1 32  ? 59.758 45.303 27.304 1.00 54.35 ? 320  TYR A N   1 
ATOM   164  C  CA  . TYR A 1 32  ? 59.342 45.445 25.891 1.00 52.74 ? 320  TYR A CA  1 
ATOM   165  C  C   . TYR A 1 32  ? 57.820 45.458 25.624 1.00 51.65 ? 320  TYR A C   1 
ATOM   166  O  O   . TYR A 1 32  ? 57.396 45.851 24.539 1.00 51.12 ? 320  TYR A O   1 
ATOM   167  C  CB  . TYR A 1 32  ? 59.976 44.321 25.057 1.00 52.93 ? 320  TYR A CB  1 
ATOM   168  N  N   . LEU A 1 33  ? 57.019 45.044 26.610 1.00 50.77 ? 321  LEU A N   1 
ATOM   169  C  CA  . LEU A 1 33  ? 55.592 44.750 26.427 1.00 49.18 ? 321  LEU A CA  1 
ATOM   170  C  C   . LEU A 1 33  ? 54.681 45.433 27.437 1.00 49.40 ? 321  LEU A C   1 
ATOM   171  O  O   . LEU A 1 33  ? 55.065 45.676 28.585 1.00 51.89 ? 321  LEU A O   1 
ATOM   172  C  CB  . LEU A 1 33  ? 55.370 43.241 26.533 1.00 49.06 ? 321  LEU A CB  1 
ATOM   173  C  CG  . LEU A 1 33  ? 56.120 42.400 25.498 1.00 41.11 ? 321  LEU A CG  1 
ATOM   174  C  CD1 . LEU A 1 33  ? 56.160 40.948 25.909 1.00 36.78 ? 321  LEU A CD1 1 
ATOM   175  C  CD2 . LEU A 1 33  ? 55.485 42.608 24.135 1.00 35.28 ? 321  LEU A CD2 1 
ATOM   176  N  N   . ASP A 1 34  ? 53.461 45.730 27.005 1.00 49.43 ? 322  ASP A N   1 
ATOM   177  C  CA  . ASP A 1 34  ? 52.457 46.345 27.877 1.00 49.66 ? 322  ASP A CA  1 
ATOM   178  C  C   . ASP A 1 34  ? 51.061 46.070 27.326 1.00 46.88 ? 322  ASP A C   1 
ATOM   179  O  O   . ASP A 1 34  ? 50.932 45.488 26.249 1.00 45.45 ? 322  ASP A O   1 
ATOM   180  C  CB  . ASP A 1 34  ? 52.727 47.858 28.075 1.00 51.61 ? 322  ASP A CB  1 
ATOM   181  C  CG  . ASP A 1 34  ? 53.071 48.588 26.769 1.00 57.45 ? 322  ASP A CG  1 
ATOM   182  O  OD1 . ASP A 1 34  ? 52.322 48.438 25.774 1.00 58.12 ? 322  ASP A OD1 1 
ATOM   183  O  OD2 . ASP A 1 34  ? 54.086 49.328 26.748 1.00 61.68 ? 322  ASP A OD2 1 
ATOM   184  N  N   . ASN A 1 35  ? 50.028 46.460 28.079 1.00 45.77 ? 323  ASN A N   1 
ATOM   185  C  CA  . ASN A 1 35  ? 48.624 46.265 27.684 1.00 45.01 ? 323  ASN A CA  1 
ATOM   186  C  C   . ASN A 1 35  ? 48.229 44.789 27.538 1.00 43.58 ? 323  ASN A C   1 
ATOM   187  O  O   . ASN A 1 35  ? 47.607 44.393 26.548 1.00 43.22 ? 323  ASN A O   1 
ATOM   188  C  CB  . ASN A 1 35  ? 48.299 47.027 26.383 1.00 46.69 ? 323  ASN A CB  1 
ATOM   189  C  CG  . ASN A 1 35  ? 47.784 48.430 26.626 1.00 44.65 ? 323  ASN A CG  1 
ATOM   190  O  OD1 . ASN A 1 35  ? 48.405 49.242 27.316 1.00 42.06 ? 323  ASN A OD1 1 
ATOM   191  N  ND2 . ASN A 1 35  ? 46.652 48.726 26.031 1.00 50.00 ? 323  ASN A ND2 1 
ATOM   192  N  N   . PHE A 1 36  ? 48.600 43.991 28.536 1.00 42.49 ? 324  PHE A N   1 
ATOM   193  C  CA  . PHE A 1 36  ? 48.287 42.564 28.573 1.00 40.42 ? 324  PHE A CA  1 
ATOM   194  C  C   . PHE A 1 36  ? 46.800 42.347 28.779 1.00 40.66 ? 324  PHE A C   1 
ATOM   195  O  O   . PHE A 1 36  ? 46.247 42.826 29.763 1.00 41.95 ? 324  PHE A O   1 
ATOM   196  C  CB  . PHE A 1 36  ? 49.061 41.881 29.697 1.00 39.96 ? 324  PHE A CB  1 
ATOM   197  C  CG  . PHE A 1 36  ? 50.531 41.742 29.413 1.00 40.43 ? 324  PHE A CG  1 
ATOM   198  C  CD1 . PHE A 1 36  ? 51.407 42.780 29.686 1.00 41.88 ? 324  PHE A CD1 1 
ATOM   199  C  CD2 . PHE A 1 36  ? 51.033 40.580 28.844 1.00 41.20 ? 324  PHE A CD2 1 
ATOM   200  C  CE1 . PHE A 1 36  ? 52.768 42.653 29.413 1.00 40.09 ? 324  PHE A CE1 1 
ATOM   201  C  CE2 . PHE A 1 36  ? 52.396 40.442 28.574 1.00 42.59 ? 324  PHE A CE2 1 
ATOM   202  C  CZ  . PHE A 1 36  ? 53.258 41.480 28.854 1.00 40.29 ? 324  PHE A CZ  1 
ATOM   203  N  N   . ILE A 1 37  ? 46.160 41.650 27.836 1.00 40.27 ? 325  ILE A N   1 
ATOM   204  C  CA  . ILE A 1 37  ? 44.753 41.239 27.956 1.00 40.12 ? 325  ILE A CA  1 
ATOM   205  C  C   . ILE A 1 37  ? 44.619 39.721 27.790 1.00 38.65 ? 325  ILE A C   1 
ATOM   206  O  O   . ILE A 1 37  ? 44.962 39.155 26.739 1.00 36.31 ? 325  ILE A O   1 
ATOM   207  C  CB  . ILE A 1 37  ? 43.841 41.927 26.904 1.00 40.74 ? 325  ILE A CB  1 
ATOM   208  C  CG1 . ILE A 1 37  ? 43.915 43.455 27.026 1.00 41.98 ? 325  ILE A CG1 1 
ATOM   209  C  CG2 . ILE A 1 37  ? 42.402 41.477 27.080 1.00 42.37 ? 325  ILE A CG2 1 
ATOM   210  C  CD1 . ILE A 1 37  ? 43.221 44.176 25.905 1.00 40.06 ? 325  ILE A CD1 1 
ATOM   211  N  N   . LYS A 1 38  ? 44.112 39.073 28.835 1.00 37.03 ? 326  LYS A N   1 
ATOM   212  C  CA  . LYS A 1 38  ? 43.925 37.642 28.826 1.00 36.17 ? 326  LYS A CA  1 
ATOM   213  C  C   . LYS A 1 38  ? 42.898 37.257 27.782 1.00 37.54 ? 326  LYS A C   1 
ATOM   214  O  O   . LYS A 1 38  ? 41.805 37.798 27.775 1.00 36.27 ? 326  LYS A O   1 
ATOM   215  C  CB  . LYS A 1 38  ? 43.477 37.154 30.197 1.00 35.24 ? 326  LYS A CB  1 
ATOM   216  C  CG  . LYS A 1 38  ? 43.419 35.653 30.303 1.00 32.04 ? 326  LYS A CG  1 
ATOM   217  C  CD  . LYS A 1 38  ? 42.928 35.230 31.660 1.00 34.28 ? 326  LYS A CD  1 
ATOM   218  C  CE  . LYS A 1 38  ? 43.000 33.720 31.774 1.00 31.61 ? 326  LYS A CE  1 
ATOM   219  N  NZ  . LYS A 1 38  ? 42.166 33.227 32.888 1.00 32.48 ? 326  LYS A NZ  1 
ATOM   220  N  N   . ILE A 1 39  ? 43.257 36.335 26.890 1.00 39.61 ? 327  ILE A N   1 
ATOM   221  C  CA  . ILE A 1 39  ? 42.328 35.878 25.849 1.00 42.47 ? 327  ILE A CA  1 
ATOM   222  C  C   . ILE A 1 39  ? 41.890 34.415 26.009 1.00 41.75 ? 327  ILE A C   1 
ATOM   223  O  O   . ILE A 1 39  ? 40.984 33.967 25.312 1.00 44.06 ? 327  ILE A O   1 
ATOM   224  C  CB  . ILE A 1 39  ? 42.873 36.132 24.408 1.00 44.66 ? 327  ILE A CB  1 
ATOM   225  C  CG1 . ILE A 1 39  ? 44.219 35.454 24.172 1.00 42.53 ? 327  ILE A CG1 1 
ATOM   226  C  CG2 . ILE A 1 39  ? 42.991 37.634 24.133 1.00 42.14 ? 327  ILE A CG2 1 
ATOM   227  C  CD1 . ILE A 1 39  ? 44.654 35.474 22.700 1.00 44.42 ? 327  ILE A CD1 1 
ATOM   228  N  N   . GLY A 1 40  ? 42.506 33.685 26.932 1.00 39.78 ? 328  GLY A N   1 
ATOM   229  C  CA  . GLY A 1 40  ? 42.099 32.326 27.216 1.00 38.48 ? 328  GLY A CA  1 
ATOM   230  C  C   . GLY A 1 40  ? 43.088 31.541 28.052 1.00 41.01 ? 328  GLY A C   1 
ATOM   231  O  O   . GLY A 1 40  ? 44.124 32.060 28.500 1.00 39.40 ? 328  GLY A O   1 
ATOM   232  N  N   . GLU A 1 41  ? 42.742 30.271 28.247 1.00 43.99 ? 329  GLU A N   1 
ATOM   233  C  CA  . GLU A 1 41  ? 43.478 29.329 29.083 1.00 46.17 ? 329  GLU A CA  1 
ATOM   234  C  C   . GLU A 1 41  ? 43.624 28.004 28.364 1.00 46.46 ? 329  GLU A C   1 
ATOM   235  O  O   . GLU A 1 41  ? 42.705 27.541 27.687 1.00 45.93 ? 329  GLU A O   1 
ATOM   236  C  CB  . GLU A 1 41  ? 42.734 29.071 30.386 1.00 46.06 ? 329  GLU A CB  1 
ATOM   237  C  CG  . GLU A 1 41  ? 42.529 30.282 31.231 1.00 46.23 ? 329  GLU A CG  1 
ATOM   238  C  CD  . GLU A 1 41  ? 41.946 29.950 32.596 1.00 48.72 ? 329  GLU A CD  1 
ATOM   239  O  OE1 . GLU A 1 41  ? 41.402 28.840 32.769 1.00 56.08 ? 329  GLU A OE1 1 
ATOM   240  O  OE2 . GLU A 1 41  ? 42.017 30.812 33.494 1.00 49.59 ? 329  GLU A OE2 1 
ATOM   241  N  N   . GLY A 1 42  ? 44.794 27.404 28.499 1.00 48.97 ? 330  GLY A N   1 
ATOM   242  C  CA  . GLY A 1 42  ? 45.042 26.080 27.951 1.00 50.44 ? 330  GLY A CA  1 
ATOM   243  C  C   . GLY A 1 42  ? 45.308 25.102 29.073 1.00 52.80 ? 330  GLY A C   1 
ATOM   244  O  O   . GLY A 1 42  ? 45.009 25.363 30.265 1.00 52.68 ? 330  GLY A O   1 
ATOM   245  N  N   . SER A 1 43  ? 45.877 23.970 28.677 1.00 54.70 ? 331  SER A N   1 
ATOM   246  C  CA  . SER A 1 43  ? 46.329 22.943 29.610 1.00 55.18 ? 331  SER A CA  1 
ATOM   247  C  C   . SER A 1 43  ? 47.536 23.392 30.421 1.00 52.96 ? 331  SER A C   1 
ATOM   248  O  O   . SER A 1 43  ? 47.549 23.227 31.637 1.00 52.76 ? 331  SER A O   1 
ATOM   249  C  CB  . SER A 1 43  ? 46.645 21.651 28.854 1.00 54.40 ? 331  SER A CB  1 
ATOM   250  O  OG  . SER A 1 43  ? 45.424 21.018 28.497 1.00 60.32 ? 331  SER A OG  1 
ATOM   251  N  N   . THR A 1 44  ? 48.520 23.987 29.746 1.00 51.85 ? 332  THR A N   1 
ATOM   252  C  CA  . THR A 1 44  ? 49.801 24.329 30.364 1.00 50.47 ? 332  THR A CA  1 
ATOM   253  C  C   . THR A 1 44  ? 49.885 25.743 30.992 1.00 50.17 ? 332  THR A C   1 
ATOM   254  O  O   . THR A 1 44  ? 50.732 25.991 31.858 1.00 51.62 ? 332  THR A O   1 
ATOM   255  C  CB  . THR A 1 44  ? 50.959 24.065 29.364 1.00 51.31 ? 332  THR A CB  1 
ATOM   256  O  OG1 . THR A 1 44  ? 50.819 24.893 28.197 1.00 55.00 ? 332  THR A OG1 1 
ATOM   257  C  CG2 . THR A 1 44  ? 50.953 22.590 28.946 1.00 47.44 ? 332  THR A CG2 1 
ATOM   258  N  N   . GLY A 1 45  ? 49.013 26.659 30.587 1.00 48.36 ? 333  GLY A N   1 
ATOM   259  C  CA  . GLY A 1 45  ? 48.949 27.992 31.210 1.00 47.50 ? 333  GLY A CA  1 
ATOM   260  C  C   . GLY A 1 45  ? 47.923 28.911 30.559 1.00 45.69 ? 333  GLY A C   1 
ATOM   261  O  O   . GLY A 1 45  ? 46.925 28.428 30.007 1.00 46.77 ? 333  GLY A O   1 
ATOM   262  N  N   . ILE A 1 46  ? 48.162 30.228 30.615 1.00 40.94 ? 334  ILE A N   1 
ATOM   263  C  CA  . ILE A 1 46  ? 47.217 31.216 30.065 1.00 39.11 ? 334  ILE A CA  1 
ATOM   264  C  C   . ILE A 1 46  ? 47.810 31.916 28.845 1.00 38.33 ? 334  ILE A C   1 
ATOM   265  O  O   . ILE A 1 46  ? 49.023 31.924 28.673 1.00 34.23 ? 334  ILE A O   1 
ATOM   266  C  CB  . ILE A 1 46  ? 46.728 32.268 31.130 1.00 38.00 ? 334  ILE A CB  1 
ATOM   267  C  CG1 . ILE A 1 46  ? 47.808 33.311 31.435 1.00 38.54 ? 334  ILE A CG1 1 
ATOM   268  C  CG2 . ILE A 1 46  ? 46.234 31.566 32.407 1.00 33.88 ? 334  ILE A CG2 1 
ATOM   269  C  CD1 . ILE A 1 46  ? 47.363 34.418 32.371 1.00 38.64 ? 334  ILE A CD1 1 
ATOM   270  N  N   . VAL A 1 47  ? 46.951 32.480 27.991 1.00 36.11 ? 335  VAL A N   1 
ATOM   271  C  CA  . VAL A 1 47  ? 47.422 33.224 26.835 1.00 35.94 ? 335  VAL A CA  1 
ATOM   272  C  C   . VAL A 1 47  ? 46.857 34.638 26.891 1.00 35.90 ? 335  VAL A C   1 
ATOM   273  O  O   . VAL A 1 47  ? 45.668 34.833 27.112 1.00 33.36 ? 335  VAL A O   1 
ATOM   274  C  CB  . VAL A 1 47  ? 47.027 32.573 25.482 1.00 38.22 ? 335  VAL A CB  1 
ATOM   275  C  CG1 . VAL A 1 47  ? 47.612 33.371 24.334 1.00 38.65 ? 335  VAL A CG1 1 
ATOM   276  C  CG2 . VAL A 1 47  ? 47.488 31.108 25.392 1.00 35.56 ? 335  VAL A CG2 1 
ATOM   277  N  N   . CYS A 1 48  ? 47.734 35.613 26.681 1.00 35.92 ? 336  CYS A N   1 
ATOM   278  C  CA  . CYS A 1 48  ? 47.375 37.017 26.628 1.00 35.42 ? 336  CYS A CA  1 
ATOM   279  C  C   . CYS A 1 48  ? 47.750 37.620 25.294 1.00 35.82 ? 336  CYS A C   1 
ATOM   280  O  O   . CYS A 1 48  ? 48.583 37.086 24.562 1.00 37.47 ? 336  CYS A O   1 
ATOM   281  C  CB  . CYS A 1 48  ? 48.146 37.803 27.682 1.00 36.07 ? 336  CYS A CB  1 
ATOM   282  S  SG  . CYS A 1 48  ? 47.811 37.341 29.354 1.00 43.08 ? 336  CYS A SG  1 
ATOM   283  N  N   . ILE A 1 49  ? 47.148 38.756 24.993 1.00 35.40 ? 337  ILE A N   1 
ATOM   284  C  CA  . ILE A 1 49  ? 47.658 39.610 23.937 1.00 36.53 ? 337  ILE A CA  1 
ATOM   285  C  C   . ILE A 1 49  ? 48.386 40.779 24.604 1.00 32.65 ? 337  ILE A C   1 
ATOM   286  O  O   . ILE A 1 49  ? 48.037 41.189 25.698 1.00 31.64 ? 337  ILE A O   1 
ATOM   287  C  CB  . ILE A 1 49  ? 46.553 40.077 22.968 1.00 36.49 ? 337  ILE A CB  1 
ATOM   288  C  CG1 . ILE A 1 49  ? 45.480 40.882 23.694 1.00 37.85 ? 337  ILE A CG1 1 
ATOM   289  C  CG2 . ILE A 1 49  ? 45.916 38.880 22.305 1.00 38.51 ? 337  ILE A CG2 1 
ATOM   290  C  CD1 . ILE A 1 49  ? 44.439 41.483 22.763 1.00 38.52 ? 337  ILE A CD1 1 
ATOM   291  N  N   . ALA A 1 50  ? 49.433 41.272 23.962 1.00 32.50 ? 338  ALA A N   1 
ATOM   292  C  CA  . ALA A 1 50  ? 50.186 42.416 24.476 1.00 31.99 ? 338  ALA A CA  1 
ATOM   293  C  C   . ALA A 1 50  ? 50.626 43.208 23.282 1.00 33.43 ? 338  ALA A C   1 
ATOM   294  O  O   . ALA A 1 50  ? 50.530 42.728 22.156 1.00 31.00 ? 338  ALA A O   1 
ATOM   295  C  CB  . ALA A 1 50  ? 51.391 41.975 25.297 1.00 31.32 ? 338  ALA A CB  1 
ATOM   296  N  N   . THR A 1 51  ? 51.077 44.433 23.534 1.00 37.44 ? 339  THR A N   1 
ATOM   297  C  CA  . THR A 1 51  ? 51.601 45.312 22.497 1.00 39.24 ? 339  THR A CA  1 
ATOM   298  C  C   . THR A 1 51  ? 53.104 45.454 22.704 1.00 40.44 ? 339  THR A C   1 
ATOM   299  O  O   . THR A 1 51  ? 53.572 45.587 23.839 1.00 37.70 ? 339  THR A O   1 
ATOM   300  C  CB  . THR A 1 51  ? 50.914 46.698 22.531 1.00 40.15 ? 339  THR A CB  1 
ATOM   301  O  OG1 . THR A 1 51  ? 50.446 46.967 23.854 1.00 44.43 ? 339  THR A OG1 1 
ATOM   302  C  CG2 . THR A 1 51  ? 49.714 46.754 21.591 1.00 39.36 ? 339  THR A CG2 1 
ATOM   303  N  N   . VAL A 1 52  ? 53.854 45.375 21.606 1.00 43.40 ? 340  VAL A N   1 
ATOM   304  C  CA  . VAL A 1 52  ? 55.300 45.665 21.600 1.00 47.08 ? 340  VAL A CA  1 
ATOM   305  C  C   . VAL A 1 52  ? 55.530 47.184 21.570 1.00 47.08 ? 340  VAL A C   1 
ATOM   306  O  O   . VAL A 1 52  ? 54.726 47.917 20.998 1.00 47.01 ? 340  VAL A O   1 
ATOM   307  C  CB  . VAL A 1 52  ? 55.991 45.012 20.375 1.00 47.05 ? 340  VAL A CB  1 
ATOM   308  C  CG1 . VAL A 1 52  ? 57.476 45.317 20.354 1.00 46.81 ? 340  VAL A CG1 1 
ATOM   309  C  CG2 . VAL A 1 52  ? 55.759 43.517 20.377 1.00 44.34 ? 340  VAL A CG2 1 
ATOM   310  N  N   . ARG A 1 53  ? 56.615 47.645 22.198 1.00 49.84 ? 341  ARG A N   1 
ATOM   311  C  CA  . ARG A 1 53  ? 56.984 49.076 22.201 1.00 51.32 ? 341  ARG A CA  1 
ATOM   312  C  C   . ARG A 1 53  ? 57.985 49.415 21.078 1.00 52.09 ? 341  ARG A C   1 
ATOM   313  O  O   . ARG A 1 53  ? 57.643 50.065 20.085 1.00 51.06 ? 341  ARG A O   1 
ATOM   314  C  CB  . ARG A 1 53  ? 57.571 49.475 23.566 1.00 52.82 ? 341  ARG A CB  1 
ATOM   315  C  CG  . ARG A 1 53  ? 56.553 49.558 24.704 1.00 53.57 ? 341  ARG A CG  1 
ATOM   316  N  N   . GLY A 1 56  ? 54.960 49.116 17.859 1.00 55.58 ? 344  GLY A N   1 
ATOM   317  C  CA  . GLY A 1 56  ? 53.523 49.034 18.113 1.00 56.71 ? 344  GLY A CA  1 
ATOM   318  C  C   . GLY A 1 56  ? 52.848 47.708 17.737 1.00 57.53 ? 344  GLY A C   1 
ATOM   319  O  O   . GLY A 1 56  ? 51.624 47.559 17.911 1.00 57.41 ? 344  GLY A O   1 
ATOM   320  N  N   . LYS A 1 57  ? 53.615 46.746 17.218 1.00 57.08 ? 345  LYS A N   1 
ATOM   321  C  CA  . LYS A 1 57  ? 53.058 45.424 16.842 1.00 57.28 ? 345  LYS A CA  1 
ATOM   322  C  C   . LYS A 1 57  ? 52.373 44.748 18.051 1.00 54.86 ? 345  LYS A C   1 
ATOM   323  O  O   . LYS A 1 57  ? 52.885 44.804 19.171 1.00 52.71 ? 345  LYS A O   1 
ATOM   324  C  CB  . LYS A 1 57  ? 54.181 44.511 16.285 1.00 57.61 ? 345  LYS A CB  1 
ATOM   325  C  CG  . LYS A 1 57  ? 53.718 43.127 15.745 1.00 58.99 ? 345  LYS A CG  1 
ATOM   326  C  CD  . LYS A 1 57  ? 54.881 42.123 15.631 1.00 57.37 ? 345  LYS A CD  1 
ATOM   327  N  N   . LEU A 1 58  ? 51.221 44.118 17.835 1.00 54.11 ? 346  LEU A N   1 
ATOM   328  C  CA  . LEU A 1 58  ? 50.601 43.315 18.901 1.00 52.96 ? 346  LEU A CA  1 
ATOM   329  C  C   . LEU A 1 58  ? 50.959 41.818 18.779 1.00 48.92 ? 346  LEU A C   1 
ATOM   330  O  O   . LEU A 1 58  ? 51.102 41.281 17.683 1.00 49.50 ? 346  LEU A O   1 
ATOM   331  C  CB  . LEU A 1 58  ? 49.084 43.569 19.023 1.00 53.75 ? 346  LEU A CB  1 
ATOM   332  C  CG  . LEU A 1 58  ? 48.066 43.023 18.023 1.00 59.36 ? 346  LEU A CG  1 
ATOM   333  C  CD1 . LEU A 1 58  ? 46.826 42.564 18.789 1.00 62.39 ? 346  LEU A CD1 1 
ATOM   334  C  CD2 . LEU A 1 58  ? 47.696 44.048 16.940 1.00 55.71 ? 346  LEU A CD2 1 
ATOM   335  N  N   . VAL A 1 59  ? 51.155 41.171 19.927 1.00 44.18 ? 347  VAL A N   1 
ATOM   336  C  CA  . VAL A 1 59  ? 51.650 39.795 19.983 1.00 40.79 ? 347  VAL A CA  1 
ATOM   337  C  C   . VAL A 1 59  ? 50.766 38.985 20.918 1.00 37.76 ? 347  VAL A C   1 
ATOM   338  O  O   . VAL A 1 59  ? 49.933 39.553 21.613 1.00 36.31 ? 347  VAL A O   1 
ATOM   339  C  CB  . VAL A 1 59  ? 53.129 39.738 20.462 1.00 40.36 ? 347  VAL A CB  1 
ATOM   340  C  CG1 . VAL A 1 59  ? 54.065 40.367 19.429 1.00 39.92 ? 347  VAL A CG1 1 
ATOM   341  C  CG2 . VAL A 1 59  ? 53.295 40.402 21.828 1.00 34.73 ? 347  VAL A CG2 1 
ATOM   342  N  N   . ALA A 1 60  ? 50.941 37.668 20.900 1.00 37.33 ? 348  ALA A N   1 
ATOM   343  C  CA  . ALA A 1 60  ? 50.297 36.741 21.849 1.00 37.15 ? 348  ALA A CA  1 
ATOM   344  C  C   . ALA A 1 60  ? 51.380 36.178 22.788 1.00 36.60 ? 348  ALA A C   1 
ATOM   345  O  O   . ALA A 1 60  ? 52.418 35.722 22.324 1.00 36.10 ? 348  ALA A O   1 
ATOM   346  C  CB  . ALA A 1 60  ? 49.612 35.603 21.114 1.00 34.13 ? 348  ALA A CB  1 
ATOM   347  N  N   . VAL A 1 61  ? 51.126 36.228 24.093 1.00 34.79 ? 349  VAL A N   1 
ATOM   348  C  CA  . VAL A 1 61  ? 52.032 35.702 25.106 1.00 33.98 ? 349  VAL A CA  1 
ATOM   349  C  C   . VAL A 1 61  ? 51.396 34.537 25.868 1.00 34.05 ? 349  VAL A C   1 
ATOM   350  O  O   . VAL A 1 61  ? 50.397 34.713 26.559 1.00 34.54 ? 349  VAL A O   1 
ATOM   351  C  CB  . VAL A 1 61  ? 52.437 36.820 26.099 1.00 35.14 ? 349  VAL A CB  1 
ATOM   352  C  CG1 . VAL A 1 61  ? 53.523 36.343 27.049 1.00 33.39 ? 349  VAL A CG1 1 
ATOM   353  C  CG2 . VAL A 1 61  ? 52.900 38.044 25.329 1.00 30.66 ? 349  VAL A CG2 1 
ATOM   354  N  N   . LYS A 1 62  ? 51.996 33.357 25.741 1.00 35.33 ? 350  LYS A N   1 
ATOM   355  C  CA  . LYS A 1 62  ? 51.639 32.177 26.523 1.00 37.34 ? 350  LYS A CA  1 
ATOM   356  C  C   . LYS A 1 62  ? 52.511 32.122 27.770 1.00 35.23 ? 350  LYS A C   1 
ATOM   357  O  O   . LYS A 1 62  ? 53.731 32.231 27.685 1.00 33.48 ? 350  LYS A O   1 
ATOM   358  C  CB  . LYS A 1 62  ? 51.834 30.919 25.679 1.00 36.25 ? 350  LYS A CB  1 
ATOM   359  C  CG  . LYS A 1 62  ? 51.175 29.681 26.238 1.00 42.00 ? 350  LYS A CG  1 
ATOM   360  C  CD  . LYS A 1 62  ? 51.464 28.495 25.332 1.00 45.91 ? 350  LYS A CD  1 
ATOM   361  C  CE  . LYS A 1 62  ? 50.871 27.200 25.862 1.00 50.13 ? 350  LYS A CE  1 
ATOM   362  N  NZ  . LYS A 1 62  ? 51.174 26.089 24.925 1.00 52.98 ? 350  LYS A NZ  1 
ATOM   363  N  N   . LYS A 1 63  ? 51.879 31.966 28.929 1.00 37.00 ? 351  LYS A N   1 
ATOM   364  C  CA  . LYS A 1 63  ? 52.562 32.056 30.225 1.00 34.96 ? 351  LYS A CA  1 
ATOM   365  C  C   . LYS A 1 63  ? 52.306 30.792 31.022 1.00 34.08 ? 351  LYS A C   1 
ATOM   366  O  O   . LYS A 1 63  ? 51.159 30.466 31.298 1.00 32.96 ? 351  LYS A O   1 
ATOM   367  C  CB  . LYS A 1 63  ? 52.100 33.277 31.014 1.00 35.83 ? 351  LYS A CB  1 
ATOM   368  C  CG  . LYS A 1 63  ? 52.011 34.545 30.197 1.00 33.92 ? 351  LYS A CG  1 
ATOM   369  C  CD  . LYS A 1 63  ? 51.825 35.763 31.080 1.00 36.43 ? 351  LYS A CD  1 
ATOM   370  C  CE  . LYS A 1 63  ? 50.729 36.680 30.609 1.00 50.62 ? 351  LYS A CE  1 
ATOM   371  N  NZ  . LYS A 1 63  ? 50.778 36.928 29.139 1.00 57.00 ? 351  LYS A NZ  1 
ATOM   372  N  N   . MET A 1 64  ? 53.381 30.080 31.368 1.00 33.32 ? 352  MET A N   1 
ATOM   373  C  CA  . MET A 1 64  ? 53.293 28.757 31.961 1.00 35.43 ? 352  MET A CA  1 
ATOM   374  C  C   . MET A 1 64  ? 54.100 28.674 33.236 1.00 34.73 ? 352  MET A C   1 
ATOM   375  O  O   . MET A 1 64  ? 55.296 28.945 33.235 1.00 35.94 ? 352  MET A O   1 
ATOM   376  C  CB  . MET A 1 64  ? 53.794 27.721 30.970 1.00 35.06 ? 352  MET A CB  1 
ATOM   377  C  CG  . MET A 1 64  ? 52.920 27.642 29.720 1.00 42.73 ? 352  MET A CG  1 
ATOM   378  S  SD  . MET A 1 64  ? 53.845 27.285 28.236 1.00 44.33 ? 352  MET A SD  1 
ATOM   379  C  CE  . MET A 1 64  ? 54.706 28.809 27.865 1.00 47.77 ? 352  MET A CE  1 
ATOM   380  N  N   . ASP A 1 65  ? 53.455 28.268 34.321 1.00 36.08 ? 353  ASP A N   1 
ATOM   381  C  CA  . ASP A 1 65  ? 54.137 28.145 35.615 1.00 38.17 ? 353  ASP A CA  1 
ATOM   382  C  C   . ASP A 1 65  ? 54.958 26.859 35.683 1.00 37.60 ? 353  ASP A C   1 
ATOM   383  O  O   . ASP A 1 65  ? 54.428 25.756 35.597 1.00 37.53 ? 353  ASP A O   1 
ATOM   384  C  CB  . ASP A 1 65  ? 53.121 28.176 36.761 1.00 39.83 ? 353  ASP A CB  1 
ATOM   385  C  CG  . ASP A 1 65  ? 53.753 28.518 38.102 1.00 40.20 ? 353  ASP A CG  1 
ATOM   386  O  OD1 . ASP A 1 65  ? 54.750 27.876 38.492 1.00 40.77 ? 353  ASP A OD1 1 
ATOM   387  O  OD2 . ASP A 1 65  ? 53.236 29.435 38.765 1.00 48.78 ? 353  ASP A OD2 1 
ATOM   388  N  N   . LEU A 1 66  ? 56.260 27.022 35.841 1.00 39.00 ? 354  LEU A N   1 
ATOM   389  C  CA  . LEU A 1 66  ? 57.186 25.900 35.904 1.00 40.18 ? 354  LEU A CA  1 
ATOM   390  C  C   . LEU A 1 66  ? 56.836 24.893 37.024 1.00 40.84 ? 354  LEU A C   1 
ATOM   391  O  O   . LEU A 1 66  ? 57.145 23.713 36.898 1.00 41.01 ? 354  LEU A O   1 
ATOM   392  C  CB  . LEU A 1 66  ? 58.633 26.411 36.067 1.00 38.33 ? 354  LEU A CB  1 
ATOM   393  C  CG  . LEU A 1 66  ? 59.462 26.723 34.813 1.00 39.75 ? 354  LEU A CG  1 
ATOM   394  C  CD1 . LEU A 1 66  ? 58.683 27.513 33.807 1.00 29.31 ? 354  LEU A CD1 1 
ATOM   395  C  CD2 . LEU A 1 66  ? 60.723 27.458 35.177 1.00 39.18 ? 354  LEU A CD2 1 
ATOM   396  N  N   . ARG A 1 67  ? 56.209 25.363 38.104 1.00 42.45 ? 355  ARG A N   1 
ATOM   397  C  CA  . ARG A 1 67  ? 55.901 24.514 39.262 1.00 44.44 ? 355  ARG A CA  1 
ATOM   398  C  C   . ARG A 1 67  ? 54.531 23.824 39.181 1.00 44.79 ? 355  ARG A C   1 
ATOM   399  O  O   . ARG A 1 67  ? 54.269 22.899 39.929 1.00 45.95 ? 355  ARG A O   1 
ATOM   400  C  CB  . ARG A 1 67  ? 56.012 25.325 40.565 1.00 44.66 ? 355  ARG A CB  1 
ATOM   401  C  CG  . ARG A 1 67  ? 57.397 25.934 40.793 1.00 46.36 ? 355  ARG A CG  1 
ATOM   402  C  CD  . ARG A 1 67  ? 57.620 26.466 42.225 1.00 50.60 ? 355  ARG A CD  1 
ATOM   403  N  NE  . ARG A 1 67  ? 58.741 25.806 42.925 1.00 52.21 ? 355  ARG A NE  1 
ATOM   404  C  CZ  . ARG A 1 67  ? 59.860 26.404 43.347 1.00 60.04 ? 355  ARG A CZ  1 
ATOM   405  N  NH1 . ARG A 1 67  ? 60.059 27.711 43.172 1.00 63.65 ? 355  ARG A NH1 1 
ATOM   406  N  NH2 . ARG A 1 67  ? 60.806 25.688 43.969 1.00 64.45 ? 355  ARG A NH2 1 
ATOM   407  N  N   . LYS A 1 68  ? 53.675 24.251 38.261 1.00 46.51 ? 356  LYS A N   1 
ATOM   408  C  CA  . LYS A 1 68  ? 52.306 23.753 38.186 1.00 49.07 ? 356  LYS A CA  1 
ATOM   409  C  C   . LYS A 1 68  ? 52.014 22.915 36.944 1.00 45.36 ? 356  LYS A C   1 
ATOM   410  O  O   . LYS A 1 68  ? 50.924 22.998 36.404 1.00 46.95 ? 356  LYS A O   1 
ATOM   411  C  CB  . LYS A 1 68  ? 51.321 24.941 38.261 1.00 50.73 ? 356  LYS A CB  1 
ATOM   412  C  CG  . LYS A 1 68  ? 51.285 25.616 39.638 1.00 53.86 ? 356  LYS A CG  1 
ATOM   413  C  CD  . LYS A 1 68  ? 50.637 27.007 39.600 1.00 54.14 ? 356  LYS A CD  1 
ATOM   414  C  CE  . LYS A 1 68  ? 50.294 27.516 41.015 1.00 55.83 ? 356  LYS A CE  1 
ATOM   415  N  NZ  . LYS A 1 68  ? 51.289 27.063 42.041 1.00 56.75 ? 356  LYS A NZ  1 
ATOM   416  N  N   . GLN A 1 69  ? 52.972 22.114 36.499 1.00 43.46 ? 357  GLN A N   1 
ATOM   417  C  CA  . GLN A 1 69  ? 52.785 21.248 35.328 1.00 42.27 ? 357  GLN A CA  1 
ATOM   418  C  C   . GLN A 1 69  ? 52.674 19.798 35.771 1.00 42.25 ? 357  GLN A C   1 
ATOM   419  O  O   . GLN A 1 69  ? 53.329 19.375 36.716 1.00 41.31 ? 357  GLN A O   1 
ATOM   420  C  CB  . GLN A 1 69  ? 53.944 21.389 34.336 1.00 41.78 ? 357  GLN A CB  1 
ATOM   421  C  CG  . GLN A 1 69  ? 54.193 22.805 33.823 1.00 40.33 ? 357  GLN A CG  1 
ATOM   422  C  CD  . GLN A 1 69  ? 52.972 23.446 33.147 1.00 39.62 ? 357  GLN A CD  1 
ATOM   423  O  OE1 . GLN A 1 69  ? 52.312 22.834 32.318 1.00 39.07 ? 357  GLN A OE1 1 
ATOM   424  N  NE2 . GLN A 1 69  ? 52.689 24.684 33.502 1.00 28.98 ? 357  GLN A NE2 1 
ATOM   425  N  N   . GLN A 1 70  ? 51.802 19.041 35.118 1.00 44.85 ? 358  GLN A N   1 
ATOM   426  C  CA  . GLN A 1 70  ? 51.758 17.597 35.348 1.00 44.26 ? 358  GLN A CA  1 
ATOM   427  C  C   . GLN A 1 70  ? 53.033 16.948 34.756 1.00 44.37 ? 358  GLN A C   1 
ATOM   428  O  O   . GLN A 1 70  ? 53.612 16.048 35.376 1.00 44.78 ? 358  GLN A O   1 
ATOM   429  C  CB  . GLN A 1 70  ? 50.449 16.995 34.816 1.00 44.97 ? 358  GLN A CB  1 
ATOM   430  C  CG  . GLN A 1 70  ? 49.240 17.135 35.820 1.00 48.29 ? 358  GLN A CG  1 
ATOM   431  C  CD  . GLN A 1 70  ? 49.204 16.032 36.918 1.00 53.76 ? 358  GLN A CD  1 
ATOM   432  O  OE1 . GLN A 1 70  ? 48.691 14.927 36.688 1.00 59.48 ? 358  GLN A OE1 1 
ATOM   433  N  NE2 . GLN A 1 70  ? 49.735 16.341 38.108 1.00 42.45 ? 358  GLN A NE2 1 
ATOM   434  N  N   . ARG A 1 71  ? 53.485 17.447 33.596 1.00 41.63 ? 359  ARG A N   1 
ATOM   435  C  CA  . ARG A 1 71  ? 54.733 17.016 32.961 1.00 41.64 ? 359  ARG A CA  1 
ATOM   436  C  C   . ARG A 1 71  ? 55.559 18.223 32.570 1.00 40.37 ? 359  ARG A C   1 
ATOM   437  O  O   . ARG A 1 71  ? 55.486 18.729 31.456 1.00 37.89 ? 359  ARG A O   1 
ATOM   438  C  CB  . ARG A 1 71  ? 54.463 16.216 31.700 1.00 43.34 ? 359  ARG A CB  1 
ATOM   439  C  CG  . ARG A 1 71  ? 53.785 14.885 31.916 1.00 47.67 ? 359  ARG A CG  1 
ATOM   440  C  CD  . ARG A 1 71  ? 52.798 14.633 30.797 1.00 50.93 ? 359  ARG A CD  1 
ATOM   441  N  NE  . ARG A 1 71  ? 51.786 13.655 31.178 1.00 53.18 ? 359  ARG A NE  1 
ATOM   442  C  CZ  . ARG A 1 71  ? 51.971 12.344 31.162 1.00 50.87 ? 359  ARG A CZ  1 
ATOM   443  N  NH1 . ARG A 1 71  ? 53.138 11.832 30.787 1.00 49.57 ? 359  ARG A NH1 1 
ATOM   444  N  NH2 . ARG A 1 71  ? 50.976 11.545 31.530 1.00 55.73 ? 359  ARG A NH2 1 
ATOM   445  N  N   . ARG A 1 72  ? 56.372 18.659 33.508 1.00 40.52 ? 360  ARG A N   1 
ATOM   446  C  CA  . ARG A 1 72  ? 57.203 19.838 33.357 1.00 40.20 ? 360  ARG A CA  1 
ATOM   447  C  C   . ARG A 1 72  ? 58.140 19.787 32.117 1.00 39.43 ? 360  ARG A C   1 
ATOM   448  O  O   . ARG A 1 72  ? 58.369 20.807 31.466 1.00 38.07 ? 360  ARG A O   1 
ATOM   449  C  CB  . ARG A 1 72  ? 57.990 19.962 34.650 1.00 39.90 ? 360  ARG A CB  1 
ATOM   450  C  CG  . ARG A 1 72  ? 58.681 21.253 34.878 1.00 43.35 ? 360  ARG A CG  1 
ATOM   451  C  CD  . ARG A 1 72  ? 59.454 21.179 36.170 1.00 41.31 ? 360  ARG A CD  1 
ATOM   452  N  NE  . ARG A 1 72  ? 60.265 19.967 36.221 1.00 45.59 ? 360  ARG A NE  1 
ATOM   453  C  CZ  . ARG A 1 72  ? 60.936 19.557 37.292 1.00 42.71 ? 360  ARG A CZ  1 
ATOM   454  N  NH1 . ARG A 1 72  ? 60.931 20.273 38.411 1.00 39.45 ? 360  ARG A NH1 1 
ATOM   455  N  NH2 . ARG A 1 72  ? 61.626 18.429 37.230 1.00 44.62 ? 360  ARG A NH2 1 
ATOM   456  N  N   . GLU A 1 73  ? 58.664 18.609 31.768 1.00 38.73 ? 361  GLU A N   1 
ATOM   457  C  CA  . GLU A 1 73  ? 59.599 18.515 30.629 1.00 39.09 ? 361  GLU A CA  1 
ATOM   458  C  C   . GLU A 1 73  ? 59.017 18.994 29.293 1.00 35.73 ? 361  GLU A C   1 
ATOM   459  O  O   . GLU A 1 73  ? 59.742 19.399 28.409 1.00 33.87 ? 361  GLU A O   1 
ATOM   460  C  CB  . GLU A 1 73  ? 60.120 17.094 30.468 1.00 39.91 ? 361  GLU A CB  1 
ATOM   461  C  CG  . GLU A 1 73  ? 61.042 16.641 31.610 1.00 52.13 ? 361  GLU A CG  1 
ATOM   462  C  CD  . GLU A 1 73  ? 62.458 17.211 31.527 1.00 61.27 ? 361  GLU A CD  1 
ATOM   463  O  OE1 . GLU A 1 73  ? 62.874 17.625 30.416 1.00 63.97 ? 361  GLU A OE1 1 
ATOM   464  O  OE2 . GLU A 1 73  ? 63.154 17.231 32.576 1.00 61.25 ? 361  GLU A OE2 1 
ATOM   465  N  N   . LEU A 1 74  ? 57.706 18.902 29.146 1.00 36.37 ? 362  LEU A N   1 
ATOM   466  C  CA  . LEU A 1 74  ? 57.023 19.337 27.933 1.00 35.89 ? 362  LEU A CA  1 
ATOM   467  C  C   . LEU A 1 74  ? 57.189 20.830 27.620 1.00 35.73 ? 362  LEU A C   1 
ATOM   468  O  O   . LEU A 1 74  ? 57.097 21.208 26.465 1.00 35.41 ? 362  LEU A O   1 
ATOM   469  C  CB  . LEU A 1 74  ? 55.532 19.001 28.035 1.00 34.73 ? 362  LEU A CB  1 
ATOM   470  C  CG  . LEU A 1 74  ? 55.135 17.522 28.031 1.00 36.79 ? 362  LEU A CG  1 
ATOM   471  C  CD1 . LEU A 1 74  ? 53.639 17.413 27.916 1.00 34.47 ? 362  LEU A CD1 1 
ATOM   472  C  CD2 . LEU A 1 74  ? 55.817 16.766 26.907 1.00 39.09 ? 362  LEU A CD2 1 
ATOM   473  N  N   . LEU A 1 75  ? 57.402 21.659 28.649 1.00 36.71 ? 363  LEU A N   1 
ATOM   474  C  CA  . LEU A 1 75  ? 57.681 23.099 28.504 1.00 37.06 ? 363  LEU A CA  1 
ATOM   475  C  C   . LEU A 1 75  ? 58.920 23.327 27.676 1.00 38.04 ? 363  LEU A C   1 
ATOM   476  O  O   . LEU A 1 75  ? 58.980 24.228 26.863 1.00 36.21 ? 363  LEU A O   1 
ATOM   477  C  CB  . LEU A 1 75  ? 57.909 23.756 29.884 1.00 39.62 ? 363  LEU A CB  1 
ATOM   478  C  CG  . LEU A 1 75  ? 56.739 23.812 30.882 1.00 40.51 ? 363  LEU A CG  1 
ATOM   479  C  CD1 . LEU A 1 75  ? 57.109 24.540 32.169 1.00 40.08 ? 363  LEU A CD1 1 
ATOM   480  C  CD2 . LEU A 1 75  ? 55.578 24.466 30.238 1.00 37.68 ? 363  LEU A CD2 1 
ATOM   481  N  N   . PHE A 1 76  ? 59.917 22.498 27.930 1.00 40.97 ? 364  PHE A N   1 
ATOM   482  C  CA  . PHE A 1 76  ? 61.166 22.489 27.194 1.00 44.59 ? 364  PHE A CA  1 
ATOM   483  C  C   . PHE A 1 76  ? 60.893 22.188 25.728 1.00 46.87 ? 364  PHE A C   1 
ATOM   484  O  O   . PHE A 1 76  ? 61.317 22.945 24.836 1.00 46.40 ? 364  PHE A O   1 
ATOM   485  C  CB  . PHE A 1 76  ? 62.093 21.432 27.821 1.00 46.06 ? 364  PHE A CB  1 
ATOM   486  C  CG  . PHE A 1 76  ? 63.531 21.601 27.488 1.00 49.55 ? 364  PHE A CG  1 
ATOM   487  C  CD1 . PHE A 1 76  ? 64.289 22.568 28.127 1.00 49.78 ? 364  PHE A CD1 1 
ATOM   488  C  CD2 . PHE A 1 76  ? 64.149 20.756 26.548 1.00 58.46 ? 364  PHE A CD2 1 
ATOM   489  C  CE1 . PHE A 1 76  ? 65.639 22.721 27.825 1.00 49.37 ? 364  PHE A CE1 1 
ATOM   490  C  CE2 . PHE A 1 76  ? 65.510 20.893 26.232 1.00 54.42 ? 364  PHE A CE2 1 
ATOM   491  C  CZ  . PHE A 1 76  ? 66.255 21.877 26.873 1.00 54.64 ? 364  PHE A CZ  1 
ATOM   492  N  N   . ASN A 1 77  ? 60.150 21.100 25.496 1.00 49.37 ? 365  ASN A N   1 
ATOM   493  C  CA  . ASN A 1 77  ? 59.898 20.580 24.148 1.00 50.56 ? 365  ASN A CA  1 
ATOM   494  C  C   . ASN A 1 77  ? 59.196 21.634 23.336 1.00 50.11 ? 365  ASN A C   1 
ATOM   495  O  O   . ASN A 1 77  ? 59.475 21.782 22.156 1.00 49.10 ? 365  ASN A O   1 
ATOM   496  C  CB  . ASN A 1 77  ? 59.008 19.314 24.146 1.00 51.23 ? 365  ASN A CB  1 
ATOM   497  C  CG  . ASN A 1 77  ? 59.648 18.105 24.834 1.00 49.54 ? 365  ASN A CG  1 
ATOM   498  O  OD1 . ASN A 1 77  ? 60.758 18.162 25.358 1.00 48.22 ? 365  ASN A OD1 1 
ATOM   499  N  ND2 . ASN A 1 77  ? 58.916 16.999 24.837 1.00 46.65 ? 365  ASN A ND2 1 
ATOM   500  N  N   . GLU A 1 78  ? 58.265 22.340 23.978 1.00 51.97 ? 366  GLU A N   1 
ATOM   501  C  CA  . GLU A 1 78  ? 57.497 23.414 23.339 1.00 51.96 ? 366  GLU A CA  1 
ATOM   502  C  C   . GLU A 1 78  ? 58.392 24.464 22.715 1.00 52.08 ? 366  GLU A C   1 
ATOM   503  O  O   . GLU A 1 78  ? 58.325 24.672 21.509 1.00 50.56 ? 366  GLU A O   1 
ATOM   504  C  CB  . GLU A 1 78  ? 56.551 24.083 24.339 1.00 52.54 ? 366  GLU A CB  1 
ATOM   505  C  CG  . GLU A 1 78  ? 55.651 25.186 23.714 1.00 53.84 ? 366  GLU A CG  1 
ATOM   506  C  CD  . GLU A 1 78  ? 54.375 25.493 24.503 1.00 53.13 ? 366  GLU A CD  1 
ATOM   507  O  OE1 . GLU A 1 78  ? 54.227 25.047 25.682 1.00 51.33 ? 366  GLU A OE1 1 
ATOM   508  O  OE2 . GLU A 1 78  ? 53.509 26.180 23.910 1.00 57.01 ? 366  GLU A OE2 1 
ATOM   509  N  N   . VAL A 1 79  ? 59.234 25.114 23.533 1.00 54.23 ? 367  VAL A N   1 
ATOM   510  C  CA  . VAL A 1 79  ? 60.112 26.218 23.060 1.00 52.71 ? 367  VAL A CA  1 
ATOM   511  C  C   . VAL A 1 79  ? 61.044 25.774 21.945 1.00 53.87 ? 367  VAL A C   1 
ATOM   512  O  O   . VAL A 1 79  ? 61.145 26.452 20.921 1.00 54.50 ? 367  VAL A O   1 
ATOM   513  C  CB  . VAL A 1 79  ? 60.993 26.812 24.182 1.00 52.74 ? 367  VAL A CB  1 
ATOM   514  C  CG1 . VAL A 1 79  ? 62.091 27.716 23.584 1.00 50.71 ? 367  VAL A CG1 1 
ATOM   515  C  CG2 . VAL A 1 79  ? 60.160 27.549 25.184 1.00 44.02 ? 367  VAL A CG2 1 
ATOM   516  N  N   . VAL A 1 80  ? 61.726 24.645 22.156 1.00 55.16 ? 368  VAL A N   1 
ATOM   517  C  CA  . VAL A 1 80  ? 62.677 24.105 21.175 1.00 55.47 ? 368  VAL A CA  1 
ATOM   518  C  C   . VAL A 1 80  ? 62.075 23.813 19.782 1.00 58.04 ? 368  VAL A C   1 
ATOM   519  O  O   . VAL A 1 80  ? 62.771 23.997 18.769 1.00 59.54 ? 368  VAL A O   1 
ATOM   520  C  CB  . VAL A 1 80  ? 63.357 22.827 21.685 1.00 56.05 ? 368  VAL A CB  1 
ATOM   521  C  CG1 . VAL A 1 80  ? 64.200 22.196 20.578 1.00 56.12 ? 368  VAL A CG1 1 
ATOM   522  C  CG2 . VAL A 1 80  ? 64.219 23.124 22.919 1.00 52.69 ? 368  VAL A CG2 1 
ATOM   523  N  N   . ILE A 1 81  ? 60.805 23.378 19.731 1.00 56.55 ? 369  ILE A N   1 
ATOM   524  C  CA  . ILE A 1 81  ? 60.145 23.012 18.472 1.00 56.31 ? 369  ILE A CA  1 
ATOM   525  C  C   . ILE A 1 81  ? 59.797 24.229 17.635 1.00 56.78 ? 369  ILE A C   1 
ATOM   526  O  O   . ILE A 1 81  ? 60.136 24.301 16.457 1.00 54.75 ? 369  ILE A O   1 
ATOM   527  C  CB  . ILE A 1 81  ? 58.824 22.166 18.691 1.00 58.36 ? 369  ILE A CB  1 
ATOM   528  C  CG1 . ILE A 1 81  ? 59.144 20.720 19.152 1.00 56.33 ? 369  ILE A CG1 1 
ATOM   529  C  CG2 . ILE A 1 81  ? 57.890 22.195 17.411 1.00 52.67 ? 369  ILE A CG2 1 
ATOM   530  C  CD1 . ILE A 1 81  ? 60.411 20.070 18.592 1.00 52.85 ? 369  ILE A CD1 1 
ATOM   531  N  N   . MET A 1 82  ? 59.092 25.180 18.221 1.00 58.25 ? 370  MET A N   1 
ATOM   532  C  CA  . MET A 1 82  ? 58.752 26.386 17.468 1.00 61.20 ? 370  MET A CA  1 
ATOM   533  C  C   . MET A 1 82  ? 59.974 27.237 17.111 1.00 58.45 ? 370  MET A C   1 
ATOM   534  O  O   . MET A 1 82  ? 59.959 27.937 16.094 1.00 57.31 ? 370  MET A O   1 
ATOM   535  C  CB  . MET A 1 82  ? 57.693 27.217 18.190 1.00 64.18 ? 370  MET A CB  1 
ATOM   536  C  CG  . MET A 1 82  ? 56.274 26.972 17.663 1.00 60.86 ? 370  MET A CG  1 
ATOM   537  S  SD  . MET A 1 82  ? 55.104 27.795 18.717 1.00 68.75 ? 370  MET A SD  1 
ATOM   538  C  CE  . MET A 1 82  ? 55.172 29.480 18.161 1.00 52.85 ? 370  MET A CE  1 
ATOM   539  N  N   . ARG A 1 83  ? 61.030 27.163 17.922 1.00 56.61 ? 371  ARG A N   1 
ATOM   540  C  CA  . ARG A 1 83  ? 62.308 27.776 17.547 1.00 55.20 ? 371  ARG A CA  1 
ATOM   541  C  C   . ARG A 1 83  ? 62.887 27.110 16.287 1.00 53.64 ? 371  ARG A C   1 
ATOM   542  O  O   . ARG A 1 83  ? 63.316 27.799 15.363 1.00 51.12 ? 371  ARG A O   1 
ATOM   543  C  CB  . ARG A 1 83  ? 63.312 27.702 18.695 1.00 54.13 ? 371  ARG A CB  1 
ATOM   544  C  CG  . ARG A 1 83  ? 64.619 28.450 18.402 1.00 57.44 ? 371  ARG A CG  1 
ATOM   545  C  CD  . ARG A 1 83  ? 65.753 28.046 19.342 1.00 55.82 ? 371  ARG A CD  1 
ATOM   546  N  NE  . ARG A 1 83  ? 66.082 26.630 19.196 1.00 55.09 ? 371  ARG A NE  1 
ATOM   547  C  CZ  . ARG A 1 83  ? 66.789 25.920 20.070 1.00 54.48 ? 371  ARG A CZ  1 
ATOM   548  N  NH1 . ARG A 1 83  ? 67.266 26.478 21.178 1.00 52.23 ? 371  ARG A NH1 1 
ATOM   549  N  NH2 . ARG A 1 83  ? 67.022 24.637 19.828 1.00 56.34 ? 371  ARG A NH2 1 
ATOM   550  N  N   . ASP A 1 84  ? 62.846 25.778 16.247 1.00 53.63 ? 372  ASP A N   1 
ATOM   551  C  CA  . ASP A 1 84  ? 63.473 24.994 15.178 1.00 54.68 ? 372  ASP A CA  1 
ATOM   552  C  C   . ASP A 1 84  ? 62.626 24.703 13.928 1.00 54.88 ? 372  ASP A C   1 
ATOM   553  O  O   . ASP A 1 84  ? 63.184 24.262 12.919 1.00 54.09 ? 372  ASP A O   1 
ATOM   554  C  CB  . ASP A 1 84  ? 64.009 23.677 15.753 1.00 55.15 ? 372  ASP A CB  1 
ATOM   555  C  CG  . ASP A 1 84  ? 65.174 23.885 16.711 1.00 58.22 ? 372  ASP A CG  1 
ATOM   556  O  OD1 . ASP A 1 84  ? 65.739 24.997 16.756 1.00 60.68 ? 372  ASP A OD1 1 
ATOM   557  O  OD2 . ASP A 1 84  ? 65.546 22.924 17.413 1.00 64.81 ? 372  ASP A OD2 1 
ATOM   558  N  N   . TYR A 1 85  ? 61.309 24.947 13.975 1.00 56.48 ? 373  TYR A N   1 
ATOM   559  C  CA  . TYR A 1 85  ? 60.397 24.595 12.858 1.00 55.38 ? 373  TYR A CA  1 
ATOM   560  C  C   . TYR A 1 85  ? 59.491 25.748 12.461 1.00 54.77 ? 373  TYR A C   1 
ATOM   561  O  O   . TYR A 1 85  ? 58.453 25.946 13.073 1.00 58.80 ? 373  TYR A O   1 
ATOM   562  C  CB  . TYR A 1 85  ? 59.549 23.351 13.207 1.00 55.99 ? 373  TYR A CB  1 
ATOM   563  C  CG  . TYR A 1 85  ? 60.407 22.134 13.479 1.00 55.38 ? 373  TYR A CG  1 
ATOM   564  C  CD1 . TYR A 1 85  ? 60.907 21.882 14.752 1.00 57.20 ? 373  TYR A CD1 1 
ATOM   565  C  CD2 . TYR A 1 85  ? 60.765 21.265 12.454 1.00 61.77 ? 373  TYR A CD2 1 
ATOM   566  C  CE1 . TYR A 1 85  ? 61.726 20.789 15.009 1.00 61.18 ? 373  TYR A CE1 1 
ATOM   567  C  CE2 . TYR A 1 85  ? 61.592 20.160 12.699 1.00 62.21 ? 373  TYR A CE2 1 
ATOM   568  C  CZ  . TYR A 1 85  ? 62.071 19.931 13.979 1.00 60.98 ? 373  TYR A CZ  1 
ATOM   569  O  OH  . TYR A 1 85  ? 62.891 18.852 14.244 1.00 59.83 ? 373  TYR A OH  1 
ATOM   570  N  N   . GLN A 1 86  ? 59.884 26.501 11.438 1.00 51.94 ? 374  GLN A N   1 
ATOM   571  C  CA  . GLN A 1 86  ? 59.037 27.550 10.865 1.00 49.28 ? 374  GLN A CA  1 
ATOM   572  C  C   . GLN A 1 86  ? 58.380 27.073 9.544  1.00 48.82 ? 374  GLN A C   1 
ATOM   573  O  O   . GLN A 1 86  ? 59.077 26.712 8.591  1.00 47.47 ? 374  GLN A O   1 
ATOM   574  C  CB  . GLN A 1 86  ? 59.842 28.826 10.611 1.00 51.32 ? 374  GLN A CB  1 
ATOM   575  N  N   . HIS A 1 87  ? 57.043 27.097 9.494  1.00 44.52 ? 375  HIS A N   1 
ATOM   576  C  CA  . HIS A 1 87  ? 56.296 26.612 8.334  1.00 41.65 ? 375  HIS A CA  1 
ATOM   577  C  C   . HIS A 1 87  ? 55.103 27.538 8.126  1.00 39.84 ? 375  HIS A C   1 
ATOM   578  O  O   . HIS A 1 87  ? 54.580 28.083 9.081  1.00 40.39 ? 375  HIS A O   1 
ATOM   579  C  CB  . HIS A 1 87  ? 55.864 25.164 8.606  1.00 39.82 ? 375  HIS A CB  1 
ATOM   580  C  CG  . HIS A 1 87  ? 55.197 24.491 7.448  1.00 34.55 ? 375  HIS A CG  1 
ATOM   581  N  ND1 . HIS A 1 87  ? 53.838 24.551 7.244  1.00 25.13 ? 375  HIS A ND1 1 
ATOM   582  C  CD2 . HIS A 1 87  ? 55.695 23.735 6.440  1.00 28.94 ? 375  HIS A CD2 1 
ATOM   583  C  CE1 . HIS A 1 87  ? 53.529 23.888 6.143  1.00 28.06 ? 375  HIS A CE1 1 
ATOM   584  N  NE2 . HIS A 1 87  ? 54.637 23.379 5.638  1.00 22.13 ? 375  HIS A NE2 1 
ATOM   585  N  N   . GLU A 1 88  ? 54.674 27.741 6.888  1.00 38.65 ? 376  GLU A N   1 
ATOM   586  C  CA  . GLU A 1 88  ? 53.554 28.646 6.624  1.00 39.85 ? 376  GLU A CA  1 
ATOM   587  C  C   . GLU A 1 88  ? 52.312 28.339 7.483  1.00 36.14 ? 376  GLU A C   1 
ATOM   588  O  O   . GLU A 1 88  ? 51.548 29.245 7.805  1.00 34.78 ? 376  GLU A O   1 
ATOM   589  C  CB  . GLU A 1 88  ? 53.188 28.675 5.122  1.00 40.01 ? 376  GLU A CB  1 
ATOM   590  C  CG  . GLU A 1 88  ? 52.266 27.551 4.636  1.00 44.25 ? 376  GLU A CG  1 
ATOM   591  C  CD  . GLU A 1 88  ? 51.755 27.763 3.203  1.00 47.03 ? 376  GLU A CD  1 
ATOM   592  O  OE1 . GLU A 1 88  ? 52.425 28.492 2.437  1.00 60.87 ? 376  GLU A OE1 1 
ATOM   593  O  OE2 . GLU A 1 88  ? 50.691 27.194 2.833  1.00 55.96 ? 376  GLU A OE2 1 
ATOM   594  N  N   . ASN A 1 89  ? 52.136 27.062 7.838  1.00 33.08 ? 377  ASN A N   1 
ATOM   595  C  CA  . ASN A 1 89  ? 50.987 26.572 8.582  1.00 30.43 ? 377  ASN A CA  1 
ATOM   596  C  C   . ASN A 1 89  ? 51.303 26.278 10.050 1.00 30.48 ? 377  ASN A C   1 
ATOM   597  O  O   . ASN A 1 89  ? 50.604 25.522 10.703 1.00 25.46 ? 377  ASN A O   1 
ATOM   598  C  CB  . ASN A 1 89  ? 50.434 25.311 7.917  1.00 31.75 ? 377  ASN A CB  1 
ATOM   599  C  CG  . ASN A 1 89  ? 49.844 25.578 6.536  1.00 30.61 ? 377  ASN A CG  1 
ATOM   600  O  OD1 . ASN A 1 89  ? 50.239 24.969 5.566  1.00 29.12 ? 377  ASN A OD1 1 
ATOM   601  N  ND2 . ASN A 1 89  ? 48.874 26.469 6.462  1.00 33.14 ? 377  ASN A ND2 1 
ATOM   602  N  N   . VAL A 1 90  ? 52.344 26.908 10.577 1.00 32.29 ? 378  VAL A N   1 
ATOM   603  C  CA  . VAL A 1 90  ? 52.679 26.754 11.982 1.00 34.71 ? 378  VAL A CA  1 
ATOM   604  C  C   . VAL A 1 90  ? 52.844 28.137 12.580 1.00 33.38 ? 378  VAL A C   1 
ATOM   605  O  O   . VAL A 1 90  ? 53.490 28.997 12.000 1.00 31.84 ? 378  VAL A O   1 
ATOM   606  C  CB  . VAL A 1 90  ? 53.973 25.899 12.195 1.00 35.15 ? 378  VAL A CB  1 
ATOM   607  C  CG1 . VAL A 1 90  ? 54.313 25.820 13.681 1.00 33.95 ? 378  VAL A CG1 1 
ATOM   608  C  CG2 . VAL A 1 90  ? 53.786 24.490 11.600 1.00 35.25 ? 378  VAL A CG2 1 
ATOM   609  N  N   . VAL A 1 91  ? 52.227 28.327 13.734 1.00 35.55 ? 379  VAL A N   1 
ATOM   610  C  CA  A VAL A 1 91  ? 52.304 29.579 14.465 0.50 37.58 ? 379  VAL A CA  1 
ATOM   611  C  CA  B VAL A 1 91  ? 52.312 29.584 14.456 0.50 36.52 ? 379  VAL A CA  1 
ATOM   612  C  C   . VAL A 1 91  ? 53.773 29.930 14.708 1.00 38.94 ? 379  VAL A C   1 
ATOM   613  O  O   . VAL A 1 91  ? 54.558 29.088 15.138 1.00 37.53 ? 379  VAL A O   1 
ATOM   614  C  CB  A VAL A 1 91  ? 51.536 29.485 15.810 0.50 38.53 ? 379  VAL A CB  1 
ATOM   615  C  CB  B VAL A 1 91  ? 51.564 29.510 15.797 0.50 37.17 ? 379  VAL A CB  1 
ATOM   616  C  CG1 A VAL A 1 91  ? 52.297 28.610 16.816 0.50 38.03 ? 379  VAL A CG1 1 
ATOM   617  C  CG1 B VAL A 1 91  ? 51.980 30.665 16.704 0.50 35.95 ? 379  VAL A CG1 1 
ATOM   618  C  CG2 A VAL A 1 91  ? 51.271 30.867 16.382 0.50 38.70 ? 379  VAL A CG2 1 
ATOM   619  C  CG2 B VAL A 1 91  ? 50.059 29.496 15.561 0.50 29.65 ? 379  VAL A CG2 1 
ATOM   620  N  N   . GLU A 1 92  ? 54.135 31.171 14.405 1.00 41.58 ? 380  GLU A N   1 
ATOM   621  C  CA  . GLU A 1 92  ? 55.478 31.668 14.579 1.00 42.70 ? 380  GLU A CA  1 
ATOM   622  C  C   . GLU A 1 92  ? 55.708 32.172 16.003 1.00 41.81 ? 380  GLU A C   1 
ATOM   623  O  O   . GLU A 1 92  ? 54.880 32.908 16.532 1.00 38.47 ? 380  GLU A O   1 
ATOM   624  C  CB  . GLU A 1 92  ? 55.705 32.825 13.607 1.00 44.44 ? 380  GLU A CB  1 
ATOM   625  C  CG  . GLU A 1 92  ? 57.167 33.257 13.522 1.00 49.00 ? 380  GLU A CG  1 
ATOM   626  C  CD  . GLU A 1 92  ? 57.365 34.501 12.708 1.00 46.58 ? 380  GLU A CD  1 
ATOM   627  O  OE1 . GLU A 1 92  ? 56.472 34.863 11.903 1.00 57.66 ? 380  GLU A OE1 1 
ATOM   628  O  OE2 . GLU A 1 92  ? 58.428 35.123 12.881 1.00 57.26 ? 380  GLU A OE2 1 
ATOM   629  N  N   . MET A 1 93  ? 56.828 31.750 16.600 1.00 44.74 ? 381  MET A N   1 
ATOM   630  C  CA  . MET A 1 93  ? 57.331 32.249 17.888 1.00 45.82 ? 381  MET A CA  1 
ATOM   631  C  C   . MET A 1 93  ? 58.391 33.306 17.636 1.00 43.06 ? 381  MET A C   1 
ATOM   632  O  O   . MET A 1 93  ? 59.267 33.104 16.827 1.00 45.93 ? 381  MET A O   1 
ATOM   633  C  CB  . MET A 1 93  ? 57.978 31.131 18.696 1.00 46.61 ? 381  MET A CB  1 
ATOM   634  C  CG  . MET A 1 93  ? 58.399 31.557 20.116 1.00 48.24 ? 381  MET A CG  1 
ATOM   635  S  SD  . MET A 1 93  ? 59.355 30.294 20.979 1.00 51.28 ? 381  MET A SD  1 
ATOM   636  C  CE  . MET A 1 93  ? 60.823 30.380 19.989 1.00 48.65 ? 381  MET A CE  1 
ATOM   637  N  N   . TYR A 1 94  ? 58.311 34.424 18.337 1.00 41.76 ? 382  TYR A N   1 
ATOM   638  C  CA  . TYR A 1 94  ? 59.274 35.493 18.201 1.00 41.27 ? 382  TYR A CA  1 
ATOM   639  C  C   . TYR A 1 94  ? 60.368 35.417 19.259 1.00 40.97 ? 382  TYR A C   1 
ATOM   640  O  O   . TYR A 1 94  ? 61.531 35.650 18.956 1.00 41.94 ? 382  TYR A O   1 
ATOM   641  C  CB  . TYR A 1 94  ? 58.576 36.842 18.327 1.00 42.38 ? 382  TYR A CB  1 
ATOM   642  C  CG  . TYR A 1 94  ? 57.526 37.115 17.270 1.00 45.57 ? 382  TYR A CG  1 
ATOM   643  C  CD1 . TYR A 1 94  ? 57.813 36.944 15.919 1.00 46.05 ? 382  TYR A CD1 1 
ATOM   644  C  CD2 . TYR A 1 94  ? 56.268 37.592 17.615 1.00 42.51 ? 382  TYR A CD2 1 
ATOM   645  C  CE1 . TYR A 1 94  ? 56.878 37.216 14.948 1.00 48.78 ? 382  TYR A CE1 1 
ATOM   646  C  CE2 . TYR A 1 94  ? 55.318 37.864 16.640 1.00 49.47 ? 382  TYR A CE2 1 
ATOM   647  C  CZ  . TYR A 1 94  ? 55.633 37.670 15.305 1.00 44.86 ? 382  TYR A CZ  1 
ATOM   648  O  OH  . TYR A 1 94  ? 54.721 37.933 14.314 1.00 44.49 ? 382  TYR A OH  1 
ATOM   649  N  N   . ASN A 1 95  ? 59.988 35.139 20.506 1.00 39.76 ? 383  ASN A N   1 
ATOM   650  C  CA  . ASN A 1 95  ? 60.927 35.142 21.645 1.00 37.97 ? 383  ASN A CA  1 
ATOM   651  C  C   . ASN A 1 95  ? 60.384 34.296 22.787 1.00 36.32 ? 383  ASN A C   1 
ATOM   652  O  O   . ASN A 1 95  ? 59.225 33.903 22.773 1.00 35.86 ? 383  ASN A O   1 
ATOM   653  C  CB  . ASN A 1 95  ? 61.179 36.569 22.153 1.00 37.92 ? 383  ASN A CB  1 
ATOM   654  C  CG  . ASN A 1 95  ? 62.001 37.414 21.180 1.00 45.52 ? 383  ASN A CG  1 
ATOM   655  O  OD1 . ASN A 1 95  ? 63.223 37.270 21.076 1.00 44.93 ? 383  ASN A OD1 1 
ATOM   656  N  ND2 . ASN A 1 95  ? 61.325 38.294 20.454 1.00 48.14 ? 383  ASN A ND2 1 
ATOM   657  N  N   . SER A 1 96  ? 61.231 34.028 23.777 1.00 34.50 ? 384  SER A N   1 
ATOM   658  C  CA  . SER A 1 96  ? 60.834 33.321 24.983 1.00 32.09 ? 384  SER A CA  1 
ATOM   659  C  C   . SER A 1 96  ? 61.656 33.810 26.146 1.00 32.51 ? 384  SER A C   1 
ATOM   660  O  O   . SER A 1 96  ? 62.813 34.210 25.981 1.00 34.08 ? 384  SER A O   1 
ATOM   661  C  CB  . SER A 1 96  ? 60.973 31.803 24.842 1.00 30.82 ? 384  SER A CB  1 
ATOM   662  O  OG  . SER A 1 96  ? 62.283 31.403 24.484 1.00 30.95 ? 384  SER A OG  1 
ATOM   663  N  N   . TYR A 1 97  ? 61.049 33.776 27.326 1.00 31.91 ? 385  TYR A N   1 
ATOM   664  C  CA  . TYR A 1 97  ? 61.634 34.359 28.518 1.00 31.45 ? 385  TYR A CA  1 
ATOM   665  C  C   . TYR A 1 97  ? 61.232 33.579 29.745 1.00 30.69 ? 385  TYR A C   1 
ATOM   666  O  O   . TYR A 1 97  ? 60.268 32.802 29.744 1.00 32.20 ? 385  TYR A O   1 
ATOM   667  C  CB  . TYR A 1 97  ? 61.162 35.810 28.691 1.00 33.42 ? 385  TYR A CB  1 
ATOM   668  C  CG  . TYR A 1 97  ? 61.423 36.693 27.492 1.00 31.46 ? 385  TYR A CG  1 
ATOM   669  C  CD1 . TYR A 1 97  ? 62.625 37.400 27.363 1.00 31.47 ? 385  TYR A CD1 1 
ATOM   670  C  CD2 . TYR A 1 97  ? 60.467 36.838 26.500 1.00 35.31 ? 385  TYR A CD2 1 
ATOM   671  C  CE1 . TYR A 1 97  ? 62.863 38.197 26.283 1.00 31.89 ? 385  TYR A CE1 1 
ATOM   672  C  CE2 . TYR A 1 97  ? 60.697 37.642 25.397 1.00 31.99 ? 385  TYR A CE2 1 
ATOM   673  C  CZ  . TYR A 1 97  ? 61.888 38.313 25.289 1.00 34.69 ? 385  TYR A CZ  1 
ATOM   674  O  OH  . TYR A 1 97  ? 62.085 39.107 24.187 1.00 33.80 ? 385  TYR A OH  1 
ATOM   675  N  N   . LEU A 1 98  ? 61.989 33.805 30.795 1.00 32.54 ? 386  LEU A N   1 
ATOM   676  C  CA  . LEU A 1 98  ? 61.655 33.335 32.122 1.00 35.16 ? 386  LEU A CA  1 
ATOM   677  C  C   . LEU A 1 98  ? 61.346 34.596 32.919 1.00 36.26 ? 386  LEU A C   1 
ATOM   678  O  O   . LEU A 1 98  ? 62.101 35.563 32.872 1.00 34.56 ? 386  LEU A O   1 
ATOM   679  C  CB  . LEU A 1 98  ? 62.838 32.566 32.754 1.00 34.82 ? 386  LEU A CB  1 
ATOM   680  C  CG  . LEU A 1 98  ? 63.016 31.118 32.309 1.00 31.80 ? 386  LEU A CG  1 
ATOM   681  C  CD1 . LEU A 1 98  ? 64.309 30.557 32.865 1.00 31.26 ? 386  LEU A CD1 1 
ATOM   682  C  CD2 . LEU A 1 98  ? 61.818 30.275 32.749 1.00 30.85 ? 386  LEU A CD2 1 
ATOM   683  N  N   . VAL A 1 99  ? 60.211 34.587 33.607 1.00 37.75 ? 387  VAL A N   1 
ATOM   684  C  CA  . VAL A 1 99  ? 59.789 35.710 34.420 1.00 37.80 ? 387  VAL A CA  1 
ATOM   685  C  C   . VAL A 1 99  ? 59.322 35.108 35.738 1.00 38.29 ? 387  VAL A C   1 
ATOM   686  O  O   . VAL A 1 99  ? 58.223 34.546 35.823 1.00 35.55 ? 387  VAL A O   1 
ATOM   687  C  CB  . VAL A 1 99  ? 58.657 36.503 33.727 1.00 38.90 ? 387  VAL A CB  1 
ATOM   688  C  CG1 . VAL A 1 99  ? 58.165 37.657 34.629 1.00 40.25 ? 387  VAL A CG1 1 
ATOM   689  C  CG2 . VAL A 1 99  ? 59.138 37.026 32.375 1.00 35.86 ? 387  VAL A CG2 1 
ATOM   690  N  N   . GLY A 1 100 ? 60.175 35.203 36.753 1.00 38.78 ? 388  GLY A N   1 
ATOM   691  C  CA  . GLY A 1 100 ? 59.947 34.502 38.002 1.00 39.79 ? 388  GLY A CA  1 
ATOM   692  C  C   . GLY A 1 100 ? 59.882 33.008 37.762 1.00 41.39 ? 388  GLY A C   1 
ATOM   693  O  O   . GLY A 1 100 ? 60.799 32.420 37.195 1.00 43.91 ? 388  GLY A O   1 
ATOM   694  N  N   . ASP A 1 101 ? 58.774 32.404 38.165 1.00 42.19 ? 389  ASP A N   1 
ATOM   695  C  CA  . ASP A 1 101 ? 58.533 30.968 37.992 1.00 42.79 ? 389  ASP A CA  1 
ATOM   696  C  C   . ASP A 1 101 ? 57.811 30.640 36.691 1.00 39.73 ? 389  ASP A C   1 
ATOM   697  O  O   . ASP A 1 101 ? 57.313 29.532 36.537 1.00 40.00 ? 389  ASP A O   1 
ATOM   698  C  CB  . ASP A 1 101 ? 57.658 30.434 39.146 1.00 44.57 ? 389  ASP A CB  1 
ATOM   699  C  CG  . ASP A 1 101 ? 58.277 30.645 40.522 1.00 50.77 ? 389  ASP A CG  1 
ATOM   700  O  OD1 . ASP A 1 101 ? 59.513 30.790 40.617 1.00 55.47 ? 389  ASP A OD1 1 
ATOM   701  O  OD2 . ASP A 1 101 ? 57.509 30.656 41.515 1.00 55.16 ? 389  ASP A OD2 1 
ATOM   702  N  N   . GLU A 1 102 ? 57.727 31.588 35.765 1.00 38.92 ? 390  GLU A N   1 
ATOM   703  C  CA  . GLU A 1 102 ? 56.938 31.385 34.562 1.00 37.98 ? 390  GLU A CA  1 
ATOM   704  C  C   . GLU A 1 102 ? 57.802 31.395 33.327 1.00 35.96 ? 390  GLU A C   1 
ATOM   705  O  O   . GLU A 1 102 ? 58.717 32.214 33.208 1.00 32.56 ? 390  GLU A O   1 
ATOM   706  C  CB  . GLU A 1 102 ? 55.824 32.446 34.426 1.00 40.05 ? 390  GLU A CB  1 
ATOM   707  C  CG  . GLU A 1 102 ? 54.756 32.349 35.527 1.00 38.73 ? 390  GLU A CG  1 
ATOM   708  C  CD  . GLU A 1 102 ? 53.688 33.444 35.470 1.00 39.40 ? 390  GLU A CD  1 
ATOM   709  O  OE1 . GLU A 1 102 ? 53.635 34.196 34.486 1.00 37.54 ? 390  GLU A OE1 1 
ATOM   710  O  OE2 . GLU A 1 102 ? 52.888 33.551 36.432 1.00 52.41 ? 390  GLU A OE2 1 
ATOM   711  N  N   . LEU A 1 103 ? 57.486 30.469 32.422 1.00 33.18 ? 391  LEU A N   1 
ATOM   712  C  CA  . LEU A 1 103 ? 57.972 30.510 31.068 1.00 34.62 ? 391  LEU A CA  1 
ATOM   713  C  C   . LEU A 1 103 ? 56.980 31.344 30.265 1.00 34.86 ? 391  LEU A C   1 
ATOM   714  O  O   . LEU A 1 103 ? 55.792 31.044 30.255 1.00 31.85 ? 391  LEU A O   1 
ATOM   715  C  CB  . LEU A 1 103 ? 58.096 29.085 30.476 1.00 32.94 ? 391  LEU A CB  1 
ATOM   716  C  CG  . LEU A 1 103 ? 58.510 28.978 28.994 1.00 35.84 ? 391  LEU A CG  1 
ATOM   717  C  CD1 . LEU A 1 103 ? 59.942 29.561 28.686 1.00 26.39 ? 391  LEU A CD1 1 
ATOM   718  C  CD2 . LEU A 1 103 ? 58.398 27.530 28.537 1.00 35.41 ? 391  LEU A CD2 1 
ATOM   719  N  N   . TRP A 1 104 ? 57.469 32.416 29.632 1.00 36.37 ? 392  TRP A N   1 
ATOM   720  C  CA  . TRP A 1 104 ? 56.677 33.167 28.671 1.00 36.09 ? 392  TRP A CA  1 
ATOM   721  C  C   . TRP A 1 104 ? 57.179 32.915 27.256 1.00 36.35 ? 392  TRP A C   1 
ATOM   722  O  O   . TRP A 1 104 ? 58.362 33.050 26.986 1.00 35.07 ? 392  TRP A O   1 
ATOM   723  C  CB  . TRP A 1 104 ? 56.736 34.668 28.939 1.00 37.01 ? 392  TRP A CB  1 
ATOM   724  C  CG  . TRP A 1 104 ? 56.063 35.131 30.176 1.00 34.91 ? 392  TRP A CG  1 
ATOM   725  C  CD1 . TRP A 1 104 ? 55.711 34.388 31.253 1.00 37.45 ? 392  TRP A CD1 1 
ATOM   726  C  CD2 . TRP A 1 104 ? 55.726 36.477 30.490 1.00 34.13 ? 392  TRP A CD2 1 
ATOM   727  N  NE1 . TRP A 1 104 ? 55.153 35.182 32.218 1.00 36.00 ? 392  TRP A NE1 1 
ATOM   728  C  CE2 . TRP A 1 104 ? 55.154 36.475 31.774 1.00 37.82 ? 392  TRP A CE2 1 
ATOM   729  C  CE3 . TRP A 1 104 ? 55.857 37.693 29.808 1.00 38.61 ? 392  TRP A CE3 1 
ATOM   730  C  CZ2 . TRP A 1 104 ? 54.699 37.638 32.389 1.00 40.67 ? 392  TRP A CZ2 1 
ATOM   731  C  CZ3 . TRP A 1 104 ? 55.422 38.848 30.426 1.00 38.25 ? 392  TRP A CZ3 1 
ATOM   732  C  CH2 . TRP A 1 104 ? 54.848 38.814 31.702 1.00 40.41 ? 392  TRP A CH2 1 
ATOM   733  N  N   . VAL A 1 105 ? 56.266 32.567 26.355 1.00 37.35 ? 393  VAL A N   1 
ATOM   734  C  CA  . VAL A 1 105 ? 56.588 32.462 24.935 1.00 38.98 ? 393  VAL A CA  1 
ATOM   735  C  C   . VAL A 1 105 ? 55.798 33.538 24.169 1.00 38.40 ? 393  VAL A C   1 
ATOM   736  O  O   . VAL A 1 105 ? 54.583 33.673 24.319 1.00 37.49 ? 393  VAL A O   1 
ATOM   737  C  CB  . VAL A 1 105 ? 56.310 31.047 24.407 1.00 39.84 ? 393  VAL A CB  1 
ATOM   738  C  CG1 . VAL A 1 105 ? 56.658 30.966 22.970 1.00 43.49 ? 393  VAL A CG1 1 
ATOM   739  C  CG2 . VAL A 1 105 ? 57.136 30.001 25.207 1.00 42.90 ? 393  VAL A CG2 1 
ATOM   740  N  N   . VAL A 1 106 ? 56.514 34.329 23.385 1.00 39.57 ? 394  VAL A N   1 
ATOM   741  C  CA  . VAL A 1 106 ? 55.935 35.439 22.650 1.00 39.45 ? 394  VAL A CA  1 
ATOM   742  C  C   . VAL A 1 106 ? 55.789 35.027 21.189 1.00 40.13 ? 394  VAL A C   1 
ATOM   743  O  O   . VAL A 1 106 ? 56.752 34.682 20.536 1.00 41.83 ? 394  VAL A O   1 
ATOM   744  C  CB  . VAL A 1 106 ? 56.795 36.706 22.783 1.00 38.75 ? 394  VAL A CB  1 
ATOM   745  C  CG1 . VAL A 1 106 ? 56.083 37.904 22.155 1.00 34.76 ? 394  VAL A CG1 1 
ATOM   746  C  CG2 . VAL A 1 106 ? 57.150 36.945 24.266 1.00 31.61 ? 394  VAL A CG2 1 
ATOM   747  N  N   . MET A 1 107 ? 54.560 35.054 20.699 1.00 40.45 ? 395  MET A N   1 
ATOM   748  C  CA  . MET A 1 107 ? 54.226 34.537 19.393 1.00 41.17 ? 395  MET A CA  1 
ATOM   749  C  C   . MET A 1 107 ? 53.389 35.529 18.625 1.00 38.53 ? 395  MET A C   1 
ATOM   750  O  O   . MET A 1 107 ? 52.842 36.473 19.192 1.00 40.43 ? 395  MET A O   1 
ATOM   751  C  CB  . MET A 1 107 ? 53.404 33.271 19.560 1.00 40.14 ? 395  MET A CB  1 
ATOM   752  C  CG  . MET A 1 107 ? 54.193 32.149 20.162 1.00 48.28 ? 395  MET A CG  1 
ATOM   753  S  SD  . MET A 1 107 ? 53.049 30.976 20.777 1.00 49.39 ? 395  MET A SD  1 
ATOM   754  C  CE  . MET A 1 107 ? 52.239 31.890 22.103 1.00 50.18 ? 395  MET A CE  1 
ATOM   755  N  N   . GLU A 1 108 ? 53.258 35.280 17.333 1.00 36.10 ? 396  GLU A N   1 
ATOM   756  C  CA  . GLU A 1 108 ? 52.360 36.063 16.518 1.00 36.17 ? 396  GLU A CA  1 
ATOM   757  C  C   . GLU A 1 108 ? 50.917 35.930 17.013 1.00 34.59 ? 396  GLU A C   1 
ATOM   758  O  O   . GLU A 1 108 ? 50.513 34.867 17.485 1.00 32.76 ? 396  GLU A O   1 
ATOM   759  C  CB  . GLU A 1 108 ? 52.473 35.669 15.041 1.00 34.01 ? 396  GLU A CB  1 
ATOM   760  C  CG  . GLU A 1 108 ? 52.061 34.254 14.744 1.00 35.28 ? 396  GLU A CG  1 
ATOM   761  C  CD  . GLU A 1 108 ? 52.052 33.957 13.257 1.00 35.35 ? 396  GLU A CD  1 
ATOM   762  O  OE1 . GLU A 1 108 ? 51.875 34.904 12.462 1.00 40.71 ? 396  GLU A OE1 1 
ATOM   763  O  OE2 . GLU A 1 108 ? 52.217 32.774 12.892 1.00 34.71 ? 396  GLU A OE2 1 
ATOM   764  N  N   . PHE A 1 109 ? 50.176 37.037 16.901 1.00 32.32 ? 397  PHE A N   1 
ATOM   765  C  CA  . PHE A 1 109 ? 48.747 37.087 17.177 1.00 32.18 ? 397  PHE A CA  1 
ATOM   766  C  C   . PHE A 1 109 ? 47.988 36.779 15.897 1.00 31.86 ? 397  PHE A C   1 
ATOM   767  O  O   . PHE A 1 109 ? 48.247 37.377 14.851 1.00 31.34 ? 397  PHE A O   1 
ATOM   768  C  CB  . PHE A 1 109 ? 48.343 38.460 17.727 1.00 32.74 ? 397  PHE A CB  1 
ATOM   769  C  CG  . PHE A 1 109 ? 46.866 38.592 18.026 1.00 33.36 ? 397  PHE A CG  1 
ATOM   770  C  CD1 . PHE A 1 109 ? 46.257 37.765 18.955 1.00 34.81 ? 397  PHE A CD1 1 
ATOM   771  C  CD2 . PHE A 1 109 ? 46.103 39.564 17.399 1.00 32.08 ? 397  PHE A CD2 1 
ATOM   772  C  CE1 . PHE A 1 109 ? 44.910 37.887 19.236 1.00 36.67 ? 397  PHE A CE1 1 
ATOM   773  C  CE2 . PHE A 1 109 ? 44.761 39.688 17.664 1.00 31.25 ? 397  PHE A CE2 1 
ATOM   774  C  CZ  . PHE A 1 109 ? 44.160 38.851 18.590 1.00 36.01 ? 397  PHE A CZ  1 
ATOM   775  N  N   . LEU A 1 110 ? 47.066 35.821 15.988 1.00 32.26 ? 398  LEU A N   1 
ATOM   776  C  CA  . LEU A 1 110 ? 46.217 35.449 14.865 1.00 32.43 ? 398  LEU A CA  1 
ATOM   777  C  C   . LEU A 1 110 ? 44.812 35.942 15.160 1.00 32.24 ? 398  LEU A C   1 
ATOM   778  O  O   . LEU A 1 110 ? 44.200 35.512 16.112 1.00 30.73 ? 398  LEU A O   1 
ATOM   779  C  CB  . LEU A 1 110 ? 46.258 33.936 14.627 1.00 32.72 ? 398  LEU A CB  1 
ATOM   780  C  CG  . LEU A 1 110 ? 47.571 33.424 13.989 1.00 35.52 ? 398  LEU A CG  1 
ATOM   781  C  CD1 . LEU A 1 110 ? 48.520 32.860 15.010 1.00 36.03 ? 398  LEU A CD1 1 
ATOM   782  C  CD2 . LEU A 1 110 ? 47.275 32.342 12.973 1.00 42.77 ? 398  LEU A CD2 1 
ATOM   783  N  N   . GLU A 1 111 ? 44.314 36.848 14.320 1.00 33.32 ? 399  GLU A N   1 
ATOM   784  C  CA  . GLU A 1 111 ? 43.087 37.587 14.591 1.00 35.23 ? 399  GLU A CA  1 
ATOM   785  C  C   . GLU A 1 111 ? 41.811 36.755 14.437 1.00 35.48 ? 399  GLU A C   1 
ATOM   786  O  O   . GLU A 1 111 ? 40.775 37.113 15.006 1.00 34.74 ? 399  GLU A O   1 
ATOM   787  C  CB  . GLU A 1 111 ? 43.000 38.805 13.672 1.00 32.86 ? 399  GLU A CB  1 
ATOM   788  C  CG  . GLU A 1 111 ? 44.198 39.713 13.786 1.00 39.51 ? 399  GLU A CG  1 
ATOM   789  C  CD  . GLU A 1 111 ? 44.072 41.003 12.989 1.00 37.94 ? 399  GLU A CD  1 
ATOM   790  O  OE1 . GLU A 1 111 ? 43.015 41.250 12.364 1.00 39.06 ? 399  GLU A OE1 1 
ATOM   791  O  OE2 . GLU A 1 111 ? 45.053 41.774 13.005 1.00 51.53 ? 399  GLU A OE2 1 
ATOM   792  N  N   . GLY A 1 112 ? 41.890 35.663 13.676 1.00 35.27 ? 400  GLY A N   1 
ATOM   793  C  CA  . GLY A 1 112 ? 40.730 34.838 13.385 1.00 36.16 ? 400  GLY A CA  1 
ATOM   794  C  C   . GLY A 1 112 ? 40.350 33.857 14.465 1.00 36.11 ? 400  GLY A C   1 
ATOM   795  O  O   . GLY A 1 112 ? 39.367 33.143 14.335 1.00 38.47 ? 400  GLY A O   1 
ATOM   796  N  N   . GLY A 1 113 ? 41.157 33.773 15.512 1.00 37.01 ? 401  GLY A N   1 
ATOM   797  C  CA  . GLY A 1 113 ? 40.890 32.870 16.606 1.00 34.14 ? 401  GLY A CA  1 
ATOM   798  C  C   . GLY A 1 113 ? 41.016 31.411 16.246 1.00 31.84 ? 401  GLY A C   1 
ATOM   799  O  O   . GLY A 1 113 ? 41.661 31.069 15.260 1.00 29.85 ? 401  GLY A O   1 
ATOM   800  N  N   . ALA A 1 114 ? 40.364 30.563 17.052 1.00 30.99 ? 402  ALA A N   1 
ATOM   801  C  CA  . ALA A 1 114 ? 40.461 29.112 16.939 1.00 31.94 ? 402  ALA A CA  1 
ATOM   802  C  C   . ALA A 1 114 ? 39.327 28.512 16.105 1.00 32.11 ? 402  ALA A C   1 
ATOM   803  O  O   . ALA A 1 114 ? 38.260 29.077 15.987 1.00 33.76 ? 402  ALA A O   1 
ATOM   804  C  CB  . ALA A 1 114 ? 40.475 28.496 18.305 1.00 29.82 ? 402  ALA A CB  1 
ATOM   805  N  N   . LEU A 1 115 ? 39.582 27.344 15.541 1.00 31.32 ? 403  LEU A N   1 
ATOM   806  C  CA  . LEU A 1 115 ? 38.594 26.625 14.781 1.00 30.14 ? 403  LEU A CA  1 
ATOM   807  C  C   . LEU A 1 115 ? 37.424 26.167 15.636 1.00 28.86 ? 403  LEU A C   1 
ATOM   808  O  O   . LEU A 1 115 ? 36.337 26.013 15.112 1.00 28.21 ? 403  LEU A O   1 
ATOM   809  C  CB  . LEU A 1 115 ? 39.254 25.434 14.090 1.00 33.40 ? 403  LEU A CB  1 
ATOM   810  C  CG  . LEU A 1 115 ? 38.464 24.609 13.079 1.00 32.13 ? 403  LEU A CG  1 
ATOM   811  C  CD1 . LEU A 1 115 ? 38.097 25.454 11.873 1.00 26.11 ? 403  LEU A CD1 1 
ATOM   812  C  CD2 . LEU A 1 115 ? 39.284 23.407 12.684 1.00 28.87 ? 403  LEU A CD2 1 
ATOM   813  N  N   . THR A 1 116 ? 37.634 25.953 16.946 1.00 30.36 ? 404  THR A N   1 
ATOM   814  C  CA  . THR A 1 116 ? 36.565 25.508 17.859 1.00 29.65 ? 404  THR A CA  1 
ATOM   815  C  C   . THR A 1 116 ? 35.329 26.374 17.744 1.00 31.02 ? 404  THR A C   1 
ATOM   816  O  O   . THR A 1 116 ? 34.194 25.890 17.733 1.00 30.24 ? 404  THR A O   1 
ATOM   817  C  CB  . THR A 1 116 ? 37.020 25.516 19.339 1.00 31.73 ? 404  THR A CB  1 
ATOM   818  O  OG1 . THR A 1 116 ? 38.213 24.742 19.460 1.00 33.48 ? 404  THR A OG1 1 
ATOM   819  C  CG2 . THR A 1 116 ? 35.924 24.902 20.278 1.00 26.59 ? 404  THR A CG2 1 
ATOM   820  N  N   . ASP A 1 117 ? 35.555 27.674 17.660 1.00 34.15 ? 405  ASP A N   1 
ATOM   821  C  CA  . ASP A 1 117 ? 34.474 28.631 17.599 1.00 33.18 ? 405  ASP A CA  1 
ATOM   822  C  C   . ASP A 1 117 ? 33.722 28.523 16.264 1.00 34.81 ? 405  ASP A C   1 
ATOM   823  O  O   . ASP A 1 117 ? 32.506 28.679 16.212 1.00 33.65 ? 405  ASP A O   1 
ATOM   824  C  CB  . ASP A 1 117 ? 35.051 30.015 17.810 1.00 35.24 ? 405  ASP A CB  1 
ATOM   825  C  CG  . ASP A 1 117 ? 33.976 31.079 18.005 1.00 38.55 ? 405  ASP A CG  1 
ATOM   826  O  OD1 . ASP A 1 117 ? 33.197 30.992 18.983 1.00 43.15 ? 405  ASP A OD1 1 
ATOM   827  O  OD2 . ASP A 1 117 ? 33.939 32.003 17.182 1.00 41.45 ? 405  ASP A OD2 1 
ATOM   828  N  N   . ILE A 1 118 ? 34.433 28.234 15.179 1.00 34.55 ? 406  ILE A N   1 
ATOM   829  C  CA  . ILE A 1 118 ? 33.755 27.959 13.913 1.00 33.06 ? 406  ILE A CA  1 
ATOM   830  C  C   . ILE A 1 118 ? 32.870 26.680 14.034 1.00 34.70 ? 406  ILE A C   1 
ATOM   831  O  O   . ILE A 1 118 ? 31.667 26.705 13.745 1.00 32.81 ? 406  ILE A O   1 
ATOM   832  C  CB  . ILE A 1 118 ? 34.759 27.856 12.735 1.00 34.12 ? 406  ILE A CB  1 
ATOM   833  C  CG1 . ILE A 1 118 ? 35.296 29.250 12.398 1.00 30.25 ? 406  ILE A CG1 1 
ATOM   834  C  CG2 . ILE A 1 118 ? 34.104 27.221 11.503 1.00 29.65 ? 406  ILE A CG2 1 
ATOM   835  C  CD1 . ILE A 1 118 ? 36.439 29.250 11.412 1.00 27.91 ? 406  ILE A CD1 1 
ATOM   836  N  N   . VAL A 1 119 ? 33.448 25.581 14.492 1.00 34.53 ? 407  VAL A N   1 
ATOM   837  C  CA  . VAL A 1 119 ? 32.738 24.290 14.433 1.00 33.77 ? 407  VAL A CA  1 
ATOM   838  C  C   . VAL A 1 119 ? 31.508 24.204 15.359 1.00 34.12 ? 407  VAL A C   1 
ATOM   839  O  O   . VAL A 1 119 ? 30.565 23.485 15.053 1.00 33.96 ? 407  VAL A O   1 
ATOM   840  C  CB  . VAL A 1 119 ? 33.702 23.080 14.651 1.00 34.24 ? 407  VAL A CB  1 
ATOM   841  C  CG1 . VAL A 1 119 ? 34.903 23.180 13.716 1.00 27.47 ? 407  VAL A CG1 1 
ATOM   842  C  CG2 . VAL A 1 119 ? 34.132 22.974 16.111 1.00 31.35 ? 407  VAL A CG2 1 
ATOM   843  N  N   . THR A 1 120 ? 31.514 24.953 16.464 1.00 35.93 ? 408  THR A N   1 
ATOM   844  C  CA  . THR A 1 120 ? 30.422 24.951 17.421 1.00 35.75 ? 408  THR A CA  1 
ATOM   845  C  C   . THR A 1 120 ? 29.315 25.937 17.043 1.00 35.64 ? 408  THR A C   1 
ATOM   846  O  O   . THR A 1 120 ? 28.214 25.849 17.579 1.00 37.30 ? 408  THR A O   1 
ATOM   847  C  CB  . THR A 1 120 ? 30.927 25.246 18.864 1.00 36.92 ? 408  THR A CB  1 
ATOM   848  O  OG1 . THR A 1 120 ? 31.494 26.549 18.918 1.00 44.18 ? 408  THR A OG1 1 
ATOM   849  C  CG2 . THR A 1 120 ? 32.011 24.248 19.290 1.00 34.45 ? 408  THR A CG2 1 
ATOM   850  N  N   . HIS A 1 121 ? 29.581 26.858 16.118 1.00 34.44 ? 409  HIS A N   1 
ATOM   851  C  CA  . HIS A 1 121 ? 28.618 27.910 15.778 1.00 34.59 ? 409  HIS A CA  1 
ATOM   852  C  C   . HIS A 1 121 ? 28.135 27.930 14.327 1.00 36.29 ? 409  HIS A C   1 
ATOM   853  O  O   . HIS A 1 121 ? 27.183 28.632 14.007 1.00 39.63 ? 409  HIS A O   1 
ATOM   854  C  CB  . HIS A 1 121 ? 29.210 29.278 16.112 1.00 35.69 ? 409  HIS A CB  1 
ATOM   855  C  CG  . HIS A 1 121 ? 29.423 29.496 17.578 1.00 42.38 ? 409  HIS A CG  1 
ATOM   856  N  ND1 . HIS A 1 121 ? 28.403 29.874 18.426 1.00 47.59 ? 409  HIS A ND1 1 
ATOM   857  C  CD2 . HIS A 1 121 ? 30.530 29.383 18.348 1.00 38.19 ? 409  HIS A CD2 1 
ATOM   858  C  CE1 . HIS A 1 121 ? 28.874 29.979 19.654 1.00 48.27 ? 409  HIS A CE1 1 
ATOM   859  N  NE2 . HIS A 1 121 ? 30.162 29.691 19.632 1.00 43.08 ? 409  HIS A NE2 1 
ATOM   860  N  N   . THR A 1 122 ? 28.804 27.212 13.442 1.00 35.19 ? 410  THR A N   1 
ATOM   861  C  CA  . THR A 1 122 ? 28.479 27.241 12.027 1.00 34.53 ? 410  THR A CA  1 
ATOM   862  C  C   . THR A 1 122 ? 28.606 25.830 11.514 1.00 34.35 ? 410  THR A C   1 
ATOM   863  O  O   . THR A 1 122 ? 29.149 24.962 12.209 1.00 35.45 ? 410  THR A O   1 
ATOM   864  C  CB  . THR A 1 122 ? 29.432 28.195 11.208 1.00 36.66 ? 410  THR A CB  1 
ATOM   865  O  OG1 . THR A 1 122 ? 30.714 27.589 11.001 1.00 39.15 ? 410  THR A OG1 1 
ATOM   866  C  CG2 . THR A 1 122 ? 29.638 29.484 11.910 1.00 32.97 ? 410  THR A CG2 1 
ATOM   867  N  N   . ARG A 1 123 ? 28.097 25.603 10.308 1.00 36.17 ? 411  ARG A N   1 
ATOM   868  C  CA  . ARG A 1 123 ? 28.340 24.358 9.559  1.00 36.33 ? 411  ARG A CA  1 
ATOM   869  C  C   . ARG A 1 123 ? 29.299 24.649 8.407  1.00 34.28 ? 411  ARG A C   1 
ATOM   870  O  O   . ARG A 1 123 ? 28.950 25.380 7.485  1.00 34.79 ? 411  ARG A O   1 
ATOM   871  C  CB  . ARG A 1 123 ? 27.029 23.777 9.015  1.00 36.49 ? 411  ARG A CB  1 
ATOM   872  C  CG  . ARG A 1 123 ? 26.207 22.975 10.036 1.00 41.31 ? 411  ARG A CG  1 
ATOM   873  N  N   . MET A 1 124 ? 30.511 24.101 8.482  1.00 32.00 ? 412  MET A N   1 
ATOM   874  C  CA  . MET A 1 124 ? 31.496 24.204 7.408  1.00 30.44 ? 412  MET A CA  1 
ATOM   875  C  C   . MET A 1 124 ? 31.088 23.364 6.183  1.00 31.43 ? 412  MET A C   1 
ATOM   876  O  O   . MET A 1 124 ? 30.555 22.276 6.323  1.00 31.05 ? 412  MET A O   1 
ATOM   877  C  CB  . MET A 1 124 ? 32.850 23.719 7.907  1.00 32.66 ? 412  MET A CB  1 
ATOM   878  C  CG  . MET A 1 124 ? 33.446 24.588 8.992  1.00 32.65 ? 412  MET A CG  1 
ATOM   879  S  SD  . MET A 1 124 ? 34.989 23.963 9.623  1.00 30.92 ? 412  MET A SD  1 
ATOM   880  C  CE  . MET A 1 124 ? 36.120 24.345 8.283  1.00 24.81 ? 412  MET A CE  1 
ATOM   881  N  N   . ASN A 1 125 ? 31.310 23.879 4.978  1.00 30.44 ? 413  ASN A N   1 
ATOM   882  C  CA  . ASN A 1 125 ? 31.121 23.048 3.796  1.00 29.55 ? 413  ASN A CA  1 
ATOM   883  C  C   . ASN A 1 125 ? 32.420 22.275 3.537  1.00 27.59 ? 413  ASN A C   1 
ATOM   884  O  O   . ASN A 1 125 ? 33.403 22.440 4.260  1.00 30.12 ? 413  ASN A O   1 
ATOM   885  C  CB  . ASN A 1 125 ? 30.598 23.859 2.577  1.00 29.08 ? 413  ASN A CB  1 
ATOM   886  C  CG  . ASN A 1 125 ? 31.537 24.965 2.153  1.00 27.63 ? 413  ASN A CG  1 
ATOM   887  O  OD1 . ASN A 1 125 ? 32.758 24.817 2.204  1.00 33.11 ? 413  ASN A OD1 1 
ATOM   888  N  ND2 . ASN A 1 125 ? 30.974 26.081 1.723  1.00 23.62 ? 413  ASN A ND2 1 
ATOM   889  N  N   . GLU A 1 126 ? 32.421 21.413 2.532  1.00 29.17 ? 414  GLU A N   1 
ATOM   890  C  CA  . GLU A 1 126 ? 33.548 20.509 2.295  1.00 29.11 ? 414  GLU A CA  1 
ATOM   891  C  C   . GLU A 1 126 ? 34.774 21.187 1.712  1.00 29.91 ? 414  GLU A C   1 
ATOM   892  O  O   . GLU A 1 126 ? 35.902 20.772 1.959  1.00 31.92 ? 414  GLU A O   1 
ATOM   893  C  CB  . GLU A 1 126 ? 33.108 19.355 1.423  1.00 29.44 ? 414  GLU A CB  1 
ATOM   894  C  CG  . GLU A 1 126 ? 32.053 18.504 2.111  1.00 28.25 ? 414  GLU A CG  1 
ATOM   895  C  CD  . GLU A 1 126 ? 31.930 17.126 1.523  1.00 31.73 ? 414  GLU A CD  1 
ATOM   896  O  OE1 . GLU A 1 126 ? 32.717 16.772 0.615  1.00 36.40 ? 414  GLU A OE1 1 
ATOM   897  O  OE2 . GLU A 1 126 ? 31.043 16.391 1.989  1.00 33.12 ? 414  GLU A OE2 1 
ATOM   898  N  N   . GLU A 1 127 ? 34.543 22.242 0.959  1.00 29.68 ? 415  GLU A N   1 
ATOM   899  C  CA  . GLU A 1 127 ? 35.602 23.126 0.493  1.00 31.46 ? 415  GLU A CA  1 
ATOM   900  C  C   . GLU A 1 127 ? 36.370 23.723 1.672  1.00 30.54 ? 415  GLU A C   1 
ATOM   901  O  O   . GLU A 1 127 ? 37.594 23.715 1.695  1.00 33.66 ? 415  GLU A O   1 
ATOM   902  C  CB  . GLU A 1 127 ? 34.960 24.230 -0.355 1.00 32.32 ? 415  GLU A CB  1 
ATOM   903  C  CG  . GLU A 1 127 ? 35.861 25.364 -0.748 1.00 39.71 ? 415  GLU A CG  1 
ATOM   904  C  CD  . GLU A 1 127 ? 35.118 26.502 -1.438 1.00 35.88 ? 415  GLU A CD  1 
ATOM   905  O  OE1 . GLU A 1 127 ? 33.865 26.527 -1.419 1.00 42.52 ? 415  GLU A OE1 1 
ATOM   906  O  OE2 . GLU A 1 127 ? 35.807 27.378 -1.992 1.00 39.27 ? 415  GLU A OE2 1 
ATOM   907  N  N   . GLN A 1 128 ? 35.644 24.222 2.661  1.00 30.76 ? 416  GLN A N   1 
ATOM   908  C  CA  . GLN A 1 128 ? 36.246 24.754 3.878  1.00 30.59 ? 416  GLN A CA  1 
ATOM   909  C  C   . GLN A 1 128 ? 36.915 23.648 4.725  1.00 29.30 ? 416  GLN A C   1 
ATOM   910  O  O   . GLN A 1 128 ? 38.039 23.801 5.194  1.00 30.16 ? 416  GLN A O   1 
ATOM   911  C  CB  . GLN A 1 128 ? 35.195 25.531 4.678  1.00 32.51 ? 416  GLN A CB  1 
ATOM   912  C  CG  . GLN A 1 128 ? 34.639 26.762 3.948  1.00 31.81 ? 416  GLN A CG  1 
ATOM   913  C  CD  . GLN A 1 128 ? 33.365 27.337 4.570  1.00 32.79 ? 416  GLN A CD  1 
ATOM   914  O  OE1 . GLN A 1 128 ? 32.568 26.606 5.160  1.00 38.43 ? 416  GLN A OE1 1 
ATOM   915  N  NE2 . GLN A 1 128 ? 33.148 28.656 4.395  1.00 23.06 ? 416  GLN A NE2 1 
ATOM   916  N  N   . ILE A 1 129 ? 36.242 22.519 4.886  1.00 30.33 ? 417  ILE A N   1 
ATOM   917  C  CA  . ILE A 1 129 ? 36.823 21.371 5.593  1.00 29.37 ? 417  ILE A CA  1 
ATOM   918  C  C   . ILE A 1 129 ? 38.116 20.893 4.916  1.00 29.83 ? 417  ILE A C   1 
ATOM   919  O  O   . ILE A 1 129 ? 39.104 20.664 5.605  1.00 30.98 ? 417  ILE A O   1 
ATOM   920  C  CB  . ILE A 1 129 ? 35.799 20.185 5.709  1.00 28.68 ? 417  ILE A CB  1 
ATOM   921  C  CG1 . ILE A 1 129 ? 34.629 20.555 6.617  1.00 28.35 ? 417  ILE A CG1 1 
ATOM   922  C  CG2 . ILE A 1 129 ? 36.450 18.915 6.225  1.00 29.30 ? 417  ILE A CG2 1 
ATOM   923  C  CD1 . ILE A 1 129 ? 33.448 19.574 6.489  1.00 26.29 ? 417  ILE A CD1 1 
ATOM   924  N  N   . ALA A 1 130 ? 38.095 20.725 3.586  1.00 30.73 ? 418  ALA A N   1 
ATOM   925  C  CA  . ALA A 1 130 ? 39.289 20.329 2.804  1.00 30.62 ? 418  ALA A CA  1 
ATOM   926  C  C   . ALA A 1 130 ? 40.476 21.303 2.953  1.00 32.06 ? 418  ALA A C   1 
ATOM   927  O  O   . ALA A 1 130 ? 41.629 20.876 3.044  1.00 34.15 ? 418  ALA A O   1 
ATOM   928  C  CB  . ALA A 1 130 ? 38.929 20.172 1.315  1.00 29.14 ? 418  ALA A CB  1 
ATOM   929  N  N   . ALA A 1 131 ? 40.189 22.606 2.960  1.00 31.44 ? 419  ALA A N   1 
ATOM   930  C  CA  . ALA A 1 131 ? 41.230 23.627 3.127  1.00 31.35 ? 419  ALA A CA  1 
ATOM   931  C  C   . ALA A 1 131 ? 41.910 23.521 4.502  1.00 31.67 ? 419  ALA A C   1 
ATOM   932  O  O   . ALA A 1 131 ? 43.134 23.652 4.609  1.00 29.71 ? 419  ALA A O   1 
ATOM   933  C  CB  . ALA A 1 131 ? 40.636 25.035 2.928  1.00 30.78 ? 419  ALA A CB  1 
ATOM   934  N  N   . VAL A 1 132 ? 41.107 23.287 5.545  1.00 31.54 ? 420  VAL A N   1 
ATOM   935  C  CA  . VAL A 1 132 ? 41.639 23.088 6.893  1.00 30.73 ? 420  VAL A CA  1 
ATOM   936  C  C   . VAL A 1 132 ? 42.468 21.804 6.973  1.00 30.74 ? 420  VAL A C   1 
ATOM   937  O  O   . VAL A 1 132 ? 43.576 21.844 7.487  1.00 32.30 ? 420  VAL A O   1 
ATOM   938  C  CB  . VAL A 1 132 ? 40.537 23.119 7.976  1.00 31.96 ? 420  VAL A CB  1 
ATOM   939  C  CG1 . VAL A 1 132 ? 41.111 22.747 9.371  1.00 32.23 ? 420  VAL A CG1 1 
ATOM   940  C  CG2 . VAL A 1 132 ? 39.850 24.505 8.012  1.00 26.25 ? 420  VAL A CG2 1 
ATOM   941  N  N   . CYS A 1 133 ? 41.968 20.683 6.447  1.00 30.51 ? 421  CYS A N   1 
ATOM   942  C  CA  . CYS A 1 133 ? 42.752 19.443 6.448  1.00 32.73 ? 421  CYS A CA  1 
ATOM   943  C  C   . CYS A 1 133 ? 44.042 19.546 5.628  1.00 31.94 ? 421  CYS A C   1 
ATOM   944  O  O   . CYS A 1 133 ? 45.051 19.003 6.020  1.00 34.08 ? 421  CYS A O   1 
ATOM   945  C  CB  . CYS A 1 133 ? 41.933 18.260 5.917  1.00 33.48 ? 421  CYS A CB  1 
ATOM   946  S  SG  . CYS A 1 133 ? 40.500 17.879 6.885  1.00 34.19 ? 421  CYS A SG  1 
ATOM   947  N  N   . LEU A 1 134 ? 43.986 20.196 4.472  1.00 33.70 ? 422  LEU A N   1 
ATOM   948  C  CA  . LEU A 1 134 ? 45.167 20.395 3.615  1.00 33.82 ? 422  LEU A CA  1 
ATOM   949  C  C   . LEU A 1 134 ? 46.284 21.124 4.364  1.00 35.11 ? 422  LEU A C   1 
ATOM   950  O  O   . LEU A 1 134 ? 47.421 20.669 4.406  1.00 36.15 ? 422  LEU A O   1 
ATOM   951  C  CB  . LEU A 1 134 ? 44.778 21.215 2.370  1.00 33.75 ? 422  LEU A CB  1 
ATOM   952  C  CG  . LEU A 1 134 ? 45.881 21.518 1.342  1.00 34.57 ? 422  LEU A CG  1 
ATOM   953  C  CD1 . LEU A 1 134 ? 46.628 20.246 0.893  1.00 28.45 ? 422  LEU A CD1 1 
ATOM   954  C  CD2 . LEU A 1 134 ? 45.295 22.260 0.158  1.00 30.63 ? 422  LEU A CD2 1 
ATOM   955  N  N   . ALA A 1 135 ? 45.931 22.271 4.928  1.00 33.78 ? 423  ALA A N   1 
ATOM   956  C  CA  . ALA A 1 135 ? 46.820 23.059 5.764  1.00 33.07 ? 423  ALA A CA  1 
ATOM   957  C  C   . ALA A 1 135 ? 47.465 22.269 6.910  1.00 33.00 ? 423  ALA A C   1 
ATOM   958  O  O   . ALA A 1 135 ? 48.675 22.366 7.138  1.00 33.23 ? 423  ALA A O   1 
ATOM   959  C  CB  . ALA A 1 135 ? 46.058 24.252 6.322  1.00 28.75 ? 423  ALA A CB  1 
ATOM   960  N  N   . VAL A 1 136 ? 46.662 21.507 7.639  1.00 33.17 ? 424  VAL A N   1 
ATOM   961  C  CA  . VAL A 1 136 ? 47.152 20.748 8.797  1.00 32.23 ? 424  VAL A CA  1 
ATOM   962  C  C   . VAL A 1 136 ? 48.034 19.584 8.350  1.00 32.23 ? 424  VAL A C   1 
ATOM   963  O  O   . VAL A 1 136 ? 49.063 19.281 8.948  1.00 31.99 ? 424  VAL A O   1 
ATOM   964  C  CB  . VAL A 1 136 ? 45.971 20.200 9.644  1.00 33.42 ? 424  VAL A CB  1 
ATOM   965  C  CG1 . VAL A 1 136 ? 46.475 19.245 10.782 1.00 31.54 ? 424  VAL A CG1 1 
ATOM   966  C  CG2 . VAL A 1 136 ? 45.195 21.336 10.219 1.00 30.33 ? 424  VAL A CG2 1 
ATOM   967  N  N   . LEU A 1 137 ? 47.632 18.928 7.281  1.00 32.35 ? 425  LEU A N   1 
ATOM   968  C  CA  . LEU A 1 137 ? 48.429 17.816 6.760  1.00 31.66 ? 425  LEU A CA  1 
ATOM   969  C  C   . LEU A 1 137 ? 49.758 18.286 6.217  1.00 30.38 ? 425  LEU A C   1 
ATOM   970  O  O   . LEU A 1 137 ? 50.746 17.576 6.322  1.00 32.03 ? 425  LEU A O   1 
ATOM   971  C  CB  . LEU A 1 137 ? 47.640 17.049 5.701  1.00 31.53 ? 425  LEU A CB  1 
ATOM   972  C  CG  . LEU A 1 137 ? 46.592 16.112 6.287  1.00 33.66 ? 425  LEU A CG  1 
ATOM   973  C  CD1 . LEU A 1 137 ? 45.676 15.624 5.178  1.00 31.09 ? 425  LEU A CD1 1 
ATOM   974  C  CD2 . LEU A 1 137 ? 47.273 14.920 7.060  1.00 33.88 ? 425  LEU A CD2 1 
ATOM   975  N  N   . GLN A 1 138 ? 49.785 19.483 5.635  1.00 30.45 ? 426  GLN A N   1 
ATOM   976  C  CA  . GLN A 1 138 ? 51.045 20.087 5.190  1.00 31.82 ? 426  GLN A CA  1 
ATOM   977  C  C   . GLN A 1 138 ? 51.987 20.323 6.384  1.00 31.66 ? 426  GLN A C   1 
ATOM   978  O  O   . GLN A 1 138 ? 53.152 19.976 6.320  1.00 30.44 ? 426  GLN A O   1 
ATOM   979  C  CB  . GLN A 1 138 ? 50.790 21.397 4.406  1.00 30.65 ? 426  GLN A CB  1 
ATOM   980  C  CG  . GLN A 1 138 ? 50.313 21.160 2.963  1.00 31.57 ? 426  GLN A CG  1 
ATOM   981  C  CD  . GLN A 1 138 ? 49.775 22.409 2.272  1.00 36.03 ? 426  GLN A CD  1 
ATOM   982  O  OE1 . GLN A 1 138 ? 49.631 23.463 2.888  1.00 47.85 ? 426  GLN A OE1 1 
ATOM   983  N  NE2 . GLN A 1 138 ? 49.496 22.297 0.973  1.00 38.43 ? 426  GLN A NE2 1 
ATOM   984  N  N   . ALA A 1 139 ? 51.477 20.923 7.465  1.00 32.27 ? 427  ALA A N   1 
ATOM   985  C  CA  . ALA A 1 139 ? 52.279 21.134 8.671  1.00 31.27 ? 427  ALA A CA  1 
ATOM   986  C  C   . ALA A 1 139 ? 52.780 19.791 9.204  1.00 31.64 ? 427  ALA A C   1 
ATOM   987  O  O   . ALA A 1 139 ? 53.961 19.629 9.470  1.00 32.77 ? 427  ALA A O   1 
ATOM   988  C  CB  . ALA A 1 139 ? 51.476 21.864 9.745  1.00 28.39 ? 427  ALA A CB  1 
ATOM   989  N  N   . LEU A 1 140 ? 51.872 18.830 9.361  1.00 32.43 ? 428  LEU A N   1 
ATOM   990  C  CA  . LEU A 1 140 ? 52.215 17.553 9.969  1.00 30.00 ? 428  LEU A CA  1 
ATOM   991  C  C   . LEU A 1 140 ? 53.191 16.723 9.153  1.00 31.79 ? 428  LEU A C   1 
ATOM   992  O  O   . LEU A 1 140 ? 54.009 16.025 9.722  1.00 33.64 ? 428  LEU A O   1 
ATOM   993  C  CB  . LEU A 1 140 ? 50.972 16.735 10.218 1.00 31.35 ? 428  LEU A CB  1 
ATOM   994  C  CG  . LEU A 1 140 ? 50.009 17.217 11.286 1.00 28.90 ? 428  LEU A CG  1 
ATOM   995  C  CD1 . LEU A 1 140 ? 48.793 16.292 11.245 1.00 27.19 ? 428  LEU A CD1 1 
ATOM   996  C  CD2 . LEU A 1 140 ? 50.694 17.240 12.660 1.00 25.58 ? 428  LEU A CD2 1 
ATOM   997  N  N   . SER A 1 141 ? 53.108 16.763 7.832  1.00 32.25 ? 429  SER A N   1 
ATOM   998  C  CA  . SER A 1 141 ? 54.086 16.036 7.004  1.00 33.20 ? 429  SER A CA  1 
ATOM   999  C  C   . SER A 1 141 ? 55.514 16.524 7.251  1.00 33.30 ? 429  SER A C   1 
ATOM   1000 O  O   . SER A 1 141 ? 56.451 15.725 7.269  1.00 35.69 ? 429  SER A O   1 
ATOM   1001 C  CB  . SER A 1 141 ? 53.754 16.156 5.508  1.00 31.90 ? 429  SER A CB  1 
ATOM   1002 O  OG  . SER A 1 141 ? 53.808 17.517 5.100  1.00 36.36 ? 429  SER A OG  1 
ATOM   1003 N  N   . VAL A 1 142 ? 55.682 17.833 7.426  1.00 34.69 ? 430  VAL A N   1 
ATOM   1004 C  CA  . VAL A 1 142 ? 57.003 18.412 7.693  1.00 33.93 ? 430  VAL A CA  1 
ATOM   1005 C  C   . VAL A 1 142 ? 57.455 18.089 9.122  1.00 34.50 ? 430  VAL A C   1 
ATOM   1006 O  O   . VAL A 1 142 ? 58.591 17.665 9.341  1.00 38.10 ? 430  VAL A O   1 
ATOM   1007 C  CB  . VAL A 1 142 ? 57.024 19.944 7.424  1.00 35.47 ? 430  VAL A CB  1 
ATOM   1008 C  CG1 . VAL A 1 142 ? 58.357 20.567 7.864  1.00 28.46 ? 430  VAL A CG1 1 
ATOM   1009 C  CG2 . VAL A 1 142 ? 56.769 20.235 5.922  1.00 35.69 ? 430  VAL A CG2 1 
ATOM   1010 N  N   . LEU A 1 143 ? 56.566 18.255 10.093 1.00 33.83 ? 431  LEU A N   1 
ATOM   1011 C  CA  . LEU A 1 143 ? 56.891 17.887 11.479 1.00 33.52 ? 431  LEU A CA  1 
ATOM   1012 C  C   . LEU A 1 143 ? 57.187 16.387 11.641 1.00 30.62 ? 431  LEU A C   1 
ATOM   1013 O  O   . LEU A 1 143 ? 58.164 16.010 12.298 1.00 27.79 ? 431  LEU A O   1 
ATOM   1014 C  CB  . LEU A 1 143 ? 55.758 18.296 12.412 1.00 34.52 ? 431  LEU A CB  1 
ATOM   1015 C  CG  . LEU A 1 143 ? 55.522 19.808 12.526 1.00 37.94 ? 431  LEU A CG  1 
ATOM   1016 C  CD1 . LEU A 1 143 ? 54.198 20.036 13.188 1.00 36.76 ? 431  LEU A CD1 1 
ATOM   1017 C  CD2 . LEU A 1 143 ? 56.680 20.509 13.277 1.00 35.48 ? 431  LEU A CD2 1 
ATOM   1018 N  N   . HIS A 1 144 ? 56.359 15.547 11.025 1.00 28.91 ? 432  HIS A N   1 
ATOM   1019 C  CA  . HIS A 1 144 ? 56.463 14.094 11.183 1.00 29.58 ? 432  HIS A CA  1 
ATOM   1020 C  C   . HIS A 1 144 ? 57.742 13.531 10.586 1.00 29.85 ? 432  HIS A C   1 
ATOM   1021 O  O   . HIS A 1 144 ? 58.297 12.571 11.107 1.00 31.03 ? 432  HIS A O   1 
ATOM   1022 C  CB  . HIS A 1 144 ? 55.229 13.374 10.595 1.00 28.66 ? 432  HIS A CB  1 
ATOM   1023 C  CG  . HIS A 1 144 ? 53.987 13.521 11.430 1.00 29.04 ? 432  HIS A CG  1 
ATOM   1024 N  ND1 . HIS A 1 144 ? 52.775 12.966 11.073 1.00 32.78 ? 432  HIS A ND1 1 
ATOM   1025 C  CD2 . HIS A 1 144 ? 53.768 14.167 12.600 1.00 24.00 ? 432  HIS A CD2 1 
ATOM   1026 C  CE1 . HIS A 1 144 ? 51.870 13.251 11.994 1.00 28.79 ? 432  HIS A CE1 1 
ATOM   1027 N  NE2 . HIS A 1 144 ? 52.448 13.972 12.936 1.00 28.65 ? 432  HIS A NE2 1 
ATOM   1028 N  N   . ALA A 1 145 ? 58.204 14.149 9.501  1.00 32.58 ? 433  ALA A N   1 
ATOM   1029 C  CA  . ALA A 1 145 ? 59.416 13.754 8.802  1.00 31.94 ? 433  ALA A CA  1 
ATOM   1030 C  C   . ALA A 1 145 ? 60.650 13.990 9.667  1.00 32.80 ? 433  ALA A C   1 
ATOM   1031 O  O   . ALA A 1 145 ? 61.648 13.270 9.547  1.00 31.06 ? 433  ALA A O   1 
ATOM   1032 C  CB  . ALA A 1 145 ? 59.538 14.534 7.490  1.00 31.78 ? 433  ALA A CB  1 
ATOM   1033 N  N   . GLN A 1 146 ? 60.574 14.999 10.533 1.00 32.26 ? 434  GLN A N   1 
ATOM   1034 C  CA  . GLN A 1 146 ? 61.647 15.294 11.478 1.00 33.99 ? 434  GLN A CA  1 
ATOM   1035 C  C   . GLN A 1 146 ? 61.408 14.638 12.832 1.00 33.27 ? 434  GLN A C   1 
ATOM   1036 O  O   . GLN A 1 146 ? 62.087 14.953 13.795 1.00 33.35 ? 434  GLN A O   1 
ATOM   1037 C  CB  . GLN A 1 146 ? 61.805 16.809 11.635 1.00 35.08 ? 434  GLN A CB  1 
ATOM   1038 C  CG  . GLN A 1 146 ? 62.266 17.509 10.362 1.00 41.91 ? 434  GLN A CG  1 
ATOM   1039 C  CD  . GLN A 1 146 ? 63.578 16.956 9.843  1.00 50.45 ? 434  GLN A CD  1 
ATOM   1040 O  OE1 . GLN A 1 146 ? 63.659 16.536 8.689  1.00 58.14 ? 434  GLN A OE1 1 
ATOM   1041 N  NE2 . GLN A 1 146 ? 64.609 16.928 10.699 1.00 52.81 ? 434  GLN A NE2 1 
ATOM   1042 N  N   . GLY A 1 147 ? 60.446 13.720 12.894 1.00 34.06 ? 435  GLY A N   1 
ATOM   1043 C  CA  . GLY A 1 147 ? 60.124 12.986 14.114 1.00 34.05 ? 435  GLY A CA  1 
ATOM   1044 C  C   . GLY A 1 147 ? 59.316 13.721 15.173 1.00 34.22 ? 435  GLY A C   1 
ATOM   1045 O  O   . GLY A 1 147 ? 59.194 13.236 16.291 1.00 35.35 ? 435  GLY A O   1 
ATOM   1046 N  N   . VAL A 1 148 ? 58.749 14.875 14.836 1.00 34.64 ? 436  VAL A N   1 
ATOM   1047 C  CA  . VAL A 1 148 ? 57.965 15.650 15.801 1.00 34.00 ? 436  VAL A CA  1 
ATOM   1048 C  C   . VAL A 1 148 ? 56.523 15.194 15.781 1.00 33.46 ? 436  VAL A C   1 
ATOM   1049 O  O   . VAL A 1 148 ? 55.902 15.167 14.732 1.00 33.54 ? 436  VAL A O   1 
ATOM   1050 C  CB  . VAL A 1 148 ? 58.017 17.185 15.517 1.00 34.44 ? 436  VAL A CB  1 
ATOM   1051 C  CG1 . VAL A 1 148 ? 57.181 17.978 16.549 1.00 29.28 ? 436  VAL A CG1 1 
ATOM   1052 C  CG2 . VAL A 1 148 ? 59.460 17.681 15.497 1.00 27.23 ? 436  VAL A CG2 1 
ATOM   1053 N  N   . ILE A 1 149 ? 56.006 14.835 16.953 1.00 32.93 ? 437  ILE A N   1 
ATOM   1054 C  CA  . ILE A 1 149 ? 54.602 14.499 17.126 1.00 30.61 ? 437  ILE A CA  1 
ATOM   1055 C  C   . ILE A 1 149 ? 53.930 15.614 17.917 1.00 31.04 ? 437  ILE A C   1 
ATOM   1056 O  O   . ILE A 1 149 ? 54.377 15.956 19.011 1.00 29.88 ? 437  ILE A O   1 
ATOM   1057 C  CB  . ILE A 1 149 ? 54.386 13.203 17.918 1.00 31.16 ? 437  ILE A CB  1 
ATOM   1058 C  CG1 . ILE A 1 149 ? 55.348 12.101 17.474 1.00 29.11 ? 437  ILE A CG1 1 
ATOM   1059 C  CG2 . ILE A 1 149 ? 52.906 12.761 17.784 1.00 24.65 ? 437  ILE A CG2 1 
ATOM   1060 C  CD1 . ILE A 1 149 ? 55.409 10.875 18.431 1.00 26.90 ? 437  ILE A CD1 1 
ATOM   1061 N  N   . HIS A 1 150 ? 52.849 16.166 17.368 1.00 32.53 ? 438  HIS A N   1 
ATOM   1062 C  CA  . HIS A 1 150 ? 52.122 17.263 18.017 1.00 31.68 ? 438  HIS A CA  1 
ATOM   1063 C  C   . HIS A 1 150 ? 51.426 16.802 19.293 1.00 32.80 ? 438  HIS A C   1 
ATOM   1064 O  O   . HIS A 1 150 ? 51.585 17.439 20.346 1.00 34.53 ? 438  HIS A O   1 
ATOM   1065 C  CB  . HIS A 1 150 ? 51.121 17.887 17.047 1.00 31.94 ? 438  HIS A CB  1 
ATOM   1066 C  CG  . HIS A 1 150 ? 50.488 19.140 17.556 1.00 30.03 ? 438  HIS A CG  1 
ATOM   1067 N  ND1 . HIS A 1 150 ? 49.458 19.134 18.473 1.00 22.19 ? 438  HIS A ND1 1 
ATOM   1068 C  CD2 . HIS A 1 150 ? 50.741 20.439 17.281 1.00 32.86 ? 438  HIS A CD2 1 
ATOM   1069 C  CE1 . HIS A 1 150 ? 49.110 20.380 18.743 1.00 32.47 ? 438  HIS A CE1 1 
ATOM   1070 N  NE2 . HIS A 1 150 ? 49.870 21.194 18.027 1.00 25.50 ? 438  HIS A NE2 1 
ATOM   1071 N  N   . ARG A 1 151 ? 50.657 15.707 19.184 1.00 32.88 ? 439  ARG A N   1 
ATOM   1072 C  CA  . ARG A 1 151 ? 49.921 15.064 20.304 1.00 32.57 ? 439  ARG A CA  1 
ATOM   1073 C  C   . ARG A 1 151 ? 48.731 15.818 20.909 1.00 32.13 ? 439  ARG A C   1 
ATOM   1074 O  O   . ARG A 1 151 ? 48.118 15.318 21.844 1.00 33.29 ? 439  ARG A O   1 
ATOM   1075 C  CB  . ARG A 1 151 ? 50.844 14.682 21.451 1.00 30.64 ? 439  ARG A CB  1 
ATOM   1076 C  CG  . ARG A 1 151 ? 51.949 13.713 21.071 1.00 36.48 ? 439  ARG A CG  1 
ATOM   1077 C  CD  . ARG A 1 151 ? 53.174 14.026 21.896 1.00 37.40 ? 439  ARG A CD  1 
ATOM   1078 N  NE  . ARG A 1 151 ? 53.507 12.950 22.775 1.00 43.20 ? 439  ARG A NE  1 
ATOM   1079 C  CZ  . ARG A 1 151 ? 54.259 13.034 23.865 1.00 32.91 ? 439  ARG A CZ  1 
ATOM   1080 N  NH1 . ARG A 1 151 ? 54.763 14.168 24.333 1.00 34.42 ? 439  ARG A NH1 1 
ATOM   1081 N  NH2 . ARG A 1 151 ? 54.475 11.927 24.516 1.00 32.39 ? 439  ARG A NH2 1 
ATOM   1082 N  N   . ASP A 1 152 ? 48.385 16.988 20.393 1.00 33.62 ? 440  ASP A N   1 
ATOM   1083 C  CA  . ASP A 1 152 ? 47.116 17.626 20.779 1.00 33.25 ? 440  ASP A CA  1 
ATOM   1084 C  C   . ASP A 1 152 ? 46.391 18.256 19.608 1.00 32.45 ? 440  ASP A C   1 
ATOM   1085 O  O   . ASP A 1 152 ? 45.905 19.388 19.687 1.00 33.55 ? 440  ASP A O   1 
ATOM   1086 C  CB  . ASP A 1 152 ? 47.347 18.635 21.891 1.00 34.19 ? 440  ASP A CB  1 
ATOM   1087 C  CG  . ASP A 1 152 ? 46.151 18.790 22.823 1.00 35.11 ? 440  ASP A CG  1 
ATOM   1088 O  OD1 . ASP A 1 152 ? 45.181 17.959 22.788 1.00 31.31 ? 440  ASP A OD1 1 
ATOM   1089 O  OD2 . ASP A 1 152 ? 46.210 19.775 23.597 1.00 31.19 ? 440  ASP A OD2 1 
ATOM   1090 N  N   . ILE A 1 153 ? 46.290 17.507 18.518 1.00 30.87 ? 441  ILE A N   1 
ATOM   1091 C  CA  . ILE A 1 153 ? 45.486 17.945 17.380 1.00 32.03 ? 441  ILE A CA  1 
ATOM   1092 C  C   . ILE A 1 153 ? 43.966 17.894 17.734 1.00 32.30 ? 441  ILE A C   1 
ATOM   1093 O  O   . ILE A 1 153 ? 43.443 16.876 18.138 1.00 33.07 ? 441  ILE A O   1 
ATOM   1094 C  CB  . ILE A 1 153 ? 45.761 17.119 16.075 1.00 32.92 ? 441  ILE A CB  1 
ATOM   1095 C  CG1 . ILE A 1 153 ? 47.244 17.162 15.666 1.00 31.07 ? 441  ILE A CG1 1 
ATOM   1096 C  CG2 . ILE A 1 153 ? 44.861 17.621 14.912 1.00 29.13 ? 441  ILE A CG2 1 
ATOM   1097 C  CD1 . ILE A 1 153 ? 47.730 18.498 15.155 1.00 33.12 ? 441  ILE A CD1 1 
ATOM   1098 N  N   . LYS A 1 154 ? 43.317 19.041 17.599 1.00 31.26 ? 442  LYS A N   1 
ATOM   1099 C  CA  . LYS A 1 154 ? 41.907 19.254 17.844 1.00 29.86 ? 442  LYS A CA  1 
ATOM   1100 C  C   . LYS A 1 154 ? 41.619 20.673 17.359 1.00 30.59 ? 442  LYS A C   1 
ATOM   1101 O  O   . LYS A 1 154 ? 42.549 21.459 17.144 1.00 29.71 ? 442  LYS A O   1 
ATOM   1102 C  CB  . LYS A 1 154 ? 41.541 19.122 19.331 1.00 28.84 ? 442  LYS A CB  1 
ATOM   1103 C  CG  . LYS A 1 154 ? 42.429 19.850 20.268 1.00 27.79 ? 442  LYS A CG  1 
ATOM   1104 C  CD  . LYS A 1 154 ? 41.919 19.748 21.704 1.00 26.87 ? 442  LYS A CD  1 
ATOM   1105 C  CE  . LYS A 1 154 ? 42.778 20.606 22.648 1.00 30.37 ? 442  LYS A CE  1 
ATOM   1106 N  NZ  . LYS A 1 154 ? 42.364 20.518 24.087 1.00 29.03 ? 442  LYS A NZ  1 
ATOM   1107 N  N   . SER A 1 155 ? 40.348 21.018 17.217 1.00 29.17 ? 443  SER A N   1 
ATOM   1108 C  CA  . SER A 1 155 ? 39.983 22.335 16.711 1.00 29.12 ? 443  SER A CA  1 
ATOM   1109 C  C   . SER A 1 155 ? 40.565 23.505 17.533 1.00 29.61 ? 443  SER A C   1 
ATOM   1110 O  O   . SER A 1 155 ? 40.897 24.554 16.968 1.00 28.22 ? 443  SER A O   1 
ATOM   1111 C  CB  . SER A 1 155 ? 38.456 22.449 16.600 1.00 30.40 ? 443  SER A CB  1 
ATOM   1112 O  OG  . SER A 1 155 ? 37.851 22.363 17.868 1.00 27.94 ? 443  SER A OG  1 
ATOM   1113 N  N   . ASP A 1 156 ? 40.704 23.312 18.847 1.00 31.15 ? 444  ASP A N   1 
ATOM   1114 C  CA  . ASP A 1 156 ? 41.221 24.348 19.736 1.00 30.88 ? 444  ASP A CA  1 
ATOM   1115 C  C   . ASP A 1 156 ? 42.653 24.715 19.390 1.00 32.80 ? 444  ASP A C   1 
ATOM   1116 O  O   . ASP A 1 156 ? 43.101 25.834 19.679 1.00 34.40 ? 444  ASP A O   1 
ATOM   1117 C  CB  . ASP A 1 156 ? 41.159 23.938 21.222 1.00 31.32 ? 444  ASP A CB  1 
ATOM   1118 C  CG  . ASP A 1 156 ? 39.906 23.164 21.590 1.00 29.87 ? 444  ASP A CG  1 
ATOM   1119 O  OD1 . ASP A 1 156 ? 39.196 23.599 22.514 1.00 39.48 ? 444  ASP A OD1 1 
ATOM   1120 O  OD2 . ASP A 1 156 ? 39.624 22.104 20.985 1.00 32.05 ? 444  ASP A OD2 1 
ATOM   1121 N  N   . SER A 1 157 ? 43.369 23.777 18.771 1.00 33.32 ? 445  SER A N   1 
ATOM   1122 C  CA  . SER A 1 157 ? 44.781 23.954 18.447 1.00 33.58 ? 445  SER A CA  1 
ATOM   1123 C  C   . SER A 1 157 ? 44.994 24.581 17.066 1.00 33.12 ? 445  SER A C   1 
ATOM   1124 O  O   . SER A 1 157 ? 46.120 24.803 16.643 1.00 34.63 ? 445  SER A O   1 
ATOM   1125 C  CB  . SER A 1 157 ? 45.495 22.593 18.508 1.00 32.92 ? 445  SER A CB  1 
ATOM   1126 O  OG  . SER A 1 157 ? 45.400 22.033 19.814 1.00 32.49 ? 445  SER A OG  1 
ATOM   1127 N  N   . ILE A 1 158 ? 43.917 24.840 16.346 1.00 32.85 ? 446  ILE A N   1 
ATOM   1128 C  CA  . ILE A 1 158 ? 44.014 25.335 14.982 1.00 31.32 ? 446  ILE A CA  1 
ATOM   1129 C  C   . ILE A 1 158 ? 43.570 26.786 15.012 1.00 31.93 ? 446  ILE A C   1 
ATOM   1130 O  O   . ILE A 1 158 ? 42.451 27.069 15.362 1.00 33.40 ? 446  ILE A O   1 
ATOM   1131 C  CB  . ILE A 1 158 ? 43.102 24.540 14.045 1.00 32.11 ? 446  ILE A CB  1 
ATOM   1132 C  CG1 . ILE A 1 158 ? 43.469 23.046 14.090 1.00 30.41 ? 446  ILE A CG1 1 
ATOM   1133 C  CG2 . ILE A 1 158 ? 43.112 25.148 12.588 1.00 29.10 ? 446  ILE A CG2 1 
ATOM   1134 C  CD1 . ILE A 1 158 ? 44.948 22.729 13.841 1.00 29.63 ? 446  ILE A CD1 1 
ATOM   1135 N  N   . LEU A 1 159 ? 44.473 27.696 14.668 1.00 32.91 ? 447  LEU A N   1 
ATOM   1136 C  CA  . LEU A 1 159 ? 44.195 29.121 14.667 1.00 32.63 ? 447  LEU A CA  1 
ATOM   1137 C  C   . LEU A 1 159 ? 44.081 29.630 13.239 1.00 33.12 ? 447  LEU A C   1 
ATOM   1138 O  O   . LEU A 1 159 ? 44.599 29.004 12.311 1.00 32.39 ? 447  LEU A O   1 
ATOM   1139 C  CB  . LEU A 1 159 ? 45.298 29.875 15.398 1.00 29.03 ? 447  LEU A CB  1 
ATOM   1140 C  CG  . LEU A 1 159 ? 45.490 29.531 16.870 1.00 30.45 ? 447  LEU A CG  1 
ATOM   1141 C  CD1 . LEU A 1 159 ? 46.723 30.252 17.400 1.00 25.41 ? 447  LEU A CD1 1 
ATOM   1142 C  CD2 . LEU A 1 159 ? 44.263 29.885 17.698 1.00 32.65 ? 447  LEU A CD2 1 
ATOM   1143 N  N   . LEU A 1 160 ? 43.399 30.762 13.080 1.00 32.38 ? 448  LEU A N   1 
ATOM   1144 C  CA  . LEU A 1 160 ? 43.178 31.367 11.756 1.00 33.18 ? 448  LEU A CA  1 
ATOM   1145 C  C   . LEU A 1 160 ? 43.625 32.824 11.701 1.00 31.18 ? 448  LEU A C   1 
ATOM   1146 O  O   . LEU A 1 160 ? 43.451 33.572 12.651 1.00 30.82 ? 448  LEU A O   1 
ATOM   1147 C  CB  . LEU A 1 160 ? 41.687 31.301 11.370 1.00 32.98 ? 448  LEU A CB  1 
ATOM   1148 C  CG  . LEU A 1 160 ? 41.048 29.903 11.335 1.00 36.87 ? 448  LEU A CG  1 
ATOM   1149 C  CD1 . LEU A 1 160 ? 39.580 30.035 11.268 1.00 39.36 ? 448  LEU A CD1 1 
ATOM   1150 C  CD2 . LEU A 1 160 ? 41.534 29.100 10.122 1.00 40.55 ? 448  LEU A CD2 1 
ATOM   1151 N  N   . THR A 1 161 ? 44.162 33.229 10.562 1.00 34.10 ? 449  THR A N   1 
ATOM   1152 C  CA  . THR A 1 161 ? 44.523 34.624 10.322 1.00 34.41 ? 449  THR A CA  1 
ATOM   1153 C  C   . THR A 1 161 ? 43.274 35.417 9.965  1.00 35.66 ? 449  THR A C   1 
ATOM   1154 O  O   . THR A 1 161 ? 42.218 34.833 9.740  1.00 36.77 ? 449  THR A O   1 
ATOM   1155 C  CB  . THR A 1 161 ? 45.554 34.727 9.175  1.00 34.80 ? 449  THR A CB  1 
ATOM   1156 O  OG1 . THR A 1 161 ? 44.951 34.278 7.953  1.00 32.50 ? 449  THR A OG1 1 
ATOM   1157 C  CG2 . THR A 1 161 ? 46.797 33.874 9.491  1.00 27.87 ? 449  THR A CG2 1 
ATOM   1158 N  N   . HIS A 1 162 ? 43.394 36.747 9.917  1.00 36.56 ? 450  HIS A N   1 
ATOM   1159 C  CA  . HIS A 1 162 ? 42.303 37.616 9.467  1.00 35.77 ? 450  HIS A CA  1 
ATOM   1160 C  C   . HIS A 1 162 ? 41.768 37.233 8.068  1.00 35.65 ? 450  HIS A C   1 
ATOM   1161 O  O   . HIS A 1 162 ? 40.571 37.346 7.788  1.00 34.54 ? 450  HIS A O   1 
ATOM   1162 C  CB  . HIS A 1 162 ? 42.757 39.104 9.475  1.00 38.58 ? 450  HIS A CB  1 
ATOM   1163 C  CG  . HIS A 1 162 ? 43.853 39.411 8.500  1.00 35.10 ? 450  HIS A CG  1 
ATOM   1164 N  ND1 . HIS A 1 162 ? 43.637 40.108 7.332  1.00 41.11 ? 450  HIS A ND1 1 
ATOM   1165 C  CD2 . HIS A 1 162 ? 45.170 39.082 8.507  1.00 45.21 ? 450  HIS A CD2 1 
ATOM   1166 C  CE1 . HIS A 1 162 ? 44.777 40.205 6.668  1.00 51.36 ? 450  HIS A CE1 1 
ATOM   1167 N  NE2 . HIS A 1 162 ? 45.720 39.580 7.354  1.00 45.11 ? 450  HIS A NE2 1 
ATOM   1168 N  N   . ASP A 1 163 ? 42.664 36.796 7.192  1.00 34.40 ? 451  ASP A N   1 
ATOM   1169 C  CA  . ASP A 1 163 ? 42.291 36.481 5.823  1.00 34.82 ? 451  ASP A CA  1 
ATOM   1170 C  C   . ASP A 1 163 ? 42.074 34.995 5.594  1.00 33.55 ? 451  ASP A C   1 
ATOM   1171 O  O   . ASP A 1 163 ? 41.950 34.565 4.460  1.00 35.00 ? 451  ASP A O   1 
ATOM   1172 C  CB  . ASP A 1 163 ? 43.330 37.047 4.833  1.00 36.33 ? 451  ASP A CB  1 
ATOM   1173 C  CG  . ASP A 1 163 ? 44.726 36.511 5.070  1.00 37.77 ? 451  ASP A CG  1 
ATOM   1174 O  OD1 . ASP A 1 163 ? 45.033 36.153 6.226  1.00 35.39 ? 451  ASP A OD1 1 
ATOM   1175 O  OD2 . ASP A 1 163 ? 45.510 36.473 4.099  1.00 42.30 ? 451  ASP A OD2 1 
ATOM   1176 N  N   . GLY A 1 164 ? 42.025 34.216 6.672  1.00 32.68 ? 452  GLY A N   1 
ATOM   1177 C  CA  . GLY A 1 164 ? 41.541 32.844 6.628  1.00 31.58 ? 452  GLY A CA  1 
ATOM   1178 C  C   . GLY A 1 164 ? 42.571 31.761 6.420  1.00 30.72 ? 452  GLY A C   1 
ATOM   1179 O  O   . GLY A 1 164 ? 42.233 30.664 6.039  1.00 28.38 ? 452  GLY A O   1 
ATOM   1180 N  N   . ARG A 1 165 ? 43.830 32.051 6.697  1.00 33.22 ? 453  ARG A N   1 
ATOM   1181 C  CA  . ARG A 1 165 ? 44.864 31.032 6.622  1.00 34.56 ? 453  ARG A CA  1 
ATOM   1182 C  C   . ARG A 1 165 ? 44.957 30.249 7.924  1.00 34.48 ? 453  ARG A C   1 
ATOM   1183 O  O   . ARG A 1 165 ? 44.726 30.782 9.003  1.00 34.68 ? 453  ARG A O   1 
ATOM   1184 C  CB  . ARG A 1 165 ? 46.206 31.658 6.234  1.00 35.68 ? 453  ARG A CB  1 
ATOM   1185 C  CG  . ARG A 1 165 ? 46.211 32.091 4.785  1.00 37.10 ? 453  ARG A CG  1 
ATOM   1186 C  CD  . ARG A 1 165 ? 47.438 32.874 4.424  1.00 38.81 ? 453  ARG A CD  1 
ATOM   1187 N  NE  . ARG A 1 165 ? 47.455 34.185 5.060  1.00 45.58 ? 453  ARG A NE  1 
ATOM   1188 C  CZ  . ARG A 1 165 ? 48.275 34.566 6.045  1.00 50.27 ? 453  ARG A CZ  1 
ATOM   1189 N  NH1 . ARG A 1 165 ? 49.202 33.745 6.546  1.00 53.37 ? 453  ARG A NH1 1 
ATOM   1190 N  NH2 . ARG A 1 165 ? 48.172 35.804 6.529  1.00 46.50 ? 453  ARG A NH2 1 
ATOM   1191 N  N   . VAL A 1 166 ? 45.286 28.967 7.799  1.00 35.30 ? 454  VAL A N   1 
ATOM   1192 C  CA  . VAL A 1 166 ? 45.257 28.034 8.921  1.00 35.68 ? 454  VAL A CA  1 
ATOM   1193 C  C   . VAL A 1 166 ? 46.667 27.844 9.486  1.00 34.63 ? 454  VAL A C   1 
ATOM   1194 O  O   . VAL A 1 166 ? 47.653 27.693 8.730  1.00 32.69 ? 454  VAL A O   1 
ATOM   1195 C  CB  . VAL A 1 166 ? 44.606 26.685 8.477  1.00 37.60 ? 454  VAL A CB  1 
ATOM   1196 C  CG1 . VAL A 1 166 ? 44.661 25.671 9.567  1.00 39.81 ? 454  VAL A CG1 1 
ATOM   1197 C  CG2 . VAL A 1 166 ? 43.148 26.924 8.058  1.00 34.60 ? 454  VAL A CG2 1 
ATOM   1198 N  N   . LYS A 1 167 ? 46.761 27.925 10.816 1.00 33.83 ? 455  LYS A N   1 
ATOM   1199 C  CA  . LYS A 1 167 ? 48.020 27.712 11.516 1.00 35.03 ? 455  LYS A CA  1 
ATOM   1200 C  C   . LYS A 1 167 ? 47.823 26.773 12.688 1.00 35.79 ? 455  LYS A C   1 
ATOM   1201 O  O   . LYS A 1 167 ? 46.916 26.935 13.486 1.00 36.80 ? 455  LYS A O   1 
ATOM   1202 C  CB  . LYS A 1 167 ? 48.638 29.025 11.986 1.00 35.89 ? 455  LYS A CB  1 
ATOM   1203 C  CG  . LYS A 1 167 ? 48.856 30.024 10.857 1.00 38.69 ? 455  LYS A CG  1 
ATOM   1204 C  CD  . LYS A 1 167 ? 50.150 30.754 10.964 1.00 38.79 ? 455  LYS A CD  1 
ATOM   1205 C  CE  . LYS A 1 167 ? 50.305 31.678 9.788  1.00 40.34 ? 455  LYS A CE  1 
ATOM   1206 N  NZ  . LYS A 1 167 ? 51.531 32.483 9.948  1.00 47.98 ? 455  LYS A NZ  1 
ATOM   1207 N  N   . LEU A 1 168 ? 48.685 25.771 12.748 1.00 36.08 ? 456  LEU A N   1 
ATOM   1208 C  CA  . LEU A 1 168 ? 48.755 24.832 13.846 1.00 33.62 ? 456  LEU A CA  1 
ATOM   1209 C  C   . LEU A 1 168 ? 49.429 25.532 15.015 1.00 29.21 ? 456  LEU A C   1 
ATOM   1210 O  O   . LEU A 1 168 ? 50.446 26.188 14.845 1.00 30.15 ? 456  LEU A O   1 
ATOM   1211 C  CB  . LEU A 1 168 ? 49.564 23.605 13.398 1.00 34.39 ? 456  LEU A CB  1 
ATOM   1212 C  CG  . LEU A 1 168 ? 49.517 22.319 14.220 1.00 38.25 ? 456  LEU A CG  1 
ATOM   1213 C  CD1 . LEU A 1 168 ? 48.090 22.015 14.660 1.00 32.76 ? 456  LEU A CD1 1 
ATOM   1214 C  CD2 . LEU A 1 168 ? 50.142 21.170 13.399 1.00 34.29 ? 456  LEU A CD2 1 
ATOM   1215 N  N   . SER A 1 169 ? 48.844 25.398 16.196 1.00 28.08 ? 457  SER A N   1 
ATOM   1216 C  CA  . SER A 1 169 ? 49.352 26.007 17.421 1.00 28.90 ? 457  SER A CA  1 
ATOM   1217 C  C   . SER A 1 169 ? 49.393 24.978 18.547 1.00 28.09 ? 457  SER A C   1 
ATOM   1218 O  O   . SER A 1 169 ? 49.137 23.798 18.335 1.00 28.90 ? 457  SER A O   1 
ATOM   1219 C  CB  . SER A 1 169 ? 48.440 27.190 17.815 1.00 30.42 ? 457  SER A CB  1 
ATOM   1220 O  OG  . SER A 1 169 ? 49.036 27.996 18.845 1.00 35.49 ? 457  SER A OG  1 
ATOM   1221 N  N   . ASP A 1 170 ? 49.693 25.429 19.759 1.00 30.45 ? 458  ASP A N   1 
ATOM   1222 C  CA  . ASP A 1 170 ? 49.587 24.590 20.969 1.00 33.15 ? 458  ASP A CA  1 
ATOM   1223 C  C   . ASP A 1 170 ? 50.492 23.343 20.926 1.00 32.96 ? 458  ASP A C   1 
ATOM   1224 O  O   . ASP A 1 170 ? 50.024 22.195 20.991 1.00 31.02 ? 458  ASP A O   1 
ATOM   1225 C  CB  . ASP A 1 170 ? 48.126 24.194 21.242 1.00 35.47 ? 458  ASP A CB  1 
ATOM   1226 C  CG  . ASP A 1 170 ? 47.495 24.984 22.366 1.00 44.30 ? 458  ASP A CG  1 
ATOM   1227 O  OD1 . ASP A 1 170 ? 48.155 25.190 23.423 1.00 45.57 ? 458  ASP A OD1 1 
ATOM   1228 O  OD2 . ASP A 1 170 ? 46.309 25.365 22.202 1.00 54.23 ? 458  ASP A OD2 1 
ATOM   1229 N  N   . PHE A 1 171 ? 51.795 23.609 20.839 1.00 33.22 ? 459  PHE A N   1 
ATOM   1230 C  CA  . PHE A 1 171 ? 52.831 22.583 20.797 1.00 34.44 ? 459  PHE A CA  1 
ATOM   1231 C  C   . PHE A 1 171 ? 53.334 22.201 22.202 1.00 34.71 ? 459  PHE A C   1 
ATOM   1232 O  O   . PHE A 1 171 ? 54.394 21.578 22.346 1.00 32.25 ? 459  PHE A O   1 
ATOM   1233 C  CB  . PHE A 1 171 ? 53.993 23.068 19.915 1.00 34.47 ? 459  PHE A CB  1 
ATOM   1234 C  CG  . PHE A 1 171 ? 53.679 23.048 18.455 1.00 29.61 ? 459  PHE A CG  1 
ATOM   1235 C  CD1 . PHE A 1 171 ? 54.086 21.989 17.662 1.00 37.48 ? 459  PHE A CD1 1 
ATOM   1236 C  CD2 . PHE A 1 171 ? 52.949 24.065 17.870 1.00 42.51 ? 459  PHE A CD2 1 
ATOM   1237 C  CE1 . PHE A 1 171 ? 53.784 21.955 16.323 1.00 33.40 ? 459  PHE A CE1 1 
ATOM   1238 C  CE2 . PHE A 1 171 ? 52.650 24.034 16.505 1.00 39.48 ? 459  PHE A CE2 1 
ATOM   1239 C  CZ  . PHE A 1 171 ? 53.063 22.977 15.749 1.00 32.52 ? 459  PHE A CZ  1 
ATOM   1240 N  N   . GLY A 1 172 ? 52.557 22.558 23.225 1.00 34.56 ? 460  GLY A N   1 
ATOM   1241 C  CA  . GLY A 1 172 ? 52.925 22.282 24.611 1.00 34.80 ? 460  GLY A CA  1 
ATOM   1242 C  C   . GLY A 1 172 ? 52.933 20.809 25.009 1.00 36.59 ? 460  GLY A C   1 
ATOM   1243 O  O   . GLY A 1 172 ? 53.485 20.477 26.065 1.00 35.13 ? 460  GLY A O   1 
ATOM   1244 N  N   . PHE A 1 173 ? 52.338 19.935 24.180 1.00 35.22 ? 461  PHE A N   1 
ATOM   1245 C  CA  . PHE A 1 173 ? 52.379 18.488 24.408 1.00 35.17 ? 461  PHE A CA  1 
ATOM   1246 C  C   . PHE A 1 173 ? 53.274 17.753 23.420 1.00 34.63 ? 461  PHE A C   1 
ATOM   1247 O  O   . PHE A 1 173 ? 53.265 16.548 23.416 1.00 33.60 ? 461  PHE A O   1 
ATOM   1248 C  CB  . PHE A 1 173 ? 50.976 17.853 24.327 1.00 35.35 ? 461  PHE A CB  1 
ATOM   1249 C  CG  . PHE A 1 173 ? 50.031 18.227 25.459 1.00 35.32 ? 461  PHE A CG  1 
ATOM   1250 C  CD1 . PHE A 1 173 ? 50.455 18.943 26.580 1.00 40.46 ? 461  PHE A CD1 1 
ATOM   1251 C  CD2 . PHE A 1 173 ? 48.702 17.820 25.397 1.00 35.49 ? 461  PHE A CD2 1 
ATOM   1252 C  CE1 . PHE A 1 173 ? 49.560 19.274 27.614 1.00 40.10 ? 461  PHE A CE1 1 
ATOM   1253 C  CE2 . PHE A 1 173 ? 47.798 18.141 26.422 1.00 40.97 ? 461  PHE A CE2 1 
ATOM   1254 C  CZ  . PHE A 1 173 ? 48.232 18.873 27.535 1.00 40.55 ? 461  PHE A CZ  1 
ATOM   1255 N  N   . CYS A 1 174 ? 54.060 18.450 22.602 1.00 35.18 ? 462  CYS A N   1 
ATOM   1256 C  CA  A CYS A 1 174 ? 54.805 17.736 21.569 0.50 34.13 ? 462  CYS A CA  1 
ATOM   1257 C  CA  B CYS A 1 174 ? 54.899 17.821 21.572 0.50 36.08 ? 462  CYS A CA  1 
ATOM   1258 C  C   . CYS A 1 174 ? 55.922 16.859 22.131 1.00 34.78 ? 462  CYS A C   1 
ATOM   1259 O  O   . CYS A 1 174 ? 56.321 16.978 23.274 1.00 36.21 ? 462  CYS A O   1 
ATOM   1260 C  CB  A CYS A 1 174 ? 55.351 18.676 20.494 0.50 34.13 ? 462  CYS A CB  1 
ATOM   1261 C  CB  B CYS A 1 174 ? 55.665 18.872 20.751 0.50 36.50 ? 462  CYS A CB  1 
ATOM   1262 S  SG  A CYS A 1 174 ? 56.500 19.887 21.093 0.50 23.09 ? 462  CYS A SG  1 
ATOM   1263 S  SG  B CYS A 1 174 ? 54.955 19.194 19.136 0.50 42.93 ? 462  CYS A SG  1 
ATOM   1264 N  N   . ALA A 1 175 ? 56.374 15.945 21.290 1.00 35.26 ? 463  ALA A N   1 
ATOM   1265 C  CA  . ALA A 1 175 ? 57.473 15.051 21.604 1.00 35.87 ? 463  ALA A CA  1 
ATOM   1266 C  C   . ALA A 1 175 ? 58.263 14.867 20.318 1.00 36.16 ? 463  ALA A C   1 
ATOM   1267 O  O   . ALA A 1 175 ? 57.791 15.178 19.228 1.00 36.35 ? 463  ALA A O   1 
ATOM   1268 C  CB  . ALA A 1 175 ? 56.958 13.715 22.113 1.00 35.28 ? 463  ALA A CB  1 
ATOM   1269 N  N   . GLN A 1 176 ? 59.482 14.394 20.454 1.00 38.08 ? 464  GLN A N   1 
ATOM   1270 C  CA  . GLN A 1 176 ? 60.294 14.092 19.301 1.00 39.77 ? 464  GLN A CA  1 
ATOM   1271 C  C   . GLN A 1 176 ? 60.800 12.662 19.447 1.00 39.17 ? 464  GLN A C   1 
ATOM   1272 O  O   . GLN A 1 176 ? 61.305 12.270 20.509 1.00 40.09 ? 464  GLN A O   1 
ATOM   1273 C  CB  . GLN A 1 176 ? 61.453 15.078 19.183 1.00 41.90 ? 464  GLN A CB  1 
ATOM   1274 C  CG  . GLN A 1 176 ? 62.358 14.815 17.986 1.00 45.49 ? 464  GLN A CG  1 
ATOM   1275 C  CD  . GLN A 1 176 ? 62.932 16.076 17.428 1.00 41.99 ? 464  GLN A CD  1 
ATOM   1276 O  OE1 . GLN A 1 176 ? 63.403 16.927 18.168 1.00 48.86 ? 464  GLN A OE1 1 
ATOM   1277 N  NE2 . GLN A 1 176 ? 62.891 16.215 16.117 1.00 40.02 ? 464  GLN A NE2 1 
ATOM   1278 N  N   . VAL A 1 177 ? 60.607 11.880 18.392 1.00 37.22 ? 465  VAL A N   1 
ATOM   1279 C  CA  . VAL A 1 177 ? 61.163 10.547 18.312 1.00 36.86 ? 465  VAL A CA  1 
ATOM   1280 C  C   . VAL A 1 177 ? 62.379 10.615 17.390 1.00 38.58 ? 465  VAL A C   1 
ATOM   1281 O  O   . VAL A 1 177 ? 62.581 11.598 16.680 1.00 39.17 ? 465  VAL A O   1 
ATOM   1282 C  CB  . VAL A 1 177 ? 60.111 9.492  17.858 1.00 35.68 ? 465  VAL A CB  1 
ATOM   1283 C  CG1 . VAL A 1 177 ? 58.982 9.424  18.875 1.00 29.29 ? 465  VAL A CG1 1 
ATOM   1284 C  CG2 . VAL A 1 177 ? 59.560 9.789  16.454 1.00 33.96 ? 465  VAL A CG2 1 
ATOM   1285 N  N   . SER A 1 178 ? 63.201 9.578  17.460 1.00 40.45 ? 466  SER A N   1 
ATOM   1286 C  CA  . SER A 1 178 ? 64.477 9.512  16.767 1.00 41.19 ? 466  SER A CA  1 
ATOM   1287 C  C   . SER A 1 178 ? 64.783 8.042  16.499 1.00 42.40 ? 466  SER A C   1 
ATOM   1288 O  O   . SER A 1 178 ? 64.008 7.167  16.892 1.00 42.64 ? 466  SER A O   1 
ATOM   1289 C  CB  . SER A 1 178 ? 65.578 10.141 17.633 1.00 40.60 ? 466  SER A CB  1 
ATOM   1290 O  OG  . SER A 1 178 ? 65.647 9.529  18.918 1.00 38.75 ? 466  SER A OG  1 
ATOM   1291 N  N   . LYS A 1 179 ? 65.903 7.777  15.829 1.00 42.61 ? 467  LYS A N   1 
ATOM   1292 C  CA  . LYS A 1 179 ? 66.356 6.407  15.573 1.00 42.08 ? 467  LYS A CA  1 
ATOM   1293 C  C   . LYS A 1 179 ? 66.607 5.665  16.890 1.00 41.98 ? 467  LYS A C   1 
ATOM   1294 O  O   . LYS A 1 179 ? 66.221 4.506  17.040 1.00 42.32 ? 467  LYS A O   1 
ATOM   1295 C  CB  . LYS A 1 179 ? 67.625 6.422  14.710 1.00 41.34 ? 467  LYS A CB  1 
ATOM   1296 N  N   . GLU A 1 180 ? 67.232 6.362  17.838 1.00 42.32 ? 468  GLU A N   1 
ATOM   1297 C  CA  . GLU A 1 180 ? 67.559 5.824  19.164 1.00 42.89 ? 468  GLU A CA  1 
ATOM   1298 C  C   . GLU A 1 180 ? 66.344 5.568  20.056 1.00 43.05 ? 468  GLU A C   1 
ATOM   1299 O  O   . GLU A 1 180 ? 66.316 4.570  20.767 1.00 43.31 ? 468  GLU A O   1 
ATOM   1300 C  CB  . GLU A 1 180 ? 68.526 6.774  19.890 1.00 42.95 ? 468  GLU A CB  1 
ATOM   1301 N  N   . VAL A 1 181 ? 65.366 6.484  20.032 1.00 44.25 ? 469  VAL A N   1 
ATOM   1302 C  CA  . VAL A 1 181 ? 64.105 6.361  20.797 1.00 43.93 ? 469  VAL A CA  1 
ATOM   1303 C  C   . VAL A 1 181 ? 62.911 6.683  19.877 1.00 42.54 ? 469  VAL A C   1 
ATOM   1304 O  O   . VAL A 1 181 ? 62.366 7.789  19.921 1.00 42.20 ? 469  VAL A O   1 
ATOM   1305 C  CB  . VAL A 1 181 ? 64.108 7.269  22.074 1.00 45.34 ? 469  VAL A CB  1 
ATOM   1306 C  CG1 . VAL A 1 181 ? 64.681 8.657  21.773 1.00 52.24 ? 469  VAL A CG1 1 
ATOM   1307 C  CG2 . VAL A 1 181 ? 62.712 7.380  22.691 1.00 44.29 ? 469  VAL A CG2 1 
ATOM   1308 N  N   . PRO A 1 182 ? 62.492 5.704  19.050 1.00 41.76 ? 470  PRO A N   1 
ATOM   1309 C  CA  . PRO A 1 182 ? 61.571 5.946  17.920 1.00 42.55 ? 470  PRO A CA  1 
ATOM   1310 C  C   . PRO A 1 182 ? 60.066 5.955  18.257 1.00 40.06 ? 470  PRO A C   1 
ATOM   1311 O  O   . PRO A 1 182 ? 59.243 6.275  17.387 1.00 39.95 ? 470  PRO A O   1 
ATOM   1312 C  CB  . PRO A 1 182 ? 61.899 4.787  16.966 1.00 43.12 ? 470  PRO A CB  1 
ATOM   1313 C  CG  . PRO A 1 182 ? 62.355 3.664  17.877 1.00 42.15 ? 470  PRO A CG  1 
ATOM   1314 C  CD  . PRO A 1 182 ? 62.838 4.274  19.170 1.00 41.47 ? 470  PRO A CD  1 
ATOM   1315 N  N   . ARG A 1 183 ? 59.729 5.609  19.500 1.00 38.23 ? 471  ARG A N   1 
ATOM   1316 C  CA  . ARG A 1 183 ? 58.351 5.551  19.973 1.00 37.92 ? 471  ARG A CA  1 
ATOM   1317 C  C   . ARG A 1 183 ? 58.251 6.230  21.330 1.00 35.73 ? 471  ARG A C   1 
ATOM   1318 O  O   . ARG A 1 183 ? 59.189 6.215  22.096 1.00 35.24 ? 471  ARG A O   1 
ATOM   1319 C  CB  . ARG A 1 183 ? 57.872 4.105  20.137 1.00 37.78 ? 471  ARG A CB  1 
ATOM   1320 C  CG  . ARG A 1 183 ? 58.167 3.149  18.994 1.00 43.80 ? 471  ARG A CG  1 
ATOM   1321 C  CD  . ARG A 1 183 ? 56.949 2.814  18.162 1.00 48.45 ? 471  ARG A CD  1 
ATOM   1322 N  NE  . ARG A 1 183 ? 56.811 3.680  17.002 1.00 51.13 ? 471  ARG A NE  1 
ATOM   1323 C  CZ  . ARG A 1 183 ? 55.713 3.775  16.246 1.00 52.96 ? 471  ARG A CZ  1 
ATOM   1324 N  NH1 . ARG A 1 183 ? 54.613 3.058  16.512 1.00 52.19 ? 471  ARG A NH1 1 
ATOM   1325 N  NH2 . ARG A 1 183 ? 55.712 4.612  15.214 1.00 46.11 ? 471  ARG A NH2 1 
ATOM   1326 N  N   . ARG A 1 184 ? 57.106 6.848  21.603 1.00 36.87 ? 472  ARG A N   1 
ATOM   1327 C  CA  . ARG A 1 184 ? 56.778 7.346  22.934 1.00 36.49 ? 472  ARG A CA  1 
ATOM   1328 C  C   . ARG A 1 184 ? 55.774 6.386  23.544 1.00 36.16 ? 472  ARG A C   1 
ATOM   1329 O  O   . ARG A 1 184 ? 55.192 5.562  22.840 1.00 32.54 ? 472  ARG A O   1 
ATOM   1330 C  CB  . ARG A 1 184 ? 56.158 8.741  22.876 1.00 35.18 ? 472  ARG A CB  1 
ATOM   1331 C  CG  . ARG A 1 184 ? 56.845 9.734  21.947 1.00 43.86 ? 472  ARG A CG  1 
ATOM   1332 C  CD  . ARG A 1 184 ? 58.319 9.916  22.264 1.00 48.65 ? 472  ARG A CD  1 
ATOM   1333 N  NE  . ARG A 1 184 ? 58.567 10.167 23.682 1.00 46.42 ? 472  ARG A NE  1 
ATOM   1334 C  CZ  . ARG A 1 184 ? 59.774 10.141 24.240 1.00 54.44 ? 472  ARG A CZ  1 
ATOM   1335 N  NH1 . ARG A 1 184 ? 60.865 9.891  23.510 1.00 57.41 ? 472  ARG A NH1 1 
ATOM   1336 N  NH2 . ARG A 1 184 ? 59.895 10.361 25.543 1.00 54.22 ? 472  ARG A NH2 1 
ATOM   1337 N  N   . LYS A 1 185 ? 55.568 6.508  24.850 1.00 39.45 ? 473  LYS A N   1 
ATOM   1338 C  CA  . LYS A 1 185 ? 54.587 5.671  25.567 1.00 42.04 ? 473  LYS A CA  1 
ATOM   1339 C  C   . LYS A 1 185 ? 53.672 6.474  26.512 1.00 42.68 ? 473  LYS A C   1 
ATOM   1340 O  O   . LYS A 1 185 ? 52.667 5.938  26.999 1.00 44.97 ? 473  LYS A O   1 
ATOM   1341 C  CB  . LYS A 1 185 ? 55.304 4.524  26.314 1.00 41.77 ? 473  LYS A CB  1 
HETATM 1342 N  N   . SEP A 1 186 ? 54.015 7.749  26.728 1.00 42.32 ? 474  SEP A N   1 
HETATM 1343 C  CA  . SEP A 1 186 ? 53.268 8.709  27.558 1.00 41.36 ? 474  SEP A CA  1 
HETATM 1344 C  CB  . SEP A 1 186 ? 53.955 10.059 27.463 1.00 40.22 ? 474  SEP A CB  1 
HETATM 1345 O  OG  . SEP A 1 186 ? 55.278 9.947  27.897 1.00 43.30 ? 474  SEP A OG  1 
HETATM 1346 C  C   . SEP A 1 186 ? 51.810 8.972  27.187 1.00 40.81 ? 474  SEP A C   1 
HETATM 1347 O  O   . SEP A 1 186 ? 51.470 9.080  26.008 1.00 40.67 ? 474  SEP A O   1 
HETATM 1348 P  P   . SEP A 1 186 ? 56.298 10.991 27.216 1.00 39.82 ? 474  SEP A P   1 
HETATM 1349 O  O1P . SEP A 1 186 ? 57.743 10.542 27.774 1.00 45.07 ? 474  SEP A O1P 1 
HETATM 1350 O  O2P . SEP A 1 186 ? 56.353 10.779 25.646 1.00 28.51 ? 474  SEP A O2P 1 
HETATM 1351 O  O3P . SEP A 1 186 ? 55.986 12.529 27.561 1.00 45.74 ? 474  SEP A O3P 1 
ATOM   1352 N  N   . LEU A 1 187 ? 50.977 9.161  28.210 1.00 39.83 ? 475  LEU A N   1 
ATOM   1353 C  CA  . LEU A 1 187 ? 49.557 9.449  28.027 1.00 39.00 ? 475  LEU A CA  1 
ATOM   1354 C  C   . LEU A 1 187 ? 49.379 10.941 28.003 1.00 36.66 ? 475  LEU A C   1 
ATOM   1355 O  O   . LEU A 1 187 ? 49.070 11.560 29.016 1.00 35.02 ? 475  LEU A O   1 
ATOM   1356 C  CB  . LEU A 1 187 ? 48.717 8.820  29.151 1.00 39.12 ? 475  LEU A CB  1 
ATOM   1357 C  CG  . LEU A 1 187 ? 47.184 8.872  29.028 1.00 39.63 ? 475  LEU A CG  1 
ATOM   1358 C  CD1 . LEU A 1 187 ? 46.691 8.259  27.737 1.00 38.08 ? 475  LEU A CD1 1 
ATOM   1359 C  CD2 . LEU A 1 187 ? 46.533 8.154  30.214 1.00 42.45 ? 475  LEU A CD2 1 
ATOM   1360 N  N   . VAL A 1 188 ? 49.604 11.526 26.836 1.00 35.61 ? 476  VAL A N   1 
ATOM   1361 C  CA  . VAL A 1 188 ? 49.386 12.939 26.668 1.00 35.44 ? 476  VAL A CA  1 
ATOM   1362 C  C   . VAL A 1 188 ? 48.410 13.179 25.537 1.00 34.37 ? 476  VAL A C   1 
ATOM   1363 O  O   . VAL A 1 188 ? 48.427 12.476 24.516 1.00 32.68 ? 476  VAL A O   1 
ATOM   1364 C  CB  . VAL A 1 188 ? 50.722 13.732 26.465 1.00 37.30 ? 476  VAL A CB  1 
ATOM   1365 C  CG1 . VAL A 1 188 ? 51.791 13.216 27.416 1.00 33.55 ? 476  VAL A CG1 1 
ATOM   1366 C  CG2 . VAL A 1 188 ? 51.199 13.641 25.065 1.00 40.60 ? 476  VAL A CG2 1 
ATOM   1367 N  N   . GLY A 1 189 ? 47.547 14.175 25.743 1.00 33.19 ? 477  GLY A N   1 
ATOM   1368 C  CA  . GLY A 1 189 ? 46.569 14.574 24.749 1.00 33.20 ? 477  GLY A CA  1 
ATOM   1369 C  C   . GLY A 1 189 ? 45.311 15.029 25.447 1.00 32.54 ? 477  GLY A C   1 
ATOM   1370 O  O   . GLY A 1 189 ? 45.345 15.413 26.605 1.00 32.73 ? 477  GLY A O   1 
ATOM   1371 N  N   . THR A 1 190 ? 44.207 14.990 24.711 1.00 33.44 ? 478  THR A N   1 
ATOM   1372 C  CA  . THR A 1 190 ? 42.882 15.343 25.206 1.00 32.52 ? 478  THR A CA  1 
ATOM   1373 C  C   . THR A 1 190 ? 41.978 14.140 24.950 1.00 32.81 ? 478  THR A C   1 
ATOM   1374 O  O   . THR A 1 190 ? 41.828 13.720 23.803 1.00 32.36 ? 478  THR A O   1 
ATOM   1375 C  CB  . THR A 1 190 ? 42.308 16.558 24.471 1.00 32.06 ? 478  THR A CB  1 
ATOM   1376 O  OG1 . THR A 1 190 ? 43.233 17.645 24.542 1.00 35.50 ? 478  THR A OG1 1 
ATOM   1377 C  CG2 . THR A 1 190 ? 40.999 17.010 25.098 1.00 28.34 ? 478  THR A CG2 1 
ATOM   1378 N  N   . PRO A 1 191 ? 41.404 13.560 26.025 1.00 32.57 ? 479  PRO A N   1 
ATOM   1379 C  CA  . PRO A 1 191 ? 40.700 12.295 25.957 1.00 29.64 ? 479  PRO A CA  1 
ATOM   1380 C  C   . PRO A 1 191 ? 40.016 11.976 24.633 1.00 30.43 ? 479  PRO A C   1 
ATOM   1381 O  O   . PRO A 1 191 ? 40.350 10.972 23.996 1.00 34.71 ? 479  PRO A O   1 
ATOM   1382 C  CB  . PRO A 1 191 ? 39.712 12.428 27.112 1.00 29.84 ? 479  PRO A CB  1 
ATOM   1383 C  CG  . PRO A 1 191 ? 40.574 13.060 28.173 1.00 32.50 ? 479  PRO A CG  1 
ATOM   1384 C  CD  . PRO A 1 191 ? 41.444 14.055 27.421 1.00 31.53 ? 479  PRO A CD  1 
ATOM   1385 N  N   . TYR A 1 192 ? 39.089 12.824 24.211 1.00 28.94 ? 480  TYR A N   1 
ATOM   1386 C  CA  . TYR A 1 192 ? 38.191 12.521 23.096 1.00 30.22 ? 480  TYR A CA  1 
ATOM   1387 C  C   . TYR A 1 192 ? 38.918 12.440 21.757 1.00 31.39 ? 480  TYR A C   1 
ATOM   1388 O  O   . TYR A 1 192 ? 38.420 11.826 20.809 1.00 33.22 ? 480  TYR A O   1 
ATOM   1389 C  CB  . TYR A 1 192 ? 37.076 13.569 23.030 1.00 30.23 ? 480  TYR A CB  1 
ATOM   1390 C  CG  . TYR A 1 192 ? 36.400 13.745 24.357 1.00 28.77 ? 480  TYR A CG  1 
ATOM   1391 C  CD1 . TYR A 1 192 ? 36.827 14.725 25.265 1.00 29.06 ? 480  TYR A CD1 1 
ATOM   1392 C  CD2 . TYR A 1 192 ? 35.358 12.896 24.740 1.00 28.45 ? 480  TYR A CD2 1 
ATOM   1393 C  CE1 . TYR A 1 192 ? 36.219 14.861 26.495 1.00 27.51 ? 480  TYR A CE1 1 
ATOM   1394 C  CE2 . TYR A 1 192 ? 34.748 13.022 25.976 1.00 27.71 ? 480  TYR A CE2 1 
ATOM   1395 C  CZ  . TYR A 1 192 ? 35.178 13.998 26.851 1.00 28.63 ? 480  TYR A CZ  1 
ATOM   1396 O  OH  . TYR A 1 192 ? 34.550 14.106 28.066 1.00 28.59 ? 480  TYR A OH  1 
ATOM   1397 N  N   . TRP A 1 193 ? 40.096 13.064 21.678 1.00 32.07 ? 481  TRP A N   1 
ATOM   1398 C  CA  . TRP A 1 193 ? 40.881 13.087 20.438 1.00 30.27 ? 481  TRP A CA  1 
ATOM   1399 C  C   . TRP A 1 193 ? 42.010 12.060 20.404 1.00 29.39 ? 481  TRP A C   1 
ATOM   1400 O  O   . TRP A 1 193 ? 42.679 11.918 19.384 1.00 30.37 ? 481  TRP A O   1 
ATOM   1401 C  CB  . TRP A 1 193 ? 41.465 14.482 20.236 1.00 28.98 ? 481  TRP A CB  1 
ATOM   1402 C  CG  . TRP A 1 193 ? 40.462 15.498 19.833 1.00 27.47 ? 481  TRP A CG  1 
ATOM   1403 C  CD1 . TRP A 1 193 ? 40.152 15.884 18.554 1.00 30.77 ? 481  TRP A CD1 1 
ATOM   1404 C  CD2 . TRP A 1 193 ? 39.624 16.260 20.697 1.00 27.15 ? 481  TRP A CD2 1 
ATOM   1405 N  NE1 . TRP A 1 193 ? 39.181 16.847 18.578 1.00 29.55 ? 481  TRP A NE1 1 
ATOM   1406 C  CE2 . TRP A 1 193 ? 38.836 17.099 19.882 1.00 28.89 ? 481  TRP A CE2 1 
ATOM   1407 C  CE3 . TRP A 1 193 ? 39.463 16.324 22.081 1.00 28.21 ? 481  TRP A CE3 1 
ATOM   1408 C  CZ2 . TRP A 1 193 ? 37.902 17.997 20.416 1.00 31.40 ? 481  TRP A CZ2 1 
ATOM   1409 C  CZ3 . TRP A 1 193 ? 38.527 17.223 22.614 1.00 30.41 ? 481  TRP A CZ3 1 
ATOM   1410 C  CH2 . TRP A 1 193 ? 37.773 18.051 21.783 1.00 29.64 ? 481  TRP A CH2 1 
ATOM   1411 N  N   . MET A 1 194 ? 42.209 11.347 21.508 1.00 30.08 ? 482  MET A N   1 
ATOM   1412 C  CA  . MET A 1 194 ? 43.360 10.437 21.674 1.00 30.41 ? 482  MET A CA  1 
ATOM   1413 C  C   . MET A 1 194 ? 43.232 9.194  20.837 1.00 31.41 ? 482  MET A C   1 
ATOM   1414 O  O   . MET A 1 194 ? 42.132 8.640  20.719 1.00 32.03 ? 482  MET A O   1 
ATOM   1415 C  CB  . MET A 1 194 ? 43.494 9.998  23.112 1.00 29.36 ? 482  MET A CB  1 
ATOM   1416 C  CG  . MET A 1 194 ? 43.977 11.068 24.044 1.00 29.45 ? 482  MET A CG  1 
ATOM   1417 S  SD  . MET A 1 194 ? 44.105 10.373 25.677 1.00 33.41 ? 482  MET A SD  1 
ATOM   1418 C  CE  . MET A 1 194 ? 44.825 11.728 26.574 1.00 30.56 ? 482  MET A CE  1 
ATOM   1419 N  N   . ALA A 1 195 ? 44.361 8.760  20.266 1.00 30.63 ? 483  ALA A N   1 
ATOM   1420 C  CA  . ALA A 1 195 ? 44.397 7.547  19.459 1.00 28.52 ? 483  ALA A CA  1 
ATOM   1421 C  C   . ALA A 1 195 ? 44.339 6.331  20.352 1.00 28.66 ? 483  ALA A C   1 
ATOM   1422 O  O   . ALA A 1 195 ? 44.855 6.355  21.446 1.00 29.00 ? 483  ALA A O   1 
ATOM   1423 C  CB  . ALA A 1 195 ? 45.631 7.501  18.585 1.00 28.52 ? 483  ALA A CB  1 
ATOM   1424 N  N   . PRO A 1 196 ? 43.704 5.249  19.868 1.00 31.66 ? 484  PRO A N   1 
ATOM   1425 C  CA  . PRO A 1 196 ? 43.557 4.042  20.670 1.00 31.71 ? 484  PRO A CA  1 
ATOM   1426 C  C   . PRO A 1 196 ? 44.875 3.484  21.212 1.00 31.90 ? 484  PRO A C   1 
ATOM   1427 O  O   . PRO A 1 196 ? 44.880 2.926  22.305 1.00 31.21 ? 484  PRO A O   1 
ATOM   1428 C  CB  . PRO A 1 196 ? 42.913 3.021  19.709 1.00 31.14 ? 484  PRO A CB  1 
ATOM   1429 C  CG  . PRO A 1 196 ? 42.596 3.730  18.469 1.00 33.90 ? 484  PRO A CG  1 
ATOM   1430 C  CD  . PRO A 1 196 ? 43.092 5.134  18.531 1.00 28.64 ? 484  PRO A CD  1 
ATOM   1431 N  N   . GLU A 1 197 ? 45.959 3.572  20.435 1.00 30.60 ? 485  GLU A N   1 
ATOM   1432 C  CA  . GLU A 1 197 ? 47.227 3.006  20.869 1.00 29.37 ? 485  GLU A CA  1 
ATOM   1433 C  C   . GLU A 1 197 ? 47.830 3.814  22.012 1.00 29.51 ? 485  GLU A C   1 
ATOM   1434 O  O   . GLU A 1 197 ? 48.581 3.284  22.814 1.00 29.61 ? 485  GLU A O   1 
ATOM   1435 C  CB  . GLU A 1 197 ? 48.234 2.858  19.705 1.00 28.82 ? 485  GLU A CB  1 
ATOM   1436 C  CG  . GLU A 1 197 ? 48.705 4.147  19.072 1.00 30.97 ? 485  GLU A CG  1 
ATOM   1437 C  CD  . GLU A 1 197 ? 47.869 4.619  17.879 1.00 30.91 ? 485  GLU A CD  1 
ATOM   1438 O  OE1 . GLU A 1 197 ? 46.669 4.259  17.749 1.00 25.41 ? 485  GLU A OE1 1 
ATOM   1439 O  OE2 . GLU A 1 197 ? 48.438 5.385  17.077 1.00 27.94 ? 485  GLU A OE2 1 
ATOM   1440 N  N   . LEU A 1 198 ? 47.500 5.102  22.061 1.00 31.16 ? 486  LEU A N   1 
ATOM   1441 C  CA  . LEU A 1 198 ? 48.009 6.016  23.066 1.00 31.40 ? 486  LEU A CA  1 
ATOM   1442 C  C   . LEU A 1 198 ? 47.210 5.832  24.339 1.00 30.71 ? 486  LEU A C   1 
ATOM   1443 O  O   . LEU A 1 198 ? 47.780 5.735  25.417 1.00 30.08 ? 486  LEU A O   1 
ATOM   1444 C  CB  . LEU A 1 198 ? 47.928 7.465  22.548 1.00 33.21 ? 486  LEU A CB  1 
ATOM   1445 C  CG  . LEU A 1 198 ? 48.406 8.601  23.463 1.00 32.92 ? 486  LEU A CG  1 
ATOM   1446 C  CD1 . LEU A 1 198 ? 48.842 9.806  22.627 1.00 32.54 ? 486  LEU A CD1 1 
ATOM   1447 C  CD2 . LEU A 1 198 ? 47.337 9.005  24.460 1.00 33.38 ? 486  LEU A CD2 1 
ATOM   1448 N  N   . ILE A 1 199 ? 45.886 5.770  24.209 1.00 30.32 ? 487  ILE A N   1 
ATOM   1449 C  CA  . ILE A 1 199 ? 45.029 5.402  25.329 1.00 30.58 ? 487  ILE A CA  1 
ATOM   1450 C  C   . ILE A 1 199 ? 45.474 4.078  25.958 1.00 32.55 ? 487  ILE A C   1 
ATOM   1451 O  O   . ILE A 1 199 ? 45.474 3.966  27.183 1.00 32.42 ? 487  ILE A O   1 
ATOM   1452 C  CB  . ILE A 1 199 ? 43.580 5.246  24.905 1.00 30.76 ? 487  ILE A CB  1 
ATOM   1453 C  CG1 . ILE A 1 199 ? 42.992 6.583  24.492 1.00 28.23 ? 487  ILE A CG1 1 
ATOM   1454 C  CG2 . ILE A 1 199 ? 42.734 4.649  26.042 1.00 27.92 ? 487  ILE A CG2 1 
ATOM   1455 C  CD1 . ILE A 1 199 ? 41.690 6.448  23.811 1.00 24.58 ? 487  ILE A CD1 1 
ATOM   1456 N  N   . SER A 1 200 ? 45.863 3.096  25.124 1.00 32.97 ? 488  SER A N   1 
ATOM   1457 C  CA  . SER A 1 200 ? 46.246 1.732  25.592 1.00 34.15 ? 488  SER A CA  1 
ATOM   1458 C  C   . SER A 1 200 ? 47.649 1.655  26.212 1.00 36.24 ? 488  SER A C   1 
ATOM   1459 O  O   . SER A 1 200 ? 48.036 0.610  26.733 1.00 37.43 ? 488  SER A O   1 
ATOM   1460 C  CB  . SER A 1 200 ? 46.206 0.728  24.441 1.00 31.99 ? 488  SER A CB  1 
ATOM   1461 O  OG  . SER A 1 200 ? 45.003 0.807  23.703 1.00 36.35 ? 488  SER A OG  1 
ATOM   1462 N  N   . ARG A 1 201 ? 48.412 2.745  26.108 1.00 38.00 ? 489  ARG A N   1 
ATOM   1463 C  CA  . ARG A 1 201 ? 49.748 2.873  26.695 1.00 39.49 ? 489  ARG A CA  1 
ATOM   1464 C  C   . ARG A 1 201 ? 50.777 2.025  25.952 1.00 39.18 ? 489  ARG A C   1 
ATOM   1465 O  O   . ARG A 1 201 ? 51.689 1.466  26.547 1.00 39.89 ? 489  ARG A O   1 
ATOM   1466 C  CB  . ARG A 1 201 ? 49.734 2.535  28.190 1.00 42.15 ? 489  ARG A CB  1 
ATOM   1467 C  CG  . ARG A 1 201 ? 48.560 3.147  28.972 1.00 50.34 ? 489  ARG A CG  1 
ATOM   1468 C  CD  . ARG A 1 201 ? 48.627 4.660  28.959 1.00 53.37 ? 489  ARG A CD  1 
ATOM   1469 N  NE  . ARG A 1 201 ? 49.505 5.192  30.004 1.00 55.69 ? 489  ARG A NE  1 
ATOM   1470 C  CZ  . ARG A 1 201 ? 49.121 5.460  31.251 1.00 55.15 ? 489  ARG A CZ  1 
ATOM   1471 N  NH1 . ARG A 1 201 ? 49.998 5.965  32.103 1.00 58.59 ? 489  ARG A NH1 1 
ATOM   1472 N  NH2 . ARG A 1 201 ? 47.872 5.229  31.657 1.00 53.30 ? 489  ARG A NH2 1 
ATOM   1473 N  N   . LEU A 1 202 ? 50.629 1.970  24.638 1.00 38.75 ? 490  LEU A N   1 
ATOM   1474 C  CA  . LEU A 1 202 ? 51.509 1.203  23.791 1.00 37.98 ? 490  LEU A CA  1 
ATOM   1475 C  C   . LEU A 1 202 ? 52.490 2.157  23.156 1.00 38.13 ? 490  LEU A C   1 
ATOM   1476 O  O   . LEU A 1 202 ? 52.189 3.316  23.003 1.00 38.85 ? 490  LEU A O   1 
ATOM   1477 C  CB  . LEU A 1 202 ? 50.722 0.483  22.693 1.00 35.25 ? 490  LEU A CB  1 
ATOM   1478 C  CG  . LEU A 1 202 ? 49.728 -0.581 23.153 1.00 33.08 ? 490  LEU A CG  1 
ATOM   1479 C  CD1 . LEU A 1 202 ? 48.701 -0.842 22.062 1.00 25.72 ? 490  LEU A CD1 1 
ATOM   1480 C  CD2 . LEU A 1 202 ? 50.480 -1.816 23.553 1.00 29.41 ? 490  LEU A CD2 1 
ATOM   1481 N  N   . PRO A 1 203 ? 53.673 1.657  22.778 1.00 40.48 ? 491  PRO A N   1 
ATOM   1482 C  CA  . PRO A 1 203 ? 54.598 2.464  21.978 1.00 40.43 ? 491  PRO A CA  1 
ATOM   1483 C  C   . PRO A 1 203 ? 53.899 3.080  20.767 1.00 37.50 ? 491  PRO A C   1 
ATOM   1484 O  O   . PRO A 1 203 ? 53.296 2.356  19.962 1.00 38.63 ? 491  PRO A O   1 
ATOM   1485 C  CB  . PRO A 1 203 ? 55.663 1.446  21.532 1.00 42.05 ? 491  PRO A CB  1 
ATOM   1486 C  CG  . PRO A 1 203 ? 55.616 0.349  22.571 1.00 40.93 ? 491  PRO A CG  1 
ATOM   1487 C  CD  . PRO A 1 203 ? 54.209 0.315  23.094 1.00 38.84 ? 491  PRO A CD  1 
ATOM   1488 N  N   . TYR A 1 204 ? 53.954 4.405  20.649 1.00 34.44 ? 492  TYR A N   1 
ATOM   1489 C  CA  . TYR A 1 204 ? 53.306 5.079  19.522 1.00 31.48 ? 492  TYR A CA  1 
ATOM   1490 C  C   . TYR A 1 204 ? 54.245 6.035  18.817 1.00 30.49 ? 492  TYR A C   1 
ATOM   1491 O  O   . TYR A 1 204 ? 55.343 6.344  19.308 1.00 30.44 ? 492  TYR A O   1 
ATOM   1492 C  CB  . TYR A 1 204 ? 52.013 5.775  19.969 1.00 30.29 ? 492  TYR A CB  1 
ATOM   1493 C  CG  . TYR A 1 204 ? 52.189 6.865  21.008 1.00 29.79 ? 492  TYR A CG  1 
ATOM   1494 C  CD1 . TYR A 1 204 ? 52.582 8.146  20.646 1.00 31.25 ? 492  TYR A CD1 1 
ATOM   1495 C  CD2 . TYR A 1 204 ? 51.911 6.628  22.339 1.00 26.73 ? 492  TYR A CD2 1 
ATOM   1496 C  CE1 . TYR A 1 204 ? 52.734 9.163  21.609 1.00 33.76 ? 492  TYR A CE1 1 
ATOM   1497 C  CE2 . TYR A 1 204 ? 52.076 7.625  23.301 1.00 28.65 ? 492  TYR A CE2 1 
ATOM   1498 C  CZ  . TYR A 1 204 ? 52.487 8.882  22.940 1.00 29.31 ? 492  TYR A CZ  1 
ATOM   1499 O  OH  . TYR A 1 204 ? 52.636 9.867  23.911 1.00 29.00 ? 492  TYR A OH  1 
ATOM   1500 N  N   . GLY A 1 205 ? 53.800 6.504  17.660 1.00 31.16 ? 493  GLY A N   1 
ATOM   1501 C  CA  . GLY A 1 205 ? 54.549 7.482  16.874 1.00 31.04 ? 493  GLY A CA  1 
ATOM   1502 C  C   . GLY A 1 205 ? 53.666 8.579  16.293 1.00 29.77 ? 493  GLY A C   1 
ATOM   1503 O  O   . GLY A 1 205 ? 52.606 8.877  16.825 1.00 31.08 ? 493  GLY A O   1 
ATOM   1504 N  N   . PRO A 1 206 ? 54.119 9.202  15.198 1.00 31.97 ? 494  PRO A N   1 
ATOM   1505 C  CA  . PRO A 1 206 ? 53.429 10.254 14.471 1.00 31.81 ? 494  PRO A CA  1 
ATOM   1506 C  C   . PRO A 1 206 ? 52.007 9.926  14.042 1.00 33.33 ? 494  PRO A C   1 
ATOM   1507 O  O   . PRO A 1 206 ? 51.213 10.841 13.800 1.00 32.21 ? 494  PRO A O   1 
ATOM   1508 C  CB  . PRO A 1 206 ? 54.311 10.441 13.240 1.00 31.92 ? 494  PRO A CB  1 
ATOM   1509 C  CG  . PRO A 1 206 ? 55.650 10.120 13.713 1.00 33.93 ? 494  PRO A CG  1 
ATOM   1510 C  CD  . PRO A 1 206 ? 55.438 8.922  14.589 1.00 32.30 ? 494  PRO A CD  1 
ATOM   1511 N  N   . GLU A 1 207 ? 51.692 8.634  13.953 1.00 34.01 ? 495  GLU A N   1 
ATOM   1512 C  CA  . GLU A 1 207 ? 50.367 8.170  13.548 1.00 32.59 ? 495  GLU A CA  1 
ATOM   1513 C  C   . GLU A 1 207 ? 49.277 8.658  14.480 1.00 30.75 ? 495  GLU A C   1 
ATOM   1514 O  O   . GLU A 1 207 ? 48.139 8.797  14.054 1.00 31.24 ? 495  GLU A O   1 
ATOM   1515 C  CB  . GLU A 1 207 ? 50.306 6.632  13.481 1.00 33.13 ? 495  GLU A CB  1 
ATOM   1516 C  CG  . GLU A 1 207 ? 51.472 5.967  12.754 1.00 39.84 ? 495  GLU A CG  1 
ATOM   1517 C  CD  . GLU A 1 207 ? 52.593 5.555  13.699 1.00 38.03 ? 495  GLU A CD  1 
ATOM   1518 O  OE1 . GLU A 1 207 ? 52.379 4.672  14.548 1.00 54.47 ? 495  GLU A OE1 1 
ATOM   1519 O  OE2 . GLU A 1 207 ? 53.683 6.112  13.599 1.00 39.40 ? 495  GLU A OE2 1 
ATOM   1520 N  N   . VAL A 1 208 ? 49.597 8.887  15.753 1.00 30.78 ? 496  VAL A N   1 
ATOM   1521 C  CA  . VAL A 1 208 ? 48.587 9.385  16.694 1.00 29.68 ? 496  VAL A CA  1 
ATOM   1522 C  C   . VAL A 1 208 ? 47.947 10.699 16.253 1.00 30.75 ? 496  VAL A C   1 
ATOM   1523 O  O   . VAL A 1 208 ? 46.769 10.911 16.467 1.00 33.15 ? 496  VAL A O   1 
ATOM   1524 C  CB  . VAL A 1 208 ? 49.124 9.497  18.149 1.00 30.69 ? 496  VAL A CB  1 
ATOM   1525 C  CG1 . VAL A 1 208 ? 49.586 8.116  18.633 1.00 27.27 ? 496  VAL A CG1 1 
ATOM   1526 C  CG2 . VAL A 1 208 ? 50.225 10.563 18.282 1.00 28.48 ? 496  VAL A CG2 1 
ATOM   1527 N  N   . ASP A 1 209 ? 48.718 11.572 15.625 1.00 30.69 ? 497  ASP A N   1 
ATOM   1528 C  CA  . ASP A 1 209 ? 48.196 12.832 15.129 1.00 30.40 ? 497  ASP A CA  1 
ATOM   1529 C  C   . ASP A 1 209 ? 47.203 12.646 13.984 1.00 29.67 ? 497  ASP A C   1 
ATOM   1530 O  O   . ASP A 1 209 ? 46.305 13.471 13.793 1.00 29.55 ? 497  ASP A O   1 
ATOM   1531 C  CB  . ASP A 1 209 ? 49.342 13.717 14.628 1.00 29.73 ? 497  ASP A CB  1 
ATOM   1532 C  CG  . ASP A 1 209 ? 50.200 14.264 15.741 1.00 29.70 ? 497  ASP A CG  1 
ATOM   1533 O  OD1 . ASP A 1 209 ? 49.692 14.429 16.875 1.00 30.88 ? 497  ASP A OD1 1 
ATOM   1534 O  OD2 . ASP A 1 209 ? 51.369 14.603 15.443 1.00 29.06 ? 497  ASP A OD2 1 
ATOM   1535 N  N   . ILE A 1 210 ? 47.376 11.585 13.211 1.00 29.43 ? 498  ILE A N   1 
ATOM   1536 C  CA  . ILE A 1 210 ? 46.468 11.315 12.090 1.00 30.01 ? 498  ILE A CA  1 
ATOM   1537 C  C   . ILE A 1 210 ? 45.081 10.919 12.605 1.00 30.16 ? 498  ILE A C   1 
ATOM   1538 O  O   . ILE A 1 210 ? 44.071 11.381 12.062 1.00 29.62 ? 498  ILE A O   1 
ATOM   1539 C  CB  . ILE A 1 210 ? 47.045 10.271 11.122 1.00 28.63 ? 498  ILE A CB  1 
ATOM   1540 C  CG1 . ILE A 1 210 ? 48.393 10.754 10.569 1.00 27.36 ? 498  ILE A CG1 1 
ATOM   1541 C  CG2 . ILE A 1 210 ? 46.069 9.974  9.982  1.00 27.64 ? 498  ILE A CG2 1 
ATOM   1542 C  CD1 . ILE A 1 210 ? 48.337 12.094 9.795  1.00 26.45 ? 498  ILE A CD1 1 
ATOM   1543 N  N   . TRP A 1 211 ? 45.033 10.099 13.661 1.00 30.17 ? 499  TRP A N   1 
ATOM   1544 C  CA  . TRP A 1 211 ? 43.761 9.747  14.309 1.00 30.92 ? 499  TRP A CA  1 
ATOM   1545 C  C   . TRP A 1 211 ? 43.072 11.009 14.840 1.00 32.85 ? 499  TRP A C   1 
ATOM   1546 O  O   . TRP A 1 211 ? 41.925 11.313 14.485 1.00 33.75 ? 499  TRP A O   1 
ATOM   1547 C  CB  . TRP A 1 211 ? 43.974 8.754  15.471 1.00 31.24 ? 499  TRP A CB  1 
ATOM   1548 C  CG  . TRP A 1 211 ? 42.677 8.382  16.163 1.00 29.35 ? 499  TRP A CG  1 
ATOM   1549 C  CD1 . TRP A 1 211 ? 42.065 9.065  17.158 1.00 31.11 ? 499  TRP A CD1 1 
ATOM   1550 C  CD2 . TRP A 1 211 ? 41.838 7.245  15.883 1.00 31.83 ? 499  TRP A CD2 1 
ATOM   1551 N  NE1 . TRP A 1 211 ? 40.895 8.444  17.523 1.00 27.21 ? 499  TRP A NE1 1 
ATOM   1552 C  CE2 . TRP A 1 211 ? 40.722 7.329  16.749 1.00 28.54 ? 499  TRP A CE2 1 
ATOM   1553 C  CE3 . TRP A 1 211 ? 41.919 6.176  14.990 1.00 30.91 ? 499  TRP A CE3 1 
ATOM   1554 C  CZ2 . TRP A 1 211 ? 39.691 6.374  16.755 1.00 27.37 ? 499  TRP A CZ2 1 
ATOM   1555 C  CZ3 . TRP A 1 211 ? 40.886 5.215  14.990 1.00 29.76 ? 499  TRP A CZ3 1 
ATOM   1556 C  CH2 . TRP A 1 211 ? 39.797 5.321  15.880 1.00 29.72 ? 499  TRP A CH2 1 
ATOM   1557 N  N   . SER A 1 212 ? 43.784 11.729 15.703 1.00 32.78 ? 500  SER A N   1 
ATOM   1558 C  CA  . SER A 1 212 ? 43.316 13.006 16.236 1.00 32.34 ? 500  SER A CA  1 
ATOM   1559 C  C   . SER A 1 212 ? 42.754 13.929 15.139 1.00 30.01 ? 500  SER A C   1 
ATOM   1560 O  O   . SER A 1 212 ? 41.713 14.512 15.326 1.00 28.19 ? 500  SER A O   1 
ATOM   1561 C  CB  . SER A 1 212 ? 44.429 13.689 17.031 1.00 31.71 ? 500  SER A CB  1 
ATOM   1562 O  OG  . SER A 1 212 ? 44.697 12.948 18.206 1.00 31.03 ? 500  SER A OG  1 
ATOM   1563 N  N   . LEU A 1 213 ? 43.426 14.034 13.998 1.00 32.11 ? 501  LEU A N   1 
ATOM   1564 C  CA  . LEU A 1 213 ? 42.913 14.828 12.884 1.00 30.78 ? 501  LEU A CA  1 
ATOM   1565 C  C   . LEU A 1 213 ? 41.579 14.281 12.376 1.00 30.40 ? 501  LEU A C   1 
ATOM   1566 O  O   . LEU A 1 213 ? 40.656 15.056 12.102 1.00 33.30 ? 501  LEU A O   1 
ATOM   1567 C  CB  . LEU A 1 213 ? 43.927 14.899 11.739 1.00 31.56 ? 501  LEU A CB  1 
ATOM   1568 C  CG  . LEU A 1 213 ? 43.471 15.660 10.472 1.00 33.25 ? 501  LEU A CG  1 
ATOM   1569 C  CD1 . LEU A 1 213 ? 43.058 17.111 10.772 1.00 30.27 ? 501  LEU A CD1 1 
ATOM   1570 C  CD2 . LEU A 1 213 ? 44.562 15.624 9.449  1.00 34.38 ? 501  LEU A CD2 1 
ATOM   1571 N  N   . GLY A 1 214 ? 41.473 12.956 12.264 1.00 28.46 ? 502  GLY A N   1 
ATOM   1572 C  CA  . GLY A 1 214 ? 40.199 12.291 12.008 1.00 26.89 ? 502  GLY A CA  1 
ATOM   1573 C  C   . GLY A 1 214 ? 39.079 12.711 12.941 1.00 29.21 ? 502  GLY A C   1 
ATOM   1574 O  O   . GLY A 1 214 ? 37.943 12.949 12.511 1.00 27.52 ? 502  GLY A O   1 
ATOM   1575 N  N   . ILE A 1 215 ? 39.380 12.780 14.240 1.00 29.01 ? 503  ILE A N   1 
ATOM   1576 C  CA  . ILE A 1 215 ? 38.390 13.233 15.213 1.00 29.21 ? 503  ILE A CA  1 
ATOM   1577 C  C   . ILE A 1 215 ? 37.995 14.710 14.998 1.00 30.14 ? 503  ILE A C   1 
ATOM   1578 O  O   . ILE A 1 215 ? 36.835 15.103 15.206 1.00 30.84 ? 503  ILE A O   1 
ATOM   1579 C  CB  . ILE A 1 215 ? 38.889 13.041 16.669 1.00 27.51 ? 503  ILE A CB  1 
ATOM   1580 C  CG1 . ILE A 1 215 ? 39.174 11.571 16.936 1.00 26.52 ? 503  ILE A CG1 1 
ATOM   1581 C  CG2 . ILE A 1 215 ? 37.822 13.528 17.651 1.00 26.53 ? 503  ILE A CG2 1 
ATOM   1582 C  CD1 . ILE A 1 215 ? 37.952 10.663 16.781 1.00 25.89 ? 503  ILE A CD1 1 
ATOM   1583 N  N   . MET A 1 216 ? 38.970 15.529 14.609 1.00 31.80 ? 504  MET A N   1 
ATOM   1584 C  CA  . MET A 1 216 ? 38.723 16.934 14.298 1.00 30.84 ? 504  MET A CA  1 
ATOM   1585 C  C   . MET A 1 216 ? 37.897 17.100 13.011 1.00 29.78 ? 504  MET A C   1 
ATOM   1586 O  O   . MET A 1 216 ? 37.110 18.037 12.896 1.00 29.97 ? 504  MET A O   1 
ATOM   1587 C  CB  . MET A 1 216 ? 40.041 17.680 14.203 1.00 30.60 ? 504  MET A CB  1 
ATOM   1588 C  CG  . MET A 1 216 ? 39.850 19.193 14.113 1.00 35.17 ? 504  MET A CG  1 
ATOM   1589 S  SD  . MET A 1 216 ? 41.380 20.093 14.005 1.00 34.02 ? 504  MET A SD  1 
ATOM   1590 C  CE  . MET A 1 216 ? 41.645 20.050 12.243 1.00 27.35 ? 504  MET A CE  1 
ATOM   1591 N  N   . VAL A 1 217 ? 38.058 16.199 12.048 1.00 30.67 ? 505  VAL A N   1 
ATOM   1592 C  CA  . VAL A 1 217 ? 37.099 16.121 10.928 1.00 30.77 ? 505  VAL A CA  1 
ATOM   1593 C  C   . VAL A 1 217 ? 35.660 15.864 11.429 1.00 31.40 ? 505  VAL A C   1 
ATOM   1594 O  O   . VAL A 1 217 ? 34.706 16.514 10.988 1.00 31.79 ? 505  VAL A O   1 
ATOM   1595 C  CB  . VAL A 1 217 ? 37.525 15.077 9.863  1.00 32.12 ? 505  VAL A CB  1 
ATOM   1596 C  CG1 . VAL A 1 217 ? 36.485 15.012 8.731  1.00 29.19 ? 505  VAL A CG1 1 
ATOM   1597 C  CG2 . VAL A 1 217 ? 38.946 15.431 9.317  1.00 23.80 ? 505  VAL A CG2 1 
ATOM   1598 N  N   . ILE A 1 218 ? 35.501 14.938 12.367 1.00 31.76 ? 506  ILE A N   1 
ATOM   1599 C  CA  . ILE A 1 218 ? 34.187 14.728 13.015 1.00 30.51 ? 506  ILE A CA  1 
ATOM   1600 C  C   . ILE A 1 218 ? 33.657 16.002 13.657 1.00 32.01 ? 506  ILE A C   1 
ATOM   1601 O  O   . ILE A 1 218 ? 32.473 16.297 13.534 1.00 32.50 ? 506  ILE A O   1 
ATOM   1602 C  CB  . ILE A 1 218 ? 34.179 13.537 14.032 1.00 28.89 ? 506  ILE A CB  1 
ATOM   1603 C  CG1 . ILE A 1 218 ? 34.498 12.230 13.288 1.00 29.52 ? 506  ILE A CG1 1 
ATOM   1604 C  CG2 . ILE A 1 218 ? 32.788 13.408 14.754 1.00 27.73 ? 506  ILE A CG2 1 
ATOM   1605 C  CD1 . ILE A 1 218 ? 34.354 10.919 14.129 1.00 27.59 ? 506  ILE A CD1 1 
ATOM   1606 N  N   . GLU A 1 219 ? 34.523 16.755 14.335 1.00 32.08 ? 507  GLU A N   1 
ATOM   1607 C  CA  . GLU A 1 219 ? 34.135 18.058 14.878 1.00 30.37 ? 507  GLU A CA  1 
ATOM   1608 C  C   . GLU A 1 219 ? 33.622 18.986 13.809 1.00 28.04 ? 507  GLU A C   1 
ATOM   1609 O  O   . GLU A 1 219 ? 32.631 19.699 14.008 1.00 26.66 ? 507  GLU A O   1 
ATOM   1610 C  CB  . GLU A 1 219 ? 35.313 18.780 15.511 1.00 28.70 ? 507  GLU A CB  1 
ATOM   1611 C  CG  . GLU A 1 219 ? 35.854 18.252 16.788 1.00 31.62 ? 507  GLU A CG  1 
ATOM   1612 C  CD  . GLU A 1 219 ? 36.850 19.251 17.360 1.00 30.41 ? 507  GLU A CD  1 
ATOM   1613 O  OE1 . GLU A 1 219 ? 38.071 19.075 17.164 1.00 32.66 ? 507  GLU A OE1 1 
ATOM   1614 O  OE2 . GLU A 1 219 ? 36.396 20.272 17.895 1.00 31.30 ? 507  GLU A OE2 1 
ATOM   1615 N  N   . MET A 1 220 ? 34.336 19.013 12.688 1.00 29.85 ? 508  MET A N   1 
ATOM   1616 C  CA  . MET A 1 220 ? 34.013 19.921 11.592 1.00 28.30 ? 508  MET A CA  1 
ATOM   1617 C  C   . MET A 1 220 ? 32.698 19.577 10.930 1.00 29.23 ? 508  MET A C   1 
ATOM   1618 O  O   . MET A 1 220 ? 31.981 20.484 10.523 1.00 29.91 ? 508  MET A O   1 
ATOM   1619 C  CB  . MET A 1 220 ? 35.135 19.985 10.548 1.00 28.69 ? 508  MET A CB  1 
ATOM   1620 C  CG  . MET A 1 220 ? 36.370 20.714 11.042 1.00 33.00 ? 508  MET A CG  1 
ATOM   1621 S  SD  . MET A 1 220 ? 37.596 21.040 9.756  1.00 33.22 ? 508  MET A SD  1 
ATOM   1622 C  CE  . MET A 1 220 ? 38.615 19.569 9.760  1.00 24.72 ? 508  MET A CE  1 
ATOM   1623 N  N   . VAL A 1 221 ? 32.372 18.285 10.854 1.00 29.70 ? 509  VAL A N   1 
ATOM   1624 C  CA  . VAL A 1 221 ? 31.106 17.807 10.267 1.00 29.76 ? 509  VAL A CA  1 
ATOM   1625 C  C   . VAL A 1 221 ? 29.923 17.767 11.255 1.00 30.39 ? 509  VAL A C   1 
ATOM   1626 O  O   . VAL A 1 221 ? 28.816 18.181 10.907 1.00 30.43 ? 509  VAL A O   1 
ATOM   1627 C  CB  . VAL A 1 221 ? 31.284 16.379 9.649  1.00 30.68 ? 509  VAL A CB  1 
ATOM   1628 C  CG1 . VAL A 1 221 ? 29.915 15.774 9.195  1.00 27.73 ? 509  VAL A CG1 1 
ATOM   1629 C  CG2 . VAL A 1 221 ? 32.285 16.447 8.493  1.00 26.07 ? 509  VAL A CG2 1 
ATOM   1630 N  N   . ASP A 1 222 ? 30.156 17.236 12.458 1.00 29.69 ? 510  ASP A N   1 
ATOM   1631 C  CA  . ASP A 1 222 ? 29.110 17.006 13.446 1.00 30.48 ? 510  ASP A CA  1 
ATOM   1632 C  C   . ASP A 1 222 ? 29.095 18.049 14.556 1.00 32.94 ? 510  ASP A C   1 
ATOM   1633 O  O   . ASP A 1 222 ? 28.137 18.083 15.328 1.00 32.97 ? 510  ASP A O   1 
ATOM   1634 C  CB  . ASP A 1 222 ? 29.274 15.633 14.127 1.00 34.28 ? 510  ASP A CB  1 
ATOM   1635 C  CG  . ASP A 1 222 ? 28.906 14.442 13.228 1.00 33.16 ? 510  ASP A CG  1 
ATOM   1636 O  OD1 . ASP A 1 222 ? 28.351 14.620 12.119 1.00 37.01 ? 510  ASP A OD1 1 
ATOM   1637 O  OD2 . ASP A 1 222 ? 29.189 13.306 13.667 1.00 38.11 ? 510  ASP A OD2 1 
ATOM   1638 N  N   . GLY A 1 223 ? 30.144 18.870 14.673 1.00 33.38 ? 511  GLY A N   1 
ATOM   1639 C  CA  . GLY A 1 223 ? 30.171 19.932 15.690 1.00 34.61 ? 511  GLY A CA  1 
ATOM   1640 C  C   . GLY A 1 223 ? 30.908 19.582 16.975 1.00 35.87 ? 511  GLY A C   1 
ATOM   1641 O  O   . GLY A 1 223 ? 31.260 20.471 17.759 1.00 37.26 ? 511  GLY A O   1 
ATOM   1642 N  N   . GLU A 1 224 ? 31.164 18.288 17.179 1.00 35.50 ? 512  GLU A N   1 
ATOM   1643 C  CA  . GLU A 1 224 ? 31.724 17.763 18.430 1.00 34.23 ? 512  GLU A CA  1 
ATOM   1644 C  C   . GLU A 1 224 ? 32.456 16.463 18.152 1.00 32.68 ? 512  GLU A C   1 
ATOM   1645 O  O   . GLU A 1 224 ? 32.128 15.779 17.202 1.00 31.33 ? 512  GLU A O   1 
ATOM   1646 C  CB  . GLU A 1 224 ? 30.605 17.428 19.405 1.00 33.09 ? 512  GLU A CB  1 
ATOM   1647 C  CG  . GLU A 1 224 ? 30.105 18.567 20.221 1.00 42.25 ? 512  GLU A CG  1 
ATOM   1648 C  CD  . GLU A 1 224 ? 28.952 18.156 21.137 1.00 40.53 ? 512  GLU A CD  1 
ATOM   1649 O  OE1 . GLU A 1 224 ? 28.523 16.977 21.071 1.00 42.55 ? 512  GLU A OE1 1 
ATOM   1650 O  OE2 . GLU A 1 224 ? 28.495 19.022 21.919 1.00 44.29 ? 512  GLU A OE2 1 
ATOM   1651 N  N   . PRO A 1 225 ? 33.422 16.097 19.012 1.00 32.23 ? 513  PRO A N   1 
ATOM   1652 C  CA  . PRO A 1 225 ? 34.030 14.804 18.877 1.00 32.77 ? 513  PRO A CA  1 
ATOM   1653 C  C   . PRO A 1 225 ? 33.055 13.711 19.364 1.00 34.53 ? 513  PRO A C   1 
ATOM   1654 O  O   . PRO A 1 225 ? 32.090 14.019 20.064 1.00 36.13 ? 513  PRO A O   1 
ATOM   1655 C  CB  . PRO A 1 225 ? 35.261 14.913 19.788 1.00 33.56 ? 513  PRO A CB  1 
ATOM   1656 C  CG  . PRO A 1 225 ? 34.825 15.796 20.855 1.00 32.51 ? 513  PRO A CG  1 
ATOM   1657 C  CD  . PRO A 1 225 ? 33.980 16.838 20.160 1.00 32.36 ? 513  PRO A CD  1 
ATOM   1658 N  N   . PRO A 1 226 ? 33.285 12.446 18.978 1.00 33.01 ? 514  PRO A N   1 
ATOM   1659 C  CA  . PRO A 1 226 ? 32.448 11.357 19.451 1.00 33.59 ? 514  PRO A CA  1 
ATOM   1660 C  C   . PRO A 1 226 ? 32.500 11.245 20.969 1.00 33.45 ? 514  PRO A C   1 
ATOM   1661 O  O   . PRO A 1 226 ? 33.521 11.578 21.566 1.00 34.18 ? 514  PRO A O   1 
ATOM   1662 C  CB  . PRO A 1 226 ? 33.092 10.125 18.815 1.00 33.40 ? 514  PRO A CB  1 
ATOM   1663 C  CG  . PRO A 1 226 ? 33.804 10.646 17.630 1.00 33.47 ? 514  PRO A CG  1 
ATOM   1664 C  CD  . PRO A 1 226 ? 34.329 11.964 18.067 1.00 33.71 ? 514  PRO A CD  1 
ATOM   1665 N  N   . TYR A 1 227 ? 31.393 10.821 21.574 1.00 32.40 ? 515  TYR A N   1 
ATOM   1666 C  CA  . TYR A 1 227 ? 31.322 10.540 23.008 1.00 35.46 ? 515  TYR A CA  1 
ATOM   1667 C  C   . TYR A 1 227 ? 31.603 11.753 23.903 1.00 35.50 ? 515  TYR A C   1 
ATOM   1668 O  O   . TYR A 1 227 ? 31.966 11.588 25.075 1.00 35.50 ? 515  TYR A O   1 
ATOM   1669 C  CB  . TYR A 1 227 ? 32.280 9.392  23.395 1.00 36.11 ? 515  TYR A CB  1 
ATOM   1670 C  CG  . TYR A 1 227 ? 32.395 8.263  22.380 1.00 36.77 ? 515  TYR A CG  1 
ATOM   1671 C  CD1 . TYR A 1 227 ? 31.275 7.520  21.992 1.00 42.76 ? 515  TYR A CD1 1 
ATOM   1672 C  CD2 . TYR A 1 227 ? 33.630 7.915  21.829 1.00 38.50 ? 515  TYR A CD2 1 
ATOM   1673 C  CE1 . TYR A 1 227 ? 31.382 6.471  21.062 1.00 40.52 ? 515  TYR A CE1 1 
ATOM   1674 C  CE2 . TYR A 1 227 ? 33.745 6.866  20.893 1.00 35.63 ? 515  TYR A CE2 1 
ATOM   1675 C  CZ  . TYR A 1 227 ? 32.628 6.150  20.521 1.00 38.78 ? 515  TYR A CZ  1 
ATOM   1676 O  OH  . TYR A 1 227 ? 32.748 5.121  19.596 1.00 37.65 ? 515  TYR A OH  1 
ATOM   1677 N  N   . PHE A 1 228 ? 31.405 12.953 23.355 1.00 36.33 ? 516  PHE A N   1 
ATOM   1678 C  CA  . PHE A 1 228 ? 31.769 14.199 24.026 1.00 36.02 ? 516  PHE A CA  1 
ATOM   1679 C  C   . PHE A 1 228 ? 31.015 14.457 25.327 1.00 36.94 ? 516  PHE A C   1 
ATOM   1680 O  O   . PHE A 1 228 ? 31.534 15.121 26.215 1.00 38.38 ? 516  PHE A O   1 
ATOM   1681 C  CB  . PHE A 1 228 ? 31.554 15.388 23.096 1.00 35.08 ? 516  PHE A CB  1 
ATOM   1682 C  CG  . PHE A 1 228 ? 32.327 16.630 23.500 1.00 34.21 ? 516  PHE A CG  1 
ATOM   1683 C  CD1 . PHE A 1 228 ? 33.675 16.559 23.809 1.00 27.87 ? 516  PHE A CD1 1 
ATOM   1684 C  CD2 . PHE A 1 228 ? 31.706 17.869 23.532 1.00 36.09 ? 516  PHE A CD2 1 
ATOM   1685 C  CE1 . PHE A 1 228 ? 34.385 17.682 24.173 1.00 30.34 ? 516  PHE A CE1 1 
ATOM   1686 C  CE2 . PHE A 1 228 ? 32.415 19.013 23.879 1.00 32.87 ? 516  PHE A CE2 1 
ATOM   1687 C  CZ  . PHE A 1 228 ? 33.756 18.917 24.199 1.00 36.03 ? 516  PHE A CZ  1 
ATOM   1688 N  N   . ASN A 1 229 ? 29.793 13.944 25.415 1.00 38.35 ? 517  ASN A N   1 
ATOM   1689 C  CA  . ASN A 1 229 ? 28.976 14.045 26.617 1.00 40.82 ? 517  ASN A CA  1 
ATOM   1690 C  C   . ASN A 1 229 ? 29.233 12.948 27.648 1.00 38.72 ? 517  ASN A C   1 
ATOM   1691 O  O   . ASN A 1 229 ? 28.540 12.901 28.654 1.00 37.22 ? 517  ASN A O   1 
ATOM   1692 C  CB  . ASN A 1 229 ? 27.488 14.022 26.247 1.00 44.22 ? 517  ASN A CB  1 
ATOM   1693 C  CG  . ASN A 1 229 ? 27.037 12.660 25.757 1.00 53.23 ? 517  ASN A CG  1 
ATOM   1694 O  OD1 . ASN A 1 229 ? 27.706 12.044 24.909 1.00 61.01 ? 517  ASN A OD1 1 
ATOM   1695 N  ND2 . ASN A 1 229 ? 25.908 12.172 26.285 1.00 60.11 ? 517  ASN A ND2 1 
ATOM   1696 N  N   . GLU A 1 230 ? 30.207 12.070 27.393 1.00 36.33 ? 518  GLU A N   1 
ATOM   1697 C  CA  . GLU A 1 230 ? 30.586 11.038 28.340 1.00 34.99 ? 518  GLU A CA  1 
ATOM   1698 C  C   . GLU A 1 230 ? 31.759 11.536 29.176 1.00 35.39 ? 518  GLU A C   1 
ATOM   1699 O  O   . GLU A 1 230 ? 32.610 12.270 28.664 1.00 36.19 ? 518  GLU A O   1 
ATOM   1700 C  CB  . GLU A 1 230 ? 31.036 9.762  27.615 1.00 34.61 ? 518  GLU A CB  1 
ATOM   1701 C  CG  . GLU A 1 230 ? 30.016 9.144  26.653 1.00 37.41 ? 518  GLU A CG  1 
ATOM   1702 C  CD  . GLU A 1 230 ? 28.893 8.379  27.341 1.00 41.44 ? 518  GLU A CD  1 
ATOM   1703 O  OE1 . GLU A 1 230 ? 28.937 8.182  28.575 1.00 39.70 ? 518  GLU A OE1 1 
ATOM   1704 O  OE2 . GLU A 1 230 ? 27.958 7.972  26.625 1.00 46.94 ? 518  GLU A OE2 1 
ATOM   1705 N  N   . PRO A 1 231 ? 31.862 11.074 30.438 1.00 34.59 ? 519  PRO A N   1 
ATOM   1706 C  CA  . PRO A 1 231 ? 33.073 11.367 31.191 1.00 35.20 ? 519  PRO A CA  1 
ATOM   1707 C  C   . PRO A 1 231 ? 34.301 10.980 30.343 1.00 36.03 ? 519  PRO A C   1 
ATOM   1708 O  O   . PRO A 1 231 ? 34.255 9.966  29.644 1.00 32.13 ? 519  PRO A O   1 
ATOM   1709 C  CB  . PRO A 1 231 ? 32.961 10.452 32.422 1.00 36.71 ? 519  PRO A CB  1 
ATOM   1710 C  CG  . PRO A 1 231 ? 31.504 10.149 32.561 1.00 36.41 ? 519  PRO A CG  1 
ATOM   1711 C  CD  . PRO A 1 231 ? 30.925 10.208 31.180 1.00 33.47 ? 519  PRO A CD  1 
ATOM   1712 N  N   . PRO A 1 232 ? 35.389 11.776 30.398 1.00 38.21 ? 520  PRO A N   1 
ATOM   1713 C  CA  . PRO A 1 232 ? 36.560 11.498 29.553 1.00 37.88 ? 520  PRO A CA  1 
ATOM   1714 C  C   . PRO A 1 232 ? 37.152 10.077 29.646 1.00 38.59 ? 520  PRO A C   1 
ATOM   1715 O  O   . PRO A 1 232 ? 37.524 9.536  28.616 1.00 38.31 ? 520  PRO A O   1 
ATOM   1716 C  CB  . PRO A 1 232 ? 37.575 12.561 29.990 1.00 38.12 ? 520  PRO A CB  1 
ATOM   1717 C  CG  . PRO A 1 232 ? 37.086 13.063 31.309 1.00 38.39 ? 520  PRO A CG  1 
ATOM   1718 C  CD  . PRO A 1 232 ? 35.602 12.970 31.234 1.00 38.38 ? 520  PRO A CD  1 
ATOM   1719 N  N   . LEU A 1 233 ? 37.237 9.487  30.843 1.00 39.19 ? 521  LEU A N   1 
ATOM   1720 C  CA  . LEU A 1 233 ? 37.721 8.102  31.000 1.00 40.67 ? 521  LEU A CA  1 
ATOM   1721 C  C   . LEU A 1 233 ? 36.806 7.060  30.333 1.00 40.25 ? 521  LEU A C   1 
ATOM   1722 O  O   . LEU A 1 233 ? 37.302 6.092  29.764 1.00 41.40 ? 521  LEU A O   1 
ATOM   1723 C  CB  . LEU A 1 233 ? 37.908 7.730  32.475 1.00 43.90 ? 521  LEU A CB  1 
ATOM   1724 C  CG  . LEU A 1 233 ? 39.191 8.222  33.149 1.00 51.24 ? 521  LEU A CG  1 
ATOM   1725 C  CD1 . LEU A 1 233 ? 39.085 8.126  34.685 1.00 53.25 ? 521  LEU A CD1 1 
ATOM   1726 C  CD2 . LEU A 1 233 ? 40.389 7.425  32.631 1.00 60.75 ? 521  LEU A CD2 1 
ATOM   1727 N  N   . LYS A 1 234 ? 35.489 7.252  30.415 1.00 37.99 ? 522  LYS A N   1 
ATOM   1728 C  CA  . LYS A 1 234 ? 34.530 6.428  29.658 1.00 38.94 ? 522  LYS A CA  1 
ATOM   1729 C  C   . LYS A 1 234 ? 34.684 6.592  28.123 1.00 38.01 ? 522  LYS A C   1 
ATOM   1730 O  O   . LYS A 1 234 ? 34.537 5.616  27.378 1.00 38.48 ? 522  LYS A O   1 
ATOM   1731 C  CB  . LYS A 1 234 ? 33.083 6.753  30.069 1.00 39.19 ? 522  LYS A CB  1 
ATOM   1732 C  CG  . LYS A 1 234 ? 32.158 5.549  30.266 1.00 45.49 ? 522  LYS A CG  1 
ATOM   1733 C  CD  . LYS A 1 234 ? 32.044 4.673  29.023 1.00 54.40 ? 522  LYS A CD  1 
ATOM   1734 N  N   . ALA A 1 235 ? 34.954 7.808  27.643 1.00 36.05 ? 523  ALA A N   1 
ATOM   1735 C  CA  . ALA A 1 235 ? 35.148 8.021  26.195 1.00 35.91 ? 523  ALA A CA  1 
ATOM   1736 C  C   . ALA A 1 235 ? 36.425 7.324  25.702 1.00 34.65 ? 523  ALA A C   1 
ATOM   1737 O  O   . ALA A 1 235 ? 36.461 6.751  24.603 1.00 34.27 ? 523  ALA A O   1 
ATOM   1738 C  CB  . ALA A 1 235 ? 35.189 9.508  25.867 1.00 36.71 ? 523  ALA A CB  1 
ATOM   1739 N  N   . MET A 1 236 ? 37.469 7.372  26.525 1.00 34.23 ? 524  MET A N   1 
ATOM   1740 C  CA  . MET A 1 236 ? 38.739 6.733  26.212 1.00 34.07 ? 524  MET A CA  1 
ATOM   1741 C  C   . MET A 1 236 ? 38.600 5.199  26.136 1.00 35.25 ? 524  MET A C   1 
ATOM   1742 O  O   . MET A 1 236 ? 39.164 4.601  25.242 1.00 37.07 ? 524  MET A O   1 
ATOM   1743 C  CB  . MET A 1 236 ? 39.809 7.140  27.227 1.00 33.37 ? 524  MET A CB  1 
ATOM   1744 C  CG  . MET A 1 236 ? 40.245 8.595  27.131 1.00 34.19 ? 524  MET A CG  1 
ATOM   1745 S  SD  . MET A 1 236 ? 41.100 9.156  28.618 1.00 34.24 ? 524  MET A SD  1 
ATOM   1746 C  CE  . MET A 1 236 ? 42.648 8.260  28.445 1.00 30.25 ? 524  MET A CE  1 
ATOM   1747 N  N   . LYS A 1 237 ? 37.854 4.585  27.061 1.00 35.27 ? 525  LYS A N   1 
ATOM   1748 C  CA  . LYS A 1 237 ? 37.509 3.153  26.995 1.00 36.95 ? 525  LYS A CA  1 
ATOM   1749 C  C   . LYS A 1 237 ? 36.747 2.776  25.712 1.00 34.43 ? 525  LYS A C   1 
ATOM   1750 O  O   . LYS A 1 237 ? 37.043 1.770  25.086 1.00 33.39 ? 525  LYS A O   1 
ATOM   1751 C  CB  . LYS A 1 237 ? 36.704 2.715  28.234 1.00 37.43 ? 525  LYS A CB  1 
ATOM   1752 C  CG  . LYS A 1 237 ? 37.521 2.710  29.534 1.00 41.84 ? 525  LYS A CG  1 
ATOM   1753 C  CD  . LYS A 1 237 ? 36.662 2.378  30.756 1.00 43.28 ? 525  LYS A CD  1 
ATOM   1754 C  CE  . LYS A 1 237 ? 37.495 2.269  32.053 1.00 48.27 ? 525  LYS A CE  1 
ATOM   1755 N  NZ  . LYS A 1 237 ? 38.039 3.583  32.504 1.00 55.05 ? 525  LYS A NZ  1 
ATOM   1756 N  N   . MET A 1 238 ? 35.786 3.600  25.326 1.00 34.85 ? 526  MET A N   1 
ATOM   1757 C  CA  . MET A 1 238 ? 35.044 3.423  24.074 1.00 36.12 ? 526  MET A CA  1 
ATOM   1758 C  C   . MET A 1 238 ? 35.881 3.583  22.809 1.00 33.98 ? 526  MET A C   1 
ATOM   1759 O  O   . MET A 1 238 ? 35.710 2.827  21.861 1.00 36.04 ? 526  MET A O   1 
ATOM   1760 C  CB  . MET A 1 238 ? 33.861 4.386  24.021 1.00 34.87 ? 526  MET A CB  1 
ATOM   1761 C  CG  . MET A 1 238 ? 32.741 4.079  25.056 1.00 40.97 ? 526  MET A CG  1 
ATOM   1762 S  SD  . MET A 1 238 ? 31.468 5.376  25.097 1.00 45.00 ? 526  MET A SD  1 
ATOM   1763 C  CE  . MET A 1 238 ? 30.378 4.684  23.850 1.00 48.72 ? 526  MET A CE  1 
ATOM   1764 N  N   . ILE A 1 239 ? 36.765 4.577  22.787 1.00 34.74 ? 527  ILE A N   1 
ATOM   1765 C  CA  . ILE A 1 239 ? 37.708 4.779  21.682 1.00 34.30 ? 527  ILE A CA  1 
ATOM   1766 C  C   . ILE A 1 239 ? 38.555 3.527  21.556 1.00 33.32 ? 527  ILE A C   1 
ATOM   1767 O  O   . ILE A 1 239 ? 38.723 2.997  20.468 1.00 29.04 ? 527  ILE A O   1 
ATOM   1768 C  CB  . ILE A 1 239 ? 38.652 5.984  21.914 1.00 33.98 ? 527  ILE A CB  1 
ATOM   1769 C  CG1 . ILE A 1 239 ? 37.878 7.300  21.858 1.00 36.26 ? 527  ILE A CG1 1 
ATOM   1770 C  CG2 . ILE A 1 239 ? 39.790 5.993  20.905 1.00 29.37 ? 527  ILE A CG2 1 
ATOM   1771 C  CD1 . ILE A 1 239 ? 38.423 8.417  22.790 1.00 38.24 ? 527  ILE A CD1 1 
ATOM   1772 N  N   . ARG A 1 240 ? 39.054 3.064  22.695 1.00 33.71 ? 528  ARG A N   1 
ATOM   1773 C  CA  . ARG A 1 240 ? 39.944 1.905  22.773 1.00 36.33 ? 528  ARG A CA  1 
ATOM   1774 C  C   . ARG A 1 240 ? 39.318 0.561  22.359 1.00 35.53 ? 528  ARG A C   1 
ATOM   1775 O  O   . ARG A 1 240 ? 40.007 -0.285 21.796 1.00 34.04 ? 528  ARG A O   1 
ATOM   1776 C  CB  . ARG A 1 240 ? 40.470 1.782  24.206 1.00 34.53 ? 528  ARG A CB  1 
ATOM   1777 C  CG  . ARG A 1 240 ? 41.571 0.755  24.388 1.00 39.37 ? 528  ARG A CG  1 
ATOM   1778 C  CD  . ARG A 1 240 ? 41.818 0.529  25.857 1.00 38.68 ? 528  ARG A CD  1 
ATOM   1779 N  NE  . ARG A 1 240 ? 40.626 -0.050 26.461 1.00 40.02 ? 528  ARG A NE  1 
ATOM   1780 C  CZ  . ARG A 1 240 ? 40.348 -0.026 27.761 1.00 43.99 ? 528  ARG A CZ  1 
ATOM   1781 N  NH1 . ARG A 1 240 ? 41.198 0.521  28.635 1.00 40.55 ? 528  ARG A NH1 1 
ATOM   1782 N  NH2 . ARG A 1 240 ? 39.208 -0.565 28.185 1.00 39.37 ? 528  ARG A NH2 1 
ATOM   1783 N  N   . ASP A 1 241 ? 38.036 0.361  22.660 1.00 35.27 ? 529  ASP A N   1 
ATOM   1784 C  CA  . ASP A 1 241 ? 37.378 -0.940 22.501 1.00 33.58 ? 529  ASP A CA  1 
ATOM   1785 C  C   . ASP A 1 241 ? 36.501 -1.073 21.282 1.00 33.95 ? 529  ASP A C   1 
ATOM   1786 O  O   . ASP A 1 241 ? 36.264 -2.187 20.813 1.00 34.54 ? 529  ASP A O   1 
ATOM   1787 C  CB  . ASP A 1 241 ? 36.466 -1.200 23.696 1.00 34.84 ? 529  ASP A CB  1 
ATOM   1788 C  CG  . ASP A 1 241 ? 37.217 -1.449 24.968 1.00 36.98 ? 529  ASP A CG  1 
ATOM   1789 O  OD1 . ASP A 1 241 ? 38.447 -1.702 24.906 1.00 36.28 ? 529  ASP A OD1 1 
ATOM   1790 O  OD2 . ASP A 1 241 ? 36.551 -1.409 26.033 1.00 41.93 ? 529  ASP A OD2 1 
ATOM   1791 N  N   . ASN A 1 242 ? 35.955 0.041  20.809 1.00 34.01 ? 530  ASN A N   1 
ATOM   1792 C  CA  . ASN A 1 242 ? 34.919 -0.003 19.779 1.00 34.52 ? 530  ASN A CA  1 
ATOM   1793 C  C   . ASN A 1 242 ? 35.461 0.218  18.380 1.00 32.25 ? 530  ASN A C   1 
ATOM   1794 O  O   . ASN A 1 242 ? 36.592 0.680  18.193 1.00 31.49 ? 530  ASN A O   1 
ATOM   1795 C  CB  . ASN A 1 242 ? 33.844 1.064  20.067 1.00 35.94 ? 530  ASN A CB  1 
ATOM   1796 C  CG  . ASN A 1 242 ? 33.093 0.810  21.368 1.00 38.55 ? 530  ASN A CG  1 
ATOM   1797 O  OD1 . ASN A 1 242 ? 33.358 -0.156 22.070 1.00 44.49 ? 530  ASN A OD1 1 
ATOM   1798 N  ND2 . ASN A 1 242 ? 32.149 1.687  21.688 1.00 44.25 ? 530  ASN A ND2 1 
ATOM   1799 N  N   . LEU A 1 243 ? 34.623 -0.105 17.405 1.00 33.77 ? 531  LEU A N   1 
ATOM   1800 C  CA  . LEU A 1 243 ? 34.816 0.298  16.009 1.00 33.74 ? 531  LEU A CA  1 
ATOM   1801 C  C   . LEU A 1 243 ? 35.092 1.807  15.880 1.00 34.06 ? 531  LEU A C   1 
ATOM   1802 O  O   . LEU A 1 243 ? 34.679 2.604  16.728 1.00 35.17 ? 531  LEU A O   1 
ATOM   1803 C  CB  . LEU A 1 243 ? 33.574 -0.084 15.178 1.00 32.50 ? 531  LEU A CB  1 
ATOM   1804 C  CG  . LEU A 1 243 ? 33.370 -1.571 14.844 1.00 34.85 ? 531  LEU A CG  1 
ATOM   1805 C  CD1 . LEU A 1 243 ? 31.894 -1.884 14.490 1.00 30.41 ? 531  LEU A CD1 1 
ATOM   1806 C  CD2 . LEU A 1 243 ? 34.310 -2.008 13.719 1.00 29.23 ? 531  LEU A CD2 1 
ATOM   1807 N  N   . PRO A 1 244 ? 35.785 2.212  14.807 1.00 35.98 ? 532  PRO A N   1 
ATOM   1808 C  CA  . PRO A 1 244 ? 36.027 3.638  14.682 1.00 37.22 ? 532  PRO A CA  1 
ATOM   1809 C  C   . PRO A 1 244 ? 34.714 4.445  14.689 1.00 37.97 ? 532  PRO A C   1 
ATOM   1810 O  O   . PRO A 1 244 ? 33.691 3.970  14.187 1.00 36.38 ? 532  PRO A O   1 
ATOM   1811 C  CB  . PRO A 1 244 ? 36.744 3.764  13.333 1.00 38.65 ? 532  PRO A CB  1 
ATOM   1812 C  CG  . PRO A 1 244 ? 37.258 2.413  13.029 1.00 37.85 ? 532  PRO A CG  1 
ATOM   1813 C  CD  . PRO A 1 244 ? 36.333 1.447  13.671 1.00 35.70 ? 532  PRO A CD  1 
ATOM   1814 N  N   . PRO A 1 245 ? 34.741 5.660  15.265 1.00 37.60 ? 533  PRO A N   1 
ATOM   1815 C  CA  . PRO A 1 245 ? 33.513 6.401  15.348 1.00 37.53 ? 533  PRO A CA  1 
ATOM   1816 C  C   . PRO A 1 245 ? 33.034 6.799  13.954 1.00 39.94 ? 533  PRO A C   1 
ATOM   1817 O  O   . PRO A 1 245 ? 33.834 6.984  13.020 1.00 39.98 ? 533  PRO A O   1 
ATOM   1818 C  CB  . PRO A 1 245 ? 33.884 7.599  16.208 1.00 38.50 ? 533  PRO A CB  1 
ATOM   1819 C  CG  . PRO A 1 245 ? 35.346 7.771  16.005 1.00 40.14 ? 533  PRO A CG  1 
ATOM   1820 C  CD  . PRO A 1 245 ? 35.879 6.399  15.827 1.00 38.69 ? 533  PRO A CD  1 
ATOM   1821 N  N   . ARG A 1 246 ? 31.725 6.869  13.791 1.00 40.87 ? 534  ARG A N   1 
ATOM   1822 C  CA  A ARG A 1 246 ? 31.158 7.280  12.515 0.50 42.23 ? 534  ARG A CA  1 
ATOM   1823 C  CA  B ARG A 1 246 ? 31.163 7.278  12.516 0.50 42.04 ? 534  ARG A CA  1 
ATOM   1824 C  C   . ARG A 1 246 ? 30.501 8.648  12.619 1.00 41.17 ? 534  ARG A C   1 
ATOM   1825 O  O   . ARG A 1 246 ? 30.156 9.110  13.707 1.00 42.23 ? 534  ARG A O   1 
ATOM   1826 C  CB  A ARG A 1 246 ? 30.192 6.221  11.949 0.50 43.35 ? 534  ARG A CB  1 
ATOM   1827 C  CB  B ARG A 1 246 ? 30.195 6.209  11.991 0.50 43.43 ? 534  ARG A CB  1 
ATOM   1828 C  CG  A ARG A 1 246 ? 29.130 5.635  12.891 0.50 43.33 ? 534  ARG A CG  1 
ATOM   1829 C  CG  B ARG A 1 246 ? 30.923 4.947  11.474 0.50 44.45 ? 534  ARG A CG  1 
ATOM   1830 C  CD  A ARG A 1 246 ? 28.759 4.222  12.419 0.50 43.91 ? 534  ARG A CD  1 
ATOM   1831 C  CD  B ARG A 1 246 ? 30.387 4.462  10.126 0.50 45.72 ? 534  ARG A CD  1 
ATOM   1832 N  NE  A ARG A 1 246 ? 27.429 3.770  12.835 0.50 47.03 ? 534  ARG A NE  1 
ATOM   1833 N  NE  B ARG A 1 246 ? 31.462 3.976  9.262  0.50 46.23 ? 534  ARG A NE  1 
ATOM   1834 C  CZ  A ARG A 1 246 ? 27.098 3.391  14.071 0.50 51.24 ? 534  ARG A CZ  1 
ATOM   1835 C  CZ  B ARG A 1 246 ? 31.281 3.453  8.049  0.50 49.79 ? 534  ARG A CZ  1 
ATOM   1836 N  NH1 A ARG A 1 246 ? 27.984 3.429  15.063 0.50 53.32 ? 534  ARG A NH1 1 
ATOM   1837 N  NH1 B ARG A 1 246 ? 30.057 3.329  7.532  0.50 43.94 ? 534  ARG A NH1 1 
ATOM   1838 N  NH2 A ARG A 1 246 ? 25.858 2.978  14.324 0.50 49.22 ? 534  ARG A NH2 1 
ATOM   1839 N  NH2 B ARG A 1 246 ? 32.335 3.039  7.349  0.50 49.72 ? 534  ARG A NH2 1 
ATOM   1840 N  N   . LEU A 1 247 ? 30.366 9.299  11.479 1.00 41.20 ? 535  LEU A N   1 
ATOM   1841 C  CA  . LEU A 1 247 ? 29.709 10.582 11.397 1.00 41.28 ? 535  LEU A CA  1 
ATOM   1842 C  C   . LEU A 1 247 ? 28.226 10.415 11.706 1.00 43.74 ? 535  LEU A C   1 
ATOM   1843 O  O   . LEU A 1 247 ? 27.583 9.535  11.144 1.00 45.23 ? 535  LEU A O   1 
ATOM   1844 C  CB  . LEU A 1 247 ? 29.896 11.155 9.998  1.00 38.97 ? 535  LEU A CB  1 
ATOM   1845 C  CG  . LEU A 1 247 ? 31.351 11.457 9.644  1.00 35.52 ? 535  LEU A CG  1 
ATOM   1846 C  CD1 . LEU A 1 247 ? 31.493 11.672 8.149  1.00 28.96 ? 535  LEU A CD1 1 
ATOM   1847 C  CD2 . LEU A 1 247 ? 31.869 12.648 10.452 1.00 32.07 ? 535  LEU A CD2 1 
ATOM   1848 N  N   . LYS A 1 248 ? 27.704 11.231 12.624 1.00 47.86 ? 536  LYS A N   1 
ATOM   1849 C  CA  . LYS A 1 248 ? 26.254 11.336 12.841 1.00 51.06 ? 536  LYS A CA  1 
ATOM   1850 C  C   . LYS A 1 248 ? 25.587 11.824 11.551 1.00 54.45 ? 536  LYS A C   1 
ATOM   1851 O  O   . LYS A 1 248 ? 24.596 11.248 11.103 1.00 57.05 ? 536  LYS A O   1 
ATOM   1852 C  CB  . LYS A 1 248 ? 25.932 12.278 14.009 1.00 51.15 ? 536  LYS A CB  1 
ATOM   1853 N  N   . ASN A 1 249 ? 26.170 12.857 10.942 1.00 57.47 ? 537  ASN A N   1 
ATOM   1854 C  CA  . ASN A 1 249 ? 25.707 13.400 9.662  1.00 59.26 ? 537  ASN A CA  1 
ATOM   1855 C  C   . ASN A 1 249 ? 26.411 12.765 8.451  1.00 59.89 ? 537  ASN A C   1 
ATOM   1856 O  O   . ASN A 1 249 ? 27.243 13.408 7.819  1.00 58.92 ? 537  ASN A O   1 
ATOM   1857 C  CB  . ASN A 1 249 ? 25.869 14.931 9.662  1.00 59.42 ? 537  ASN A CB  1 
ATOM   1858 C  CG  . ASN A 1 249 ? 25.005 15.604 10.729 1.00 59.14 ? 537  ASN A CG  1 
ATOM   1859 O  OD1 . ASN A 1 249 ? 23.776 15.457 10.725 1.00 59.86 ? 537  ASN A OD1 1 
ATOM   1860 N  ND2 . ASN A 1 249 ? 25.641 16.313 11.659 1.00 47.79 ? 537  ASN A ND2 1 
ATOM   1861 N  N   . LEU A 1 250 ? 26.017 11.524 8.114  1.00 61.92 ? 538  LEU A N   1 
ATOM   1862 C  CA  . LEU A 1 250 ? 26.714 10.680 7.109  1.00 61.06 ? 538  LEU A CA  1 
ATOM   1863 C  C   . LEU A 1 250 ? 26.159 10.857 5.692  1.00 61.70 ? 538  LEU A C   1 
ATOM   1864 O  O   . LEU A 1 250 ? 26.919 11.111 4.753  1.00 63.20 ? 538  LEU A O   1 
ATOM   1865 C  CB  . LEU A 1 250 ? 26.651 9.184  7.500  1.00 61.73 ? 538  LEU A CB  1 
ATOM   1866 C  CG  . LEU A 1 250 ? 27.876 8.261  7.286  1.00 61.12 ? 538  LEU A CG  1 
ATOM   1867 C  CD1 . LEU A 1 250 ? 27.467 6.775  7.367  1.00 56.89 ? 538  LEU A CD1 1 
ATOM   1868 C  CD2 . LEU A 1 250 ? 28.618 8.532  5.988  1.00 58.55 ? 538  LEU A CD2 1 
ATOM   1869 N  N   . HIS A 1 251 ? 24.844 10.700 5.533  1.00 61.45 ? 539  HIS A N   1 
ATOM   1870 C  CA  . HIS A 1 251 ? 24.174 10.922 4.239  1.00 59.59 ? 539  HIS A CA  1 
ATOM   1871 C  C   . HIS A 1 251 ? 24.431 12.339 3.682  1.00 56.85 ? 539  HIS A C   1 
ATOM   1872 O  O   . HIS A 1 251 ? 24.427 12.554 2.465  1.00 56.53 ? 539  HIS A O   1 
ATOM   1873 C  CB  . HIS A 1 251 ? 22.664 10.682 4.375  1.00 61.00 ? 539  HIS A CB  1 
ATOM   1874 N  N   . LYS A 1 252 ? 24.661 13.289 4.587  1.00 53.54 ? 540  LYS A N   1 
ATOM   1875 C  CA  . LYS A 1 252 ? 25.011 14.660 4.237  1.00 50.50 ? 540  LYS A CA  1 
ATOM   1876 C  C   . LYS A 1 252 ? 26.458 14.878 3.706  1.00 48.65 ? 540  LYS A C   1 
ATOM   1877 O  O   . LYS A 1 252 ? 26.797 16.009 3.348  1.00 48.13 ? 540  LYS A O   1 
ATOM   1878 C  CB  . LYS A 1 252 ? 24.763 15.573 5.453  1.00 51.25 ? 540  LYS A CB  1 
ATOM   1879 N  N   . VAL A 1 253 ? 27.295 13.833 3.640  1.00 46.04 ? 541  VAL A N   1 
ATOM   1880 C  CA  . VAL A 1 253 ? 28.707 13.998 3.216  1.00 43.78 ? 541  VAL A CA  1 
ATOM   1881 C  C   . VAL A 1 253 ? 29.047 13.224 1.945  1.00 40.20 ? 541  VAL A C   1 
ATOM   1882 O  O   . VAL A 1 253 ? 28.470 12.179 1.675  1.00 37.68 ? 541  VAL A O   1 
ATOM   1883 C  CB  . VAL A 1 253 ? 29.729 13.628 4.334  1.00 42.84 ? 541  VAL A CB  1 
ATOM   1884 C  CG1 . VAL A 1 253 ? 29.377 14.331 5.659  1.00 46.15 ? 541  VAL A CG1 1 
ATOM   1885 C  CG2 . VAL A 1 253 ? 29.839 12.135 4.535  1.00 37.25 ? 541  VAL A CG2 1 
ATOM   1886 N  N   . SER A 1 254 ? 30.011 13.741 1.186  1.00 38.21 ? 542  SER A N   1 
ATOM   1887 C  CA  . SER A 1 254 ? 30.398 13.157 -0.110 1.00 36.45 ? 542  SER A CA  1 
ATOM   1888 C  C   . SER A 1 254 ? 31.169 11.847 0.074  1.00 35.90 ? 542  SER A C   1 
ATOM   1889 O  O   . SER A 1 254 ? 31.726 11.617 1.138  1.00 34.30 ? 542  SER A O   1 
ATOM   1890 C  CB  . SER A 1 254 ? 31.269 14.137 -0.909 1.00 35.38 ? 542  SER A CB  1 
ATOM   1891 O  OG  . SER A 1 254 ? 32.605 14.185 -0.406 1.00 31.98 ? 542  SER A OG  1 
ATOM   1892 N  N   . PRO A 1 255 ? 31.214 10.995 -0.975 1.00 35.91 ? 543  PRO A N   1 
ATOM   1893 C  CA  . PRO A 1 255 ? 32.012 9.756  -0.916 1.00 36.10 ? 543  PRO A CA  1 
ATOM   1894 C  C   . PRO A 1 255 ? 33.504 10.027 -0.715 1.00 34.85 ? 543  PRO A C   1 
ATOM   1895 O  O   . PRO A 1 255 ? 34.194 9.262  -0.042 1.00 35.96 ? 543  PRO A O   1 
ATOM   1896 C  CB  . PRO A 1 255 ? 31.751 9.092  -2.279 1.00 36.11 ? 543  PRO A CB  1 
ATOM   1897 C  CG  . PRO A 1 255 ? 30.534 9.742  -2.817 1.00 37.71 ? 543  PRO A CG  1 
ATOM   1898 C  CD  . PRO A 1 255 ? 30.511 11.135 -2.263 1.00 36.55 ? 543  PRO A CD  1 
ATOM   1899 N  N   . SER A 1 256 ? 33.973 11.135 -1.283 1.00 34.64 ? 544  SER A N   1 
ATOM   1900 C  CA  . SER A 1 256 ? 35.360 11.578 -1.161 1.00 34.65 ? 544  SER A CA  1 
ATOM   1901 C  C   . SER A 1 256 ? 35.751 11.860 0.299  1.00 34.32 ? 544  SER A C   1 
ATOM   1902 O  O   . SER A 1 256 ? 36.835 11.483 0.746  1.00 35.63 ? 544  SER A O   1 
ATOM   1903 C  CB  . SER A 1 256 ? 35.554 12.825 -2.022 1.00 35.34 ? 544  SER A CB  1 
ATOM   1904 O  OG  . SER A 1 256 ? 36.902 13.220 -2.090 1.00 39.62 ? 544  SER A OG  1 
ATOM   1905 N  N   . LEU A 1 257 ? 34.852 12.509 1.034  1.00 35.17 ? 545  LEU A N   1 
ATOM   1906 C  CA  . LEU A 1 257 ? 35.092 12.903 2.423  1.00 35.10 ? 545  LEU A CA  1 
ATOM   1907 C  C   . LEU A 1 257 ? 35.041 11.675 3.333  1.00 35.16 ? 545  LEU A C   1 
ATOM   1908 O  O   . LEU A 1 257 ? 35.877 11.529 4.239  1.00 32.77 ? 545  LEU A O   1 
ATOM   1909 C  CB  . LEU A 1 257 ? 34.071 13.966 2.883  1.00 35.06 ? 545  LEU A CB  1 
ATOM   1910 C  CG  . LEU A 1 257 ? 34.273 14.620 4.268  1.00 35.80 ? 545  LEU A CG  1 
ATOM   1911 C  CD1 . LEU A 1 257 ? 33.392 15.853 4.430  1.00 24.62 ? 545  LEU A CD1 1 
ATOM   1912 C  CD2 . LEU A 1 257 ? 33.993 13.659 5.391  1.00 40.31 ? 545  LEU A CD2 1 
ATOM   1913 N  N   . LYS A 1 258 ? 34.068 10.797 3.083  1.00 35.61 ? 546  LYS A N   1 
ATOM   1914 C  CA  . LYS A 1 258 ? 33.959 9.548  3.846  1.00 37.25 ? 546  LYS A CA  1 
ATOM   1915 C  C   . LYS A 1 258 ? 35.181 8.656  3.649  1.00 33.54 ? 546  LYS A C   1 
ATOM   1916 O  O   . LYS A 1 258 ? 35.717 8.146  4.611  1.00 35.09 ? 546  LYS A O   1 
ATOM   1917 C  CB  . LYS A 1 258 ? 32.667 8.779  3.521  1.00 38.43 ? 546  LYS A CB  1 
ATOM   1918 C  CG  . LYS A 1 258 ? 31.845 8.363  4.791  1.00 50.44 ? 546  LYS A CG  1 
ATOM   1919 C  CD  . LYS A 1 258 ? 32.528 7.315  5.762  1.00 52.60 ? 546  LYS A CD  1 
ATOM   1920 C  CE  . LYS A 1 258 ? 33.048 7.938  7.101  1.00 57.58 ? 546  LYS A CE  1 
ATOM   1921 N  NZ  . LYS A 1 258 ? 32.112 7.912  8.305  1.00 56.95 ? 546  LYS A NZ  1 
ATOM   1922 N  N   . GLY A 1 259 ? 35.618 8.475  2.411  1.00 33.84 ? 547  GLY A N   1 
ATOM   1923 C  CA  . GLY A 1 259 ? 36.778 7.635  2.115  1.00 33.19 ? 547  GLY A CA  1 
ATOM   1924 C  C   . GLY A 1 259 ? 38.071 8.196  2.676  1.00 34.67 ? 547  GLY A C   1 
ATOM   1925 O  O   . GLY A 1 259 ? 38.952 7.441  3.117  1.00 36.67 ? 547  GLY A O   1 
ATOM   1926 N  N   . PHE A 1 260 ? 38.185 9.524  2.654  1.00 32.94 ? 548  PHE A N   1 
ATOM   1927 C  CA  . PHE A 1 260 ? 39.290 10.245 3.293  1.00 30.19 ? 548  PHE A CA  1 
ATOM   1928 C  C   . PHE A 1 260 ? 39.284 9.994  4.815  1.00 30.84 ? 548  PHE A C   1 
ATOM   1929 O  O   . PHE A 1 260 ? 40.304 9.624  5.402  1.00 31.66 ? 548  PHE A O   1 
ATOM   1930 C  CB  . PHE A 1 260 ? 39.134 11.738 2.982  1.00 30.84 ? 548  PHE A CB  1 
ATOM   1931 C  CG  . PHE A 1 260 ? 40.101 12.632 3.704  1.00 29.87 ? 548  PHE A CG  1 
ATOM   1932 C  CD1 . PHE A 1 260 ? 41.390 12.787 3.251  1.00 32.36 ? 548  PHE A CD1 1 
ATOM   1933 C  CD2 . PHE A 1 260 ? 39.697 13.359 4.811  1.00 33.23 ? 548  PHE A CD2 1 
ATOM   1934 C  CE1 . PHE A 1 260 ? 42.270 13.623 3.904  1.00 37.73 ? 548  PHE A CE1 1 
ATOM   1935 C  CE2 . PHE A 1 260 ? 40.572 14.184 5.463  1.00 32.83 ? 548  PHE A CE2 1 
ATOM   1936 C  CZ  . PHE A 1 260 ? 41.861 14.314 5.012  1.00 32.98 ? 548  PHE A CZ  1 
ATOM   1937 N  N   . LEU A 1 261 ? 38.135 10.178 5.456  1.00 29.47 ? 549  LEU A N   1 
ATOM   1938 C  CA  . LEU A 1 261 ? 38.054 9.982  6.900  1.00 30.41 ? 549  LEU A CA  1 
ATOM   1939 C  C   . LEU A 1 261 ? 38.302 8.525  7.286  1.00 30.26 ? 549  LEU A C   1 
ATOM   1940 O  O   . LEU A 1 261 ? 38.836 8.264  8.353  1.00 31.41 ? 549  LEU A O   1 
ATOM   1941 C  CB  . LEU A 1 261 ? 36.716 10.485 7.448  1.00 29.56 ? 549  LEU A CB  1 
ATOM   1942 C  CG  . LEU A 1 261 ? 36.552 10.506 8.967  1.00 29.15 ? 549  LEU A CG  1 
ATOM   1943 C  CD1 . LEU A 1 261 ? 37.632 11.393 9.698  1.00 24.79 ? 549  LEU A CD1 1 
ATOM   1944 C  CD2 . LEU A 1 261 ? 35.142 10.926 9.282  1.00 27.68 ? 549  LEU A CD2 1 
ATOM   1945 N  N   . ASP A 1 262 ? 37.947 7.583  6.412  1.00 32.57 ? 550  ASP A N   1 
ATOM   1946 C  CA  . ASP A 1 262 ? 38.150 6.136  6.671  1.00 32.06 ? 550  ASP A CA  1 
ATOM   1947 C  C   . ASP A 1 262 ? 39.620 5.735  6.720  1.00 31.04 ? 550  ASP A C   1 
ATOM   1948 O  O   . ASP A 1 262 ? 39.922 4.627  7.179  1.00 32.61 ? 550  ASP A O   1 
ATOM   1949 C  CB  . ASP A 1 262 ? 37.468 5.259  5.587  1.00 34.87 ? 550  ASP A CB  1 
ATOM   1950 C  CG  . ASP A 1 262 ? 35.948 5.200  5.720  1.00 38.05 ? 550  ASP A CG  1 
ATOM   1951 O  OD1 . ASP A 1 262 ? 35.422 5.685  6.733  1.00 41.92 ? 550  ASP A OD1 1 
ATOM   1952 O  OD2 . ASP A 1 262 ? 35.280 4.664  4.802  1.00 36.06 ? 550  ASP A OD2 1 
ATOM   1953 N  N   . ARG A 1 263 ? 40.495 6.613  6.203  1.00 32.17 ? 551  ARG A N   1 
ATOM   1954 C  CA  A ARG A 1 263 ? 41.946 6.399  6.168  0.50 32.45 ? 551  ARG A CA  1 
ATOM   1955 C  CA  B ARG A 1 263 ? 41.953 6.392  6.173  0.50 31.39 ? 551  ARG A CA  1 
ATOM   1956 C  C   . ARG A 1 263 ? 42.655 7.013  7.377  1.00 32.00 ? 551  ARG A C   1 
ATOM   1957 O  O   . ARG A 1 263 ? 43.792 6.654  7.686  1.00 31.16 ? 551  ARG A O   1 
ATOM   1958 C  CB  A ARG A 1 263 ? 42.526 6.977  4.875  0.50 32.98 ? 551  ARG A CB  1 
ATOM   1959 C  CB  B ARG A 1 263 ? 42.577 6.972  4.900  0.50 31.55 ? 551  ARG A CB  1 
ATOM   1960 C  CG  A ARG A 1 263 ? 42.113 6.192  3.626  0.50 34.26 ? 551  ARG A CG  1 
ATOM   1961 C  CG  B ARG A 1 263 ? 42.236 6.238  3.594  0.50 29.58 ? 551  ARG A CG  1 
ATOM   1962 C  CD  A ARG A 1 263 ? 42.840 6.636  2.360  0.50 34.90 ? 551  ARG A CD  1 
ATOM   1963 C  CD  B ARG A 1 263 ? 42.758 4.793  3.538  0.50 27.10 ? 551  ARG A CD  1 
ATOM   1964 N  NE  A ARG A 1 263 ? 43.233 5.474  1.554  0.50 40.50 ? 551  ARG A NE  1 
ATOM   1965 N  NE  B ARG A 1 263 ? 44.221 4.691  3.588  0.50 23.56 ? 551  ARG A NE  1 
ATOM   1966 C  CZ  A ARG A 1 263 ? 42.690 5.087  0.399  0.50 37.88 ? 551  ARG A CZ  1 
ATOM   1967 C  CZ  B ARG A 1 263 ? 44.922 3.970  4.464  0.50 23.82 ? 551  ARG A CZ  1 
ATOM   1968 N  NH1 A ARG A 1 263 ? 41.706 5.766  -0.176 0.50 39.56 ? 551  ARG A NH1 1 
ATOM   1969 N  NH1 B ARG A 1 263 ? 44.325 3.241  5.408  0.50 23.04 ? 551  ARG A NH1 1 
ATOM   1970 N  NH2 A ARG A 1 263 ? 43.154 3.999  -0.197 0.50 37.97 ? 551  ARG A NH2 1 
ATOM   1971 N  NH2 B ARG A 1 263 ? 46.245 3.961  4.381  0.50 27.37 ? 551  ARG A NH2 1 
ATOM   1972 N  N   . LEU A 1 264 ? 41.975 7.940  8.056  1.00 31.87 ? 552  LEU A N   1 
ATOM   1973 C  CA  . LEU A 1 264 ? 42.479 8.553  9.275  1.00 31.70 ? 552  LEU A CA  1 
ATOM   1974 C  C   . LEU A 1 264 ? 42.096 7.734  10.495 1.00 30.23 ? 552  LEU A C   1 
ATOM   1975 O  O   . LEU A 1 264 ? 42.901 7.502  11.406 1.00 28.16 ? 552  LEU A O   1 
ATOM   1976 C  CB  . LEU A 1 264 ? 41.934 9.980  9.424  1.00 31.03 ? 552  LEU A CB  1 
ATOM   1977 C  CG  . LEU A 1 264 ? 42.600 11.039 8.523  1.00 33.99 ? 552  LEU A CG  1 
ATOM   1978 C  CD1 . LEU A 1 264 ? 42.044 10.985 7.161  1.00 37.93 ? 552  LEU A CD1 1 
ATOM   1979 C  CD2 . LEU A 1 264 ? 42.393 12.412 9.067  1.00 33.40 ? 552  LEU A CD2 1 
ATOM   1980 N  N   . LEU A 1 265 ? 40.842 7.323  10.517 1.00 30.64 ? 553  LEU A N   1 
ATOM   1981 C  CA  . LEU A 1 265 ? 40.271 6.707  11.687 1.00 31.91 ? 553  LEU A CA  1 
ATOM   1982 C  C   . LEU A 1 265 ? 40.369 5.195  11.555 1.00 32.62 ? 553  LEU A C   1 
ATOM   1983 O  O   . LEU A 1 265 ? 39.364 4.489  11.529 1.00 33.47 ? 553  LEU A O   1 
ATOM   1984 C  CB  . LEU A 1 265 ? 38.833 7.189  11.913 1.00 32.28 ? 553  LEU A CB  1 
ATOM   1985 C  CG  . LEU A 1 265 ? 38.676 8.638  12.400 1.00 32.24 ? 553  LEU A CG  1 
ATOM   1986 C  CD1 . LEU A 1 265 ? 37.182 8.959  12.661 1.00 30.09 ? 553  LEU A CD1 1 
ATOM   1987 C  CD2 . LEU A 1 265 ? 39.497 8.893  13.651 1.00 29.25 ? 553  LEU A CD2 1 
ATOM   1988 N  N   . VAL A 1 266 ? 41.618 4.723  11.497 1.00 32.72 ? 554  VAL A N   1 
ATOM   1989 C  CA  . VAL A 1 266 ? 41.956 3.313  11.407 1.00 32.35 ? 554  VAL A CA  1 
ATOM   1990 C  C   . VAL A 1 266 ? 42.612 2.944  12.725 1.00 32.68 ? 554  VAL A C   1 
ATOM   1991 O  O   . VAL A 1 266 ? 43.585 3.568  13.112 1.00 32.51 ? 554  VAL A O   1 
ATOM   1992 C  CB  . VAL A 1 266 ? 42.944 3.064  10.249 1.00 33.52 ? 554  VAL A CB  1 
ATOM   1993 C  CG1 . VAL A 1 266 ? 43.387 1.613  10.241 1.00 29.62 ? 554  VAL A CG1 1 
ATOM   1994 C  CG2 . VAL A 1 266 ? 42.303 3.451  8.906  1.00 29.14 ? 554  VAL A CG2 1 
ATOM   1995 N  N   . ARG A 1 267 ? 42.054 1.962  13.432 1.00 34.20 ? 555  ARG A N   1 
ATOM   1996 C  CA  . ARG A 1 267 ? 42.466 1.663  14.817 1.00 35.10 ? 555  ARG A CA  1 
ATOM   1997 C  C   . ARG A 1 267 ? 43.907 1.166  14.872 1.00 33.18 ? 555  ARG A C   1 
ATOM   1998 O  O   . ARG A 1 267 ? 44.674 1.573  15.724 1.00 34.87 ? 555  ARG A O   1 
ATOM   1999 C  CB  . ARG A 1 267 ? 41.564 0.624  15.475 1.00 34.92 ? 555  ARG A CB  1 
ATOM   2000 C  CG  . ARG A 1 267 ? 40.099 0.648  15.098 1.00 39.52 ? 555  ARG A CG  1 
ATOM   2001 C  CD  . ARG A 1 267 ? 39.359 -0.501 15.796 1.00 40.56 ? 555  ARG A CD  1 
ATOM   2002 N  NE  . ARG A 1 267 ? 39.211 -0.114 17.170 1.00 51.73 ? 555  ARG A NE  1 
ATOM   2003 C  CZ  . ARG A 1 267 ? 39.881 -0.596 18.201 1.00 48.27 ? 555  ARG A CZ  1 
ATOM   2004 N  NH1 . ARG A 1 267 ? 40.753 -1.588 18.102 1.00 47.97 ? 555  ARG A NH1 1 
ATOM   2005 N  NH2 . ARG A 1 267 ? 39.640 -0.059 19.375 1.00 53.09 ? 555  ARG A NH2 1 
ATOM   2006 N  N   . ASP A 1 268 ? 44.268 0.295  13.941 1.00 32.40 ? 556  ASP A N   1 
ATOM   2007 C  CA  . ASP A 1 268 ? 45.633 -0.180 13.823 1.00 32.87 ? 556  ASP A CA  1 
ATOM   2008 C  C   . ASP A 1 268 ? 46.523 0.918  13.206 1.00 31.63 ? 556  ASP A C   1 
ATOM   2009 O  O   . ASP A 1 268 ? 46.388 1.262  12.024 1.00 30.63 ? 556  ASP A O   1 
ATOM   2010 C  CB  . ASP A 1 268 ? 45.653 -1.476 12.996 1.00 33.15 ? 556  ASP A CB  1 
ATOM   2011 C  CG  . ASP A 1 268 ? 47.019 -2.148 12.953 1.00 36.49 ? 556  ASP A CG  1 
ATOM   2012 O  OD1 . ASP A 1 268 ? 47.993 -1.617 13.529 1.00 37.40 ? 556  ASP A OD1 1 
ATOM   2013 O  OD2 . ASP A 1 268 ? 47.108 -3.238 12.339 1.00 38.09 ? 556  ASP A OD2 1 
ATOM   2014 N  N   . PRO A 1 269 ? 47.460 1.462  14.004 1.00 31.18 ? 557  PRO A N   1 
ATOM   2015 C  CA  . PRO A 1 269 ? 48.259 2.568  13.506 1.00 29.18 ? 557  PRO A CA  1 
ATOM   2016 C  C   . PRO A 1 269 ? 49.161 2.187  12.347 1.00 29.10 ? 557  PRO A C   1 
ATOM   2017 O  O   . PRO A 1 269 ? 49.570 3.064  11.577 1.00 28.09 ? 557  PRO A O   1 
ATOM   2018 C  CB  . PRO A 1 269 ? 49.082 2.970  14.732 1.00 30.51 ? 557  PRO A CB  1 
ATOM   2019 C  CG  . PRO A 1 269 ? 49.171 1.747  15.549 1.00 30.20 ? 557  PRO A CG  1 
ATOM   2020 C  CD  . PRO A 1 269 ? 47.842 1.096  15.385 1.00 31.07 ? 557  PRO A CD  1 
ATOM   2021 N  N   . ALA A 1 270 ? 49.496 0.900  12.244 1.00 28.53 ? 558  ALA A N   1 
ATOM   2022 C  CA  . ALA A 1 270 ? 50.288 0.380  11.117 1.00 29.13 ? 558  ALA A CA  1 
ATOM   2023 C  C   . ALA A 1 270 ? 49.524 0.386  9.784  1.00 31.12 ? 558  ALA A C   1 
ATOM   2024 O  O   . ALA A 1 270 ? 50.144 0.383  8.724  1.00 32.04 ? 558  ALA A O   1 
ATOM   2025 C  CB  . ALA A 1 270 ? 50.826 -1.035 11.425 1.00 27.26 ? 558  ALA A CB  1 
ATOM   2026 N  N   . GLN A 1 271 ? 48.192 0.413  9.841  1.00 32.35 ? 559  GLN A N   1 
ATOM   2027 C  CA  . GLN A 1 271 ? 47.362 0.479  8.644  1.00 34.53 ? 559  GLN A CA  1 
ATOM   2028 C  C   . GLN A 1 271 ? 46.768 1.866  8.400  1.00 34.41 ? 559  GLN A C   1 
ATOM   2029 O  O   . GLN A 1 271 ? 46.182 2.121  7.356  1.00 37.75 ? 559  GLN A O   1 
ATOM   2030 C  CB  . GLN A 1 271 ? 46.244 -0.569 8.728  1.00 36.32 ? 559  GLN A CB  1 
ATOM   2031 C  CG  . GLN A 1 271 ? 46.753 -2.020 8.849  1.00 41.91 ? 559  GLN A CG  1 
ATOM   2032 C  CD  . GLN A 1 271 ? 47.651 -2.444 7.683  1.00 53.34 ? 559  GLN A CD  1 
ATOM   2033 O  OE1 . GLN A 1 271 ? 47.495 -1.961 6.557  1.00 61.84 ? 559  GLN A OE1 1 
ATOM   2034 N  NE2 . GLN A 1 271 ? 48.600 -3.345 7.953  1.00 56.44 ? 559  GLN A NE2 1 
ATOM   2035 N  N   . ARG A 1 272 ? 46.943 2.764  9.353  1.00 33.09 ? 560  ARG A N   1 
ATOM   2036 C  CA  . ARG A 1 272 ? 46.527 4.149  9.209  1.00 32.14 ? 560  ARG A CA  1 
ATOM   2037 C  C   . ARG A 1 272 ? 47.373 4.882  8.159  1.00 31.76 ? 560  ARG A C   1 
ATOM   2038 O  O   . ARG A 1 272 ? 48.575 4.654  8.030  1.00 33.09 ? 560  ARG A O   1 
ATOM   2039 C  CB  . ARG A 1 272 ? 46.644 4.835  10.576 1.00 31.99 ? 560  ARG A CB  1 
ATOM   2040 C  CG  . ARG A 1 272 ? 45.861 6.145  10.746 1.00 30.49 ? 560  ARG A CG  1 
ATOM   2041 C  CD  . ARG A 1 272 ? 45.997 6.608  12.174 1.00 31.07 ? 560  ARG A CD  1 
ATOM   2042 N  NE  . ARG A 1 272 ? 45.517 5.588  13.114 1.00 29.12 ? 560  ARG A NE  1 
ATOM   2043 C  CZ  . ARG A 1 272 ? 45.969 5.439  14.359 1.00 31.09 ? 560  ARG A CZ  1 
ATOM   2044 N  NH1 . ARG A 1 272 ? 46.906 6.247  14.848 1.00 31.47 ? 560  ARG A NH1 1 
ATOM   2045 N  NH2 . ARG A 1 272 ? 45.479 4.483  15.127 1.00 30.97 ? 560  ARG A NH2 1 
ATOM   2046 N  N   . ALA A 1 273 ? 46.737 5.758  7.405  1.00 30.90 ? 561  ALA A N   1 
ATOM   2047 C  CA  . ALA A 1 273 ? 47.431 6.563  6.418  1.00 31.76 ? 561  ALA A CA  1 
ATOM   2048 C  C   . ALA A 1 273 ? 48.414 7.573  7.087  1.00 33.66 ? 561  ALA A C   1 
ATOM   2049 O  O   . ALA A 1 273 ? 48.182 8.044  8.209  1.00 34.47 ? 561  ALA A O   1 
ATOM   2050 C  CB  . ALA A 1 273 ? 46.400 7.310  5.575  1.00 30.35 ? 561  ALA A CB  1 
ATOM   2051 N  N   . THR A 1 274 ? 49.510 7.880  6.398  1.00 32.33 ? 562  THR A N   1 
ATOM   2052 C  CA  . THR A 1 274 ? 50.457 8.882  6.859  1.00 30.79 ? 562  THR A CA  1 
ATOM   2053 C  C   . THR A 1 274 ? 50.033 10.269 6.350  1.00 32.44 ? 562  THR A C   1 
ATOM   2054 O  O   . THR A 1 274 ? 49.170 10.393 5.472  1.00 32.67 ? 562  THR A O   1 
ATOM   2055 C  CB  . THR A 1 274 ? 51.862 8.618  6.317  1.00 28.86 ? 562  THR A CB  1 
ATOM   2056 O  OG1 . THR A 1 274 ? 51.813 8.690  4.893  1.00 27.26 ? 562  THR A OG1 1 
ATOM   2057 C  CG2 . THR A 1 274 ? 52.406 7.244  6.765  1.00 23.64 ? 562  THR A CG2 1 
ATOM   2058 N  N   . ALA A 1 275 ? 50.653 11.312 6.889  1.00 32.40 ? 563  ALA A N   1 
ATOM   2059 C  CA  . ALA A 1 275 ? 50.380 12.661 6.422  1.00 32.26 ? 563  ALA A CA  1 
ATOM   2060 C  C   . ALA A 1 275 ? 50.771 12.798 4.938  1.00 31.72 ? 563  ALA A C   1 
ATOM   2061 O  O   . ALA A 1 275 ? 50.032 13.402 4.154  1.00 30.64 ? 563  ALA A O   1 
ATOM   2062 C  CB  . ALA A 1 275 ? 51.102 13.687 7.295  1.00 30.99 ? 563  ALA A CB  1 
ATOM   2063 N  N   . ALA A 1 276 ? 51.902 12.202 4.555  1.00 31.81 ? 564  ALA A N   1 
ATOM   2064 C  CA  . ALA A 1 276 ? 52.406 12.315 3.184  1.00 32.55 ? 564  ALA A CA  1 
ATOM   2065 C  C   . ALA A 1 276 ? 51.431 11.666 2.196  1.00 33.65 ? 564  ALA A C   1 
ATOM   2066 O  O   . ALA A 1 276 ? 51.135 12.240 1.138  1.00 32.70 ? 564  ALA A O   1 
ATOM   2067 C  CB  . ALA A 1 276 ? 53.806 11.698 3.054  1.00 30.83 ? 564  ALA A CB  1 
ATOM   2068 N  N   . GLU A 1 277 ? 50.933 10.482 2.569  1.00 34.19 ? 565  GLU A N   1 
ATOM   2069 C  CA  . GLU A 1 277 ? 49.934 9.753  1.797  1.00 34.55 ? 565  GLU A CA  1 
ATOM   2070 C  C   . GLU A 1 277 ? 48.648 10.570 1.602  1.00 33.66 ? 565  GLU A C   1 
ATOM   2071 O  O   . GLU A 1 277 ? 48.136 10.702 0.486  1.00 34.36 ? 565  GLU A O   1 
ATOM   2072 C  CB  . GLU A 1 277 ? 49.633 8.407  2.480  1.00 34.88 ? 565  GLU A CB  1 
ATOM   2073 C  CG  . GLU A 1 277 ? 50.766 7.354  2.314  1.00 39.50 ? 565  GLU A CG  1 
ATOM   2074 C  CD  . GLU A 1 277 ? 50.603 6.103  3.194  1.00 38.09 ? 565  GLU A CD  1 
ATOM   2075 O  OE1 . GLU A 1 277 ? 49.652 6.038  3.995  1.00 43.48 ? 565  GLU A OE1 1 
ATOM   2076 O  OE2 . GLU A 1 277 ? 51.445 5.180  3.084  1.00 44.39 ? 565  GLU A OE2 1 
ATOM   2077 N  N   . LEU A 1 278 ? 48.147 11.131 2.693  1.00 34.53 ? 566  LEU A N   1 
ATOM   2078 C  CA  . LEU A 1 278 ? 46.881 11.859 2.692  1.00 33.98 ? 566  LEU A CA  1 
ATOM   2079 C  C   . LEU A 1 278 ? 46.930 13.168 1.902  1.00 33.63 ? 566  LEU A C   1 
ATOM   2080 O  O   . LEU A 1 278 ? 45.904 13.634 1.421  1.00 33.27 ? 566  LEU A O   1 
ATOM   2081 C  CB  . LEU A 1 278 ? 46.423 12.116 4.132  1.00 33.30 ? 566  LEU A CB  1 
ATOM   2082 C  CG  . LEU A 1 278 ? 46.043 10.867 4.926  1.00 34.90 ? 566  LEU A CG  1 
ATOM   2083 C  CD1 . LEU A 1 278 ? 46.031 11.168 6.434  1.00 30.86 ? 566  LEU A CD1 1 
ATOM   2084 C  CD2 . LEU A 1 278 ? 44.716 10.311 4.442  1.00 28.81 ? 566  LEU A CD2 1 
ATOM   2085 N  N   . LEU A 1 279 ? 48.115 13.758 1.758  1.00 34.48 ? 567  LEU A N   1 
ATOM   2086 C  CA  . LEU A 1 279 ? 48.274 14.962 0.929  1.00 33.76 ? 567  LEU A CA  1 
ATOM   2087 C  C   . LEU A 1 279 ? 47.971 14.696 -0.557 1.00 34.90 ? 567  LEU A C   1 
ATOM   2088 O  O   . LEU A 1 279 ? 47.696 15.626 -1.329 1.00 33.03 ? 567  LEU A O   1 
ATOM   2089 C  CB  . LEU A 1 279 ? 49.683 15.556 1.097  1.00 35.05 ? 567  LEU A CB  1 
ATOM   2090 C  CG  . LEU A 1 279 ? 49.947 16.375 2.372  1.00 35.33 ? 567  LEU A CG  1 
ATOM   2091 C  CD1 . LEU A 1 279 ? 51.436 16.713 2.457  1.00 32.86 ? 567  LEU A CD1 1 
ATOM   2092 C  CD2 . LEU A 1 279 ? 49.108 17.642 2.403  1.00 32.30 ? 567  LEU A CD2 1 
ATOM   2093 N  N   . LYS A 1 280 ? 48.027 13.425 -0.951 1.00 36.48 ? 568  LYS A N   1 
ATOM   2094 C  CA  . LYS A 1 280 ? 47.678 13.010 -2.303 1.00 36.69 ? 568  LYS A CA  1 
ATOM   2095 C  C   . LYS A 1 280 ? 46.211 12.569 -2.434 1.00 34.68 ? 568  LYS A C   1 
ATOM   2096 O  O   . LYS A 1 280 ? 45.797 12.151 -3.504 1.00 34.02 ? 568  LYS A O   1 
ATOM   2097 C  CB  . LYS A 1 280 ? 48.636 11.902 -2.766 1.00 36.91 ? 568  LYS A CB  1 
ATOM   2098 C  CG  . LYS A 1 280 ? 50.065 12.413 -2.943 1.00 38.72 ? 568  LYS A CG  1 
ATOM   2099 C  CD  . LYS A 1 280 ? 50.979 11.427 -3.658 1.00 39.56 ? 568  LYS A CD  1 
ATOM   2100 C  CE  . LYS A 1 280 ? 51.936 10.712 -2.698 1.00 47.16 ? 568  LYS A CE  1 
ATOM   2101 N  NZ  . LYS A 1 280 ? 53.171 10.207 -3.401 1.00 47.54 ? 568  LYS A NZ  1 
ATOM   2102 N  N   . HIS A 1 281 ? 45.420 12.690 -1.370 1.00 33.43 ? 569  HIS A N   1 
ATOM   2103 C  CA  . HIS A 1 281 ? 44.033 12.217 -1.413 1.00 33.09 ? 569  HIS A CA  1 
ATOM   2104 C  C   . HIS A 1 281 ? 43.130 13.201 -2.186 1.00 33.22 ? 569  HIS A C   1 
ATOM   2105 O  O   . HIS A 1 281 ? 43.223 14.409 -1.985 1.00 36.11 ? 569  HIS A O   1 
ATOM   2106 C  CB  . HIS A 1 281 ? 43.476 11.953 0.008  1.00 32.18 ? 569  HIS A CB  1 
ATOM   2107 C  CG  . HIS A 1 281 ? 42.227 11.124 0.006  1.00 33.74 ? 569  HIS A CG  1 
ATOM   2108 N  ND1 . HIS A 1 281 ? 40.991 11.640 -0.319 1.00 36.71 ? 569  HIS A ND1 1 
ATOM   2109 C  CD2 . HIS A 1 281 ? 42.032 9.805  0.223  1.00 34.57 ? 569  HIS A CD2 1 
ATOM   2110 C  CE1 . HIS A 1 281 ? 40.089 10.676 -0.296 1.00 30.41 ? 569  HIS A CE1 1 
ATOM   2111 N  NE2 . HIS A 1 281 ? 40.696 9.551  0.028  1.00 28.54 ? 569  HIS A NE2 1 
ATOM   2112 N  N   . PRO A 1 282 ? 42.249 12.689 -3.063 1.00 32.30 ? 570  PRO A N   1 
ATOM   2113 C  CA  . PRO A 1 282 ? 41.375 13.527 -3.874 1.00 31.91 ? 570  PRO A CA  1 
ATOM   2114 C  C   . PRO A 1 282 ? 40.428 14.451 -3.110 1.00 30.95 ? 570  PRO A C   1 
ATOM   2115 O  O   . PRO A 1 282 ? 39.999 15.452 -3.656 1.00 31.12 ? 570  PRO A O   1 
ATOM   2116 C  CB  . PRO A 1 282 ? 40.550 12.508 -4.674 1.00 31.79 ? 570  PRO A CB  1 
ATOM   2117 C  CG  . PRO A 1 282 ? 41.279 11.287 -4.623 1.00 30.25 ? 570  PRO A CG  1 
ATOM   2118 C  CD  . PRO A 1 282 ? 42.038 11.266 -3.361 1.00 33.80 ? 570  PRO A CD  1 
ATOM   2119 N  N   . PHE A 1 283 ? 40.096 14.129 -1.868 1.00 32.15 ? 571  PHE A N   1 
ATOM   2120 C  CA  . PHE A 1 283 ? 39.235 15.005 -1.077 1.00 31.25 ? 571  PHE A CA  1 
ATOM   2121 C  C   . PHE A 1 283 ? 39.866 16.378 -0.925 1.00 31.69 ? 571  PHE A C   1 
ATOM   2122 O  O   . PHE A 1 283 ? 39.164 17.382 -0.947 1.00 29.93 ? 571  PHE A O   1 
ATOM   2123 C  CB  . PHE A 1 283 ? 38.923 14.413 0.295  1.00 30.89 ? 571  PHE A CB  1 
ATOM   2124 C  CG  . PHE A 1 283 ? 38.218 15.385 1.220  1.00 32.12 ? 571  PHE A CG  1 
ATOM   2125 C  CD1 . PHE A 1 283 ? 36.929 15.818 0.937  1.00 26.47 ? 571  PHE A CD1 1 
ATOM   2126 C  CD2 . PHE A 1 283 ? 38.862 15.897 2.349  1.00 32.36 ? 571  PHE A CD2 1 
ATOM   2127 C  CE1 . PHE A 1 283 ? 36.295 16.732 1.749  1.00 33.14 ? 571  PHE A CE1 1 
ATOM   2128 C  CE2 . PHE A 1 283 ? 38.219 16.794 3.179  1.00 34.20 ? 571  PHE A CE2 1 
ATOM   2129 C  CZ  . PHE A 1 283 ? 36.933 17.215 2.877  1.00 33.32 ? 571  PHE A CZ  1 
ATOM   2130 N  N   . LEU A 1 284 ? 41.193 16.421 -0.791 1.00 32.73 ? 572  LEU A N   1 
ATOM   2131 C  CA  . LEU A 1 284 ? 41.887 17.684 -0.581 1.00 32.22 ? 572  LEU A CA  1 
ATOM   2132 C  C   . LEU A 1 284 ? 41.888 18.568 -1.815 1.00 33.20 ? 572  LEU A C   1 
ATOM   2133 O  O   . LEU A 1 284 ? 42.157 19.768 -1.700 1.00 33.43 ? 572  LEU A O   1 
ATOM   2134 C  CB  . LEU A 1 284 ? 43.323 17.451 -0.130 1.00 32.19 ? 572  LEU A CB  1 
ATOM   2135 C  CG  . LEU A 1 284 ? 43.532 16.647 1.147  1.00 33.86 ? 572  LEU A CG  1 
ATOM   2136 C  CD1 . LEU A 1 284 ? 45.031 16.679 1.533  1.00 29.30 ? 572  LEU A CD1 1 
ATOM   2137 C  CD2 . LEU A 1 284 ? 42.645 17.159 2.274  1.00 24.05 ? 572  LEU A CD2 1 
ATOM   2138 N  N   . ALA A 1 285 ? 41.615 17.974 -2.988 1.00 33.04 ? 573  ALA A N   1 
ATOM   2139 C  CA  . ALA A 1 285 ? 41.402 18.726 -4.230 1.00 33.06 ? 573  ALA A CA  1 
ATOM   2140 C  C   . ALA A 1 285 ? 40.250 19.727 -4.117 1.00 34.45 ? 573  ALA A C   1 
ATOM   2141 O  O   . ALA A 1 285 ? 40.223 20.722 -4.849 1.00 36.17 ? 573  ALA A O   1 
ATOM   2142 C  CB  . ALA A 1 285 ? 41.150 17.759 -5.427 1.00 32.22 ? 573  ALA A CB  1 
ATOM   2143 N  N   . LYS A 1 286 ? 39.303 19.460 -3.214 1.00 34.92 ? 574  LYS A N   1 
ATOM   2144 C  CA  . LYS A 1 286 ? 38.187 20.374 -2.938 1.00 34.45 ? 574  LYS A CA  1 
ATOM   2145 C  C   . LYS A 1 286 ? 38.592 21.635 -2.176 1.00 33.27 ? 574  LYS A C   1 
ATOM   2146 O  O   . LYS A 1 286 ? 37.807 22.561 -2.106 1.00 34.43 ? 574  LYS A O   1 
ATOM   2147 C  CB  . LYS A 1 286 ? 37.099 19.681 -2.111 1.00 34.21 ? 574  LYS A CB  1 
ATOM   2148 C  CG  . LYS A 1 286 ? 36.434 18.453 -2.732 1.00 37.51 ? 574  LYS A CG  1 
ATOM   2149 C  CD  . LYS A 1 286 ? 35.270 18.025 -1.839 1.00 36.10 ? 574  LYS A CD  1 
ATOM   2150 C  CE  . LYS A 1 286 ? 34.241 17.194 -2.565 1.00 43.01 ? 574  LYS A CE  1 
ATOM   2151 N  NZ  . LYS A 1 286 ? 32.853 17.539 -2.109 1.00 40.87 ? 574  LYS A NZ  1 
ATOM   2152 N  N   . ALA A 1 287 ? 39.788 21.676 -1.594 1.00 34.04 ? 575  ALA A N   1 
ATOM   2153 C  CA  . ALA A 1 287 ? 40.211 22.812 -0.748 1.00 33.54 ? 575  ALA A CA  1 
ATOM   2154 C  C   . ALA A 1 287 ? 39.939 24.150 -1.420 1.00 34.13 ? 575  ALA A C   1 
ATOM   2155 O  O   . ALA A 1 287 ? 40.360 24.376 -2.543 1.00 35.27 ? 575  ALA A O   1 
ATOM   2156 C  CB  . ALA A 1 287 ? 41.696 22.711 -0.399 1.00 33.07 ? 575  ALA A CB  1 
ATOM   2157 N  N   . GLY A 1 288 ? 39.220 25.028 -0.737 1.00 33.18 ? 576  GLY A N   1 
ATOM   2158 C  CA  . GLY A 1 288 ? 39.030 26.381 -1.223 1.00 32.46 ? 576  GLY A CA  1 
ATOM   2159 C  C   . GLY A 1 288 ? 40.138 27.275 -0.717 1.00 33.42 ? 576  GLY A C   1 
ATOM   2160 O  O   . GLY A 1 288 ? 40.916 26.888 0.165  1.00 35.51 ? 576  GLY A O   1 
ATOM   2161 N  N   . PRO A 1 289 ? 40.211 28.494 -1.247 1.00 32.19 ? 577  PRO A N   1 
ATOM   2162 C  CA  . PRO A 1 289 ? 41.226 29.427 -0.784 1.00 31.82 ? 577  PRO A CA  1 
ATOM   2163 C  C   . PRO A 1 289 ? 40.919 29.983 0.608  1.00 31.71 ? 577  PRO A C   1 
ATOM   2164 O  O   . PRO A 1 289 ? 39.836 29.790 1.134  1.00 31.46 ? 577  PRO A O   1 
ATOM   2165 C  CB  . PRO A 1 289 ? 41.172 30.531 -1.832 1.00 28.69 ? 577  PRO A CB  1 
ATOM   2166 C  CG  . PRO A 1 289 ? 39.811 30.505 -2.304 1.00 32.11 ? 577  PRO A CG  1 
ATOM   2167 C  CD  . PRO A 1 289 ? 39.373 29.080 -2.296 1.00 31.20 ? 577  PRO A CD  1 
ATOM   2168 N  N   . PRO A 1 290 ? 41.874 30.680 1.205  1.00 34.62 ? 578  PRO A N   1 
ATOM   2169 C  CA  . PRO A 1 290 ? 41.638 31.275 2.535  1.00 35.65 ? 578  PRO A CA  1 
ATOM   2170 C  C   . PRO A 1 290 ? 40.373 32.150 2.621  1.00 32.20 ? 578  PRO A C   1 
ATOM   2171 O  O   . PRO A 1 290 ? 39.680 32.149 3.630  1.00 32.70 ? 578  PRO A O   1 
ATOM   2172 C  CB  . PRO A 1 290 ? 42.902 32.120 2.760  1.00 36.62 ? 578  PRO A CB  1 
ATOM   2173 C  CG  . PRO A 1 290 ? 43.953 31.437 1.923  1.00 38.83 ? 578  PRO A CG  1 
ATOM   2174 C  CD  . PRO A 1 290 ? 43.241 30.916 0.715  1.00 34.52 ? 578  PRO A CD  1 
ATOM   2175 N  N   . ALA A 1 291 ? 40.069 32.877 1.564  1.00 29.55 ? 579  ALA A N   1 
ATOM   2176 C  CA  . ALA A 1 291 ? 38.889 33.749 1.577  1.00 30.86 ? 579  ALA A CA  1 
ATOM   2177 C  C   . ALA A 1 291 ? 37.581 32.971 1.825  1.00 30.79 ? 579  ALA A C   1 
ATOM   2178 O  O   . ALA A 1 291 ? 36.614 33.552 2.315  1.00 31.35 ? 579  ALA A O   1 
ATOM   2179 C  CB  . ALA A 1 291 ? 38.805 34.568 0.298  1.00 27.10 ? 579  ALA A CB  1 
ATOM   2180 N  N   . SER A 1 292 ? 37.560 31.671 1.501  1.00 30.44 ? 580  SER A N   1 
ATOM   2181 C  CA  . SER A 1 292 ? 36.397 30.819 1.764  1.00 30.54 ? 580  SER A CA  1 
ATOM   2182 C  C   . SER A 1 292 ? 36.122 30.612 3.274  1.00 30.81 ? 580  SER A C   1 
ATOM   2183 O  O   . SER A 1 292 ? 35.005 30.309 3.659  1.00 31.31 ? 580  SER A O   1 
ATOM   2184 C  CB  . SER A 1 292 ? 36.538 29.453 1.048  1.00 29.32 ? 580  SER A CB  1 
ATOM   2185 O  OG  . SER A 1 292 ? 37.528 28.595 1.631  1.00 30.90 ? 580  SER A OG  1 
ATOM   2186 N  N   . ILE A 1 293 ? 37.135 30.772 4.121  1.00 32.48 ? 581  ILE A N   1 
ATOM   2187 C  CA  . ILE A 1 293 ? 36.959 30.590 5.572  1.00 33.66 ? 581  ILE A CA  1 
ATOM   2188 C  C   . ILE A 1 293 ? 36.487 31.854 6.278  1.00 31.97 ? 581  ILE A C   1 
ATOM   2189 O  O   . ILE A 1 293 ? 35.765 31.782 7.269  1.00 32.76 ? 581  ILE A O   1 
ATOM   2190 C  CB  . ILE A 1 293 ? 38.259 29.998 6.246  1.00 36.71 ? 581  ILE A CB  1 
ATOM   2191 C  CG1 . ILE A 1 293 ? 38.245 28.459 6.196  1.00 43.10 ? 581  ILE A CG1 1 
ATOM   2192 C  CG2 . ILE A 1 293 ? 38.381 30.403 7.725  1.00 35.59 ? 581  ILE A CG2 1 
ATOM   2193 C  CD1 . ILE A 1 293 ? 38.884 27.826 4.970  1.00 45.17 ? 581  ILE A CD1 1 
ATOM   2194 N  N   . VAL A 1 294 ? 36.856 33.009 5.732  1.00 33.35 ? 582  VAL A N   1 
ATOM   2195 C  CA  . VAL A 1 294 ? 36.614 34.314 6.348  1.00 30.55 ? 582  VAL A CA  1 
ATOM   2196 C  C   . VAL A 1 294 ? 35.184 34.540 6.850  1.00 29.50 ? 582  VAL A C   1 
ATOM   2197 O  O   . VAL A 1 294 ? 35.007 34.999 7.970  1.00 28.12 ? 582  VAL A O   1 
ATOM   2198 C  CB  . VAL A 1 294 ? 37.107 35.482 5.427  1.00 30.69 ? 582  VAL A CB  1 
ATOM   2199 C  CG1 . VAL A 1 294 ? 36.718 36.859 6.002  1.00 30.26 ? 582  VAL A CG1 1 
ATOM   2200 C  CG2 . VAL A 1 294 ? 38.603 35.426 5.268  1.00 24.56 ? 582  VAL A CG2 1 
ATOM   2201 N  N   . PRO A 1 295 ? 34.161 34.229 6.032  1.00 30.61 ? 583  PRO A N   1 
ATOM   2202 C  CA  . PRO A 1 295 ? 32.781 34.454 6.509  1.00 31.59 ? 583  PRO A CA  1 
ATOM   2203 C  C   . PRO A 1 295 ? 32.334 33.555 7.679  1.00 31.64 ? 583  PRO A C   1 
ATOM   2204 O  O   . PRO A 1 295 ? 31.349 33.873 8.342  1.00 30.15 ? 583  PRO A O   1 
ATOM   2205 C  CB  . PRO A 1 295 ? 31.908 34.219 5.260  1.00 32.33 ? 583  PRO A CB  1 
ATOM   2206 C  CG  . PRO A 1 295 ? 32.803 33.701 4.200  1.00 32.24 ? 583  PRO A CG  1 
ATOM   2207 C  CD  . PRO A 1 295 ? 34.212 33.708 4.653  1.00 31.70 ? 583  PRO A CD  1 
ATOM   2208 N  N   . LEU A 1 296 ? 33.070 32.475 7.944  1.00 31.27 ? 584  LEU A N   1 
ATOM   2209 C  CA  . LEU A 1 296 ? 32.827 31.626 9.109  1.00 31.26 ? 584  LEU A CA  1 
ATOM   2210 C  C   . LEU A 1 296 ? 33.257 32.262 10.437 1.00 30.68 ? 584  LEU A C   1 
ATOM   2211 O  O   . LEU A 1 296 ? 32.771 31.869 11.494 1.00 26.91 ? 584  LEU A O   1 
ATOM   2212 C  CB  . LEU A 1 296 ? 33.558 30.282 8.964  1.00 32.94 ? 584  LEU A CB  1 
ATOM   2213 C  CG  . LEU A 1 296 ? 33.207 29.339 7.798  1.00 36.74 ? 584  LEU A CG  1 
ATOM   2214 C  CD1 . LEU A 1 296 ? 34.187 28.148 7.764  1.00 29.75 ? 584  LEU A CD1 1 
ATOM   2215 C  CD2 . LEU A 1 296 ? 31.803 28.850 7.922  1.00 31.85 ? 584  LEU A CD2 1 
ATOM   2216 N  N   . MET A 1 297 ? 34.177 33.222 10.387 1.00 32.37 ? 585  MET A N   1 
ATOM   2217 C  CA  . MET A 1 297 ? 34.763 33.787 11.610 1.00 33.27 ? 585  MET A CA  1 
ATOM   2218 C  C   . MET A 1 297 ? 33.761 34.666 12.360 1.00 30.18 ? 585  MET A C   1 
ATOM   2219 O  O   . MET A 1 297 ? 32.952 35.339 11.776 1.00 25.72 ? 585  MET A O   1 
ATOM   2220 C  CB  . MET A 1 297 ? 36.051 34.576 11.306 1.00 32.33 ? 585  MET A CB  1 
ATOM   2221 C  CG  . MET A 1 297 ? 37.246 33.687 10.912 1.00 36.17 ? 585  MET A CG  1 
ATOM   2222 S  SD  . MET A 1 297 ? 38.553 34.588 10.037 1.00 41.22 ? 585  MET A SD  1 
ATOM   2223 C  CE  . MET A 1 297 ? 39.358 33.247 9.201  1.00 45.78 ? 585  MET A CE  1 
ATOM   2224 N  N   . ARG A 1 298 ? 33.852 34.618 13.677 1.00 31.29 ? 586  ARG A N   1 
ATOM   2225 C  CA  . ARG A 1 298 ? 33.013 35.369 14.588 1.00 32.97 ? 586  ARG A CA  1 
ATOM   2226 C  C   . ARG A 1 298 ? 32.811 36.816 14.198 1.00 30.45 ? 586  ARG A C   1 
ATOM   2227 O  O   . ARG A 1 298 ? 31.698 37.304 14.246 1.00 31.75 ? 586  ARG A O   1 
ATOM   2228 C  CB  . ARG A 1 298 ? 33.655 35.296 15.988 1.00 32.56 ? 586  ARG A CB  1 
ATOM   2229 C  CG  . ARG A 1 298 ? 32.841 35.892 17.152 1.00 37.47 ? 586  ARG A CG  1 
ATOM   2230 C  CD  . ARG A 1 298 ? 33.472 35.407 18.492 1.00 41.93 ? 586  ARG A CD  1 
ATOM   2231 N  NE  . ARG A 1 298 ? 32.549 35.436 19.625 1.00 51.02 ? 586  ARG A NE  1 
ATOM   2232 C  CZ  . ARG A 1 298 ? 31.746 34.435 20.013 1.00 53.85 ? 586  ARG A CZ  1 
ATOM   2233 N  NH1 . ARG A 1 298 ? 31.707 33.269 19.384 1.00 44.37 ? 586  ARG A NH1 1 
ATOM   2234 N  NH2 . ARG A 1 298 ? 30.960 34.608 21.068 1.00 64.03 ? 586  ARG A NH2 1 
ATOM   2235 N  N   . GLN A 1 299 ? 33.883 37.515 13.832 1.00 32.82 ? 587  GLN A N   1 
ATOM   2236 C  CA  . GLN A 1 299 ? 33.794 38.969 13.539 1.00 34.10 ? 587  GLN A CA  1 
ATOM   2237 C  C   . GLN A 1 299 ? 32.999 39.277 12.298 1.00 32.42 ? 587  GLN A C   1 
ATOM   2238 O  O   . GLN A 1 299 ? 32.627 40.418 12.097 1.00 32.26 ? 587  GLN A O   1 
ATOM   2239 C  CB  . GLN A 1 299 ? 35.154 39.651 13.316 1.00 36.37 ? 587  GLN A CB  1 
ATOM   2240 C  CG  . GLN A 1 299 ? 36.326 39.101 14.053 1.00 44.40 ? 587  GLN A CG  1 
ATOM   2241 C  CD  . GLN A 1 299 ? 36.866 37.862 13.398 1.00 46.59 ? 587  GLN A CD  1 
ATOM   2242 O  OE1 . GLN A 1 299 ? 36.865 36.803 14.004 1.00 36.85 ? 587  GLN A OE1 1 
ATOM   2243 N  NE2 . GLN A 1 299 ? 37.283 37.977 12.138 1.00 49.86 ? 587  GLN A NE2 1 
ATOM   2244 N  N   . ASN A 1 300 ? 32.809 38.279 11.440 1.00 32.77 ? 588  ASN A N   1 
ATOM   2245 C  CA  . ASN A 1 300 ? 32.068 38.435 10.184 1.00 33.29 ? 588  ASN A CA  1 
ATOM   2246 C  C   . ASN A 1 300 ? 30.672 37.794 10.214 1.00 33.48 ? 588  ASN A C   1 
ATOM   2247 O  O   . ASN A 1 300 ? 29.958 37.790 9.208  1.00 33.23 ? 588  ASN A O   1 
ATOM   2248 C  CB  . ASN A 1 300 ? 32.948 37.895 9.043  1.00 30.28 ? 588  ASN A CB  1 
ATOM   2249 C  CG  . ASN A 1 300 ? 34.354 38.477 9.095  1.00 33.79 ? 588  ASN A CG  1 
ATOM   2250 O  OD1 . ASN A 1 300 ? 34.518 39.656 9.421  1.00 36.14 ? 588  ASN A OD1 1 
ATOM   2251 N  ND2 . ASN A 1 300 ? 35.373 37.657 8.835  1.00 30.50 ? 588  ASN A ND2 1 
ATOM   2252 N  N   . ARG A 1 301 ? 30.300 37.241 11.373 1.00 36.56 ? 589  ARG A N   1 
ATOM   2253 C  CA  . ARG A 1 301 ? 28.969 36.645 11.604 1.00 37.54 ? 589  ARG A CA  1 
ATOM   2254 C  C   . ARG A 1 301 ? 28.103 37.584 12.404 1.00 39.59 ? 589  ARG A C   1 
ATOM   2255 O  O   . ARG A 1 301 ? 28.609 38.429 13.149 1.00 39.21 ? 589  ARG A O   1 
ATOM   2256 C  CB  . ARG A 1 301 ? 29.051 35.384 12.463 1.00 35.86 ? 589  ARG A CB  1 
ATOM   2257 C  CG  . ARG A 1 301 ? 29.703 34.169 11.879 1.00 37.12 ? 589  ARG A CG  1 
ATOM   2258 C  CD  . ARG A 1 301 ? 29.401 32.967 12.808 1.00 38.10 ? 589  ARG A CD  1 
ATOM   2259 N  NE  . ARG A 1 301 ? 30.617 32.298 13.215 1.00 49.78 ? 589  ARG A NE  1 
ATOM   2260 C  CZ  . ARG A 1 301 ? 31.103 32.180 14.453 1.00 40.97 ? 589  ARG A CZ  1 
ATOM   2261 N  NH1 . ARG A 1 301 ? 30.496 32.661 15.538 1.00 27.88 ? 589  ARG A NH1 1 
ATOM   2262 N  NH2 . ARG A 1 301 ? 32.248 31.540 14.587 1.00 39.26 ? 589  ARG A NH2 1 
ATOM   2263 N  N   . THR A 1 302 ? 26.798 37.354 12.331 1.00 43.36 ? 590  THR A N   1 
ATOM   2264 C  CA  . THR A 1 302 ? 25.833 38.176 13.038 1.00 46.69 ? 590  THR A CA  1 
ATOM   2265 C  C   . THR A 1 302 ? 24.597 37.371 13.444 1.00 46.64 ? 590  THR A C   1 
ATOM   2266 O  O   . THR A 1 302 ? 24.680 36.159 13.666 1.00 45.47 ? 590  THR A O   1 
ATOM   2267 C  CB  . THR A 1 302 ? 25.430 39.348 12.157 1.00 48.38 ? 590  THR A CB  1 
ATOM   2268 O  OG1 . THR A 1 302 ? 24.722 40.322 12.938 1.00 54.15 ? 590  THR A OG1 1 
ATOM   2269 C  CG2 . THR A 1 302 ? 24.570 38.855 10.962 1.00 51.81 ? 590  THR A CG2 1 
HETATM 2270 C  CAS . 23D B 2 .   ? 41.971 34.568 20.118 1.00 45.05 ? 1591 23D A CAS 1 
HETATM 2271 C  CAQ . 23D B 2 .   ? 40.686 35.021 20.415 1.00 52.38 ? 1591 23D A CAQ 1 
HETATM 2272 CL CL1 . 23D B 2 .   ? 39.882 34.501 21.876 1.00 61.65 ? 1591 23D A CL1 1 
HETATM 2273 C  CAP . 23D B 2 .   ? 40.046 35.903 19.548 1.00 45.63 ? 1591 23D A CAP 1 
HETATM 2274 C  CAO . 23D B 2 .   ? 40.682 36.305 18.389 1.00 49.51 ? 1591 23D A CAO 1 
HETATM 2275 C  CAN . 23D B 2 .   ? 41.959 35.843 18.099 1.00 46.81 ? 1591 23D A CAN 1 
HETATM 2276 C  CAM . 23D B 2 .   ? 42.626 34.961 18.947 1.00 45.98 ? 1591 23D A CAM 1 
HETATM 2277 N  N6  . 23D B 2 .   ? 43.879 34.545 18.613 1.00 41.35 ? 1591 23D A N6  1 
HETATM 2278 C  C6  . 23D B 2 .   ? 44.571 33.635 19.302 1.00 36.81 ? 1591 23D A C6  1 
HETATM 2279 N  N1  . 23D B 2 .   ? 43.912 32.823 20.105 1.00 38.02 ? 1591 23D A N1  1 
HETATM 2280 C  C5  . 23D B 2 .   ? 45.950 33.483 19.224 1.00 34.32 ? 1591 23D A C5  1 
HETATM 2281 N  N7  . 23D B 2 .   ? 46.889 34.114 18.526 1.00 31.88 ? 1591 23D A N7  1 
HETATM 2282 C  C8  . 23D B 2 .   ? 48.061 33.574 18.824 1.00 38.67 ? 1591 23D A C8  1 
HETATM 2283 N  N9  . 23D B 2 .   ? 47.853 32.598 19.712 1.00 40.21 ? 1591 23D A N9  1 
HETATM 2284 C  CAZ . 23D B 2 .   ? 48.927 31.774 20.281 1.00 36.81 ? 1591 23D A CAZ 1 
HETATM 2285 C  CBA . 23D B 2 .   ? 49.447 30.893 19.162 1.00 45.89 ? 1591 23D A CBA 1 
HETATM 2286 C  C4  . 23D B 2 .   ? 46.554 32.489 19.996 1.00 35.96 ? 1591 23D A C4  1 
HETATM 2287 N  N3  . 23D B 2 .   ? 45.812 31.676 20.808 1.00 35.12 ? 1591 23D A N3  1 
HETATM 2288 C  C2  . 23D B 2 .   ? 44.483 31.880 20.852 1.00 39.27 ? 1591 23D A C2  1 
HETATM 2289 N  N2  . 23D B 2 .   ? 43.527 31.215 21.505 1.00 46.69 ? 1591 23D A N2  1 
HETATM 2290 C  CAG . 23D B 2 .   ? 43.481 30.460 22.758 1.00 56.31 ? 1591 23D A CAG 1 
HETATM 2291 C  CAF . 23D B 2 .   ? 44.825 30.236 23.427 1.00 61.97 ? 1591 23D A CAF 1 
HETATM 2292 C  CAE . 23D B 2 .   ? 44.662 29.323 24.661 1.00 62.38 ? 1591 23D A CAE 1 
HETATM 2293 C  CAD . 23D B 2 .   ? 43.218 28.870 24.882 1.00 61.03 ? 1591 23D A CAD 1 
HETATM 2294 C  CAC . 23D B 2 .   ? 42.639 28.214 23.615 1.00 61.02 ? 1591 23D A CAC 1 
HETATM 2295 C  CAA . 23D B 2 .   ? 42.752 29.156 22.406 1.00 58.29 ? 1591 23D A CAA 1 
HETATM 2296 N  NAB . 23D B 2 .   ? 41.406 29.509 21.938 1.00 53.83 ? 1591 23D A NAB 1 
HETATM 2297 S  S   . SO4 C 3 .   ? 52.796 8.183  31.444 1.00 77.41 ? 1592 SO4 A S   1 
HETATM 2298 O  O1  . SO4 C 3 .   ? 54.069 8.901  31.373 1.00 75.41 ? 1592 SO4 A O1  1 
HETATM 2299 O  O2  . SO4 C 3 .   ? 51.766 8.817  30.640 1.00 76.64 ? 1592 SO4 A O2  1 
HETATM 2300 O  O3  . SO4 C 3 .   ? 53.026 6.837  30.926 1.00 80.34 ? 1592 SO4 A O3  1 
HETATM 2301 O  O4  . SO4 C 3 .   ? 52.305 8.149  32.819 1.00 79.81 ? 1592 SO4 A O4  1 
HETATM 2302 S  S   . SO4 D 3 .   ? 38.371 -1.149 31.907 1.00 82.88 ? 1593 SO4 A S   1 
HETATM 2303 O  O1  . SO4 D 3 .   ? 39.638 -0.408 31.826 1.00 72.24 ? 1593 SO4 A O1  1 
HETATM 2304 O  O2  . SO4 D 3 .   ? 37.588 -0.992 30.685 1.00 84.89 ? 1593 SO4 A O2  1 
HETATM 2305 O  O3  . SO4 D 3 .   ? 38.635 -2.573 32.078 1.00 83.56 ? 1593 SO4 A O3  1 
HETATM 2306 O  O4  . SO4 D 3 .   ? 37.539 -0.667 33.010 1.00 80.72 ? 1593 SO4 A O4  1 
HETATM 2307 CL CL  . CL  E 4 .   ? 38.918 6.344  -0.907 1.00 69.32 ? 1594 CL  A CL  1 
HETATM 2308 O  O   . HOH F 5 .   ? 62.483 21.178 43.865 1.00 44.31 ? 2001 HOH A O   1 
HETATM 2309 O  O   . HOH F 5 .   ? 67.638 27.913 38.501 1.00 40.79 ? 2002 HOH A O   1 
HETATM 2310 O  O   . HOH F 5 .   ? 68.607 18.501 40.080 1.00 52.30 ? 2003 HOH A O   1 
HETATM 2311 O  O   . HOH F 5 .   ? 66.237 34.235 34.428 1.00 39.82 ? 2004 HOH A O   1 
HETATM 2312 O  O   . HOH F 5 .   ? 67.253 29.495 36.592 1.00 36.13 ? 2005 HOH A O   1 
HETATM 2313 O  O   . HOH F 5 .   ? 71.043 28.463 33.537 1.00 33.63 ? 2006 HOH A O   1 
HETATM 2314 O  O   . HOH F 5 .   ? 70.666 29.576 35.723 1.00 37.15 ? 2007 HOH A O   1 
HETATM 2315 O  O   . HOH F 5 .   ? 69.023 32.324 37.754 1.00 54.09 ? 2008 HOH A O   1 
HETATM 2316 O  O   . HOH F 5 .   ? 69.746 31.764 26.161 1.00 26.19 ? 2009 HOH A O   1 
HETATM 2317 O  O   . HOH F 5 .   ? 63.719 32.175 21.946 1.00 36.12 ? 2010 HOH A O   1 
HETATM 2318 O  O   . HOH F 5 .   ? 64.410 35.503 30.360 1.00 31.19 ? 2011 HOH A O   1 
HETATM 2319 O  O   . HOH F 5 .   ? 67.832 37.342 23.509 1.00 44.88 ? 2012 HOH A O   1 
HETATM 2320 O  O   . HOH F 5 .   ? 67.016 38.790 25.275 1.00 40.67 ? 2013 HOH A O   1 
HETATM 2321 O  O   . HOH F 5 .   ? 47.692 44.973 23.691 1.00 65.16 ? 2014 HOH A O   1 
HETATM 2322 O  O   . HOH F 5 .   ? 50.804 27.258 34.253 1.00 29.40 ? 2015 HOH A O   1 
HETATM 2323 O  O   . HOH F 5 .   ? 51.697 39.450 15.841 1.00 35.68 ? 2016 HOH A O   1 
HETATM 2324 O  O   . HOH F 5 .   ? 50.104 31.155 34.566 1.00 45.11 ? 2017 HOH A O   1 
HETATM 2325 O  O   . HOH F 5 .   ? 53.696 20.943 30.467 1.00 42.37 ? 2018 HOH A O   1 
HETATM 2326 O  O   . HOH F 5 .   ? 49.952 20.309 32.763 1.00 48.04 ? 2019 HOH A O   1 
HETATM 2327 O  O   . HOH F 5 .   ? 49.788 16.139 30.477 1.00 51.15 ? 2020 HOH A O   1 
HETATM 2328 O  O   . HOH F 5 .   ? 58.107 15.616 34.664 1.00 34.47 ? 2021 HOH A O   1 
HETATM 2329 O  O   . HOH F 5 .   ? 62.673 27.941 12.320 1.00 46.69 ? 2022 HOH A O   1 
HETATM 2330 O  O   . HOH F 5 .   ? 59.204 39.529 21.027 1.00 42.26 ? 2023 HOH A O   1 
HETATM 2331 O  O   . HOH F 5 .   ? 59.725 41.549 23.753 1.00 58.64 ? 2024 HOH A O   1 
HETATM 2332 O  O   . HOH F 5 .   ? 62.324 37.194 36.690 1.00 41.08 ? 2025 HOH A O   1 
HETATM 2333 O  O   . HOH F 5 .   ? 61.299 29.793 39.600 1.00 48.88 ? 2026 HOH A O   1 
HETATM 2334 O  O   . HOH F 5 .   ? 46.051 37.620 11.675 1.00 25.79 ? 2027 HOH A O   1 
HETATM 2335 O  O   . HOH F 5 .   ? 37.504 31.430 14.721 1.00 31.86 ? 2028 HOH A O   1 
HETATM 2336 O  O   . HOH F 5 .   ? 38.409 31.592 19.161 1.00 33.37 ? 2029 HOH A O   1 
HETATM 2337 O  O   . HOH F 5 .   ? 35.177 32.421 14.933 1.00 21.98 ? 2030 HOH A O   1 
HETATM 2338 O  O   . HOH F 5 .   ? 37.316 29.029 20.239 1.00 35.77 ? 2031 HOH A O   1 
HETATM 2339 O  O   . HOH F 5 .   ? 26.100 24.300 14.756 1.00 52.29 ? 2032 HOH A O   1 
HETATM 2340 O  O   . HOH F 5 .   ? 27.790 22.199 18.372 1.00 52.16 ? 2033 HOH A O   1 
HETATM 2341 O  O   . HOH F 5 .   ? 66.333 34.061 31.771 1.00 26.67 ? 2034 HOH A O   1 
HETATM 2342 O  O   . HOH F 5 .   ? 29.677 26.944 5.484  1.00 33.20 ? 2035 HOH A O   1 
HETATM 2343 O  O   . HOH F 5 .   ? 27.129 23.352 4.460  1.00 45.96 ? 2036 HOH A O   1 
HETATM 2344 O  O   . HOH F 5 .   ? 69.281 32.617 23.414 1.00 42.26 ? 2037 HOH A O   1 
HETATM 2345 O  O   . HOH F 5 .   ? 29.627 18.467 5.618  1.00 46.37 ? 2038 HOH A O   1 
HETATM 2346 O  O   . HOH F 5 .   ? 31.519 22.693 -0.547 1.00 45.12 ? 2039 HOH A O   1 
HETATM 2347 O  O   . HOH F 5 .   ? 35.727 29.770 -2.931 1.00 45.90 ? 2040 HOH A O   1 
HETATM 2348 O  O   . HOH F 5 .   ? 37.273 25.112 -4.971 1.00 53.50 ? 2041 HOH A O   1 
HETATM 2349 O  O   . HOH F 5 .   ? 47.156 12.802 21.813 1.00 26.82 ? 2042 HOH A O   1 
HETATM 2350 O  O   . HOH F 5 .   ? 43.965 16.266 21.029 1.00 23.76 ? 2043 HOH A O   1 
HETATM 2351 O  O   . HOH F 5 .   ? 36.049 21.963 21.650 1.00 32.17 ? 2044 HOH A O   1 
HETATM 2352 O  O   . HOH F 5 .   ? 44.759 23.133 21.957 1.00 32.44 ? 2045 HOH A O   1 
HETATM 2353 O  O   . HOH F 5 .   ? 39.915 39.859 5.658  1.00 49.89 ? 2046 HOH A O   1 
HETATM 2354 O  O   . HOH F 5 .   ? 38.220 38.720 8.966  1.00 40.58 ? 2047 HOH A O   1 
HETATM 2355 O  O   . HOH F 5 .   ? 48.169 39.553 6.301  1.00 53.71 ? 2048 HOH A O   1 
HETATM 2356 O  O   . HOH F 5 .   ? 29.034 21.090 0.976  1.00 29.63 ? 2049 HOH A O   1 
HETATM 2357 O  O   . HOH F 5 .   ? 40.776 36.476 2.627  1.00 44.22 ? 2050 HOH A O   1 
HETATM 2358 O  O   . HOH F 5 .   ? 42.737 28.612 4.357  1.00 44.99 ? 2051 HOH A O   1 
HETATM 2359 O  O   . HOH F 5 .   ? 45.750 28.090 4.917  1.00 39.74 ? 2052 HOH A O   1 
HETATM 2360 O  O   . HOH F 5 .   ? 50.701 27.829 21.326 1.00 53.07 ? 2053 HOH A O   1 
HETATM 2361 O  O   . HOH F 5 .   ? 47.203 28.954 20.861 1.00 46.46 ? 2054 HOH A O   1 
HETATM 2362 O  O   . HOH F 5 .   ? 45.345 27.238 20.542 1.00 37.26 ? 2055 HOH A O   1 
HETATM 2363 O  O   . HOH F 5 .   ? 51.206 19.854 21.510 1.00 28.94 ? 2056 HOH A O   1 
HETATM 2364 O  O   . HOH F 5 .   ? 50.094 23.642 24.351 1.00 41.00 ? 2057 HOH A O   1 
HETATM 2365 O  O   . HOH F 5 .   ? 52.900 26.400 20.909 1.00 31.78 ? 2058 HOH A O   1 
HETATM 2366 O  O   . HOH F 5 .   ? 35.740 23.289 23.733 1.00 42.58 ? 2059 HOH A O   1 
HETATM 2367 O  O   . HOH F 5 .   ? 54.003 22.677 27.705 1.00 44.27 ? 2060 HOH A O   1 
HETATM 2368 O  O   . HOH F 5 .   ? 63.246 11.353 25.841 1.00 48.66 ? 2061 HOH A O   1 
HETATM 2369 O  O   . HOH F 5 .   ? 36.986 7.952  19.292 1.00 42.32 ? 2062 HOH A O   1 
HETATM 2370 O  O   . HOH F 5 .   ? 44.396 18.039 27.497 1.00 38.80 ? 2063 HOH A O   1 
HETATM 2371 O  O   . HOH F 5 .   ? 47.962 15.296 28.699 1.00 42.80 ? 2064 HOH A O   1 
HETATM 2372 O  O   . HOH F 5 .   ? 44.754 13.898 21.927 1.00 23.11 ? 2065 HOH A O   1 
HETATM 2373 O  O   . HOH F 5 .   ? 36.034 10.421 21.176 1.00 30.77 ? 2066 HOH A O   1 
HETATM 2374 O  O   . HOH F 5 .   ? 39.737 9.550  19.892 1.00 27.40 ? 2067 HOH A O   1 
HETATM 2375 O  O   . HOH F 5 .   ? 46.458 10.980 19.920 1.00 20.25 ? 2068 HOH A O   1 
HETATM 2376 O  O   . HOH F 5 .   ? 37.687 32.837 -5.440 1.00 26.98 ? 2069 HOH A O   1 
HETATM 2377 O  O   . HOH F 5 .   ? 43.995 7.044  32.060 1.00 59.13 ? 2070 HOH A O   1 
HETATM 2378 O  O   . HOH F 5 .   ? 51.744 -0.405 18.628 1.00 47.47 ? 2071 HOH A O   1 
HETATM 2379 O  O   . HOH F 5 .   ? 51.428 5.283  16.811 1.00 35.62 ? 2072 HOH A O   1 
HETATM 2380 O  O   . HOH F 5 .   ? 52.941 1.893  12.791 1.00 45.09 ? 2073 HOH A O   1 
HETATM 2381 O  O   . HOH F 5 .   ? 47.421 14.633 18.329 1.00 23.19 ? 2074 HOH A O   1 
HETATM 2382 O  O   . HOH F 5 .   ? 38.127 -1.720 13.104 1.00 39.17 ? 2075 HOH A O   1 
HETATM 2383 O  O   . HOH F 5 .   ? 52.186 8.980  10.240 1.00 33.73 ? 2076 HOH A O   1 
HETATM 2384 O  O   . HOH F 5 .   ? 56.300 9.267  8.631  1.00 44.46 ? 2077 HOH A O   1 
HETATM 2385 O  O   . HOH F 5 .   ? 33.940 20.322 18.956 1.00 29.66 ? 2078 HOH A O   1 
HETATM 2386 O  O   . HOH F 5 .   ? 31.255 22.965 10.956 1.00 32.32 ? 2079 HOH A O   1 
HETATM 2387 O  O   . HOH F 5 .   ? 40.173 34.096 -2.947 1.00 36.76 ? 2080 HOH A O   1 
HETATM 2388 O  O   . HOH F 5 .   ? 37.635 33.680 -3.250 1.00 38.67 ? 2081 HOH A O   1 
HETATM 2389 O  O   . HOH F 5 .   ? 30.083 13.714 16.839 1.00 34.18 ? 2082 HOH A O   1 
HETATM 2390 O  O   . HOH F 5 .   ? 30.449 37.294 5.571  1.00 43.52 ? 2083 HOH A O   1 
HETATM 2391 O  O   . HOH F 5 .   ? 28.938 10.171 20.141 1.00 34.70 ? 2084 HOH A O   1 
HETATM 2392 O  O   . HOH F 5 .   ? 35.032 4.604  18.710 1.00 60.07 ? 2085 HOH A O   1 
HETATM 2393 O  O   . HOH F 5 .   ? 31.165 15.654 30.375 1.00 46.06 ? 2086 HOH A O   1 
HETATM 2394 O  O   . HOH F 5 .   ? 27.776 11.008 22.952 1.00 58.01 ? 2087 HOH A O   1 
HETATM 2395 O  O   . HOH F 5 .   ? 28.021 8.217  23.932 1.00 63.27 ? 2088 HOH A O   1 
HETATM 2396 O  O   . HOH F 5 .   ? 36.093 10.504 33.537 1.00 42.89 ? 2089 HOH A O   1 
HETATM 2397 O  O   . HOH F 5 .   ? 40.753 4.169  30.326 1.00 52.16 ? 2090 HOH A O   1 
HETATM 2398 O  O   . HOH F 5 .   ? 37.912 3.288  18.098 1.00 32.38 ? 2091 HOH A O   1 
HETATM 2399 O  O   . HOH F 5 .   ? 35.050 6.763  10.072 1.00 41.88 ? 2092 HOH A O   1 
HETATM 2400 O  O   . HOH F 5 .   ? 28.742 8.628  1.932  1.00 54.72 ? 2093 HOH A O   1 
HETATM 2401 O  O   . HOH F 5 .   ? 33.239 13.085 -4.217 1.00 45.45 ? 2094 HOH A O   1 
HETATM 2402 O  O   . HOH F 5 .   ? 38.813 4.908  2.150  1.00 35.79 ? 2095 HOH A O   1 
HETATM 2403 O  O   . HOH F 5 .   ? 40.074 0.271  11.904 1.00 33.77 ? 2096 HOH A O   1 
HETATM 2404 O  O   . HOH F 5 .   ? 42.457 -1.184 11.952 1.00 39.44 ? 2097 HOH A O   1 
HETATM 2405 O  O   . HOH F 5 .   ? 49.915 -2.602 15.302 1.00 39.05 ? 2098 HOH A O   1 
HETATM 2406 O  O   . HOH F 5 .   ? 49.884 -4.833 12.212 1.00 59.69 ? 2099 HOH A O   1 
HETATM 2407 O  O   . HOH F 5 .   ? 50.591 4.540  9.733  1.00 32.83 ? 2100 HOH A O   1 
HETATM 2408 O  O   . HOH F 5 .   ? 49.798 7.355  10.450 1.00 32.48 ? 2101 HOH A O   1 
HETATM 2409 O  O   . HOH F 5 .   ? 54.029 7.803  4.008  1.00 44.11 ? 2102 HOH A O   1 
HETATM 2410 O  O   . HOH F 5 .   ? 52.477 11.068 9.000  1.00 26.88 ? 2103 HOH A O   1 
HETATM 2411 O  O   . HOH F 5 .   ? 53.876 11.593 6.731  1.00 34.41 ? 2104 HOH A O   1 
HETATM 2412 O  O   . HOH F 5 .   ? 49.313 3.342  4.978  1.00 46.44 ? 2105 HOH A O   1 
HETATM 2413 O  O   . HOH F 5 .   ? 51.862 7.968  -0.701 1.00 66.15 ? 2106 HOH A O   1 
HETATM 2414 O  O   . HOH F 5 .   ? 53.225 3.681  6.455  1.00 48.52 ? 2107 HOH A O   1 
HETATM 2415 O  O   . HOH F 5 .   ? 45.198 16.360 -3.497 1.00 44.76 ? 2108 HOH A O   1 
HETATM 2416 O  O   . HOH F 5 .   ? 31.990 15.703 -4.086 1.00 54.18 ? 2109 HOH A O   1 
HETATM 2417 O  O   . HOH F 5 .   ? 43.749 25.890 -2.298 1.00 46.65 ? 2110 HOH A O   1 
HETATM 2418 O  O   . HOH F 5 .   ? 42.744 27.694 1.738  1.00 44.16 ? 2111 HOH A O   1 
HETATM 2419 O  O   . HOH F 5 .   ? 44.600 29.762 -2.411 1.00 48.09 ? 2112 HOH A O   1 
HETATM 2420 O  O   . HOH F 5 .   ? 35.813 36.045 1.969  1.00 34.17 ? 2113 HOH A O   1 
HETATM 2421 O  O   . HOH F 5 .   ? 41.842 33.840 -0.958 1.00 27.45 ? 2114 HOH A O   1 
HETATM 2422 O  O   . HOH F 5 .   ? 36.495 31.668 -1.474 1.00 34.77 ? 2115 HOH A O   1 
HETATM 2423 O  O   . HOH F 5 .   ? 29.387 35.662 7.646  1.00 36.84 ? 2116 HOH A O   1 
HETATM 2424 O  O   . HOH F 5 .   ? 29.999 39.790 15.041 1.00 41.61 ? 2117 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   289 ?   ?   ?   A . n 
A 1 2   SER 2   290 ?   ?   ?   A . n 
A 1 3   SER 3   291 ?   ?   ?   A . n 
A 1 4   PRO 4   292 ?   ?   ?   A . n 
A 1 5   GLN 5   293 ?   ?   ?   A . n 
A 1 6   ARG 6   294 ?   ?   ?   A . n 
A 1 7   GLU 7   295 ?   ?   ?   A . n 
A 1 8   PRO 8   296 ?   ?   ?   A . n 
A 1 9   GLN 9   297 ?   ?   ?   A . n 
A 1 10  ARG 10  298 ?   ?   ?   A . n 
A 1 11  VAL 11  299 299 VAL VAL A . n 
A 1 12  SER 12  300 300 SER SER A . n 
A 1 13  HIS 13  301 301 HIS HIS A . n 
A 1 14  GLU 14  302 302 GLU GLU A . n 
A 1 15  GLN 15  303 303 GLN GLN A . n 
A 1 16  PHE 16  304 304 PHE PHE A . n 
A 1 17  ARG 17  305 305 ARG ARG A . n 
A 1 18  ALA 18  306 306 ALA ALA A . n 
A 1 19  ALA 19  307 307 ALA ALA A . n 
A 1 20  LEU 20  308 308 LEU LEU A . n 
A 1 21  GLN 21  309 309 GLN GLN A . n 
A 1 22  LEU 22  310 310 LEU LEU A . n 
A 1 23  VAL 23  311 311 VAL VAL A . n 
A 1 24  VAL 24  312 312 VAL VAL A . n 
A 1 25  ASP 25  313 313 ASP ASP A . n 
A 1 26  PRO 26  314 314 PRO PRO A . n 
A 1 27  GLY 27  315 315 GLY GLY A . n 
A 1 28  ASP 28  316 316 ASP ASP A . n 
A 1 29  PRO 29  317 317 PRO PRO A . n 
A 1 30  ARG 30  318 318 ARG ARG A . n 
A 1 31  SER 31  319 319 SER SER A . n 
A 1 32  TYR 32  320 320 TYR TYR A . n 
A 1 33  LEU 33  321 321 LEU LEU A . n 
A 1 34  ASP 34  322 322 ASP ASP A . n 
A 1 35  ASN 35  323 323 ASN ASN A . n 
A 1 36  PHE 36  324 324 PHE PHE A . n 
A 1 37  ILE 37  325 325 ILE ILE A . n 
A 1 38  LYS 38  326 326 LYS LYS A . n 
A 1 39  ILE 39  327 327 ILE ILE A . n 
A 1 40  GLY 40  328 328 GLY GLY A . n 
A 1 41  GLU 41  329 329 GLU GLU A . n 
A 1 42  GLY 42  330 330 GLY GLY A . n 
A 1 43  SER 43  331 331 SER SER A . n 
A 1 44  THR 44  332 332 THR THR A . n 
A 1 45  GLY 45  333 333 GLY GLY A . n 
A 1 46  ILE 46  334 334 ILE ILE A . n 
A 1 47  VAL 47  335 335 VAL VAL A . n 
A 1 48  CYS 48  336 336 CYS CYS A . n 
A 1 49  ILE 49  337 337 ILE ILE A . n 
A 1 50  ALA 50  338 338 ALA ALA A . n 
A 1 51  THR 51  339 339 THR THR A . n 
A 1 52  VAL 52  340 340 VAL VAL A . n 
A 1 53  ARG 53  341 341 ARG ARG A . n 
A 1 54  SER 54  342 ?   ?   ?   A . n 
A 1 55  SER 55  343 ?   ?   ?   A . n 
A 1 56  GLY 56  344 344 GLY GLY A . n 
A 1 57  LYS 57  345 345 LYS LYS A . n 
A 1 58  LEU 58  346 346 LEU LEU A . n 
A 1 59  VAL 59  347 347 VAL VAL A . n 
A 1 60  ALA 60  348 348 ALA ALA A . n 
A 1 61  VAL 61  349 349 VAL VAL A . n 
A 1 62  LYS 62  350 350 LYS LYS A . n 
A 1 63  LYS 63  351 351 LYS LYS A . n 
A 1 64  MET 64  352 352 MET MET A . n 
A 1 65  ASP 65  353 353 ASP ASP A . n 
A 1 66  LEU 66  354 354 LEU LEU A . n 
A 1 67  ARG 67  355 355 ARG ARG A . n 
A 1 68  LYS 68  356 356 LYS LYS A . n 
A 1 69  GLN 69  357 357 GLN GLN A . n 
A 1 70  GLN 70  358 358 GLN GLN A . n 
A 1 71  ARG 71  359 359 ARG ARG A . n 
A 1 72  ARG 72  360 360 ARG ARG A . n 
A 1 73  GLU 73  361 361 GLU GLU A . n 
A 1 74  LEU 74  362 362 LEU LEU A . n 
A 1 75  LEU 75  363 363 LEU LEU A . n 
A 1 76  PHE 76  364 364 PHE PHE A . n 
A 1 77  ASN 77  365 365 ASN ASN A . n 
A 1 78  GLU 78  366 366 GLU GLU A . n 
A 1 79  VAL 79  367 367 VAL VAL A . n 
A 1 80  VAL 80  368 368 VAL VAL A . n 
A 1 81  ILE 81  369 369 ILE ILE A . n 
A 1 82  MET 82  370 370 MET MET A . n 
A 1 83  ARG 83  371 371 ARG ARG A . n 
A 1 84  ASP 84  372 372 ASP ASP A . n 
A 1 85  TYR 85  373 373 TYR TYR A . n 
A 1 86  GLN 86  374 374 GLN GLN A . n 
A 1 87  HIS 87  375 375 HIS HIS A . n 
A 1 88  GLU 88  376 376 GLU GLU A . n 
A 1 89  ASN 89  377 377 ASN ASN A . n 
A 1 90  VAL 90  378 378 VAL VAL A . n 
A 1 91  VAL 91  379 379 VAL VAL A . n 
A 1 92  GLU 92  380 380 GLU GLU A . n 
A 1 93  MET 93  381 381 MET MET A . n 
A 1 94  TYR 94  382 382 TYR TYR A . n 
A 1 95  ASN 95  383 383 ASN ASN A . n 
A 1 96  SER 96  384 384 SER SER A . n 
A 1 97  TYR 97  385 385 TYR TYR A . n 
A 1 98  LEU 98  386 386 LEU LEU A . n 
A 1 99  VAL 99  387 387 VAL VAL A . n 
A 1 100 GLY 100 388 388 GLY GLY A . n 
A 1 101 ASP 101 389 389 ASP ASP A . n 
A 1 102 GLU 102 390 390 GLU GLU A . n 
A 1 103 LEU 103 391 391 LEU LEU A . n 
A 1 104 TRP 104 392 392 TRP TRP A . n 
A 1 105 VAL 105 393 393 VAL VAL A . n 
A 1 106 VAL 106 394 394 VAL VAL A . n 
A 1 107 MET 107 395 395 MET MET A . n 
A 1 108 GLU 108 396 396 GLU GLU A . n 
A 1 109 PHE 109 397 397 PHE PHE A . n 
A 1 110 LEU 110 398 398 LEU LEU A . n 
A 1 111 GLU 111 399 399 GLU GLU A . n 
A 1 112 GLY 112 400 400 GLY GLY A . n 
A 1 113 GLY 113 401 401 GLY GLY A . n 
A 1 114 ALA 114 402 402 ALA ALA A . n 
A 1 115 LEU 115 403 403 LEU LEU A . n 
A 1 116 THR 116 404 404 THR THR A . n 
A 1 117 ASP 117 405 405 ASP ASP A . n 
A 1 118 ILE 118 406 406 ILE ILE A . n 
A 1 119 VAL 119 407 407 VAL VAL A . n 
A 1 120 THR 120 408 408 THR THR A . n 
A 1 121 HIS 121 409 409 HIS HIS A . n 
A 1 122 THR 122 410 410 THR THR A . n 
A 1 123 ARG 123 411 411 ARG ARG A . n 
A 1 124 MET 124 412 412 MET MET A . n 
A 1 125 ASN 125 413 413 ASN ASN A . n 
A 1 126 GLU 126 414 414 GLU GLU A . n 
A 1 127 GLU 127 415 415 GLU GLU A . n 
A 1 128 GLN 128 416 416 GLN GLN A . n 
A 1 129 ILE 129 417 417 ILE ILE A . n 
A 1 130 ALA 130 418 418 ALA ALA A . n 
A 1 131 ALA 131 419 419 ALA ALA A . n 
A 1 132 VAL 132 420 420 VAL VAL A . n 
A 1 133 CYS 133 421 421 CYS CYS A . n 
A 1 134 LEU 134 422 422 LEU LEU A . n 
A 1 135 ALA 135 423 423 ALA ALA A . n 
A 1 136 VAL 136 424 424 VAL VAL A . n 
A 1 137 LEU 137 425 425 LEU LEU A . n 
A 1 138 GLN 138 426 426 GLN GLN A . n 
A 1 139 ALA 139 427 427 ALA ALA A . n 
A 1 140 LEU 140 428 428 LEU LEU A . n 
A 1 141 SER 141 429 429 SER SER A . n 
A 1 142 VAL 142 430 430 VAL VAL A . n 
A 1 143 LEU 143 431 431 LEU LEU A . n 
A 1 144 HIS 144 432 432 HIS HIS A . n 
A 1 145 ALA 145 433 433 ALA ALA A . n 
A 1 146 GLN 146 434 434 GLN GLN A . n 
A 1 147 GLY 147 435 435 GLY GLY A . n 
A 1 148 VAL 148 436 436 VAL VAL A . n 
A 1 149 ILE 149 437 437 ILE ILE A . n 
A 1 150 HIS 150 438 438 HIS HIS A . n 
A 1 151 ARG 151 439 439 ARG ARG A . n 
A 1 152 ASP 152 440 440 ASP ASP A . n 
A 1 153 ILE 153 441 441 ILE ILE A . n 
A 1 154 LYS 154 442 442 LYS LYS A . n 
A 1 155 SER 155 443 443 SER SER A . n 
A 1 156 ASP 156 444 444 ASP ASP A . n 
A 1 157 SER 157 445 445 SER SER A . n 
A 1 158 ILE 158 446 446 ILE ILE A . n 
A 1 159 LEU 159 447 447 LEU LEU A . n 
A 1 160 LEU 160 448 448 LEU LEU A . n 
A 1 161 THR 161 449 449 THR THR A . n 
A 1 162 HIS 162 450 450 HIS HIS A . n 
A 1 163 ASP 163 451 451 ASP ASP A . n 
A 1 164 GLY 164 452 452 GLY GLY A . n 
A 1 165 ARG 165 453 453 ARG ARG A . n 
A 1 166 VAL 166 454 454 VAL VAL A . n 
A 1 167 LYS 167 455 455 LYS LYS A . n 
A 1 168 LEU 168 456 456 LEU LEU A . n 
A 1 169 SER 169 457 457 SER SER A . n 
A 1 170 ASP 170 458 458 ASP ASP A . n 
A 1 171 PHE 171 459 459 PHE PHE A . n 
A 1 172 GLY 172 460 460 GLY GLY A . n 
A 1 173 PHE 173 461 461 PHE PHE A . n 
A 1 174 CYS 174 462 462 CYS CYS A . n 
A 1 175 ALA 175 463 463 ALA ALA A . n 
A 1 176 GLN 176 464 464 GLN GLN A . n 
A 1 177 VAL 177 465 465 VAL VAL A . n 
A 1 178 SER 178 466 466 SER SER A . n 
A 1 179 LYS 179 467 467 LYS LYS A . n 
A 1 180 GLU 180 468 468 GLU GLU A . n 
A 1 181 VAL 181 469 469 VAL VAL A . n 
A 1 182 PRO 182 470 470 PRO PRO A . n 
A 1 183 ARG 183 471 471 ARG ARG A . n 
A 1 184 ARG 184 472 472 ARG ARG A . n 
A 1 185 LYS 185 473 473 LYS LYS A . n 
A 1 186 SEP 186 474 474 SEP SEP A . n 
A 1 187 LEU 187 475 475 LEU LEU A . n 
A 1 188 VAL 188 476 476 VAL VAL A . n 
A 1 189 GLY 189 477 477 GLY GLY A . n 
A 1 190 THR 190 478 478 THR THR A . n 
A 1 191 PRO 191 479 479 PRO PRO A . n 
A 1 192 TYR 192 480 480 TYR TYR A . n 
A 1 193 TRP 193 481 481 TRP TRP A . n 
A 1 194 MET 194 482 482 MET MET A . n 
A 1 195 ALA 195 483 483 ALA ALA A . n 
A 1 196 PRO 196 484 484 PRO PRO A . n 
A 1 197 GLU 197 485 485 GLU GLU A . n 
A 1 198 LEU 198 486 486 LEU LEU A . n 
A 1 199 ILE 199 487 487 ILE ILE A . n 
A 1 200 SER 200 488 488 SER SER A . n 
A 1 201 ARG 201 489 489 ARG ARG A . n 
A 1 202 LEU 202 490 490 LEU LEU A . n 
A 1 203 PRO 203 491 491 PRO PRO A . n 
A 1 204 TYR 204 492 492 TYR TYR A . n 
A 1 205 GLY 205 493 493 GLY GLY A . n 
A 1 206 PRO 206 494 494 PRO PRO A . n 
A 1 207 GLU 207 495 495 GLU GLU A . n 
A 1 208 VAL 208 496 496 VAL VAL A . n 
A 1 209 ASP 209 497 497 ASP ASP A . n 
A 1 210 ILE 210 498 498 ILE ILE A . n 
A 1 211 TRP 211 499 499 TRP TRP A . n 
A 1 212 SER 212 500 500 SER SER A . n 
A 1 213 LEU 213 501 501 LEU LEU A . n 
A 1 214 GLY 214 502 502 GLY GLY A . n 
A 1 215 ILE 215 503 503 ILE ILE A . n 
A 1 216 MET 216 504 504 MET MET A . n 
A 1 217 VAL 217 505 505 VAL VAL A . n 
A 1 218 ILE 218 506 506 ILE ILE A . n 
A 1 219 GLU 219 507 507 GLU GLU A . n 
A 1 220 MET 220 508 508 MET MET A . n 
A 1 221 VAL 221 509 509 VAL VAL A . n 
A 1 222 ASP 222 510 510 ASP ASP A . n 
A 1 223 GLY 223 511 511 GLY GLY A . n 
A 1 224 GLU 224 512 512 GLU GLU A . n 
A 1 225 PRO 225 513 513 PRO PRO A . n 
A 1 226 PRO 226 514 514 PRO PRO A . n 
A 1 227 TYR 227 515 515 TYR TYR A . n 
A 1 228 PHE 228 516 516 PHE PHE A . n 
A 1 229 ASN 229 517 517 ASN ASN A . n 
A 1 230 GLU 230 518 518 GLU GLU A . n 
A 1 231 PRO 231 519 519 PRO PRO A . n 
A 1 232 PRO 232 520 520 PRO PRO A . n 
A 1 233 LEU 233 521 521 LEU LEU A . n 
A 1 234 LYS 234 522 522 LYS LYS A . n 
A 1 235 ALA 235 523 523 ALA ALA A . n 
A 1 236 MET 236 524 524 MET MET A . n 
A 1 237 LYS 237 525 525 LYS LYS A . n 
A 1 238 MET 238 526 526 MET MET A . n 
A 1 239 ILE 239 527 527 ILE ILE A . n 
A 1 240 ARG 240 528 528 ARG ARG A . n 
A 1 241 ASP 241 529 529 ASP ASP A . n 
A 1 242 ASN 242 530 530 ASN ASN A . n 
A 1 243 LEU 243 531 531 LEU LEU A . n 
A 1 244 PRO 244 532 532 PRO PRO A . n 
A 1 245 PRO 245 533 533 PRO PRO A . n 
A 1 246 ARG 246 534 534 ARG ARG A . n 
A 1 247 LEU 247 535 535 LEU LEU A . n 
A 1 248 LYS 248 536 536 LYS LYS A . n 
A 1 249 ASN 249 537 537 ASN ASN A . n 
A 1 250 LEU 250 538 538 LEU LEU A . n 
A 1 251 HIS 251 539 539 HIS HIS A . n 
A 1 252 LYS 252 540 540 LYS LYS A . n 
A 1 253 VAL 253 541 541 VAL VAL A . n 
A 1 254 SER 254 542 542 SER SER A . n 
A 1 255 PRO 255 543 543 PRO PRO A . n 
A 1 256 SER 256 544 544 SER SER A . n 
A 1 257 LEU 257 545 545 LEU LEU A . n 
A 1 258 LYS 258 546 546 LYS LYS A . n 
A 1 259 GLY 259 547 547 GLY GLY A . n 
A 1 260 PHE 260 548 548 PHE PHE A . n 
A 1 261 LEU 261 549 549 LEU LEU A . n 
A 1 262 ASP 262 550 550 ASP ASP A . n 
A 1 263 ARG 263 551 551 ARG ARG A . n 
A 1 264 LEU 264 552 552 LEU LEU A . n 
A 1 265 LEU 265 553 553 LEU LEU A . n 
A 1 266 VAL 266 554 554 VAL VAL A . n 
A 1 267 ARG 267 555 555 ARG ARG A . n 
A 1 268 ASP 268 556 556 ASP ASP A . n 
A 1 269 PRO 269 557 557 PRO PRO A . n 
A 1 270 ALA 270 558 558 ALA ALA A . n 
A 1 271 GLN 271 559 559 GLN GLN A . n 
A 1 272 ARG 272 560 560 ARG ARG A . n 
A 1 273 ALA 273 561 561 ALA ALA A . n 
A 1 274 THR 274 562 562 THR THR A . n 
A 1 275 ALA 275 563 563 ALA ALA A . n 
A 1 276 ALA 276 564 564 ALA ALA A . n 
A 1 277 GLU 277 565 565 GLU GLU A . n 
A 1 278 LEU 278 566 566 LEU LEU A . n 
A 1 279 LEU 279 567 567 LEU LEU A . n 
A 1 280 LYS 280 568 568 LYS LYS A . n 
A 1 281 HIS 281 569 569 HIS HIS A . n 
A 1 282 PRO 282 570 570 PRO PRO A . n 
A 1 283 PHE 283 571 571 PHE PHE A . n 
A 1 284 LEU 284 572 572 LEU LEU A . n 
A 1 285 ALA 285 573 573 ALA ALA A . n 
A 1 286 LYS 286 574 574 LYS LYS A . n 
A 1 287 ALA 287 575 575 ALA ALA A . n 
A 1 288 GLY 288 576 576 GLY GLY A . n 
A 1 289 PRO 289 577 577 PRO PRO A . n 
A 1 290 PRO 290 578 578 PRO PRO A . n 
A 1 291 ALA 291 579 579 ALA ALA A . n 
A 1 292 SER 292 580 580 SER SER A . n 
A 1 293 ILE 293 581 581 ILE ILE A . n 
A 1 294 VAL 294 582 582 VAL VAL A . n 
A 1 295 PRO 295 583 583 PRO PRO A . n 
A 1 296 LEU 296 584 584 LEU LEU A . n 
A 1 297 MET 297 585 585 MET MET A . n 
A 1 298 ARG 298 586 586 ARG ARG A . n 
A 1 299 GLN 299 587 587 GLN GLN A . n 
A 1 300 ASN 300 588 588 ASN ASN A . n 
A 1 301 ARG 301 589 589 ARG ARG A . n 
A 1 302 THR 302 590 590 THR THR A . n 
A 1 303 ARG 303 591 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 23D 1   1591 1591 23D 23D A . 
C 3 SO4 1   1592 1592 SO4 SO4 A . 
D 3 SO4 1   1593 1593 SO4 SO4 A . 
E 4 CL  1   1594 1594 CL  CL  A . 
F 5 HOH 1   2001 2001 HOH HOH A . 
F 5 HOH 2   2002 2002 HOH HOH A . 
F 5 HOH 3   2003 2003 HOH HOH A . 
F 5 HOH 4   2004 2004 HOH HOH A . 
F 5 HOH 5   2005 2005 HOH HOH A . 
F 5 HOH 6   2006 2006 HOH HOH A . 
F 5 HOH 7   2007 2007 HOH HOH A . 
F 5 HOH 8   2008 2008 HOH HOH A . 
F 5 HOH 9   2009 2009 HOH HOH A . 
F 5 HOH 10  2010 2010 HOH HOH A . 
F 5 HOH 11  2011 2011 HOH HOH A . 
F 5 HOH 12  2012 2012 HOH HOH A . 
F 5 HOH 13  2013 2013 HOH HOH A . 
F 5 HOH 14  2014 2014 HOH HOH A . 
F 5 HOH 15  2015 2015 HOH HOH A . 
F 5 HOH 16  2016 2016 HOH HOH A . 
F 5 HOH 17  2017 2017 HOH HOH A . 
F 5 HOH 18  2018 2018 HOH HOH A . 
F 5 HOH 19  2019 2019 HOH HOH A . 
F 5 HOH 20  2020 2020 HOH HOH A . 
F 5 HOH 21  2021 2021 HOH HOH A . 
F 5 HOH 22  2022 2022 HOH HOH A . 
F 5 HOH 23  2023 2023 HOH HOH A . 
F 5 HOH 24  2024 2024 HOH HOH A . 
F 5 HOH 25  2025 2025 HOH HOH A . 
F 5 HOH 26  2026 2026 HOH HOH A . 
F 5 HOH 27  2027 2027 HOH HOH A . 
F 5 HOH 28  2028 2028 HOH HOH A . 
F 5 HOH 29  2029 2029 HOH HOH A . 
F 5 HOH 30  2030 2030 HOH HOH A . 
F 5 HOH 31  2031 2031 HOH HOH A . 
F 5 HOH 32  2032 2032 HOH HOH A . 
F 5 HOH 33  2033 2033 HOH HOH A . 
F 5 HOH 34  2034 2034 HOH HOH A . 
F 5 HOH 35  2035 2035 HOH HOH A . 
F 5 HOH 36  2036 2036 HOH HOH A . 
F 5 HOH 37  2037 2037 HOH HOH A . 
F 5 HOH 38  2038 2038 HOH HOH A . 
F 5 HOH 39  2039 2039 HOH HOH A . 
F 5 HOH 40  2040 2040 HOH HOH A . 
F 5 HOH 41  2041 2041 HOH HOH A . 
F 5 HOH 42  2042 2042 HOH HOH A . 
F 5 HOH 43  2043 2043 HOH HOH A . 
F 5 HOH 44  2044 2044 HOH HOH A . 
F 5 HOH 45  2045 2045 HOH HOH A . 
F 5 HOH 46  2046 2046 HOH HOH A . 
F 5 HOH 47  2047 2047 HOH HOH A . 
F 5 HOH 48  2048 2048 HOH HOH A . 
F 5 HOH 49  2049 2049 HOH HOH A . 
F 5 HOH 50  2050 2050 HOH HOH A . 
F 5 HOH 51  2051 2051 HOH HOH A . 
F 5 HOH 52  2052 2052 HOH HOH A . 
F 5 HOH 53  2053 2053 HOH HOH A . 
F 5 HOH 54  2054 2054 HOH HOH A . 
F 5 HOH 55  2055 2055 HOH HOH A . 
F 5 HOH 56  2056 2056 HOH HOH A . 
F 5 HOH 57  2057 2057 HOH HOH A . 
F 5 HOH 58  2058 2058 HOH HOH A . 
F 5 HOH 59  2059 2059 HOH HOH A . 
F 5 HOH 60  2060 2060 HOH HOH A . 
F 5 HOH 61  2061 2061 HOH HOH A . 
F 5 HOH 62  2062 2062 HOH HOH A . 
F 5 HOH 63  2063 2063 HOH HOH A . 
F 5 HOH 64  2064 2064 HOH HOH A . 
F 5 HOH 65  2065 2065 HOH HOH A . 
F 5 HOH 66  2066 2066 HOH HOH A . 
F 5 HOH 67  2067 2067 HOH HOH A . 
F 5 HOH 68  2068 2068 HOH HOH A . 
F 5 HOH 69  2069 2069 HOH HOH A . 
F 5 HOH 70  2070 2070 HOH HOH A . 
F 5 HOH 71  2071 2071 HOH HOH A . 
F 5 HOH 72  2072 2072 HOH HOH A . 
F 5 HOH 73  2073 2073 HOH HOH A . 
F 5 HOH 74  2074 2074 HOH HOH A . 
F 5 HOH 75  2075 2075 HOH HOH A . 
F 5 HOH 76  2076 2076 HOH HOH A . 
F 5 HOH 77  2077 2077 HOH HOH A . 
F 5 HOH 78  2078 2078 HOH HOH A . 
F 5 HOH 79  2079 2079 HOH HOH A . 
F 5 HOH 80  2080 2080 HOH HOH A . 
F 5 HOH 81  2081 2081 HOH HOH A . 
F 5 HOH 82  2082 2082 HOH HOH A . 
F 5 HOH 83  2083 2083 HOH HOH A . 
F 5 HOH 84  2084 2084 HOH HOH A . 
F 5 HOH 85  2085 2085 HOH HOH A . 
F 5 HOH 86  2086 2086 HOH HOH A . 
F 5 HOH 87  2087 2087 HOH HOH A . 
F 5 HOH 88  2088 2088 HOH HOH A . 
F 5 HOH 89  2089 2089 HOH HOH A . 
F 5 HOH 90  2090 2090 HOH HOH A . 
F 5 HOH 91  2091 2091 HOH HOH A . 
F 5 HOH 92  2092 2092 HOH HOH A . 
F 5 HOH 93  2093 2093 HOH HOH A . 
F 5 HOH 94  2094 2094 HOH HOH A . 
F 5 HOH 95  2095 2095 HOH HOH A . 
F 5 HOH 96  2096 2096 HOH HOH A . 
F 5 HOH 97  2097 2097 HOH HOH A . 
F 5 HOH 98  2098 2098 HOH HOH A . 
F 5 HOH 99  2099 2099 HOH HOH A . 
F 5 HOH 100 2100 2100 HOH HOH A . 
F 5 HOH 101 2101 2101 HOH HOH A . 
F 5 HOH 102 2102 2102 HOH HOH A . 
F 5 HOH 103 2103 2103 HOH HOH A . 
F 5 HOH 104 2104 2104 HOH HOH A . 
F 5 HOH 105 2105 2105 HOH HOH A . 
F 5 HOH 106 2106 2106 HOH HOH A . 
F 5 HOH 107 2107 2107 HOH HOH A . 
F 5 HOH 108 2108 2108 HOH HOH A . 
F 5 HOH 109 2109 2109 HOH HOH A . 
F 5 HOH 110 2110 2110 HOH HOH A . 
F 5 HOH 111 2111 2111 HOH HOH A . 
F 5 HOH 112 2112 2112 HOH HOH A . 
F 5 HOH 113 2113 2113 HOH HOH A . 
F 5 HOH 114 2114 2114 HOH HOH A . 
F 5 HOH 115 2115 2115 HOH HOH A . 
F 5 HOH 116 2116 2116 HOH HOH A . 
F 5 HOH 117 2117 2117 HOH HOH A . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    SEP 
_pdbx_struct_mod_residue.label_seq_id     186 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     SEP 
_pdbx_struct_mod_residue.auth_seq_id      474 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   SER 
_pdbx_struct_mod_residue.details          PHOSPHOSERINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-02-08 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2018-01-24 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Version format compliance' 
3 3 'Structure model' 'Structure summary'         
4 4 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' audit_author  
2 4 'Structure model' diffrn_source 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_audit_author.name'  
2 4 'Structure model' '_diffrn_source.type' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 56.5090 31.2670 26.7780 -0.1742 -0.0757 -0.0098 -0.0110 -0.0113 -0.0126 3.8255 1.3229 3.6783 
0.6878  1.4303 0.2639  -0.0438 -0.1680 0.0994  -0.0265 -0.0879 0.0626  -0.1562 0.0956 0.1317 
'X-RAY DIFFRACTION' 2 ? refined 42.2680 15.7810 13.8050 -0.0814 -0.1243 -0.0838 0.0146  -0.0355 -0.0124 1.3654 4.1546 1.6007 
-0.1723 0.2851 -0.6032 0.0032  0.1217  -0.1093 -0.0231 -0.0035 -0.1061 0.0575  0.0124 0.0004 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 299 ? ? A 398 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 399 ? ? A 590 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0019 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
PHASER    phasing          .        ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 439 ? ? CZ A ARG 439 ? ? NH1 A ARG 439 ? ? 124.01 120.30 3.71  0.50 N 
2 1 NE A ARG 439 ? ? CZ A ARG 439 ? ? NH2 A ARG 439 ? ? 116.80 120.30 -3.50 0.50 N 
3 1 NE A ARG 555 ? ? CZ A ARG 555 ? ? NH2 A ARG 555 ? ? 117.10 120.30 -3.20 0.50 N 
4 1 NE A ARG 589 ? ? CZ A ARG 589 ? ? NH1 A ARG 589 ? ? 123.85 120.30 3.55  0.50 N 
5 1 NE A ARG 589 ? ? CZ A ARG 589 ? ? NH2 A ARG 589 ? ? 116.95 120.30 -3.35 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 458 ? ? 60.56 61.36 
2 1 ARG A 489 ? ? 71.89 37.64 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2069 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.54 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 319 ? OG  ? A SER 31  OG  
2  1 Y 1 A TYR 320 ? CG  ? A TYR 32  CG  
3  1 Y 1 A TYR 320 ? CD1 ? A TYR 32  CD1 
4  1 Y 1 A TYR 320 ? CD2 ? A TYR 32  CD2 
5  1 Y 1 A TYR 320 ? CE1 ? A TYR 32  CE1 
6  1 Y 1 A TYR 320 ? CE2 ? A TYR 32  CE2 
7  1 Y 1 A TYR 320 ? CZ  ? A TYR 32  CZ  
8  1 Y 1 A TYR 320 ? OH  ? A TYR 32  OH  
9  1 Y 1 A ARG 341 ? CD  ? A ARG 53  CD  
10 1 Y 1 A ARG 341 ? NE  ? A ARG 53  NE  
11 1 Y 1 A ARG 341 ? CZ  ? A ARG 53  CZ  
12 1 Y 1 A ARG 341 ? NH1 ? A ARG 53  NH1 
13 1 Y 1 A ARG 341 ? NH2 ? A ARG 53  NH2 
14 1 Y 1 A LYS 345 ? CE  ? A LYS 57  CE  
15 1 Y 1 A LYS 345 ? NZ  ? A LYS 57  NZ  
16 1 Y 1 A GLN 374 ? CG  ? A GLN 86  CG  
17 1 Y 1 A GLN 374 ? CD  ? A GLN 86  CD  
18 1 Y 1 A GLN 374 ? OE1 ? A GLN 86  OE1 
19 1 Y 1 A GLN 374 ? NE2 ? A GLN 86  NE2 
20 1 Y 1 A ARG 411 ? CD  ? A ARG 123 CD  
21 1 Y 1 A ARG 411 ? NE  ? A ARG 123 NE  
22 1 Y 1 A ARG 411 ? CZ  ? A ARG 123 CZ  
23 1 Y 1 A ARG 411 ? NH1 ? A ARG 123 NH1 
24 1 Y 1 A ARG 411 ? NH2 ? A ARG 123 NH2 
25 1 Y 1 A LYS 467 ? CG  ? A LYS 179 CG  
26 1 Y 1 A LYS 467 ? CD  ? A LYS 179 CD  
27 1 Y 1 A LYS 467 ? CE  ? A LYS 179 CE  
28 1 Y 1 A LYS 467 ? NZ  ? A LYS 179 NZ  
29 1 Y 1 A GLU 468 ? CG  ? A GLU 180 CG  
30 1 Y 1 A GLU 468 ? CD  ? A GLU 180 CD  
31 1 Y 1 A GLU 468 ? OE1 ? A GLU 180 OE1 
32 1 Y 1 A GLU 468 ? OE2 ? A GLU 180 OE2 
33 1 Y 1 A LYS 473 ? CG  ? A LYS 185 CG  
34 1 Y 1 A LYS 473 ? CD  ? A LYS 185 CD  
35 1 Y 1 A LYS 473 ? CE  ? A LYS 185 CE  
36 1 Y 1 A LYS 473 ? NZ  ? A LYS 185 NZ  
37 1 Y 1 A LYS 522 ? CE  ? A LYS 234 CE  
38 1 Y 1 A LYS 522 ? NZ  ? A LYS 234 NZ  
39 1 Y 1 A LYS 536 ? CG  ? A LYS 248 CG  
40 1 Y 1 A LYS 536 ? CD  ? A LYS 248 CD  
41 1 Y 1 A LYS 536 ? CE  ? A LYS 248 CE  
42 1 Y 1 A LYS 536 ? NZ  ? A LYS 248 NZ  
43 1 Y 1 A HIS 539 ? CG  ? A HIS 251 CG  
44 1 Y 1 A HIS 539 ? ND1 ? A HIS 251 ND1 
45 1 Y 1 A HIS 539 ? CD2 ? A HIS 251 CD2 
46 1 Y 1 A HIS 539 ? CE1 ? A HIS 251 CE1 
47 1 Y 1 A HIS 539 ? NE2 ? A HIS 251 NE2 
48 1 Y 1 A LYS 540 ? CG  ? A LYS 252 CG  
49 1 Y 1 A LYS 540 ? CD  ? A LYS 252 CD  
50 1 Y 1 A LYS 540 ? CE  ? A LYS 252 CE  
51 1 Y 1 A LYS 540 ? NZ  ? A LYS 252 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 289 ? A GLY 1   
2  1 Y 1 A SER 290 ? A SER 2   
3  1 Y 1 A SER 291 ? A SER 3   
4  1 Y 1 A PRO 292 ? A PRO 4   
5  1 Y 1 A GLN 293 ? A GLN 5   
6  1 Y 1 A ARG 294 ? A ARG 6   
7  1 Y 1 A GLU 295 ? A GLU 7   
8  1 Y 1 A PRO 296 ? A PRO 8   
9  1 Y 1 A GLN 297 ? A GLN 9   
10 1 Y 1 A ARG 298 ? A ARG 10  
11 1 Y 1 A SER 342 ? A SER 54  
12 1 Y 1 A SER 343 ? A SER 55  
13 1 Y 1 A ARG 591 ? A ARG 303 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N2-[(1R,2S)-2-AMINOCYCLOHEXYL]-N6-(3-CHLOROPHENYL)-9-ETHYL-9H-PURINE-2,6-DIAMINE' 23D 
3 'SULFATE ION'                                                                      SO4 
4 'CHLORIDE ION'                                                                     CL  
5 water                                                                              HOH 
#