data_2CE6
# 
_entry.id   2CE6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CE6         
PDBE  EBI-27430    
WWPDB D_1290027430 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2CCV 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        
'STRUCTURE OF HELIX POMATIA AGGLUTININ WITH ZINC AND N-ACETYL-ALPHA-D-GALACTOSEAMINE ( GALNAC)' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CE6 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-02-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sanchez, J.-F.' 1 
'Lescar, J.'     2 
'Chazalet, V.'   3 
'Audfray, A.'    4 
'Gautier, C.'    5 
'Gagnon, J.'     6 
'Breton, C.'     7 
'Imberty, A.'    8 
'Mitchell, E.P.' 9 
# 
_citation.id                        primary 
_citation.title                     
'Biochemical and Structural Analysis of Helix Pomatia Agglutinin. A Hexameric Lectin with a Novel Fold.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            281 
_citation.page_first                20171 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16704980 
_citation.pdbx_database_id_DOI      10.1074/JBC.M603452200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Sanchez, J.-F.' 1 ? 
primary 'Lescar, J.'     2 ? 
primary 'Chazalet, V.'   3 ? 
primary 'Audfray, A.'    4 ? 
primary 'Gagnon, J.'     5 ? 
primary 'Alvarez, R.'    6 ? 
primary 'Breton, C.'     7 ? 
primary 'Imberty, A.'    8 ? 
primary 'Mitchell, E.P.' 9 ? 
# 
_cell.entry_id           2CE6 
_cell.length_a           61.600 
_cell.length_b           61.600 
_cell.length_c           105.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2CE6 
_symmetry.space_group_name_H-M             'P 63 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                182 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'HELIX POMATIA AGGLUTININ' 11338.778 1  ? ? 'RESIDUES 21-121' 
'GLYCOLYSIS SITE AT N34 BUT SUGAR IS DISORDERED IN THE STRUCTURE' 
2 water   nat water                      18.015    25 ? ? ?                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RVQSGKINCGDDAGWAKVPSNDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPTGFKASC
YTWHNTKVYSMSISWISIENY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RVQSGKINCGDDAGWAKVPSNDPGRDNTRELAKNITFASPYCRPPVVLLSITQLDVEQSQNLRVIARLYSVSPTGFKASC
YTWHNTKVYSMSISWISIENY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   VAL n 
1 3   GLN n 
1 4   SER n 
1 5   GLY n 
1 6   LYS n 
1 7   ILE n 
1 8   ASN n 
1 9   CYS n 
1 10  GLY n 
1 11  ASP n 
1 12  ASP n 
1 13  ALA n 
1 14  GLY n 
1 15  TRP n 
1 16  ALA n 
1 17  LYS n 
1 18  VAL n 
1 19  PRO n 
1 20  SER n 
1 21  ASN n 
1 22  ASP n 
1 23  PRO n 
1 24  GLY n 
1 25  ARG n 
1 26  ASP n 
1 27  ASN n 
1 28  THR n 
1 29  ARG n 
1 30  GLU n 
1 31  LEU n 
1 32  ALA n 
1 33  LYS n 
1 34  ASN n 
1 35  ILE n 
1 36  THR n 
1 37  PHE n 
1 38  ALA n 
1 39  SER n 
1 40  PRO n 
1 41  TYR n 
1 42  CYS n 
1 43  ARG n 
1 44  PRO n 
1 45  PRO n 
1 46  VAL n 
1 47  VAL n 
1 48  LEU n 
1 49  LEU n 
1 50  SER n 
1 51  ILE n 
1 52  THR n 
1 53  GLN n 
1 54  LEU n 
1 55  ASP n 
1 56  VAL n 
1 57  GLU n 
1 58  GLN n 
1 59  SER n 
1 60  GLN n 
1 61  ASN n 
1 62  LEU n 
1 63  ARG n 
1 64  VAL n 
1 65  ILE n 
1 66  ALA n 
1 67  ARG n 
1 68  LEU n 
1 69  TYR n 
1 70  SER n 
1 71  VAL n 
1 72  SER n 
1 73  PRO n 
1 74  THR n 
1 75  GLY n 
1 76  PHE n 
1 77  LYS n 
1 78  ALA n 
1 79  SER n 
1 80  CYS n 
1 81  TYR n 
1 82  THR n 
1 83  TRP n 
1 84  HIS n 
1 85  ASN n 
1 86  THR n 
1 87  LYS n 
1 88  VAL n 
1 89  TYR n 
1 90  SER n 
1 91  MET n 
1 92  SER n 
1 93  ILE n 
1 94  SER n 
1 95  TRP n 
1 96  ILE n 
1 97  SER n 
1 98  ILE n 
1 99  GLU n 
1 100 ASN n 
1 101 TYR n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'ROMAN SNAIL' 
_entity_src_nat.pdbx_organism_scientific   'HELIX POMATIA' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      6536 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ALBUMIN GLAND' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    SIGMA-ALDRICH 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q2F1K8_HELPO 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q2F1K8 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2CE6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 101 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q2F1K8 
_struct_ref_seq.db_align_beg                  21 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  121 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       101 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2CE6 ASN A 8  ? UNP Q2F1K8 ASP 28 conflict 8  1 
1 2CE6 ASP A 11 ? UNP Q2F1K8 ASN 31 conflict 11 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2CE6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.53 
_exptl_crystal.density_percent_sol   44.9 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;HANGING DROP METHOD WITH PRECIPITATION SOLUTION CONTAINING LITHIUM SULPHATE (2 M) AND AMMONIUM SULPHATE (3.5 M) IN SODIUM CITRATE BUFFER (1.5M, PH 6.5).
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC CCD' 
_diffrn_detector.pdbx_collection_date   2002-11-10 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    DIAMOND 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             0.933 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2CE6 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             52.490 
_reflns.d_resolution_high            2.400 
_reflns.number_obs                   5042 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.07000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.6700 
_reflns.B_iso_Wilson_estimate        56.00 
_reflns.pdbx_redundancy              7.350 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.43 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.38000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.590 
_reflns_shell.pdbx_redundancy        4.37 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2CE6 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     4785 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.57 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.224 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       0.266 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.700 
_refine.ls_number_reflns_R_free                  236 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.945 
_refine.correlation_coeff_Fo_to_Fc_free          0.907 
_refine.B_iso_mean                               52.99 
_refine.aniso_B[1][1]                            -2.02000 
_refine.aniso_B[2][2]                            -2.02000 
_refine.aniso_B[3][3]                            3.04000 
_refine.aniso_B[1][2]                            -1.01000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.RESIDUES 100-101 ARE DISORDERED AND HAVE NOT BEEN MODELLED.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2CCV' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.388 
_refine.pdbx_overall_ESU_R_Free                  0.266 
_refine.overall_SU_ML                            0.218 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             10.227 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        780 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             25 
_refine_hist.number_atoms_total               805 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        47.57 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.012  0.022  ? 799  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 711  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.458  1.939  ? 1089 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.787  3.000  ? 1656 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.900  5.000  ? 99   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       29.573 23.529 ? 34   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       15.467 15.000 ? 130  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       23.151 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.081  0.200  ? 122  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 883  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 160  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.189  0.200  ? 142  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.196  0.200  ? 721  'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.178  0.200  ? 383  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.088  0.200  ? 493  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.168  0.200  ? 28   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.169  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.205  0.200  ? 29   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.182  0.200  ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.804  1.500  ? 635  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.991  2.000  ? 814  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.335  3.000  ? 360  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.058  4.500  ? 275  'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.40 
_refine_ls_shell.d_res_low                        2.46 
_refine_ls_shell.number_reflns_R_work             336 
_refine_ls_shell.R_factor_R_work                  0.3190 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.4260 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             27 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2CE6 
_struct.title                     'Structure of Helix Pomatia agglutinin with no ligands' 
_struct.pdbx_descriptor           'HELIX POMATIA AGGLUTININ' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CE6 
_struct_keywords.pdbx_keywords   LECTIN 
_struct_keywords.text            'LECTIN, SNAIL, HELIX POMATIA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASP 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        11 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       TRP 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        15 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASP 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         11 
_struct_conf.end_auth_comp_id        TRP 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         15 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 9  SG ? ? ? 1_555 A CYS 80 SG ? ? A CYS 9  A CYS 80 1_555  ? ? ? ? ? ? ? 2.070 ? 
disulf2 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 42 A CYS 42 10_664 ? ? ? ? ? ? ? 2.067 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 2  ? CYS A 9  ? VAL A 2  CYS A 9  
AA 2 VAL A 88 ? GLU A 99 ? VAL A 88 GLU A 99 
AA 3 VAL A 46 ? GLU A 57 ? VAL A 46 GLU A 57 
AB 1 ALA A 16 ? VAL A 18 ? ALA A 16 VAL A 18 
AB 2 THR A 28 ? PHE A 37 ? THR A 28 PHE A 37 
AB 3 GLY A 75 ? TRP A 83 ? GLY A 75 TRP A 83 
AB 4 VAL A 64 ? SER A 72 ? VAL A 64 SER A 72 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ILE A 7  ? N ILE A 7  O ILE A 93 ? O ILE A 93 
AA 2 3 N ILE A 98 ? N ILE A 98 O VAL A 46 ? O VAL A 46 
AB 1 2 N ALA A 16 ? N ALA A 16 O GLU A 30 ? O GLU A 30 
AB 2 3 O ILE A 35 ? O ILE A 35 N PHE A 76 ? N PHE A 76 
AB 3 4 N TYR A 81 ? N TYR A 81 O ILE A 65 ? O ILE A 65 
# 
_database_PDB_matrix.entry_id          2CE6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CE6 
_atom_sites.fract_transf_matrix[1][1]   0.016234 
_atom_sites.fract_transf_matrix[1][2]   0.009373 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018745 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009524 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . ARG A 1 1   ? -2.551  40.785 -22.255 1.00 67.39 ? 1    ARG A N   1 
ATOM   2   C CA  . ARG A 1 1   ? -2.589  42.098 -21.523 1.00 66.84 ? 1    ARG A CA  1 
ATOM   3   C C   . ARG A 1 1   ? -2.672  41.879 -20.012 1.00 66.29 ? 1    ARG A C   1 
ATOM   4   O O   . ARG A 1 1   ? -3.700  41.415 -19.496 1.00 65.99 ? 1    ARG A O   1 
ATOM   5   C CB  . ARG A 1 1   ? -3.783  42.926 -21.994 1.00 67.59 ? 1    ARG A CB  1 
ATOM   6   C CG  . ARG A 1 1   ? -4.042  44.186 -21.205 1.00 68.43 ? 1    ARG A CG  1 
ATOM   7   C CD  . ARG A 1 1   ? -2.928  45.147 -21.395 1.00 71.14 ? 1    ARG A CD  1 
ATOM   8   N NE  . ARG A 1 1   ? -3.282  46.445 -20.843 1.00 72.28 ? 1    ARG A NE  1 
ATOM   9   C CZ  . ARG A 1 1   ? -2.394  47.372 -20.492 1.00 74.30 ? 1    ARG A CZ  1 
ATOM   10  N NH1 . ARG A 1 1   ? -1.078  47.139 -20.634 1.00 74.93 ? 1    ARG A NH1 1 
ATOM   11  N NH2 . ARG A 1 1   ? -2.813  48.533 -19.985 1.00 73.24 ? 1    ARG A NH2 1 
ATOM   12  N N   . VAL A 1 2   ? -1.589  42.223 -19.320 1.00 65.34 ? 2    VAL A N   1 
ATOM   13  C CA  . VAL A 1 2   ? -1.473  42.011 -17.887 1.00 64.68 ? 2    VAL A CA  1 
ATOM   14  C C   . VAL A 1 2   ? -1.425  43.344 -17.186 1.00 63.96 ? 2    VAL A C   1 
ATOM   15  O O   . VAL A 1 2   ? -0.664  44.228 -17.582 1.00 64.29 ? 2    VAL A O   1 
ATOM   16  C CB  . VAL A 1 2   ? -0.202  41.236 -17.525 1.00 64.65 ? 2    VAL A CB  1 
ATOM   17  C CG1 . VAL A 1 2   ? -0.214  40.853 -16.056 1.00 64.99 ? 2    VAL A CG1 1 
ATOM   18  C CG2 . VAL A 1 2   ? -0.093  39.998 -18.367 1.00 64.91 ? 2    VAL A CG2 1 
ATOM   19  N N   . GLN A 1 3   ? -2.235  43.483 -16.143 1.00 63.02 ? 3    GLN A N   1 
ATOM   20  C CA  . GLN A 1 3   ? -2.233  44.685 -15.317 1.00 62.45 ? 3    GLN A CA  1 
ATOM   21  C C   . GLN A 1 3   ? -2.038  44.248 -13.861 1.00 61.95 ? 3    GLN A C   1 
ATOM   22  O O   . GLN A 1 3   ? -2.208  43.074 -13.533 1.00 61.89 ? 3    GLN A O   1 
ATOM   23  C CB  . GLN A 1 3   ? -3.518  45.506 -15.552 1.00 62.28 ? 3    GLN A CB  1 
ATOM   24  C CG  . GLN A 1 3   ? -3.719  45.859 -17.065 1.00 62.43 ? 3    GLN A CG  1 
ATOM   25  C CD  . GLN A 1 3   ? -5.018  46.605 -17.403 1.00 62.11 ? 3    GLN A CD  1 
ATOM   26  O OE1 . GLN A 1 3   ? -5.389  47.562 -16.734 1.00 62.31 ? 3    GLN A OE1 1 
ATOM   27  N NE2 . GLN A 1 3   ? -5.690  46.174 -18.470 1.00 61.41 ? 3    GLN A NE2 1 
ATOM   28  N N   . SER A 1 4   ? -1.613  45.177 -13.009 1.00 61.37 ? 4    SER A N   1 
ATOM   29  C CA  . SER A 1 4   ? -1.387  44.878 -11.599 1.00 60.87 ? 4    SER A CA  1 
ATOM   30  C C   . SER A 1 4   ? -1.520  46.106 -10.704 1.00 59.98 ? 4    SER A C   1 
ATOM   31  O O   . SER A 1 4   ? -1.570  47.234 -11.160 1.00 59.30 ? 4    SER A O   1 
ATOM   32  C CB  . SER A 1 4   ? -0.003  44.245 -11.397 1.00 61.13 ? 4    SER A CB  1 
ATOM   33  O OG  . SER A 1 4   ? 1.027   45.232 -11.440 1.00 61.92 ? 4    SER A OG  1 
ATOM   34  N N   . GLY A 1 5   ? -1.558  45.870 -9.409  1.00 59.58 ? 5    GLY A N   1 
ATOM   35  C CA  . GLY A 1 5   ? -1.699  46.962 -8.457  1.00 59.69 ? 5    GLY A CA  1 
ATOM   36  C C   . GLY A 1 5   ? -1.612  46.459 -7.039  1.00 59.10 ? 5    GLY A C   1 
ATOM   37  O O   . GLY A 1 5   ? -1.175  45.340 -6.794  1.00 59.11 ? 5    GLY A O   1 
ATOM   38  N N   . LYS A 1 6   ? -2.045  47.292 -6.108  1.00 59.44 ? 6    LYS A N   1 
ATOM   39  C CA  . LYS A 1 6   ? -1.927  46.995 -4.683  1.00 59.42 ? 6    LYS A CA  1 
ATOM   40  C C   . LYS A 1 6   ? -2.991  47.801 -3.947  1.00 58.74 ? 6    LYS A C   1 
ATOM   41  O O   . LYS A 1 6   ? -3.088  49.000 -4.124  1.00 58.64 ? 6    LYS A O   1 
ATOM   42  C CB  . LYS A 1 6   ? -0.478  47.289 -4.242  1.00 59.80 ? 6    LYS A CB  1 
ATOM   43  C CG  . LYS A 1 6   ? -0.194  47.815 -2.822  1.00 60.36 ? 6    LYS A CG  1 
ATOM   44  C CD  . LYS A 1 6   ? 1.088   48.716 -2.860  1.00 61.13 ? 6    LYS A CD  1 
ATOM   45  C CE  . LYS A 1 6   ? 1.840   48.749 -1.528  1.00 63.14 ? 6    LYS A CE  1 
ATOM   46  N NZ  . LYS A 1 6   ? 2.230   47.362 -1.094  1.00 65.49 ? 6    LYS A NZ  1 
ATOM   47  N N   . ILE A 1 7   ? -3.825  47.122 -3.171  1.00 58.36 ? 7    ILE A N   1 
ATOM   48  C CA  . ILE A 1 7   ? -4.836  47.792 -2.371  1.00 58.44 ? 7    ILE A CA  1 
ATOM   49  C C   . ILE A 1 7   ? -4.281  47.858 -0.959  1.00 57.93 ? 7    ILE A C   1 
ATOM   50  O O   . ILE A 1 7   ? -4.038  46.834 -0.355  1.00 57.24 ? 7    ILE A O   1 
ATOM   51  C CB  . ILE A 1 7   ? -6.186  47.012 -2.380  1.00 58.51 ? 7    ILE A CB  1 
ATOM   52  C CG1 . ILE A 1 7   ? -6.740  46.897 -3.808  1.00 59.55 ? 7    ILE A CG1 1 
ATOM   53  C CG2 . ILE A 1 7   ? -7.226  47.680 -1.469  1.00 58.27 ? 7    ILE A CG2 1 
ATOM   54  C CD1 . ILE A 1 7   ? -7.788  45.769 -4.003  1.00 59.66 ? 7    ILE A CD1 1 
ATOM   55  N N   . ASN A 1 8   ? -4.053  49.063 -0.449  1.00 57.76 ? 8    ASN A N   1 
ATOM   56  C CA  . ASN A 1 8   ? -3.622  49.233 0.927   1.00 57.69 ? 8    ASN A CA  1 
ATOM   57  C C   . ASN A 1 8   ? -4.852  49.486 1.721   1.00 57.06 ? 8    ASN A C   1 
ATOM   58  O O   . ASN A 1 8   ? -5.498  50.485 1.480   1.00 57.07 ? 8    ASN A O   1 
ATOM   59  C CB  . ASN A 1 8   ? -2.661  50.413 1.082   1.00 57.86 ? 8    ASN A CB  1 
ATOM   60  C CG  . ASN A 1 8   ? -1.270  50.130 0.492   1.00 60.04 ? 8    ASN A CG  1 
ATOM   61  O OD1 . ASN A 1 8   ? -0.618  49.119 0.815   1.00 62.01 ? 8    ASN A OD1 1 
ATOM   62  N ND2 . ASN A 1 8   ? -0.802  51.040 -0.371  1.00 61.88 ? 8    ASN A ND2 1 
ATOM   63  N N   . CYS A 1 9   ? -5.176  48.595 2.659   1.00 56.60 ? 9    CYS A N   1 
ATOM   64  C CA  . CYS A 1 9   ? -6.413  48.712 3.448   1.00 56.81 ? 9    CYS A CA  1 
ATOM   65  C C   . CYS A 1 9   ? -6.270  49.462 4.753   1.00 56.70 ? 9    CYS A C   1 
ATOM   66  O O   . CYS A 1 9   ? -7.259  49.995 5.262   1.00 57.27 ? 9    CYS A O   1 
ATOM   67  C CB  . CYS A 1 9   ? -6.973  47.345 3.787   1.00 56.70 ? 9    CYS A CB  1 
ATOM   68  S SG  . CYS A 1 9   ? -7.432  46.452 2.337   1.00 57.31 ? 9    CYS A SG  1 
ATOM   69  N N   . GLY A 1 10  ? -5.065  49.461 5.315   1.00 56.10 ? 10   GLY A N   1 
ATOM   70  C CA  . GLY A 1 10  ? -4.806  50.164 6.554   1.00 55.68 ? 10   GLY A CA  1 
ATOM   71  C C   . GLY A 1 10  ? -5.490  49.585 7.772   1.00 55.21 ? 10   GLY A C   1 
ATOM   72  O O   . GLY A 1 10  ? -5.927  48.431 7.794   1.00 55.10 ? 10   GLY A O   1 
ATOM   73  N N   . ASP A 1 11  ? -5.575  50.429 8.789   1.00 55.24 ? 11   ASP A N   1 
ATOM   74  C CA  . ASP A 1 11  ? -5.982  50.049 10.126  1.00 55.36 ? 11   ASP A CA  1 
ATOM   75  C C   . ASP A 1 11  ? -7.456  49.726 10.088  1.00 55.72 ? 11   ASP A C   1 
ATOM   76  O O   . ASP A 1 11  ? -8.208  50.455 9.434   1.00 56.20 ? 11   ASP A O   1 
ATOM   77  C CB  . ASP A 1 11  ? -5.693  51.224 11.056  1.00 54.84 ? 11   ASP A CB  1 
ATOM   78  C CG  . ASP A 1 11  ? -5.784  50.861 12.516  1.00 54.16 ? 11   ASP A CG  1 
ATOM   79  O OD1 . ASP A 1 11  ? -6.819  50.297 12.928  1.00 51.72 ? 11   ASP A OD1 1 
ATOM   80  O OD2 . ASP A 1 11  ? -4.817  51.164 13.255  1.00 53.12 ? 11   ASP A OD2 1 
ATOM   81  N N   . ASP A 1 12  ? -7.872  48.654 10.775  1.00 55.98 ? 12   ASP A N   1 
ATOM   82  C CA  . ASP A 1 12  ? -9.280  48.186 10.707  1.00 56.35 ? 12   ASP A CA  1 
ATOM   83  C C   . ASP A 1 12  ? -10.320 49.052 11.450  1.00 56.70 ? 12   ASP A C   1 
ATOM   84  O O   . ASP A 1 12  ? -11.535 48.826 11.310  1.00 56.87 ? 12   ASP A O   1 
ATOM   85  C CB  . ASP A 1 12  ? -9.423  46.689 11.093  1.00 56.28 ? 12   ASP A CB  1 
ATOM   86  C CG  . ASP A 1 12  ? -9.221  46.418 12.590  1.00 56.47 ? 12   ASP A CG  1 
ATOM   87  O OD1 . ASP A 1 12  ? -9.103  47.369 13.387  1.00 57.85 ? 12   ASP A OD1 1 
ATOM   88  O OD2 . ASP A 1 12  ? -9.162  45.229 12.973  1.00 56.14 ? 12   ASP A OD2 1 
ATOM   89  N N   . ALA A 1 13  ? -9.848  50.030 12.227  1.00 57.11 ? 13   ALA A N   1 
ATOM   90  C CA  . ALA A 1 13  ? -10.708 51.094 12.783  1.00 57.45 ? 13   ALA A CA  1 
ATOM   91  C C   . ALA A 1 13  ? -11.460 51.885 11.688  1.00 57.84 ? 13   ALA A C   1 
ATOM   92  O O   . ALA A 1 13  ? -12.558 52.387 11.939  1.00 58.44 ? 13   ALA A O   1 
ATOM   93  C CB  . ALA A 1 13  ? -9.877  52.070 13.673  1.00 57.42 ? 13   ALA A CB  1 
ATOM   94  N N   . GLY A 1 14  ? -10.871 51.988 10.490  1.00 57.95 ? 14   GLY A N   1 
ATOM   95  C CA  . GLY A 1 14  ? -11.473 52.688 9.358   1.00 57.94 ? 14   GLY A CA  1 
ATOM   96  C C   . GLY A 1 14  ? -12.214 51.734 8.438   1.00 58.12 ? 14   GLY A C   1 
ATOM   97  O O   . GLY A 1 14  ? -12.655 52.120 7.353   1.00 57.86 ? 14   GLY A O   1 
ATOM   98  N N   . TRP A 1 15  ? -12.353 50.477 8.862   1.00 58.68 ? 15   TRP A N   1 
ATOM   99  C CA  . TRP A 1 15  ? -13.004 49.443 8.031   1.00 58.82 ? 15   TRP A CA  1 
ATOM   100 C C   . TRP A 1 15  ? -14.478 49.385 8.348   1.00 59.06 ? 15   TRP A C   1 
ATOM   101 O O   . TRP A 1 15  ? -14.888 49.674 9.461   1.00 58.96 ? 15   TRP A O   1 
ATOM   102 C CB  . TRP A 1 15  ? -12.425 48.035 8.255   1.00 57.98 ? 15   TRP A CB  1 
ATOM   103 C CG  . TRP A 1 15  ? -11.049 47.814 7.738   1.00 57.42 ? 15   TRP A CG  1 
ATOM   104 C CD1 . TRP A 1 15  ? -10.152 48.766 7.312   1.00 56.98 ? 15   TRP A CD1 1 
ATOM   105 C CD2 . TRP A 1 15  ? -10.373 46.554 7.644   1.00 56.44 ? 15   TRP A CD2 1 
ATOM   106 N NE1 . TRP A 1 15  ? -8.965  48.164 6.963   1.00 56.98 ? 15   TRP A NE1 1 
ATOM   107 C CE2 . TRP A 1 15  ? -9.079  46.808 7.153   1.00 56.61 ? 15   TRP A CE2 1 
ATOM   108 C CE3 . TRP A 1 15  ? -10.741 45.233 7.920   1.00 56.89 ? 15   TRP A CE3 1 
ATOM   109 C CZ2 . TRP A 1 15  ? -8.154  45.789 6.934   1.00 57.15 ? 15   TRP A CZ2 1 
ATOM   110 C CZ3 . TRP A 1 15  ? -9.808  44.213 7.701   1.00 56.80 ? 15   TRP A CZ3 1 
ATOM   111 C CH2 . TRP A 1 15  ? -8.538  44.502 7.218   1.00 56.69 ? 15   TRP A CH2 1 
ATOM   112 N N   . ALA A 1 16  ? -15.251 48.953 7.362   1.00 59.60 ? 16   ALA A N   1 
ATOM   113 C CA  . ALA A 1 16  ? -16.687 48.918 7.473   1.00 60.18 ? 16   ALA A CA  1 
ATOM   114 C C   . ALA A 1 16  ? -17.164 47.670 8.206   1.00 60.75 ? 16   ALA A C   1 
ATOM   115 O O   . ALA A 1 16  ? -16.648 46.573 8.022   1.00 60.61 ? 16   ALA A O   1 
ATOM   116 C CB  . ALA A 1 16  ? -17.311 48.994 6.095   1.00 60.04 ? 16   ALA A CB  1 
ATOM   117 N N   . LYS A 1 17  ? -18.162 47.861 9.053   1.00 61.67 ? 17   LYS A N   1 
ATOM   118 C CA  . LYS A 1 17  ? -18.851 46.750 9.673   1.00 62.19 ? 17   LYS A CA  1 
ATOM   119 C C   . LYS A 1 17  ? -19.840 46.289 8.616   1.00 62.71 ? 17   LYS A C   1 
ATOM   120 O O   . LYS A 1 17  ? -20.584 47.104 8.065   1.00 63.21 ? 17   LYS A O   1 
ATOM   121 C CB  . LYS A 1 17  ? -19.560 47.195 10.957  1.00 62.46 ? 17   LYS A CB  1 
ATOM   122 C CG  . LYS A 1 17  ? -19.596 46.135 12.024  1.00 63.45 ? 17   LYS A CG  1 
ATOM   123 C CD  . LYS A 1 17  ? -20.220 44.808 11.503  1.00 64.62 ? 17   LYS A CD  1 
ATOM   124 C CE  . LYS A 1 17  ? -19.989 43.676 12.476  1.00 64.40 ? 17   LYS A CE  1 
ATOM   125 N NZ  . LYS A 1 17  ? -20.163 44.156 13.884  1.00 64.68 ? 17   LYS A NZ  1 
ATOM   126 N N   . VAL A 1 18  ? -19.798 45.003 8.285   1.00 63.05 ? 18   VAL A N   1 
ATOM   127 C CA  . VAL A 1 18  ? -20.702 44.428 7.291   1.00 63.06 ? 18   VAL A CA  1 
ATOM   128 C C   . VAL A 1 18  ? -21.439 43.221 7.869   1.00 63.18 ? 18   VAL A C   1 
ATOM   129 O O   . VAL A 1 18  ? -20.990 42.620 8.842   1.00 63.15 ? 18   VAL A O   1 
ATOM   130 C CB  . VAL A 1 18  ? -19.955 44.037 5.990   1.00 63.08 ? 18   VAL A CB  1 
ATOM   131 C CG1 . VAL A 1 18  ? -19.252 45.256 5.424   1.00 63.06 ? 18   VAL A CG1 1 
ATOM   132 C CG2 . VAL A 1 18  ? -18.958 42.889 6.231   1.00 63.07 ? 18   VAL A CG2 1 
ATOM   133 N N   . PRO A 1 19  ? -22.600 42.893 7.291   1.00 63.28 ? 19   PRO A N   1 
ATOM   134 C CA  . PRO A 1 19  ? -23.303 41.687 7.689   1.00 63.13 ? 19   PRO A CA  1 
ATOM   135 C C   . PRO A 1 19  ? -22.575 40.440 7.214   1.00 62.90 ? 19   PRO A C   1 
ATOM   136 O O   . PRO A 1 19  ? -22.156 40.361 6.056   1.00 62.46 ? 19   PRO A O   1 
ATOM   137 C CB  . PRO A 1 19  ? -24.661 41.823 6.988   1.00 63.26 ? 19   PRO A CB  1 
ATOM   138 C CG  . PRO A 1 19  ? -24.379 42.661 5.796   1.00 63.49 ? 19   PRO A CG  1 
ATOM   139 C CD  . PRO A 1 19  ? -23.340 43.642 6.256   1.00 63.38 ? 19   PRO A CD  1 
ATOM   140 N N   . SER A 1 20  ? -22.449 39.472 8.118   1.00 62.93 ? 20   SER A N   1 
ATOM   141 C CA  . SER A 1 20  ? -21.747 38.227 7.831   1.00 62.98 ? 20   SER A CA  1 
ATOM   142 C C   . SER A 1 20  ? -22.452 37.402 6.747   1.00 63.05 ? 20   SER A C   1 
ATOM   143 O O   . SER A 1 20  ? -23.684 37.392 6.675   1.00 63.76 ? 20   SER A O   1 
ATOM   144 C CB  . SER A 1 20  ? -21.620 37.405 9.108   1.00 62.84 ? 20   SER A CB  1 
ATOM   145 O OG  . SER A 1 20  ? -21.032 36.153 8.824   1.00 63.40 ? 20   SER A OG  1 
ATOM   146 N N   . ASN A 1 21  ? -21.672 36.735 5.893   1.00 62.55 ? 21   ASN A N   1 
ATOM   147 C CA  . ASN A 1 21  ? -22.236 35.775 4.932   1.00 61.91 ? 21   ASN A CA  1 
ATOM   148 C C   . ASN A 1 21  ? -21.719 34.352 5.158   1.00 61.04 ? 21   ASN A C   1 
ATOM   149 O O   . ASN A 1 21  ? -21.797 33.486 4.278   1.00 60.77 ? 21   ASN A O   1 
ATOM   150 C CB  . ASN A 1 21  ? -22.062 36.245 3.476   1.00 62.18 ? 21   ASN A CB  1 
ATOM   151 C CG  . ASN A 1 21  ? -20.604 36.413 3.053   1.00 63.19 ? 21   ASN A CG  1 
ATOM   152 O OD1 . ASN A 1 21  ? -19.675 35.862 3.651   1.00 63.88 ? 21   ASN A OD1 1 
ATOM   153 N ND2 . ASN A 1 21  ? -20.410 37.172 1.978   1.00 65.03 ? 21   ASN A ND2 1 
ATOM   154 N N   . ASP A 1 22  ? -21.224 34.124 6.366   1.00 60.26 ? 22   ASP A N   1 
ATOM   155 C CA  . ASP A 1 22  ? -20.822 32.810 6.803   1.00 60.22 ? 22   ASP A CA  1 
ATOM   156 C C   . ASP A 1 22  ? -21.371 32.635 8.206   1.00 59.81 ? 22   ASP A C   1 
ATOM   157 O O   . ASP A 1 22  ? -21.009 33.388 9.100   1.00 59.25 ? 22   ASP A O   1 
ATOM   158 C CB  . ASP A 1 22  ? -19.297 32.672 6.794   1.00 60.08 ? 22   ASP A CB  1 
ATOM   159 C CG  . ASP A 1 22  ? -18.818 31.355 7.398   1.00 60.32 ? 22   ASP A CG  1 
ATOM   160 O OD1 . ASP A 1 22  ? -19.022 31.138 8.599   1.00 61.66 ? 22   ASP A OD1 1 
ATOM   161 O OD2 . ASP A 1 22  ? -18.211 30.536 6.689   1.00 62.87 ? 22   ASP A OD2 1 
ATOM   162 N N   . PRO A 1 23  ? -22.250 31.636 8.401   1.00 59.67 ? 23   PRO A N   1 
ATOM   163 C CA  . PRO A 1 23  ? -22.819 31.313 9.701   1.00 59.77 ? 23   PRO A CA  1 
ATOM   164 C C   . PRO A 1 23  ? -21.800 31.252 10.840  1.00 59.75 ? 23   PRO A C   1 
ATOM   165 O O   . PRO A 1 23  ? -22.156 31.524 11.981  1.00 59.93 ? 23   PRO A O   1 
ATOM   166 C CB  . PRO A 1 23  ? -23.421 29.925 9.468   1.00 59.85 ? 23   PRO A CB  1 
ATOM   167 C CG  . PRO A 1 23  ? -23.760 29.895 8.045   1.00 59.26 ? 23   PRO A CG  1 
ATOM   168 C CD  . PRO A 1 23  ? -22.766 30.744 7.344   1.00 59.52 ? 23   PRO A CD  1 
ATOM   169 N N   . GLY A 1 24  ? -20.552 30.902 10.533  1.00 59.90 ? 24   GLY A N   1 
ATOM   170 C CA  . GLY A 1 24  ? -19.471 30.813 11.538  1.00 60.31 ? 24   GLY A CA  1 
ATOM   171 C C   . GLY A 1 24  ? -18.698 32.083 11.918  1.00 60.64 ? 24   GLY A C   1 
ATOM   172 O O   . GLY A 1 24  ? -17.824 32.033 12.789  1.00 61.07 ? 24   GLY A O   1 
ATOM   173 N N   . ARG A 1 25  ? -19.025 33.224 11.309  1.00 60.78 ? 25   ARG A N   1 
ATOM   174 C CA  . ARG A 1 25  ? -18.280 34.476 11.544  1.00 60.79 ? 25   ARG A CA  1 
ATOM   175 C C   . ARG A 1 25  ? -19.172 35.600 12.047  1.00 60.93 ? 25   ARG A C   1 
ATOM   176 O O   . ARG A 1 25  ? -20.143 35.965 11.395  1.00 60.63 ? 25   ARG A O   1 
ATOM   177 C CB  . ARG A 1 25  ? -17.609 34.962 10.264  1.00 60.84 ? 25   ARG A CB  1 
ATOM   178 C CG  . ARG A 1 25  ? -16.583 34.010 9.688   1.00 60.93 ? 25   ARG A CG  1 
ATOM   179 C CD  . ARG A 1 25  ? -16.158 34.444 8.298   1.00 60.77 ? 25   ARG A CD  1 
ATOM   180 N NE  . ARG A 1 25  ? -15.322 33.416 7.693   1.00 61.47 ? 25   ARG A NE  1 
ATOM   181 C CZ  . ARG A 1 25  ? -15.206 33.191 6.382   1.00 61.62 ? 25   ARG A CZ  1 
ATOM   182 N NH1 . ARG A 1 25  ? -15.859 33.930 5.484   1.00 60.08 ? 25   ARG A NH1 1 
ATOM   183 N NH2 . ARG A 1 25  ? -14.414 32.211 5.965   1.00 62.27 ? 25   ARG A NH2 1 
ATOM   184 N N   . ASP A 1 26  ? -18.818 36.142 13.211  1.00 61.07 ? 26   ASP A N   1 
ATOM   185 C CA  . ASP A 1 26  ? -19.473 37.323 13.765  1.00 60.88 ? 26   ASP A CA  1 
ATOM   186 C C   . ASP A 1 26  ? -18.537 38.547 13.681  1.00 60.22 ? 26   ASP A C   1 
ATOM   187 O O   . ASP A 1 26  ? -17.332 38.418 13.451  1.00 59.90 ? 26   ASP A O   1 
ATOM   188 C CB  . ASP A 1 26  ? -19.904 37.062 15.215  1.00 61.40 ? 26   ASP A CB  1 
ATOM   189 C CG  . ASP A 1 26  ? -18.728 36.943 16.172  1.00 64.70 ? 26   ASP A CG  1 
ATOM   190 O OD1 . ASP A 1 26  ? -18.948 37.050 17.406  1.00 70.11 ? 26   ASP A OD1 1 
ATOM   191 O OD2 . ASP A 1 26  ? -17.584 36.722 15.705  1.00 69.60 ? 26   ASP A OD2 1 
ATOM   192 N N   . ASN A 1 27  ? -19.103 39.731 13.870  1.00 59.04 ? 27   ASN A N   1 
ATOM   193 C CA  . ASN A 1 27  ? -18.327 40.962 13.827  1.00 58.57 ? 27   ASN A CA  1 
ATOM   194 C C   . ASN A 1 27  ? -17.451 41.048 12.549  1.00 57.84 ? 27   ASN A C   1 
ATOM   195 O O   . ASN A 1 27  ? -16.300 41.478 12.577  1.00 57.14 ? 27   ASN A O   1 
ATOM   196 C CB  . ASN A 1 27  ? -17.496 41.090 15.115  1.00 58.25 ? 27   ASN A CB  1 
ATOM   197 C CG  . ASN A 1 27  ? -17.017 42.497 15.361  1.00 57.59 ? 27   ASN A CG  1 
ATOM   198 O OD1 . ASN A 1 27  ? -17.667 43.457 14.982  1.00 55.11 ? 27   ASN A OD1 1 
ATOM   199 N ND2 . ASN A 1 27  ? -15.869 42.624 15.988  1.00 56.03 ? 27   ASN A ND2 1 
ATOM   200 N N   . THR A 1 28  ? -18.025 40.634 11.427  1.00 57.47 ? 28   THR A N   1 
ATOM   201 C CA  . THR A 1 28  ? -17.317 40.667 10.150  1.00 57.40 ? 28   THR A CA  1 
ATOM   202 C C   . THR A 1 28  ? -17.121 42.102 9.694   1.00 57.14 ? 28   THR A C   1 
ATOM   203 O O   . THR A 1 28  ? -18.004 42.931 9.858   1.00 57.12 ? 28   THR A O   1 
ATOM   204 C CB  . THR A 1 28  ? -18.069 39.889 9.067   1.00 57.29 ? 28   THR A CB  1 
ATOM   205 O OG1 . THR A 1 28  ? -19.376 40.444 8.885   1.00 56.49 ? 28   THR A OG1 1 
ATOM   206 C CG2 . THR A 1 28  ? -18.181 38.412 9.464   1.00 57.62 ? 28   THR A CG2 1 
ATOM   207 N N   . ARG A 1 29  ? -15.946 42.398 9.146   1.00 57.28 ? 29   ARG A N   1 
ATOM   208 C CA  . ARG A 1 29  ? -15.551 43.783 8.831   1.00 57.10 ? 29   ARG A CA  1 
ATOM   209 C C   . ARG A 1 29  ? -14.647 43.784 7.622   1.00 57.28 ? 29   ARG A C   1 
ATOM   210 O O   . ARG A 1 29  ? -13.715 42.991 7.552   1.00 57.07 ? 29   ARG A O   1 
ATOM   211 C CB  . ARG A 1 29  ? -14.804 44.417 10.014  1.00 56.76 ? 29   ARG A CB  1 
ATOM   212 C CG  . ARG A 1 29  ? -15.624 44.543 11.277  1.00 55.72 ? 29   ARG A CG  1 
ATOM   213 C CD  . ARG A 1 29  ? -14.771 44.764 12.506  1.00 55.61 ? 29   ARG A CD  1 
ATOM   214 N NE  . ARG A 1 29  ? -14.190 43.521 12.997  1.00 54.70 ? 29   ARG A NE  1 
ATOM   215 C CZ  . ARG A 1 29  ? -12.906 43.333 13.292  1.00 53.61 ? 29   ARG A CZ  1 
ATOM   216 N NH1 . ARG A 1 29  ? -12.021 44.309 13.171  1.00 54.00 ? 29   ARG A NH1 1 
ATOM   217 N NH2 . ARG A 1 29  ? -12.503 42.150 13.727  1.00 53.31 ? 29   ARG A NH2 1 
ATOM   218 N N   . GLU A 1 30  ? -14.909 44.675 6.675   1.00 58.09 ? 30   GLU A N   1 
ATOM   219 C CA  . GLU A 1 30  ? -14.105 44.730 5.454   1.00 58.54 ? 30   GLU A CA  1 
ATOM   220 C C   . GLU A 1 30  ? -13.819 46.137 4.926   1.00 58.59 ? 30   GLU A C   1 
ATOM   221 O O   . GLU A 1 30  ? -14.650 47.045 5.037   1.00 59.65 ? 30   GLU A O   1 
ATOM   222 C CB  . GLU A 1 30  ? -14.760 43.887 4.360   1.00 58.60 ? 30   GLU A CB  1 
ATOM   223 C CG  . GLU A 1 30  ? -16.007 44.475 3.748   1.00 59.25 ? 30   GLU A CG  1 
ATOM   224 C CD  . GLU A 1 30  ? -16.463 43.726 2.492   1.00 60.21 ? 30   GLU A CD  1 
ATOM   225 O OE1 . GLU A 1 30  ? -15.891 42.647 2.195   1.00 61.79 ? 30   GLU A OE1 1 
ATOM   226 O OE2 . GLU A 1 30  ? -17.403 44.218 1.803   1.00 62.25 ? 30   GLU A OE2 1 
ATOM   227 N N   . LEU A 1 31  ? -12.629 46.311 4.366   1.00 58.44 ? 31   LEU A N   1 
ATOM   228 C CA  . LEU A 1 31  ? -12.315 47.476 3.552   1.00 58.35 ? 31   LEU A CA  1 
ATOM   229 C C   . LEU A 1 31  ? -12.448 46.988 2.116   1.00 58.35 ? 31   LEU A C   1 
ATOM   230 O O   . LEU A 1 31  ? -11.492 46.469 1.547   1.00 58.49 ? 31   LEU A O   1 
ATOM   231 C CB  . LEU A 1 31  ? -10.888 47.977 3.844   1.00 58.32 ? 31   LEU A CB  1 
ATOM   232 C CG  . LEU A 1 31  ? -10.364 49.305 3.254   1.00 58.29 ? 31   LEU A CG  1 
ATOM   233 C CD1 . LEU A 1 31  ? -10.171 49.248 1.741   1.00 58.43 ? 31   LEU A CD1 1 
ATOM   234 C CD2 . LEU A 1 31  ? -11.257 50.486 3.621   1.00 58.76 ? 31   LEU A CD2 1 
ATOM   235 N N   . ALA A 1 32  ? -13.640 47.117 1.546   1.00 58.18 ? 32   ALA A N   1 
ATOM   236 C CA  . ALA A 1 32  ? -13.887 46.667 0.178   1.00 58.33 ? 32   ALA A CA  1 
ATOM   237 C C   . ALA A 1 32  ? -13.418 47.727 -0.797  1.00 58.27 ? 32   ALA A C   1 
ATOM   238 O O   . ALA A 1 32  ? -13.460 48.895 -0.484  1.00 58.70 ? 32   ALA A O   1 
ATOM   239 C CB  . ALA A 1 32  ? -15.365 46.364 -0.028  1.00 57.88 ? 32   ALA A CB  1 
ATOM   240 N N   . LYS A 1 33  ? -12.941 47.323 -1.964  1.00 58.56 ? 33   LYS A N   1 
ATOM   241 C CA  . LYS A 1 33  ? -12.612 48.283 -3.013  1.00 59.01 ? 33   LYS A CA  1 
ATOM   242 C C   . LYS A 1 33  ? -13.121 47.791 -4.349  1.00 59.22 ? 33   LYS A C   1 
ATOM   243 O O   . LYS A 1 33  ? -13.054 46.606 -4.686  1.00 58.18 ? 33   LYS A O   1 
ATOM   244 C CB  . LYS A 1 33  ? -11.101 48.547 -3.113  1.00 59.51 ? 33   LYS A CB  1 
ATOM   245 C CG  . LYS A 1 33  ? -10.520 49.592 -2.139  1.00 61.02 ? 33   LYS A CG  1 
ATOM   246 C CD  . LYS A 1 33  ? -10.729 51.033 -2.639  1.00 63.32 ? 33   LYS A CD  1 
ATOM   247 C CE  . LYS A 1 33  ? -11.733 51.769 -1.783  1.00 64.93 ? 33   LYS A CE  1 
ATOM   248 N NZ  . LYS A 1 33  ? -11.165 52.014 -0.421  1.00 66.67 ? 33   LYS A NZ  1 
ATOM   249 N N   . ASN A 1 34  ? -13.632 48.748 -5.099  1.00 60.26 ? 34   ASN A N   1 
ATOM   250 C CA  . ASN A 1 34  ? -14.145 48.536 -6.431  1.00 60.68 ? 34   ASN A CA  1 
ATOM   251 C C   . ASN A 1 34  ? -13.094 49.146 -7.354  1.00 60.34 ? 34   ASN A C   1 
ATOM   252 O O   . ASN A 1 34  ? -13.046 50.365 -7.547  1.00 60.38 ? 34   ASN A O   1 
ATOM   253 C CB  . ASN A 1 34  ? -15.543 49.206 -6.531  1.00 61.40 ? 34   ASN A CB  1 
ATOM   254 C CG  . ASN A 1 34  ? -16.186 49.101 -7.921  1.00 62.65 ? 34   ASN A CG  1 
ATOM   255 O OD1 . ASN A 1 34  ? -17.128 49.866 -8.236  1.00 68.45 ? 34   ASN A OD1 1 
ATOM   256 N ND2 . ASN A 1 34  ? -15.696 48.165 -8.757  1.00 66.11 ? 34   ASN A ND2 1 
ATOM   257 N N   . ILE A 1 35  ? -12.227 48.281 -7.870  1.00 60.26 ? 35   ILE A N   1 
ATOM   258 C CA  . ILE A 1 35  ? -11.099 48.683 -8.693  1.00 60.44 ? 35   ILE A CA  1 
ATOM   259 C C   . ILE A 1 35  ? -11.470 48.568 -10.146 1.00 60.54 ? 35   ILE A C   1 
ATOM   260 O O   . ILE A 1 35  ? -12.022 47.563 -10.571 1.00 61.08 ? 35   ILE A O   1 
ATOM   261 C CB  . ILE A 1 35  ? -9.861  47.780 -8.465  1.00 60.36 ? 35   ILE A CB  1 
ATOM   262 C CG1 . ILE A 1 35  ? -9.241  48.070 -7.113  1.00 60.54 ? 35   ILE A CG1 1 
ATOM   263 C CG2 . ILE A 1 35  ? -8.809  47.983 -9.546  1.00 60.43 ? 35   ILE A CG2 1 
ATOM   264 C CD1 . ILE A 1 35  ? -9.961  47.375 -6.017  1.00 62.06 ? 35   ILE A CD1 1 
ATOM   265 N N   . THR A 1 36  ? -11.118 49.598 -10.901 1.00 60.82 ? 36   THR A N   1 
ATOM   266 C CA  . THR A 1 36  ? -11.314 49.655 -12.330 1.00 61.15 ? 36   THR A CA  1 
ATOM   267 C C   . THR A 1 36  ? -9.946  49.560 -13.024 1.00 61.73 ? 36   THR A C   1 
ATOM   268 O O   . THR A 1 36  ? -8.972  50.183 -12.608 1.00 61.52 ? 36   THR A O   1 
ATOM   269 C CB  . THR A 1 36  ? -12.021 50.978 -12.687 1.00 61.08 ? 36   THR A CB  1 
ATOM   270 O OG1 . THR A 1 36  ? -13.096 51.217 -11.757 1.00 60.00 ? 36   THR A OG1 1 
ATOM   271 C CG2 . THR A 1 36  ? -12.564 50.951 -14.109 1.00 60.78 ? 36   THR A CG2 1 
ATOM   272 N N   . PHE A 1 37  ? -9.864  48.751 -14.074 1.00 62.71 ? 37   PHE A N   1 
ATOM   273 C CA  . PHE A 1 37  ? -8.621  48.622 -14.821 1.00 63.39 ? 37   PHE A CA  1 
ATOM   274 C C   . PHE A 1 37  ? -8.363  49.894 -15.624 1.00 64.15 ? 37   PHE A C   1 
ATOM   275 O O   . PHE A 1 37  ? -9.305  50.535 -16.099 1.00 64.56 ? 37   PHE A O   1 
ATOM   276 C CB  . PHE A 1 37  ? -8.696  47.429 -15.770 1.00 63.63 ? 37   PHE A CB  1 
ATOM   277 C CG  . PHE A 1 37  ? -9.113  46.143 -15.103 1.00 64.33 ? 37   PHE A CG  1 
ATOM   278 C CD1 . PHE A 1 37  ? -10.301 45.501 -15.478 1.00 64.61 ? 37   PHE A CD1 1 
ATOM   279 C CD2 . PHE A 1 37  ? -8.330  45.574 -14.098 1.00 63.28 ? 37   PHE A CD2 1 
ATOM   280 C CE1 . PHE A 1 37  ? -10.688 44.301 -14.875 1.00 63.90 ? 37   PHE A CE1 1 
ATOM   281 C CE2 . PHE A 1 37  ? -8.715  44.390 -13.485 1.00 63.29 ? 37   PHE A CE2 1 
ATOM   282 C CZ  . PHE A 1 37  ? -9.898  43.748 -13.876 1.00 63.56 ? 37   PHE A CZ  1 
ATOM   283 N N   . ALA A 1 38  ? -7.096  50.265 -15.776 1.00 64.84 ? 38   ALA A N   1 
ATOM   284 C CA  . ALA A 1 38  ? -6.744  51.399 -16.621 1.00 65.43 ? 38   ALA A CA  1 
ATOM   285 C C   . ALA A 1 38  ? -7.168  51.109 -18.063 1.00 66.05 ? 38   ALA A C   1 
ATOM   286 O O   . ALA A 1 38  ? -7.793  51.951 -18.711 1.00 65.86 ? 38   ALA A O   1 
ATOM   287 C CB  . ALA A 1 38  ? -5.261  51.687 -16.540 1.00 65.63 ? 38   ALA A CB  1 
ATOM   288 N N   . SER A 1 39  ? -6.848  49.905 -18.544 1.00 66.96 ? 39   SER A N   1 
ATOM   289 C CA  . SER A 1 39  ? -7.318  49.418 -19.862 1.00 67.51 ? 39   SER A CA  1 
ATOM   290 C C   . SER A 1 39  ? -8.405  48.351 -19.743 1.00 67.89 ? 39   SER A C   1 
ATOM   291 O O   . SER A 1 39  ? -8.105  47.206 -19.378 1.00 68.08 ? 39   SER A O   1 
ATOM   292 C CB  . SER A 1 39  ? -6.170  48.829 -20.682 1.00 67.52 ? 39   SER A CB  1 
ATOM   293 O OG  . SER A 1 39  ? -5.178  49.806 -20.897 1.00 68.32 ? 39   SER A OG  1 
ATOM   294 N N   . PRO A 1 40  ? -9.658  48.707 -20.096 1.00 68.31 ? 40   PRO A N   1 
ATOM   295 C CA  . PRO A 1 40  ? -10.731 47.730 -20.045 1.00 68.41 ? 40   PRO A CA  1 
ATOM   296 C C   . PRO A 1 40  ? -10.406 46.471 -20.837 1.00 68.82 ? 40   PRO A C   1 
ATOM   297 O O   . PRO A 1 40  ? -9.629  46.498 -21.806 1.00 69.26 ? 40   PRO A O   1 
ATOM   298 C CB  . PRO A 1 40  ? -11.916 48.469 -20.685 1.00 68.42 ? 40   PRO A CB  1 
ATOM   299 C CG  . PRO A 1 40  ? -11.638 49.890 -20.470 1.00 68.12 ? 40   PRO A CG  1 
ATOM   300 C CD  . PRO A 1 40  ? -10.150 50.012 -20.578 1.00 68.27 ? 40   PRO A CD  1 
ATOM   301 N N   . TYR A 1 41  ? -10.986 45.370 -20.393 1.00 68.96 ? 41   TYR A N   1 
ATOM   302 C CA  . TYR A 1 41  ? -10.836 44.117 -21.075 1.00 69.28 ? 41   TYR A CA  1 
ATOM   303 C C   . TYR A 1 41  ? -12.077 43.845 -21.924 1.00 69.58 ? 41   TYR A C   1 
ATOM   304 O O   . TYR A 1 41  ? -13.123 44.495 -21.783 1.00 69.23 ? 41   TYR A O   1 
ATOM   305 C CB  . TYR A 1 41  ? -10.610 42.973 -20.075 1.00 68.64 ? 41   TYR A CB  1 
ATOM   306 C CG  . TYR A 1 41  ? -9.218  42.918 -19.488 1.00 68.57 ? 41   TYR A CG  1 
ATOM   307 C CD1 . TYR A 1 41  ? -8.965  43.410 -18.201 1.00 68.67 ? 41   TYR A CD1 1 
ATOM   308 C CD2 . TYR A 1 41  ? -8.151  42.356 -20.202 1.00 67.31 ? 41   TYR A CD2 1 
ATOM   309 C CE1 . TYR A 1 41  ? -7.689  43.355 -17.645 1.00 67.74 ? 41   TYR A CE1 1 
ATOM   310 C CE2 . TYR A 1 41  ? -6.877  42.294 -19.648 1.00 67.32 ? 41   TYR A CE2 1 
ATOM   311 C CZ  . TYR A 1 41  ? -6.661  42.800 -18.370 1.00 67.21 ? 41   TYR A CZ  1 
ATOM   312 O OH  . TYR A 1 41  ? -5.425  42.760 -17.799 1.00 67.61 ? 41   TYR A OH  1 
ATOM   313 N N   . CYS A 1 42  ? -11.923 42.862 -22.805 1.00 70.24 ? 42   CYS A N   1 
ATOM   314 C CA  . CYS A 1 42  ? -12.999 42.350 -23.625 1.00 70.34 ? 42   CYS A CA  1 
ATOM   315 C C   . CYS A 1 42  ? -13.860 41.482 -22.728 1.00 70.57 ? 42   CYS A C   1 
ATOM   316 O O   . CYS A 1 42  ? -15.057 41.753 -22.552 1.00 70.82 ? 42   CYS A O   1 
ATOM   317 C CB  . CYS A 1 42  ? -12.414 41.522 -24.779 1.00 70.75 ? 42   CYS A CB  1 
ATOM   318 S SG  . CYS A 1 42  ? -13.065 41.926 -26.392 0.50 70.77 ? 42   CYS A SG  1 
ATOM   319 N N   . ARG A 1 43  ? -13.227 40.461 -22.145 1.00 70.39 ? 43   ARG A N   1 
ATOM   320 C CA  . ARG A 1 43  ? -13.882 39.555 -21.211 1.00 70.37 ? 43   ARG A CA  1 
ATOM   321 C C   . ARG A 1 43  ? -13.193 39.648 -19.861 1.00 69.07 ? 43   ARG A C   1 
ATOM   322 O O   . ARG A 1 43  ? -12.023 40.040 -19.796 1.00 69.23 ? 43   ARG A O   1 
ATOM   323 C CB  . ARG A 1 43  ? -13.806 38.115 -21.728 1.00 71.29 ? 43   ARG A CB  1 
ATOM   324 C CG  . ARG A 1 43  ? -14.358 37.936 -23.126 1.00 72.67 ? 43   ARG A CG  1 
ATOM   325 C CD  . ARG A 1 43  ? -14.420 36.453 -23.550 1.00 75.23 ? 43   ARG A CD  1 
ATOM   326 N NE  . ARG A 1 43  ? -15.078 36.288 -24.866 1.00 78.28 ? 43   ARG A NE  1 
ATOM   327 C CZ  . ARG A 1 43  ? -16.394 36.434 -25.103 1.00 80.33 ? 43   ARG A CZ  1 
ATOM   328 N NH1 . ARG A 1 43  ? -17.250 36.753 -24.124 1.00 80.59 ? 43   ARG A NH1 1 
ATOM   329 N NH2 . ARG A 1 43  ? -16.866 36.265 -26.341 1.00 81.27 ? 43   ARG A NH2 1 
ATOM   330 N N   . PRO A 1 44  ? -13.915 39.293 -18.777 1.00 67.30 ? 44   PRO A N   1 
ATOM   331 C CA  . PRO A 1 44  ? -13.284 39.152 -17.485 1.00 65.91 ? 44   PRO A CA  1 
ATOM   332 C C   . PRO A 1 44  ? -11.899 38.517 -17.569 1.00 64.45 ? 44   PRO A C   1 
ATOM   333 O O   . PRO A 1 44  ? -11.750 37.391 -18.071 1.00 64.04 ? 44   PRO A O   1 
ATOM   334 C CB  . PRO A 1 44  ? -14.251 38.244 -16.731 1.00 66.02 ? 44   PRO A CB  1 
ATOM   335 C CG  . PRO A 1 44  ? -15.574 38.669 -17.223 1.00 66.76 ? 44   PRO A CG  1 
ATOM   336 C CD  . PRO A 1 44  ? -15.365 39.040 -18.683 1.00 67.40 ? 44   PRO A CD  1 
ATOM   337 N N   . PRO A 1 45  ? -10.881 39.244 -17.075 1.00 62.65 ? 45   PRO A N   1 
ATOM   338 C CA  . PRO A 1 45  ? -9.568  38.638 -16.959 1.00 61.49 ? 45   PRO A CA  1 
ATOM   339 C C   . PRO A 1 45  ? -9.603  37.695 -15.795 1.00 58.98 ? 45   PRO A C   1 
ATOM   340 O O   . PRO A 1 45  ? -10.579 37.676 -15.038 1.00 57.89 ? 45   PRO A O   1 
ATOM   341 C CB  . PRO A 1 45  ? -8.664  39.832 -16.648 1.00 61.14 ? 45   PRO A CB  1 
ATOM   342 C CG  . PRO A 1 45  ? -9.552  40.776 -15.922 1.00 61.70 ? 45   PRO A CG  1 
ATOM   343 C CD  . PRO A 1 45  ? -10.896 40.630 -16.563 1.00 62.44 ? 45   PRO A CD  1 
ATOM   344 N N   . VAL A 1 46  ? -8.543  36.918 -15.649 1.00 57.20 ? 46   VAL A N   1 
ATOM   345 C CA  . VAL A 1 46  ? -8.339  36.170 -14.427 1.00 55.67 ? 46   VAL A CA  1 
ATOM   346 C C   . VAL A 1 46  ? -7.625  37.095 -13.465 1.00 55.06 ? 46   VAL A C   1 
ATOM   347 O O   . VAL A 1 46  ? -6.640  37.741 -13.837 1.00 55.20 ? 46   VAL A O   1 
ATOM   348 C CB  . VAL A 1 46  ? -7.515  34.920 -14.680 1.00 55.78 ? 46   VAL A CB  1 
ATOM   349 C CG1 . VAL A 1 46  ? -7.245  34.219 -13.386 1.00 56.82 ? 46   VAL A CG1 1 
ATOM   350 C CG2 . VAL A 1 46  ? -8.262  33.989 -15.606 1.00 56.00 ? 46   VAL A CG2 1 
ATOM   351 N N   . VAL A 1 47  ? -8.115  37.174 -12.233 1.00 54.23 ? 47   VAL A N   1 
ATOM   352 C CA  . VAL A 1 47  ? -7.491  38.038 -11.232 1.00 53.61 ? 47   VAL A CA  1 
ATOM   353 C C   . VAL A 1 47  ? -7.003  37.214 -10.065 1.00 52.74 ? 47   VAL A C   1 
ATOM   354 O O   . VAL A 1 47  ? -7.730  36.358 -9.555  1.00 51.94 ? 47   VAL A O   1 
ATOM   355 C CB  . VAL A 1 47  ? -8.451  39.139 -10.715 1.00 53.68 ? 47   VAL A CB  1 
ATOM   356 C CG1 . VAL A 1 47  ? -7.790  39.952 -9.604  1.00 54.48 ? 47   VAL A CG1 1 
ATOM   357 C CG2 . VAL A 1 47  ? -8.883  40.059 -11.846 1.00 53.40 ? 47   VAL A CG2 1 
ATOM   358 N N   . LEU A 1 48  ? -5.763  37.475 -9.656  1.00 52.10 ? 48   LEU A N   1 
ATOM   359 C CA  . LEU A 1 48  ? -5.206  36.831 -8.481  1.00 52.23 ? 48   LEU A CA  1 
ATOM   360 C C   . LEU A 1 48  ? -4.915  37.862 -7.431  1.00 51.90 ? 48   LEU A C   1 
ATOM   361 O O   . LEU A 1 48  ? -4.413  38.947 -7.747  1.00 52.10 ? 48   LEU A O   1 
ATOM   362 C CB  . LEU A 1 48  ? -3.917  36.044 -8.790  1.00 52.29 ? 48   LEU A CB  1 
ATOM   363 C CG  . LEU A 1 48  ? -3.377  35.215 -7.605  1.00 52.02 ? 48   LEU A CG  1 
ATOM   364 C CD1 . LEU A 1 48  ? -4.224  33.995 -7.332  1.00 53.10 ? 48   LEU A CD1 1 
ATOM   365 C CD2 . LEU A 1 48  ? -1.985  34.764 -7.834  1.00 52.93 ? 48   LEU A CD2 1 
ATOM   366 N N   . LEU A 1 49  ? -5.215  37.489 -6.188  1.00 51.51 ? 49   LEU A N   1 
ATOM   367 C CA  . LEU A 1 49  ? -4.943  38.290 -5.008  1.00 51.58 ? 49   LEU A CA  1 
ATOM   368 C C   . LEU A 1 49  ? -3.839  37.655 -4.161  1.00 51.98 ? 49   LEU A C   1 
ATOM   369 O O   . LEU A 1 49  ? -3.766  36.436 -3.997  1.00 52.28 ? 49   LEU A O   1 
ATOM   370 C CB  . LEU A 1 49  ? -6.212  38.444 -4.154  1.00 51.56 ? 49   LEU A CB  1 
ATOM   371 C CG  . LEU A 1 49  ? -7.146  39.626 -4.430  1.00 51.31 ? 49   LEU A CG  1 
ATOM   372 C CD1 . LEU A 1 49  ? -7.189  40.041 -5.896  1.00 52.79 ? 49   LEU A CD1 1 
ATOM   373 C CD2 . LEU A 1 49  ? -8.529  39.342 -3.938  1.00 50.96 ? 49   LEU A CD2 1 
ATOM   374 N N   . SER A 1 50  ? -3.003  38.523 -3.604  1.00 52.04 ? 50   SER A N   1 
ATOM   375 C CA  . SER A 1 50  ? -1.879  38.146 -2.789  1.00 51.60 ? 50   SER A CA  1 
ATOM   376 C C   . SER A 1 50  ? -1.807  39.157 -1.655  1.00 51.23 ? 50   SER A C   1 
ATOM   377 O O   . SER A 1 50  ? -1.744  40.349 -1.884  1.00 51.64 ? 50   SER A O   1 
ATOM   378 C CB  . SER A 1 50  ? -0.614  38.206 -3.653  1.00 52.24 ? 50   SER A CB  1 
ATOM   379 O OG  . SER A 1 50  ? 0.557   37.786 -2.968  1.00 54.30 ? 50   SER A OG  1 
ATOM   380 N N   . ILE A 1 51  ? -1.829  38.679 -0.425  1.00 51.17 ? 51   ILE A N   1 
ATOM   381 C CA  . ILE A 1 51  ? -1.615  39.532 0.731   1.00 50.66 ? 51   ILE A CA  1 
ATOM   382 C C   . ILE A 1 51  ? -0.118  39.761 0.805   1.00 50.73 ? 51   ILE A C   1 
ATOM   383 O O   . ILE A 1 51  ? 0.658   38.805 0.967   1.00 51.64 ? 51   ILE A O   1 
ATOM   384 C CB  . ILE A 1 51  ? -2.088  38.842 2.015   1.00 50.56 ? 51   ILE A CB  1 
ATOM   385 C CG1 . ILE A 1 51  ? -3.602  38.559 1.936   1.00 50.59 ? 51   ILE A CG1 1 
ATOM   386 C CG2 . ILE A 1 51  ? -1.723  39.687 3.238   1.00 51.33 ? 51   ILE A CG2 1 
ATOM   387 C CD1 . ILE A 1 51  ? -4.107  37.498 2.888   1.00 50.72 ? 51   ILE A CD1 1 
ATOM   388 N N   . THR A 1 52  ? 0.299   41.007 0.640   1.00 50.53 ? 52   THR A N   1 
ATOM   389 C CA  . THR A 1 52  ? 1.722   41.349 0.671   1.00 50.30 ? 52   THR A CA  1 
ATOM   390 C C   . THR A 1 52  ? 2.064   42.278 1.831   1.00 49.87 ? 52   THR A C   1 
ATOM   391 O O   . THR A 1 52  ? 3.178   42.778 1.931   1.00 49.59 ? 52   THR A O   1 
ATOM   392 C CB  . THR A 1 52  ? 2.153   42.001 -0.641  1.00 50.19 ? 52   THR A CB  1 
ATOM   393 O OG1 . THR A 1 52  ? 1.354   43.172 -0.880  1.00 50.04 ? 52   THR A OG1 1 
ATOM   394 C CG2 . THR A 1 52  ? 1.984   41.012 -1.778  1.00 50.67 ? 52   THR A CG2 1 
ATOM   395 N N   . GLN A 1 53  ? 1.113   42.519 2.712   1.00 49.84 ? 53   GLN A N   1 
ATOM   396 C CA  . GLN A 1 53  ? 1.433   43.241 3.918   1.00 50.39 ? 53   GLN A CA  1 
ATOM   397 C C   . GLN A 1 53  ? 0.477   42.873 5.018   1.00 50.07 ? 53   GLN A C   1 
ATOM   398 O O   . GLN A 1 53  ? -0.719  42.737 4.776   1.00 50.41 ? 53   GLN A O   1 
ATOM   399 C CB  . GLN A 1 53  ? 1.418   44.757 3.673   1.00 50.28 ? 53   GLN A CB  1 
ATOM   400 C CG  . GLN A 1 53  ? 1.645   45.557 4.940   1.00 50.45 ? 53   GLN A CG  1 
ATOM   401 C CD  . GLN A 1 53  ? 1.890   47.017 4.659   1.00 51.89 ? 53   GLN A CD  1 
ATOM   402 O OE1 . GLN A 1 53  ? 2.566   47.382 3.681   1.00 53.25 ? 53   GLN A OE1 1 
ATOM   403 N NE2 . GLN A 1 53  ? 1.316   47.877 5.505   1.00 52.64 ? 53   GLN A NE2 1 
ATOM   404 N N   . LEU A 1 54  ? 1.024   42.717 6.219   1.00 50.31 ? 54   LEU A N   1 
ATOM   405 C CA  . LEU A 1 54  ? 0.246   42.365 7.400   1.00 50.77 ? 54   LEU A CA  1 
ATOM   406 C C   . LEU A 1 54  ? 0.868   42.905 8.684   1.00 50.62 ? 54   LEU A C   1 
ATOM   407 O O   . LEU A 1 54  ? 2.085   42.896 8.872   1.00 50.29 ? 54   LEU A O   1 
ATOM   408 C CB  . LEU A 1 54  ? 0.122   40.851 7.530   1.00 51.04 ? 54   LEU A CB  1 
ATOM   409 C CG  . LEU A 1 54  ? -1.130  40.179 7.019   1.00 52.54 ? 54   LEU A CG  1 
ATOM   410 C CD1 . LEU A 1 54  ? -0.967  38.675 7.153   1.00 53.20 ? 54   LEU A CD1 1 
ATOM   411 C CD2 . LEU A 1 54  ? -2.356  40.636 7.796   1.00 54.97 ? 54   LEU A CD2 1 
ATOM   412 N N   . ASP A 1 55  ? -0.009  43.362 9.559   1.00 50.82 ? 55   ASP A N   1 
ATOM   413 C CA  . ASP A 1 55  ? 0.350   43.903 10.857  1.00 51.24 ? 55   ASP A CA  1 
ATOM   414 C C   . ASP A 1 55  ? -0.874  43.622 11.729  1.00 51.27 ? 55   ASP A C   1 
ATOM   415 O O   . ASP A 1 55  ? -1.899  44.303 11.634  1.00 50.35 ? 55   ASP A O   1 
ATOM   416 C CB  . ASP A 1 55  ? 0.687   45.398 10.737  1.00 51.15 ? 55   ASP A CB  1 
ATOM   417 C CG  . ASP A 1 55  ? 1.189   46.012 12.036  1.00 51.14 ? 55   ASP A CG  1 
ATOM   418 O OD1 . ASP A 1 55  ? 1.109   45.365 13.117  1.00 51.37 ? 55   ASP A OD1 1 
ATOM   419 O OD2 . ASP A 1 55  ? 1.661   47.178 11.961  1.00 52.27 ? 55   ASP A OD2 1 
ATOM   420 N N   . VAL A 1 56  ? -0.773  42.554 12.515  1.00 52.08 ? 56   VAL A N   1 
ATOM   421 C CA  . VAL A 1 56  ? -1.907  42.020 13.262  1.00 52.96 ? 56   VAL A CA  1 
ATOM   422 C C   . VAL A 1 56  ? -1.572  41.936 14.749  1.00 53.34 ? 56   VAL A C   1 
ATOM   423 O O   . VAL A 1 56  ? -0.446  41.630 15.126  1.00 52.53 ? 56   VAL A O   1 
ATOM   424 C CB  . VAL A 1 56  ? -2.331  40.620 12.708  1.00 52.73 ? 56   VAL A CB  1 
ATOM   425 C CG1 . VAL A 1 56  ? -3.253  39.898 13.666  1.00 52.83 ? 56   VAL A CG1 1 
ATOM   426 C CG2 . VAL A 1 56  ? -3.006  40.766 11.370  1.00 52.71 ? 56   VAL A CG2 1 
ATOM   427 N N   . GLU A 1 57  ? -2.569  42.221 15.582  1.00 54.89 ? 57   GLU A N   1 
ATOM   428 C CA  . GLU A 1 57  ? -2.430  42.149 17.041  1.00 55.23 ? 57   GLU A CA  1 
ATOM   429 C C   . GLU A 1 57  ? -2.248  40.712 17.475  1.00 55.42 ? 57   GLU A C   1 
ATOM   430 O O   . GLU A 1 57  ? -3.014  39.846 17.076  1.00 54.97 ? 57   GLU A O   1 
ATOM   431 C CB  . GLU A 1 57  ? -3.670  42.738 17.706  1.00 55.75 ? 57   GLU A CB  1 
ATOM   432 C CG  . GLU A 1 57  ? -3.737  42.590 19.225  1.00 56.91 ? 57   GLU A CG  1 
ATOM   433 C CD  . GLU A 1 57  ? -2.560  43.225 19.949  1.00 59.92 ? 57   GLU A CD  1 
ATOM   434 O OE1 . GLU A 1 57  ? -2.216  44.391 19.641  1.00 61.08 ? 57   GLU A OE1 1 
ATOM   435 O OE2 . GLU A 1 57  ? -1.991  42.550 20.838  1.00 62.67 ? 57   GLU A OE2 1 
ATOM   436 N N   . GLN A 1 58  ? -1.235  40.477 18.306  1.00 56.31 ? 58   GLN A N   1 
ATOM   437 C CA  . GLN A 1 58  ? -0.865  39.121 18.732  1.00 57.03 ? 58   GLN A CA  1 
ATOM   438 C C   . GLN A 1 58  ? -1.720  38.494 19.850  1.00 57.54 ? 58   GLN A C   1 
ATOM   439 O O   . GLN A 1 58  ? -1.802  37.258 19.952  1.00 58.08 ? 58   GLN A O   1 
ATOM   440 C CB  . GLN A 1 58  ? 0.619   39.061 19.104  1.00 57.34 ? 58   GLN A CB  1 
ATOM   441 C CG  . GLN A 1 58  ? 1.013   39.828 20.351  1.00 58.82 ? 58   GLN A CG  1 
ATOM   442 C CD  . GLN A 1 58  ? 0.639   39.099 21.610  1.00 61.14 ? 58   GLN A CD  1 
ATOM   443 O OE1 . GLN A 1 58  ? -0.051  39.649 22.460  1.00 63.31 ? 58   GLN A OE1 1 
ATOM   444 N NE2 . GLN A 1 58  ? 1.052   37.837 21.722  1.00 62.28 ? 58   GLN A NE2 1 
ATOM   445 N N   . SER A 1 59  ? -2.361  39.321 20.675  1.00 57.81 ? 59   SER A N   1 
ATOM   446 C CA  . SER A 1 59  ? -3.167  38.809 21.804  1.00 57.94 ? 59   SER A CA  1 
ATOM   447 C C   . SER A 1 59  ? -4.474  38.146 21.341  1.00 58.21 ? 59   SER A C   1 
ATOM   448 O O   . SER A 1 59  ? -5.222  37.597 22.147  1.00 58.22 ? 59   SER A O   1 
ATOM   449 C CB  . SER A 1 59  ? -3.478  39.941 22.779  1.00 58.01 ? 59   SER A CB  1 
ATOM   450 O OG  . SER A 1 59  ? -4.006  41.056 22.074  1.00 58.21 ? 59   SER A OG  1 
ATOM   451 N N   . GLN A 1 60  ? -4.753  38.226 20.043  1.00 58.30 ? 60   GLN A N   1 
ATOM   452 C CA  . GLN A 1 60  ? -5.960  37.645 19.468  1.00 58.09 ? 60   GLN A CA  1 
ATOM   453 C C   . GLN A 1 60  ? -5.592  36.876 18.208  1.00 57.81 ? 60   GLN A C   1 
ATOM   454 O O   . GLN A 1 60  ? -4.541  37.124 17.593  1.00 58.16 ? 60   GLN A O   1 
ATOM   455 C CB  . GLN A 1 60  ? -6.992  38.738 19.136  1.00 58.74 ? 60   GLN A CB  1 
ATOM   456 C CG  . GLN A 1 60  ? -7.539  39.511 20.349  1.00 60.86 ? 60   GLN A CG  1 
ATOM   457 C CD  . GLN A 1 60  ? -8.288  38.619 21.367  1.00 64.54 ? 60   GLN A CD  1 
ATOM   458 O OE1 . GLN A 1 60  ? -8.854  37.566 21.020  1.00 65.70 ? 60   GLN A OE1 1 
ATOM   459 N NE2 . GLN A 1 60  ? -8.283  39.045 22.631  1.00 65.13 ? 60   GLN A NE2 1 
ATOM   460 N N   . ASN A 1 61  ? -6.455  35.931 17.837  1.00 56.96 ? 61   ASN A N   1 
ATOM   461 C CA  . ASN A 1 61  ? -6.245  35.114 16.642  1.00 55.91 ? 61   ASN A CA  1 
ATOM   462 C C   . ASN A 1 61  ? -6.087  35.943 15.391  1.00 55.09 ? 61   ASN A C   1 
ATOM   463 O O   . ASN A 1 61  ? -6.682  37.016 15.249  1.00 54.52 ? 61   ASN A O   1 
ATOM   464 C CB  . ASN A 1 61  ? -7.395  34.131 16.427  1.00 55.73 ? 61   ASN A CB  1 
ATOM   465 C CG  . ASN A 1 61  ? -7.368  32.977 17.400  1.00 55.29 ? 61   ASN A CG  1 
ATOM   466 O OD1 . ASN A 1 61  ? -6.490  32.900 18.266  1.00 54.52 ? 61   ASN A OD1 1 
ATOM   467 N ND2 . ASN A 1 61  ? -8.332  32.057 17.259  1.00 55.36 ? 61   ASN A ND2 1 
ATOM   468 N N   . LEU A 1 62  ? -5.253  35.417 14.501  1.00 54.76 ? 62   LEU A N   1 
ATOM   469 C CA  . LEU A 1 62  ? -5.063  35.960 13.172  1.00 54.12 ? 62   LEU A CA  1 
ATOM   470 C C   . LEU A 1 62  ? -6.217  35.438 12.361  1.00 53.34 ? 62   LEU A C   1 
ATOM   471 O O   . LEU A 1 62  ? -6.323  34.240 12.157  1.00 52.90 ? 62   LEU A O   1 
ATOM   472 C CB  . LEU A 1 62  ? -3.764  35.453 12.573  1.00 54.40 ? 62   LEU A CB  1 
ATOM   473 C CG  . LEU A 1 62  ? -3.139  36.306 11.470  1.00 55.67 ? 62   LEU A CG  1 
ATOM   474 C CD1 . LEU A 1 62  ? -1.881  35.626 11.036  1.00 57.49 ? 62   LEU A CD1 1 
ATOM   475 C CD2 . LEU A 1 62  ? -4.010  36.492 10.282  1.00 57.31 ? 62   LEU A CD2 1 
ATOM   476 N N   . ARG A 1 63  ? -7.082  36.352 11.930  1.00 52.58 ? 63   ARG A N   1 
ATOM   477 C CA  . ARG A 1 63  ? -8.211  36.042 11.074  1.00 51.83 ? 63   ARG A CA  1 
ATOM   478 C C   . ARG A 1 63  ? -8.231  37.051 9.933   1.00 51.20 ? 63   ARG A C   1 
ATOM   479 O O   . ARG A 1 63  ? -8.537  38.223 10.151  1.00 50.72 ? 63   ARG A O   1 
ATOM   480 C CB  . ARG A 1 63  ? -9.492  36.161 11.869  1.00 51.69 ? 63   ARG A CB  1 
ATOM   481 C CG  . ARG A 1 63  ? -9.534  35.290 13.124  1.00 51.39 ? 63   ARG A CG  1 
ATOM   482 C CD  . ARG A 1 63  ? -10.908 35.403 13.761  1.00 51.54 ? 63   ARG A CD  1 
ATOM   483 N NE  . ARG A 1 63  ? -11.024 34.722 15.046  1.00 51.14 ? 63   ARG A NE  1 
ATOM   484 C CZ  . ARG A 1 63  ? -10.709 35.255 16.217  1.00 52.54 ? 63   ARG A CZ  1 
ATOM   485 N NH1 . ARG A 1 63  ? -10.214 36.484 16.309  1.00 54.21 ? 63   ARG A NH1 1 
ATOM   486 N NH2 . ARG A 1 63  ? -10.863 34.543 17.312  1.00 53.98 ? 63   ARG A NH2 1 
ATOM   487 N N   . VAL A 1 64  ? -7.881  36.600 8.731   1.00 50.62 ? 64   VAL A N   1 
ATOM   488 C CA  . VAL A 1 64  ? -7.897  37.458 7.545   1.00 50.92 ? 64   VAL A CA  1 
ATOM   489 C C   . VAL A 1 64  ? -8.331  36.709 6.286   1.00 50.54 ? 64   VAL A C   1 
ATOM   490 O O   . VAL A 1 64  ? -8.132  35.500 6.153   1.00 51.00 ? 64   VAL A O   1 
ATOM   491 C CB  . VAL A 1 64  ? -6.498  38.142 7.245   1.00 51.07 ? 64   VAL A CB  1 
ATOM   492 C CG1 . VAL A 1 64  ? -5.943  38.840 8.471   1.00 51.69 ? 64   VAL A CG1 1 
ATOM   493 C CG2 . VAL A 1 64  ? -5.469  37.132 6.697   1.00 52.62 ? 64   VAL A CG2 1 
ATOM   494 N N   . ILE A 1 65  ? -8.935  37.446 5.363   1.00 50.23 ? 65   ILE A N   1 
ATOM   495 C CA  . ILE A 1 65  ? -9.238  36.934 4.043   1.00 49.84 ? 65   ILE A CA  1 
ATOM   496 C C   . ILE A 1 65  ? -8.924  38.039 3.043   1.00 49.33 ? 65   ILE A C   1 
ATOM   497 O O   . ILE A 1 65  ? -9.196  39.198 3.293   1.00 48.89 ? 65   ILE A O   1 
ATOM   498 C CB  . ILE A 1 65  ? -10.718 36.478 3.918   1.00 49.64 ? 65   ILE A CB  1 
ATOM   499 C CG1 . ILE A 1 65  ? -11.032 35.384 4.931   1.00 49.23 ? 65   ILE A CG1 1 
ATOM   500 C CG2 . ILE A 1 65  ? -10.999 35.938 2.501   1.00 50.53 ? 65   ILE A CG2 1 
ATOM   501 C CD1 . ILE A 1 65  ? -12.502 35.047 5.032   1.00 49.59 ? 65   ILE A CD1 1 
ATOM   502 N N   . ALA A 1 66  ? -8.299  37.673 1.937   1.00 49.63 ? 66   ALA A N   1 
ATOM   503 C CA  . ALA A 1 66  ? -8.158  38.553 0.797   1.00 50.08 ? 66   ALA A CA  1 
ATOM   504 C C   . ALA A 1 66  ? -9.279  38.124 -0.134  1.00 50.60 ? 66   ALA A C   1 
ATOM   505 O O   . ALA A 1 66  ? -9.188  37.110 -0.824  1.00 51.48 ? 66   ALA A O   1 
ATOM   506 C CB  . ALA A 1 66  ? -6.814  38.380 0.151   1.00 49.60 ? 66   ALA A CB  1 
ATOM   507 N N   . ARG A 1 67  ? -10.364 38.877 -0.129  1.00 50.88 ? 67   ARG A N   1 
ATOM   508 C CA  . ARG A 1 67  ? -11.573 38.419 -0.771  1.00 51.26 ? 67   ARG A CA  1 
ATOM   509 C C   . ARG A 1 67  ? -11.784 39.024 -2.156  1.00 50.30 ? 67   ARG A C   1 
ATOM   510 O O   . ARG A 1 67  ? -11.792 40.238 -2.318  1.00 49.81 ? 67   ARG A O   1 
ATOM   511 C CB  . ARG A 1 67  ? -12.756 38.692 0.130   1.00 51.43 ? 67   ARG A CB  1 
ATOM   512 C CG  . ARG A 1 67  ? -13.953 37.898 -0.273  1.00 53.72 ? 67   ARG A CG  1 
ATOM   513 C CD  . ARG A 1 67  ? -14.972 37.855 0.817   1.00 55.41 ? 67   ARG A CD  1 
ATOM   514 N NE  . ARG A 1 67  ? -16.214 37.303 0.297   1.00 59.96 ? 67   ARG A NE  1 
ATOM   515 C CZ  . ARG A 1 67  ? -17.269 37.000 1.050   1.00 62.45 ? 67   ARG A CZ  1 
ATOM   516 N NH1 . ARG A 1 67  ? -17.223 37.195 2.376   1.00 61.82 ? 67   ARG A NH1 1 
ATOM   517 N NH2 . ARG A 1 67  ? -18.365 36.497 0.465   1.00 62.47 ? 67   ARG A NH2 1 
ATOM   518 N N   . LEU A 1 68  ? -11.922 38.147 -3.149  1.00 49.90 ? 68   LEU A N   1 
ATOM   519 C CA  . LEU A 1 68  ? -12.289 38.533 -4.487  1.00 50.42 ? 68   LEU A CA  1 
ATOM   520 C C   . LEU A 1 68  ? -13.786 38.257 -4.666  1.00 50.73 ? 68   LEU A C   1 
ATOM   521 O O   . LEU A 1 68  ? -14.228 37.115 -4.528  1.00 50.38 ? 68   LEU A O   1 
ATOM   522 C CB  . LEU A 1 68  ? -11.464 37.749 -5.490  1.00 49.73 ? 68   LEU A CB  1 
ATOM   523 C CG  . LEU A 1 68  ? -11.579 38.170 -6.947  1.00 49.96 ? 68   LEU A CG  1 
ATOM   524 C CD1 . LEU A 1 68  ? -11.094 39.607 -7.227  1.00 49.58 ? 68   LEU A CD1 1 
ATOM   525 C CD2 . LEU A 1 68  ? -10.801 37.165 -7.764  1.00 50.50 ? 68   LEU A CD2 1 
ATOM   526 N N   . TYR A 1 69  ? -14.561 39.315 -4.943  1.00 51.78 ? 69   TYR A N   1 
ATOM   527 C CA  . TYR A 1 69  ? -16.029 39.221 -5.058  1.00 52.23 ? 69   TYR A CA  1 
ATOM   528 C C   . TYR A 1 69  ? -16.431 38.991 -6.501  1.00 52.83 ? 69   TYR A C   1 
ATOM   529 O O   . TYR A 1 69  ? -17.182 38.068 -6.796  1.00 53.70 ? 69   TYR A O   1 
ATOM   530 C CB  . TYR A 1 69  ? -16.719 40.488 -4.548  1.00 52.60 ? 69   TYR A CB  1 
ATOM   531 C CG  . TYR A 1 69  ? -16.890 40.564 -3.045  1.00 52.89 ? 69   TYR A CG  1 
ATOM   532 C CD1 . TYR A 1 69  ? -16.004 41.289 -2.254  1.00 53.85 ? 69   TYR A CD1 1 
ATOM   533 C CD2 . TYR A 1 69  ? -17.945 39.924 -2.414  1.00 53.62 ? 69   TYR A CD2 1 
ATOM   534 C CE1 . TYR A 1 69  ? -16.167 41.369 -0.867  1.00 53.58 ? 69   TYR A CE1 1 
ATOM   535 C CE2 . TYR A 1 69  ? -18.117 39.991 -1.030  1.00 52.91 ? 69   TYR A CE2 1 
ATOM   536 C CZ  . TYR A 1 69  ? -17.234 40.714 -0.262  1.00 53.45 ? 69   TYR A CZ  1 
ATOM   537 O OH  . TYR A 1 69  ? -17.408 40.776 1.112   1.00 53.08 ? 69   TYR A OH  1 
ATOM   538 N N   . SER A 1 70  ? -15.932 39.817 -7.414  1.00 52.97 ? 70   SER A N   1 
ATOM   539 C CA  . SER A 1 70  ? -16.345 39.708 -8.815  1.00 53.10 ? 70   SER A CA  1 
ATOM   540 C C   . SER A 1 70  ? -15.359 40.363 -9.742  1.00 52.70 ? 70   SER A C   1 
ATOM   541 O O   . SER A 1 70  ? -14.645 41.265 -9.358  1.00 52.12 ? 70   SER A O   1 
ATOM   542 C CB  . SER A 1 70  ? -17.737 40.329 -9.015  1.00 53.64 ? 70   SER A CB  1 
ATOM   543 O OG  . SER A 1 70  ? -17.839 41.609 -8.379  1.00 54.56 ? 70   SER A OG  1 
ATOM   544 N N   . VAL A 1 71  ? -15.315 39.875 -10.965 1.00 53.09 ? 71   VAL A N   1 
ATOM   545 C CA  . VAL A 1 71  ? -14.426 40.407 -11.976 1.00 53.86 ? 71   VAL A CA  1 
ATOM   546 C C   . VAL A 1 71  ? -15.256 40.614 -13.216 1.00 54.53 ? 71   VAL A C   1 
ATOM   547 O O   . VAL A 1 71  ? -15.902 39.688 -13.706 1.00 55.07 ? 71   VAL A O   1 
ATOM   548 C CB  . VAL A 1 71  ? -13.278 39.437 -12.331 1.00 53.57 ? 71   VAL A CB  1 
ATOM   549 C CG1 . VAL A 1 71  ? -12.335 40.088 -13.315 1.00 53.38 ? 71   VAL A CG1 1 
ATOM   550 C CG2 . VAL A 1 71  ? -12.505 39.012 -11.091 1.00 53.52 ? 71   VAL A CG2 1 
ATOM   551 N N   . SER A 1 72  ? -15.233 41.836 -13.718 1.00 55.27 ? 72   SER A N   1 
ATOM   552 C CA  . SER A 1 72  ? -15.944 42.189 -14.915 1.00 55.80 ? 72   SER A CA  1 
ATOM   553 C C   . SER A 1 72  ? -14.892 42.538 -15.919 1.00 56.28 ? 72   SER A C   1 
ATOM   554 O O   . SER A 1 72  ? -13.716 42.563 -15.578 1.00 56.68 ? 72   SER A O   1 
ATOM   555 C CB  . SER A 1 72  ? -16.818 43.406 -14.646 1.00 56.03 ? 72   SER A CB  1 
ATOM   556 O OG  . SER A 1 72  ? -16.030 44.586 -14.671 1.00 57.56 ? 72   SER A OG  1 
ATOM   557 N N   . PRO A 1 73  ? -15.289 42.799 -17.169 1.00 56.92 ? 73   PRO A N   1 
ATOM   558 C CA  . PRO A 1 73  ? -14.258 43.235 -18.118 1.00 56.94 ? 73   PRO A CA  1 
ATOM   559 C C   . PRO A 1 73  ? -13.629 44.615 -17.797 1.00 57.08 ? 73   PRO A C   1 
ATOM   560 O O   . PRO A 1 73  ? -12.497 44.898 -18.232 1.00 57.34 ? 73   PRO A O   1 
ATOM   561 C CB  . PRO A 1 73  ? -14.991 43.245 -19.481 1.00 57.48 ? 73   PRO A CB  1 
ATOM   562 C CG  . PRO A 1 73  ? -16.299 42.521 -19.257 1.00 57.72 ? 73   PRO A CG  1 
ATOM   563 C CD  . PRO A 1 73  ? -16.619 42.660 -17.792 1.00 57.13 ? 73   PRO A CD  1 
ATOM   564 N N   . THR A 1 74  ? -14.327 45.443 -17.027 1.00 56.65 ? 74   THR A N   1 
ATOM   565 C CA  . THR A 1 74  ? -13.827 46.769 -16.696 1.00 56.51 ? 74   THR A CA  1 
ATOM   566 C C   . THR A 1 74  ? -13.158 46.920 -15.310 1.00 56.52 ? 74   THR A C   1 
ATOM   567 O O   . THR A 1 74  ? -12.465 47.920 -15.056 1.00 57.39 ? 74   THR A O   1 
ATOM   568 C CB  . THR A 1 74  ? -14.962 47.779 -16.807 1.00 56.66 ? 74   THR A CB  1 
ATOM   569 O OG1 . THR A 1 74  ? -16.102 47.305 -16.076 1.00 57.98 ? 74   THR A OG1 1 
ATOM   570 C CG2 . THR A 1 74  ? -15.341 47.961 -18.264 1.00 56.71 ? 74   THR A CG2 1 
ATOM   571 N N   . GLY A 1 75  ? -13.341 45.958 -14.413 1.00 55.70 ? 75   GLY A N   1 
ATOM   572 C CA  . GLY A 1 75  ? -12.793 46.096 -13.063 1.00 54.84 ? 75   GLY A CA  1 
ATOM   573 C C   . GLY A 1 75  ? -13.108 44.912 -12.185 1.00 54.28 ? 75   GLY A C   1 
ATOM   574 O O   . GLY A 1 75  ? -13.564 43.883 -12.662 1.00 54.41 ? 75   GLY A O   1 
ATOM   575 N N   . PHE A 1 76  ? -12.880 45.051 -10.886 1.00 53.74 ? 76   PHE A N   1 
ATOM   576 C CA  . PHE A 1 76  ? -13.222 43.994 -9.961  1.00 53.05 ? 76   PHE A CA  1 
ATOM   577 C C   . PHE A 1 76  ? -13.483 44.541 -8.591  1.00 52.79 ? 76   PHE A C   1 
ATOM   578 O O   . PHE A 1 76  ? -13.130 45.675 -8.273  1.00 52.78 ? 76   PHE A O   1 
ATOM   579 C CB  . PHE A 1 76  ? -12.113 42.928 -9.913  1.00 53.12 ? 76   PHE A CB  1 
ATOM   580 C CG  . PHE A 1 76  ? -10.799 43.416 -9.370  1.00 51.99 ? 76   PHE A CG  1 
ATOM   581 C CD1 . PHE A 1 76  ? -10.483 43.246 -8.032  1.00 52.44 ? 76   PHE A CD1 1 
ATOM   582 C CD2 . PHE A 1 76  ? -9.880  44.023 -10.195 1.00 52.59 ? 76   PHE A CD2 1 
ATOM   583 C CE1 . PHE A 1 76  ? -9.276  43.678 -7.524  1.00 53.24 ? 76   PHE A CE1 1 
ATOM   584 C CE2 . PHE A 1 76  ? -8.656  44.466 -9.701  1.00 53.82 ? 76   PHE A CE2 1 
ATOM   585 C CZ  . PHE A 1 76  ? -8.353  44.290 -8.358  1.00 53.50 ? 76   PHE A CZ  1 
ATOM   586 N N   . LYS A 1 77  ? -14.109 43.715 -7.778  1.00 52.78 ? 77   LYS A N   1 
ATOM   587 C CA  . LYS A 1 77  ? -14.375 44.050 -6.402  1.00 52.73 ? 77   LYS A CA  1 
ATOM   588 C C   . LYS A 1 77  ? -13.635 43.063 -5.504  1.00 52.16 ? 77   LYS A C   1 
ATOM   589 O O   . LYS A 1 77  ? -13.763 41.844 -5.655  1.00 51.96 ? 77   LYS A O   1 
ATOM   590 C CB  . LYS A 1 77  ? -15.870 44.007 -6.125  1.00 52.75 ? 77   LYS A CB  1 
ATOM   591 C CG  . LYS A 1 77  ? -16.233 44.403 -4.699  1.00 54.12 ? 77   LYS A CG  1 
ATOM   592 C CD  . LYS A 1 77  ? -17.743 44.415 -4.489  1.00 54.76 ? 77   LYS A CD  1 
ATOM   593 C CE  . LYS A 1 77  ? -18.118 44.227 -3.018  1.00 56.55 ? 77   LYS A CE  1 
ATOM   594 N NZ  . LYS A 1 77  ? -19.604 44.041 -2.884  1.00 57.33 ? 77   LYS A NZ  1 
ATOM   595 N N   . ALA A 1 78  ? -12.846 43.604 -4.583  1.00 51.64 ? 78   ALA A N   1 
ATOM   596 C CA  . ALA A 1 78  ? -12.060 42.798 -3.671  1.00 51.48 ? 78   ALA A CA  1 
ATOM   597 C C   . ALA A 1 78  ? -12.030 43.490 -2.334  1.00 50.98 ? 78   ALA A C   1 
ATOM   598 O O   . ALA A 1 78  ? -12.321 44.675 -2.268  1.00 51.31 ? 78   ALA A O   1 
ATOM   599 C CB  . ALA A 1 78  ? -10.675 42.621 -4.210  1.00 51.47 ? 78   ALA A CB  1 
ATOM   600 N N   . SER A 1 79  ? -11.701 42.768 -1.270  1.00 50.66 ? 79   SER A N   1 
ATOM   601 C CA  . SER A 1 79  ? -11.655 43.380 0.060   1.00 51.02 ? 79   SER A CA  1 
ATOM   602 C C   . SER A 1 79  ? -10.646 42.777 1.038   1.00 51.00 ? 79   SER A C   1 
ATOM   603 O O   . SER A 1 79  ? -10.328 41.608 0.951   1.00 50.41 ? 79   SER A O   1 
ATOM   604 C CB  . SER A 1 79  ? -13.050 43.324 0.696   1.00 50.98 ? 79   SER A CB  1 
ATOM   605 O OG  . SER A 1 79  ? -13.310 42.077 1.310   1.00 49.83 ? 79   SER A OG  1 
ATOM   606 N N   . CYS A 1 80  ? -10.154 43.588 1.976   1.00 51.65 ? 80   CYS A N   1 
ATOM   607 C CA  . CYS A 1 80  ? -9.515  43.063 3.178   1.00 52.27 ? 80   CYS A CA  1 
ATOM   608 C C   . CYS A 1 80  ? -10.658 42.748 4.092   1.00 52.28 ? 80   CYS A C   1 
ATOM   609 O O   . CYS A 1 80  ? -11.499 43.598 4.327   1.00 52.44 ? 80   CYS A O   1 
ATOM   610 C CB  . CYS A 1 80  ? -8.606  44.080 3.853   1.00 52.55 ? 80   CYS A CB  1 
ATOM   611 S SG  . CYS A 1 80  ? -7.115  44.487 2.907   1.00 58.07 ? 80   CYS A SG  1 
ATOM   612 N N   . TYR A 1 81  ? -10.689 41.531 4.610   1.00 52.69 ? 81   TYR A N   1 
ATOM   613 C CA  . TYR A 1 81  ? -11.803 41.046 5.393   1.00 52.30 ? 81   TYR A CA  1 
ATOM   614 C C   . TYR A 1 81  ? -11.268 40.416 6.668   1.00 51.97 ? 81   TYR A C   1 
ATOM   615 O O   . TYR A 1 81  ? -10.299 39.651 6.639   1.00 51.81 ? 81   TYR A O   1 
ATOM   616 C CB  . TYR A 1 81  ? -12.552 40.027 4.555   1.00 52.95 ? 81   TYR A CB  1 
ATOM   617 C CG  . TYR A 1 81  ? -13.883 39.541 5.086   1.00 53.56 ? 81   TYR A CG  1 
ATOM   618 C CD1 . TYR A 1 81  ? -15.069 40.090 4.610   1.00 55.01 ? 81   TYR A CD1 1 
ATOM   619 C CD2 . TYR A 1 81  ? -13.965 38.488 6.014   1.00 54.05 ? 81   TYR A CD2 1 
ATOM   620 C CE1 . TYR A 1 81  ? -16.302 39.639 5.066   1.00 54.63 ? 81   TYR A CE1 1 
ATOM   621 C CE2 . TYR A 1 81  ? -15.188 38.026 6.469   1.00 53.69 ? 81   TYR A CE2 1 
ATOM   622 C CZ  . TYR A 1 81  ? -16.352 38.607 5.990   1.00 55.11 ? 81   TYR A CZ  1 
ATOM   623 O OH  . TYR A 1 81  ? -17.598 38.175 6.404   1.00 56.17 ? 81   TYR A OH  1 
ATOM   624 N N   . THR A 1 82  ? -11.890 40.766 7.791   1.00 52.17 ? 82   THR A N   1 
ATOM   625 C CA  . THR A 1 82  ? -11.601 40.149 9.101   1.00 52.19 ? 82   THR A CA  1 
ATOM   626 C C   . THR A 1 82  ? -12.897 39.902 9.908   1.00 51.25 ? 82   THR A C   1 
ATOM   627 O O   . THR A 1 82  ? -13.970 40.287 9.485   1.00 50.39 ? 82   THR A O   1 
ATOM   628 C CB  . THR A 1 82  ? -10.568 40.998 9.904   1.00 52.41 ? 82   THR A CB  1 
ATOM   629 O OG1 . THR A 1 82  ? -10.082 40.240 11.015  1.00 54.04 ? 82   THR A OG1 1 
ATOM   630 C CG2 . THR A 1 82  ? -11.180 42.294 10.404  1.00 52.94 ? 82   THR A CG2 1 
ATOM   631 N N   . TRP A 1 83  ? -12.795 39.223 11.039  1.00 51.14 ? 83   TRP A N   1 
ATOM   632 C CA  . TRP A 1 83  ? -13.978 38.953 11.850  1.00 51.95 ? 83   TRP A CA  1 
ATOM   633 C C   . TRP A 1 83  ? -13.633 38.644 13.309  1.00 52.25 ? 83   TRP A C   1 
ATOM   634 O O   . TRP A 1 83  ? -12.463 38.577 13.680  1.00 52.62 ? 83   TRP A O   1 
ATOM   635 C CB  . TRP A 1 83  ? -14.838 37.829 11.232  1.00 51.73 ? 83   TRP A CB  1 
ATOM   636 C CG  . TRP A 1 83  ? -14.210 36.466 11.227  1.00 51.97 ? 83   TRP A CG  1 
ATOM   637 C CD1 . TRP A 1 83  ? -14.445 35.452 12.110  1.00 52.46 ? 83   TRP A CD1 1 
ATOM   638 C CD2 . TRP A 1 83  ? -13.251 35.962 10.281  1.00 52.63 ? 83   TRP A CD2 1 
ATOM   639 N NE1 . TRP A 1 83  ? -13.700 34.340 11.771  1.00 52.33 ? 83   TRP A NE1 1 
ATOM   640 C CE2 . TRP A 1 83  ? -12.952 34.631 10.657  1.00 53.02 ? 83   TRP A CE2 1 
ATOM   641 C CE3 . TRP A 1 83  ? -12.621 36.503 9.145   1.00 52.37 ? 83   TRP A CE3 1 
ATOM   642 C CZ2 . TRP A 1 83  ? -12.038 33.841 9.947   1.00 51.78 ? 83   TRP A CZ2 1 
ATOM   643 C CZ3 . TRP A 1 83  ? -11.718 35.719 8.445   1.00 52.05 ? 83   TRP A CZ3 1 
ATOM   644 C CH2 . TRP A 1 83  ? -11.442 34.402 8.842   1.00 52.16 ? 83   TRP A CH2 1 
ATOM   645 N N   . HIS A 1 84  ? -14.666 38.477 14.129  1.00 52.77 ? 84   HIS A N   1 
ATOM   646 C CA  . HIS A 1 84  ? -14.523 38.318 15.578  1.00 53.17 ? 84   HIS A CA  1 
ATOM   647 C C   . HIS A 1 84  ? -13.631 39.423 16.193  1.00 52.99 ? 84   HIS A C   1 
ATOM   648 O O   . HIS A 1 84  ? -13.770 40.578 15.826  1.00 52.46 ? 84   HIS A O   1 
ATOM   649 C CB  . HIS A 1 84  ? -14.063 36.891 15.915  1.00 53.57 ? 84   HIS A CB  1 
ATOM   650 C CG  . HIS A 1 84  ? -14.522 36.414 17.264  1.00 55.21 ? 84   HIS A CG  1 
ATOM   651 N ND1 . HIS A 1 84  ? -15.846 36.448 17.656  1.00 55.81 ? 84   HIS A ND1 1 
ATOM   652 C CD2 . HIS A 1 84  ? -13.836 35.869 18.302  1.00 56.28 ? 84   HIS A CD2 1 
ATOM   653 C CE1 . HIS A 1 84  ? -15.950 35.972 18.886  1.00 56.70 ? 84   HIS A CE1 1 
ATOM   654 N NE2 . HIS A 1 84  ? -14.745 35.609 19.299  1.00 55.71 ? 84   HIS A NE2 1 
ATOM   655 N N   . ASN A 1 85  ? -12.743 39.101 17.124  1.00 53.06 ? 85   ASN A N   1 
ATOM   656 C CA  . ASN A 1 85  ? -11.964 40.146 17.795  1.00 53.52 ? 85   ASN A CA  1 
ATOM   657 C C   . ASN A 1 85  ? -10.527 40.260 17.278  1.00 53.72 ? 85   ASN A C   1 
ATOM   658 O O   . ASN A 1 85  ? -9.616  40.606 18.039  1.00 54.64 ? 85   ASN A O   1 
ATOM   659 C CB  . ASN A 1 85  ? -11.942 39.874 19.296  1.00 53.89 ? 85   ASN A CB  1 
ATOM   660 C CG  . ASN A 1 85  ? -11.361 38.531 19.612  1.00 55.00 ? 85   ASN A CG  1 
ATOM   661 O OD1 . ASN A 1 85  ? -10.722 37.924 18.759  1.00 58.11 ? 85   ASN A OD1 1 
ATOM   662 N ND2 . ASN A 1 85  ? -11.593 38.039 20.823  1.00 56.01 ? 85   ASN A ND2 1 
ATOM   663 N N   . THR A 1 86  ? -10.316 39.940 16.001  1.00 53.37 ? 86   THR A N   1 
ATOM   664 C CA  . THR A 1 86  ? -9.027  40.139 15.360  1.00 52.76 ? 86   THR A CA  1 
ATOM   665 C C   . THR A 1 86  ? -8.820  41.638 15.224  1.00 52.39 ? 86   THR A C   1 
ATOM   666 O O   . THR A 1 86  ? -9.764  42.370 14.909  1.00 52.16 ? 86   THR A O   1 
ATOM   667 C CB  . THR A 1 86  ? -8.988  39.488 13.964  1.00 52.83 ? 86   THR A CB  1 
ATOM   668 O OG1 . THR A 1 86  ? -8.881  38.076 14.118  1.00 54.78 ? 86   THR A OG1 1 
ATOM   669 C CG2 . THR A 1 86  ? -7.791  39.963 13.140  1.00 52.46 ? 86   THR A CG2 1 
ATOM   670 N N   . LYS A 1 87  ? -7.586  42.082 15.455  1.00 51.48 ? 87   LYS A N   1 
ATOM   671 C CA  . LYS A 1 87  ? -7.218  43.472 15.273  1.00 51.29 ? 87   LYS A CA  1 
ATOM   672 C C   . LYS A 1 87  ? -6.125  43.582 14.225  1.00 50.85 ? 87   LYS A C   1 
ATOM   673 O O   . LYS A 1 87  ? -5.002  43.134 14.474  1.00 50.48 ? 87   LYS A O   1 
ATOM   674 C CB  . LYS A 1 87  ? -6.707  44.054 16.601  1.00 51.25 ? 87   LYS A CB  1 
ATOM   675 C CG  . LYS A 1 87  ? -6.042  45.420 16.489  1.00 51.06 ? 87   LYS A CG  1 
ATOM   676 C CD  . LYS A 1 87  ? -7.081  46.488 16.108  1.00 51.96 ? 87   LYS A CD  1 
ATOM   677 C CE  . LYS A 1 87  ? -6.449  47.767 15.549  1.00 51.69 ? 87   LYS A CE  1 
ATOM   678 N NZ  . LYS A 1 87  ? -7.472  48.568 14.841  1.00 49.99 ? 87   LYS A NZ  1 
ATOM   679 N N   . VAL A 1 88  ? -6.423  44.181 13.072  1.00 50.37 ? 88   VAL A N   1 
ATOM   680 C CA  . VAL A 1 88  ? -5.349  44.426 12.104  1.00 50.39 ? 88   VAL A CA  1 
ATOM   681 C C   . VAL A 1 88  ? -4.985  45.907 12.030  1.00 49.88 ? 88   VAL A C   1 
ATOM   682 O O   . VAL A 1 88  ? -5.846  46.794 11.972  1.00 49.66 ? 88   VAL A O   1 
ATOM   683 C CB  . VAL A 1 88  ? -5.576  43.766 10.676  1.00 50.39 ? 88   VAL A CB  1 
ATOM   684 C CG1 . VAL A 1 88  ? -6.776  42.821 10.668  1.00 50.18 ? 88   VAL A CG1 1 
ATOM   685 C CG2 . VAL A 1 88  ? -5.667  44.794 9.568   1.00 50.07 ? 88   VAL A CG2 1 
ATOM   686 N N   . TYR A 1 89  ? -3.685  46.155 12.064  1.00 49.84 ? 89   TYR A N   1 
ATOM   687 C CA  . TYR A 1 89  ? -3.160  47.512 12.000  1.00 50.03 ? 89   TYR A CA  1 
ATOM   688 C C   . TYR A 1 89  ? -2.927  47.912 10.565  1.00 49.74 ? 89   TYR A C   1 
ATOM   689 O O   . TYR A 1 89  ? -3.089  49.088 10.220  1.00 49.45 ? 89   TYR A O   1 
ATOM   690 C CB  . TYR A 1 89  ? -1.880  47.646 12.833  1.00 50.45 ? 89   TYR A CB  1 
ATOM   691 C CG  . TYR A 1 89  ? -2.121  47.307 14.278  1.00 51.19 ? 89   TYR A CG  1 
ATOM   692 C CD1 . TYR A 1 89  ? -1.788  46.045 14.780  1.00 52.17 ? 89   TYR A CD1 1 
ATOM   693 C CD2 . TYR A 1 89  ? -2.725  48.216 15.135  1.00 51.61 ? 89   TYR A CD2 1 
ATOM   694 C CE1 . TYR A 1 89  ? -2.007  45.710 16.087  1.00 51.18 ? 89   TYR A CE1 1 
ATOM   695 C CE2 . TYR A 1 89  ? -2.954  47.884 16.459  1.00 51.82 ? 89   TYR A CE2 1 
ATOM   696 C CZ  . TYR A 1 89  ? -2.599  46.623 16.924  1.00 51.95 ? 89   TYR A CZ  1 
ATOM   697 O OH  . TYR A 1 89  ? -2.846  46.264 18.231  1.00 52.17 ? 89   TYR A OH  1 
ATOM   698 N N   . SER A 1 90  ? -2.545  46.941 9.733   1.00 49.67 ? 90   SER A N   1 
ATOM   699 C CA  . SER A 1 90  ? -2.522  47.147 8.285   1.00 49.80 ? 90   SER A CA  1 
ATOM   700 C C   . SER A 1 90  ? -2.536  45.847 7.486   1.00 49.58 ? 90   SER A C   1 
ATOM   701 O O   . SER A 1 90  ? -2.178  44.774 7.969   1.00 49.90 ? 90   SER A O   1 
ATOM   702 C CB  . SER A 1 90  ? -1.343  48.029 7.851   1.00 49.70 ? 90   SER A CB  1 
ATOM   703 O OG  . SER A 1 90  ? -0.100  47.404 8.051   1.00 50.35 ? 90   SER A OG  1 
ATOM   704 N N   . MET A 1 91  ? -2.975  45.965 6.252   1.00 49.35 ? 91   MET A N   1 
ATOM   705 C CA  . MET A 1 91  ? -3.063  44.828 5.379   1.00 49.59 ? 91   MET A CA  1 
ATOM   706 C C   . MET A 1 91  ? -3.075  45.348 3.949   1.00 49.38 ? 91   MET A C   1 
ATOM   707 O O   . MET A 1 91  ? -3.829  46.257 3.629   1.00 49.83 ? 91   MET A O   1 
ATOM   708 C CB  . MET A 1 91  ? -4.352  44.050 5.681   1.00 49.89 ? 91   MET A CB  1 
ATOM   709 C CG  . MET A 1 91  ? -4.639  42.927 4.712   1.00 49.94 ? 91   MET A CG  1 
ATOM   710 S SD  . MET A 1 91  ? -6.017  41.862 5.217   1.00 49.81 ? 91   MET A SD  1 
ATOM   711 C CE  . MET A 1 91  ? -5.949  40.646 3.909   1.00 49.32 ? 91   MET A CE  1 
ATOM   712 N N   . SER A 1 92  ? -2.235  44.786 3.095   1.00 49.13 ? 92   SER A N   1 
ATOM   713 C CA  . SER A 1 92  ? -2.240  45.162 1.689   1.00 49.14 ? 92   SER A CA  1 
ATOM   714 C C   . SER A 1 92  ? -2.319  43.944 0.815   1.00 49.09 ? 92   SER A C   1 
ATOM   715 O O   . SER A 1 92  ? -1.804  42.885 1.152   1.00 49.73 ? 92   SER A O   1 
ATOM   716 C CB  . SER A 1 92  ? -1.015  46.000 1.313   1.00 48.79 ? 92   SER A CB  1 
ATOM   717 O OG  . SER A 1 92  ? -0.843  47.041 2.252   1.00 49.07 ? 92   SER A OG  1 
ATOM   718 N N   . ILE A 1 93  ? -2.969  44.120 -0.319  1.00 49.32 ? 93   ILE A N   1 
ATOM   719 C CA  . ILE A 1 93  ? -3.262  43.040 -1.207  1.00 49.56 ? 93   ILE A CA  1 
ATOM   720 C C   . ILE A 1 93  ? -2.773  43.452 -2.564  1.00 49.66 ? 93   ILE A C   1 
ATOM   721 O O   . ILE A 1 93  ? -3.201  44.468 -3.101  1.00 49.57 ? 93   ILE A O   1 
ATOM   722 C CB  . ILE A 1 93  ? -4.783  42.769 -1.298  1.00 49.52 ? 93   ILE A CB  1 
ATOM   723 C CG1 . ILE A 1 93  ? -5.334  42.283 0.042   1.00 49.03 ? 93   ILE A CG1 1 
ATOM   724 C CG2 . ILE A 1 93  ? -5.057  41.726 -2.374  1.00 49.78 ? 93   ILE A CG2 1 
ATOM   725 C CD1 . ILE A 1 93  ? -6.856  42.365 0.128   1.00 49.33 ? 93   ILE A CD1 1 
ATOM   726 N N   . SER A 1 94  ? -1.874  42.659 -3.114  1.00 50.11 ? 94   SER A N   1 
ATOM   727 C CA  . SER A 1 94  ? -1.420  42.872 -4.481  1.00 50.30 ? 94   SER A CA  1 
ATOM   728 C C   . SER A 1 94  ? -2.252  42.026 -5.406  1.00 50.45 ? 94   SER A C   1 
ATOM   729 O O   . SER A 1 94  ? -2.748  40.971 -5.015  1.00 50.03 ? 94   SER A O   1 
ATOM   730 C CB  . SER A 1 94  ? 0.043   42.494 -4.620  1.00 50.21 ? 94   SER A CB  1 
ATOM   731 O OG  . SER A 1 94  ? 0.816   43.240 -3.707  1.00 49.23 ? 94   SER A OG  1 
ATOM   732 N N   . TRP A 1 95  ? -2.391  42.482 -6.638  1.00 51.05 ? 95   TRP A N   1 
ATOM   733 C CA  . TRP A 1 95  ? -3.196  41.758 -7.593  1.00 51.93 ? 95   TRP A CA  1 
ATOM   734 C C   . TRP A 1 95  ? -2.646  41.877 -8.976  1.00 53.32 ? 95   TRP A C   1 
ATOM   735 O O   . TRP A 1 95  ? -1.912  42.800 -9.289  1.00 53.48 ? 95   TRP A O   1 
ATOM   736 C CB  . TRP A 1 95  ? -4.642  42.264 -7.578  1.00 51.56 ? 95   TRP A CB  1 
ATOM   737 C CG  . TRP A 1 95  ? -4.794  43.742 -7.925  1.00 50.96 ? 95   TRP A CG  1 
ATOM   738 C CD1 . TRP A 1 95  ? -4.826  44.792 -7.056  1.00 50.33 ? 95   TRP A CD1 1 
ATOM   739 C CD2 . TRP A 1 95  ? -4.951  44.305 -9.230  1.00 51.55 ? 95   TRP A CD2 1 
ATOM   740 N NE1 . TRP A 1 95  ? -4.984  45.968 -7.739  1.00 50.14 ? 95   TRP A NE1 1 
ATOM   741 C CE2 . TRP A 1 95  ? -5.064  45.697 -9.074  1.00 50.27 ? 95   TRP A CE2 1 
ATOM   742 C CE3 . TRP A 1 95  ? -5.015  43.761 -10.524 1.00 51.55 ? 95   TRP A CE3 1 
ATOM   743 C CZ2 . TRP A 1 95  ? -5.230  46.552 -10.151 1.00 51.17 ? 95   TRP A CZ2 1 
ATOM   744 C CZ3 . TRP A 1 95  ? -5.178  44.620 -11.596 1.00 50.87 ? 95   TRP A CZ3 1 
ATOM   745 C CH2 . TRP A 1 95  ? -5.283  45.996 -11.403 1.00 50.68 ? 95   TRP A CH2 1 
ATOM   746 N N   . ILE A 1 96  ? -3.029  40.910 -9.794  1.00 55.47 ? 96   ILE A N   1 
ATOM   747 C CA  . ILE A 1 96  ? -2.745  40.885 -11.222 1.00 57.04 ? 96   ILE A CA  1 
ATOM   748 C C   . ILE A 1 96  ? -4.025  40.519 -11.937 1.00 57.06 ? 96   ILE A C   1 
ATOM   749 O O   . ILE A 1 96  ? -4.863  39.809 -11.400 1.00 56.55 ? 96   ILE A O   1 
ATOM   750 C CB  . ILE A 1 96  ? -1.679  39.829 -11.608 1.00 57.18 ? 96   ILE A CB  1 
ATOM   751 C CG1 . ILE A 1 96  ? -1.813  38.593 -10.715 1.00 57.73 ? 96   ILE A CG1 1 
ATOM   752 C CG2 . ILE A 1 96  ? -0.269  40.426 -11.518 1.00 58.66 ? 96   ILE A CG2 1 
ATOM   753 C CD1 . ILE A 1 96  ? -0.921  37.450 -11.116 1.00 58.25 ? 96   ILE A CD1 1 
ATOM   754 N N   . SER A 1 97  ? -4.163  41.060 -13.136 1.00 58.26 ? 97   SER A N   1 
ATOM   755 C CA  . SER A 1 97  ? -5.241  40.735 -14.037 1.00 59.22 ? 97   SER A CA  1 
ATOM   756 C C   . SER A 1 97  ? -4.601  40.290 -15.337 1.00 60.06 ? 97   SER A C   1 
ATOM   757 O O   . SER A 1 97  ? -3.634  40.884 -15.799 1.00 59.69 ? 97   SER A O   1 
ATOM   758 C CB  . SER A 1 97  ? -6.127  41.953 -14.272 1.00 59.18 ? 97   SER A CB  1 
ATOM   759 O OG  . SER A 1 97  ? -5.392  43.013 -14.859 1.00 59.46 ? 97   SER A OG  1 
ATOM   760 N N   . ILE A 1 98  ? -5.124  39.212 -15.901 1.00 61.61 ? 98   ILE A N   1 
ATOM   761 C CA  . ILE A 1 98  ? -4.578  38.644 -17.114 1.00 62.52 ? 98   ILE A CA  1 
ATOM   762 C C   . ILE A 1 98  ? -5.722  38.353 -18.062 1.00 63.52 ? 98   ILE A C   1 
ATOM   763 O O   . ILE A 1 98  ? -6.701  37.688 -17.678 1.00 63.69 ? 98   ILE A O   1 
ATOM   764 C CB  . ILE A 1 98  ? -3.812  37.327 -16.831 1.00 62.58 ? 98   ILE A CB  1 
ATOM   765 C CG1 . ILE A 1 98  ? -2.764  37.536 -15.732 1.00 62.90 ? 98   ILE A CG1 1 
ATOM   766 C CG2 . ILE A 1 98  ? -3.141  36.826 -18.116 1.00 62.13 ? 98   ILE A CG2 1 
ATOM   767 C CD1 . ILE A 1 98  ? -2.132  36.260 -15.209 1.00 63.08 ? 98   ILE A CD1 1 
ATOM   768 N N   . GLU A 1 99  ? -5.607  38.873 -19.287 1.00 64.74 ? 99   GLU A N   1 
ATOM   769 C CA  . GLU A 1 99  ? -6.507  38.494 -20.381 1.00 65.63 ? 99   GLU A CA  1 
ATOM   770 C C   . GLU A 1 99  ? -6.481  36.973 -20.542 1.00 66.47 ? 99   GLU A C   1 
ATOM   771 O O   . GLU A 1 99  ? -5.411  36.367 -20.697 1.00 66.48 ? 99   GLU A O   1 
ATOM   772 C CB  . GLU A 1 99  ? -6.103  39.165 -21.697 1.00 65.67 ? 99   GLU A CB  1 
ATOM   773 N N   . ASN A 1 100 ? -7.660  36.368 -20.467 1.00 67.59 ? 100  ASN A N   1 
ATOM   774 C CA  . ASN A 1 100 ? -7.793  34.935 -20.625 1.00 68.08 ? 100  ASN A CA  1 
ATOM   775 C C   . ASN A 1 100 ? -8.162  34.584 -22.061 1.00 68.71 ? 100  ASN A C   1 
ATOM   776 O O   . ASN A 1 100 ? -7.334  34.030 -22.787 1.00 70.04 ? 100  ASN A O   1 
ATOM   777 C CB  . ASN A 1 100 ? -8.853  34.392 -19.669 1.00 68.73 ? 100  ASN A CB  1 
ATOM   778 C CG  . ASN A 1 100 ? -8.752  32.892 -19.490 1.00 69.18 ? 100  ASN A CG  1 
ATOM   779 O OD1 . ASN A 1 100 ? -7.860  32.242 -20.064 1.00 70.66 ? 100  ASN A OD1 1 
ATOM   780 N ND2 . ASN A 1 100 ? -9.665  32.327 -18.688 1.00 71.82 ? 100  ASN A ND2 1 
HETATM 781 O O   . HOH B 2 .   ? -4.887  48.703 -14.024 1.00 57.06 ? 2001 HOH A O   1 
HETATM 782 O O   . HOH B 2 .   ? 0.769   46.762 -14.840 1.00 63.10 ? 2002 HOH A O   1 
HETATM 783 O O   . HOH B 2 .   ? 3.578   45.029 -0.257  1.00 53.34 ? 2003 HOH A O   1 
HETATM 784 O O   . HOH B 2 .   ? -2.099  50.206 -7.394  1.00 50.98 ? 2004 HOH A O   1 
HETATM 785 O O   . HOH B 2 .   ? -5.219  51.466 -2.316  1.00 54.64 ? 2005 HOH A O   1 
HETATM 786 O O   . HOH B 2 .   ? -15.448 33.313 2.355   1.00 64.30 ? 2006 HOH A O   1 
HETATM 787 O O   . HOH B 2 .   ? -13.952 31.009 8.763   1.00 58.40 ? 2007 HOH A O   1 
HETATM 788 O O   . HOH B 2 .   ? -16.616 34.294 14.689  1.00 46.36 ? 2008 HOH A O   1 
HETATM 789 O O   . HOH B 2 .   ? -19.727 43.320 0.618   1.00 64.82 ? 2009 HOH A O   1 
HETATM 790 O O   . HOH B 2 .   ? -8.794  53.290 -0.003  0.50 65.47 ? 2010 HOH A O   1 
HETATM 791 O O   . HOH B 2 .   ? -13.881 51.650 -4.101  1.00 47.11 ? 2011 HOH A O   1 
HETATM 792 O O   . HOH B 2 .   ? -7.139  45.325 -22.832 1.00 76.62 ? 2012 HOH A O   1 
HETATM 793 O O   . HOH B 2 .   ? -11.541 34.635 -18.232 1.00 65.73 ? 2013 HOH A O   1 
HETATM 794 O O   . HOH B 2 .   ? -11.152 35.858 -12.067 1.00 50.59 ? 2014 HOH A O   1 
HETATM 795 O O   . HOH B 2 .   ? -8.554  33.968 -8.115  1.00 55.17 ? 2015 HOH A O   1 
HETATM 796 O O   . HOH B 2 .   ? -7.546  35.572 -6.101  1.00 48.77 ? 2016 HOH A O   1 
HETATM 797 O O   . HOH B 2 .   ? -0.019  35.625 0.096   0.33 29.83 ? 2017 HOH A O   1 
HETATM 798 O O   . HOH B 2 .   ? 2.769   46.826 1.294   1.00 59.59 ? 2018 HOH A O   1 
HETATM 799 O O   . HOH B 2 .   ? 1.241   48.783 10.152  1.00 46.41 ? 2019 HOH A O   1 
HETATM 800 O O   . HOH B 2 .   ? -0.020  35.593 20.589  0.33 30.98 ? 2020 HOH A O   1 
HETATM 801 O O   . HOH B 2 .   ? -2.379  36.390 16.213  1.00 44.77 ? 2021 HOH A O   1 
HETATM 802 O O   . HOH B 2 .   ? -10.834 31.337 16.197  1.00 60.34 ? 2022 HOH A O   1 
HETATM 803 O O   . HOH B 2 .   ? -10.518 34.988 -2.506  1.00 46.13 ? 2023 HOH A O   1 
HETATM 804 O O   . HOH B 2 .   ? -20.563 42.345 -4.620  1.00 63.06 ? 2024 HOH A O   1 
HETATM 805 O O   . HOH B 2 .   ? -4.871  49.051 -7.231  1.00 58.31 ? 2025 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   1   1   ARG ARG A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLY 5   5   5   GLY GLY A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   CYS 9   9   9   CYS CYS A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  TRP 15  15  15  TRP TRP A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  ASP 22  22  22  ASP ASP A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  ARG 25  25  25  ARG ARG A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  THR 28  28  28  THR THR A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  TYR 41  41  41  TYR TYR A . n 
A 1 42  CYS 42  42  42  CYS CYS A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  PRO 45  45  45  PRO PRO A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  SER 50  50  50  SER SER A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  THR 52  52  52  THR THR A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  GLU 57  57  57  GLU GLU A . n 
A 1 58  GLN 58  58  58  GLN GLN A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ARG 63  63  63  ARG ARG A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  TYR 69  69  69  TYR TYR A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  THR 74  74  74  THR THR A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  CYS 80  80  80  CYS CYS A . n 
A 1 81  TYR 81  81  81  TYR TYR A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  TRP 83  83  83  TRP TRP A . n 
A 1 84  HIS 84  84  84  HIS HIS A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  TRP 95  95  95  TRP TRP A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  SER 97  97  97  SER SER A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 TYR 101 101 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  2001 2001 HOH HOH A . 
B 2 HOH 2  2002 2002 HOH HOH A . 
B 2 HOH 3  2003 2003 HOH HOH A . 
B 2 HOH 4  2004 2004 HOH HOH A . 
B 2 HOH 5  2005 2005 HOH HOH A . 
B 2 HOH 6  2006 2006 HOH HOH A . 
B 2 HOH 7  2007 2007 HOH HOH A . 
B 2 HOH 8  2008 2008 HOH HOH A . 
B 2 HOH 9  2009 2009 HOH HOH A . 
B 2 HOH 10 2010 2010 HOH HOH A . 
B 2 HOH 11 2011 2011 HOH HOH A . 
B 2 HOH 12 2012 2012 HOH HOH A . 
B 2 HOH 13 2013 2013 HOH HOH A . 
B 2 HOH 14 2014 2014 HOH HOH A . 
B 2 HOH 15 2015 2015 HOH HOH A . 
B 2 HOH 16 2016 2016 HOH HOH A . 
B 2 HOH 17 2017 2017 HOH HOH A . 
B 2 HOH 18 2018 2018 HOH HOH A . 
B 2 HOH 19 2019 2019 HOH HOH A . 
B 2 HOH 20 2020 2020 HOH HOH A . 
B 2 HOH 21 2021 2021 HOH HOH A . 
B 2 HOH 22 2022 2022 HOH HOH A . 
B 2 HOH 23 2023 2023 HOH HOH A . 
B 2 HOH 24 2024 2024 HOH HOH A . 
B 2 HOH 25 2025 2025 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4,5,6 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 3_565  -x+y,-x+1,z      -0.5000000000 0.8660254038  0.0000000000 -30.8000000000 -0.8660254038 
-0.5000000000 0.0000000000 53.3471648731 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
3 'crystal symmetry operation' 2_665  -y+1,x-y+1,z     -0.5000000000 -0.8660254038 0.0000000000 30.8000000000  0.8660254038  
-0.5000000000 0.0000000000 53.3471648731 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
4 'crystal symmetry operation' 10_664 -y+1,-x+1,-z-1/2 0.5000000000  -0.8660254038 0.0000000000 30.8000000000  -0.8660254038 
-0.5000000000 0.0000000000 53.3471648731 0.0000000000 0.0000000000 -1.0000000000 -52.5000000000 
5 'crystal symmetry operation' 12_564 x,x-y+1,-z-1/2   0.5000000000  0.8660254038  0.0000000000 -30.8000000000 0.8660254038  
-0.5000000000 0.0000000000 53.3471648731 0.0000000000 0.0000000000 -1.0000000000 -52.5000000000 
6 'crystal symmetry operation' 11_554 -x+y,y,-z-1/2    -1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 -52.5000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 2010 ? B HOH . 
2 1 A HOH 2017 ? B HOH . 
3 1 A HOH 2020 ? B HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-05-15 
2 'Structure model' 1 1 2011-05-08 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Experimental preparation'  
5 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_PDB_rev        
2 4 'Structure model' database_PDB_rev_record 
3 4 'Structure model' exptl_crystal_grow      
4 4 'Structure model' pdbx_database_proc      
5 4 'Structure model' pdbx_database_status    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_exptl_crystal_grow.method'                  
2 4 'Structure model' '_pdbx_database_status.recvd_author_approval' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0005 ? 1 
MOSFLM 'data reduction' .        ? 2 
SCALA  'data scaling'   .        ? 3 
MOLREP phasing          .        ? 4 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
650 
;
HELIX
DETERMINATION METHOD: AUTHOR PROVIDED.
;
700 
;
SHEET
DETERMINATION METHOD: AUTHOR PROVIDED.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 44 ? ? -38.78 121.74  
2 1 HIS A 84 ? ? 50.28  -138.28 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A GLU 99 ? CG  ? A GLU 99 CG  
2 1 Y 1 A GLU 99 ? CD  ? A GLU 99 CD  
3 1 Y 1 A GLU 99 ? OE1 ? A GLU 99 OE1 
4 1 Y 1 A GLU 99 ? OE2 ? A GLU 99 OE2 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     TYR 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      101 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    TYR 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     101 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#