data_2CGA
# 
_entry.id   2CGA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CGA         
WWPDB D_1000177912 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CGA 
_pdbx_database_status.recvd_initial_deposition_date   1987-01-16 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, D.'  1 
'Bode, W.'  2 
'Huber, R.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Bovine chymotrypsinogen A X-ray crystal structure analysis and refinement of a new crystal form at 1.8 A resolution.' 
J.Mol.Biol.  185 595  624 1985 JMOBAK UK 0022-2836 0070 ? 4057257 '10.1016/0022-2836(85)90074-9' 
1       
;The Transition of Bovine Trypsinogen to a Trypsin-Like State Upon Strong Ligand Binding. II. The Binding of the Pancreatic Trypsin Inhibitor and of Isoleucine-Valine and of Sequentially Related Peptides to Trypsinogen and to P-Guanidinobenzoate-Trypsinogen
;
J.Mol.Biol.  127 357  ?   1979 JMOBAK UK 0022-2836 0070 ? ?       ?                              
2       
;Crystal Structure of Bovine Trypsinogen at 1.8 Angstroms Resolution. II. Crystallographic Refinement, Refined Crystal Structure and Comparison with Bovine Trypsin
;
J.Mol.Biol.  111 415  ?   1977 JMOBAK UK 0022-2836 0070 ? ?       ?                              
3       
;Crystal Structure of Bovine Trypsinogen at 1.8 Angstroms Resolution. I. Data Collection, Application of Patterson Search Techniques and Preliminary Structural Interpretation
;
J.Mol.Biol.  106 325  ?   1976 JMOBAK UK 0022-2836 0070 ? ?       ?                              
4       
'Chymotrypsinogen. 2.5-Angstroms Crystal Structure, Comparison with Alpha-Chymotrypsin, and Implications for Zymogen Activation' 
Biochemistry 9   1997 ?   1970 BICHAW US 0006-2960 0033 ? ?       ?                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wang, D.'       1  
primary 'Bode, W.'       2  
primary 'Huber, R.'      3  
1       'Bode, W.'       4  
2       'Fehlhammer, H.' 5  
2       'Bode, W.'       6  
2       'Huber, R.'      7  
3       'Bode, W.'       8  
3       'Fehlhammer, H.' 9  
3       'Huber, R.'      10 
4       'Freer, S.T.'    11 
4       'Kraut, J.'      12 
4       'Robertus, J.D.' 13 
4       'Wright, H.T.'   14 
4       'Xuong, N.H.'    15 
# 
_cell.entry_id           2CGA 
_cell.length_a           59.300 
_cell.length_b           77.100 
_cell.length_c           110.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2CGA 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CHYMOTRYPSINOGEN A' 25686.037 2   ? ? ? ? 
2 water   nat water                18.015    329 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKI
QKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASL
PLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKI
QKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASL
PLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   GLY n 
1 3   VAL n 
1 4   PRO n 
1 5   ALA n 
1 6   ILE n 
1 7   GLN n 
1 8   PRO n 
1 9   VAL n 
1 10  LEU n 
1 11  SER n 
1 12  GLY n 
1 13  LEU n 
1 14  SER n 
1 15  ARG n 
1 16  ILE n 
1 17  VAL n 
1 18  ASN n 
1 19  GLY n 
1 20  GLU n 
1 21  GLU n 
1 22  ALA n 
1 23  VAL n 
1 24  PRO n 
1 25  GLY n 
1 26  SER n 
1 27  TRP n 
1 28  PRO n 
1 29  TRP n 
1 30  GLN n 
1 31  VAL n 
1 32  SER n 
1 33  LEU n 
1 34  GLN n 
1 35  ASP n 
1 36  LYS n 
1 37  THR n 
1 38  GLY n 
1 39  PHE n 
1 40  HIS n 
1 41  PHE n 
1 42  CYS n 
1 43  GLY n 
1 44  GLY n 
1 45  SER n 
1 46  LEU n 
1 47  ILE n 
1 48  ASN n 
1 49  GLU n 
1 50  ASN n 
1 51  TRP n 
1 52  VAL n 
1 53  VAL n 
1 54  THR n 
1 55  ALA n 
1 56  ALA n 
1 57  HIS n 
1 58  CYS n 
1 59  GLY n 
1 60  VAL n 
1 61  THR n 
1 62  THR n 
1 63  SER n 
1 64  ASP n 
1 65  VAL n 
1 66  VAL n 
1 67  VAL n 
1 68  ALA n 
1 69  GLY n 
1 70  GLU n 
1 71  PHE n 
1 72  ASP n 
1 73  GLN n 
1 74  GLY n 
1 75  SER n 
1 76  SER n 
1 77  SER n 
1 78  GLU n 
1 79  LYS n 
1 80  ILE n 
1 81  GLN n 
1 82  LYS n 
1 83  LEU n 
1 84  LYS n 
1 85  ILE n 
1 86  ALA n 
1 87  LYS n 
1 88  VAL n 
1 89  PHE n 
1 90  LYS n 
1 91  ASN n 
1 92  SER n 
1 93  LYS n 
1 94  TYR n 
1 95  ASN n 
1 96  SER n 
1 97  LEU n 
1 98  THR n 
1 99  ILE n 
1 100 ASN n 
1 101 ASN n 
1 102 ASP n 
1 103 ILE n 
1 104 THR n 
1 105 LEU n 
1 106 LEU n 
1 107 LYS n 
1 108 LEU n 
1 109 SER n 
1 110 THR n 
1 111 ALA n 
1 112 ALA n 
1 113 SER n 
1 114 PHE n 
1 115 SER n 
1 116 GLN n 
1 117 THR n 
1 118 VAL n 
1 119 SER n 
1 120 ALA n 
1 121 VAL n 
1 122 CYS n 
1 123 LEU n 
1 124 PRO n 
1 125 SER n 
1 126 ALA n 
1 127 SER n 
1 128 ASP n 
1 129 ASP n 
1 130 PHE n 
1 131 ALA n 
1 132 ALA n 
1 133 GLY n 
1 134 THR n 
1 135 THR n 
1 136 CYS n 
1 137 VAL n 
1 138 THR n 
1 139 THR n 
1 140 GLY n 
1 141 TRP n 
1 142 GLY n 
1 143 LEU n 
1 144 THR n 
1 145 ARG n 
1 146 TYR n 
1 147 THR n 
1 148 ASN n 
1 149 ALA n 
1 150 ASN n 
1 151 THR n 
1 152 PRO n 
1 153 ASP n 
1 154 ARG n 
1 155 LEU n 
1 156 GLN n 
1 157 GLN n 
1 158 ALA n 
1 159 SER n 
1 160 LEU n 
1 161 PRO n 
1 162 LEU n 
1 163 LEU n 
1 164 SER n 
1 165 ASN n 
1 166 THR n 
1 167 ASN n 
1 168 CYS n 
1 169 LYS n 
1 170 LYS n 
1 171 TYR n 
1 172 TRP n 
1 173 GLY n 
1 174 THR n 
1 175 LYS n 
1 176 ILE n 
1 177 LYS n 
1 178 ASP n 
1 179 ALA n 
1 180 MET n 
1 181 ILE n 
1 182 CYS n 
1 183 ALA n 
1 184 GLY n 
1 185 ALA n 
1 186 SER n 
1 187 GLY n 
1 188 VAL n 
1 189 SER n 
1 190 SER n 
1 191 CYS n 
1 192 MET n 
1 193 GLY n 
1 194 ASP n 
1 195 SER n 
1 196 GLY n 
1 197 GLY n 
1 198 PRO n 
1 199 LEU n 
1 200 VAL n 
1 201 CYS n 
1 202 LYS n 
1 203 LYS n 
1 204 ASN n 
1 205 GLY n 
1 206 ALA n 
1 207 TRP n 
1 208 THR n 
1 209 LEU n 
1 210 VAL n 
1 211 GLY n 
1 212 ILE n 
1 213 VAL n 
1 214 SER n 
1 215 TRP n 
1 216 GLY n 
1 217 SER n 
1 218 SER n 
1 219 THR n 
1 220 CYS n 
1 221 SER n 
1 222 THR n 
1 223 SER n 
1 224 THR n 
1 225 PRO n 
1 226 GLY n 
1 227 VAL n 
1 228 TYR n 
1 229 ALA n 
1 230 ARG n 
1 231 VAL n 
1 232 THR n 
1 233 ALA n 
1 234 LEU n 
1 235 VAL n 
1 236 ASN n 
1 237 TRP n 
1 238 VAL n 
1 239 GLN n 
1 240 GLN n 
1 241 THR n 
1 242 LEU n 
1 243 ALA n 
1 244 ALA n 
1 245 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               cattle 
_entity_src_gen.gene_src_genus                     Bos 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9913 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CTRA_BOVIN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00766 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGVTTSDVVVAGEFDQGSSSEKI
QKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSAVCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASL
PLLSNTNCKKYWGTKIKDAMICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2CGA A 1 ? 245 ? P00766 1 ? 245 ? 1 245 
2 1 2CGA B 1 ? 245 ? P00766 1 ? 245 ? 1 245 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2CGA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.77 
_exptl_crystal.description           ? 
# 
_refine.entry_id                                 2CGA 
_refine.ls_number_reflns_obs                     30617 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.173 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3598 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             329 
_refine_hist.number_atoms_total               3927 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d                0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg             2.5   ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
o_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   .987700 
_struct_ncs_oper.matrix[1][2]   .155000 
_struct_ncs_oper.matrix[1][3]   .017700 
_struct_ncs_oper.matrix[2][1]   .022800 
_struct_ncs_oper.matrix[2][2]   -.031400 
_struct_ncs_oper.matrix[2][3]   -.999200 
_struct_ncs_oper.matrix[3][1]   -.154300 
_struct_ncs_oper.matrix[3][2]   .987400 
_struct_ncs_oper.matrix[3][3]   -.034600 
_struct_ncs_oper.vector[1]      6.21700 
_struct_ncs_oper.vector[2]      115.61600 
_struct_ncs_oper.vector[3]      -3.74800 
# 
_struct.entry_id                  2CGA 
_struct.title                     
'BOVINE CHYMOTRYPSINOGEN A. X-RAY CRYSTAL STRUCTURE ANALYSIS AND REFINEMENT OF A NEW CRYSTAL FORM AT 1.8 ANGSTROMS RESOLUTION' 
_struct.pdbx_descriptor           'CHYMOTRYPSINOGEN A' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CGA 
_struct_keywords.pdbx_keywords   'HYDROLASE(ZYMOGEN)' 
_struct_keywords.text            'HYDROLASE(ZYMOGEN)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;THE TRANSFORMATION PRESENTED ON THE *MTRIX* RECORDS BELOW
WILL YIELD COORDINATES FOR CHAIN *A* WHEN APPLIED TO CHAIN
*B*.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 11  ? ILE A 16  ? SER A 11  ILE A 16  5 ? 6  
HELX_P HELX_P2  2  ALA A 55  ? GLY A 59  ? ALA A 55  GLY A 59  5 ? 5  
HELX_P HELX_P3  3  TRP A 141 ? TYR A 146 ? TRP A 141 TYR A 146 5 ? 6  
HELX_P HELX_P4  4  SER A 164 ? GLY A 173 ? SER A 164 GLY A 173 1 ? 10 
HELX_P HELX_P5  5  THR A 174 ? ILE A 176 ? THR A 174 ILE A 176 5 ? 3  
HELX_P HELX_P6  6  LEU A 234 ? ASN A 245 ? LEU A 234 ASN A 245 1 ? 12 
HELX_P HELX_P7  7  SER B 11  ? ILE B 16  ? SER B 11  ILE B 16  5 ? 6  
HELX_P HELX_P8  8  ALA B 55  ? GLY B 59  ? ALA B 55  GLY B 59  5 ? 5  
HELX_P HELX_P9  9  SER B 164 ? GLY B 173 ? SER B 164 GLY B 173 1 ? 10 
HELX_P HELX_P10 10 THR B 174 ? ILE B 176 ? THR B 174 ILE B 176 5 ? 3  
HELX_P HELX_P11 11 LEU B 234 ? ASN B 245 ? LEU B 234 ASN B 245 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 1   SG ? ? ? 1_555 A CYS 122 SG ? ? A CYS 1   A CYS 122 1_555 ? ? ? ? ? ? ? 1.999 ? 
disulf2  disulf ? ? A CYS 42  SG ? ? ? 1_555 A CYS 58  SG ? ? A CYS 42  A CYS 58  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf3  disulf ? ? A CYS 136 SG ? ? ? 1_555 A CYS 201 SG ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf4  disulf ? ? A CYS 168 SG ? ? ? 1_555 A CYS 182 SG ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf5  disulf ? ? A CYS 191 SG ? ? ? 1_555 A CYS 220 SG ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf6  disulf ? ? B CYS 1   SG ? ? ? 1_555 B CYS 122 SG ? ? B CYS 1   B CYS 122 1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf7  disulf ? ? B CYS 42  SG ? ? ? 1_555 B CYS 58  SG ? ? B CYS 42  B CYS 58  1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf8  disulf ? ? B CYS 136 SG ? ? ? 1_555 B CYS 201 SG ? ? B CYS 136 B CYS 201 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf9  disulf ? ? B CYS 168 SG ? ? ? 1_555 B CYS 182 SG ? ? B CYS 168 B CYS 182 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf10 disulf ? ? B CYS 191 SG ? ? ? 1_555 B CYS 220 SG ? ? B CYS 191 B CYS 220 1_555 ? ? ? ? ? ? ? 2.029 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 81  ? LEU A 83  ? GLN A 81  LEU A 83  
A 2 VAL A 65  ? ALA A 68  ? VAL A 65  ALA A 68  
A 3 GLN A 30  ? GLN A 34  ? GLN A 30  GLN A 34  
A 4 HIS A 40  ? ASN A 48  ? HIS A 40  ASN A 48  
A 5 TRP A 51  ? THR A 54  ? TRP A 51  THR A 54  
A 6 THR A 104 ? LEU A 108 ? THR A 104 LEU A 108 
A 7 ILE A 85  ? LYS A 90  ? ILE A 85  LYS A 90  
B 1 GLU B 20  ? GLU B 21  ? GLU B 20  GLU B 21  
B 2 GLN B 156 ? PRO B 161 ? GLN B 156 PRO B 161 
B 3 THR B 135 ? GLY B 140 ? THR B 135 GLY B 140 
B 4 PRO B 198 ? LYS B 203 ? PRO B 198 LYS B 203 
B 5 ALA B 206 ? TRP B 215 ? ALA B 206 TRP B 215 
B 6 PRO B 225 ? ARG B 230 ? PRO B 225 ARG B 230 
B 7 MET B 180 ? GLY B 184 ? MET B 180 GLY B 184 
C 1 GLN B 30  ? GLN B 34  ? GLN B 30  GLN B 34  
C 2 HIS B 40  ? ASN B 48  ? HIS B 40  ASN B 48  
C 3 TRP B 51  ? THR B 54  ? TRP B 51  THR B 54  
C 4 THR B 104 ? LEU B 108 ? THR B 104 LEU B 108 
C 5 GLN B 81  ? LYS B 90  ? GLN B 81  LYS B 90  
C 6 VAL B 65  ? ALA B 68  ? VAL B 65  ALA B 68  
C 7 GLN B 30  ? GLN B 34  ? GLN B 30  GLN B 34  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 83  ? N LEU A 83  O VAL A 66  ? O VAL A 66  
A 2 3 N VAL A 67  ? N VAL A 67  O SER A 32  ? O SER A 32  
A 3 4 O LEU A 33  ? O LEU A 33  N PHE A 41  ? N PHE A 41  
A 4 5 N ILE A 47  ? N ILE A 47  O TRP A 51  ? O TRP A 51  
A 5 6 O THR A 54  ? O THR A 54  N THR A 104 ? N THR A 104 
A 6 7 O LYS A 107 ? O LYS A 107 N ALA A 86  ? N ALA A 86  
B 1 2 O GLU B 20  ? O GLU B 20  N GLN B 157 ? N GLN B 157 
B 2 3 O LEU B 160 ? O LEU B 160 N CYS B 136 ? N CYS B 136 
B 3 4 N THR B 139 ? N THR B 139 O PRO B 198 ? O PRO B 198 
B 4 5 N LYS B 203 ? N LYS B 203 O ALA B 206 ? O ALA B 206 
B 5 6 O TRP B 215 ? O TRP B 215 N VAL B 227 ? N VAL B 227 
B 6 7 N TYR B 228 ? N TYR B 228 O ILE B 181 ? O ILE B 181 
C 1 2 O LEU B 33  ? O LEU B 33  N PHE B 41  ? N PHE B 41  
C 2 3 N ILE B 47  ? N ILE B 47  O TRP B 51  ? O TRP B 51  
C 3 4 N THR B 54  ? N THR B 54  O THR B 104 ? O THR B 104 
C 4 5 O LYS B 107 ? O LYS B 107 N ALA B 86  ? N ALA B 86  
C 5 6 N LEU B 83  ? N LEU B 83  O VAL B 66  ? O VAL B 66  
C 6 7 N VAL B 67  ? N VAL B 67  O SER B 32  ? O SER B 32  
# 
_database_PDB_matrix.entry_id          2CGA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CGA 
_atom_sites.fract_transf_matrix[1][1]   .016863 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   .012970 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   .009083 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_sites_footnote.id     1 
_atom_sites_footnote.text   'RESIDUES VAL A 17 AND VAL B 17 HAVE UNUSUAL MAIN CHAIN CONFORMATION.' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 1   ? -10.656 55.938 41.808 1.00 11.66 ? 1   CYS A N   1 
ATOM   2    C CA  . CYS A 1 1   ? -10.044 57.246 41.343 1.00 11.66 ? 1   CYS A CA  1 
ATOM   3    C C   . CYS A 1 1   ? -10.076 58.323 42.431 1.00 11.66 ? 1   CYS A C   1 
ATOM   4    O O   . CYS A 1 1   ? -10.772 58.097 43.448 1.00 11.66 ? 1   CYS A O   1 
ATOM   5    C CB  . CYS A 1 1   ? -10.807 57.718 40.066 1.00 11.66 ? 1   CYS A CB  1 
ATOM   6    S SG  . CYS A 1 1   ? -12.618 58.053 40.257 1.00 15.54 ? 1   CYS A SG  1 
ATOM   7    N N   . GLY A 1 2   ? -9.555  59.552 42.181 1.00 9.94  ? 2   GLY A N   1 
ATOM   8    C CA  . GLY A 1 2   ? -9.755  60.717 43.076 1.00 9.94  ? 2   GLY A CA  1 
ATOM   9    C C   . GLY A 1 2   ? -9.173  60.695 44.501 1.00 9.94  ? 2   GLY A C   1 
ATOM   10   O O   . GLY A 1 2   ? -9.518  61.569 45.349 1.00 9.94  ? 2   GLY A O   1 
ATOM   11   N N   . VAL A 1 3   ? -8.600  59.560 44.885 1.00 14.22 ? 3   VAL A N   1 
ATOM   12   C CA  . VAL A 1 3   ? -8.109  59.279 46.248 1.00 14.22 ? 3   VAL A CA  1 
ATOM   13   C C   . VAL A 1 3   ? -6.631  58.917 46.187 1.00 14.22 ? 3   VAL A C   1 
ATOM   14   O O   . VAL A 1 3   ? -6.281  57.697 46.045 1.00 14.22 ? 3   VAL A O   1 
ATOM   15   C CB  . VAL A 1 3   ? -8.814  58.083 46.909 1.00 14.22 ? 3   VAL A CB  1 
ATOM   16   C CG1 . VAL A 1 3   ? -8.347  57.832 48.346 1.00 8.27  ? 3   VAL A CG1 1 
ATOM   17   C CG2 . VAL A 1 3   ? -10.329 58.317 46.957 1.00 8.27  ? 3   VAL A CG2 1 
ATOM   18   N N   . PRO A 1 4   ? -5.813  59.912 46.427 1.00 13.61 ? 4   PRO A N   1 
ATOM   19   C CA  . PRO A 1 4   ? -4.350  59.727 46.453 1.00 13.61 ? 4   PRO A CA  1 
ATOM   20   C C   . PRO A 1 4   ? -3.839  58.950 47.674 1.00 13.61 ? 4   PRO A C   1 
ATOM   21   O O   . PRO A 1 4   ? -4.189  59.259 48.825 1.00 13.61 ? 4   PRO A O   1 
ATOM   22   C CB  . PRO A 1 4   ? -3.744  61.146 46.424 1.00 13.61 ? 4   PRO A CB  1 
ATOM   23   C CG  . PRO A 1 4   ? -4.921  62.136 46.452 1.00 11.11 ? 4   PRO A CG  1 
ATOM   24   C CD  . PRO A 1 4   ? -6.218  61.308 46.511 1.00 11.11 ? 4   PRO A CD  1 
ATOM   25   N N   . ALA A 1 5   ? -2.969  58.016 47.465 1.00 7.84  ? 5   ALA A N   1 
ATOM   26   C CA  . ALA A 1 5   ? -2.119  57.311 48.471 1.00 7.84  ? 5   ALA A CA  1 
ATOM   27   C C   . ALA A 1 5   ? -1.303  58.283 49.305 1.00 7.84  ? 5   ALA A C   1 
ATOM   28   O O   . ALA A 1 5   ? -1.071  58.030 50.505 1.00 7.84  ? 5   ALA A O   1 
ATOM   29   C CB  . ALA A 1 5   ? -1.028  56.503 47.774 1.00 7.84  ? 5   ALA A CB  1 
ATOM   30   N N   . ILE A 1 6   ? -0.899  59.338 48.700 1.00 18.04 ? 6   ILE A N   1 
ATOM   31   C CA  . ILE A 1 6   ? -0.106  60.387 49.403 1.00 18.04 ? 6   ILE A CA  1 
ATOM   32   C C   . ILE A 1 6   ? -0.867  61.701 49.539 1.00 18.04 ? 6   ILE A C   1 
ATOM   33   O O   . ILE A 1 6   ? -1.176  62.366 48.522 1.00 18.04 ? 6   ILE A O   1 
ATOM   34   C CB  . ILE A 1 6   ? 1.253   60.705 48.715 1.00 18.04 ? 6   ILE A CB  1 
ATOM   35   C CG1 . ILE A 1 6   ? 2.240   59.521 48.644 1.00 9.68  ? 6   ILE A CG1 1 
ATOM   36   C CG2 . ILE A 1 6   ? 1.907   61.881 49.464 1.00 9.68  ? 6   ILE A CG2 1 
ATOM   37   C CD1 . ILE A 1 6   ? 3.531   59.942 47.876 1.00 9.68  ? 6   ILE A CD1 1 
ATOM   38   N N   . GLN A 1 7   ? -1.412  61.893 50.703 1.00 15.92 ? 7   GLN A N   1 
ATOM   39   C CA  . GLN A 1 7   ? -2.395  62.920 51.020 1.00 15.92 ? 7   GLN A CA  1 
ATOM   40   C C   . GLN A 1 7   ? -1.906  64.357 50.817 1.00 15.92 ? 7   GLN A C   1 
ATOM   41   O O   . GLN A 1 7   ? -0.809  64.652 51.323 1.00 15.92 ? 7   GLN A O   1 
ATOM   42   C CB  . GLN A 1 7   ? -2.926  62.776 52.460 1.00 15.92 ? 7   GLN A CB  1 
ATOM   43   C CG  . GLN A 1 7   ? -2.234  61.657 53.267 1.00 0.00  ? 7   GLN A CG  1 
ATOM   44   C CD  . GLN A 1 7   ? -2.701  60.287 52.784 1.00 0.00  ? 7   GLN A CD  1 
ATOM   45   O OE1 . GLN A 1 7   ? -3.760  60.192 52.111 1.00 0.00  ? 7   GLN A OE1 1 
ATOM   46   N NE2 . GLN A 1 7   ? -1.802  59.326 52.879 1.00 0.00  ? 7   GLN A NE2 1 
ATOM   47   N N   . PRO A 1 8   ? -2.537  65.216 49.969 1.00 20.98 ? 8   PRO A N   1 
ATOM   48   C CA  . PRO A 1 8   ? -2.085  66.636 49.794 1.00 20.98 ? 8   PRO A CA  1 
ATOM   49   C C   . PRO A 1 8   ? -2.137  67.449 51.092 1.00 20.98 ? 8   PRO A C   1 
ATOM   50   O O   . PRO A 1 8   ? -3.142  67.343 51.867 1.00 20.98 ? 8   PRO A O   1 
ATOM   51   C CB  . PRO A 1 8   ? -2.970  67.323 48.738 1.00 20.98 ? 8   PRO A CB  1 
ATOM   52   C CG  . PRO A 1 8   ? -3.975  66.297 48.306 1.00 6.47  ? 8   PRO A CG  1 
ATOM   53   C CD  . PRO A 1 8   ? -3.681  64.948 49.059 1.00 6.47  ? 8   PRO A CD  1 
ATOM   54   N N   . VAL A 1 9   ? -1.109  68.281 51.292 1.00 16.19 ? 9   VAL A N   1 
ATOM   55   C CA  . VAL A 1 9   ? -1.147  69.302 52.381 1.00 16.19 ? 9   VAL A CA  1 
ATOM   56   C C   . VAL A 1 9   ? -1.344  70.727 51.819 1.00 16.19 ? 9   VAL A C   1 
ATOM   57   O O   . VAL A 1 9   ? -0.522  71.212 51.003 1.00 16.19 ? 9   VAL A O   1 
ATOM   58   C CB  . VAL A 1 9   ? 0.135   69.254 53.263 1.00 16.19 ? 9   VAL A CB  1 
ATOM   59   C CG1 . VAL A 1 9   ? 0.073   70.422 54.266 1.00 8.85  ? 9   VAL A CG1 1 
ATOM   60   C CG2 . VAL A 1 9   ? 0.303   67.880 53.936 1.00 8.85  ? 9   VAL A CG2 1 
ATOM   61   N N   . LEU A 1 10  ? -2.465  71.341 52.143 1.00 14.91 ? 10  LEU A N   1 
ATOM   62   C CA  . LEU A 1 10  ? -2.776  72.693 51.658 1.00 14.91 ? 10  LEU A CA  1 
ATOM   63   C C   . LEU A 1 10  ? -2.907  73.667 52.800 1.00 14.91 ? 10  LEU A C   1 
ATOM   64   O O   . LEU A 1 10  ? -3.814  73.513 53.652 1.00 14.91 ? 10  LEU A O   1 
ATOM   65   C CB  . LEU A 1 10  ? -4.094  72.767 50.898 1.00 14.91 ? 10  LEU A CB  1 
ATOM   66   C CG  . LEU A 1 10  ? -4.112  71.779 49.729 1.00 18.88 ? 10  LEU A CG  1 
ATOM   67   C CD1 . LEU A 1 10  ? -5.566  71.278 49.572 1.00 18.88 ? 10  LEU A CD1 1 
ATOM   68   C CD2 . LEU A 1 10  ? -3.639  72.494 48.443 1.00 18.88 ? 10  LEU A CD2 1 
ATOM   69   N N   . SER A 1 11  ? -1.956  74.584 52.866 1.00 23.22 ? 11  SER A N   1 
ATOM   70   C CA  . SER A 1 11  ? -1.948  75.626 53.890 1.00 23.22 ? 11  SER A CA  1 
ATOM   71   C C   . SER A 1 11  ? -2.397  76.989 53.327 1.00 23.22 ? 11  SER A C   1 
ATOM   72   O O   . SER A 1 11  ? -2.793  77.118 52.139 1.00 23.22 ? 11  SER A O   1 
ATOM   73   C CB  . SER A 1 11  ? -0.529  75.735 54.490 1.00 23.22 ? 11  SER A CB  1 
ATOM   74   O OG  . SER A 1 11  ? 0.287   76.473 53.599 1.00 10.73 ? 11  SER A OG  1 
ATOM   75   N N   . GLY A 1 12  ? -2.385  77.996 54.169 1.00 18.36 ? 12  GLY A N   1 
ATOM   76   C CA  . GLY A 1 12  ? -2.770  79.326 53.731 1.00 18.36 ? 12  GLY A CA  1 
ATOM   77   C C   . GLY A 1 12  ? -2.003  79.948 52.559 1.00 18.36 ? 12  GLY A C   1 
ATOM   78   O O   . GLY A 1 12  ? -2.566  80.786 51.826 1.00 18.36 ? 12  GLY A O   1 
ATOM   79   N N   . LEU A 1 13  ? -0.746  79.646 52.428 1.00 6.95  ? 13  LEU A N   1 
ATOM   80   C CA  . LEU A 1 13  ? 0.116   80.094 51.335 1.00 6.95  ? 13  LEU A CA  1 
ATOM   81   C C   . LEU A 1 13  ? -0.413  79.583 50.010 1.00 6.95  ? 13  LEU A C   1 
ATOM   82   O O   . LEU A 1 13  ? -0.005  80.113 48.962 1.00 6.95  ? 13  LEU A O   1 
ATOM   83   C CB  . LEU A 1 13  ? 1.543   79.587 51.537 1.00 6.95  ? 13  LEU A CB  1 
ATOM   84   C CG  . LEU A 1 13  ? 2.426   80.619 52.279 1.00 18.78 ? 13  LEU A CG  1 
ATOM   85   C CD1 . LEU A 1 13  ? 1.701   81.624 53.216 1.00 18.78 ? 13  LEU A CD1 1 
ATOM   86   C CD2 . LEU A 1 13  ? 3.719   80.033 52.849 1.00 18.78 ? 13  LEU A CD2 1 
ATOM   87   N N   . SER A 1 14  ? -1.274  78.580 50.007 1.00 18.11 ? 14  SER A N   1 
ATOM   88   C CA  . SER A 1 14  ? -1.846  78.216 48.717 1.00 18.11 ? 14  SER A CA  1 
ATOM   89   C C   . SER A 1 14  ? -2.876  79.256 48.256 1.00 18.11 ? 14  SER A C   1 
ATOM   90   O O   . SER A 1 14  ? -3.350  79.212 47.085 1.00 18.11 ? 14  SER A O   1 
ATOM   91   C CB  . SER A 1 14  ? -2.533  76.835 48.746 1.00 18.11 ? 14  SER A CB  1 
ATOM   92   O OG  . SER A 1 14  ? -3.759  76.905 49.468 1.00 17.91 ? 14  SER A OG  1 
ATOM   93   N N   . ARG A 1 15  ? -3.229  80.114 49.227 1.00 18.64 ? 15  ARG A N   1 
ATOM   94   C CA  . ARG A 1 15  ? -4.253  81.133 49.062 1.00 18.64 ? 15  ARG A CA  1 
ATOM   95   C C   . ARG A 1 15  ? -3.750  82.536 48.686 1.00 18.64 ? 15  ARG A C   1 
ATOM   96   O O   . ARG A 1 15  ? -4.568  83.410 48.332 1.00 18.64 ? 15  ARG A O   1 
ATOM   97   C CB  . ARG A 1 15  ? -5.202  81.182 50.282 1.00 18.64 ? 15  ARG A CB  1 
ATOM   98   C CG  . ARG A 1 15  ? -6.219  80.041 50.288 1.00 24.84 ? 15  ARG A CG  1 
ATOM   99   C CD  . ARG A 1 15  ? -6.983  80.034 51.658 1.00 24.84 ? 15  ARG A CD  1 
ATOM   100  N NE  . ARG A 1 15  ? -7.419  81.398 51.985 1.00 0.00  ? 15  ARG A NE  1 
ATOM   101  C CZ  . ARG A 1 15  ? -8.671  81.765 52.175 1.00 0.00  ? 15  ARG A CZ  1 
ATOM   102  N NH1 . ARG A 1 15  ? -9.646  80.883 52.072 1.00 0.00  ? 15  ARG A NH1 1 
ATOM   103  N NH2 . ARG A 1 15  ? -8.947  83.019 52.476 1.00 0.00  ? 15  ARG A NH2 1 
ATOM   104  N N   . ILE A 1 16  ? -2.466  82.763 48.607 1.00 19.63 ? 16  ILE A N   1 
ATOM   105  C CA  . ILE A 1 16  ? -1.974  84.070 48.166 1.00 19.63 ? 16  ILE A CA  1 
ATOM   106  C C   . ILE A 1 16  ? -0.897  84.032 47.074 1.00 19.63 ? 16  ILE A C   1 
ATOM   107  O O   . ILE A 1 16  ? -0.199  83.001 46.890 1.00 19.63 ? 16  ILE A O   1 
ATOM   108  C CB  . ILE A 1 16  ? -1.338  84.745 49.395 1.00 19.63 ? 16  ILE A CB  1 
ATOM   109  C CG1 . ILE A 1 16  ? -0.361  83.841 50.142 1.00 17.19 ? 16  ILE A CG1 1 
ATOM   110  C CG2 . ILE A 1 16  ? -2.392  85.199 50.384 1.00 17.19 ? 16  ILE A CG2 1 
ATOM   111  C CD1 . ILE A 1 16  ? 0.343   84.692 51.202 1.00 17.19 ? 16  ILE A CD1 1 
ATOM   112  N N   . VAL A 1 17  ? -0.598  85.209 46.559 1.00 21.86 ? 17  VAL A N   1 
ATOM   113  C CA  . VAL A 1 17  ? 0.479   85.480 45.627 1.00 21.86 ? 17  VAL A CA  1 
ATOM   114  C C   . VAL A 1 17  ? 0.414   84.481 44.478 1.00 21.86 ? 17  VAL A C   1 
ATOM   115  O O   . VAL A 1 17  ? -0.605  84.507 43.765 1.00 21.86 ? 17  VAL A O   1 
ATOM   116  C CB  . VAL A 1 17  ? 1.879   85.589 46.305 1.00 21.86 ? 17  VAL A CB  1 
ATOM   117  C CG1 . VAL A 1 17  ? 3.005   86.018 45.320 1.00 15.97 ? 17  VAL A CG1 1 
ATOM   118  C CG2 . VAL A 1 17  ? 1.869   86.470 47.581 1.00 15.97 ? 17  VAL A CG2 1 
ATOM   119  N N   . ASN A 1 18  ? 1.309   83.519 44.428 1.00 13.56 ? 18  ASN A N   1 
ATOM   120  C CA  . ASN A 1 18  ? 1.352   82.456 43.408 1.00 13.56 ? 18  ASN A CA  1 
ATOM   121  C C   . ASN A 1 18  ? 1.281   81.052 44.003 1.00 13.56 ? 18  ASN A C   1 
ATOM   122  O O   . ASN A 1 18  ? 1.918   80.196 43.363 1.00 13.56 ? 18  ASN A O   1 
ATOM   123  C CB  . ASN A 1 18  ? 2.676   82.525 42.617 1.00 13.56 ? 18  ASN A CB  1 
ATOM   124  C CG  . ASN A 1 18  ? 2.735   83.689 41.634 1.00 16.17 ? 18  ASN A CG  1 
ATOM   125  O OD1 . ASN A 1 18  ? 1.708   84.268 41.220 1.00 16.17 ? 18  ASN A OD1 1 
ATOM   126  N ND2 . ASN A 1 18  ? 3.913   84.103 41.343 1.00 16.17 ? 18  ASN A ND2 1 
ATOM   127  N N   . GLY A 1 19  ? 0.672   80.818 45.198 1.00 11.31 ? 19  GLY A N   1 
ATOM   128  C CA  . GLY A 1 19  ? 0.485   79.459 45.730 1.00 11.31 ? 19  GLY A CA  1 
ATOM   129  C C   . GLY A 1 19  ? 1.711   78.925 46.459 1.00 11.31 ? 19  GLY A C   1 
ATOM   130  O O   . GLY A 1 19  ? 2.482   79.772 46.955 1.00 11.31 ? 19  GLY A O   1 
ATOM   131  N N   . GLU A 1 20  ? 1.811   77.601 46.643 1.00 12.80 ? 20  GLU A N   1 
ATOM   132  C CA  . GLU A 1 20  ? 2.918   76.929 47.390 1.00 12.80 ? 20  GLU A CA  1 
ATOM   133  C C   . GLU A 1 20  ? 3.311   75.615 46.719 1.00 12.80 ? 20  GLU A C   1 
ATOM   134  O O   . GLU A 1 20  ? 2.582   75.128 45.792 1.00 12.80 ? 20  GLU A O   1 
ATOM   135  C CB  . GLU A 1 20  ? 2.515   76.625 48.861 1.00 12.80 ? 20  GLU A CB  1 
ATOM   136  C CG  . GLU A 1 20  ? 1.380   75.568 48.905 1.00 10.18 ? 20  GLU A CG  1 
ATOM   137  C CD  . GLU A 1 20  ? 0.870   75.283 50.308 1.00 10.18 ? 20  GLU A CD  1 
ATOM   138  O OE1 . GLU A 1 20  ? -0.310  74.901 50.442 1.00 10.18 ? 20  GLU A OE1 1 
ATOM   139  O OE2 . GLU A 1 20  ? 1.476   75.720 51.329 1.00 10.18 ? 20  GLU A OE2 1 
ATOM   140  N N   . GLU A 1 21  ? 4.492   75.153 47.112 1.00 9.06  ? 21  GLU A N   1 
ATOM   141  C CA  . GLU A 1 21  ? 4.911   73.860 46.635 1.00 9.06  ? 21  GLU A CA  1 
ATOM   142  C C   . GLU A 1 21  ? 4.004   72.776 47.214 1.00 9.06  ? 21  GLU A C   1 
ATOM   143  O O   . GLU A 1 21  ? 3.814   72.698 48.434 1.00 9.06  ? 21  GLU A O   1 
ATOM   144  C CB  . GLU A 1 21  ? 6.402   73.551 46.964 1.00 9.06  ? 21  GLU A CB  1 
ATOM   145  C CG  . GLU A 1 21  ? 7.350   74.102 45.895 1.00 24.26 ? 21  GLU A CG  1 
ATOM   146  C CD  . GLU A 1 21  ? 8.763   74.103 46.455 1.00 24.26 ? 21  GLU A CD  1 
ATOM   147  O OE1 . GLU A 1 21  ? 9.265   73.094 47.028 1.00 24.26 ? 21  GLU A OE1 1 
ATOM   148  O OE2 . GLU A 1 21  ? 9.534   74.908 45.914 1.00 24.26 ? 21  GLU A OE2 1 
ATOM   149  N N   . ALA A 1 22  ? 3.668   71.829 46.375 1.00 15.79 ? 22  ALA A N   1 
ATOM   150  C CA  . ALA A 1 22  ? 2.960   70.608 46.703 1.00 15.79 ? 22  ALA A CA  1 
ATOM   151  C C   . ALA A 1 22  ? 3.899   69.688 47.469 1.00 15.79 ? 22  ALA A C   1 
ATOM   152  O O   . ALA A 1 22  ? 5.128   69.725 47.204 1.00 15.79 ? 22  ALA A O   1 
ATOM   153  C CB  . ALA A 1 22  ? 2.501   69.986 45.364 1.00 15.79 ? 22  ALA A CB  1 
ATOM   154  N N   . VAL A 1 23  ? 3.335   68.760 48.193 1.00 8.88  ? 23  VAL A N   1 
ATOM   155  C CA  . VAL A 1 23  ? 4.074   67.588 48.729 1.00 8.88  ? 23  VAL A CA  1 
ATOM   156  C C   . VAL A 1 23  ? 4.266   66.581 47.629 1.00 8.88  ? 23  VAL A C   1 
ATOM   157  O O   . VAL A 1 23  ? 3.360   66.424 46.788 1.00 8.88  ? 23  VAL A O   1 
ATOM   158  C CB  . VAL A 1 23  ? 3.226   66.950 49.811 1.00 8.88  ? 23  VAL A CB  1 
ATOM   159  C CG1 . VAL A 1 23  ? 3.626   65.497 50.202 1.00 9.01  ? 23  VAL A CG1 1 
ATOM   160  C CG2 . VAL A 1 23  ? 3.131   67.902 51.003 1.00 9.01  ? 23  VAL A CG2 1 
ATOM   161  N N   . PRO A 1 24  ? 5.468   66.132 47.405 1.00 14.83 ? 24  PRO A N   1 
ATOM   162  C CA  . PRO A 1 24  ? 5.751   65.202 46.308 1.00 14.83 ? 24  PRO A CA  1 
ATOM   163  C C   . PRO A 1 24  ? 4.904   63.916 46.292 1.00 14.83 ? 24  PRO A C   1 
ATOM   164  O O   . PRO A 1 24  ? 4.661   63.245 47.328 1.00 14.83 ? 24  PRO A O   1 
ATOM   165  C CB  . PRO A 1 24  ? 7.264   64.949 46.295 1.00 14.83 ? 24  PRO A CB  1 
ATOM   166  C CG  . PRO A 1 24  ? 7.827   65.684 47.502 1.00 9.92  ? 24  PRO A CG  1 
ATOM   167  C CD  . PRO A 1 24  ? 6.663   66.389 48.208 1.00 9.92  ? 24  PRO A CD  1 
ATOM   168  N N   . GLY A 1 25  ? 4.379   63.605 45.133 1.00 7.97  ? 25  GLY A N   1 
ATOM   169  C CA  . GLY A 1 25  ? 3.534   62.420 44.936 1.00 7.97  ? 25  GLY A CA  1 
ATOM   170  C C   . GLY A 1 25  ? 2.064   62.722 45.092 1.00 7.97  ? 25  GLY A C   1 
ATOM   171  O O   . GLY A 1 25  ? 1.285   61.761 45.071 1.00 7.97  ? 25  GLY A O   1 
ATOM   172  N N   . SER A 1 26  ? 1.746   63.798 45.738 1.00 6.78  ? 26  SER A N   1 
ATOM   173  C CA  . SER A 1 26  ? 0.420   64.036 46.298 1.00 6.78  ? 26  SER A CA  1 
ATOM   174  C C   . SER A 1 26  ? -0.620  64.432 45.267 1.00 6.78  ? 26  SER A C   1 
ATOM   175  O O   . SER A 1 26  ? -1.809  64.463 45.650 1.00 6.78  ? 26  SER A O   1 
ATOM   176  C CB  . SER A 1 26  ? 0.334   65.069 47.456 1.00 6.78  ? 26  SER A CB  1 
ATOM   177  O OG  . SER A 1 26  ? 0.692   66.399 47.027 1.00 12.11 ? 26  SER A OG  1 
ATOM   178  N N   . TRP A 1 27  ? -0.212  64.746 44.058 1.00 7.71  ? 27  TRP A N   1 
ATOM   179  C CA  . TRP A 1 27  ? -1.197  64.935 42.952 1.00 7.71  ? 27  TRP A CA  1 
ATOM   180  C C   . TRP A 1 27  ? -0.928  63.938 41.825 1.00 7.71  ? 27  TRP A C   1 
ATOM   181  O O   . TRP A 1 27  ? -0.292  64.292 40.819 1.00 7.71  ? 27  TRP A O   1 
ATOM   182  C CB  . TRP A 1 27  ? -1.175  66.392 42.404 1.00 7.71  ? 27  TRP A CB  1 
ATOM   183  C CG  . TRP A 1 27  ? -1.450  67.453 43.495 1.00 11.44 ? 27  TRP A CG  1 
ATOM   184  C CD1 . TRP A 1 27  ? -0.558  68.297 44.086 1.00 11.44 ? 27  TRP A CD1 1 
ATOM   185  C CD2 . TRP A 1 27  ? -2.674  67.726 44.104 1.00 11.44 ? 27  TRP A CD2 1 
ATOM   186  N NE1 . TRP A 1 27  ? -1.236  69.062 45.058 1.00 11.44 ? 27  TRP A NE1 1 
ATOM   187  C CE2 . TRP A 1 27  ? -2.442  68.718 45.079 1.00 11.44 ? 27  TRP A CE2 1 
ATOM   188  C CE3 . TRP A 1 27  ? -3.929  67.163 43.905 1.00 11.44 ? 27  TRP A CE3 1 
ATOM   189  C CZ2 . TRP A 1 27  ? -3.443  69.237 45.870 1.00 11.44 ? 27  TRP A CZ2 1 
ATOM   190  C CZ3 . TRP A 1 27  ? -4.955  67.685 44.666 1.00 11.44 ? 27  TRP A CZ3 1 
ATOM   191  C CH2 . TRP A 1 27  ? -4.726  68.713 45.618 1.00 11.44 ? 27  TRP A CH2 1 
ATOM   192  N N   . PRO A 1 28  ? -1.221  62.694 42.056 1.00 6.21  ? 28  PRO A N   1 
ATOM   193  C CA  . PRO A 1 28  ? -0.694  61.526 41.276 1.00 6.21  ? 28  PRO A CA  1 
ATOM   194  C C   . PRO A 1 28  ? -1.228  61.418 39.864 1.00 6.21  ? 28  PRO A C   1 
ATOM   195  O O   . PRO A 1 28  ? -0.590  60.731 39.030 1.00 6.21  ? 28  PRO A O   1 
ATOM   196  C CB  . PRO A 1 28  ? -1.185  60.269 41.984 1.00 6.21  ? 28  PRO A CB  1 
ATOM   197  C CG  . PRO A 1 28  ? -2.152  60.680 43.091 1.00 7.88  ? 28  PRO A CG  1 
ATOM   198  C CD  . PRO A 1 28  ? -2.060  62.222 43.169 1.00 7.88  ? 28  PRO A CD  1 
ATOM   199  N N   . TRP A 1 29  ? -2.298  62.175 39.525 1.00 7.01  ? 29  TRP A N   1 
ATOM   200  C CA  . TRP A 1 29  ? -2.744  62.166 38.102 1.00 7.01  ? 29  TRP A CA  1 
ATOM   201  C C   . TRP A 1 29  ? -2.026  63.135 37.145 1.00 7.01  ? 29  TRP A C   1 
ATOM   202  O O   . TRP A 1 29  ? -2.108  63.016 35.886 1.00 7.01  ? 29  TRP A O   1 
ATOM   203  C CB  . TRP A 1 29  ? -4.283  62.378 38.076 1.00 7.01  ? 29  TRP A CB  1 
ATOM   204  C CG  . TRP A 1 29  ? -4.669  63.521 39.020 1.00 8.29  ? 29  TRP A CG  1 
ATOM   205  C CD1 . TRP A 1 29  ? -4.586  64.892 38.811 1.00 8.29  ? 29  TRP A CD1 1 
ATOM   206  C CD2 . TRP A 1 29  ? -5.127  63.374 40.321 1.00 8.29  ? 29  TRP A CD2 1 
ATOM   207  N NE1 . TRP A 1 29  ? -5.003  65.578 39.995 1.00 8.29  ? 29  TRP A NE1 1 
ATOM   208  C CE2 . TRP A 1 29  ? -5.335  64.679 40.860 1.00 8.29  ? 29  TRP A CE2 1 
ATOM   209  C CE3 . TRP A 1 29  ? -5.427  62.241 41.035 1.00 8.29  ? 29  TRP A CE3 1 
ATOM   210  C CZ2 . TRP A 1 29  ? -5.830  64.873 42.155 1.00 8.29  ? 29  TRP A CZ2 1 
ATOM   211  C CZ3 . TRP A 1 29  ? -5.901  62.439 42.319 1.00 8.29  ? 29  TRP A CZ3 1 
ATOM   212  C CH2 . TRP A 1 29  ? -6.084  63.717 42.870 1.00 8.29  ? 29  TRP A CH2 1 
ATOM   213  N N   . GLN A 1 30  ? -1.332  64.111 37.745 1.00 9.84  ? 30  GLN A N   1 
ATOM   214  C CA  . GLN A 1 30  ? -0.578  65.147 37.052 1.00 9.84  ? 30  GLN A CA  1 
ATOM   215  C C   . GLN A 1 30  ? 0.530   64.571 36.137 1.00 9.84  ? 30  GLN A C   1 
ATOM   216  O O   . GLN A 1 30  ? 1.494   63.917 36.606 1.00 9.84  ? 30  GLN A O   1 
ATOM   217  C CB  . GLN A 1 30  ? 0.039   66.134 38.100 1.00 9.84  ? 30  GLN A CB  1 
ATOM   218  C CG  . GLN A 1 30  ? 0.952   67.227 37.495 1.00 5.77  ? 30  GLN A CG  1 
ATOM   219  C CD  . GLN A 1 30  ? 0.134   68.329 36.882 1.00 5.77  ? 30  GLN A CD  1 
ATOM   220  O OE1 . GLN A 1 30  ? -0.710  68.893 37.602 1.00 5.77  ? 30  GLN A OE1 1 
ATOM   221  N NE2 . GLN A 1 30  ? 0.126   68.382 35.572 1.00 5.77  ? 30  GLN A NE2 1 
ATOM   222  N N   . VAL A 1 31  ? 0.454   64.947 34.873 1.00 8.82  ? 31  VAL A N   1 
ATOM   223  C CA  . VAL A 1 31  ? 1.488   64.588 33.918 1.00 8.82  ? 31  VAL A CA  1 
ATOM   224  C C   . VAL A 1 31  ? 2.030   65.837 33.248 1.00 8.82  ? 31  VAL A C   1 
ATOM   225  O O   . VAL A 1 31  ? 1.328   66.892 33.251 1.00 8.82  ? 31  VAL A O   1 
ATOM   226  C CB  . VAL A 1 31  ? 1.039   63.484 32.890 1.00 8.82  ? 31  VAL A CB  1 
ATOM   227  C CG1 . VAL A 1 31  ? 0.701   62.133 33.559 1.00 8.45  ? 31  VAL A CG1 1 
ATOM   228  C CG2 . VAL A 1 31  ? -0.003  63.887 31.818 1.00 8.45  ? 31  VAL A CG2 1 
ATOM   229  N N   . SER A 1 32  ? 3.196   65.627 32.662 1.00 15.43 ? 32  SER A N   1 
ATOM   230  C CA  . SER A 1 32  ? 3.844   66.617 31.792 1.00 15.43 ? 32  SER A CA  1 
ATOM   231  C C   . SER A 1 32  ? 3.990   66.056 30.380 1.00 15.43 ? 32  SER A C   1 
ATOM   232  O O   . SER A 1 32  ? 4.339   64.870 30.204 1.00 15.43 ? 32  SER A O   1 
ATOM   233  C CB  . SER A 1 32  ? 5.233   66.965 32.342 1.00 15.43 ? 32  SER A CB  1 
ATOM   234  O OG  . SER A 1 32  ? 6.126   67.282 31.283 1.00 30.92 ? 32  SER A OG  1 
ATOM   235  N N   . LEU A 1 33  ? 3.692   66.955 29.465 1.00 13.60 ? 33  LEU A N   1 
ATOM   236  C CA  . LEU A 1 33  ? 3.818   66.738 28.029 1.00 13.60 ? 33  LEU A CA  1 
ATOM   237  C C   . LEU A 1 33  ? 5.088   67.396 27.559 1.00 13.60 ? 33  LEU A C   1 
ATOM   238  O O   . LEU A 1 33  ? 5.315   68.592 27.805 1.00 13.60 ? 33  LEU A O   1 
ATOM   239  C CB  . LEU A 1 33  ? 2.695   67.406 27.243 1.00 13.60 ? 33  LEU A CB  1 
ATOM   240  C CG  . LEU A 1 33  ? 1.286   67.046 27.723 1.00 15.63 ? 33  LEU A CG  1 
ATOM   241  C CD1 . LEU A 1 33  ? 0.210   67.326 26.667 1.00 15.63 ? 33  LEU A CD1 1 
ATOM   242  C CD2 . LEU A 1 33  ? 1.129   65.571 28.088 1.00 15.63 ? 33  LEU A CD2 1 
ATOM   243  N N   . GLN A 1 34  ? 5.866   66.598 26.906 1.00 9.20  ? 34  GLN A N   1 
ATOM   244  C CA  . GLN A 1 34  ? 7.134   67.036 26.368 1.00 9.20  ? 34  GLN A CA  1 
ATOM   245  C C   . GLN A 1 34  ? 7.200   66.677 24.893 1.00 9.20  ? 34  GLN A C   1 
ATOM   246  O O   . GLN A 1 34  ? 6.511   65.756 24.430 1.00 9.20  ? 34  GLN A O   1 
ATOM   247  C CB  . GLN A 1 34  ? 8.263   66.359 27.131 1.00 9.20  ? 34  GLN A CB  1 
ATOM   248  C CG  . GLN A 1 34  ? 8.537   67.025 28.476 1.00 34.79 ? 34  GLN A CG  1 
ATOM   249  C CD  . GLN A 1 34  ? 9.473   66.218 29.370 1.00 34.79 ? 34  GLN A CD  1 
ATOM   250  O OE1 . GLN A 1 34  ? 10.276  65.435 28.869 1.00 34.79 ? 34  GLN A OE1 1 
ATOM   251  N NE2 . GLN A 1 34  ? 9.422   66.370 30.680 1.00 34.79 ? 34  GLN A NE2 1 
ATOM   252  N N   . ASP A 1 35  ? 8.017   67.380 24.192 1.00 32.86 ? 35  ASP A N   1 
ATOM   253  C CA  . ASP A 1 35  ? 8.330   66.896 22.829 1.00 32.86 ? 35  ASP A CA  1 
ATOM   254  C C   . ASP A 1 35  ? 9.479   65.893 22.717 1.00 32.86 ? 35  ASP A C   1 
ATOM   255  O O   . ASP A 1 35  ? 10.106  65.528 23.750 1.00 32.86 ? 35  ASP A O   1 
ATOM   256  C CB  . ASP A 1 35  ? 8.495   67.990 21.756 1.00 32.86 ? 35  ASP A CB  1 
ATOM   257  C CG  . ASP A 1 35  ? 9.720   68.854 21.994 1.00 47.82 ? 35  ASP A CG  1 
ATOM   258  O OD1 . ASP A 1 35  ? 10.835  68.354 22.247 1.00 47.82 ? 35  ASP A OD1 1 
ATOM   259  O OD2 . ASP A 1 35  ? 9.707   69.977 21.460 1.00 47.82 ? 35  ASP A OD2 1 
ATOM   260  N N   . LYS A 1 36  ? 9.696   65.489 21.458 1.00 36.39 ? 36  LYS A N   1 
ATOM   261  C CA  . LYS A 1 36  ? 10.799  64.571 21.041 1.00 36.39 ? 36  LYS A CA  1 
ATOM   262  C C   . LYS A 1 36  ? 12.125  64.893 21.733 1.00 36.39 ? 36  LYS A C   1 
ATOM   263  O O   . LYS A 1 36  ? 12.729  64.007 22.384 1.00 36.39 ? 36  LYS A O   1 
ATOM   264  C CB  . LYS A 1 36  ? 10.983  64.465 19.489 1.00 36.39 ? 36  LYS A CB  1 
ATOM   265  C CG  . LYS A 1 36  ? 10.816  65.804 18.715 1.00 0.00  ? 36  LYS A CG  1 
ATOM   266  C CD  . LYS A 1 36  ? 11.130  65.675 17.198 1.00 44.37 ? 36  LYS A CD  1 
ATOM   267  C CE  . LYS A 1 36  ? 10.989  66.996 16.396 1.00 44.37 ? 36  LYS A CE  1 
ATOM   268  N NZ  . LYS A 1 36  ? 9.583   67.359 16.107 1.00 44.37 ? 36  LYS A NZ  1 
ATOM   269  N N   . THR A 1 37  ? 12.457  66.168 21.753 1.00 33.38 ? 37  THR A N   1 
ATOM   270  C CA  . THR A 1 37  ? 13.715  66.709 22.316 1.00 33.38 ? 37  THR A CA  1 
ATOM   271  C C   . THR A 1 37  ? 13.689  67.043 23.814 1.00 33.38 ? 37  THR A C   1 
ATOM   272  O O   . THR A 1 37  ? 14.759  67.396 24.380 1.00 33.38 ? 37  THR A O   1 
ATOM   273  C CB  . THR A 1 37  ? 14.126  67.952 21.484 1.00 33.38 ? 37  THR A CB  1 
ATOM   274  O OG1 . THR A 1 37  ? 13.549  69.158 22.065 1.00 27.54 ? 37  THR A OG1 1 
ATOM   275  C CG2 . THR A 1 37  ? 13.634  67.804 20.019 1.00 27.54 ? 37  THR A CG2 1 
ATOM   276  N N   . GLY A 1 38  ? 12.511  66.918 24.453 1.00 27.01 ? 38  GLY A N   1 
ATOM   277  C CA  . GLY A 1 38  ? 12.360  67.127 25.906 1.00 27.01 ? 38  GLY A CA  1 
ATOM   278  C C   . GLY A 1 38  ? 11.965  68.512 26.441 1.00 27.01 ? 38  GLY A C   1 
ATOM   279  O O   . GLY A 1 38  ? 12.149  68.708 27.663 1.00 27.01 ? 38  GLY A O   1 
ATOM   280  N N   . PHE A 1 39  ? 11.358  69.382 25.632 1.00 15.59 ? 39  PHE A N   1 
ATOM   281  C CA  . PHE A 1 39  ? 10.775  70.692 26.050 1.00 15.59 ? 39  PHE A CA  1 
ATOM   282  C C   . PHE A 1 39  ? 9.383   70.518 26.682 1.00 15.59 ? 39  PHE A C   1 
ATOM   283  O O   . PHE A 1 39  ? 8.451   70.038 26.023 1.00 15.59 ? 39  PHE A O   1 
ATOM   284  C CB  . PHE A 1 39  ? 10.776  71.757 24.906 1.00 15.59 ? 39  PHE A CB  1 
ATOM   285  C CG  . PHE A 1 39  ? 10.075  73.081 25.274 1.00 33.92 ? 39  PHE A CG  1 
ATOM   286  C CD1 . PHE A 1 39  ? 10.478  73.829 26.366 1.00 33.92 ? 39  PHE A CD1 1 
ATOM   287  C CD2 . PHE A 1 39  ? 8.963   73.479 24.555 1.00 33.92 ? 39  PHE A CD2 1 
ATOM   288  C CE1 . PHE A 1 39  ? 9.734   74.960 26.767 1.00 33.92 ? 39  PHE A CE1 1 
ATOM   289  C CE2 . PHE A 1 39  ? 8.226   74.610 24.941 1.00 33.92 ? 39  PHE A CE2 1 
ATOM   290  C CZ  . PHE A 1 39  ? 8.601   75.335 26.059 1.00 33.92 ? 39  PHE A CZ  1 
ATOM   291  N N   . HIS A 1 40  ? 9.254   70.842 27.933 1.00 15.59 ? 40  HIS A N   1 
ATOM   292  C CA  . HIS A 1 40  ? 7.956   70.733 28.572 1.00 15.59 ? 40  HIS A CA  1 
ATOM   293  C C   . HIS A 1 40  ? 6.919   71.783 28.123 1.00 15.59 ? 40  HIS A C   1 
ATOM   294  O O   . HIS A 1 40  ? 7.098   73.002 28.336 1.00 15.59 ? 40  HIS A O   1 
ATOM   295  C CB  . HIS A 1 40  ? 8.237   70.826 30.075 1.00 15.59 ? 40  HIS A CB  1 
ATOM   296  C CG  . HIS A 1 40  ? 6.940   71.128 30.867 1.00 36.31 ? 40  HIS A CG  1 
ATOM   297  N ND1 . HIS A 1 40  ? 5.990   70.117 31.142 1.00 36.31 ? 40  HIS A ND1 1 
ATOM   298  C CD2 . HIS A 1 40  ? 6.506   72.291 31.454 1.00 36.31 ? 40  HIS A CD2 1 
ATOM   299  C CE1 . HIS A 1 40  ? 4.996   70.692 31.931 1.00 36.31 ? 40  HIS A CE1 1 
ATOM   300  N NE2 . HIS A 1 40  ? 5.297   72.043 32.138 1.00 36.31 ? 40  HIS A NE2 1 
ATOM   301  N N   . PHE A 1 41  ? 5.980   71.439 27.283 1.00 4.18  ? 41  PHE A N   1 
ATOM   302  C CA  . PHE A 1 41  ? 5.088   72.442 26.692 1.00 4.18  ? 41  PHE A CA  1 
ATOM   303  C C   . PHE A 1 41  ? 3.678   72.504 27.254 1.00 4.18  ? 41  PHE A C   1 
ATOM   304  O O   . PHE A 1 41  ? 2.915   73.454 26.913 1.00 4.18  ? 41  PHE A O   1 
ATOM   305  C CB  . PHE A 1 41  ? 5.066   72.285 25.179 1.00 4.18  ? 41  PHE A CB  1 
ATOM   306  C CG  . PHE A 1 41  ? 4.441   70.981 24.655 1.00 13.21 ? 41  PHE A CG  1 
ATOM   307  C CD1 . PHE A 1 41  ? 3.149   70.997 24.147 1.00 13.21 ? 41  PHE A CD1 1 
ATOM   308  C CD2 . PHE A 1 41  ? 5.220   69.859 24.563 1.00 13.21 ? 41  PHE A CD2 1 
ATOM   309  C CE1 . PHE A 1 41  ? 2.607   69.881 23.551 1.00 13.21 ? 41  PHE A CE1 1 
ATOM   310  C CE2 . PHE A 1 41  ? 4.679   68.732 23.988 1.00 13.21 ? 41  PHE A CE2 1 
ATOM   311  C CZ  . PHE A 1 41  ? 3.367   68.732 23.464 1.00 13.21 ? 41  PHE A CZ  1 
ATOM   312  N N   . CYS A 1 42  ? 3.210   71.441 27.869 1.00 4.11  ? 42  CYS A N   1 
ATOM   313  C CA  . CYS A 1 42  ? 1.808   71.340 28.306 1.00 4.11  ? 42  CYS A CA  1 
ATOM   314  C C   . CYS A 1 42  ? 1.633   70.434 29.498 1.00 4.11  ? 42  CYS A C   1 
ATOM   315  O O   . CYS A 1 42  ? 2.547   69.685 29.866 1.00 4.11  ? 42  CYS A O   1 
ATOM   316  C CB  . CYS A 1 42  ? 0.818   70.981 27.200 1.00 4.11  ? 42  CYS A CB  1 
ATOM   317  S SG  . CYS A 1 42  ? 0.175   72.429 26.315 1.00 8.81  ? 42  CYS A SG  1 
ATOM   318  N N   . GLY A 1 43  ? 0.540   70.548 30.185 1.00 7.33  ? 43  GLY A N   1 
ATOM   319  C CA  . GLY A 1 43  ? 0.236   69.573 31.240 1.00 7.33  ? 43  GLY A CA  1 
ATOM   320  C C   . GLY A 1 43  ? -0.901  68.637 30.798 1.00 7.33  ? 43  GLY A C   1 
ATOM   321  O O   . GLY A 1 43  ? -1.368  68.789 29.645 1.00 7.33  ? 43  GLY A O   1 
ATOM   322  N N   . GLY A 1 44  ? -1.256  67.692 31.628 1.00 9.08  ? 44  GLY A N   1 
ATOM   323  C CA  . GLY A 1 44  ? -2.365  66.747 31.406 1.00 9.08  ? 44  GLY A CA  1 
ATOM   324  C C   . GLY A 1 44  ? -2.773  66.026 32.692 1.00 9.08  ? 44  GLY A C   1 
ATOM   325  O O   . GLY A 1 44  ? -2.039  66.167 33.712 1.00 9.08  ? 44  GLY A O   1 
ATOM   326  N N   . SER A 1 45  ? -3.901  65.277 32.654 1.00 8.42  ? 45  SER A N   1 
ATOM   327  C CA  . SER A 1 45  ? -4.329  64.397 33.769 1.00 8.42  ? 45  SER A CA  1 
ATOM   328  C C   . SER A 1 45  ? -4.536  62.940 33.313 1.00 8.42  ? 45  SER A C   1 
ATOM   329  O O   . SER A 1 45  ? -5.103  62.691 32.229 1.00 8.42  ? 45  SER A O   1 
ATOM   330  C CB  . SER A 1 45  ? -5.589  64.905 34.503 1.00 8.42  ? 45  SER A CB  1 
ATOM   331  O OG  . SER A 1 45  ? -5.408  66.258 34.931 1.00 8.36  ? 45  SER A OG  1 
ATOM   332  N N   . LEU A 1 46  ? -4.130  61.991 34.092 1.00 5.45  ? 46  LEU A N   1 
ATOM   333  C CA  . LEU A 1 46  ? -4.478  60.549 33.857 1.00 5.45  ? 46  LEU A CA  1 
ATOM   334  C C   . LEU A 1 46  ? -5.906  60.317 34.338 1.00 5.45  ? 46  LEU A C   1 
ATOM   335  O O   . LEU A 1 46  ? -6.218  60.715 35.500 1.00 5.45  ? 46  LEU A O   1 
ATOM   336  C CB  . LEU A 1 46  ? -3.629  59.629 34.751 1.00 5.45  ? 46  LEU A CB  1 
ATOM   337  C CG  . LEU A 1 46  ? -2.192  59.473 34.200 1.00 11.33 ? 46  LEU A CG  1 
ATOM   338  C CD1 . LEU A 1 46  ? -1.231  58.949 35.299 1.00 11.33 ? 46  LEU A CD1 1 
ATOM   339  C CD2 . LEU A 1 46  ? -2.180  58.535 32.967 1.00 11.33 ? 46  LEU A CD2 1 
ATOM   340  N N   . ILE A 1 47  ? -6.636  59.660 33.486 1.00 13.19 ? 47  ILE A N   1 
ATOM   341  C CA  . ILE A 1 47  ? -7.996  59.251 33.822 1.00 13.19 ? 47  ILE A CA  1 
ATOM   342  C C   . ILE A 1 47  ? -8.120  57.756 33.984 1.00 13.19 ? 47  ILE A C   1 
ATOM   343  O O   . ILE A 1 47  ? -9.025  57.261 34.707 1.00 13.19 ? 47  ILE A O   1 
ATOM   344  C CB  . ILE A 1 47  ? -9.046  59.828 32.885 1.00 13.19 ? 47  ILE A CB  1 
ATOM   345  C CG1 . ILE A 1 47  ? -8.836  59.486 31.393 1.00 9.26  ? 47  ILE A CG1 1 
ATOM   346  C CG2 . ILE A 1 47  ? -9.309  61.337 33.186 1.00 9.26  ? 47  ILE A CG2 1 
ATOM   347  C CD1 . ILE A 1 47  ? -10.166 59.402 30.616 1.00 9.26  ? 47  ILE A CD1 1 
ATOM   348  N N   . ASN A 1 48  ? -7.069  57.127 33.478 1.00 11.48 ? 48  ASN A N   1 
ATOM   349  C CA  . ASN A 1 48  ? -6.767  55.688 33.687 1.00 11.48 ? 48  ASN A CA  1 
ATOM   350  C C   . ASN A 1 48  ? -5.396  55.314 33.114 1.00 11.48 ? 48  ASN A C   1 
ATOM   351  O O   . ASN A 1 48  ? -4.613  56.242 32.771 1.00 11.48 ? 48  ASN A O   1 
ATOM   352  C CB  . ASN A 1 48  ? -7.918  54.737 33.236 1.00 11.48 ? 48  ASN A CB  1 
ATOM   353  C CG  . ASN A 1 48  ? -8.199  54.506 31.741 1.00 11.05 ? 48  ASN A CG  1 
ATOM   354  O OD1 . ASN A 1 48  ? -9.402  54.328 31.359 1.00 11.05 ? 48  ASN A OD1 1 
ATOM   355  N ND2 . ASN A 1 48  ? -7.294  54.868 30.910 1.00 11.05 ? 48  ASN A ND2 1 
ATOM   356  N N   . GLU A 1 49  ? -5.048  54.034 33.196 1.00 12.53 ? 49  GLU A N   1 
ATOM   357  C CA  . GLU A 1 49  ? -3.702  53.659 32.793 1.00 12.53 ? 49  GLU A CA  1 
ATOM   358  C C   . GLU A 1 49  ? -3.388  53.872 31.326 1.00 12.53 ? 49  GLU A C   1 
ATOM   359  O O   . GLU A 1 49  ? -2.173  53.896 30.987 1.00 12.53 ? 49  GLU A O   1 
ATOM   360  C CB  . GLU A 1 49  ? -3.177  52.285 33.255 1.00 12.53 ? 49  GLU A CB  1 
ATOM   361  C CG  . GLU A 1 49  ? -4.107  51.104 32.946 1.00 43.61 ? 49  GLU A CG  1 
ATOM   362  C CD  . GLU A 1 49  ? -5.133  51.009 34.058 1.00 43.61 ? 49  GLU A CD  1 
ATOM   363  O OE1 . GLU A 1 49  ? -4.761  50.694 35.223 1.00 43.61 ? 49  GLU A OE1 1 
ATOM   364  O OE2 . GLU A 1 49  ? -6.309  51.400 33.846 1.00 43.61 ? 49  GLU A OE2 1 
ATOM   365  N N   . ASN A 1 50  ? -4.439  54.065 30.547 1.00 6.96  ? 50  ASN A N   1 
ATOM   366  C CA  . ASN A 1 50  ? -4.364  54.140 29.044 1.00 6.96  ? 50  ASN A CA  1 
ATOM   367  C C   . ASN A 1 50  ? -4.622  55.486 28.400 1.00 6.96  ? 50  ASN A C   1 
ATOM   368  O O   . ASN A 1 50  ? -4.485  55.643 27.158 1.00 6.96  ? 50  ASN A O   1 
ATOM   369  C CB  . ASN A 1 50  ? -5.293  53.100 28.378 1.00 6.96  ? 50  ASN A CB  1 
ATOM   370  C CG  . ASN A 1 50  ? -4.690  51.713 28.539 1.00 21.33 ? 50  ASN A CG  1 
ATOM   371  O OD1 . ASN A 1 50  ? -3.655  51.436 27.868 1.00 21.33 ? 50  ASN A OD1 1 
ATOM   372  N ND2 . ASN A 1 50  ? -5.213  51.038 29.535 1.00 21.33 ? 50  ASN A ND2 1 
ATOM   373  N N   . TRP A 1 51  ? -5.154  56.365 29.169 1.00 8.55  ? 51  TRP A N   1 
ATOM   374  C CA  . TRP A 1 51  ? -5.724  57.628 28.667 1.00 8.55  ? 51  TRP A CA  1 
ATOM   375  C C   . TRP A 1 51  ? -5.313  58.839 29.497 1.00 8.55  ? 51  TRP A C   1 
ATOM   376  O O   . TRP A 1 51  ? -5.439  58.787 30.717 1.00 8.55  ? 51  TRP A O   1 
ATOM   377  C CB  . TRP A 1 51  ? -7.312  57.561 28.485 1.00 8.55  ? 51  TRP A CB  1 
ATOM   378  C CG  . TRP A 1 51  ? -7.850  56.555 27.414 1.00 7.80  ? 51  TRP A CG  1 
ATOM   379  C CD1 . TRP A 1 51  ? -8.117  55.221 27.515 1.00 7.80  ? 51  TRP A CD1 1 
ATOM   380  C CD2 . TRP A 1 51  ? -8.143  56.882 26.075 1.00 7.80  ? 51  TRP A CD2 1 
ATOM   381  N NE1 . TRP A 1 51  ? -8.573  54.719 26.264 1.00 7.80  ? 51  TRP A NE1 1 
ATOM   382  C CE2 . TRP A 1 51  ? -8.597  55.700 25.436 1.00 7.80  ? 51  TRP A CE2 1 
ATOM   383  C CE3 . TRP A 1 51  ? -8.035  58.086 25.396 1.00 7.80  ? 51  TRP A CE3 1 
ATOM   384  C CZ2 . TRP A 1 51  ? -9.014  55.678 24.117 1.00 7.80  ? 51  TRP A CZ2 1 
ATOM   385  C CZ3 . TRP A 1 51  ? -8.427  58.056 24.071 1.00 7.80  ? 51  TRP A CZ3 1 
ATOM   386  C CH2 . TRP A 1 51  ? -8.903  56.866 23.453 1.00 7.80  ? 51  TRP A CH2 1 
ATOM   387  N N   . VAL A 1 52  ? -5.000  59.949 28.808 1.00 10.84 ? 52  VAL A N   1 
ATOM   388  C CA  . VAL A 1 52  ? -4.726  61.304 29.314 1.00 10.84 ? 52  VAL A CA  1 
ATOM   389  C C   . VAL A 1 52  ? -5.665  62.357 28.703 1.00 10.84 ? 52  VAL A C   1 
ATOM   390  O O   . VAL A 1 52  ? -5.953  62.334 27.479 1.00 10.84 ? 52  VAL A O   1 
ATOM   391  C CB  . VAL A 1 52  ? -3.232  61.709 29.116 1.00 10.84 ? 52  VAL A CB  1 
ATOM   392  C CG1 . VAL A 1 52  ? -2.848  63.178 29.525 1.00 0.10  ? 52  VAL A CG1 1 
ATOM   393  C CG2 . VAL A 1 52  ? -2.316  60.688 29.828 1.00 0.10  ? 52  VAL A CG2 1 
ATOM   394  N N   . VAL A 1 53  ? -6.115  63.261 29.547 1.00 11.13 ? 53  VAL A N   1 
ATOM   395  C CA  . VAL A 1 53  ? -6.923  64.404 29.124 1.00 11.13 ? 53  VAL A CA  1 
ATOM   396  C C   . VAL A 1 53  ? -6.045  65.640 29.183 1.00 11.13 ? 53  VAL A C   1 
ATOM   397  O O   . VAL A 1 53  ? -5.367  65.847 30.218 1.00 11.13 ? 53  VAL A O   1 
ATOM   398  C CB  . VAL A 1 53  ? -8.051  64.816 30.094 1.00 11.13 ? 53  VAL A CB  1 
ATOM   399  C CG1 . VAL A 1 53  ? -9.083  65.676 29.351 1.00 19.65 ? 53  VAL A CG1 1 
ATOM   400  C CG2 . VAL A 1 53  ? -8.782  63.699 30.785 1.00 19.65 ? 53  VAL A CG2 1 
ATOM   401  N N   . THR A 1 54  ? -6.141  66.442 28.177 1.00 8.50  ? 54  THR A N   1 
ATOM   402  C CA  . THR A 1 54  ? -5.405  67.710 28.034 1.00 8.50  ? 54  THR A CA  1 
ATOM   403  C C   . THR A 1 54  ? -6.238  68.678 27.173 1.00 8.50  ? 54  THR A C   1 
ATOM   404  O O   . THR A 1 54  ? -7.443  68.454 26.863 1.00 8.50  ? 54  THR A O   1 
ATOM   405  C CB  . THR A 1 54  ? -3.907  67.540 27.550 1.00 8.50  ? 54  THR A CB  1 
ATOM   406  O OG1 . THR A 1 54  ? -3.099  68.761 27.643 1.00 7.45  ? 54  THR A OG1 1 
ATOM   407  C CG2 . THR A 1 54  ? -3.808  67.027 26.107 1.00 7.45  ? 54  THR A CG2 1 
ATOM   408  N N   . ALA A 1 55  ? -5.642  69.841 26.908 1.00 6.79  ? 55  ALA A N   1 
ATOM   409  C CA  . ALA A 1 55  ? -6.274  70.885 26.116 1.00 6.79  ? 55  ALA A CA  1 
ATOM   410  C C   . ALA A 1 55  ? -6.061  70.686 24.625 1.00 6.79  ? 55  ALA A C   1 
ATOM   411  O O   . ALA A 1 55  ? -4.930  70.419 24.167 1.00 6.79  ? 55  ALA A O   1 
ATOM   412  C CB  . ALA A 1 55  ? -5.693  72.239 26.517 1.00 6.79  ? 55  ALA A CB  1 
ATOM   413  N N   . ALA A 1 56  ? -7.141  70.862 23.840 1.00 8.22  ? 56  ALA A N   1 
ATOM   414  C CA  . ALA A 1 56  ? -6.941  70.878 22.342 1.00 8.22  ? 56  ALA A CA  1 
ATOM   415  C C   . ALA A 1 56  ? -5.953  71.958 21.878 1.00 8.22  ? 56  ALA A C   1 
ATOM   416  O O   . ALA A 1 56  ? -5.278  71.770 20.854 1.00 8.22  ? 56  ALA A O   1 
ATOM   417  C CB  . ALA A 1 56  ? -8.273  71.097 21.563 1.00 8.22  ? 56  ALA A CB  1 
ATOM   418  N N   . HIS A 1 57  ? -5.916  73.153 22.436 1.00 11.25 ? 57  HIS A N   1 
ATOM   419  C CA  . HIS A 1 57  ? -4.962  74.169 21.907 1.00 11.25 ? 57  HIS A CA  1 
ATOM   420  C C   . HIS A 1 57  ? -3.523  73.773 22.186 1.00 11.25 ? 57  HIS A C   1 
ATOM   421  O O   . HIS A 1 57  ? -2.587  74.407 21.650 1.00 11.25 ? 57  HIS A O   1 
ATOM   422  C CB  . HIS A 1 57  ? -5.239  75.630 22.461 1.00 11.25 ? 57  HIS A CB  1 
ATOM   423  C CG  . HIS A 1 57  ? -4.720  75.856 23.900 1.00 9.84  ? 57  HIS A CG  1 
ATOM   424  N ND1 . HIS A 1 57  ? -5.433  75.466 24.965 1.00 9.84  ? 57  HIS A ND1 1 
ATOM   425  C CD2 . HIS A 1 57  ? -3.522  76.297 24.369 1.00 9.84  ? 57  HIS A CD2 1 
ATOM   426  C CE1 . HIS A 1 57  ? -4.665  75.699 26.146 1.00 9.84  ? 57  HIS A CE1 1 
ATOM   427  N NE2 . HIS A 1 57  ? -3.493  76.212 25.735 1.00 9.84  ? 57  HIS A NE2 1 
ATOM   428  N N   . CYS A 1 58  ? -3.321  72.693 22.922 1.00 13.61 ? 58  CYS A N   1 
ATOM   429  C CA  . CYS A 1 58  ? -1.915  72.207 23.139 1.00 13.61 ? 58  CYS A CA  1 
ATOM   430  C C   . CYS A 1 58  ? -1.234  71.628 21.902 1.00 13.61 ? 58  CYS A C   1 
ATOM   431  O O   . CYS A 1 58  ? -0.007  71.796 21.753 1.00 13.61 ? 58  CYS A O   1 
ATOM   432  C CB  . CYS A 1 58  ? -1.745  71.198 24.294 1.00 13.61 ? 58  CYS A CB  1 
ATOM   433  S SG  . CYS A 1 58  ? -1.752  71.944 25.899 1.00 13.14 ? 58  CYS A SG  1 
ATOM   434  N N   . GLY A 1 59  ? -2.013  71.229 20.937 1.00 12.59 ? 59  GLY A N   1 
ATOM   435  C CA  . GLY A 1 59  ? -1.476  70.814 19.601 1.00 12.59 ? 59  GLY A CA  1 
ATOM   436  C C   . GLY A 1 59  ? -0.570  69.589 19.679 1.00 12.59 ? 59  GLY A C   1 
ATOM   437  O O   . GLY A 1 59  ? 0.294   69.428 18.793 1.00 12.59 ? 59  GLY A O   1 
ATOM   438  N N   . VAL A 1 60  ? -0.876  68.696 20.627 1.00 13.85 ? 60  VAL A N   1 
ATOM   439  C CA  . VAL A 1 60  ? -0.216  67.383 20.756 1.00 13.85 ? 60  VAL A CA  1 
ATOM   440  C C   . VAL A 1 60  ? -0.199  66.495 19.496 1.00 13.85 ? 60  VAL A C   1 
ATOM   441  O O   . VAL A 1 60  ? -1.156  66.466 18.683 1.00 13.85 ? 60  VAL A O   1 
ATOM   442  C CB  . VAL A 1 60  ? -0.748  66.607 21.965 1.00 13.85 ? 60  VAL A CB  1 
ATOM   443  C CG1 . VAL A 1 60  ? 0.203   65.444 22.309 1.00 16.50 ? 60  VAL A CG1 1 
ATOM   444  C CG2 . VAL A 1 60  ? -0.813  67.511 23.192 1.00 16.50 ? 60  VAL A CG2 1 
ATOM   445  N N   . THR A 1 61  ? 0.948   65.870 19.256 1.00 19.02 ? 61  THR A N   1 
ATOM   446  C CA  . THR A 1 61  ? 1.142   64.926 18.166 1.00 19.02 ? 61  THR A CA  1 
ATOM   447  C C   . THR A 1 61  ? 1.641   63.631 18.784 1.00 19.02 ? 61  THR A C   1 
ATOM   448  O O   . THR A 1 61  ? 2.166   63.649 19.946 1.00 19.02 ? 61  THR A O   1 
ATOM   449  C CB  . THR A 1 61  ? 2.197   65.451 17.160 1.00 19.02 ? 61  THR A CB  1 
ATOM   450  O OG1 . THR A 1 61  ? 3.510   65.411 17.742 1.00 26.54 ? 61  THR A OG1 1 
ATOM   451  C CG2 . THR A 1 61  ? 1.930   66.900 16.750 1.00 26.54 ? 61  THR A CG2 1 
ATOM   452  N N   . THR A 1 62  ? 1.611   62.589 17.985 1.00 10.86 ? 62  THR A N   1 
ATOM   453  C CA  . THR A 1 62  ? 2.167   61.310 18.411 1.00 10.86 ? 62  THR A CA  1 
ATOM   454  C C   . THR A 1 62  ? 3.714   61.289 18.443 1.00 10.86 ? 62  THR A C   1 
ATOM   455  O O   . THR A 1 62  ? 4.263   60.292 18.959 1.00 10.86 ? 62  THR A O   1 
ATOM   456  C CB  . THR A 1 62  ? 1.633   60.181 17.487 1.00 10.86 ? 62  THR A CB  1 
ATOM   457  O OG1 . THR A 1 62  ? 2.174   60.405 16.172 1.00 17.88 ? 62  THR A OG1 1 
ATOM   458  C CG2 . THR A 1 62  ? 0.094   60.106 17.393 1.00 17.88 ? 62  THR A CG2 1 
ATOM   459  N N   . SER A 1 63  ? 4.405   62.383 18.232 1.00 16.24 ? 63  SER A N   1 
ATOM   460  C CA  . SER A 1 63  ? 5.829   62.423 18.556 1.00 16.24 ? 63  SER A CA  1 
ATOM   461  C C   . SER A 1 63  ? 6.075   62.688 20.039 1.00 16.24 ? 63  SER A C   1 
ATOM   462  O O   . SER A 1 63  ? 7.166   62.320 20.572 1.00 16.24 ? 63  SER A O   1 
ATOM   463  C CB  . SER A 1 63  ? 6.522   63.541 17.724 1.00 16.24 ? 63  SER A CB  1 
ATOM   464  O OG  . SER A 1 63  ? 6.188   63.294 16.357 1.00 36.12 ? 63  SER A OG  1 
ATOM   465  N N   . ASP A 1 64  ? 5.196   63.510 20.637 1.00 11.37 ? 64  ASP A N   1 
ATOM   466  C CA  . ASP A 1 64  ? 5.333   64.035 21.996 1.00 11.37 ? 64  ASP A CA  1 
ATOM   467  C C   . ASP A 1 64  ? 5.346   62.868 22.964 1.00 11.37 ? 64  ASP A C   1 
ATOM   468  O O   . ASP A 1 64  ? 4.829   61.778 22.622 1.00 11.37 ? 64  ASP A O   1 
ATOM   469  C CB  . ASP A 1 64  ? 4.100   64.927 22.279 1.00 11.37 ? 64  ASP A CB  1 
ATOM   470  C CG  . ASP A 1 64  ? 4.228   66.204 21.468 1.00 11.61 ? 64  ASP A CG  1 
ATOM   471  O OD1 . ASP A 1 64  ? 3.277   66.629 20.760 1.00 11.61 ? 64  ASP A OD1 1 
ATOM   472  O OD2 . ASP A 1 64  ? 5.381   66.454 21.075 1.00 11.61 ? 64  ASP A OD2 1 
ATOM   473  N N   . VAL A 1 65  ? 5.943   63.037 24.127 1.00 13.44 ? 65  VAL A N   1 
ATOM   474  C CA  . VAL A 1 65  ? 5.969   61.993 25.206 1.00 13.44 ? 65  VAL A CA  1 
ATOM   475  C C   . VAL A 1 65  ? 5.177   62.496 26.421 1.00 13.44 ? 65  VAL A C   1 
ATOM   476  O O   . VAL A 1 65  ? 5.133   63.740 26.702 1.00 13.44 ? 65  VAL A O   1 
ATOM   477  C CB  . VAL A 1 65  ? 7.443   61.691 25.584 1.00 13.44 ? 65  VAL A CB  1 
ATOM   478  C CG1 . VAL A 1 65  ? 8.119   62.983 25.954 1.00 13.47 ? 65  VAL A CG1 1 
ATOM   479  C CG2 . VAL A 1 65  ? 7.685   60.790 26.797 1.00 13.47 ? 65  VAL A CG2 1 
ATOM   480  N N   . VAL A 1 66  ? 4.610   61.549 27.154 1.00 12.27 ? 66  VAL A N   1 
ATOM   481  C CA  . VAL A 1 66  ? 3.923   61.822 28.430 1.00 12.27 ? 66  VAL A CA  1 
ATOM   482  C C   . VAL A 1 66  ? 4.759   61.388 29.609 1.00 12.27 ? 66  VAL A C   1 
ATOM   483  O O   . VAL A 1 66  ? 5.046   60.187 29.755 1.00 12.27 ? 66  VAL A O   1 
ATOM   484  C CB  . VAL A 1 66  ? 2.527   61.103 28.483 1.00 12.27 ? 66  VAL A CB  1 
ATOM   485  C CG1 . VAL A 1 66  ? 1.944   61.066 29.916 1.00 10.95 ? 66  VAL A CG1 1 
ATOM   486  C CG2 . VAL A 1 66  ? 1.487   61.688 27.515 1.00 10.95 ? 66  VAL A CG2 1 
ATOM   487  N N   . VAL A 1 67  ? 5.084   62.305 30.500 1.00 13.50 ? 67  VAL A N   1 
ATOM   488  C CA  . VAL A 1 67  ? 5.824   61.988 31.707 1.00 13.50 ? 67  VAL A CA  1 
ATOM   489  C C   . VAL A 1 67  ? 4.958   61.927 32.979 1.00 13.50 ? 67  VAL A C   1 
ATOM   490  O O   . VAL A 1 67  ? 4.190   62.885 33.257 1.00 13.50 ? 67  VAL A O   1 
ATOM   491  C CB  . VAL A 1 67  ? 7.029   62.914 31.904 1.00 13.50 ? 67  VAL A CB  1 
ATOM   492  C CG1 . VAL A 1 67  ? 7.790   62.435 33.182 1.00 12.79 ? 67  VAL A CG1 1 
ATOM   493  C CG2 . VAL A 1 67  ? 7.907   62.978 30.637 1.00 12.79 ? 67  VAL A CG2 1 
ATOM   494  N N   . ALA A 1 68  ? 5.011   60.818 33.681 1.00 8.97  ? 68  ALA A N   1 
ATOM   495  C CA  . ALA A 1 68  ? 4.231   60.625 34.891 1.00 8.97  ? 68  ALA A CA  1 
ATOM   496  C C   . ALA A 1 68  ? 5.095   60.360 36.105 1.00 8.97  ? 68  ALA A C   1 
ATOM   497  O O   . ALA A 1 68  ? 6.129   59.676 35.944 1.00 8.97  ? 68  ALA A O   1 
ATOM   498  C CB  . ALA A 1 68  ? 3.189   59.466 34.728 1.00 8.97  ? 68  ALA A CB  1 
ATOM   499  N N   . GLY A 1 69  ? 4.624   60.860 37.264 1.00 10.86 ? 69  GLY A N   1 
ATOM   500  C CA  . GLY A 1 69  ? 5.271   60.640 38.563 1.00 10.86 ? 69  GLY A CA  1 
ATOM   501  C C   . GLY A 1 69  ? 6.372   61.657 38.856 1.00 10.86 ? 69  GLY A C   1 
ATOM   502  O O   . GLY A 1 69  ? 7.211   61.455 39.788 1.00 10.86 ? 69  GLY A O   1 
ATOM   503  N N   . GLU A 1 70  ? 6.305   62.776 38.144 1.00 16.79 ? 70  GLU A N   1 
ATOM   504  C CA  . GLU A 1 70  ? 7.287   63.848 38.330 1.00 16.79 ? 70  GLU A CA  1 
ATOM   505  C C   . GLU A 1 70  ? 6.978   64.830 39.484 1.00 16.79 ? 70  GLU A C   1 
ATOM   506  O O   . GLU A 1 70  ? 5.793   65.158 39.783 1.00 16.79 ? 70  GLU A O   1 
ATOM   507  C CB  . GLU A 1 70  ? 7.515   64.510 36.955 1.00 16.79 ? 70  GLU A CB  1 
ATOM   508  C CG  . GLU A 1 70  ? 8.699   65.486 36.886 1.00 39.83 ? 70  GLU A CG  1 
ATOM   509  C CD  . GLU A 1 70  ? 9.044   65.620 35.400 1.00 39.83 ? 70  GLU A CD  1 
ATOM   510  O OE1 . GLU A 1 70  ? 10.197  65.291 34.999 1.00 39.83 ? 70  GLU A OE1 1 
ATOM   511  O OE2 . GLU A 1 70  ? 8.104   65.690 34.561 1.00 39.83 ? 70  GLU A OE2 1 
ATOM   512  N N   . PHE A 1 71  ? 8.015   65.320 40.158 1.00 14.02 ? 71  PHE A N   1 
ATOM   513  C CA  . PHE A 1 71  ? 7.829   66.435 41.044 1.00 14.02 ? 71  PHE A CA  1 
ATOM   514  C C   . PHE A 1 71  ? 8.715   67.641 40.681 1.00 14.02 ? 71  PHE A C   1 
ATOM   515  O O   . PHE A 1 71  ? 8.247   68.759 40.353 1.00 14.02 ? 71  PHE A O   1 
ATOM   516  C CB  . PHE A 1 71  ? 8.032   65.980 42.494 1.00 14.02 ? 71  PHE A CB  1 
ATOM   517  C CG  . PHE A 1 71  ? 8.145   67.177 43.492 1.00 18.71 ? 71  PHE A CG  1 
ATOM   518  C CD1 . PHE A 1 71  ? 7.036   67.947 43.776 1.00 18.71 ? 71  PHE A CD1 1 
ATOM   519  C CD2 . PHE A 1 71  ? 9.341   67.441 44.135 1.00 18.71 ? 71  PHE A CD2 1 
ATOM   520  C CE1 . PHE A 1 71  ? 7.105   68.950 44.719 1.00 18.71 ? 71  PHE A CE1 1 
ATOM   521  C CE2 . PHE A 1 71  ? 9.421   68.456 45.076 1.00 18.71 ? 71  PHE A CE2 1 
ATOM   522  C CZ  . PHE A 1 71  ? 8.294   69.203 45.388 1.00 18.71 ? 71  PHE A CZ  1 
ATOM   523  N N   . ASP A 1 72  ? 9.971   67.421 40.739 1.00 24.05 ? 72  ASP A N   1 
ATOM   524  C CA  . ASP A 1 72  ? 10.984  68.417 40.423 1.00 24.05 ? 72  ASP A CA  1 
ATOM   525  C C   . ASP A 1 72  ? 11.592  68.025 39.087 1.00 24.05 ? 72  ASP A C   1 
ATOM   526  O O   . ASP A 1 72  ? 12.302  66.988 39.020 1.00 24.05 ? 72  ASP A O   1 
ATOM   527  C CB  . ASP A 1 72  ? 12.131  68.347 41.491 1.00 24.05 ? 72  ASP A CB  1 
ATOM   528  C CG  . ASP A 1 72  ? 13.181  69.455 41.339 1.00 26.45 ? 72  ASP A CG  1 
ATOM   529  O OD1 . ASP A 1 72  ? 13.890  69.735 42.342 1.00 26.45 ? 72  ASP A OD1 1 
ATOM   530  O OD2 . ASP A 1 72  ? 13.147  70.263 40.371 1.00 26.45 ? 72  ASP A OD2 1 
ATOM   531  N N   . GLN A 1 73  ? 11.340  68.871 38.147 1.00 33.25 ? 73  GLN A N   1 
ATOM   532  C CA  . GLN A 1 73  ? 11.891  68.736 36.820 1.00 33.25 ? 73  GLN A CA  1 
ATOM   533  C C   . GLN A 1 73  ? 13.414  68.766 36.772 1.00 33.25 ? 73  GLN A C   1 
ATOM   534  O O   . GLN A 1 73  ? 14.053  68.085 35.923 1.00 33.25 ? 73  GLN A O   1 
ATOM   535  C CB  . GLN A 1 73  ? 11.363  69.937 36.052 1.00 33.25 ? 73  GLN A CB  1 
ATOM   536  C CG  . GLN A 1 73  ? 9.838   69.808 36.026 1.00 0.00  ? 73  GLN A CG  1 
ATOM   537  C CD  . GLN A 1 73  ? 9.306   70.820 35.034 1.00 47.96 ? 73  GLN A CD  1 
ATOM   538  O OE1 . GLN A 1 73  ? 8.521   70.414 34.140 1.00 47.96 ? 73  GLN A OE1 1 
ATOM   539  N NE2 . GLN A 1 73  ? 10.037  71.913 34.961 1.00 47.96 ? 73  GLN A NE2 1 
ATOM   540  N N   . GLY A 1 74  ? 13.979  69.449 37.726 1.00 37.50 ? 74  GLY A N   1 
ATOM   541  C CA  . GLY A 1 74  ? 15.438  69.543 37.770 1.00 37.50 ? 74  GLY A CA  1 
ATOM   542  C C   . GLY A 1 74  ? 16.101  68.324 38.391 1.00 37.50 ? 74  GLY A C   1 
ATOM   543  O O   . GLY A 1 74  ? 17.314  68.364 38.686 1.00 37.50 ? 74  GLY A O   1 
ATOM   544  N N   . SER A 1 75  ? 15.336  67.304 38.714 1.00 31.61 ? 75  SER A N   1 
ATOM   545  C CA  . SER A 1 75  ? 15.946  66.105 39.355 1.00 31.61 ? 75  SER A CA  1 
ATOM   546  C C   . SER A 1 75  ? 15.966  64.889 38.442 1.00 31.61 ? 75  SER A C   1 
ATOM   547  O O   . SER A 1 75  ? 14.874  64.537 37.928 1.00 31.61 ? 75  SER A O   1 
ATOM   548  C CB  . SER A 1 75  ? 15.236  65.674 40.664 1.00 31.61 ? 75  SER A CB  1 
ATOM   549  O OG  . SER A 1 75  ? 15.699  64.365 41.029 1.00 0.00  ? 75  SER A OG  1 
ATOM   550  N N   . SER A 1 76  ? 17.143  64.226 38.294 1.00 44.98 ? 76  SER A N   1 
ATOM   551  C CA  . SER A 1 76  ? 17.326  62.985 37.498 1.00 44.98 ? 76  SER A CA  1 
ATOM   552  C C   . SER A 1 76  ? 17.295  61.738 38.376 1.00 44.98 ? 76  SER A C   1 
ATOM   553  O O   . SER A 1 76  ? 17.613  60.594 37.949 1.00 44.98 ? 76  SER A O   1 
ATOM   554  C CB  . SER A 1 76  ? 18.625  63.005 36.668 1.00 44.98 ? 76  SER A CB  1 
ATOM   555  O OG  . SER A 1 76  ? 18.611  61.938 35.708 1.00 0.00  ? 76  SER A OG  1 
ATOM   556  N N   . SER A 1 77  ? 16.955  61.993 39.603 1.00 38.58 ? 77  SER A N   1 
ATOM   557  C CA  . SER A 1 77  ? 16.876  60.973 40.629 1.00 38.58 ? 77  SER A CA  1 
ATOM   558  C C   . SER A 1 77  ? 15.432  60.586 40.945 1.00 38.58 ? 77  SER A C   1 
ATOM   559  O O   . SER A 1 77  ? 15.126  59.947 41.991 1.00 38.58 ? 77  SER A O   1 
ATOM   560  C CB  . SER A 1 77  ? 17.548  61.553 41.869 1.00 38.58 ? 77  SER A CB  1 
ATOM   561  O OG  . SER A 1 77  ? 17.616  60.494 42.810 1.00 54.51 ? 77  SER A OG  1 
ATOM   562  N N   . GLU A 1 78  ? 14.509  60.980 40.075 1.00 36.45 ? 78  GLU A N   1 
ATOM   563  C CA  . GLU A 1 78  ? 13.119  60.580 40.308 1.00 36.45 ? 78  GLU A CA  1 
ATOM   564  C C   . GLU A 1 78  ? 12.749  59.393 39.435 1.00 36.45 ? 78  GLU A C   1 
ATOM   565  O O   . GLU A 1 78  ? 13.186  59.316 38.265 1.00 36.45 ? 78  GLU A O   1 
ATOM   566  C CB  . GLU A 1 78  ? 12.125  61.730 40.087 1.00 36.45 ? 78  GLU A CB  1 
ATOM   567  C CG  . GLU A 1 78  ? 12.253  62.781 41.196 1.00 23.91 ? 78  GLU A CG  1 
ATOM   568  C CD  . GLU A 1 78  ? 11.230  63.888 41.003 1.00 23.91 ? 78  GLU A CD  1 
ATOM   569  O OE1 . GLU A 1 78  ? 11.348  64.910 41.734 1.00 23.91 ? 78  GLU A OE1 1 
ATOM   570  O OE2 . GLU A 1 78  ? 10.740  64.026 39.854 1.00 23.91 ? 78  GLU A OE2 1 
ATOM   571  N N   . LYS A 1 79  ? 12.058  58.472 40.040 1.00 25.35 ? 79  LYS A N   1 
ATOM   572  C CA  . LYS A 1 79  ? 11.556  57.303 39.312 1.00 25.35 ? 79  LYS A CA  1 
ATOM   573  C C   . LYS A 1 79  ? 10.230  57.643 38.607 1.00 25.35 ? 79  LYS A C   1 
ATOM   574  O O   . LYS A 1 79  ? 9.143   57.595 39.196 1.00 25.35 ? 79  LYS A O   1 
ATOM   575  C CB  . LYS A 1 79  ? 11.418  56.108 40.275 1.00 25.35 ? 79  LYS A CB  1 
ATOM   576  C CG  . LYS A 1 79  ? 12.770  55.727 40.906 1.00 0.00  ? 79  LYS A CG  1 
ATOM   577  C CD  . LYS A 1 79  ? 12.678  54.420 41.715 1.00 0.00  ? 79  LYS A CD  1 
ATOM   578  C CE  . LYS A 1 79  ? 11.627  54.505 42.837 1.00 0.00  ? 79  LYS A CE  1 
ATOM   579  N NZ  . LYS A 1 79  ? 11.567  53.231 43.564 1.00 0.00  ? 79  LYS A NZ  1 
ATOM   580  N N   . ILE A 1 80  ? 10.341  58.241 37.474 1.00 18.18 ? 80  ILE A N   1 
ATOM   581  C CA  . ILE A 1 80  ? 9.247   58.694 36.621 1.00 18.18 ? 80  ILE A CA  1 
ATOM   582  C C   . ILE A 1 80  ? 9.004   57.688 35.479 1.00 18.18 ? 80  ILE A C   1 
ATOM   583  O O   . ILE A 1 80  ? 9.858   56.785 35.248 1.00 18.18 ? 80  ILE A O   1 
ATOM   584  C CB  . ILE A 1 80  ? 9.702   60.032 35.978 1.00 18.18 ? 80  ILE A CB  1 
ATOM   585  C CG1 . ILE A 1 80  ? 10.947  59.805 35.122 1.00 19.56 ? 80  ILE A CG1 1 
ATOM   586  C CG2 . ILE A 1 80  ? 9.895   61.167 37.007 1.00 19.56 ? 80  ILE A CG2 1 
ATOM   587  C CD1 . ILE A 1 80  ? 11.311  61.049 34.307 1.00 19.56 ? 80  ILE A CD1 1 
ATOM   588  N N   . GLN A 1 81  ? 7.841   57.778 34.823 1.00 16.62 ? 81  GLN A N   1 
ATOM   589  C CA  . GLN A 1 81  ? 7.443   56.954 33.676 1.00 16.62 ? 81  GLN A CA  1 
ATOM   590  C C   . GLN A 1 81  ? 7.354   57.798 32.427 1.00 16.62 ? 81  GLN A C   1 
ATOM   591  O O   . GLN A 1 81  ? 6.617   58.800 32.441 1.00 16.62 ? 81  GLN A O   1 
ATOM   592  C CB  . GLN A 1 81  ? 6.122   56.199 33.948 1.00 16.62 ? 81  GLN A CB  1 
ATOM   593  C CG  . GLN A 1 81  ? 6.287   55.259 35.149 1.00 8.78  ? 81  GLN A CG  1 
ATOM   594  C CD  . GLN A 1 81  ? 4.921   54.668 35.455 1.00 8.78  ? 81  GLN A CD  1 
ATOM   595  O OE1 . GLN A 1 81  ? 4.184   54.435 34.462 1.00 8.78  ? 81  GLN A OE1 1 
ATOM   596  N NE2 . GLN A 1 81  ? 4.628   54.451 36.748 1.00 8.78  ? 81  GLN A NE2 1 
ATOM   597  N N   . LYS A 1 82  ? 8.097   57.492 31.394 1.00 22.58 ? 82  LYS A N   1 
ATOM   598  C CA  . LYS A 1 82  ? 7.937   58.263 30.146 1.00 22.58 ? 82  LYS A CA  1 
ATOM   599  C C   . LYS A 1 82  ? 7.181   57.453 29.117 1.00 22.58 ? 82  LYS A C   1 
ATOM   600  O O   . LYS A 1 82  ? 7.590   56.304 28.853 1.00 22.58 ? 82  LYS A O   1 
ATOM   601  C CB  . LYS A 1 82  ? 9.285   58.647 29.512 1.00 22.58 ? 82  LYS A CB  1 
ATOM   602  C CG  . LYS A 1 82  ? 10.199  59.402 30.496 1.00 50.78 ? 82  LYS A CG  1 
ATOM   603  C CD  . LYS A 1 82  ? 11.600  59.598 29.897 1.00 50.78 ? 82  LYS A CD  1 
ATOM   604  C CE  . LYS A 1 82  ? 12.621  60.059 30.966 1.00 50.78 ? 82  LYS A CE  1 
ATOM   605  N NZ  . LYS A 1 82  ? 13.958  60.178 30.372 1.00 0.00  ? 82  LYS A NZ  1 
ATOM   606  N N   . LEU A 1 83  ? 6.006   57.919 28.780 1.00 12.25 ? 83  LEU A N   1 
ATOM   607  C CA  . LEU A 1 83  ? 4.983   57.100 28.115 1.00 12.25 ? 83  LEU A CA  1 
ATOM   608  C C   . LEU A 1 83  ? 4.749   57.564 26.684 1.00 12.25 ? 83  LEU A C   1 
ATOM   609  O O   . LEU A 1 83  ? 4.793   58.784 26.423 1.00 12.25 ? 83  LEU A O   1 
ATOM   610  C CB  . LEU A 1 83  ? 3.659   57.128 28.917 1.00 12.25 ? 83  LEU A CB  1 
ATOM   611  C CG  . LEU A 1 83  ? 3.816   56.625 30.368 1.00 8.54  ? 83  LEU A CG  1 
ATOM   612  C CD1 . LEU A 1 83  ? 2.655   57.054 31.298 1.00 8.54  ? 83  LEU A CD1 1 
ATOM   613  C CD2 . LEU A 1 83  ? 3.938   55.091 30.404 1.00 8.54  ? 83  LEU A CD2 1 
ATOM   614  N N   . LYS A 1 84  ? 4.654   56.643 25.746 1.00 12.10 ? 84  LYS A N   1 
ATOM   615  C CA  . LYS A 1 84  ? 4.523   57.004 24.350 1.00 12.10 ? 84  LYS A CA  1 
ATOM   616  C C   . LYS A 1 84  ? 3.059   57.063 23.990 1.00 12.10 ? 84  LYS A C   1 
ATOM   617  O O   . LYS A 1 84  ? 2.229   56.536 24.771 1.00 12.10 ? 84  LYS A O   1 
ATOM   618  C CB  . LYS A 1 84  ? 5.349   56.107 23.379 1.00 12.10 ? 84  LYS A CB  1 
ATOM   619  C CG  . LYS A 1 84  ? 6.833   56.205 23.765 1.00 54.35 ? 84  LYS A CG  1 
ATOM   620  C CD  . LYS A 1 84  ? 7.717   55.311 22.893 1.00 54.35 ? 84  LYS A CD  1 
ATOM   621  C CE  . LYS A 1 84  ? 7.353   53.822 23.040 1.00 0.00  ? 84  LYS A CE  1 
ATOM   622  N NZ  . LYS A 1 84  ? 8.247   53.002 22.213 1.00 0.00  ? 84  LYS A NZ  1 
ATOM   623  N N   . ILE A 1 85  ? 2.758   57.843 23.008 1.00 17.53 ? 85  ILE A N   1 
ATOM   624  C CA  . ILE A 1 85  ? 1.363   58.094 22.572 1.00 17.53 ? 85  ILE A CA  1 
ATOM   625  C C   . ILE A 1 85  ? 1.013   57.285 21.307 1.00 17.53 ? 85  ILE A C   1 
ATOM   626  O O   . ILE A 1 85  ? 1.705   57.416 20.255 1.00 17.53 ? 85  ILE A O   1 
ATOM   627  C CB  . ILE A 1 85  ? 1.234   59.619 22.311 1.00 17.53 ? 85  ILE A CB  1 
ATOM   628  C CG1 . ILE A 1 85  ? 1.481   60.436 23.601 1.00 12.12 ? 85  ILE A CG1 1 
ATOM   629  C CG2 . ILE A 1 85  ? -0.079  60.057 21.641 1.00 12.12 ? 85  ILE A CG2 1 
ATOM   630  C CD1 . ILE A 1 85  ? 1.467   61.967 23.383 1.00 12.12 ? 85  ILE A CD1 1 
ATOM   631  N N   . ALA A 1 86  ? -0.084  56.538 21.357 1.00 6.51  ? 86  ALA A N   1 
ATOM   632  C CA  . ALA A 1 86  ? -0.656  55.810 20.212 1.00 6.51  ? 86  ALA A CA  1 
ATOM   633  C C   . ALA A 1 86  ? -1.438  56.662 19.209 1.00 6.51  ? 86  ALA A C   1 
ATOM   634  O O   . ALA A 1 86  ? -1.121  56.681 17.986 1.00 6.51  ? 86  ALA A O   1 
ATOM   635  C CB  . ALA A 1 86  ? -1.576  54.726 20.718 1.00 6.51  ? 86  ALA A CB  1 
ATOM   636  N N   . LYS A 1 87  ? -2.532  57.269 19.658 1.00 10.03 ? 87  LYS A N   1 
ATOM   637  C CA  . LYS A 1 87  ? -3.350  58.190 18.869 1.00 10.03 ? 87  LYS A CA  1 
ATOM   638  C C   . LYS A 1 87  ? -3.752  59.393 19.680 1.00 10.03 ? 87  LYS A C   1 
ATOM   639  O O   . LYS A 1 87  ? -3.978  59.273 20.909 1.00 10.03 ? 87  LYS A O   1 
ATOM   640  C CB  . LYS A 1 87  ? -4.741  57.670 18.550 1.00 10.03 ? 87  LYS A CB  1 
ATOM   641  C CG  . LYS A 1 87  ? -4.839  56.904 17.231 1.00 43.06 ? 87  LYS A CG  1 
ATOM   642  C CD  . LYS A 1 87  ? -6.202  57.186 16.574 1.00 43.06 ? 87  LYS A CD  1 
ATOM   643  C CE  . LYS A 1 87  ? -6.331  58.690 16.290 1.00 43.06 ? 87  LYS A CE  1 
ATOM   644  N NZ  . LYS A 1 87  ? -7.634  58.955 15.674 1.00 43.06 ? 87  LYS A NZ  1 
ATOM   645  N N   . VAL A 1 88  ? -4.074  60.421 18.970 1.00 13.95 ? 88  VAL A N   1 
ATOM   646  C CA  . VAL A 1 88  ? -4.536  61.714 19.534 1.00 13.95 ? 88  VAL A CA  1 
ATOM   647  C C   . VAL A 1 88  ? -5.920  62.120 18.995 1.00 13.95 ? 88  VAL A C   1 
ATOM   648  O O   . VAL A 1 88  ? -6.223  61.917 17.789 1.00 13.95 ? 88  VAL A O   1 
ATOM   649  C CB  . VAL A 1 88  ? -3.541  62.853 19.181 1.00 13.95 ? 88  VAL A CB  1 
ATOM   650  C CG1 . VAL A 1 88  ? -4.152  64.217 19.626 1.00 4.47  ? 88  VAL A CG1 1 
ATOM   651  C CG2 . VAL A 1 88  ? -2.064  62.572 19.638 1.00 4.47  ? 88  VAL A CG2 1 
ATOM   652  N N   . PHE A 1 89  ? -6.851  62.334 19.912 1.00 12.58 ? 89  PHE A N   1 
ATOM   653  C CA  . PHE A 1 89  ? -8.272  62.588 19.570 1.00 12.58 ? 89  PHE A CA  1 
ATOM   654  C C   . PHE A 1 89  ? -8.666  63.992 20.001 1.00 12.58 ? 89  PHE A C   1 
ATOM   655  O O   . PHE A 1 89  ? -9.067  64.177 21.183 1.00 12.58 ? 89  PHE A O   1 
ATOM   656  C CB  . PHE A 1 89  ? -9.109  61.594 20.364 1.00 12.58 ? 89  PHE A CB  1 
ATOM   657  C CG  . PHE A 1 89  ? -8.864  60.149 19.904 1.00 14.64 ? 89  PHE A CG  1 
ATOM   658  C CD1 . PHE A 1 89  ? -7.980  59.389 20.600 1.00 14.64 ? 89  PHE A CD1 1 
ATOM   659  C CD2 . PHE A 1 89  ? -9.540  59.626 18.812 1.00 14.64 ? 89  PHE A CD2 1 
ATOM   660  C CE1 . PHE A 1 89  ? -7.754  58.080 20.253 1.00 14.64 ? 89  PHE A CE1 1 
ATOM   661  C CE2 . PHE A 1 89  ? -9.301  58.294 18.434 1.00 14.64 ? 89  PHE A CE2 1 
ATOM   662  C CZ  . PHE A 1 89  ? -8.404  57.505 19.182 1.00 14.64 ? 89  PHE A CZ  1 
ATOM   663  N N   . LYS A 1 90  ? -8.510  64.985 19.107 1.00 15.73 ? 90  LYS A N   1 
ATOM   664  C CA  . LYS A 1 90  ? -9.113  66.291 19.427 1.00 15.73 ? 90  LYS A CA  1 
ATOM   665  C C   . LYS A 1 90  ? -10.666 66.339 19.330 1.00 15.73 ? 90  LYS A C   1 
ATOM   666  O O   . LYS A 1 90  ? -11.260 65.658 18.467 1.00 15.73 ? 90  LYS A O   1 
ATOM   667  C CB  . LYS A 1 90  ? -8.484  67.262 18.461 1.00 15.73 ? 90  LYS A CB  1 
ATOM   668  C CG  . LYS A 1 90  ? -9.094  68.653 18.631 1.00 37.29 ? 90  LYS A CG  1 
ATOM   669  C CD  . LYS A 1 90  ? -8.232  69.651 17.874 1.00 37.29 ? 90  LYS A CD  1 
ATOM   670  C CE  . LYS A 1 90  ? -7.967  69.171 16.442 1.00 37.29 ? 90  LYS A CE  1 
ATOM   671  N NZ  . LYS A 1 90  ? -6.839  69.934 15.875 1.00 37.29 ? 90  LYS A NZ  1 
ATOM   672  N N   . ASN A 1 91  ? -11.393 67.088 20.186 1.00 14.89 ? 91  ASN A N   1 
ATOM   673  C CA  . ASN A 1 91  ? -12.834 67.298 20.044 1.00 14.89 ? 91  ASN A CA  1 
ATOM   674  C C   . ASN A 1 91  ? -13.201 68.174 18.828 1.00 14.89 ? 91  ASN A C   1 
ATOM   675  O O   . ASN A 1 91  ? -12.475 69.128 18.395 1.00 14.89 ? 91  ASN A O   1 
ATOM   676  C CB  . ASN A 1 91  ? -13.324 67.908 21.349 1.00 14.89 ? 91  ASN A CB  1 
ATOM   677  C CG  . ASN A 1 91  ? -14.834 67.875 21.436 1.00 8.63  ? 91  ASN A CG  1 
ATOM   678  O OD1 . ASN A 1 91  ? -15.495 68.482 20.559 1.00 8.63  ? 91  ASN A OD1 1 
ATOM   679  N ND2 . ASN A 1 91  ? -15.275 67.814 22.663 1.00 8.63  ? 91  ASN A ND2 1 
ATOM   680  N N   . SER A 1 92  ? -14.027 67.606 18.023 1.00 21.93 ? 92  SER A N   1 
ATOM   681  C CA  . SER A 1 92  ? -14.202 68.183 16.692 1.00 21.93 ? 92  SER A CA  1 
ATOM   682  C C   . SER A 1 92  ? -15.050 69.428 16.757 1.00 21.93 ? 92  SER A C   1 
ATOM   683  O O   . SER A 1 92  ? -15.118 70.163 15.761 1.00 21.93 ? 92  SER A O   1 
ATOM   684  C CB  . SER A 1 92  ? -14.861 67.143 15.725 1.00 21.93 ? 92  SER A CB  1 
ATOM   685  O OG  . SER A 1 92  ? -16.222 66.870 16.096 1.00 41.37 ? 92  SER A OG  1 
ATOM   686  N N   . LYS A 1 93  ? -15.610 69.695 17.895 1.00 16.75 ? 93  LYS A N   1 
ATOM   687  C CA  . LYS A 1 93  ? -16.318 70.984 18.066 1.00 16.75 ? 93  LYS A CA  1 
ATOM   688  C C   . LYS A 1 93  ? -15.427 72.113 18.625 1.00 16.75 ? 93  LYS A C   1 
ATOM   689  O O   . LYS A 1 93  ? -15.937 73.185 19.036 1.00 16.75 ? 93  LYS A O   1 
ATOM   690  C CB  . LYS A 1 93  ? -17.539 70.815 18.930 1.00 16.75 ? 93  LYS A CB  1 
ATOM   691  C CG  . LYS A 1 93  ? -18.564 69.821 18.376 1.00 38.39 ? 93  LYS A CG  1 
ATOM   692  C CD  . LYS A 1 93  ? -19.777 69.814 19.314 1.00 38.39 ? 93  LYS A CD  1 
ATOM   693  C CE  . LYS A 1 93  ? -20.729 68.636 19.036 1.00 0.00  ? 93  LYS A CE  1 
ATOM   694  N NZ  . LYS A 1 93  ? -21.757 68.567 20.083 1.00 0.00  ? 93  LYS A NZ  1 
ATOM   695  N N   . TYR A 1 94  ? -14.108 71.838 18.599 1.00 15.97 ? 94  TYR A N   1 
ATOM   696  C CA  . TYR A 1 94  ? -13.099 72.763 19.028 1.00 15.97 ? 94  TYR A CA  1 
ATOM   697  C C   . TYR A 1 94  ? -12.968 73.943 18.068 1.00 15.97 ? 94  TYR A C   1 
ATOM   698  O O   . TYR A 1 94  ? -12.890 73.773 16.823 1.00 15.97 ? 94  TYR A O   1 
ATOM   699  C CB  . TYR A 1 94  ? -11.725 72.084 19.238 1.00 15.97 ? 94  TYR A CB  1 
ATOM   700  C CG  . TYR A 1 94  ? -10.575 73.118 19.408 1.00 16.24 ? 94  TYR A CG  1 
ATOM   701  C CD1 . TYR A 1 94  ? -10.496 73.862 20.566 1.00 16.24 ? 94  TYR A CD1 1 
ATOM   702  C CD2 . TYR A 1 94  ? -9.618  73.291 18.431 1.00 16.24 ? 94  TYR A CD2 1 
ATOM   703  C CE1 . TYR A 1 94  ? -9.476  74.783 20.757 1.00 16.24 ? 94  TYR A CE1 1 
ATOM   704  C CE2 . TYR A 1 94  ? -8.591  74.215 18.614 1.00 16.24 ? 94  TYR A CE2 1 
ATOM   705  C CZ  . TYR A 1 94  ? -8.536  74.960 19.777 1.00 16.24 ? 94  TYR A CZ  1 
ATOM   706  O OH  . TYR A 1 94  ? -7.434  75.840 20.029 1.00 16.24 ? 94  TYR A OH  1 
ATOM   707  N N   . ASN A 1 95  ? -13.101 75.103 18.634 1.00 16.00 ? 95  ASN A N   1 
ATOM   708  C CA  . ASN A 1 95  ? -13.195 76.277 17.809 1.00 16.00 ? 95  ASN A CA  1 
ATOM   709  C C   . ASN A 1 95  ? -11.938 77.052 18.056 1.00 16.00 ? 95  ASN A C   1 
ATOM   710  O O   . ASN A 1 95  ? -11.749 77.590 19.174 1.00 16.00 ? 95  ASN A O   1 
ATOM   711  C CB  . ASN A 1 95  ? -14.421 77.132 18.206 1.00 16.00 ? 95  ASN A CB  1 
ATOM   712  C CG  . ASN A 1 95  ? -14.612 78.402 17.376 1.00 33.98 ? 95  ASN A CG  1 
ATOM   713  O OD1 . ASN A 1 95  ? -13.758 78.802 16.548 1.00 33.98 ? 95  ASN A OD1 1 
ATOM   714  N ND2 . ASN A 1 95  ? -15.878 78.758 17.317 1.00 33.98 ? 95  ASN A ND2 1 
ATOM   715  N N   . SER A 1 96  ? -11.081 76.922 17.118 1.00 29.87 ? 96  SER A N   1 
ATOM   716  C CA  . SER A 1 96  ? -9.793  77.556 17.259 1.00 29.87 ? 96  SER A CA  1 
ATOM   717  C C   . SER A 1 96  ? -9.880  79.077 17.213 1.00 29.87 ? 96  SER A C   1 
ATOM   718  O O   . SER A 1 96  ? -8.867  79.761 17.500 1.00 29.87 ? 96  SER A O   1 
ATOM   719  C CB  . SER A 1 96  ? -8.924  77.032 16.124 1.00 29.87 ? 96  SER A CB  1 
ATOM   720  O OG  . SER A 1 96  ? -9.581  77.287 14.884 1.00 42.80 ? 96  SER A OG  1 
ATOM   721  N N   . LEU A 1 97  ? -11.078 79.615 17.008 1.00 20.65 ? 97  LEU A N   1 
ATOM   722  C CA  . LEU A 1 97  ? -11.186 81.049 17.029 1.00 20.65 ? 97  LEU A CA  1 
ATOM   723  C C   . LEU A 1 97  ? -11.707 81.592 18.358 1.00 20.65 ? 97  LEU A C   1 
ATOM   724  O O   . LEU A 1 97  ? -11.135 82.509 19.006 1.00 20.65 ? 97  LEU A O   1 
ATOM   725  C CB  . LEU A 1 97  ? -12.063 81.484 15.837 1.00 20.65 ? 97  LEU A CB  1 
ATOM   726  C CG  . LEU A 1 97  ? -11.245 81.804 14.541 1.00 45.32 ? 97  LEU A CG  1 
ATOM   727  C CD1 . LEU A 1 97  ? -10.277 80.700 14.076 1.00 45.32 ? 97  LEU A CD1 1 
ATOM   728  C CD2 . LEU A 1 97  ? -12.136 82.192 13.349 1.00 45.32 ? 97  LEU A CD2 1 
ATOM   729  N N   . THR A 1 98  ? -12.608 80.886 18.949 1.00 13.45 ? 98  THR A N   1 
ATOM   730  C CA  . THR A 1 98  ? -13.003 81.291 20.300 1.00 13.45 ? 98  THR A CA  1 
ATOM   731  C C   . THR A 1 98  ? -12.350 80.479 21.407 1.00 13.45 ? 98  THR A C   1 
ATOM   732  O O   . THR A 1 98  ? -12.612 80.811 22.573 1.00 13.45 ? 98  THR A O   1 
ATOM   733  C CB  . THR A 1 98  ? -14.515 81.175 20.451 1.00 13.45 ? 98  THR A CB  1 
ATOM   734  O OG1 . THR A 1 98  ? -14.921 79.778 20.373 1.00 24.87 ? 98  THR A OG1 1 
ATOM   735  C CG2 . THR A 1 98  ? -15.232 81.963 19.320 1.00 24.87 ? 98  THR A CG2 1 
ATOM   736  N N   . ILE A 1 99  ? -11.556 79.475 21.091 1.00 23.69 ? 99  ILE A N   1 
ATOM   737  C CA  . ILE A 1 99  ? -10.894 78.567 22.062 1.00 23.69 ? 99  ILE A CA  1 
ATOM   738  C C   . ILE A 1 99  ? -11.910 77.774 22.879 1.00 23.69 ? 99  ILE A C   1 
ATOM   739  O O   . ILE A 1 99  ? -11.553 77.201 23.932 1.00 23.69 ? 99  ILE A O   1 
ATOM   740  C CB  . ILE A 1 99  ? -9.817  79.275 22.949 1.00 23.69 ? 99  ILE A CB  1 
ATOM   741  C CG1 . ILE A 1 99  ? -9.028  80.303 22.153 1.00 30.58 ? 99  ILE A CG1 1 
ATOM   742  C CG2 . ILE A 1 99  ? -8.784  78.339 23.620 1.00 30.58 ? 99  ILE A CG2 1 
ATOM   743  C CD1 . ILE A 1 99  ? -7.911  80.897 23.030 1.00 30.58 ? 99  ILE A CD1 1 
ATOM   744  N N   . ASN A 1 100 ? -13.152 77.724 22.378 1.00 8.65  ? 100 ASN A N   1 
ATOM   745  C CA  . ASN A 1 100 ? -14.213 76.940 23.011 1.00 8.65  ? 100 ASN A CA  1 
ATOM   746  C C   . ASN A 1 100 ? -14.134 75.441 22.693 1.00 8.65  ? 100 ASN A C   1 
ATOM   747  O O   . ASN A 1 100 ? -13.706 75.062 21.563 1.00 8.65  ? 100 ASN A O   1 
ATOM   748  C CB  . ASN A 1 100 ? -15.603 77.563 22.700 1.00 8.65  ? 100 ASN A CB  1 
ATOM   749  C CG  . ASN A 1 100 ? -16.696 76.947 23.574 1.00 18.91 ? 100 ASN A CG  1 
ATOM   750  O OD1 . ASN A 1 100 ? -17.849 76.814 23.109 1.00 18.91 ? 100 ASN A OD1 1 
ATOM   751  N ND2 . ASN A 1 100 ? -16.498 76.989 24.874 1.00 18.91 ? 100 ASN A ND2 1 
ATOM   752  N N   . ASN A 1 101 ? -14.600 74.635 23.608 1.00 11.67 ? 101 ASN A N   1 
ATOM   753  C CA  . ASN A 1 101 ? -14.589 73.139 23.593 1.00 11.67 ? 101 ASN A CA  1 
ATOM   754  C C   . ASN A 1 101 ? -13.158 72.582 23.562 1.00 11.67 ? 101 ASN A C   1 
ATOM   755  O O   . ASN A 1 101 ? -12.781 71.853 22.624 1.00 11.67 ? 101 ASN A O   1 
ATOM   756  C CB  . ASN A 1 101 ? -15.374 72.642 22.356 1.00 11.67 ? 101 ASN A CB  1 
ATOM   757  C CG  . ASN A 1 101 ? -16.849 73.106 22.436 1.00 16.45 ? 101 ASN A CG  1 
ATOM   758  O OD1 . ASN A 1 101 ? -17.475 72.966 23.514 1.00 16.45 ? 101 ASN A OD1 1 
ATOM   759  N ND2 . ASN A 1 101 ? -17.266 73.973 21.508 1.00 16.45 ? 101 ASN A ND2 1 
ATOM   760  N N   . ASP A 1 102 ? -12.340 73.066 24.481 1.00 11.65 ? 102 ASP A N   1 
ATOM   761  C CA  . ASP A 1 102 ? -10.812 72.995 24.454 1.00 11.65 ? 102 ASP A CA  1 
ATOM   762  C C   . ASP A 1 102 ? -10.242 71.721 25.069 1.00 11.65 ? 102 ASP A C   1 
ATOM   763  O O   . ASP A 1 102 ? -9.847  71.667 26.263 1.00 11.65 ? 102 ASP A O   1 
ATOM   764  C CB  . ASP A 1 102 ? -10.163 74.233 25.133 1.00 11.65 ? 102 ASP A CB  1 
ATOM   765  C CG  . ASP A 1 102 ? -8.640  74.312 24.934 1.00 8.64  ? 102 ASP A CG  1 
ATOM   766  O OD1 . ASP A 1 102 ? -8.008  75.200 25.551 1.00 8.64  ? 102 ASP A OD1 1 
ATOM   767  O OD2 . ASP A 1 102 ? -8.087  73.754 23.957 1.00 8.64  ? 102 ASP A OD2 1 
ATOM   768  N N   . ILE A 1 103 ? -10.412 70.654 24.382 1.00 9.85  ? 103 ILE A N   1 
ATOM   769  C CA  . ILE A 1 103 ? -10.088 69.326 25.019 1.00 9.85  ? 103 ILE A CA  1 
ATOM   770  C C   . ILE A 1 103 ? -9.585  68.323 23.985 1.00 9.85  ? 103 ILE A C   1 
ATOM   771  O O   . ILE A 1 103 ? -10.027 68.309 22.812 1.00 9.85  ? 103 ILE A O   1 
ATOM   772  C CB  . ILE A 1 103 ? -11.274 68.711 25.824 1.00 9.85  ? 103 ILE A CB  1 
ATOM   773  C CG1 . ILE A 1 103 ? -10.908 67.548 26.771 1.00 3.30  ? 103 ILE A CG1 1 
ATOM   774  C CG2 . ILE A 1 103 ? -12.566 68.408 24.952 1.00 3.30  ? 103 ILE A CG2 1 
ATOM   775  C CD1 . ILE A 1 103 ? -12.149 66.717 27.260 1.00 3.30  ? 103 ILE A CD1 1 
ATOM   776  N N   . THR A 1 104 ? -8.623  67.551 24.402 1.00 13.60 ? 104 THR A N   1 
ATOM   777  C CA  . THR A 1 104 ? -8.034  66.452 23.642 1.00 13.60 ? 104 THR A CA  1 
ATOM   778  C C   . THR A 1 104 ? -7.834  65.219 24.510 1.00 13.60 ? 104 THR A C   1 
ATOM   779  O O   . THR A 1 104 ? -7.390  65.392 25.667 1.00 13.60 ? 104 THR A O   1 
ATOM   780  C CB  . THR A 1 104 ? -6.718  66.950 23.061 1.00 13.60 ? 104 THR A CB  1 
ATOM   781  O OG1 . THR A 1 104 ? -7.054  67.684 21.939 1.00 12.73 ? 104 THR A OG1 1 
ATOM   782  C CG2 . THR A 1 104 ? -5.731  65.849 22.604 1.00 12.73 ? 104 THR A CG2 1 
ATOM   783  N N   . LEU A 1 105 ? -8.085  64.038 23.931 1.00 14.89 ? 105 LEU A N   1 
ATOM   784  C CA  . LEU A 1 105 ? -7.654  62.742 24.528 1.00 14.89 ? 105 LEU A CA  1 
ATOM   785  C C   . LEU A 1 105 ? -6.434  62.133 23.864 1.00 14.89 ? 105 LEU A C   1 
ATOM   786  O O   . LEU A 1 105 ? -6.276  62.103 22.610 1.00 14.89 ? 105 LEU A O   1 
ATOM   787  C CB  . LEU A 1 105 ? -8.746  61.690 24.534 1.00 14.89 ? 105 LEU A CB  1 
ATOM   788  C CG  . LEU A 1 105 ? -9.974  62.028 25.353 1.00 6.08  ? 105 LEU A CG  1 
ATOM   789  C CD1 . LEU A 1 105 ? -11.130 61.071 24.967 1.00 6.08  ? 105 LEU A CD1 1 
ATOM   790  C CD2 . LEU A 1 105 ? -9.676  61.855 26.863 1.00 6.08  ? 105 LEU A CD2 1 
ATOM   791  N N   . LEU A 1 106 ? -5.544  61.694 24.708 1.00 10.96 ? 106 LEU A N   1 
ATOM   792  C CA  . LEU A 1 106 ? -4.440  60.939 24.195 1.00 10.96 ? 106 LEU A CA  1 
ATOM   793  C C   . LEU A 1 106 ? -4.581  59.471 24.617 1.00 10.96 ? 106 LEU A C   1 
ATOM   794  O O   . LEU A 1 106 ? -4.531  59.181 25.840 1.00 10.96 ? 106 LEU A O   1 
ATOM   795  C CB  . LEU A 1 106 ? -3.090  61.511 24.719 1.00 10.96 ? 106 LEU A CB  1 
ATOM   796  C CG  . LEU A 1 106 ? -2.994  63.057 24.709 1.00 10.35 ? 106 LEU A CG  1 
ATOM   797  C CD1 . LEU A 1 106 ? -1.824  63.573 25.562 1.00 10.35 ? 106 LEU A CD1 1 
ATOM   798  C CD2 . LEU A 1 106 ? -2.988  63.648 23.294 1.00 10.35 ? 106 LEU A CD2 1 
ATOM   799  N N   . LYS A 1 107 ? -4.521  58.576 23.644 1.00 12.64 ? 107 LYS A N   1 
ATOM   800  C CA  . LYS A 1 107 ? -4.395  57.141 24.006 1.00 12.64 ? 107 LYS A CA  1 
ATOM   801  C C   . LYS A 1 107 ? -2.926  56.721 24.057 1.00 12.64 ? 107 LYS A C   1 
ATOM   802  O O   . LYS A 1 107 ? -2.161  57.014 23.118 1.00 12.64 ? 107 LYS A O   1 
ATOM   803  C CB  . LYS A 1 107 ? -5.227  56.379 22.919 1.00 12.64 ? 107 LYS A CB  1 
ATOM   804  C CG  . LYS A 1 107 ? -5.042  54.869 22.728 1.00 34.12 ? 107 LYS A CG  1 
ATOM   805  C CD  . LYS A 1 107 ? -5.794  54.001 23.707 1.00 34.12 ? 107 LYS A CD  1 
ATOM   806  C CE  . LYS A 1 107 ? -6.120  52.655 23.027 1.00 34.12 ? 107 LYS A CE  1 
ATOM   807  N NZ  . LYS A 1 107 ? -7.107  51.912 23.831 1.00 34.12 ? 107 LYS A NZ  1 
ATOM   808  N N   . LEU A 1 108 ? -2.443  56.218 25.171 1.00 14.77 ? 108 LEU A N   1 
ATOM   809  C CA  . LEU A 1 108 ? -1.016  55.810 25.294 1.00 14.77 ? 108 LEU A CA  1 
ATOM   810  C C   . LEU A 1 108 ? -0.644  54.489 24.583 1.00 14.77 ? 108 LEU A C   1 
ATOM   811  O O   . LEU A 1 108 ? -1.437  53.507 24.611 1.00 14.77 ? 108 LEU A O   1 
ATOM   812  C CB  . LEU A 1 108 ? -0.646  55.715 26.784 1.00 14.77 ? 108 LEU A CB  1 
ATOM   813  C CG  . LEU A 1 108 ? -0.937  57.000 27.595 1.00 8.88  ? 108 LEU A CG  1 
ATOM   814  C CD1 . LEU A 1 108 ? -0.531  56.792 29.058 1.00 8.88  ? 108 LEU A CD1 1 
ATOM   815  C CD2 . LEU A 1 108 ? -0.241  58.252 27.019 1.00 8.88  ? 108 LEU A CD2 1 
ATOM   816  N N   . SER A 1 109 ? 0.499   54.465 23.889 1.00 16.60 ? 109 SER A N   1 
ATOM   817  C CA  . SER A 1 109 ? 0.976   53.196 23.239 1.00 16.60 ? 109 SER A CA  1 
ATOM   818  C C   . SER A 1 109 ? 1.446   52.272 24.356 1.00 16.60 ? 109 SER A C   1 
ATOM   819  O O   . SER A 1 109 ? 1.416   51.010 24.273 1.00 16.60 ? 109 SER A O   1 
ATOM   820  C CB  . SER A 1 109 ? 2.220   53.413 22.349 1.00 16.60 ? 109 SER A CB  1 
ATOM   821  O OG  . SER A 1 109 ? 1.922   54.342 21.330 1.00 39.52 ? 109 SER A OG  1 
ATOM   822  N N   . THR A 1 110 ? 1.934   52.903 25.388 1.00 23.57 ? 110 THR A N   1 
ATOM   823  C CA  . THR A 1 110 ? 2.437   52.128 26.527 1.00 23.57 ? 110 THR A CA  1 
ATOM   824  C C   . THR A 1 110 ? 1.728   52.507 27.824 1.00 23.57 ? 110 THR A C   1 
ATOM   825  O O   . THR A 1 110 ? 1.844   53.680 28.238 1.00 23.57 ? 110 THR A O   1 
ATOM   826  C CB  . THR A 1 110 ? 3.950   52.315 26.685 1.00 23.57 ? 110 THR A CB  1 
ATOM   827  O OG1 . THR A 1 110 ? 4.234   53.586 27.263 1.00 32.55 ? 110 THR A OG1 1 
ATOM   828  C CG2 . THR A 1 110 ? 4.695   52.162 25.339 1.00 32.55 ? 110 THR A CG2 1 
ATOM   829  N N   . ALA A 1 111 ? 0.914   51.603 28.378 1.00 9.47  ? 111 ALA A N   1 
ATOM   830  C CA  . ALA A 1 111 ? 0.179   51.833 29.601 1.00 9.47  ? 111 ALA A CA  1 
ATOM   831  C C   . ALA A 1 111 ? 1.004   52.348 30.788 1.00 9.47  ? 111 ALA A C   1 
ATOM   832  O O   . ALA A 1 111 ? 2.143   51.888 31.040 1.00 9.47  ? 111 ALA A O   1 
ATOM   833  C CB  . ALA A 1 111 ? -0.655  50.603 29.981 1.00 9.47  ? 111 ALA A CB  1 
ATOM   834  N N   . ALA A 1 112 ? 0.408   53.272 31.560 1.00 8.86  ? 112 ALA A N   1 
ATOM   835  C CA  . ALA A 1 112 ? 0.893   53.692 32.866 1.00 8.86  ? 112 ALA A CA  1 
ATOM   836  C C   . ALA A 1 112 ? 0.835   52.574 33.888 1.00 8.86  ? 112 ALA A C   1 
ATOM   837  O O   . ALA A 1 112 ? -0.103  51.755 33.928 1.00 8.86  ? 112 ALA A O   1 
ATOM   838  C CB  . ALA A 1 112 ? 0.270   54.966 33.411 1.00 8.86  ? 112 ALA A CB  1 
ATOM   839  N N   . SER A 1 113 ? 1.810   52.553 34.760 1.00 13.26 ? 113 SER A N   1 
ATOM   840  C CA  . SER A 1 113 ? 1.867   51.619 35.815 1.00 13.26 ? 113 SER A CA  1 
ATOM   841  C C   . SER A 1 113 ? 1.520   52.290 37.115 1.00 13.26 ? 113 SER A C   1 
ATOM   842  O O   . SER A 1 113 ? 2.380   53.014 37.684 1.00 13.26 ? 113 SER A O   1 
ATOM   843  C CB  . SER A 1 113 ? 3.307   51.032 35.852 1.00 13.26 ? 113 SER A CB  1 
ATOM   844  O OG  . SER A 1 113 ? 3.596   50.619 37.182 1.00 33.63 ? 113 SER A OG  1 
ATOM   845  N N   . PHE A 1 114 ? 0.266   52.144 37.530 1.00 15.59 ? 114 PHE A N   1 
ATOM   846  C CA  . PHE A 1 114 ? -0.249  52.753 38.753 1.00 15.59 ? 114 PHE A CA  1 
ATOM   847  C C   . PHE A 1 114 ? 0.397   52.253 40.058 1.00 15.59 ? 114 PHE A C   1 
ATOM   848  O O   . PHE A 1 114 ? 0.739   51.035 40.210 1.00 15.59 ? 114 PHE A O   1 
ATOM   849  C CB  . PHE A 1 114 ? -1.777  52.757 38.895 1.00 15.59 ? 114 PHE A CB  1 
ATOM   850  C CG  . PHE A 1 114 ? -2.614  53.672 37.983 1.00 13.29 ? 114 PHE A CG  1 
ATOM   851  C CD1 . PHE A 1 114 ? -2.035  54.467 37.000 1.00 13.29 ? 114 PHE A CD1 1 
ATOM   852  C CD2 . PHE A 1 114 ? -3.989  53.667 38.118 1.00 13.29 ? 114 PHE A CD2 1 
ATOM   853  C CE1 . PHE A 1 114 ? -2.831  55.234 36.144 1.00 13.29 ? 114 PHE A CE1 1 
ATOM   854  C CE2 . PHE A 1 114 ? -4.780  54.432 37.265 1.00 13.29 ? 114 PHE A CE2 1 
ATOM   855  C CZ  . PHE A 1 114 ? -4.196  55.207 36.276 1.00 13.29 ? 114 PHE A CZ  1 
ATOM   856  N N   . SER A 1 115 ? 0.728   53.246 40.879 1.00 20.50 ? 115 SER A N   1 
ATOM   857  C CA  . SER A 1 115 ? 1.591   53.184 42.071 1.00 20.50 ? 115 SER A CA  1 
ATOM   858  C C   . SER A 1 115 ? 1.192   54.189 43.131 1.00 20.50 ? 115 SER A C   1 
ATOM   859  O O   . SER A 1 115 ? 0.197   54.923 42.915 1.00 20.50 ? 115 SER A O   1 
ATOM   860  C CB  . SER A 1 115 ? 3.107   53.391 41.748 1.00 20.50 ? 115 SER A CB  1 
ATOM   861  O OG  . SER A 1 115 ? 3.457   54.746 41.455 1.00 23.59 ? 115 SER A OG  1 
ATOM   862  N N   . GLN A 1 116 ? 2.013   54.289 44.159 1.00 20.06 ? 116 GLN A N   1 
ATOM   863  C CA  . GLN A 1 116 ? 1.782   55.271 45.175 1.00 20.06 ? 116 GLN A CA  1 
ATOM   864  C C   . GLN A 1 116 ? 1.810   56.690 44.620 1.00 20.06 ? 116 GLN A C   1 
ATOM   865  O O   . GLN A 1 116 ? 1.126   57.587 45.158 1.00 20.06 ? 116 GLN A O   1 
ATOM   866  C CB  . GLN A 1 116 ? 2.770   55.126 46.344 1.00 20.06 ? 116 GLN A CB  1 
ATOM   867  C CG  . GLN A 1 116 ? 2.025   54.951 47.687 1.00 51.98 ? 116 GLN A CG  1 
ATOM   868  C CD  . GLN A 1 116 ? 2.959   55.115 48.883 1.00 51.98 ? 116 GLN A CD  1 
ATOM   869  O OE1 . GLN A 1 116 ? 2.879   56.127 49.623 1.00 51.98 ? 116 GLN A OE1 1 
ATOM   870  N NE2 . GLN A 1 116 ? 3.910   54.218 49.013 1.00 0.00  ? 116 GLN A NE2 1 
ATOM   871  N N   . THR A 1 117 ? 2.545   56.922 43.564 1.00 11.79 ? 117 THR A N   1 
ATOM   872  C CA  . THR A 1 117 ? 2.668   58.294 43.042 1.00 11.79 ? 117 THR A CA  1 
ATOM   873  C C   . THR A 1 117 ? 2.084   58.497 41.646 1.00 11.79 ? 117 THR A C   1 
ATOM   874  O O   . THR A 1 117 ? 2.074   59.654 41.158 1.00 11.79 ? 117 THR A O   1 
ATOM   875  C CB  . THR A 1 117 ? 4.150   58.717 42.995 1.00 11.79 ? 117 THR A CB  1 
ATOM   876  O OG1 . THR A 1 117 ? 4.888   58.047 41.958 1.00 10.51 ? 117 THR A OG1 1 
ATOM   877  C CG2 . THR A 1 117 ? 4.827   58.458 44.315 1.00 10.51 ? 117 THR A CG2 1 
ATOM   878  N N   . VAL A 1 118 ? 1.547   57.428 41.055 1.00 10.24 ? 118 VAL A N   1 
ATOM   879  C CA  . VAL A 1 118 ? 0.873   57.506 39.754 1.00 10.24 ? 118 VAL A CA  1 
ATOM   880  C C   . VAL A 1 118 ? -0.497  56.877 39.786 1.00 10.24 ? 118 VAL A C   1 
ATOM   881  O O   . VAL A 1 118 ? -0.572  55.686 40.114 1.00 10.24 ? 118 VAL A O   1 
ATOM   882  C CB  . VAL A 1 118 ? 1.669   56.812 38.657 1.00 10.24 ? 118 VAL A CB  1 
ATOM   883  C CG1 . VAL A 1 118 ? 0.919   56.815 37.304 1.00 5.66  ? 118 VAL A CG1 1 
ATOM   884  C CG2 . VAL A 1 118 ? 3.037   57.537 38.573 1.00 5.66  ? 118 VAL A CG2 1 
ATOM   885  N N   . SER A 1 119 ? -1.535  57.644 39.580 1.00 6.87  ? 119 SER A N   1 
ATOM   886  C CA  . SER A 1 119 ? -2.904  57.130 39.621 1.00 6.87  ? 119 SER A CA  1 
ATOM   887  C C   . SER A 1 119 ? -3.877  58.132 39.029 1.00 6.87  ? 119 SER A C   1 
ATOM   888  O O   . SER A 1 119 ? -3.421  59.083 38.401 1.00 6.87  ? 119 SER A O   1 
ATOM   889  C CB  . SER A 1 119 ? -3.327  56.718 41.064 1.00 6.87  ? 119 SER A CB  1 
ATOM   890  O OG  . SER A 1 119 ? -3.510  57.788 42.042 1.00 21.24 ? 119 SER A OG  1 
ATOM   891  N N   . ALA A 1 120 ? -5.125  57.826 38.965 1.00 7.81  ? 120 ALA A N   1 
ATOM   892  C CA  . ALA A 1 120 ? -6.149  58.597 38.215 1.00 7.81  ? 120 ALA A CA  1 
ATOM   893  C C   . ALA A 1 120 ? -7.027  59.592 39.003 1.00 7.81  ? 120 ALA A C   1 
ATOM   894  O O   . ALA A 1 120 ? -7.426  59.326 40.180 1.00 7.81  ? 120 ALA A O   1 
ATOM   895  C CB  . ALA A 1 120 ? -7.093  57.655 37.434 1.00 7.81  ? 120 ALA A CB  1 
ATOM   896  N N   . VAL A 1 121 ? -7.396  60.672 38.278 1.00 11.12 ? 121 VAL A N   1 
ATOM   897  C CA  . VAL A 1 121 ? -8.380  61.669 38.775 1.00 11.12 ? 121 VAL A CA  1 
ATOM   898  C C   . VAL A 1 121 ? -9.810  61.166 38.415 1.00 11.12 ? 121 VAL A C   1 
ATOM   899  O O   . VAL A 1 121 ? -9.896  60.401 37.414 1.00 11.12 ? 121 VAL A O   1 
ATOM   900  C CB  . VAL A 1 121 ? -8.085  63.092 38.181 1.00 11.12 ? 121 VAL A CB  1 
ATOM   901  C CG1 . VAL A 1 121 ? -8.552  63.227 36.707 1.00 7.02  ? 121 VAL A CG1 1 
ATOM   902  C CG2 . VAL A 1 121 ? -8.745  64.218 38.996 1.00 7.02  ? 121 VAL A CG2 1 
ATOM   903  N N   . CYS A 1 122 ? -10.844 61.451 39.221 1.00 4.81  ? 122 CYS A N   1 
ATOM   904  C CA  . CYS A 1 122 ? -12.176 61.096 38.780 1.00 4.81  ? 122 CYS A CA  1 
ATOM   905  C C   . CYS A 1 122 ? -12.704 62.050 37.729 1.00 4.81  ? 122 CYS A C   1 
ATOM   906  O O   . CYS A 1 122 ? -12.323 63.246 37.770 1.00 4.81  ? 122 CYS A O   1 
ATOM   907  C CB  . CYS A 1 122 ? -13.133 61.043 39.996 1.00 4.81  ? 122 CYS A CB  1 
ATOM   908  S SG  . CYS A 1 122 ? -12.714 59.794 41.234 1.00 9.11  ? 122 CYS A SG  1 
ATOM   909  N N   . LEU A 1 123 ? -13.696 61.639 36.958 1.00 7.98  ? 123 LEU A N   1 
ATOM   910  C CA  . LEU A 1 123 ? -14.405 62.532 36.027 1.00 7.98  ? 123 LEU A CA  1 
ATOM   911  C C   . LEU A 1 123 ? -15.796 62.777 36.590 1.00 7.98  ? 123 LEU A C   1 
ATOM   912  O O   . LEU A 1 123 ? -16.293 61.760 37.083 1.00 7.98  ? 123 LEU A O   1 
ATOM   913  C CB  . LEU A 1 123 ? -14.624 61.783 34.724 1.00 7.98  ? 123 LEU A CB  1 
ATOM   914  C CG  . LEU A 1 123 ? -13.297 61.746 33.918 1.00 13.72 ? 123 LEU A CG  1 
ATOM   915  C CD1 . LEU A 1 123 ? -13.399 60.879 32.621 1.00 13.72 ? 123 LEU A CD1 1 
ATOM   916  C CD2 . LEU A 1 123 ? -12.739 63.156 33.675 1.00 13.72 ? 123 LEU A CD2 1 
ATOM   917  N N   . PRO A 1 124 ? -16.361 64.020 36.504 1.00 12.68 ? 124 PRO A N   1 
ATOM   918  C CA  . PRO A 1 124 ? -17.753 64.389 36.940 1.00 12.68 ? 124 PRO A CA  1 
ATOM   919  C C   . PRO A 1 124 ? -18.828 63.658 36.092 1.00 12.68 ? 124 PRO A C   1 
ATOM   920  O O   . PRO A 1 124 ? -18.491 63.259 34.950 1.00 12.68 ? 124 PRO A O   1 
ATOM   921  C CB  . PRO A 1 124 ? -17.896 65.904 36.650 1.00 12.68 ? 124 PRO A CB  1 
ATOM   922  C CG  . PRO A 1 124 ? -16.771 66.297 35.669 1.00 6.71  ? 124 PRO A CG  1 
ATOM   923  C CD  . PRO A 1 124 ? -15.763 65.119 35.690 1.00 6.71  ? 124 PRO A CD  1 
ATOM   924  N N   . SER A 1 125 ? -20.153 63.655 36.476 1.00 8.69  ? 125 SER A N   1 
ATOM   925  C CA  . SER A 1 125 ? -21.257 63.258 35.541 1.00 8.69  ? 125 SER A CA  1 
ATOM   926  C C   . SER A 1 125 ? -21.535 64.497 34.740 1.00 8.69  ? 125 SER A C   1 
ATOM   927  O O   . SER A 1 125 ? -21.209 65.527 35.337 1.00 8.69  ? 125 SER A O   1 
ATOM   928  C CB  . SER A 1 125 ? -22.589 62.982 36.283 1.00 8.69  ? 125 SER A CB  1 
ATOM   929  O OG  . SER A 1 125 ? -22.243 62.263 37.456 1.00 27.66 ? 125 SER A OG  1 
ATOM   930  N N   . ALA A 1 126 ? -22.174 64.410 33.589 1.00 18.26 ? 126 ALA A N   1 
ATOM   931  C CA  . ALA A 1 126 ? -22.689 65.572 32.844 1.00 18.26 ? 126 ALA A CA  1 
ATOM   932  C C   . ALA A 1 126 ? -23.724 66.408 33.613 1.00 18.26 ? 126 ALA A C   1 
ATOM   933  O O   . ALA A 1 126 ? -23.747 67.662 33.459 1.00 18.26 ? 126 ALA A O   1 
ATOM   934  C CB  . ALA A 1 126 ? -23.240 65.187 31.470 1.00 18.26 ? 126 ALA A CB  1 
ATOM   935  N N   . SER A 1 127 ? -24.274 65.856 34.682 1.00 29.67 ? 127 SER A N   1 
ATOM   936  C CA  . SER A 1 127 ? -25.283 66.591 35.496 1.00 29.67 ? 127 SER A CA  1 
ATOM   937  C C   . SER A 1 127 ? -24.724 67.155 36.804 1.00 29.67 ? 127 SER A C   1 
ATOM   938  O O   . SER A 1 127 ? -25.505 67.580 37.695 1.00 29.67 ? 127 SER A O   1 
ATOM   939  C CB  . SER A 1 127 ? -26.449 65.621 35.830 1.00 29.67 ? 127 SER A CB  1 
ATOM   940  O OG  . SER A 1 127 ? -25.969 64.537 36.668 1.00 40.38 ? 127 SER A OG  1 
ATOM   941  N N   . ASP A 1 128 ? -23.421 66.949 37.006 1.00 22.05 ? 128 ASP A N   1 
ATOM   942  C CA  . ASP A 1 128 ? -22.825 67.481 38.210 1.00 22.05 ? 128 ASP A CA  1 
ATOM   943  C C   . ASP A 1 128 ? -22.902 68.990 38.216 1.00 22.05 ? 128 ASP A C   1 
ATOM   944  O O   . ASP A 1 128 ? -22.363 69.666 37.314 1.00 22.05 ? 128 ASP A O   1 
ATOM   945  C CB  . ASP A 1 128 ? -21.350 67.137 38.337 1.00 22.05 ? 128 ASP A CB  1 
ATOM   946  C CG  . ASP A 1 128 ? -21.278 65.862 39.145 1.00 23.99 ? 128 ASP A CG  1 
ATOM   947  O OD1 . ASP A 1 128 ? -20.347 65.038 38.924 1.00 23.99 ? 128 ASP A OD1 1 
ATOM   948  O OD2 . ASP A 1 128 ? -22.330 65.487 39.740 1.00 23.99 ? 128 ASP A OD2 1 
ATOM   949  N N   . ASP A 1 129 ? -23.339 69.467 39.323 1.00 25.70 ? 129 ASP A N   1 
ATOM   950  C CA  . ASP A 1 129 ? -23.278 70.887 39.568 1.00 25.70 ? 129 ASP A CA  1 
ATOM   951  C C   . ASP A 1 129 ? -22.239 71.203 40.624 1.00 25.70 ? 129 ASP A C   1 
ATOM   952  O O   . ASP A 1 129 ? -22.361 70.724 41.786 1.00 25.70 ? 129 ASP A O   1 
ATOM   953  C CB  . ASP A 1 129 ? -24.642 71.395 40.078 1.00 25.70 ? 129 ASP A CB  1 
ATOM   954  C CG  . ASP A 1 129 ? -24.535 72.920 40.086 1.00 50.15 ? 129 ASP A CG  1 
ATOM   955  O OD1 . ASP A 1 129 ? -24.352 73.483 38.979 1.00 50.15 ? 129 ASP A OD1 1 
ATOM   956  O OD2 . ASP A 1 129 ? -24.185 73.527 41.134 1.00 50.15 ? 129 ASP A OD2 1 
ATOM   957  N N   . PHE A 1 130 ? -21.317 72.039 40.225 1.00 18.05 ? 130 PHE A N   1 
ATOM   958  C CA  . PHE A 1 130 ? -20.276 72.591 41.095 1.00 18.05 ? 130 PHE A CA  1 
ATOM   959  C C   . PHE A 1 130 ? -20.507 74.105 41.200 1.00 18.05 ? 130 PHE A C   1 
ATOM   960  O O   . PHE A 1 130 ? -20.250 74.845 40.203 1.00 18.05 ? 130 PHE A O   1 
ATOM   961  C CB  . PHE A 1 130 ? -18.872 72.284 40.482 1.00 18.05 ? 130 PHE A CB  1 
ATOM   962  C CG  . PHE A 1 130 ? -18.376 70.811 40.544 1.00 13.41 ? 130 PHE A CG  1 
ATOM   963  C CD1 . PHE A 1 130 ? -18.620 69.942 39.509 1.00 13.41 ? 130 PHE A CD1 1 
ATOM   964  C CD2 . PHE A 1 130 ? -17.738 70.325 41.677 1.00 13.41 ? 130 PHE A CD2 1 
ATOM   965  C CE1 . PHE A 1 130 ? -18.243 68.569 39.626 1.00 13.41 ? 130 PHE A CE1 1 
ATOM   966  C CE2 . PHE A 1 130 ? -17.358 68.965 41.793 1.00 13.41 ? 130 PHE A CE2 1 
ATOM   967  C CZ  . PHE A 1 130 ? -17.612 68.098 40.774 1.00 13.41 ? 130 PHE A CZ  1 
ATOM   968  N N   . ALA A 1 131 ? -21.075 74.506 42.337 1.00 22.21 ? 131 ALA A N   1 
ATOM   969  C CA  . ALA A 1 131 ? -21.446 75.887 42.753 1.00 22.21 ? 131 ALA A CA  1 
ATOM   970  C C   . ALA A 1 131 ? -20.273 76.861 42.677 1.00 22.21 ? 131 ALA A C   1 
ATOM   971  O O   . ALA A 1 131 ? -19.269 76.524 43.325 1.00 22.21 ? 131 ALA A O   1 
ATOM   972  C CB  . ALA A 1 131 ? -21.839 75.883 44.252 1.00 22.21 ? 131 ALA A CB  1 
ATOM   973  N N   . ALA A 1 132 ? -20.554 78.113 42.403 1.00 14.99 ? 132 ALA A N   1 
ATOM   974  C CA  . ALA A 1 132 ? -19.689 79.285 42.608 1.00 14.99 ? 132 ALA A CA  1 
ATOM   975  C C   . ALA A 1 132 ? -19.236 79.457 44.037 1.00 14.99 ? 132 ALA A C   1 
ATOM   976  O O   . ALA A 1 132 ? -20.067 79.389 44.976 1.00 14.99 ? 132 ALA A O   1 
ATOM   977  C CB  . ALA A 1 132 ? -20.461 80.561 42.333 1.00 14.99 ? 132 ALA A CB  1 
ATOM   978  N N   . GLY A 1 133 ? -17.979 79.771 44.204 1.00 17.74 ? 133 GLY A N   1 
ATOM   979  C CA  . GLY A 1 133 ? -17.488 79.998 45.553 1.00 17.74 ? 133 GLY A CA  1 
ATOM   980  C C   . GLY A 1 133 ? -17.013 78.719 46.193 1.00 17.74 ? 133 GLY A C   1 
ATOM   981  O O   . GLY A 1 133 ? -16.456 78.775 47.308 1.00 17.74 ? 133 GLY A O   1 
ATOM   982  N N   . THR A 1 134 ? -17.268 77.597 45.550 1.00 11.86 ? 134 THR A N   1 
ATOM   983  C CA  . THR A 1 134 ? -16.581 76.382 45.955 1.00 11.86 ? 134 THR A CA  1 
ATOM   984  C C   . THR A 1 134 ? -15.053 76.471 45.773 1.00 11.86 ? 134 THR A C   1 
ATOM   985  O O   . THR A 1 134 ? -14.632 76.867 44.656 1.00 11.86 ? 134 THR A O   1 
ATOM   986  C CB  . THR A 1 134 ? -17.034 75.302 44.989 1.00 11.86 ? 134 THR A CB  1 
ATOM   987  O OG1 . THR A 1 134 ? -18.440 75.019 45.289 1.00 15.80 ? 134 THR A OG1 1 
ATOM   988  C CG2 . THR A 1 134 ? -16.211 74.027 45.212 1.00 15.80 ? 134 THR A CG2 1 
ATOM   989  N N   . THR A 1 135 ? -14.254 76.119 46.799 1.00 13.35 ? 135 THR A N   1 
ATOM   990  C CA  . THR A 1 135 ? -12.775 76.229 46.641 1.00 13.35 ? 135 THR A CA  1 
ATOM   991  C C   . THR A 1 135 ? -12.144 74.984 46.022 1.00 13.35 ? 135 THR A C   1 
ATOM   992  O O   . THR A 1 135 ? -12.554 73.885 46.439 1.00 13.35 ? 135 THR A O   1 
ATOM   993  C CB  . THR A 1 135 ? -12.073 76.454 47.985 1.00 13.35 ? 135 THR A CB  1 
ATOM   994  O OG1 . THR A 1 135 ? -12.502 77.718 48.494 1.00 21.90 ? 135 THR A OG1 1 
ATOM   995  C CG2 . THR A 1 135 ? -10.515 76.456 47.902 1.00 21.90 ? 135 THR A CG2 1 
ATOM   996  N N   . CYS A 1 136 ? -11.424 75.123 44.911 1.00 5.46  ? 136 CYS A N   1 
ATOM   997  C CA  . CYS A 1 136 ? -10.838 74.029 44.117 1.00 5.46  ? 136 CYS A CA  1 
ATOM   998  C C   . CYS A 1 136 ? -9.349  74.292 43.946 1.00 5.46  ? 136 CYS A C   1 
ATOM   999  O O   . CYS A 1 136 ? -8.857  75.178 44.669 1.00 5.46  ? 136 CYS A O   1 
ATOM   1000 C CB  . CYS A 1 136 ? -11.519 73.991 42.745 1.00 5.46  ? 136 CYS A CB  1 
ATOM   1001 S SG  . CYS A 1 136 ? -13.312 73.710 42.871 1.00 13.92 ? 136 CYS A SG  1 
ATOM   1002 N N   . VAL A 1 137 ? -8.650  73.365 43.399 1.00 11.35 ? 137 VAL A N   1 
ATOM   1003 C CA  . VAL A 1 137 ? -7.183  73.268 43.357 1.00 11.35 ? 137 VAL A CA  1 
ATOM   1004 C C   . VAL A 1 137 ? -6.665  73.180 41.925 1.00 11.35 ? 137 VAL A C   1 
ATOM   1005 O O   . VAL A 1 137 ? -7.275  72.482 41.087 1.00 11.35 ? 137 VAL A O   1 
ATOM   1006 C CB  . VAL A 1 137 ? -6.577  72.183 44.330 1.00 11.35 ? 137 VAL A CB  1 
ATOM   1007 C CG1 . VAL A 1 137 ? -5.012  72.099 44.336 1.00 5.47  ? 137 VAL A CG1 1 
ATOM   1008 C CG2 . VAL A 1 137 ? -7.018  72.420 45.788 1.00 5.47  ? 137 VAL A CG2 1 
ATOM   1009 N N   . THR A 1 138 ? -5.716  74.013 41.555 1.00 5.19  ? 138 THR A N   1 
ATOM   1010 C CA  . THR A 1 138 ? -5.010  73.937 40.303 1.00 5.19  ? 138 THR A CA  1 
ATOM   1011 C C   . THR A 1 138 ? -3.534  73.696 40.566 1.00 5.19  ? 138 THR A C   1 
ATOM   1012 O O   . THR A 1 138 ? -2.936  74.114 41.604 1.00 5.19  ? 138 THR A O   1 
ATOM   1013 C CB  . THR A 1 138 ? -5.180  75.151 39.339 1.00 5.19  ? 138 THR A CB  1 
ATOM   1014 O OG1 . THR A 1 138 ? -4.478  74.807 38.148 1.00 9.23  ? 138 THR A OG1 1 
ATOM   1015 C CG2 . THR A 1 138 ? -4.589  76.477 39.833 1.00 9.23  ? 138 THR A CG2 1 
ATOM   1016 N N   . THR A 1 139 ? -2.992  72.749 39.832 1.00 8.46  ? 139 THR A N   1 
ATOM   1017 C CA  . THR A 1 139 ? -1.555  72.463 40.055 1.00 8.46  ? 139 THR A CA  1 
ATOM   1018 C C   . THR A 1 139 ? -0.762  72.528 38.761 1.00 8.46  ? 139 THR A C   1 
ATOM   1019 O O   . THR A 1 139 ? -1.334  72.272 37.688 1.00 8.46  ? 139 THR A O   1 
ATOM   1020 C CB  . THR A 1 139 ? -1.351  71.066 40.721 1.00 8.46  ? 139 THR A CB  1 
ATOM   1021 O OG1 . THR A 1 139 ? -1.999  70.130 39.865 1.00 6.37  ? 139 THR A OG1 1 
ATOM   1022 C CG2 . THR A 1 139 ? -2.042  70.911 42.074 1.00 6.37  ? 139 THR A CG2 1 
ATOM   1023 N N   . GLY A 1 140 ? 0.544   72.667 38.856 1.00 5.74  ? 140 GLY A N   1 
ATOM   1024 C CA  . GLY A 1 140 ? 1.396   72.658 37.686 1.00 5.74  ? 140 GLY A CA  1 
ATOM   1025 C C   . GLY A 1 140 ? 2.761   73.323 37.878 1.00 5.74  ? 140 GLY A C   1 
ATOM   1026 O O   . GLY A 1 140 ? 3.201   73.684 39.019 1.00 5.74  ? 140 GLY A O   1 
ATOM   1027 N N   . TRP A 1 141 ? 3.434   73.353 36.716 1.00 12.06 ? 141 TRP A N   1 
ATOM   1028 C CA  . TRP A 1 141 ? 4.800   73.867 36.531 1.00 12.06 ? 141 TRP A CA  1 
ATOM   1029 C C   . TRP A 1 141 ? 4.771   75.145 35.700 1.00 12.06 ? 141 TRP A C   1 
ATOM   1030 O O   . TRP A 1 141 ? 5.811   75.491 35.108 1.00 12.06 ? 141 TRP A O   1 
ATOM   1031 C CB  . TRP A 1 141 ? 5.696   72.828 35.817 1.00 12.06 ? 141 TRP A CB  1 
ATOM   1032 C CG  . TRP A 1 141 ? 6.028   71.602 36.690 1.00 9.41  ? 141 TRP A CG  1 
ATOM   1033 C CD1 . TRP A 1 141 ? 6.937   71.487 37.658 1.00 9.41  ? 141 TRP A CD1 1 
ATOM   1034 C CD2 . TRP A 1 141 ? 5.391   70.336 36.609 1.00 9.41  ? 141 TRP A CD2 1 
ATOM   1035 N NE1 . TRP A 1 141 ? 6.871   70.171 38.210 1.00 9.41  ? 141 TRP A NE1 1 
ATOM   1036 C CE2 . TRP A 1 141 ? 5.973   69.501 37.587 1.00 9.41  ? 141 TRP A CE2 1 
ATOM   1037 C CE3 . TRP A 1 141 ? 4.390   69.856 35.768 1.00 9.41  ? 141 TRP A CE3 1 
ATOM   1038 C CZ2 . TRP A 1 141 ? 5.582   68.162 37.759 1.00 9.41  ? 141 TRP A CZ2 1 
ATOM   1039 C CZ3 . TRP A 1 141 ? 4.007   68.486 35.945 1.00 9.41  ? 141 TRP A CZ3 1 
ATOM   1040 C CH2 . TRP A 1 141 ? 4.588   67.664 36.917 1.00 9.41  ? 141 TRP A CH2 1 
ATOM   1041 N N   . GLY A 1 142 ? 3.628   75.787 35.594 1.00 20.08 ? 142 GLY A N   1 
ATOM   1042 C CA  . GLY A 1 142 ? 3.441   76.968 34.791 1.00 20.08 ? 142 GLY A CA  1 
ATOM   1043 C C   . GLY A 1 142 ? 4.369   78.145 35.084 1.00 20.08 ? 142 GLY A C   1 
ATOM   1044 O O   . GLY A 1 142 ? 4.518   79.022 34.209 1.00 20.08 ? 142 GLY A O   1 
ATOM   1045 N N   . LEU A 1 143 ? 4.930   78.191 36.238 1.00 23.92 ? 143 LEU A N   1 
ATOM   1046 C CA  . LEU A 1 143 ? 5.843   79.271 36.624 1.00 23.92 ? 143 LEU A CA  1 
ATOM   1047 C C   . LEU A 1 143 ? 7.154   79.155 35.818 1.00 23.92 ? 143 LEU A C   1 
ATOM   1048 O O   . LEU A 1 143 ? 7.926   80.127 35.621 1.00 23.92 ? 143 LEU A O   1 
ATOM   1049 C CB  . LEU A 1 143 ? 6.088   79.190 38.161 1.00 23.92 ? 143 LEU A CB  1 
ATOM   1050 C CG  . LEU A 1 143 ? 5.273   80.183 39.035 1.00 18.75 ? 143 LEU A CG  1 
ATOM   1051 C CD1 . LEU A 1 143 ? 4.133   80.967 38.426 1.00 18.75 ? 143 LEU A CD1 1 
ATOM   1052 C CD2 . LEU A 1 143 ? 5.048   79.802 40.500 1.00 18.75 ? 143 LEU A CD2 1 
ATOM   1053 N N   . THR A 1 144 ? 7.429   77.990 35.321 1.00 20.00 ? 144 THR A N   1 
ATOM   1054 C CA  . THR A 1 144 ? 8.622   77.844 34.515 1.00 20.00 ? 144 THR A CA  1 
ATOM   1055 C C   . THR A 1 144 ? 8.488   78.496 33.126 1.00 20.00 ? 144 THR A C   1 
ATOM   1056 O O   . THR A 1 144 ? 9.509   78.733 32.431 1.00 20.00 ? 144 THR A O   1 
ATOM   1057 C CB  . THR A 1 144 ? 9.005   76.357 34.441 1.00 20.00 ? 144 THR A CB  1 
ATOM   1058 O OG1 . THR A 1 144 ? 8.086   75.626 33.613 1.00 19.98 ? 144 THR A OG1 1 
ATOM   1059 C CG2 . THR A 1 144 ? 9.112   75.691 35.817 1.00 19.98 ? 144 THR A CG2 1 
ATOM   1060 N N   . ARG A 1 145 ? 7.293   78.949 32.725 1.00 24.11 ? 145 ARG A N   1 
ATOM   1061 C CA  . ARG A 1 145 ? 7.174   79.633 31.448 1.00 24.11 ? 145 ARG A CA  1 
ATOM   1062 C C   . ARG A 1 145 ? 7.788   81.043 31.460 1.00 24.11 ? 145 ARG A C   1 
ATOM   1063 O O   . ARG A 1 145 ? 7.922   81.754 30.430 1.00 24.11 ? 145 ARG A O   1 
ATOM   1064 C CB  . ARG A 1 145 ? 5.723   79.597 30.927 1.00 24.11 ? 145 ARG A CB  1 
ATOM   1065 C CG  . ARG A 1 145 ? 4.856   80.648 31.605 1.00 37.48 ? 145 ARG A CG  1 
ATOM   1066 C CD  . ARG A 1 145 ? 3.442   80.745 30.971 1.00 37.48 ? 145 ARG A CD  1 
ATOM   1067 N NE  . ARG A 1 145 ? 2.661   79.504 31.170 1.00 37.48 ? 145 ARG A NE  1 
ATOM   1068 C CZ  . ARG A 1 145 ? 1.744   79.358 32.099 1.00 37.48 ? 145 ARG A CZ  1 
ATOM   1069 N NH1 . ARG A 1 145 ? 1.541   80.334 32.985 1.00 37.48 ? 145 ARG A NH1 1 
ATOM   1070 N NH2 . ARG A 1 145 ? 1.205   78.181 32.230 1.00 37.48 ? 145 ARG A NH2 1 
ATOM   1071 N N   . TYR A 1 146 ? 8.207   81.443 32.626 1.00 27.01 ? 146 TYR A N   1 
ATOM   1072 C CA  . TYR A 1 146 ? 8.747   82.787 32.768 1.00 27.01 ? 146 TYR A CA  1 
ATOM   1073 C C   . TYR A 1 146 ? 10.261  82.826 32.708 1.00 27.01 ? 146 TYR A C   1 
ATOM   1074 O O   . TYR A 1 146 ? 10.879  82.801 33.802 1.00 27.01 ? 146 TYR A O   1 
ATOM   1075 C CB  . TYR A 1 146 ? 8.158   83.523 33.989 1.00 27.01 ? 146 TYR A CB  1 
ATOM   1076 C CG  . TYR A 1 146 ? 6.626   83.592 33.752 1.00 28.50 ? 146 TYR A CG  1 
ATOM   1077 C CD1 . TYR A 1 146 ? 5.807   82.890 34.603 1.00 28.50 ? 146 TYR A CD1 1 
ATOM   1078 C CD2 . TYR A 1 146 ? 6.077   84.257 32.654 1.00 28.50 ? 146 TYR A CD2 1 
ATOM   1079 C CE1 . TYR A 1 146 ? 4.451   82.868 34.402 1.00 28.50 ? 146 TYR A CE1 1 
ATOM   1080 C CE2 . TYR A 1 146 ? 4.689   84.257 32.453 1.00 28.50 ? 146 TYR A CE2 1 
ATOM   1081 C CZ  . TYR A 1 146 ? 3.889   83.555 33.354 1.00 28.50 ? 146 TYR A CZ  1 
ATOM   1082 O OH  . TYR A 1 146 ? 2.470   83.502 33.211 1.00 28.50 ? 146 TYR A OH  1 
ATOM   1083 N N   . THR A 1 147 ? 10.727  82.574 31.471 1.00 34.22 ? 147 THR A N   1 
ATOM   1084 C CA  . THR A 1 147 ? 12.120  82.201 31.063 1.00 34.22 ? 147 THR A CA  1 
ATOM   1085 C C   . THR A 1 147 ? 13.246  82.990 31.704 1.00 34.22 ? 147 THR A C   1 
ATOM   1086 O O   . THR A 1 147 ? 14.337  82.446 31.946 1.00 34.22 ? 147 THR A O   1 
ATOM   1087 C CB  . THR A 1 147 ? 12.343  82.323 29.549 1.00 34.22 ? 147 THR A CB  1 
ATOM   1088 O OG1 . THR A 1 147 ? 12.130  83.707 29.211 1.00 30.94 ? 147 THR A OG1 1 
ATOM   1089 C CG2 . THR A 1 147 ? 11.412  81.406 28.725 1.00 30.94 ? 147 THR A CG2 1 
ATOM   1090 N N   . ASN A 1 148 ? 13.013  84.234 31.971 1.00 25.43 ? 148 ASN A N   1 
ATOM   1091 C CA  . ASN A 1 148 ? 14.012  85.109 32.546 1.00 25.43 ? 148 ASN A CA  1 
ATOM   1092 C C   . ASN A 1 148 ? 13.788  85.322 34.028 1.00 25.43 ? 148 ASN A C   1 
ATOM   1093 O O   . ASN A 1 148 ? 14.716  85.850 34.688 1.00 25.43 ? 148 ASN A O   1 
ATOM   1094 C CB  . ASN A 1 148 ? 14.055  86.480 31.820 1.00 25.43 ? 148 ASN A CB  1 
ATOM   1095 C CG  . ASN A 1 148 ? 12.908  87.426 32.209 1.00 26.63 ? 148 ASN A CG  1 
ATOM   1096 O OD1 . ASN A 1 148 ? 13.067  88.666 32.019 1.00 26.63 ? 148 ASN A OD1 1 
ATOM   1097 N ND2 . ASN A 1 148 ? 11.707  86.879 32.211 1.00 26.63 ? 148 ASN A ND2 1 
ATOM   1098 N N   . ALA A 1 149 ? 12.826  84.600 34.578 1.00 26.90 ? 149 ALA A N   1 
ATOM   1099 C CA  . ALA A 1 149 ? 12.808  84.387 36.022 1.00 26.90 ? 149 ALA A CA  1 
ATOM   1100 C C   . ALA A 1 149 ? 13.472  83.043 36.251 1.00 26.90 ? 149 ALA A C   1 
ATOM   1101 O O   . ALA A 1 149 ? 14.085  82.845 37.340 1.00 26.90 ? 149 ALA A O   1 
ATOM   1102 C CB  . ALA A 1 149 ? 11.366  84.239 36.508 1.00 26.90 ? 149 ALA A CB  1 
ATOM   1103 N N   . ASN A 1 150 ? 13.406  82.283 35.168 1.00 0.00  ? 150 ASN A N   1 
ATOM   1104 C CA  . ASN A 1 150 ? 13.893  80.912 35.037 1.00 41.46 ? 150 ASN A CA  1 
ATOM   1105 C C   . ASN A 1 150 ? 13.057  79.959 35.926 1.00 41.46 ? 150 ASN A C   1 
ATOM   1106 O O   . ASN A 1 150 ? 12.494  78.941 35.411 1.00 41.46 ? 150 ASN A O   1 
ATOM   1107 C CB  . ASN A 1 150 ? 15.422  80.840 35.400 1.00 41.46 ? 150 ASN A CB  1 
ATOM   1108 C CG  . ASN A 1 150 ? 16.296  81.714 34.483 1.00 36.43 ? 150 ASN A CG  1 
ATOM   1109 O OD1 . ASN A 1 150 ? 16.166  82.964 34.510 1.00 0.00  ? 150 ASN A OD1 1 
ATOM   1110 N ND2 . ASN A 1 150 ? 17.374  81.111 34.030 1.00 0.00  ? 150 ASN A ND2 1 
ATOM   1111 N N   . THR A 1 151 ? 12.923  80.356 37.198 1.00 0.00  ? 151 THR A N   1 
ATOM   1112 C CA  . THR A 1 151 ? 11.943  79.922 38.227 1.00 0.00  ? 151 THR A CA  1 
ATOM   1113 C C   . THR A 1 151 ? 12.164  78.584 38.954 1.00 0.00  ? 151 THR A C   1 
ATOM   1114 O O   . THR A 1 151 ? 12.827  77.673 38.394 1.00 0.00  ? 151 THR A O   1 
ATOM   1115 C CB  . THR A 1 151 ? 10.543  79.978 37.589 1.00 0.00  ? 151 THR A CB  1 
ATOM   1116 O OG1 . THR A 1 151 ? 9.629   80.790 38.335 1.00 0.00  ? 151 THR A OG1 1 
ATOM   1117 C CG2 . THR A 1 151 ? 9.975   78.574 37.391 1.00 0.00  ? 151 THR A CG2 1 
ATOM   1118 N N   . PRO A 1 152 ? 11.534  78.414 40.130 1.00 0.00  ? 152 PRO A N   1 
ATOM   1119 C CA  . PRO A 1 152 ? 11.352  77.109 40.824 1.00 0.00  ? 152 PRO A CA  1 
ATOM   1120 C C   . PRO A 1 152 ? 10.596  76.060 40.005 1.00 41.88 ? 152 PRO A C   1 
ATOM   1121 O O   . PRO A 1 152 ? 9.518   76.387 39.437 1.00 41.88 ? 152 PRO A O   1 
ATOM   1122 C CB  . PRO A 1 152 ? 10.547  77.370 42.108 1.00 0.00  ? 152 PRO A CB  1 
ATOM   1123 C CG  . PRO A 1 152 ? 10.222  78.866 42.142 1.00 0.00  ? 152 PRO A CG  1 
ATOM   1124 C CD  . PRO A 1 152 ? 10.862  79.489 40.892 1.00 0.00  ? 152 PRO A CD  1 
ATOM   1125 N N   . ASP A 1 153 ? 11.244  74.906 39.856 1.00 25.62 ? 153 ASP A N   1 
ATOM   1126 C CA  . ASP A 1 153 ? 10.849  73.828 38.938 1.00 25.62 ? 153 ASP A CA  1 
ATOM   1127 C C   . ASP A 1 153 ? 10.190  72.622 39.628 1.00 25.62 ? 153 ASP A C   1 
ATOM   1128 O O   . ASP A 1 153 ? 10.112  71.509 39.049 1.00 25.62 ? 153 ASP A O   1 
ATOM   1129 C CB  . ASP A 1 153 ? 12.031  73.438 37.992 1.00 25.62 ? 153 ASP A CB  1 
ATOM   1130 C CG  . ASP A 1 153 ? 13.253  72.952 38.765 1.00 0.00  ? 153 ASP A CG  1 
ATOM   1131 O OD1 . ASP A 1 153 ? 14.203  72.451 38.116 1.00 0.00  ? 153 ASP A OD1 1 
ATOM   1132 O OD2 . ASP A 1 153 ? 13.492  73.400 39.916 1.00 0.00  ? 153 ASP A OD2 1 
ATOM   1133 N N   . ARG A 1 154 ? 9.599   72.911 40.799 1.00 8.85  ? 154 ARG A N   1 
ATOM   1134 C CA  . ARG A 1 154 ? 8.819   71.971 41.578 1.00 8.85  ? 154 ARG A CA  1 
ATOM   1135 C C   . ARG A 1 154 ? 7.331   72.178 41.436 1.00 8.85  ? 154 ARG A C   1 
ATOM   1136 O O   . ARG A 1 154 ? 6.876   73.291 41.043 1.00 8.85  ? 154 ARG A O   1 
ATOM   1137 C CB  . ARG A 1 154 ? 9.296   72.239 43.004 1.00 8.85  ? 154 ARG A CB  1 
ATOM   1138 C CG  . ARG A 1 154 ? 10.732  71.694 42.969 1.00 26.87 ? 154 ARG A CG  1 
ATOM   1139 C CD  . ARG A 1 154 ? 11.701  72.233 44.014 1.00 26.87 ? 154 ARG A CD  1 
ATOM   1140 N NE  . ARG A 1 154 ? 11.312  71.802 45.335 1.00 26.87 ? 154 ARG A NE  1 
ATOM   1141 C CZ  . ARG A 1 154 ? 12.029  70.977 46.053 1.00 26.87 ? 154 ARG A CZ  1 
ATOM   1142 N NH1 . ARG A 1 154 ? 11.647  70.721 47.305 1.00 26.87 ? 154 ARG A NH1 1 
ATOM   1143 N NH2 . ARG A 1 154 ? 13.115  70.423 45.499 1.00 26.87 ? 154 ARG A NH2 1 
ATOM   1144 N N   . LEU A 1 155 ? 6.553   71.120 41.604 1.00 8.42  ? 155 LEU A N   1 
ATOM   1145 C CA  . LEU A 1 155 ? 5.070   71.244 41.295 1.00 8.42  ? 155 LEU A CA  1 
ATOM   1146 C C   . LEU A 1 155 ? 4.447   72.267 42.260 1.00 8.42  ? 155 LEU A C   1 
ATOM   1147 O O   . LEU A 1 155 ? 4.721   72.158 43.487 1.00 8.42  ? 155 LEU A O   1 
ATOM   1148 C CB  . LEU A 1 155 ? 4.422   69.816 41.396 1.00 8.42  ? 155 LEU A CB  1 
ATOM   1149 C CG  . LEU A 1 155 ? 2.939   69.732 41.012 1.00 4.89  ? 155 LEU A CG  1 
ATOM   1150 C CD1 . LEU A 1 155 ? 2.723   70.043 39.533 1.00 4.89  ? 155 LEU A CD1 1 
ATOM   1151 C CD2 . LEU A 1 155 ? 2.425   68.326 41.271 1.00 4.89  ? 155 LEU A CD2 1 
ATOM   1152 N N   . GLN A 1 156 ? 3.678   73.289 41.799 1.00 8.62  ? 156 GLN A N   1 
ATOM   1153 C CA  . GLN A 1 156 ? 3.016   74.217 42.743 1.00 8.62  ? 156 GLN A CA  1 
ATOM   1154 C C   . GLN A 1 156 ? 1.574   73.819 42.871 1.00 8.62  ? 156 GLN A C   1 
ATOM   1155 O O   . GLN A 1 156 ? 1.085   73.375 41.829 1.00 8.62  ? 156 GLN A O   1 
ATOM   1156 C CB  . GLN A 1 156 ? 2.900   75.679 42.210 1.00 8.62  ? 156 GLN A CB  1 
ATOM   1157 C CG  . GLN A 1 156 ? 4.256   76.248 41.827 1.00 32.69 ? 156 GLN A CG  1 
ATOM   1158 C CD  . GLN A 1 156 ? 5.095   76.321 43.092 1.00 32.69 ? 156 GLN A CD  1 
ATOM   1159 O OE1 . GLN A 1 156 ? 4.792   77.175 43.955 1.00 32.69 ? 156 GLN A OE1 1 
ATOM   1160 N NE2 . GLN A 1 156 ? 6.293   75.807 42.914 1.00 32.69 ? 156 GLN A NE2 1 
ATOM   1161 N N   . GLN A 1 157 ? 0.920   74.306 43.894 1.00 7.94  ? 157 GLN A N   1 
ATOM   1162 C CA  . GLN A 1 157 ? -0.547  74.233 43.971 1.00 7.94  ? 157 GLN A CA  1 
ATOM   1163 C C   . GLN A 1 157 ? -1.102  75.585 44.415 1.00 7.94  ? 157 GLN A C   1 
ATOM   1164 O O   . GLN A 1 157 ? -0.386  76.289 45.185 1.00 7.94  ? 157 GLN A O   1 
ATOM   1165 C CB  . GLN A 1 157 ? -0.921  73.124 44.952 1.00 7.94  ? 157 GLN A CB  1 
ATOM   1166 C CG  . GLN A 1 157 ? -0.500  73.454 46.371 1.00 3.24  ? 157 GLN A CG  1 
ATOM   1167 C CD  . GLN A 1 157 ? -0.289  72.269 47.274 1.00 3.24  ? 157 GLN A CD  1 
ATOM   1168 O OE1 . GLN A 1 157 ? -0.405  71.116 46.852 1.00 3.24  ? 157 GLN A OE1 1 
ATOM   1169 N NE2 . GLN A 1 157 ? -0.289  72.448 48.536 1.00 3.24  ? 157 GLN A NE2 1 
ATOM   1170 N N   . ALA A 1 158 ? -2.338  75.900 44.012 1.00 7.45  ? 158 ALA A N   1 
ATOM   1171 C CA  . ALA A 1 158 ? -3.084  77.023 44.558 1.00 7.45  ? 158 ALA A CA  1 
ATOM   1172 C C   . ALA A 1 158 ? -4.535  76.656 44.740 1.00 7.45  ? 158 ALA A C   1 
ATOM   1173 O O   . ALA A 1 158 ? -5.069  76.000 43.812 1.00 7.45  ? 158 ALA A O   1 
ATOM   1174 C CB  . ALA A 1 158 ? -3.160  78.216 43.598 1.00 7.45  ? 158 ALA A CB  1 
ATOM   1175 N N   . SER A 1 159 ? -5.160  77.245 45.764 1.00 10.24 ? 159 SER A N   1 
ATOM   1176 C CA  . SER A 1 159 ? -6.624  77.039 46.025 1.00 10.24 ? 159 SER A CA  1 
ATOM   1177 C C   . SER A 1 159 ? -7.405  78.242 45.553 1.00 10.24 ? 159 SER A C   1 
ATOM   1178 O O   . SER A 1 159 ? -6.897  79.366 45.811 1.00 10.24 ? 159 SER A O   1 
ATOM   1179 C CB  . SER A 1 159 ? -6.883  76.931 47.520 1.00 10.24 ? 159 SER A CB  1 
ATOM   1180 O OG  . SER A 1 159 ? -6.052  75.896 48.053 1.00 20.99 ? 159 SER A OG  1 
ATOM   1181 N N   . LEU A 1 160 ? -8.343  78.045 44.663 1.00 8.26  ? 160 LEU A N   1 
ATOM   1182 C CA  . LEU A 1 160 ? -9.007  79.152 43.994 1.00 8.26  ? 160 LEU A CA  1 
ATOM   1183 C C   . LEU A 1 160 ? -10.526 78.925 43.808 1.00 8.26  ? 160 LEU A C   1 
ATOM   1184 O O   . LEU A 1 160 ? -10.952 77.758 43.908 1.00 8.26  ? 160 LEU A O   1 
ATOM   1185 C CB  . LEU A 1 160 ? -8.181  79.589 42.768 1.00 8.26  ? 160 LEU A CB  1 
ATOM   1186 C CG  . LEU A 1 160 ? -8.099  78.689 41.537 1.00 22.45 ? 160 LEU A CG  1 
ATOM   1187 C CD1 . LEU A 1 160 ? -7.361  79.444 40.436 1.00 22.45 ? 160 LEU A CD1 1 
ATOM   1188 C CD2 . LEU A 1 160 ? -7.337  77.371 41.765 1.00 22.45 ? 160 LEU A CD2 1 
ATOM   1189 N N   . PRO A 1 161 ? -11.388 79.920 44.066 1.00 8.36  ? 161 PRO A N   1 
ATOM   1190 C CA  . PRO A 1 161 ? -12.850 79.704 44.240 1.00 8.36  ? 161 PRO A CA  1 
ATOM   1191 C C   . PRO A 1 161 ? -13.406 79.552 42.831 1.00 8.36  ? 161 PRO A C   1 
ATOM   1192 O O   . PRO A 1 161 ? -12.917 80.246 41.898 1.00 8.36  ? 161 PRO A O   1 
ATOM   1193 C CB  . PRO A 1 161 ? -13.444 80.992 44.821 1.00 8.36  ? 161 PRO A CB  1 
ATOM   1194 C CG  . PRO A 1 161 ? -12.362 82.084 44.664 1.00 18.56 ? 161 PRO A CG  1 
ATOM   1195 C CD  . PRO A 1 161 ? -11.063 81.365 44.218 1.00 18.56 ? 161 PRO A CD  1 
ATOM   1196 N N   . LEU A 1 162 ? -14.515 78.794 42.636 1.00 12.83 ? 162 LEU A N   1 
ATOM   1197 C CA  . LEU A 1 162 ? -15.116 78.862 41.283 1.00 12.83 ? 162 LEU A CA  1 
ATOM   1198 C C   . LEU A 1 162 ? -15.928 80.121 41.147 1.00 12.83 ? 162 LEU A C   1 
ATOM   1199 O O   . LEU A 1 162 ? -16.369 80.645 42.192 1.00 12.83 ? 162 LEU A O   1 
ATOM   1200 C CB  . LEU A 1 162 ? -16.091 77.701 41.000 1.00 12.83 ? 162 LEU A CB  1 
ATOM   1201 C CG  . LEU A 1 162 ? -15.377 76.355 41.067 1.00 8.54  ? 162 LEU A CG  1 
ATOM   1202 C CD1 . LEU A 1 162 ? -16.379 75.191 41.077 1.00 8.54  ? 162 LEU A CD1 1 
ATOM   1203 C CD2 . LEU A 1 162 ? -14.250 76.268 39.988 1.00 8.54  ? 162 LEU A CD2 1 
ATOM   1204 N N   . LEU A 1 163 ? -16.098 80.607 39.936 1.00 11.91 ? 163 LEU A N   1 
ATOM   1205 C CA  . LEU A 1 163 ? -16.941 81.790 39.703 1.00 11.91 ? 163 LEU A CA  1 
ATOM   1206 C C   . LEU A 1 163 ? -18.128 81.356 38.880 1.00 11.91 ? 163 LEU A C   1 
ATOM   1207 O O   . LEU A 1 163 ? -18.023 80.421 38.070 1.00 11.91 ? 163 LEU A O   1 
ATOM   1208 C CB  . LEU A 1 163 ? -16.287 82.913 38.862 1.00 11.91 ? 163 LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 163 ? -14.945 83.535 39.334 1.00 22.26 ? 163 LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 163 ? -14.823 84.874 38.584 1.00 22.26 ? 163 LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 163 ? -14.895 83.734 40.845 1.00 22.26 ? 163 LEU A CD2 1 
ATOM   1212 N N   . SER A 1 164 ? -19.194 82.088 38.890 1.00 10.88 ? 164 SER A N   1 
ATOM   1213 C CA  . SER A 1 164 ? -20.249 81.871 37.863 1.00 10.88 ? 164 SER A CA  1 
ATOM   1214 C C   . SER A 1 164 ? -19.839 82.561 36.583 1.00 10.88 ? 164 SER A C   1 
ATOM   1215 O O   . SER A 1 164 ? -18.994 83.465 36.679 1.00 10.88 ? 164 SER A O   1 
ATOM   1216 C CB  . SER A 1 164 ? -21.512 82.577 38.293 1.00 10.88 ? 164 SER A CB  1 
ATOM   1217 O OG  . SER A 1 164 ? -21.301 83.994 38.293 1.00 23.66 ? 164 SER A OG  1 
ATOM   1218 N N   . ASN A 1 165 ? -20.303 82.147 35.426 1.00 18.21 ? 165 ASN A N   1 
ATOM   1219 C CA  . ASN A 1 165 ? -19.879 82.767 34.161 1.00 18.21 ? 165 ASN A CA  1 
ATOM   1220 C C   . ASN A 1 165 ? -20.392 84.204 33.989 1.00 18.21 ? 165 ASN A C   1 
ATOM   1221 O O   . ASN A 1 165 ? -19.807 84.993 33.209 1.00 18.21 ? 165 ASN A O   1 
ATOM   1222 C CB  . ASN A 1 165 ? -20.450 81.950 33.008 1.00 18.21 ? 165 ASN A CB  1 
ATOM   1223 C CG  . ASN A 1 165 ? -19.632 80.700 32.684 1.00 13.63 ? 165 ASN A CG  1 
ATOM   1224 O OD1 . ASN A 1 165 ? -19.600 80.341 31.474 1.00 13.63 ? 165 ASN A OD1 1 
ATOM   1225 N ND2 . ASN A 1 165 ? -18.777 80.311 33.569 1.00 13.63 ? 165 ASN A ND2 1 
ATOM   1226 N N   . THR A 1 166 ? -21.431 84.561 34.723 1.00 23.60 ? 166 THR A N   1 
ATOM   1227 C CA  . THR A 1 166 ? -22.042 85.929 34.749 1.00 23.60 ? 166 THR A CA  1 
ATOM   1228 C C   . THR A 1 166 ? -21.066 86.961 35.313 1.00 23.60 ? 166 THR A C   1 
ATOM   1229 O O   . THR A 1 166 ? -20.783 88.041 34.723 1.00 23.60 ? 166 THR A O   1 
ATOM   1230 C CB  . THR A 1 166 ? -23.277 85.889 35.671 1.00 23.60 ? 166 THR A CB  1 
ATOM   1231 O OG1 . THR A 1 166 ? -24.335 85.244 34.937 1.00 33.98 ? 166 THR A OG1 1 
ATOM   1232 C CG2 . THR A 1 166 ? -23.751 87.318 36.053 1.00 33.98 ? 166 THR A CG2 1 
ATOM   1233 N N   . ASN A 1 167 ? -20.520 86.482 36.389 1.00 15.88 ? 167 ASN A N   1 
ATOM   1234 C CA  . ASN A 1 167 ? -19.504 87.147 37.094 1.00 15.88 ? 167 ASN A CA  1 
ATOM   1235 C C   . ASN A 1 167 ? -18.148 87.154 36.419 1.00 15.88 ? 167 ASN A C   1 
ATOM   1236 O O   . ASN A 1 167 ? -17.468 88.213 36.436 1.00 15.88 ? 167 ASN A O   1 
ATOM   1237 C CB  . ASN A 1 167 ? -19.416 86.519 38.445 1.00 15.88 ? 167 ASN A CB  1 
ATOM   1238 C CG  . ASN A 1 167 ? -19.200 87.612 39.467 1.00 48.98 ? 167 ASN A CG  1 
ATOM   1239 O OD1 . ASN A 1 167 ? -20.151 88.438 39.604 1.00 48.98 ? 167 ASN A OD1 1 
ATOM   1240 N ND2 . ASN A 1 167 ? -17.894 87.868 39.626 1.00 48.98 ? 167 ASN A ND2 1 
ATOM   1241 N N   . CYS A 1 168 ? -17.817 86.091 35.725 1.00 13.78 ? 168 CYS A N   1 
ATOM   1242 C CA  . CYS A 1 168 ? -16.604 86.095 34.886 1.00 13.78 ? 168 CYS A CA  1 
ATOM   1243 C C   . CYS A 1 168 ? -16.618 87.055 33.702 1.00 13.78 ? 168 CYS A C   1 
ATOM   1244 O O   . CYS A 1 168 ? -15.530 87.578 33.307 1.00 13.78 ? 168 CYS A O   1 
ATOM   1245 C CB  . CYS A 1 168 ? -16.268 84.672 34.373 1.00 13.78 ? 168 CYS A CB  1 
ATOM   1246 S SG  . CYS A 1 168 ? -14.572 84.463 33.828 1.00 12.46 ? 168 CYS A SG  1 
ATOM   1247 N N   . LYS A 1 169 ? -17.781 87.312 33.155 1.00 20.79 ? 169 LYS A N   1 
ATOM   1248 C CA  . LYS A 1 169 ? -17.887 88.290 32.031 1.00 20.79 ? 169 LYS A CA  1 
ATOM   1249 C C   . LYS A 1 169 ? -17.610 89.754 32.423 1.00 20.79 ? 169 LYS A C   1 
ATOM   1250 O O   . LYS A 1 169 ? -17.429 90.611 31.541 1.00 20.79 ? 169 LYS A O   1 
ATOM   1251 C CB  . LYS A 1 169 ? -19.285 88.174 31.336 1.00 20.79 ? 169 LYS A CB  1 
ATOM   1252 C CG  . LYS A 1 169 ? -19.528 86.726 30.860 1.00 22.01 ? 169 LYS A CG  1 
ATOM   1253 C CD  . LYS A 1 169 ? -20.885 86.528 30.195 1.00 22.01 ? 169 LYS A CD  1 
ATOM   1254 C CE  . LYS A 1 169 ? -20.966 85.117 29.635 1.00 22.01 ? 169 LYS A CE  1 
ATOM   1255 N NZ  . LYS A 1 169 ? -22.310 84.845 29.114 1.00 22.01 ? 169 LYS A NZ  1 
ATOM   1256 N N   . LYS A 1 170 ? -17.534 90.046 33.711 1.00 10.57 ? 170 LYS A N   1 
ATOM   1257 C CA  . LYS A 1 170 ? -17.104 91.332 34.190 1.00 10.57 ? 170 LYS A CA  1 
ATOM   1258 C C   . LYS A 1 170 ? -15.633 91.504 33.944 1.00 10.57 ? 170 LYS A C   1 
ATOM   1259 O O   . LYS A 1 170 ? -15.195 92.672 33.787 1.00 10.57 ? 170 LYS A O   1 
ATOM   1260 C CB  . LYS A 1 170 ? -17.332 91.404 35.690 1.00 10.57 ? 170 LYS A CB  1 
ATOM   1261 C CG  . LYS A 1 170 ? -18.862 91.320 35.871 1.00 34.37 ? 170 LYS A CG  1 
ATOM   1262 C CD  . LYS A 1 170 ? -19.374 91.271 37.312 1.00 34.37 ? 170 LYS A CD  1 
ATOM   1263 C CE  . LYS A 1 170 ? -20.907 91.148 37.274 1.00 34.37 ? 170 LYS A CE  1 
ATOM   1264 N NZ  . LYS A 1 170 ? -21.440 90.797 38.602 1.00 34.37 ? 170 LYS A NZ  1 
ATOM   1265 N N   . TYR A 1 171 ? -14.945 90.406 33.749 1.00 13.05 ? 171 TYR A N   1 
ATOM   1266 C CA  . TYR A 1 171 ? -13.523 90.472 33.495 1.00 13.05 ? 171 TYR A CA  1 
ATOM   1267 C C   . TYR A 1 171 ? -13.160 90.312 32.057 1.00 13.05 ? 171 TYR A C   1 
ATOM   1268 O O   . TYR A 1 171 ? -12.331 91.161 31.627 1.00 13.05 ? 171 TYR A O   1 
ATOM   1269 C CB  . TYR A 1 171 ? -12.664 89.459 34.284 1.00 13.05 ? 171 TYR A CB  1 
ATOM   1270 C CG  . TYR A 1 171 ? -12.930 89.523 35.801 1.00 17.03 ? 171 TYR A CG  1 
ATOM   1271 C CD1 . TYR A 1 171 ? -12.107 90.324 36.551 1.00 17.03 ? 171 TYR A CD1 1 
ATOM   1272 C CD2 . TYR A 1 171 ? -13.969 88.833 36.404 1.00 17.03 ? 171 TYR A CD2 1 
ATOM   1273 C CE1 . TYR A 1 171 ? -12.286 90.411 37.928 1.00 17.03 ? 171 TYR A CE1 1 
ATOM   1274 C CE2 . TYR A 1 171 ? -14.177 88.933 37.770 1.00 17.03 ? 171 TYR A CE2 1 
ATOM   1275 C CZ  . TYR A 1 171 ? -13.311 89.712 38.534 1.00 17.03 ? 171 TYR A CZ  1 
ATOM   1276 O OH  . TYR A 1 171 ? -13.446 89.827 39.964 1.00 17.03 ? 171 TYR A OH  1 
ATOM   1277 N N   . TRP A 1 172 ? -13.701 89.305 31.374 1.00 18.39 ? 172 TRP A N   1 
ATOM   1278 C CA  . TRP A 1 172 ? -13.266 88.956 30.001 1.00 18.39 ? 172 TRP A CA  1 
ATOM   1279 C C   . TRP A 1 172 ? -14.298 89.214 28.914 1.00 18.39 ? 172 TRP A C   1 
ATOM   1280 O O   . TRP A 1 172 ? -14.056 88.872 27.719 1.00 18.39 ? 172 TRP A O   1 
ATOM   1281 C CB  . TRP A 1 172 ? -12.921 87.443 29.998 1.00 18.39 ? 172 TRP A CB  1 
ATOM   1282 C CG  . TRP A 1 172 ? -11.697 87.096 30.884 1.00 19.66 ? 172 TRP A CG  1 
ATOM   1283 C CD1 . TRP A 1 172 ? -11.620 86.362 32.006 1.00 19.66 ? 172 TRP A CD1 1 
ATOM   1284 C CD2 . TRP A 1 172 ? -10.380 87.453 30.574 1.00 19.66 ? 172 TRP A CD2 1 
ATOM   1285 N NE1 . TRP A 1 172 ? -10.260 86.250 32.390 1.00 19.66 ? 172 TRP A NE1 1 
ATOM   1286 C CE2 . TRP A 1 172 ? -9.540  86.859 31.535 1.00 19.66 ? 172 TRP A CE2 1 
ATOM   1287 C CE3 . TRP A 1 172 ? -9.868  88.210 29.532 1.00 19.66 ? 172 TRP A CE3 1 
ATOM   1288 C CZ2 . TRP A 1 172 ? -8.158  86.926 31.453 1.00 19.66 ? 172 TRP A CZ2 1 
ATOM   1289 C CZ3 . TRP A 1 172 ? -8.492  88.295 29.456 1.00 19.66 ? 172 TRP A CZ3 1 
ATOM   1290 C CH2 . TRP A 1 172 ? -7.659  87.654 30.388 1.00 19.66 ? 172 TRP A CH2 1 
ATOM   1291 N N   . GLY A 1 173 ? -15.489 89.661 29.357 1.00 20.28 ? 173 GLY A N   1 
ATOM   1292 C CA  . GLY A 1 173 ? -16.587 89.972 28.430 1.00 20.28 ? 173 GLY A CA  1 
ATOM   1293 C C   . GLY A 1 173 ? -17.110 88.772 27.653 1.00 20.28 ? 173 GLY A C   1 
ATOM   1294 O O   . GLY A 1 173 ? -17.294 87.658 28.224 1.00 20.28 ? 173 GLY A O   1 
ATOM   1295 N N   . THR A 1 174 ? -17.437 89.031 26.410 1.00 30.14 ? 174 THR A N   1 
ATOM   1296 C CA  . THR A 1 174 ? -18.106 88.018 25.546 1.00 30.14 ? 174 THR A CA  1 
ATOM   1297 C C   . THR A 1 174 ? -17.173 86.908 25.055 1.00 30.14 ? 174 THR A C   1 
ATOM   1298 O O   . THR A 1 174 ? -17.698 85.879 24.560 1.00 30.14 ? 174 THR A O   1 
ATOM   1299 C CB  . THR A 1 174 ? -18.668 88.744 24.329 1.00 30.14 ? 174 THR A CB  1 
ATOM   1300 O OG1 . THR A 1 174 ? -17.604 89.452 23.681 1.00 26.61 ? 174 THR A OG1 1 
ATOM   1301 C CG2 . THR A 1 174 ? -19.691 89.740 24.821 1.00 26.61 ? 174 THR A CG2 1 
ATOM   1302 N N   . LYS A 1 175 ? -15.894 86.990 25.468 1.00 20.29 ? 175 LYS A N   1 
ATOM   1303 C CA  . LYS A 1 175 ? -15.071 85.772 25.337 1.00 20.29 ? 175 LYS A CA  1 
ATOM   1304 C C   . LYS A 1 175 ? -15.568 84.537 26.116 1.00 20.29 ? 175 LYS A C   1 
ATOM   1305 O O   . LYS A 1 175 ? -15.106 83.406 25.836 1.00 20.29 ? 175 LYS A O   1 
ATOM   1306 C CB  . LYS A 1 175 ? -13.644 86.085 25.794 1.00 20.29 ? 175 LYS A CB  1 
ATOM   1307 C CG  . LYS A 1 175 ? -13.045 87.238 24.987 1.00 41.20 ? 175 LYS A CG  1 
ATOM   1308 C CD  . LYS A 1 175 ? -11.643 87.549 25.530 1.00 41.20 ? 175 LYS A CD  1 
ATOM   1309 C CE  . LYS A 1 175 ? -11.008 88.703 24.759 1.00 41.20 ? 175 LYS A CE  1 
ATOM   1310 N NZ  . LYS A 1 175 ? -10.840 88.295 23.351 1.00 41.20 ? 175 LYS A NZ  1 
ATOM   1311 N N   . ILE A 1 176 ? -16.371 84.744 27.164 1.00 24.23 ? 176 ILE A N   1 
ATOM   1312 C CA  . ILE A 1 176 ? -16.785 83.667 28.065 1.00 24.23 ? 176 ILE A CA  1 
ATOM   1313 C C   . ILE A 1 176 ? -17.985 82.900 27.496 1.00 24.23 ? 176 ILE A C   1 
ATOM   1314 O O   . ILE A 1 176 ? -19.095 83.456 27.376 1.00 24.23 ? 176 ILE A O   1 
ATOM   1315 C CB  . ILE A 1 176 ? -16.941 84.105 29.578 1.00 24.23 ? 176 ILE A CB  1 
ATOM   1316 C CG1 . ILE A 1 176 ? -15.680 84.860 30.117 1.00 7.81  ? 176 ILE A CG1 1 
ATOM   1317 C CG2 . ILE A 1 176 ? -17.262 82.947 30.553 1.00 7.81  ? 176 ILE A CG2 1 
ATOM   1318 C CD1 . ILE A 1 176 ? -14.427 83.953 29.987 1.00 7.81  ? 176 ILE A CD1 1 
ATOM   1319 N N   . LYS A 1 177 ? -17.715 81.686 26.986 1.00 11.02 ? 177 LYS A N   1 
ATOM   1320 C CA  . LYS A 1 177 ? -18.707 80.747 26.390 1.00 11.02 ? 177 LYS A CA  1 
ATOM   1321 C C   . LYS A 1 177 ? -19.147 79.691 27.390 1.00 11.02 ? 177 LYS A C   1 
ATOM   1322 O O   . LYS A 1 177 ? -18.527 79.553 28.477 1.00 11.02 ? 177 LYS A O   1 
ATOM   1323 C CB  . LYS A 1 177 ? -18.222 80.032 25.108 1.00 11.02 ? 177 LYS A CB  1 
ATOM   1324 C CG  . LYS A 1 177 ? -17.513 80.880 24.062 1.00 22.97 ? 177 LYS A CG  1 
ATOM   1325 C CD  . LYS A 1 177 ? -18.367 82.057 23.567 1.00 22.97 ? 177 LYS A CD  1 
ATOM   1326 C CE  . LYS A 1 177 ? -17.553 82.983 22.616 1.00 22.97 ? 177 LYS A CE  1 
ATOM   1327 N NZ  . LYS A 1 177 ? -18.407 84.026 22.030 1.00 22.97 ? 177 LYS A NZ  1 
ATOM   1328 N N   . ASP A 1 178 ? -20.301 79.057 27.107 1.00 18.43 ? 178 ASP A N   1 
ATOM   1329 C CA  . ASP A 1 178 ? -20.954 78.196 28.120 1.00 18.43 ? 178 ASP A CA  1 
ATOM   1330 C C   . ASP A 1 178 ? -20.163 76.974 28.501 1.00 18.43 ? 178 ASP A C   1 
ATOM   1331 O O   . ASP A 1 178 ? -20.396 76.489 29.631 1.00 18.43 ? 178 ASP A O   1 
ATOM   1332 C CB  . ASP A 1 178 ? -22.338 77.659 27.742 1.00 18.43 ? 178 ASP A CB  1 
ATOM   1333 C CG  . ASP A 1 178 ? -23.339 78.777 27.447 1.00 33.51 ? 178 ASP A CG  1 
ATOM   1334 O OD1 . ASP A 1 178 ? -23.277 79.852 28.080 1.00 33.51 ? 178 ASP A OD1 1 
ATOM   1335 O OD2 . ASP A 1 178 ? -24.017 78.723 26.395 1.00 33.51 ? 178 ASP A OD2 1 
ATOM   1336 N N   . ALA A 1 179 ? -19.277 76.592 27.599 1.00 9.12  ? 179 ALA A N   1 
ATOM   1337 C CA  . ALA A 1 179 ? -18.413 75.405 27.768 1.00 9.12  ? 179 ALA A CA  1 
ATOM   1338 C C   . ALA A 1 179 ? -17.066 75.789 28.371 1.00 9.12  ? 179 ALA A C   1 
ATOM   1339 O O   . ALA A 1 179 ? -16.059 75.034 28.242 1.00 9.12  ? 179 ALA A O   1 
ATOM   1340 C CB  . ALA A 1 179 ? -18.123 74.734 26.406 1.00 9.12  ? 179 ALA A CB  1 
ATOM   1341 N N   . MET A 1 180 ? -17.119 76.909 29.059 1.00 15.50 ? 180 MET A N   1 
ATOM   1342 C CA  . MET A 1 180 ? -16.014 77.423 29.839 1.00 15.50 ? 180 MET A CA  1 
ATOM   1343 C C   . MET A 1 180 ? -16.479 77.552 31.288 1.00 15.50 ? 180 MET A C   1 
ATOM   1344 O O   . MET A 1 180 ? -17.695 77.770 31.555 1.00 15.50 ? 180 MET A O   1 
ATOM   1345 C CB  . MET A 1 180 ? -15.508 78.774 29.308 1.00 15.50 ? 180 MET A CB  1 
ATOM   1346 C CG  . MET A 1 180 ? -14.749 78.636 27.971 1.00 9.04  ? 180 MET A CG  1 
ATOM   1347 S SD  . MET A 1 180 ? -14.427 80.222 27.126 1.00 9.04  ? 180 MET A SD  1 
ATOM   1348 C CE  . MET A 1 180 ? -14.311 79.783 25.387 1.00 9.04  ? 180 MET A CE  1 
ATOM   1349 N N   . ILE A 1 181 ? -15.459 77.566 32.152 1.00 9.34  ? 181 ILE A N   1 
ATOM   1350 C CA  . ILE A 1 181 ? -15.561 77.841 33.611 1.00 9.34  ? 181 ILE A CA  1 
ATOM   1351 C C   . ILE A 1 181 ? -14.374 78.681 34.089 1.00 9.34  ? 181 ILE A C   1 
ATOM   1352 O O   . ILE A 1 181 ? -13.258 78.463 33.601 1.00 9.34  ? 181 ILE A O   1 
ATOM   1353 C CB  . ILE A 1 181 ? -15.840 76.542 34.444 1.00 9.34  ? 181 ILE A CB  1 
ATOM   1354 C CG1 . ILE A 1 181 ? -16.356 76.905 35.854 1.00 3.87  ? 181 ILE A CG1 1 
ATOM   1355 C CG2 . ILE A 1 181 ? -14.609 75.572 34.484 1.00 3.87  ? 181 ILE A CG2 1 
ATOM   1356 C CD1 . ILE A 1 181 ? -16.512 75.664 36.796 1.00 3.87  ? 181 ILE A CD1 1 
ATOM   1357 N N   . CYS A 1 182 ? -14.587 79.640 34.952 1.00 11.63 ? 182 CYS A N   1 
ATOM   1358 C CA  . CYS A 1 182 ? -13.568 80.508 35.515 1.00 11.63 ? 182 CYS A CA  1 
ATOM   1359 C C   . CYS A 1 182 ? -13.366 80.349 36.998 1.00 11.63 ? 182 CYS A C   1 
ATOM   1360 O O   . CYS A 1 182 ? -14.310 80.020 37.744 1.00 11.63 ? 182 CYS A O   1 
ATOM   1361 C CB  . CYS A 1 182 ? -13.977 81.983 35.303 1.00 11.63 ? 182 CYS A CB  1 
ATOM   1362 S SG  . CYS A 1 182 ? -14.375 82.441 33.606 1.00 11.77 ? 182 CYS A SG  1 
ATOM   1363 N N   . ALA A 1 183 ? -12.161 80.468 37.395 1.00 9.15  ? 183 ALA A N   1 
ATOM   1364 C CA  . ALA A 1 183 ? -11.806 80.350 38.810 1.00 9.15  ? 183 ALA A CA  1 
ATOM   1365 C C   . ALA A 1 183 ? -10.693 81.332 39.221 1.00 9.15  ? 183 ALA A C   1 
ATOM   1366 O O   . ALA A 1 183 ? -9.737  81.585 38.429 1.00 9.15  ? 183 ALA A O   1 
ATOM   1367 C CB  . ALA A 1 183 ? -11.444 78.894 39.164 1.00 9.15  ? 183 ALA A CB  1 
ATOM   1368 N N   . GLY A 1 184 ? -10.711 81.760 40.460 1.00 17.39 ? 184 GLY A N   1 
ATOM   1369 C CA  . GLY A 1 184 ? -9.693  82.601 41.052 1.00 17.39 ? 184 GLY A CA  1 
ATOM   1370 C C   . GLY A 1 184 ? -10.136 84.054 41.100 1.00 17.39 ? 184 GLY A C   1 
ATOM   1371 O O   . GLY A 1 184 ? -11.209 84.334 41.671 1.00 17.39 ? 184 GLY A O   1 
ATOM   1372 N N   . ALA A 1 185 ? -9.172  84.937 40.830 1.00 20.64 ? 185 ALA A N   1 
ATOM   1373 C CA  . ALA A 1 185 ? -9.248  86.382 41.159 1.00 20.64 ? 185 ALA A CA  1 
ATOM   1374 C C   . ALA A 1 185 ? -9.485  86.688 42.636 1.00 20.64 ? 185 ALA A C   1 
ATOM   1375 O O   . ALA A 1 185 ? -10.177 87.684 42.923 1.00 20.64 ? 185 ALA A O   1 
ATOM   1376 C CB  . ALA A 1 185 ? -10.371 87.095 40.372 1.00 20.64 ? 185 ALA A CB  1 
ATOM   1377 N N   . SER A 1 186 ? -9.084  85.894 43.552 1.00 23.92 ? 186 SER A N   1 
ATOM   1378 C CA  . SER A 1 186 ? -9.283  86.285 44.959 1.00 23.92 ? 186 SER A CA  1 
ATOM   1379 C C   . SER A 1 186 ? -7.994  86.513 45.706 1.00 23.92 ? 186 SER A C   1 
ATOM   1380 O O   . SER A 1 186 ? -7.954  86.270 46.925 1.00 23.92 ? 186 SER A O   1 
ATOM   1381 C CB  . SER A 1 186 ? -10.047 85.244 45.821 1.00 23.92 ? 186 SER A CB  1 
ATOM   1382 O OG  . SER A 1 186 ? -11.463 85.411 45.681 1.00 58.85 ? 186 SER A OG  1 
ATOM   1383 N N   . GLY A 1 187 ? -6.979  86.941 45.057 1.00 17.56 ? 187 GLY A N   1 
ATOM   1384 C CA  . GLY A 1 187 ? -5.724  87.135 45.792 1.00 17.56 ? 187 GLY A CA  1 
ATOM   1385 C C   . GLY A 1 187 ? -4.641  86.122 45.470 1.00 17.56 ? 187 GLY A C   1 
ATOM   1386 O O   . GLY A 1 187 ? -3.460  86.306 45.854 1.00 17.56 ? 187 GLY A O   1 
ATOM   1387 N N   . VAL A 1 188 ? -5.031  85.057 44.784 1.00 16.44 ? 188 VAL A N   1 
ATOM   1388 C CA  . VAL A 1 188 ? -3.922  84.226 44.293 1.00 16.44 ? 188 VAL A CA  1 
ATOM   1389 C C   . VAL A 1 188 ? -4.085  83.982 42.789 1.00 16.44 ? 188 VAL A C   1 
ATOM   1390 O O   . VAL A 1 188 ? -5.180  84.145 42.226 1.00 16.44 ? 188 VAL A O   1 
ATOM   1391 C CB  . VAL A 1 188 ? -3.897  82.886 45.049 1.00 16.44 ? 188 VAL A CB  1 
ATOM   1392 C CG1 . VAL A 1 188 ? -5.126  82.006 44.784 1.00 16.10 ? 188 VAL A CG1 1 
ATOM   1393 C CG2 . VAL A 1 188 ? -2.688  82.014 44.697 1.00 16.10 ? 188 VAL A CG2 1 
ATOM   1394 N N   . SER A 1 189 ? -2.906  84.024 42.183 1.00 14.35 ? 189 SER A N   1 
ATOM   1395 C CA  . SER A 1 189 ? -2.700  83.758 40.776 1.00 14.35 ? 189 SER A CA  1 
ATOM   1396 C C   . SER A 1 189 ? -3.355  82.464 40.246 1.00 14.35 ? 189 SER A C   1 
ATOM   1397 O O   . SER A 1 189 ? -3.294  81.428 40.966 1.00 14.35 ? 189 SER A O   1 
ATOM   1398 C CB  . SER A 1 189 ? -1.171  83.624 40.607 1.00 14.35 ? 189 SER A CB  1 
ATOM   1399 O OG  . SER A 1 189 ? -1.061  84.161 39.310 1.00 27.63 ? 189 SER A OG  1 
ATOM   1400 N N   . SER A 1 190 ? -3.549  82.359 38.933 1.00 10.01 ? 190 SER A N   1 
ATOM   1401 C CA  . SER A 1 190 ? -3.696  80.995 38.328 1.00 10.01 ? 190 SER A CA  1 
ATOM   1402 C C   . SER A 1 190 ? -2.566  80.514 37.439 1.00 10.01 ? 190 SER A C   1 
ATOM   1403 O O   . SER A 1 190 ? -2.673  79.468 36.793 1.00 10.01 ? 190 SER A O   1 
ATOM   1404 C CB  . SER A 1 190 ? -5.019  80.849 37.529 1.00 10.01 ? 190 SER A CB  1 
ATOM   1405 O OG  . SER A 1 190 ? -4.846  81.586 36.340 1.00 23.90 ? 190 SER A OG  1 
ATOM   1406 N N   . CYS A 1 191 ? -1.592  81.324 37.208 1.00 7.17  ? 191 CYS A N   1 
ATOM   1407 C CA  . CYS A 1 191 ? -0.488  81.049 36.255 1.00 7.17  ? 191 CYS A CA  1 
ATOM   1408 C C   . CYS A 1 191 ? 0.328   79.782 36.513 1.00 7.17  ? 191 CYS A C   1 
ATOM   1409 O O   . CYS A 1 191 ? 1.087   79.413 35.621 1.00 7.17  ? 191 CYS A O   1 
ATOM   1410 C CB  . CYS A 1 191 ? 0.521   82.208 36.221 1.00 7.17  ? 191 CYS A CB  1 
ATOM   1411 S SG  . CYS A 1 191 ? 1.239   82.580 37.810 1.00 17.83 ? 191 CYS A SG  1 
ATOM   1412 N N   . MET A 1 192 ? 0.248   79.170 37.683 1.00 13.56 ? 192 MET A N   1 
ATOM   1413 C CA  . MET A 1 192 ? 0.943   77.911 37.968 1.00 13.56 ? 192 MET A CA  1 
ATOM   1414 C C   . MET A 1 192 ? 0.368   76.710 37.202 1.00 13.56 ? 192 MET A C   1 
ATOM   1415 O O   . MET A 1 192 ? 1.118   75.743 36.935 1.00 13.56 ? 192 MET A O   1 
ATOM   1416 C CB  . MET A 1 192 ? 1.068   77.579 39.472 1.00 13.56 ? 192 MET A CB  1 
ATOM   1417 C CG  . MET A 1 192 ? -0.290  77.224 40.116 1.00 13.28 ? 192 MET A CG  1 
ATOM   1418 S SD  . MET A 1 192 ? -1.329  78.655 40.323 1.00 13.28 ? 192 MET A SD  1 
ATOM   1419 C CE  . MET A 1 192 ? -0.300  79.535 41.450 1.00 13.28 ? 192 MET A CE  1 
ATOM   1420 N N   . GLY A 1 193 ? -0.867  76.798 36.707 1.00 9.62  ? 193 GLY A N   1 
ATOM   1421 C CA  . GLY A 1 193 ? -1.437  75.772 35.807 1.00 9.62  ? 193 GLY A CA  1 
ATOM   1422 C C   . GLY A 1 193 ? -0.689  75.736 34.476 1.00 9.62  ? 193 GLY A C   1 
ATOM   1423 O O   . GLY A 1 193 ? -0.580  76.769 33.788 1.00 9.62  ? 193 GLY A O   1 
ATOM   1424 N N   . ASP A 1 194 ? -0.295  74.629 34.007 1.00 11.22 ? 194 ASP A N   1 
ATOM   1425 C CA  . ASP A 1 194 ? 0.232   74.561 32.653 1.00 11.22 ? 194 ASP A CA  1 
ATOM   1426 C C   . ASP A 1 194 ? -0.988  74.469 31.742 1.00 11.22 ? 194 ASP A C   1 
ATOM   1427 O O   . ASP A 1 194 ? -2.026  73.976 32.216 1.00 11.22 ? 194 ASP A O   1 
ATOM   1428 C CB  . ASP A 1 194 ? 0.990   73.207 32.443 1.00 11.22 ? 194 ASP A CB  1 
ATOM   1429 C CG  . ASP A 1 194 ? 2.135   73.022 33.429 1.00 17.41 ? 194 ASP A CG  1 
ATOM   1430 O OD1 . ASP A 1 194 ? 3.244   73.507 33.126 1.00 17.41 ? 194 ASP A OD1 1 
ATOM   1431 O OD2 . ASP A 1 194 ? 2.055   72.173 34.357 1.00 17.41 ? 194 ASP A OD2 1 
ATOM   1432 N N   . SER A 1 195 ? -0.852  74.785 30.485 1.00 10.17 ? 195 SER A N   1 
ATOM   1433 C CA  . SER A 1 195 ? -1.907  74.617 29.536 1.00 10.17 ? 195 SER A CA  1 
ATOM   1434 C C   . SER A 1 195 ? -2.337  73.157 29.475 1.00 10.17 ? 195 SER A C   1 
ATOM   1435 O O   . SER A 1 195 ? -1.450  72.284 29.405 1.00 10.17 ? 195 SER A O   1 
ATOM   1436 C CB  . SER A 1 195 ? -1.411  75.059 28.148 1.00 10.17 ? 195 SER A CB  1 
ATOM   1437 O OG  . SER A 1 195 ? -1.814  76.434 27.900 1.00 12.29 ? 195 SER A OG  1 
ATOM   1438 N N   . GLY A 1 196 ? -3.602  72.883 29.553 1.00 10.62 ? 196 GLY A N   1 
ATOM   1439 C CA  . GLY A 1 196 ? -3.995  71.507 29.579 1.00 10.62 ? 196 GLY A CA  1 
ATOM   1440 C C   . GLY A 1 196 ? -4.144  70.934 30.977 1.00 10.62 ? 196 GLY A C   1 
ATOM   1441 O O   . GLY A 1 196 ? -4.663  69.794 31.115 1.00 10.62 ? 196 GLY A O   1 
ATOM   1442 N N   . GLY A 1 197 ? -3.524  71.517 31.973 1.00 6.64  ? 197 GLY A N   1 
ATOM   1443 C CA  . GLY A 1 197 ? -3.461  70.905 33.331 1.00 6.64  ? 197 GLY A CA  1 
ATOM   1444 C C   . GLY A 1 197 ? -4.795  70.955 34.073 1.00 6.64  ? 197 GLY A C   1 
ATOM   1445 O O   . GLY A 1 197 ? -5.823  71.384 33.496 1.00 6.64  ? 197 GLY A O   1 
ATOM   1446 N N   . PRO A 1 198 ? -4.848  70.396 35.220 1.00 6.79  ? 198 PRO A N   1 
ATOM   1447 C CA  . PRO A 1 198 ? -6.126  70.163 35.987 1.00 6.79  ? 198 PRO A CA  1 
ATOM   1448 C C   . PRO A 1 198 ? -6.613  71.345 36.826 1.00 6.79  ? 198 PRO A C   1 
ATOM   1449 O O   . PRO A 1 198 ? -5.867  71.992 37.604 1.00 6.79  ? 198 PRO A O   1 
ATOM   1450 C CB  . PRO A 1 198 ? -5.796  69.027 36.998 1.00 6.79  ? 198 PRO A CB  1 
ATOM   1451 C CG  . PRO A 1 198 ? -4.247  68.990 37.096 1.00 7.86  ? 198 PRO A CG  1 
ATOM   1452 C CD  . PRO A 1 198 ? -3.685  69.761 35.906 1.00 7.86  ? 198 PRO A CD  1 
ATOM   1453 N N   . LEU A 1 199 ? -7.896  71.402 36.916 1.00 9.01  ? 199 LEU A N   1 
ATOM   1454 C CA  . LEU A 1 199 ? -8.556  72.113 38.018 1.00 9.01  ? 199 LEU A CA  1 
ATOM   1455 C C   . LEU A 1 199 ? -9.547  71.176 38.739 1.00 9.01  ? 199 LEU A C   1 
ATOM   1456 O O   . LEU A 1 199 ? -10.424 70.605 38.033 1.00 9.01  ? 199 LEU A O   1 
ATOM   1457 C CB  . LEU A 1 199 ? -9.364  73.259 37.416 1.00 9.01  ? 199 LEU A CB  1 
ATOM   1458 C CG  . LEU A 1 199 ? -10.246 73.913 38.478 1.00 7.58  ? 199 LEU A CG  1 
ATOM   1459 C CD1 . LEU A 1 199 ? -9.420  74.640 39.485 1.00 7.58  ? 199 LEU A CD1 1 
ATOM   1460 C CD2 . LEU A 1 199 ? -11.195 74.865 37.793 1.00 7.58  ? 199 LEU A CD2 1 
ATOM   1461 N N   . VAL A 1 200 ? -9.212  70.793 39.923 1.00 9.30  ? 200 VAL A N   1 
ATOM   1462 C CA  . VAL A 1 200 ? -9.875  69.689 40.639 1.00 9.30  ? 200 VAL A CA  1 
ATOM   1463 C C   . VAL A 1 200 ? -10.634 70.148 41.868 1.00 9.30  ? 200 VAL A C   1 
ATOM   1464 O O   . VAL A 1 200 ? -10.151 70.985 42.657 1.00 9.30  ? 200 VAL A O   1 
ATOM   1465 C CB  . VAL A 1 200 ? -8.936  68.527 41.004 1.00 9.30  ? 200 VAL A CB  1 
ATOM   1466 C CG1 . VAL A 1 200 ? -8.460  67.776 39.735 1.00 2.37  ? 200 VAL A CG1 1 
ATOM   1467 C CG2 . VAL A 1 200 ? -7.777  68.925 41.985 1.00 2.37  ? 200 VAL A CG2 1 
ATOM   1468 N N   . CYS A 1 201 ? -11.747 69.591 42.060 1.00 8.75  ? 201 CYS A N   1 
ATOM   1469 C CA  . CYS A 1 201 ? -12.566 69.905 43.235 1.00 8.75  ? 201 CYS A CA  1 
ATOM   1470 C C   . CYS A 1 201 ? -12.943 68.604 43.916 1.00 8.75  ? 201 CYS A C   1 
ATOM   1471 O O   . CYS A 1 201 ? -13.108 67.584 43.194 1.00 8.75  ? 201 CYS A O   1 
ATOM   1472 C CB  . CYS A 1 201 ? -13.875 70.584 42.785 1.00 8.75  ? 201 CYS A CB  1 
ATOM   1473 S SG  . CYS A 1 201 ? -13.732 72.058 41.737 1.00 14.06 ? 201 CYS A SG  1 
ATOM   1474 N N   . LYS A 1 202 ? -13.143 68.620 45.217 1.00 22.32 ? 202 LYS A N   1 
ATOM   1475 C CA  . LYS A 1 202 ? -13.601 67.364 45.795 1.00 22.32 ? 202 LYS A CA  1 
ATOM   1476 C C   . LYS A 1 202 ? -15.066 67.075 45.972 1.00 22.32 ? 202 LYS A C   1 
ATOM   1477 O O   . LYS A 1 202 ? -15.804 67.890 46.549 1.00 22.32 ? 202 LYS A O   1 
ATOM   1478 C CB  . LYS A 1 202 ? -12.646 66.633 46.704 1.00 22.32 ? 202 LYS A CB  1 
ATOM   1479 C CG  . LYS A 1 202 ? -12.450 67.191 48.080 1.00 28.95 ? 202 LYS A CG  1 
ATOM   1480 C CD  . LYS A 1 202 ? -11.252 66.406 48.610 1.00 28.95 ? 202 LYS A CD  1 
ATOM   1481 C CE  . LYS A 1 202 ? -11.056 66.540 50.108 1.00 28.95 ? 202 LYS A CE  1 
ATOM   1482 N NZ  . LYS A 1 202 ? -9.979  65.615 50.488 1.00 28.95 ? 202 LYS A NZ  1 
ATOM   1483 N N   . LYS A 1 203 ? -15.536 66.073 45.308 1.00 15.27 ? 203 LYS A N   1 
ATOM   1484 C CA  . LYS A 1 203 ? -16.920 65.573 45.286 1.00 15.27 ? 203 LYS A CA  1 
ATOM   1485 C C   . LYS A 1 203 ? -17.003 64.225 46.051 1.00 15.27 ? 203 LYS A C   1 
ATOM   1486 O O   . LYS A 1 203 ? -16.518 63.181 45.572 1.00 15.27 ? 203 LYS A O   1 
ATOM   1487 C CB  . LYS A 1 203 ? -17.326 65.396 43.802 1.00 15.27 ? 203 LYS A CB  1 
ATOM   1488 C CG  . LYS A 1 203 ? -18.691 64.709 43.469 1.00 44.17 ? 203 LYS A CG  1 
ATOM   1489 C CD  . LYS A 1 203 ? -19.937 65.444 44.024 1.00 44.17 ? 203 LYS A CD  1 
ATOM   1490 C CE  . LYS A 1 203 ? -20.118 66.918 43.528 1.00 44.17 ? 203 LYS A CE  1 
ATOM   1491 N NZ  . LYS A 1 203 ? -20.655 67.020 42.157 1.00 44.17 ? 203 LYS A NZ  1 
ATOM   1492 N N   . ASN A 1 204 ? -17.743 64.185 47.147 1.00 32.17 ? 204 ASN A N   1 
ATOM   1493 C CA  . ASN A 1 204 ? -17.942 62.968 47.922 1.00 32.17 ? 204 ASN A CA  1 
ATOM   1494 C C   . ASN A 1 204 ? -16.611 62.372 48.390 1.00 32.17 ? 204 ASN A C   1 
ATOM   1495 O O   . ASN A 1 204 ? -16.374 61.149 48.244 1.00 32.17 ? 204 ASN A O   1 
ATOM   1496 C CB  . ASN A 1 204 ? -18.868 61.970 47.178 1.00 32.17 ? 204 ASN A CB  1 
ATOM   1497 C CG  . ASN A 1 204 ? -20.253 62.612 46.952 1.00 48.92 ? 204 ASN A CG  1 
ATOM   1498 O OD1 . ASN A 1 204 ? -20.553 63.724 47.469 1.00 48.92 ? 204 ASN A OD1 1 
ATOM   1499 N ND2 . ASN A 1 204 ? -20.980 62.060 46.001 1.00 48.92 ? 204 ASN A ND2 1 
ATOM   1500 N N   . GLY A 1 205 ? -15.728 63.277 48.819 1.00 26.22 ? 205 GLY A N   1 
ATOM   1501 C CA  . GLY A 1 205 ? -14.326 63.003 49.230 1.00 26.22 ? 205 GLY A CA  1 
ATOM   1502 C C   . GLY A 1 205 ? -13.376 62.542 48.107 1.00 26.22 ? 205 GLY A C   1 
ATOM   1503 O O   . GLY A 1 205 ? -12.188 62.233 48.354 1.00 26.22 ? 205 GLY A O   1 
ATOM   1504 N N   . ALA A 1 206 ? -13.823 62.550 46.882 1.00 13.24 ? 206 ALA A N   1 
ATOM   1505 C CA  . ALA A 1 206 ? -12.859 62.265 45.839 1.00 13.24 ? 206 ALA A CA  1 
ATOM   1506 C C   . ALA A 1 206 ? -12.565 63.478 44.977 1.00 13.24 ? 206 ALA A C   1 
ATOM   1507 O O   . ALA A 1 206 ? -13.519 64.211 44.642 1.00 13.24 ? 206 ALA A O   1 
ATOM   1508 C CB  . ALA A 1 206 ? -13.443 61.196 44.922 1.00 13.24 ? 206 ALA A CB  1 
ATOM   1509 N N   . TRP A 1 207 ? -11.304 63.639 44.618 1.00 13.84 ? 207 TRP A N   1 
ATOM   1510 C CA  . TRP A 1 207 ? -10.811 64.681 43.710 1.00 13.84 ? 207 TRP A CA  1 
ATOM   1511 C C   . TRP A 1 207 ? -11.287 64.480 42.272 1.00 13.84 ? 207 TRP A C   1 
ATOM   1512 O O   . TRP A 1 207 ? -11.117 63.366 41.697 1.00 13.84 ? 207 TRP A O   1 
ATOM   1513 C CB  . TRP A 1 207 ? -9.255  64.774 43.785 1.00 13.84 ? 207 TRP A CB  1 
ATOM   1514 C CG  . TRP A 1 207 ? -8.771  65.326 45.148 1.00 9.76  ? 207 TRP A CG  1 
ATOM   1515 C CD1 . TRP A 1 207 ? -8.199  64.648 46.171 1.00 9.76  ? 207 TRP A CD1 1 
ATOM   1516 C CD2 . TRP A 1 207 ? -8.833  66.671 45.587 1.00 9.76  ? 207 TRP A CD2 1 
ATOM   1517 N NE1 . TRP A 1 207 ? -7.872  65.536 47.197 1.00 9.76  ? 207 TRP A NE1 1 
ATOM   1518 C CE2 . TRP A 1 207 ? -8.252  66.723 46.865 1.00 9.76  ? 207 TRP A CE2 1 
ATOM   1519 C CE3 . TRP A 1 207 ? -9.312  67.827 44.964 1.00 9.76  ? 207 TRP A CE3 1 
ATOM   1520 C CZ2 . TRP A 1 207 ? -8.103  67.931 47.587 1.00 9.76  ? 207 TRP A CZ2 1 
ATOM   1521 C CZ3 . TRP A 1 207 ? -9.188  69.049 45.704 1.00 9.76  ? 207 TRP A CZ3 1 
ATOM   1522 C CH2 . TRP A 1 207 ? -8.581  69.095 46.973 1.00 9.76  ? 207 TRP A CH2 1 
ATOM   1523 N N   . THR A 1 208 ? -12.015 65.418 41.772 1.00 8.96  ? 208 THR A N   1 
ATOM   1524 C CA  . THR A 1 208 ? -12.757 65.309 40.508 1.00 8.96  ? 208 THR A CA  1 
ATOM   1525 C C   . THR A 1 208 ? -12.353 66.447 39.566 1.00 8.96  ? 208 THR A C   1 
ATOM   1526 O O   . THR A 1 208 ? -12.105 67.580 40.006 1.00 8.96  ? 208 THR A O   1 
ATOM   1527 C CB  . THR A 1 208 ? -14.260 65.393 40.779 1.00 8.96  ? 208 THR A CB  1 
ATOM   1528 O OG1 . THR A 1 208 ? -14.645 64.395 41.713 1.00 14.35 ? 208 THR A OG1 1 
ATOM   1529 C CG2 . THR A 1 208 ? -15.107 65.195 39.523 1.00 14.35 ? 208 THR A CG2 1 
ATOM   1530 N N   . LEU A 1 209 ? -12.043 66.138 38.288 1.00 8.55  ? 209 LEU A N   1 
ATOM   1531 C CA  . LEU A 1 209 ? -11.612 67.082 37.287 1.00 8.55  ? 209 LEU A CA  1 
ATOM   1532 C C   . LEU A 1 209 ? -12.804 67.931 36.837 1.00 8.55  ? 209 LEU A C   1 
ATOM   1533 O O   . LEU A 1 209 ? -13.713 67.433 36.130 1.00 8.55  ? 209 LEU A O   1 
ATOM   1534 C CB  . LEU A 1 209 ? -11.075 66.357 36.034 1.00 8.55  ? 209 LEU A CB  1 
ATOM   1535 C CG  . LEU A 1 209 ? -10.374 67.274 34.985 1.00 4.30  ? 209 LEU A CG  1 
ATOM   1536 C CD1 . LEU A 1 209 ? -9.109  67.956 35.543 1.00 4.30  ? 209 LEU A CD1 1 
ATOM   1537 C CD2 . LEU A 1 209 ? -10.057 66.481 33.728 1.00 4.30  ? 209 LEU A CD2 1 
ATOM   1538 N N   . VAL A 1 210 ? -12.818 69.156 37.305 1.00 7.17  ? 210 VAL A N   1 
ATOM   1539 C CA  . VAL A 1 210 ? -13.839 70.134 36.905 1.00 7.17  ? 210 VAL A CA  1 
ATOM   1540 C C   . VAL A 1 210 ? -13.423 71.049 35.740 1.00 7.17  ? 210 VAL A C   1 
ATOM   1541 O O   . VAL A 1 210 ? -14.285 71.441 34.913 1.00 7.17  ? 210 VAL A O   1 
ATOM   1542 C CB  . VAL A 1 210 ? -14.177 70.898 38.183 1.00 7.17  ? 210 VAL A CB  1 
ATOM   1543 C CG1 . VAL A 1 210 ? -15.033 72.157 37.882 1.00 7.58  ? 210 VAL A CG1 1 
ATOM   1544 C CG2 . VAL A 1 210 ? -14.834 69.933 39.179 1.00 7.58  ? 210 VAL A CG2 1 
ATOM   1545 N N   . GLY A 1 211 ? -12.130 71.452 35.668 1.00 5.76  ? 211 GLY A N   1 
ATOM   1546 C CA  . GLY A 1 211 ? -11.565 72.330 34.609 1.00 5.76  ? 211 GLY A CA  1 
ATOM   1547 C C   . GLY A 1 211 ? -10.309 71.774 33.931 1.00 5.76  ? 211 GLY A C   1 
ATOM   1548 O O   . GLY A 1 211 ? -9.595  70.973 34.572 1.00 5.76  ? 211 GLY A O   1 
ATOM   1549 N N   . ILE A 1 212 ? -10.027 72.225 32.725 1.00 10.43 ? 212 ILE A N   1 
ATOM   1550 C CA  . ILE A 1 212 ? -8.749  72.060 32.021 1.00 10.43 ? 212 ILE A CA  1 
ATOM   1551 C C   . ILE A 1 212 ? -8.198  73.451 31.641 1.00 10.43 ? 212 ILE A C   1 
ATOM   1552 O O   . ILE A 1 212 ? -9.022  74.289 31.169 1.00 10.43 ? 212 ILE A O   1 
ATOM   1553 C CB  . ILE A 1 212 ? -8.974  71.292 30.707 1.00 10.43 ? 212 ILE A CB  1 
ATOM   1554 C CG1 . ILE A 1 212 ? -9.547  69.858 30.945 1.00 10.72 ? 212 ILE A CG1 1 
ATOM   1555 C CG2 . ILE A 1 212 ? -7.691  71.298 29.837 1.00 10.72 ? 212 ILE A CG2 1 
ATOM   1556 C CD1 . ILE A 1 212 ? -10.043 69.194 29.643 1.00 10.72 ? 212 ILE A CD1 1 
ATOM   1557 N N   . VAL A 1 213 ? -6.998  73.815 32.131 1.00 11.16 ? 213 VAL A N   1 
ATOM   1558 C CA  . VAL A 1 213 ? -6.387  75.131 31.876 1.00 11.16 ? 213 VAL A CA  1 
ATOM   1559 C C   . VAL A 1 213 ? -6.451  75.492 30.402 1.00 11.16 ? 213 VAL A C   1 
ATOM   1560 O O   . VAL A 1 213 ? -5.811  74.820 29.543 1.00 11.16 ? 213 VAL A O   1 
ATOM   1561 C CB  . VAL A 1 213 ? -4.935  75.182 32.332 1.00 11.16 ? 213 VAL A CB  1 
ATOM   1562 C CG1 . VAL A 1 213 ? -4.125  76.407 31.827 1.00 3.70  ? 213 VAL A CG1 1 
ATOM   1563 C CG2 . VAL A 1 213 ? -4.904  75.007 33.828 1.00 3.70  ? 213 VAL A CG2 1 
ATOM   1564 N N   . SER A 1 214 ? -7.280  76.495 30.115 1.00 17.39 ? 214 SER A N   1 
ATOM   1565 C CA  . SER A 1 214 ? -7.424  76.931 28.708 1.00 17.39 ? 214 SER A CA  1 
ATOM   1566 C C   . SER A 1 214 ? -6.746  78.284 28.402 1.00 17.39 ? 214 SER A C   1 
ATOM   1567 O O   . SER A 1 214 ? -5.848  78.386 27.533 1.00 17.39 ? 214 SER A O   1 
ATOM   1568 C CB  . SER A 1 214 ? -8.940  76.962 28.429 1.00 17.39 ? 214 SER A CB  1 
ATOM   1569 O OG  . SER A 1 214 ? -9.192  77.112 27.061 1.00 8.80  ? 214 SER A OG  1 
ATOM   1570 N N   . TRP A 1 215 ? -7.035  79.315 29.149 1.00 17.37 ? 215 TRP A N   1 
ATOM   1571 C CA  . TRP A 1 215 ? -6.431  80.602 28.808 1.00 17.37 ? 215 TRP A CA  1 
ATOM   1572 C C   . TRP A 1 215 ? -6.609  81.602 29.938 1.00 17.37 ? 215 TRP A C   1 
ATOM   1573 O O   . TRP A 1 215 ? -7.264  81.258 30.936 1.00 17.37 ? 215 TRP A O   1 
ATOM   1574 C CB  . TRP A 1 215 ? -6.963  81.238 27.474 1.00 17.37 ? 215 TRP A CB  1 
ATOM   1575 C CG  . TRP A 1 215 ? -8.505  81.345 27.358 1.00 17.05 ? 215 TRP A CG  1 
ATOM   1576 C CD1 . TRP A 1 215 ? -9.388  80.414 26.958 1.00 17.05 ? 215 TRP A CD1 1 
ATOM   1577 C CD2 . TRP A 1 215 ? -9.257  82.521 27.522 1.00 17.05 ? 215 TRP A CD2 1 
ATOM   1578 N NE1 . TRP A 1 215 ? -10.696 80.984 26.935 1.00 17.05 ? 215 TRP A NE1 1 
ATOM   1579 C CE2 . TRP A 1 215 ? -10.619 82.195 27.289 1.00 17.05 ? 215 TRP A CE2 1 
ATOM   1580 C CE3 . TRP A 1 215 ? -8.869  83.807 27.888 1.00 17.05 ? 215 TRP A CE3 1 
ATOM   1581 C CZ2 . TRP A 1 215 ? -11.637 83.116 27.467 1.00 17.05 ? 215 TRP A CZ2 1 
ATOM   1582 C CZ3 . TRP A 1 215 ? -9.899  84.749 28.036 1.00 17.05 ? 215 TRP A CZ3 1 
ATOM   1583 C CH2 . TRP A 1 215 ? -11.248 84.401 27.839 1.00 17.05 ? 215 TRP A CH2 1 
ATOM   1584 N N   . GLY A 1 216 ? -6.076  82.790 29.733 1.00 26.19 ? 216 GLY A N   1 
ATOM   1585 C CA  . GLY A 1 216 ? -6.218  83.942 30.642 1.00 26.19 ? 216 GLY A CA  1 
ATOM   1586 C C   . GLY A 1 216 ? -5.038  84.901 30.505 1.00 26.19 ? 216 GLY A C   1 
ATOM   1587 O O   . GLY A 1 216 ? -4.477  85.090 29.404 1.00 26.19 ? 216 GLY A O   1 
ATOM   1588 N N   . SER A 1 217 ? -4.682  85.466 31.621 1.00 15.75 ? 217 SER A N   1 
ATOM   1589 C CA  . SER A 1 217 ? -3.629  86.447 31.738 1.00 15.75 ? 217 SER A CA  1 
ATOM   1590 C C   . SER A 1 217 ? -2.290  85.961 31.198 1.00 15.75 ? 217 SER A C   1 
ATOM   1591 O O   . SER A 1 217 ? -1.819  84.873 31.605 1.00 15.75 ? 217 SER A O   1 
ATOM   1592 C CB  . SER A 1 217 ? -3.495  86.799 33.234 1.00 15.75 ? 217 SER A CB  1 
ATOM   1593 O OG  . SER A 1 217 ? -3.704  88.195 33.291 1.00 22.47 ? 217 SER A OG  1 
ATOM   1594 N N   . SER A 1 218 ? -1.602  86.793 30.480 1.00 23.11 ? 218 SER A N   1 
ATOM   1595 C CA  . SER A 1 218 ? -0.185  86.460 30.105 1.00 23.11 ? 218 SER A CA  1 
ATOM   1596 C C   . SER A 1 218 ? 0.814   86.602 31.251 1.00 23.11 ? 218 SER A C   1 
ATOM   1597 O O   . SER A 1 218 ? 1.877   85.942 31.238 1.00 23.11 ? 218 SER A O   1 
ATOM   1598 C CB  . SER A 1 218 ? 0.315   87.200 28.857 1.00 23.11 ? 218 SER A CB  1 
ATOM   1599 O OG  . SER A 1 218 ? -0.596  87.003 27.776 1.00 43.74 ? 218 SER A OG  1 
ATOM   1600 N N   . THR A 1 219 ? 0.488   87.325 32.313 1.00 23.40 ? 219 THR A N   1 
ATOM   1601 C CA  . THR A 1 219 ? 1.348   87.345 33.512 1.00 23.40 ? 219 THR A CA  1 
ATOM   1602 C C   . THR A 1 219 ? 0.579   86.873 34.745 1.00 23.40 ? 219 THR A C   1 
ATOM   1603 O O   . THR A 1 219 ? -0.667  86.866 34.716 1.00 23.40 ? 219 THR A O   1 
ATOM   1604 C CB  . THR A 1 219 ? 1.767   88.795 33.794 1.00 23.40 ? 219 THR A CB  1 
ATOM   1605 O OG1 . THR A 1 219 ? 0.551   89.568 33.855 1.00 28.47 ? 219 THR A OG1 1 
ATOM   1606 C CG2 . THR A 1 219 ? 2.678   89.320 32.698 1.00 28.47 ? 219 THR A CG2 1 
ATOM   1607 N N   . CYS A 1 220 ? 1.248   86.484 35.788 1.00 19.93 ? 220 CYS A N   1 
ATOM   1608 C CA  . CYS A 1 220 ? 0.504   85.993 36.943 1.00 19.93 ? 220 CYS A CA  1 
ATOM   1609 C C   . CYS A 1 220 ? -0.277  87.127 37.598 1.00 19.93 ? 220 CYS A C   1 
ATOM   1610 O O   . CYS A 1 220 ? 0.314   88.194 37.909 1.00 19.93 ? 220 CYS A O   1 
ATOM   1611 C CB  . CYS A 1 220 ? 1.573   85.514 37.946 1.00 19.93 ? 220 CYS A CB  1 
ATOM   1612 S SG  . CYS A 1 220 ? 2.553   84.091 37.411 1.00 24.55 ? 220 CYS A SG  1 
ATOM   1613 N N   . SER A 1 221 ? -1.574  87.016 37.648 1.00 16.26 ? 221 SER A N   1 
ATOM   1614 C CA  . SER A 1 221 ? -2.476  88.027 38.112 1.00 16.26 ? 221 SER A CA  1 
ATOM   1615 C C   . SER A 1 221 ? -3.375  87.475 39.182 1.00 16.26 ? 221 SER A C   1 
ATOM   1616 O O   . SER A 1 221 ? -4.083  86.478 38.867 1.00 16.26 ? 221 SER A O   1 
ATOM   1617 C CB  . SER A 1 221 ? -3.437  88.450 36.986 1.00 16.26 ? 221 SER A CB  1 
ATOM   1618 O OG  . SER A 1 221 ? -4.391  89.355 37.567 1.00 20.74 ? 221 SER A OG  1 
ATOM   1619 N N   . THR A 1 222 ? -3.345  88.154 40.331 1.00 16.71 ? 222 THR A N   1 
ATOM   1620 C CA  . THR A 1 222 ? -4.112  87.799 41.536 1.00 16.71 ? 222 THR A CA  1 
ATOM   1621 C C   . THR A 1 222 ? -5.544  88.307 41.478 1.00 16.71 ? 222 THR A C   1 
ATOM   1622 O O   . THR A 1 222 ? -6.338  87.983 42.390 1.00 16.71 ? 222 THR A O   1 
ATOM   1623 C CB  . THR A 1 222 ? -3.474  88.296 42.856 1.00 16.71 ? 222 THR A CB  1 
ATOM   1624 O OG1 . THR A 1 222 ? -3.650  89.712 42.989 1.00 41.01 ? 222 THR A OG1 1 
ATOM   1625 C CG2 . THR A 1 222 ? -1.972  87.950 42.910 1.00 41.01 ? 222 THR A CG2 1 
ATOM   1626 N N   . SER A 1 223 ? -5.814  89.166 40.531 1.00 16.51 ? 223 SER A N   1 
ATOM   1627 C CA  . SER A 1 223 ? -7.120  89.801 40.568 1.00 16.51 ? 223 SER A CA  1 
ATOM   1628 C C   . SER A 1 223 ? -7.907  89.543 39.286 1.00 16.51 ? 223 SER A C   1 
ATOM   1629 O O   . SER A 1 223 ? -9.057  90.060 39.216 1.00 16.51 ? 223 SER A O   1 
ATOM   1630 C CB  . SER A 1 223 ? -6.838  91.299 40.570 1.00 16.51 ? 223 SER A CB  1 
ATOM   1631 O OG  . SER A 1 223 ? -6.123  91.503 39.368 1.00 19.63 ? 223 SER A OG  1 
ATOM   1632 N N   . THR A 1 224 ? -7.352  88.770 38.368 1.00 15.30 ? 224 THR A N   1 
ATOM   1633 C CA  . THR A 1 224 ? -8.063  88.257 37.174 1.00 15.30 ? 224 THR A CA  1 
ATOM   1634 C C   . THR A 1 224 ? -8.252  86.717 37.219 1.00 15.30 ? 224 THR A C   1 
ATOM   1635 O O   . THR A 1 224 ? -7.328  85.973 37.667 1.00 15.30 ? 224 THR A O   1 
ATOM   1636 C CB  . THR A 1 224 ? -7.248  88.640 35.912 1.00 15.30 ? 224 THR A CB  1 
ATOM   1637 O OG1 . THR A 1 224 ? -6.599  89.852 36.101 1.00 26.59 ? 224 THR A OG1 1 
ATOM   1638 C CG2 . THR A 1 224 ? -8.071  88.777 34.640 1.00 26.59 ? 224 THR A CG2 1 
ATOM   1639 N N   . PRO A 1 225 ? -9.457  86.203 36.888 1.00 8.00  ? 225 PRO A N   1 
ATOM   1640 C CA  . PRO A 1 225 ? -9.712  84.768 36.925 1.00 8.00  ? 225 PRO A CA  1 
ATOM   1641 C C   . PRO A 1 225 ? -8.972  84.035 35.823 1.00 8.00  ? 225 PRO A C   1 
ATOM   1642 O O   . PRO A 1 225 ? -8.823  84.528 34.674 1.00 8.00  ? 225 PRO A O   1 
ATOM   1643 C CB  . PRO A 1 225 ? -11.231 84.497 36.765 1.00 8.00  ? 225 PRO A CB  1 
ATOM   1644 C CG  . PRO A 1 225 ? -11.836 85.867 36.369 1.00 5.88  ? 225 PRO A CG  1 
ATOM   1645 C CD  . PRO A 1 225 ? -10.718 86.941 36.574 1.00 5.88  ? 225 PRO A CD  1 
ATOM   1646 N N   . GLY A 1 226 ? -8.766  82.749 36.021 1.00 9.71  ? 226 GLY A N   1 
ATOM   1647 C CA  . GLY A 1 226 ? -8.214  82.029 34.866 1.00 9.71  ? 226 GLY A CA  1 
ATOM   1648 C C   . GLY A 1 226 ? -9.417  81.396 34.191 1.00 9.71  ? 226 GLY A C   1 
ATOM   1649 O O   . GLY A 1 226 ? -10.474 81.335 34.862 1.00 9.71  ? 226 GLY A O   1 
ATOM   1650 N N   . VAL A 1 227 ? -9.265  81.009 32.954 1.00 15.48 ? 227 VAL A N   1 
ATOM   1651 C CA  . VAL A 1 227 ? -10.331 80.416 32.148 1.00 15.48 ? 227 VAL A CA  1 
ATOM   1652 C C   . VAL A 1 227 ? -10.015 78.968 31.738 1.00 15.48 ? 227 VAL A C   1 
ATOM   1653 O O   . VAL A 1 227 ? -8.878  78.595 31.342 1.00 15.48 ? 227 VAL A O   1 
ATOM   1654 C CB  . VAL A 1 227 ? -10.664 81.296 30.914 1.00 15.48 ? 227 VAL A CB  1 
ATOM   1655 C CG1 . VAL A 1 227 ? -11.910 80.736 30.186 1.00 6.42  ? 227 VAL A CG1 1 
ATOM   1656 C CG2 . VAL A 1 227 ? -10.846 82.783 31.321 1.00 6.42  ? 227 VAL A CG2 1 
ATOM   1657 N N   . TYR A 1 228 ? -10.961 78.106 32.073 1.00 11.89 ? 228 TYR A N   1 
ATOM   1658 C CA  . TYR A 1 228 ? -10.810 76.663 31.884 1.00 11.89 ? 228 TYR A CA  1 
ATOM   1659 C C   . TYR A 1 228 ? -11.916 76.142 30.972 1.00 11.89 ? 228 TYR A C   1 
ATOM   1660 O O   . TYR A 1 228 ? -13.081 76.663 31.004 1.00 11.89 ? 228 TYR A O   1 
ATOM   1661 C CB  . TYR A 1 228 ? -10.885 75.979 33.256 1.00 11.89 ? 228 TYR A CB  1 
ATOM   1662 C CG  . TYR A 1 228 ? -9.886  76.546 34.301 1.00 7.35  ? 228 TYR A CG  1 
ATOM   1663 C CD1 . TYR A 1 228 ? -10.184 77.677 35.016 1.00 7.35  ? 228 TYR A CD1 1 
ATOM   1664 C CD2 . TYR A 1 228 ? -8.717  75.867 34.553 1.00 7.35  ? 228 TYR A CD2 1 
ATOM   1665 C CE1 . TYR A 1 228 ? -9.288  78.163 35.933 1.00 7.35  ? 228 TYR A CE1 1 
ATOM   1666 C CE2 . TYR A 1 228 ? -7.804  76.342 35.506 1.00 7.35  ? 228 TYR A CE2 1 
ATOM   1667 C CZ  . TYR A 1 228 ? -8.097  77.529 36.158 1.00 7.35  ? 228 TYR A CZ  1 
ATOM   1668 O OH  . TYR A 1 228 ? -7.221  78.027 37.111 1.00 7.35  ? 228 TYR A OH  1 
ATOM   1669 N N   . ALA A 1 229 ? -11.585 75.014 30.379 1.00 12.13 ? 229 ALA A N   1 
ATOM   1670 C CA  . ALA A 1 229 ? -12.566 74.118 29.776 1.00 12.13 ? 229 ALA A CA  1 
ATOM   1671 C C   . ALA A 1 229 ? -13.410 73.339 30.815 1.00 12.13 ? 229 ALA A C   1 
ATOM   1672 O O   . ALA A 1 229 ? -12.844 72.756 31.774 1.00 12.13 ? 229 ALA A O   1 
ATOM   1673 C CB  . ALA A 1 229 ? -11.871 73.151 28.810 1.00 12.13 ? 229 ALA A CB  1 
ATOM   1674 N N   . ARG A 1 230 ? -14.750 73.440 30.626 1.00 12.88 ? 230 ARG A N   1 
ATOM   1675 C CA  . ARG A 1 230 ? -15.793 72.935 31.547 1.00 12.88 ? 230 ARG A CA  1 
ATOM   1676 C C   . ARG A 1 230 ? -16.082 71.441 31.336 1.00 12.88 ? 230 ARG A C   1 
ATOM   1677 O O   . ARG A 1 230 ? -16.654 71.088 30.282 1.00 12.88 ? 230 ARG A O   1 
ATOM   1678 C CB  . ARG A 1 230 ? -17.112 73.795 31.396 1.00 12.88 ? 230 ARG A CB  1 
ATOM   1679 C CG  . ARG A 1 230 ? -18.148 73.420 32.464 1.00 2.84  ? 230 ARG A CG  1 
ATOM   1680 C CD  . ARG A 1 230 ? -19.450 74.196 32.322 1.00 2.84  ? 230 ARG A CD  1 
ATOM   1681 N NE  . ARG A 1 230 ? -19.259 75.646 32.519 1.00 2.84  ? 230 ARG A NE  1 
ATOM   1682 C CZ  . ARG A 1 230 ? -19.593 76.161 33.667 1.00 2.84  ? 230 ARG A CZ  1 
ATOM   1683 N NH1 . ARG A 1 230 ? -19.441 77.428 33.858 1.00 2.84  ? 230 ARG A NH1 1 
ATOM   1684 N NH2 . ARG A 1 230 ? -19.921 75.461 34.691 1.00 2.84  ? 230 ARG A NH2 1 
ATOM   1685 N N   . VAL A 1 231 ? -15.408 70.603 32.112 1.00 11.50 ? 231 VAL A N   1 
ATOM   1686 C CA  . VAL A 1 231 ? -15.324 69.164 31.845 1.00 11.50 ? 231 VAL A CA  1 
ATOM   1687 C C   . VAL A 1 231 ? -16.691 68.473 31.774 1.00 11.50 ? 231 VAL A C   1 
ATOM   1688 O O   . VAL A 1 231 ? -16.920 67.668 30.834 1.00 11.50 ? 231 VAL A O   1 
ATOM   1689 C CB  . VAL A 1 231 ? -14.379 68.499 32.893 1.00 11.50 ? 231 VAL A CB  1 
ATOM   1690 C CG1 . VAL A 1 231 ? -14.416 66.953 32.726 1.00 9.44  ? 231 VAL A CG1 1 
ATOM   1691 C CG2 . VAL A 1 231 ? -12.929 68.971 32.661 1.00 9.44  ? 231 VAL A CG2 1 
ATOM   1692 N N   . THR A 1 232 ? -17.682 69.128 32.656 1.00 9.93  ? 232 THR A N   1 
ATOM   1693 C CA  . THR A 1 232 ? -19.032 68.546 32.684 1.00 9.93  ? 232 THR A CA  1 
ATOM   1694 C C   . THR A 1 232 ? -19.734 68.750 31.344 1.00 9.93  ? 232 THR A C   1 
ATOM   1695 O O   . THR A 1 232 ? -20.484 67.874 30.889 1.00 9.93  ? 232 THR A O   1 
ATOM   1696 C CB  . THR A 1 232 ? -19.894 69.210 33.766 1.00 9.93  ? 232 THR A CB  1 
ATOM   1697 O OG1 . THR A 1 232 ? -19.901 70.621 33.603 1.00 5.83  ? 232 THR A OG1 1 
ATOM   1698 C CG2 . THR A 1 232 ? -19.422 68.898 35.189 1.00 5.83  ? 232 THR A CG2 1 
ATOM   1699 N N   . ALA A 1 233 ? -19.412 69.747 30.545 1.00 8.46  ? 233 ALA A N   1 
ATOM   1700 C CA  . ALA A 1 233 ? -19.965 69.971 29.229 1.00 8.46  ? 233 ALA A CA  1 
ATOM   1701 C C   . ALA A 1 233 ? -19.347 69.073 28.181 1.00 8.46  ? 233 ALA A C   1 
ATOM   1702 O O   . ALA A 1 233 ? -19.842 68.986 27.027 1.00 8.46  ? 233 ALA A O   1 
ATOM   1703 C CB  . ALA A 1 233 ? -19.697 71.452 28.850 1.00 8.46  ? 233 ALA A CB  1 
ATOM   1704 N N   . LEU A 1 234 ? -18.236 68.439 28.537 1.00 16.55 ? 234 LEU A N   1 
ATOM   1705 C CA  . LEU A 1 234 ? -17.392 67.727 27.565 1.00 16.55 ? 234 LEU A CA  1 
ATOM   1706 C C   . LEU A 1 234 ? -17.374 66.209 27.772 1.00 16.55 ? 234 LEU A C   1 
ATOM   1707 O O   . LEU A 1 234 ? -16.914 65.417 26.903 1.00 16.55 ? 234 LEU A O   1 
ATOM   1708 C CB  . LEU A 1 234 ? -15.969 68.354 27.572 1.00 16.55 ? 234 LEU A CB  1 
ATOM   1709 C CG  . LEU A 1 234 ? -16.008 69.853 27.176 1.00 5.64  ? 234 LEU A CG  1 
ATOM   1710 C CD1 . LEU A 1 234 ? -14.675 70.611 27.450 1.00 5.64  ? 234 LEU A CD1 1 
ATOM   1711 C CD2 . LEU A 1 234 ? -16.489 70.027 25.720 1.00 5.64  ? 234 LEU A CD2 1 
ATOM   1712 N N   . VAL A 1 235 ? -17.856 65.880 28.946 1.00 15.28 ? 235 VAL A N   1 
ATOM   1713 C CA  . VAL A 1 235 ? -17.762 64.517 29.526 1.00 15.28 ? 235 VAL A CA  1 
ATOM   1714 C C   . VAL A 1 235 ? -18.515 63.451 28.762 1.00 15.28 ? 235 VAL A C   1 
ATOM   1715 O O   . VAL A 1 235 ? -18.000 62.322 28.721 1.00 15.28 ? 235 VAL A O   1 
ATOM   1716 C CB  . VAL A 1 235 ? -18.017 64.468 31.044 1.00 15.28 ? 235 VAL A CB  1 
ATOM   1717 C CG1 . VAL A 1 235 ? -19.504 64.173 31.374 1.00 8.45  ? 235 VAL A CG1 1 
ATOM   1718 C CG2 . VAL A 1 235 ? -17.002 63.551 31.784 1.00 8.45  ? 235 VAL A CG2 1 
ATOM   1719 N N   . ASN A 1 236 ? -19.556 63.821 27.988 1.00 17.57 ? 236 ASN A N   1 
ATOM   1720 C CA  . ASN A 1 236 ? -20.185 62.815 27.134 1.00 17.57 ? 236 ASN A CA  1 
ATOM   1721 C C   . ASN A 1 236 ? -19.348 62.280 25.979 1.00 17.57 ? 236 ASN A C   1 
ATOM   1722 O O   . ASN A 1 236 ? -19.362 61.055 25.721 1.00 17.57 ? 236 ASN A O   1 
ATOM   1723 C CB  . ASN A 1 236 ? -21.606 63.192 26.659 1.00 17.57 ? 236 ASN A CB  1 
ATOM   1724 C CG  . ASN A 1 236 ? -22.571 63.176 27.858 1.00 36.75 ? 236 ASN A CG  1 
ATOM   1725 O OD1 . ASN A 1 236 ? -23.422 64.088 27.997 1.00 36.75 ? 236 ASN A OD1 1 
ATOM   1726 N ND2 . ASN A 1 236 ? -22.699 62.034 28.469 1.00 36.75 ? 236 ASN A ND2 1 
ATOM   1727 N N   . TRP A 1 237 ? -18.676 63.190 25.316 1.00 8.76  ? 237 TRP A N   1 
ATOM   1728 C CA  . TRP A 1 237 ? -17.743 62.947 24.216 1.00 8.76  ? 237 TRP A CA  1 
ATOM   1729 C C   . TRP A 1 237 ? -16.575 62.059 24.677 1.00 8.76  ? 237 TRP A C   1 
ATOM   1730 O O   . TRP A 1 237 ? -16.230 61.117 23.950 1.00 8.76  ? 237 TRP A O   1 
ATOM   1731 C CB  . TRP A 1 237 ? -17.205 64.359 23.828 1.00 8.76  ? 237 TRP A CB  1 
ATOM   1732 C CG  . TRP A 1 237 ? -16.034 64.317 22.827 1.00 13.11 ? 237 TRP A CG  1 
ATOM   1733 C CD1 . TRP A 1 237 ? -16.119 64.055 21.511 1.00 13.11 ? 237 TRP A CD1 1 
ATOM   1734 C CD2 . TRP A 1 237 ? -14.653 64.402 23.107 1.00 13.11 ? 237 TRP A CD2 1 
ATOM   1735 N NE1 . TRP A 1 237 ? -14.805 63.949 20.949 1.00 13.11 ? 237 TRP A NE1 1 
ATOM   1736 C CE2 . TRP A 1 237 ? -13.955 64.135 21.892 1.00 13.11 ? 237 TRP A CE2 1 
ATOM   1737 C CE3 . TRP A 1 237 ? -13.953 64.632 24.286 1.00 13.11 ? 237 TRP A CE3 1 
ATOM   1738 C CZ2 . TRP A 1 237 ? -12.571 64.104 21.823 1.00 13.11 ? 237 TRP A CZ2 1 
ATOM   1739 C CZ3 . TRP A 1 237 ? -12.583 64.600 24.183 1.00 13.11 ? 237 TRP A CZ3 1 
ATOM   1740 C CH2 . TRP A 1 237 ? -11.907 64.353 22.999 1.00 13.11 ? 237 TRP A CH2 1 
ATOM   1741 N N   . VAL A 1 238 ? -16.012 62.328 25.857 1.00 7.15  ? 238 VAL A N   1 
ATOM   1742 C CA  . VAL A 1 238 ? -14.981 61.516 26.516 1.00 7.15  ? 238 VAL A CA  1 
ATOM   1743 C C   . VAL A 1 238 ? -15.410 60.062 26.613 1.00 7.15  ? 238 VAL A C   1 
ATOM   1744 O O   . VAL A 1 238 ? -14.638 59.206 26.172 1.00 7.15  ? 238 VAL A O   1 
ATOM   1745 C CB  . VAL A 1 238 ? -14.535 62.098 27.913 1.00 7.15  ? 238 VAL A CB  1 
ATOM   1746 C CG1 . VAL A 1 238 ? -13.549 61.177 28.589 1.00 8.06  ? 238 VAL A CG1 1 
ATOM   1747 C CG2 . VAL A 1 238 ? -13.938 63.536 27.925 1.00 8.06  ? 238 VAL A CG2 1 
ATOM   1748 N N   . GLN A 1 239 ? -16.560 59.789 27.283 1.00 17.99 ? 239 GLN A N   1 
ATOM   1749 C CA  . GLN A 1 239 ? -17.042 58.414 27.476 1.00 17.99 ? 239 GLN A CA  1 
ATOM   1750 C C   . GLN A 1 239 ? -17.211 57.745 26.134 1.00 17.99 ? 239 GLN A C   1 
ATOM   1751 O O   . GLN A 1 239 ? -16.886 56.540 25.990 1.00 17.99 ? 239 GLN A O   1 
ATOM   1752 C CB  . GLN A 1 239 ? -18.444 58.293 28.140 1.00 17.99 ? 239 GLN A CB  1 
ATOM   1753 C CG  . GLN A 1 239 ? -18.452 57.627 29.552 1.00 51.94 ? 239 GLN A CG  1 
ATOM   1754 C CD  . GLN A 1 239 ? -18.017 58.652 30.609 1.00 51.94 ? 239 GLN A CD  1 
ATOM   1755 O OE1 . GLN A 1 239 ? -18.882 59.343 31.218 1.00 51.94 ? 239 GLN A OE1 1 
ATOM   1756 N NE2 . GLN A 1 239 ? -16.733 58.686 30.888 1.00 51.94 ? 239 GLN A NE2 1 
ATOM   1757 N N   . GLN A 1 240 ? -17.695 58.533 25.216 1.00 15.99 ? 240 GLN A N   1 
ATOM   1758 C CA  . GLN A 1 240 ? -17.953 58.036 23.900 1.00 15.99 ? 240 GLN A CA  1 
ATOM   1759 C C   . GLN A 1 240 ? -16.698 57.633 23.157 1.00 15.99 ? 240 GLN A C   1 
ATOM   1760 O O   . GLN A 1 240 ? -16.707 56.505 22.608 1.00 15.99 ? 240 GLN A O   1 
ATOM   1761 C CB  . GLN A 1 240 ? -18.886 58.939 23.095 1.00 15.99 ? 240 GLN A CB  1 
ATOM   1762 C CG  . GLN A 1 240 ? -20.304 58.746 23.713 1.00 56.65 ? 240 GLN A CG  1 
ATOM   1763 C CD  . GLN A 1 240 ? -21.329 59.746 23.181 1.00 56.65 ? 240 GLN A CD  1 
ATOM   1764 O OE1 . GLN A 1 240 ? -20.907 60.840 22.735 1.00 56.65 ? 240 GLN A OE1 1 
ATOM   1765 N NE2 . GLN A 1 240 ? -22.504 59.687 23.790 1.00 56.65 ? 240 GLN A NE2 1 
ATOM   1766 N N   . THR A 1 241 ? -15.671 58.460 23.194 1.00 16.80 ? 241 THR A N   1 
ATOM   1767 C CA  . THR A 1 241 ? -14.350 58.179 22.581 1.00 16.80 ? 241 THR A CA  1 
ATOM   1768 C C   . THR A 1 241 ? -13.674 56.979 23.200 1.00 16.80 ? 241 THR A C   1 
ATOM   1769 O O   . THR A 1 241 ? -13.170 56.073 22.494 1.00 16.80 ? 241 THR A O   1 
ATOM   1770 C CB  . THR A 1 241 ? -13.433 59.402 22.772 1.00 16.80 ? 241 THR A CB  1 
ATOM   1771 O OG1 . THR A 1 241 ? -14.051 60.529 22.147 1.00 12.20 ? 241 THR A OG1 1 
ATOM   1772 C CG2 . THR A 1 241 ? -12.078 59.252 22.057 1.00 12.20 ? 241 THR A CG2 1 
ATOM   1773 N N   . LEU A 1 242 ? -13.657 56.962 24.490 1.00 13.81 ? 242 LEU A N   1 
ATOM   1774 C CA  . LEU A 1 242 ? -13.081 55.812 25.238 1.00 13.81 ? 242 LEU A CA  1 
ATOM   1775 C C   . LEU A 1 242 ? -13.785 54.499 24.908 1.00 13.81 ? 242 LEU A C   1 
ATOM   1776 O O   . LEU A 1 242 ? -13.118 53.453 24.732 1.00 13.81 ? 242 LEU A O   1 
ATOM   1777 C CB  . LEU A 1 242 ? -13.169 56.001 26.777 1.00 13.81 ? 242 LEU A CB  1 
ATOM   1778 C CG  . LEU A 1 242 ? -11.831 56.492 27.359 1.00 9.98  ? 242 LEU A CG  1 
ATOM   1779 C CD1 . LEU A 1 242 ? -11.337 57.762 26.676 1.00 9.98  ? 242 LEU A CD1 1 
ATOM   1780 C CD2 . LEU A 1 242 ? -11.738 56.590 28.904 1.00 9.98  ? 242 LEU A CD2 1 
ATOM   1781 N N   . ALA A 1 243 ? -15.101 54.524 24.924 1.00 22.29 ? 243 ALA A N   1 
ATOM   1782 C CA  . ALA A 1 243 ? -15.927 53.318 24.651 1.00 22.29 ? 243 ALA A CA  1 
ATOM   1783 C C   . ALA A 1 243 ? -15.563 52.686 23.325 1.00 22.29 ? 243 ALA A C   1 
ATOM   1784 O O   . ALA A 1 243 ? -15.858 51.498 23.111 1.00 22.29 ? 243 ALA A O   1 
ATOM   1785 C CB  . ALA A 1 243 ? -17.417 53.715 24.509 1.00 22.29 ? 243 ALA A CB  1 
ATOM   1786 N N   . ALA A 1 244 ? -15.152 53.484 22.390 1.00 16.87 ? 244 ALA A N   1 
ATOM   1787 C CA  . ALA A 1 244 ? -14.980 53.011 21.045 1.00 16.87 ? 244 ALA A CA  1 
ATOM   1788 C C   . ALA A 1 244 ? -13.541 52.719 20.624 1.00 16.87 ? 244 ALA A C   1 
ATOM   1789 O O   . ALA A 1 244 ? -13.316 52.247 19.492 1.00 16.87 ? 244 ALA A O   1 
ATOM   1790 C CB  . ALA A 1 244 ? -15.659 53.987 20.094 1.00 16.87 ? 244 ALA A CB  1 
ATOM   1791 N N   . ASN A 1 245 ? -12.573 53.231 21.378 1.00 15.61 ? 245 ASN A N   1 
ATOM   1792 C CA  . ASN A 1 245 ? -11.187 53.294 20.853 1.00 15.61 ? 245 ASN A CA  1 
ATOM   1793 C C   . ASN A 1 245 ? -10.301 52.516 21.780 1.00 15.61 ? 245 ASN A C   1 
ATOM   1794 O O   . ASN A 1 245 ? -9.073  52.724 21.760 1.00 15.61 ? 245 ASN A O   1 
ATOM   1795 C CB  . ASN A 1 245 ? -10.658 54.746 20.739 1.00 15.61 ? 245 ASN A CB  1 
ATOM   1796 C CG  . ASN A 1 245 ? -11.412 55.357 19.558 1.00 16.22 ? 245 ASN A CG  1 
ATOM   1797 O OD1 . ASN A 1 245 ? -11.184 54.909 18.406 1.00 16.22 ? 245 ASN A OD1 1 
ATOM   1798 N ND2 . ASN A 1 245 ? -12.616 55.845 19.860 1.00 16.22 ? 245 ASN A ND2 1 
ATOM   1799 O OXT . ASN A 1 245 ? -10.837 52.135 22.839 1.00 25.46 ? 245 ASN A OXT 1 
ATOM   1800 N N   . CYS B 1 1   ? -24.802 44.291 57.674 1.00 13.76 ? 1   CYS B N   1 
ATOM   1801 C CA  . CYS B 1 1   ? -24.150 43.916 56.396 1.00 13.76 ? 1   CYS B CA  1 
ATOM   1802 C C   . CYS B 1 1   ? -24.436 44.974 55.340 1.00 13.76 ? 1   CYS B C   1 
ATOM   1803 O O   . CYS B 1 1   ? -25.478 45.662 55.473 1.00 13.76 ? 1   CYS B O   1 
ATOM   1804 C CB  . CYS B 1 1   ? -24.698 42.547 55.884 1.00 13.76 ? 1   CYS B CB  1 
ATOM   1805 S SG  . CYS B 1 1   ? -26.488 42.423 55.673 1.00 15.06 ? 1   CYS B SG  1 
ATOM   1806 N N   . GLY B 1 2   ? -23.713 44.906 54.194 1.00 14.70 ? 2   GLY B N   1 
ATOM   1807 C CA  . GLY B 1 2   ? -24.038 45.617 52.944 1.00 14.70 ? 2   GLY B CA  1 
ATOM   1808 C C   . GLY B 1 2   ? -23.815 47.135 53.022 1.00 14.70 ? 2   GLY B C   1 
ATOM   1809 O O   . GLY B 1 2   ? -24.252 47.890 52.131 1.00 14.70 ? 2   GLY B O   1 
ATOM   1810 N N   . VAL B 1 3   ? -23.251 47.627 54.088 1.00 15.89 ? 3   VAL B N   1 
ATOM   1811 C CA  . VAL B 1 3   ? -23.085 49.071 54.249 1.00 15.89 ? 3   VAL B CA  1 
ATOM   1812 C C   . VAL B 1 3   ? -21.635 49.436 54.603 1.00 15.89 ? 3   VAL B C   1 
ATOM   1813 O O   . VAL B 1 3   ? -21.291 49.575 55.809 1.00 15.89 ? 3   VAL B O   1 
ATOM   1814 C CB  . VAL B 1 3   ? -24.065 49.589 55.348 1.00 15.89 ? 3   VAL B CB  1 
ATOM   1815 C CG1 . VAL B 1 3   ? -23.876 51.118 55.515 1.00 11.10 ? 3   VAL B CG1 1 
ATOM   1816 C CG2 . VAL B 1 3   ? -25.538 49.275 55.020 1.00 11.10 ? 3   VAL B CG2 1 
ATOM   1817 N N   . PRO B 1 4   ? -20.747 49.476 53.617 1.00 11.38 ? 4   PRO B N   1 
ATOM   1818 C CA  . PRO B 1 4   ? -19.326 49.678 53.882 1.00 11.38 ? 4   PRO B CA  1 
ATOM   1819 C C   . PRO B 1 4   ? -18.988 50.884 54.753 1.00 11.38 ? 4   PRO B C   1 
ATOM   1820 O O   . PRO B 1 4   ? -19.385 52.013 54.394 1.00 11.38 ? 4   PRO B O   1 
ATOM   1821 C CB  . PRO B 1 4   ? -18.645 49.829 52.528 1.00 11.38 ? 4   PRO B CB  1 
ATOM   1822 C CG  . PRO B 1 4   ? -19.669 49.445 51.471 1.00 9.35  ? 4   PRO B CG  1 
ATOM   1823 C CD  . PRO B 1 4   ? -21.011 49.249 52.209 1.00 9.35  ? 4   PRO B CD  1 
ATOM   1824 N N   . ALA B 1 5   ? -17.972 50.744 55.564 1.00 15.49 ? 5   ALA B N   1 
ATOM   1825 C CA  . ALA B 1 5   ? -17.367 51.921 56.187 1.00 15.49 ? 5   ALA B CA  1 
ATOM   1826 C C   . ALA B 1 5   ? -16.762 52.917 55.184 1.00 15.49 ? 5   ALA B C   1 
ATOM   1827 O O   . ALA B 1 5   ? -16.758 54.116 55.474 1.00 15.49 ? 5   ALA B O   1 
ATOM   1828 C CB  . ALA B 1 5   ? -16.356 51.521 57.292 1.00 15.49 ? 5   ALA B CB  1 
ATOM   1829 N N   . ILE B 1 6   ? -16.040 52.495 54.152 1.00 17.55 ? 6   ILE B N   1 
ATOM   1830 C CA  . ILE B 1 6   ? -15.501 53.408 53.163 1.00 17.55 ? 6   ILE B CA  1 
ATOM   1831 C C   . ILE B 1 6   ? -16.406 53.250 51.940 1.00 17.55 ? 6   ILE B C   1 
ATOM   1832 O O   . ILE B 1 6   ? -16.430 52.116 51.375 1.00 17.55 ? 6   ILE B O   1 
ATOM   1833 C CB  . ILE B 1 6   ? -14.066 53.053 52.636 1.00 17.55 ? 6   ILE B CB  1 
ATOM   1834 C CG1 . ILE B 1 6   ? -12.934 52.596 53.568 1.00 15.94 ? 6   ILE B CG1 1 
ATOM   1835 C CG2 . ILE B 1 6   ? -13.566 53.952 51.497 1.00 15.94 ? 6   ILE B CG2 1 
ATOM   1836 C CD1 . ILE B 1 6   ? -12.926 53.353 54.834 1.00 15.94 ? 6   ILE B CD1 1 
ATOM   1837 N N   . GLN B 1 7   ? -17.158 54.280 51.589 1.00 14.42 ? 7   GLN B N   1 
ATOM   1838 C CA  . GLN B 1 7   ? -18.069 54.193 50.465 1.00 14.42 ? 7   GLN B CA  1 
ATOM   1839 C C   . GLN B 1 7   ? -17.355 54.136 49.119 1.00 14.42 ? 7   GLN B C   1 
ATOM   1840 O O   . GLN B 1 7   ? -16.369 54.865 48.857 1.00 14.42 ? 7   GLN B O   1 
ATOM   1841 C CB  . GLN B 1 7   ? -18.962 55.426 50.473 1.00 14.42 ? 7   GLN B CB  1 
ATOM   1842 C CG  . GLN B 1 7   ? -19.916 55.412 51.691 1.00 37.73 ? 7   GLN B CG  1 
ATOM   1843 C CD  . GLN B 1 7   ? -21.055 54.462 51.342 1.00 37.73 ? 7   GLN B CD  1 
ATOM   1844 O OE1 . GLN B 1 7   ? -21.678 54.692 50.271 1.00 37.73 ? 7   GLN B OE1 1 
ATOM   1845 N NE2 . GLN B 1 7   ? -21.196 53.331 52.068 1.00 37.73 ? 7   GLN B NE2 1 
ATOM   1846 N N   . PRO B 1 8   ? -17.837 53.245 48.250 1.00 18.95 ? 8   PRO B N   1 
ATOM   1847 C CA  . PRO B 1 8   ? -17.331 53.122 46.878 1.00 18.95 ? 8   PRO B CA  1 
ATOM   1848 C C   . PRO B 1 8   ? -17.590 54.392 46.074 1.00 18.95 ? 8   PRO B C   1 
ATOM   1849 O O   . PRO B 1 8   ? -18.679 54.973 46.265 1.00 18.95 ? 8   PRO B O   1 
ATOM   1850 C CB  . PRO B 1 8   ? -18.045 51.933 46.195 1.00 18.95 ? 8   PRO B CB  1 
ATOM   1851 C CG  . PRO B 1 8   ? -18.987 51.365 47.227 1.00 15.09 ? 8   PRO B CG  1 
ATOM   1852 C CD  . PRO B 1 8   ? -18.884 52.245 48.501 1.00 15.09 ? 8   PRO B CD  1 
ATOM   1853 N N   . VAL B 1 9   ? -16.652 54.764 45.215 1.00 10.92 ? 9   VAL B N   1 
ATOM   1854 C CA  . VAL B 1 9   ? -16.827 55.803 44.250 1.00 10.92 ? 9   VAL B CA  1 
ATOM   1855 C C   . VAL B 1 9   ? -16.943 55.137 42.889 1.00 10.92 ? 9   VAL B C   1 
ATOM   1856 O O   . VAL B 1 9   ? -15.960 54.584 42.332 1.00 10.92 ? 9   VAL B O   1 
ATOM   1857 C CB  . VAL B 1 9   ? -15.679 56.876 44.236 1.00 10.92 ? 9   VAL B CB  1 
ATOM   1858 C CG1 . VAL B 1 9   ? -15.773 57.926 43.090 1.00 12.55 ? 9   VAL B CG1 1 
ATOM   1859 C CG2 . VAL B 1 9   ? -15.418 57.547 45.585 1.00 12.55 ? 9   VAL B CG2 1 
ATOM   1860 N N   . LEU B 1 10  ? -18.086 55.237 42.338 1.00 16.21 ? 10  LEU B N   1 
ATOM   1861 C CA  . LEU B 1 10  ? -18.286 54.778 40.984 1.00 16.21 ? 10  LEU B CA  1 
ATOM   1862 C C   . LEU B 1 10  ? -18.480 55.950 40.038 1.00 16.21 ? 10  LEU B C   1 
ATOM   1863 O O   . LEU B 1 10  ? -19.485 56.681 40.159 1.00 16.21 ? 10  LEU B O   1 
ATOM   1864 C CB  . LEU B 1 10  ? -19.562 53.911 40.881 1.00 16.21 ? 10  LEU B CB  1 
ATOM   1865 C CG  . LEU B 1 10  ? -19.405 52.591 41.635 1.00 15.57 ? 10  LEU B CG  1 
ATOM   1866 C CD1 . LEU B 1 10  ? -20.593 52.307 42.555 1.00 15.57 ? 10  LEU B CD1 1 
ATOM   1867 C CD2 . LEU B 1 10  ? -19.105 51.443 40.657 1.00 15.57 ? 10  LEU B CD2 1 
ATOM   1868 N N   . SER B 1 11  ? -17.663 55.992 39.023 1.00 17.81 ? 11  SER B N   1 
ATOM   1869 C CA  . SER B 1 11  ? -17.715 56.960 37.954 1.00 17.81 ? 11  SER B CA  1 
ATOM   1870 C C   . SER B 1 11  ? -18.203 56.290 36.682 1.00 17.81 ? 11  SER B C   1 
ATOM   1871 O O   . SER B 1 11  ? -18.428 55.045 36.638 1.00 17.81 ? 11  SER B O   1 
ATOM   1872 C CB  . SER B 1 11  ? -16.301 57.525 37.763 1.00 17.81 ? 11  SER B CB  1 
ATOM   1873 O OG  . SER B 1 11  ? -15.678 56.718 36.786 1.00 0.10  ? 11  SER B OG  1 
ATOM   1874 N N   . GLY B 1 12  ? -18.437 57.136 35.713 1.00 14.01 ? 12  GLY B N   1 
ATOM   1875 C CA  . GLY B 1 12  ? -18.843 56.758 34.361 1.00 14.01 ? 12  GLY B CA  1 
ATOM   1876 C C   . GLY B 1 12  ? -17.866 55.810 33.689 1.00 14.01 ? 12  GLY B C   1 
ATOM   1877 O O   . GLY B 1 12  ? -18.331 54.969 32.876 1.00 14.01 ? 12  GLY B O   1 
ATOM   1878 N N   . LEU B 1 13  ? -16.635 55.781 34.126 1.00 8.28  ? 13  LEU B N   1 
ATOM   1879 C CA  . LEU B 1 13  ? -15.679 54.782 33.592 1.00 8.28  ? 13  LEU B CA  1 
ATOM   1880 C C   . LEU B 1 13  ? -15.960 53.298 33.953 1.00 8.28  ? 13  LEU B C   1 
ATOM   1881 O O   . LEU B 1 13  ? -15.413 52.330 33.329 1.00 8.28  ? 13  LEU B O   1 
ATOM   1882 C CB  . LEU B 1 13  ? -14.195 55.141 33.914 1.00 8.28  ? 13  LEU B CB  1 
ATOM   1883 C CG  . LEU B 1 13  ? -13.637 56.454 33.327 1.00 29.04 ? 13  LEU B CG  1 
ATOM   1884 C CD1 . LEU B 1 13  ? -12.113 56.532 33.572 1.00 29.04 ? 13  LEU B CD1 1 
ATOM   1885 C CD2 . LEU B 1 13  ? -13.933 56.650 31.849 1.00 29.04 ? 13  LEU B CD2 1 
ATOM   1886 N N   . SER B 1 14  ? -16.733 53.130 35.013 1.00 11.41 ? 14  SER B N   1 
ATOM   1887 C CA  . SER B 1 14  ? -17.144 51.818 35.498 1.00 11.41 ? 14  SER B CA  1 
ATOM   1888 C C   . SER B 1 14  ? -18.157 51.112 34.552 1.00 11.41 ? 14  SER B C   1 
ATOM   1889 O O   . SER B 1 14  ? -18.257 49.848 34.580 1.00 11.41 ? 14  SER B O   1 
ATOM   1890 C CB  . SER B 1 14  ? -17.692 51.965 36.930 1.00 11.41 ? 14  SER B CB  1 
ATOM   1891 O OG  . SER B 1 14  ? -19.075 52.333 36.844 1.00 14.76 ? 14  SER B OG  1 
ATOM   1892 N N   . ARG B 1 15  ? -18.666 51.857 33.551 1.00 17.90 ? 15  ARG B N   1 
ATOM   1893 C CA  . ARG B 1 15  ? -19.680 51.317 32.602 1.00 17.90 ? 15  ARG B CA  1 
ATOM   1894 C C   . ARG B 1 15  ? -19.145 50.818 31.251 1.00 17.90 ? 15  ARG B C   1 
ATOM   1895 O O   . ARG B 1 15  ? -19.918 50.456 30.307 1.00 17.90 ? 15  ARG B O   1 
ATOM   1896 C CB  . ARG B 1 15  ? -20.796 52.363 32.346 1.00 17.90 ? 15  ARG B CB  1 
ATOM   1897 C CG  . ARG B 1 15  ? -21.737 52.619 33.546 1.00 26.62 ? 15  ARG B CG  1 
ATOM   1898 C CD  . ARG B 1 15  ? -22.830 53.677 33.217 1.00 26.62 ? 15  ARG B CD  1 
ATOM   1899 N NE  . ARG B 1 15  ? -24.151 53.306 33.846 1.00 26.62 ? 15  ARG B NE  1 
ATOM   1900 C CZ  . ARG B 1 15  ? -24.902 53.996 34.741 1.00 26.62 ? 15  ARG B CZ  1 
ATOM   1901 N NH1 . ARG B 1 15  ? -24.502 55.176 35.176 1.00 0.00  ? 15  ARG B NH1 1 
ATOM   1902 N NH2 . ARG B 1 15  ? -26.021 53.473 35.201 1.00 0.00  ? 15  ARG B NH2 1 
ATOM   1903 N N   . ILE B 1 16  ? -17.878 51.108 31.062 1.00 16.41 ? 16  ILE B N   1 
ATOM   1904 C CA  . ILE B 1 16  ? -17.291 50.932 29.734 1.00 16.41 ? 16  ILE B CA  1 
ATOM   1905 C C   . ILE B 1 16  ? -15.952 50.213 29.706 1.00 16.41 ? 16  ILE B C   1 
ATOM   1906 O O   . ILE B 1 16  ? -15.249 50.245 30.726 1.00 16.41 ? 16  ILE B O   1 
ATOM   1907 C CB  . ILE B 1 16  ? -17.169 52.276 29.003 1.00 16.41 ? 16  ILE B CB  1 
ATOM   1908 C CG1 . ILE B 1 16  ? -16.306 53.304 29.776 1.00 26.00 ? 16  ILE B CG1 1 
ATOM   1909 C CG2 . ILE B 1 16  ? -18.567 52.836 28.622 1.00 26.00 ? 16  ILE B CG2 1 
ATOM   1910 C CD1 . ILE B 1 16  ? -15.632 54.311 28.813 1.00 26.00 ? 16  ILE B CD1 1 
ATOM   1911 N N   . VAL B 1 17  ? -15.741 49.456 28.644 1.00 14.80 ? 17  VAL B N   1 
ATOM   1912 C CA  . VAL B 1 17  ? -14.643 48.516 28.409 1.00 14.80 ? 17  VAL B CA  1 
ATOM   1913 C C   . VAL B 1 17  ? -14.314 47.566 29.578 1.00 14.80 ? 17  VAL B C   1 
ATOM   1914 O O   . VAL B 1 17  ? -15.047 46.569 29.814 1.00 14.80 ? 17  VAL B O   1 
ATOM   1915 C CB  . VAL B 1 17  ? -13.436 49.287 27.814 1.00 14.80 ? 17  VAL B CB  1 
ATOM   1916 C CG1 . VAL B 1 17  ? -12.369 48.367 27.189 1.00 15.67 ? 17  VAL B CG1 1 
ATOM   1917 C CG2 . VAL B 1 17  ? -13.881 50.369 26.789 1.00 15.67 ? 17  VAL B CG2 1 
ATOM   1918 N N   . ASN B 1 18  ? -13.234 47.840 30.310 1.00 22.38 ? 18  ASN B N   1 
ATOM   1919 C CA  . ASN B 1 18  ? -12.758 46.997 31.409 1.00 22.38 ? 18  ASN B CA  1 
ATOM   1920 C C   . ASN B 1 18  ? -12.964 47.621 32.792 1.00 22.38 ? 18  ASN B C   1 
ATOM   1921 O O   . ASN B 1 18  ? -12.329 47.178 33.778 1.00 22.38 ? 18  ASN B O   1 
ATOM   1922 C CB  . ASN B 1 18  ? -11.291 46.562 31.172 1.00 22.38 ? 18  ASN B CB  1 
ATOM   1923 C CG  . ASN B 1 18  ? -11.147 45.672 29.917 1.00 15.05 ? 18  ASN B CG  1 
ATOM   1924 O OD1 . ASN B 1 18  ? -12.078 44.887 29.579 1.00 15.05 ? 18  ASN B OD1 1 
ATOM   1925 N ND2 . ASN B 1 18  ? -9.943  45.575 29.425 1.00 15.05 ? 18  ASN B ND2 1 
ATOM   1926 N N   . GLY B 1 19  ? -13.932 48.488 32.889 1.00 11.02 ? 19  GLY B N   1 
ATOM   1927 C CA  . GLY B 1 19  ? -14.334 49.070 34.135 1.00 11.02 ? 19  GLY B CA  1 
ATOM   1928 C C   . GLY B 1 19  ? -13.327 50.098 34.679 1.00 11.02 ? 19  GLY B C   1 
ATOM   1929 O O   . GLY B 1 19  ? -12.696 50.828 33.866 1.00 11.02 ? 19  GLY B O   1 
ATOM   1930 N N   . GLU B 1 20  ? -13.108 50.091 36.008 1.00 10.26 ? 20  GLU B N   1 
ATOM   1931 C CA  . GLU B 1 20  ? -12.157 51.013 36.593 1.00 10.26 ? 20  GLU B CA  1 
ATOM   1932 C C   . GLU B 1 20  ? -11.598 50.566 37.925 1.00 10.26 ? 20  GLU B C   1 
ATOM   1933 O O   . GLU B 1 20  ? -12.184 49.694 38.557 1.00 10.26 ? 20  GLU B O   1 
ATOM   1934 C CB  . GLU B 1 20  ? -12.752 52.412 36.774 1.00 10.26 ? 20  GLU B CB  1 
ATOM   1935 C CG  . GLU B 1 20  ? -14.045 52.375 37.629 1.00 20.43 ? 20  GLU B CG  1 
ATOM   1936 C CD  . GLU B 1 20  ? -14.604 53.753 37.899 1.00 20.43 ? 20  GLU B CD  1 
ATOM   1937 O OE1 . GLU B 1 20  ? -15.603 53.845 38.651 1.00 20.43 ? 20  GLU B OE1 1 
ATOM   1938 O OE2 . GLU B 1 20  ? -13.987 54.782 37.531 1.00 20.43 ? 20  GLU B OE2 1 
ATOM   1939 N N   . GLU B 1 21  ? -10.566 51.212 38.416 1.00 8.95  ? 21  GLU B N   1 
ATOM   1940 C CA  . GLU B 1 21  ? -10.009 50.899 39.731 1.00 8.95  ? 21  GLU B CA  1 
ATOM   1941 C C   . GLU B 1 21  ? -10.977 51.247 40.836 1.00 8.95  ? 21  GLU B C   1 
ATOM   1942 O O   . GLU B 1 21  ? -11.351 52.423 40.881 1.00 8.95  ? 21  GLU B O   1 
ATOM   1943 C CB  . GLU B 1 21  ? -8.681  51.695 39.957 1.00 8.95  ? 21  GLU B CB  1 
ATOM   1944 C CG  . GLU B 1 21  ? -7.978  51.351 41.252 1.00 13.08 ? 21  GLU B CG  1 
ATOM   1945 C CD  . GLU B 1 21  ? -6.614  52.022 41.242 1.00 13.08 ? 21  GLU B CD  1 
ATOM   1946 O OE1 . GLU B 1 21  ? -6.479  53.175 41.701 1.00 13.08 ? 21  GLU B OE1 1 
ATOM   1947 O OE2 . GLU B 1 21  ? -5.810  51.628 40.375 1.00 13.08 ? 21  GLU B OE2 1 
ATOM   1948 N N   . ALA B 1 22  ? -11.118 50.386 41.809 1.00 9.15  ? 22  ALA B N   1 
ATOM   1949 C CA  . ALA B 1 22  ? -11.831 50.720 43.017 1.00 9.15  ? 22  ALA B CA  1 
ATOM   1950 C C   . ALA B 1 22  ? -11.048 51.599 43.989 1.00 9.15  ? 22  ALA B C   1 
ATOM   1951 O O   . ALA B 1 22  ? -9.782  51.624 43.990 1.00 9.15  ? 22  ALA B O   1 
ATOM   1952 C CB  . ALA B 1 22  ? -12.266 49.445 43.746 1.00 9.15  ? 22  ALA B CB  1 
ATOM   1953 N N   . VAL B 1 23  ? -11.791 52.227 44.907 1.00 15.80 ? 23  VAL B N   1 
ATOM   1954 C CA  . VAL B 1 23  ? -11.196 52.934 46.070 1.00 15.80 ? 23  VAL B CA  1 
ATOM   1955 C C   . VAL B 1 23  ? -10.848 51.908 47.114 1.00 15.80 ? 23  VAL B C   1 
ATOM   1956 O O   . VAL B 1 23  ? -11.714 51.037 47.426 1.00 15.80 ? 23  VAL B O   1 
ATOM   1957 C CB  . VAL B 1 23  ? -12.267 53.816 46.731 1.00 15.80 ? 23  VAL B CB  1 
ATOM   1958 C CG1 . VAL B 1 23  ? -11.758 54.365 48.085 1.00 10.74 ? 23  VAL B CG1 1 
ATOM   1959 C CG2 . VAL B 1 23  ? -12.677 54.887 45.711 1.00 10.74 ? 23  VAL B CG2 1 
ATOM   1960 N N   . PRO B 1 24  ? -9.620  51.916 47.482 1.00 9.50  ? 24  PRO B N   1 
ATOM   1961 C CA  . PRO B 1 24  ? -9.087  50.968 48.437 1.00 9.50  ? 24  PRO B CA  1 
ATOM   1962 C C   . PRO B 1 24  ? -9.959  50.735 49.656 1.00 9.50  ? 24  PRO B C   1 
ATOM   1963 O O   . PRO B 1 24  ? -10.263 51.723 50.372 1.00 9.50  ? 24  PRO B O   1 
ATOM   1964 C CB  . PRO B 1 24  ? -7.692  51.392 48.827 1.00 9.50  ? 24  PRO B CB  1 
ATOM   1965 C CG  . PRO B 1 24  ? -7.313  52.424 47.779 1.00 14.83 ? 24  PRO B CG  1 
ATOM   1966 C CD  . PRO B 1 24  ? -8.570  52.823 47.011 1.00 14.83 ? 24  PRO B CD  1 
ATOM   1967 N N   . GLY B 1 25  ? -10.343 49.478 49.901 1.00 5.63  ? 25  GLY B N   1 
ATOM   1968 C CA  . GLY B 1 25  ? -11.094 49.192 51.120 1.00 5.63  ? 25  GLY B CA  1 
ATOM   1969 C C   . GLY B 1 25  ? -12.594 49.366 50.905 1.00 5.63  ? 25  GLY B C   1 
ATOM   1970 O O   . GLY B 1 25  ? -13.402 49.196 51.868 1.00 5.63  ? 25  GLY B O   1 
ATOM   1971 N N   . SER B 1 26  ? -13.013 49.653 49.705 1.00 10.26 ? 26  SER B N   1 
ATOM   1972 C CA  . SER B 1 26  ? -14.430 50.021 49.559 1.00 10.26 ? 26  SER B CA  1 
ATOM   1973 C C   . SER B 1 26  ? -15.389 48.874 49.298 1.00 10.26 ? 26  SER B C   1 
ATOM   1974 O O   . SER B 1 26  ? -16.646 49.055 49.290 1.00 10.26 ? 26  SER B O   1 
ATOM   1975 C CB  . SER B 1 26  ? -14.620 51.163 48.532 1.00 10.26 ? 26  SER B CB  1 
ATOM   1976 O OG  . SER B 1 26  ? -14.292 50.763 47.187 1.00 11.56 ? 26  SER B OG  1 
ATOM   1977 N N   . TRP B 1 27  ? -14.802 47.705 49.145 1.00 10.49 ? 27  TRP B N   1 
ATOM   1978 C CA  . TRP B 1 27  ? -15.609 46.487 48.991 1.00 10.49 ? 27  TRP B CA  1 
ATOM   1979 C C   . TRP B 1 27  ? -15.254 45.394 49.995 1.00 10.49 ? 27  TRP B C   1 
ATOM   1980 O O   . TRP B 1 27  ? -14.485 44.496 49.601 1.00 10.49 ? 27  TRP B O   1 
ATOM   1981 C CB  . TRP B 1 27  ? -15.539 45.882 47.570 1.00 10.49 ? 27  TRP B CB  1 
ATOM   1982 C CG  . TRP B 1 27  ? -15.877 46.883 46.444 1.00 11.04 ? 27  TRP B CG  1 
ATOM   1983 C CD1 . TRP B 1 27  ? -15.042 47.486 45.552 1.00 11.04 ? 27  TRP B CD1 1 
ATOM   1984 C CD2 . TRP B 1 27  ? -17.155 47.379 46.153 1.00 11.04 ? 27  TRP B CD2 1 
ATOM   1985 N NE1 . TRP B 1 27  ? -15.782 48.299 44.711 1.00 11.04 ? 27  TRP B NE1 1 
ATOM   1986 C CE2 . TRP B 1 27  ? -17.018 48.240 45.058 1.00 11.04 ? 27  TRP B CE2 1 
ATOM   1987 C CE3 . TRP B 1 27  ? -18.378 47.150 46.763 1.00 11.04 ? 27  TRP B CE3 1 
ATOM   1988 C CZ2 . TRP B 1 27  ? -18.107 48.907 44.495 1.00 11.04 ? 27  TRP B CZ2 1 
ATOM   1989 C CZ3 . TRP B 1 27  ? -19.474 47.806 46.196 1.00 11.04 ? 27  TRP B CZ3 1 
ATOM   1990 C CH2 . TRP B 1 27  ? -19.345 48.660 45.082 1.00 11.04 ? 27  TRP B CH2 1 
ATOM   1991 N N   . PRO B 1 28  ? -15.510 45.645 51.247 1.00 8.38  ? 28  PRO B N   1 
ATOM   1992 C CA  . PRO B 1 28  ? -14.814 45.017 52.385 1.00 8.38  ? 28  PRO B CA  1 
ATOM   1993 C C   . PRO B 1 28  ? -15.108 43.531 52.606 1.00 8.38  ? 28  PRO B C   1 
ATOM   1994 O O   . PRO B 1 28  ? -14.376 42.914 53.397 1.00 8.38  ? 28  PRO B O   1 
ATOM   1995 C CB  . PRO B 1 28  ? -15.243 45.757 53.622 1.00 8.38  ? 28  PRO B CB  1 
ATOM   1996 C CG  . PRO B 1 28  ? -16.353 46.695 53.192 1.00 1.05  ? 28  PRO B CG  1 
ATOM   1997 C CD  . PRO B 1 28  ? -16.409 46.696 51.686 1.00 1.05  ? 28  PRO B CD  1 
ATOM   1998 N N   . TRP B 1 29  ? -16.059 42.992 51.871 1.00 9.34  ? 29  TRP B N   1 
ATOM   1999 C CA  . TRP B 1 29  ? -16.427 41.548 51.799 1.00 9.34  ? 29  TRP B CA  1 
ATOM   2000 C C   . TRP B 1 29  ? -15.648 40.853 50.707 1.00 9.34  ? 29  TRP B C   1 
ATOM   2001 O O   . TRP B 1 29  ? -15.550 39.614 50.801 1.00 9.34  ? 29  TRP B O   1 
ATOM   2002 C CB  . TRP B 1 29  ? -17.920 41.321 51.530 1.00 9.34  ? 29  TRP B CB  1 
ATOM   2003 C CG  . TRP B 1 29  ? -18.446 42.196 50.377 1.00 10.76 ? 29  TRP B CG  1 
ATOM   2004 C CD1 . TRP B 1 29  ? -18.420 41.950 49.053 1.00 10.76 ? 29  TRP B CD1 1 
ATOM   2005 C CD2 . TRP B 1 29  ? -19.059 43.461 50.529 1.00 10.76 ? 29  TRP B CD2 1 
ATOM   2006 N NE1 . TRP B 1 29  ? -19.045 43.042 48.386 1.00 10.76 ? 29  TRP B NE1 1 
ATOM   2007 C CE2 . TRP B 1 29  ? -19.442 43.894 49.260 1.00 10.76 ? 29  TRP B CE2 1 
ATOM   2008 C CE3 . TRP B 1 29  ? -19.316 44.217 51.663 1.00 10.76 ? 29  TRP B CE3 1 
ATOM   2009 C CZ2 . TRP B 1 29  ? -20.161 45.074 49.060 1.00 10.76 ? 29  TRP B CZ2 1 
ATOM   2010 C CZ3 . TRP B 1 29  ? -20.042 45.400 51.477 1.00 10.76 ? 29  TRP B CZ3 1 
ATOM   2011 C CH2 . TRP B 1 29  ? -20.460 45.811 50.218 1.00 10.76 ? 29  TRP B CH2 1 
ATOM   2012 N N   . GLN B 1 30  ? -14.995 41.612 49.885 1.00 11.59 ? 30  GLN B N   1 
ATOM   2013 C CA  . GLN B 1 30  ? -14.141 41.035 48.877 1.00 11.59 ? 30  GLN B CA  1 
ATOM   2014 C C   . GLN B 1 30  ? -12.950 40.241 49.425 1.00 11.59 ? 30  GLN B C   1 
ATOM   2015 O O   . GLN B 1 30  ? -12.026 40.845 50.023 1.00 11.59 ? 30  GLN B O   1 
ATOM   2016 C CB  . GLN B 1 30  ? -13.705 42.033 47.792 1.00 11.59 ? 30  GLN B CB  1 
ATOM   2017 C CG  . GLN B 1 30  ? -12.687 41.406 46.802 1.00 7.86  ? 30  GLN B CG  1 
ATOM   2018 C CD  . GLN B 1 30  ? -13.381 40.628 45.694 1.00 7.86  ? 30  GLN B CD  1 
ATOM   2019 O OE1 . GLN B 1 30  ? -14.088 41.266 44.880 1.00 7.86  ? 30  GLN B OE1 1 
ATOM   2020 N NE2 . GLN B 1 30  ? -13.185 39.314 45.600 1.00 7.86  ? 30  GLN B NE2 1 
ATOM   2021 N N   . VAL B 1 31  ? -12.921 38.917 49.139 1.00 14.60 ? 31  VAL B N   1 
ATOM   2022 C CA  . VAL B 1 31  ? -11.737 38.113 49.508 1.00 14.60 ? 31  VAL B CA  1 
ATOM   2023 C C   . VAL B 1 31  ? -10.965 37.464 48.351 1.00 14.60 ? 31  VAL B C   1 
ATOM   2024 O O   . VAL B 1 31  ? -11.486 37.305 47.233 1.00 14.60 ? 31  VAL B O   1 
ATOM   2025 C CB  . VAL B 1 31  ? -11.971 37.109 50.668 1.00 14.60 ? 31  VAL B CB  1 
ATOM   2026 C CG1 . VAL B 1 31  ? -12.667 37.736 51.898 1.00 7.12  ? 31  VAL B CG1 1 
ATOM   2027 C CG2 . VAL B 1 31  ? -12.715 35.826 50.263 1.00 7.12  ? 31  VAL B CG2 1 
ATOM   2028 N N   . SER B 1 32  ? -9.724  37.117 48.602 1.00 10.29 ? 32  SER B N   1 
ATOM   2029 C CA  . SER B 1 32  ? -8.899  36.369 47.689 1.00 10.29 ? 32  SER B CA  1 
ATOM   2030 C C   . SER B 1 32  ? -8.727  34.978 48.285 1.00 10.29 ? 32  SER B C   1 
ATOM   2031 O O   . SER B 1 32  ? -8.452  34.854 49.523 1.00 10.29 ? 32  SER B O   1 
ATOM   2032 C CB  . SER B 1 32  ? -7.565  37.052 47.655 1.00 10.29 ? 32  SER B CB  1 
ATOM   2033 O OG  . SER B 1 32  ? -6.676  36.283 46.877 1.00 17.01 ? 32  SER B OG  1 
ATOM   2034 N N   . LEU B 1 33  ? -8.771  33.968 47.427 1.00 8.43  ? 33  LEU B N   1 
ATOM   2035 C CA  . LEU B 1 33  ? -8.326  32.591 47.827 1.00 8.43  ? 33  LEU B CA  1 
ATOM   2036 C C   . LEU B 1 33  ? -7.005  32.303 47.193 1.00 8.43  ? 33  LEU B C   1 
ATOM   2037 O O   . LEU B 1 33  ? -6.883  32.453 45.966 1.00 8.43  ? 33  LEU B O   1 
ATOM   2038 C CB  . LEU B 1 33  ? -9.233  31.416 47.405 1.00 8.43  ? 33  LEU B CB  1 
ATOM   2039 C CG  . LEU B 1 33  ? -10.713 31.675 47.724 1.00 20.43 ? 33  LEU B CG  1 
ATOM   2040 C CD1 . LEU B 1 33  ? -11.680 30.682 47.106 1.00 20.43 ? 33  LEU B CD1 1 
ATOM   2041 C CD2 . LEU B 1 33  ? -10.979 31.870 49.202 1.00 20.43 ? 33  LEU B CD2 1 
ATOM   2042 N N   . GLN B 1 34  ? -6.090  31.933 48.035 1.00 20.17 ? 34  GLN B N   1 
ATOM   2043 C CA  . GLN B 1 34  ? -4.699  31.598 47.656 1.00 20.17 ? 34  GLN B CA  1 
ATOM   2044 C C   . GLN B 1 34  ? -4.338  30.154 47.930 1.00 20.17 ? 34  GLN B C   1 
ATOM   2045 O O   . GLN B 1 34  ? -4.906  29.534 48.860 1.00 20.17 ? 34  GLN B O   1 
ATOM   2046 C CB  . GLN B 1 34  ? -3.756  32.581 48.359 1.00 20.17 ? 34  GLN B CB  1 
ATOM   2047 C CG  . GLN B 1 34  ? -3.967  33.899 47.579 1.00 42.44 ? 34  GLN B CG  1 
ATOM   2048 C CD  . GLN B 1 34  ? -3.287  35.061 48.279 1.00 42.44 ? 34  GLN B CD  1 
ATOM   2049 O OE1 . GLN B 1 34  ? -2.608  34.768 49.299 1.00 42.44 ? 34  GLN B OE1 1 
ATOM   2050 N NE2 . GLN B 1 34  ? -3.782  36.278 47.931 1.00 42.44 ? 34  GLN B NE2 1 
ATOM   2051 N N   . ASP B 1 35  ? -3.473  29.600 47.124 1.00 18.72 ? 35  ASP B N   1 
ATOM   2052 C CA  . ASP B 1 35  ? -3.113  28.246 47.473 1.00 18.72 ? 35  ASP B CA  1 
ATOM   2053 C C   . ASP B 1 35  ? -1.892  28.253 48.388 1.00 18.72 ? 35  ASP B C   1 
ATOM   2054 O O   . ASP B 1 35  ? -1.413  29.360 48.785 1.00 18.72 ? 35  ASP B O   1 
ATOM   2055 C CB  . ASP B 1 35  ? -2.959  27.348 46.232 1.00 18.72 ? 35  ASP B CB  1 
ATOM   2056 C CG  . ASP B 1 35  ? -1.708  27.694 45.416 1.00 32.07 ? 35  ASP B CG  1 
ATOM   2057 O OD1 . ASP B 1 35  ? -1.669  27.310 44.224 1.00 32.07 ? 35  ASP B OD1 1 
ATOM   2058 O OD2 . ASP B 1 35  ? -0.898  28.596 45.769 1.00 32.07 ? 35  ASP B OD2 1 
ATOM   2059 N N   . LYS B 1 36  ? -1.172  27.157 48.452 1.00 53.14 ? 36  LYS B N   1 
ATOM   2060 C CA  . LYS B 1 36  ? 0.135   27.186 49.153 1.00 53.14 ? 36  LYS B CA  1 
ATOM   2061 C C   . LYS B 1 36  ? 1.365   27.623 48.348 1.00 53.14 ? 36  LYS B C   1 
ATOM   2062 O O   . LYS B 1 36  ? 2.252   28.313 48.915 1.00 53.14 ? 36  LYS B O   1 
ATOM   2063 C CB  . LYS B 1 36  ? 0.372   25.898 49.957 1.00 53.14 ? 36  LYS B CB  1 
ATOM   2064 C CG  . LYS B 1 36  ? 0.364   24.632 49.082 1.00 0.00  ? 36  LYS B CG  1 
ATOM   2065 C CD  . LYS B 1 36  ? 0.517   23.362 49.940 1.00 0.00  ? 36  LYS B CD  1 
ATOM   2066 C CE  . LYS B 1 36  ? 0.459   22.079 49.092 1.00 0.00  ? 36  LYS B CE  1 
ATOM   2067 N NZ  . LYS B 1 36  ? 0.582   20.900 49.958 1.00 0.00  ? 36  LYS B NZ  1 
ATOM   2068 N N   . THR B 1 37  ? 1.246   27.591 47.040 1.00 0.00  ? 37  THR B N   1 
ATOM   2069 C CA  . THR B 1 37  ? 2.220   28.262 46.164 1.00 29.10 ? 37  THR B CA  1 
ATOM   2070 C C   . THR B 1 37  ? 2.105   29.800 46.275 1.00 29.10 ? 37  THR B C   1 
ATOM   2071 O O   . THR B 1 37  ? 3.012   30.550 45.834 1.00 0.00  ? 37  THR B O   1 
ATOM   2072 C CB  . THR B 1 37  ? 1.987   27.831 44.703 1.00 0.00  ? 37  THR B CB  1 
ATOM   2073 O OG1 . THR B 1 37  ? 1.608   26.449 44.664 1.00 0.00  ? 37  THR B OG1 1 
ATOM   2074 C CG2 . THR B 1 37  ? 3.217   28.071 43.807 1.00 0.00  ? 37  THR B CG2 1 
ATOM   2075 N N   . GLY B 1 38  ? 1.039   30.228 46.963 1.00 0.00  ? 38  GLY B N   1 
ATOM   2076 C CA  . GLY B 1 38  ? 0.706   31.632 47.312 1.00 32.72 ? 38  GLY B CA  1 
ATOM   2077 C C   . GLY B 1 38  ? -0.123  32.351 46.229 1.00 32.72 ? 38  GLY B C   1 
ATOM   2078 O O   . GLY B 1 38  ? -0.266  33.616 46.197 1.00 32.72 ? 38  GLY B O   1 
ATOM   2079 N N   . PHE B 1 39  ? -0.445  31.528 45.249 1.00 20.29 ? 39  PHE B N   1 
ATOM   2080 C CA  . PHE B 1 39  ? -1.176  31.863 44.032 1.00 20.29 ? 39  PHE B CA  1 
ATOM   2081 C C   . PHE B 1 39  ? -2.654  32.125 44.311 1.00 20.29 ? 39  PHE B C   1 
ATOM   2082 O O   . PHE B 1 39  ? -3.315  31.166 44.757 1.00 20.29 ? 39  PHE B O   1 
ATOM   2083 C CB  . PHE B 1 39  ? -1.066  30.674 43.062 1.00 20.29 ? 39  PHE B CB  1 
ATOM   2084 C CG  . PHE B 1 39  ? -1.671  30.946 41.674 1.00 27.24 ? 39  PHE B CG  1 
ATOM   2085 C CD1 . PHE B 1 39  ? -1.077  31.859 40.835 1.00 27.24 ? 39  PHE B CD1 1 
ATOM   2086 C CD2 . PHE B 1 39  ? -2.823  30.288 41.278 1.00 27.24 ? 39  PHE B CD2 1 
ATOM   2087 C CE1 . PHE B 1 39  ? -1.657  32.124 39.601 1.00 27.24 ? 39  PHE B CE1 1 
ATOM   2088 C CE2 . PHE B 1 39  ? -3.412  30.545 40.056 1.00 27.24 ? 39  PHE B CE2 1 
ATOM   2089 C CZ  . PHE B 1 39  ? -2.836  31.472 39.212 1.00 27.24 ? 39  PHE B CZ  1 
ATOM   2090 N N   . HIS B 1 40  ? -3.123  33.311 43.896 1.00 18.25 ? 40  HIS B N   1 
ATOM   2091 C CA  . HIS B 1 40  ? -4.515  33.748 43.884 1.00 18.25 ? 40  HIS B CA  1 
ATOM   2092 C C   . HIS B 1 40  ? -5.268  33.040 42.773 1.00 18.25 ? 40  HIS B C   1 
ATOM   2093 O O   . HIS B 1 40  ? -5.057  33.330 41.568 1.00 18.25 ? 40  HIS B O   1 
ATOM   2094 C CB  . HIS B 1 40  ? -4.602  35.267 43.611 1.00 18.25 ? 40  HIS B CB  1 
ATOM   2095 C CG  . HIS B 1 40  ? -5.998  35.817 43.214 1.00 30.28 ? 40  HIS B CG  1 
ATOM   2096 N ND1 . HIS B 1 40  ? -7.118  35.839 44.121 1.00 30.28 ? 40  HIS B ND1 1 
ATOM   2097 C CD2 . HIS B 1 40  ? -6.384  36.373 42.056 1.00 30.28 ? 40  HIS B CD2 1 
ATOM   2098 C CE1 . HIS B 1 40  ? -8.166  36.464 43.473 1.00 30.28 ? 40  HIS B CE1 1 
ATOM   2099 N NE2 . HIS B 1 40  ? -7.712  36.793 42.197 1.00 30.28 ? 40  HIS B NE2 1 
ATOM   2100 N N   . PHE B 1 41  ? -6.144  32.177 43.147 1.00 13.34 ? 41  PHE B N   1 
ATOM   2101 C CA  . PHE B 1 41  ? -6.815  31.433 42.106 1.00 13.34 ? 41  PHE B CA  1 
ATOM   2102 C C   . PHE B 1 41  ? -8.323  31.658 42.025 1.00 13.34 ? 41  PHE B C   1 
ATOM   2103 O O   . PHE B 1 41  ? -8.936  31.179 41.043 1.00 13.34 ? 41  PHE B O   1 
ATOM   2104 C CB  . PHE B 1 41  ? -6.482  29.940 42.196 1.00 13.34 ? 41  PHE B CB  1 
ATOM   2105 C CG  . PHE B 1 41  ? -7.115  29.214 43.387 1.00 14.35 ? 41  PHE B CG  1 
ATOM   2106 C CD1 . PHE B 1 41  ? -8.331  28.588 43.251 1.00 14.35 ? 41  PHE B CD1 1 
ATOM   2107 C CD2 . PHE B 1 41  ? -6.504  29.253 44.612 1.00 14.35 ? 41  PHE B CD2 1 
ATOM   2108 C CE1 . PHE B 1 41  ? -8.948  27.995 44.346 1.00 14.35 ? 41  PHE B CE1 1 
ATOM   2109 C CE2 . PHE B 1 41  ? -7.109  28.653 45.704 1.00 14.35 ? 41  PHE B CE2 1 
ATOM   2110 C CZ  . PHE B 1 41  ? -8.341  28.007 45.570 1.00 14.35 ? 41  PHE B CZ  1 
ATOM   2111 N N   . CYS B 1 42  ? -8.924  32.328 43.009 1.00 13.47 ? 42  CYS B N   1 
ATOM   2112 C CA  . CYS B 1 42  ? -10.360 32.583 42.979 1.00 13.47 ? 42  CYS B CA  1 
ATOM   2113 C C   . CYS B 1 42  ? -10.776 33.705 43.917 1.00 13.47 ? 42  CYS B C   1 
ATOM   2114 O O   . CYS B 1 42  ? -9.961  34.083 44.764 1.00 13.47 ? 42  CYS B O   1 
ATOM   2115 C CB  . CYS B 1 42  ? -11.171 31.291 43.348 1.00 13.47 ? 42  CYS B CB  1 
ATOM   2116 S SG  . CYS B 1 42  ? -11.695 30.148 42.013 1.00 16.46 ? 42  CYS B SG  1 
ATOM   2117 N N   . GLY B 1 43  ? -11.989 34.213 43.817 1.00 13.55 ? 43  GLY B N   1 
ATOM   2118 C CA  . GLY B 1 43  ? -12.528 35.272 44.662 1.00 13.55 ? 43  GLY B CA  1 
ATOM   2119 C C   . GLY B 1 43  ? -13.521 34.663 45.615 1.00 13.55 ? 43  GLY B C   1 
ATOM   2120 O O   . GLY B 1 43  ? -13.683 33.407 45.588 1.00 13.55 ? 43  GLY B O   1 
ATOM   2121 N N   . GLY B 1 44  ? -14.182 35.516 46.377 1.00 9.67  ? 44  GLY B N   1 
ATOM   2122 C CA  . GLY B 1 44  ? -15.281 35.147 47.343 1.00 9.67  ? 44  GLY B CA  1 
ATOM   2123 C C   . GLY B 1 44  ? -15.708 36.335 48.175 1.00 9.67  ? 44  GLY B C   1 
ATOM   2124 O O   . GLY B 1 44  ? -15.128 37.448 47.996 1.00 9.67  ? 44  GLY B O   1 
ATOM   2125 N N   . SER B 1 45  ? -16.752 36.104 48.932 1.00 5.29  ? 45  SER B N   1 
ATOM   2126 C CA  . SER B 1 45  ? -17.454 37.122 49.755 1.00 5.29  ? 45  SER B CA  1 
ATOM   2127 C C   . SER B 1 45  ? -17.635 36.675 51.195 1.00 5.29  ? 45  SER B C   1 
ATOM   2128 O O   . SER B 1 45  ? -18.176 35.551 51.403 1.00 5.29  ? 45  SER B O   1 
ATOM   2129 C CB  . SER B 1 45  ? -18.868 37.381 49.241 1.00 5.29  ? 45  SER B CB  1 
ATOM   2130 O OG  . SER B 1 45  ? -18.753 37.893 47.940 1.00 14.79 ? 45  SER B OG  1 
ATOM   2131 N N   . LEU B 1 46  ? -17.144 37.468 52.146 1.00 14.94 ? 46  LEU B N   1 
ATOM   2132 C CA  . LEU B 1 46  ? -17.495 37.198 53.535 1.00 14.94 ? 46  LEU B CA  1 
ATOM   2133 C C   . LEU B 1 46  ? -18.977 37.503 53.757 1.00 14.94 ? 46  LEU B C   1 
ATOM   2134 O O   . LEU B 1 46  ? -19.448 38.588 53.278 1.00 14.94 ? 46  LEU B O   1 
ATOM   2135 C CB  . LEU B 1 46  ? -16.723 38.203 54.361 1.00 14.94 ? 46  LEU B CB  1 
ATOM   2136 C CG  . LEU B 1 46  ? -15.243 37.839 54.536 1.00 17.30 ? 46  LEU B CG  1 
ATOM   2137 C CD1 . LEU B 1 46  ? -14.448 39.139 54.809 1.00 17.30 ? 46  LEU B CD1 1 
ATOM   2138 C CD2 . LEU B 1 46  ? -15.044 36.851 55.690 1.00 17.30 ? 46  LEU B CD2 1 
ATOM   2139 N N   . ILE B 1 47  ? -19.717 36.552 54.385 1.00 10.96 ? 47  ILE B N   1 
ATOM   2140 C CA  . ILE B 1 47  ? -21.108 36.802 54.790 1.00 10.96 ? 47  ILE B CA  1 
ATOM   2141 C C   . ILE B 1 47  ? -21.232 36.842 56.320 1.00 10.96 ? 47  ILE B C   1 
ATOM   2142 O O   . ILE B 1 47  ? -22.192 37.442 56.878 1.00 10.96 ? 47  ILE B O   1 
ATOM   2143 C CB  . ILE B 1 47  ? -22.073 35.734 54.223 1.00 10.96 ? 47  ILE B CB  1 
ATOM   2144 C CG1 . ILE B 1 47  ? -21.612 34.336 54.693 1.00 16.65 ? 47  ILE B CG1 1 
ATOM   2145 C CG2 . ILE B 1 47  ? -22.145 35.813 52.695 1.00 16.65 ? 47  ILE B CG2 1 
ATOM   2146 C CD1 . ILE B 1 47  ? -22.689 33.232 54.565 1.00 16.65 ? 47  ILE B CD1 1 
ATOM   2147 N N   . ASN B 1 48  ? -20.141 36.539 57.015 1.00 14.25 ? 48  ASN B N   1 
ATOM   2148 C CA  . ASN B 1 48  ? -19.906 36.946 58.403 1.00 14.25 ? 48  ASN B CA  1 
ATOM   2149 C C   . ASN B 1 48  ? -18.491 36.608 58.797 1.00 14.25 ? 48  ASN B C   1 
ATOM   2150 O O   . ASN B 1 48  ? -17.710 36.259 57.877 1.00 14.25 ? 48  ASN B O   1 
ATOM   2151 C CB  . ASN B 1 48  ? -20.889 36.396 59.493 1.00 14.25 ? 48  ASN B CB  1 
ATOM   2152 C CG  . ASN B 1 48  ? -21.023 34.866 59.502 1.00 17.21 ? 48  ASN B CG  1 
ATOM   2153 O OD1 . ASN B 1 48  ? -22.122 34.349 59.723 1.00 17.21 ? 48  ASN B OD1 1 
ATOM   2154 N ND2 . ASN B 1 48  ? -19.978 34.112 59.419 1.00 17.21 ? 48  ASN B ND2 1 
ATOM   2155 N N   . GLU B 1 49  ? -18.194 36.723 60.097 1.00 13.62 ? 49  GLU B N   1 
ATOM   2156 C CA  . GLU B 1 49  ? -16.784 36.546 60.433 1.00 13.62 ? 49  GLU B CA  1 
ATOM   2157 C C   . GLU B 1 49  ? -16.183 35.145 60.358 1.00 13.62 ? 49  GLU B C   1 
ATOM   2158 O O   . GLU B 1 49  ? -14.933 34.996 60.271 1.00 13.62 ? 49  GLU B O   1 
ATOM   2159 C CB  . GLU B 1 49  ? -16.174 37.505 61.471 1.00 13.62 ? 49  GLU B CB  1 
ATOM   2160 C CG  . GLU B 1 49  ? -16.893 37.589 62.788 1.00 25.22 ? 49  GLU B CG  1 
ATOM   2161 C CD  . GLU B 1 49  ? -18.013 38.618 62.667 1.00 25.22 ? 49  GLU B CD  1 
ATOM   2162 O OE1 . GLU B 1 49  ? -17.870 39.747 63.217 1.00 25.22 ? 49  GLU B OE1 1 
ATOM   2163 O OE2 . GLU B 1 49  ? -19.166 38.225 62.348 1.00 25.22 ? 49  GLU B OE2 1 
ATOM   2164 N N   . ASN B 1 50  ? -17.100 34.169 60.273 1.00 23.45 ? 50  ASN B N   1 
ATOM   2165 C CA  . ASN B 1 50  ? -16.790 32.726 60.199 1.00 23.45 ? 50  ASN B CA  1 
ATOM   2166 C C   . ASN B 1 50  ? -16.962 32.103 58.811 1.00 23.45 ? 50  ASN B C   1 
ATOM   2167 O O   . ASN B 1 50  ? -16.620 30.913 58.640 1.00 23.45 ? 50  ASN B O   1 
ATOM   2168 C CB  . ASN B 1 50  ? -17.653 31.970 61.253 1.00 23.45 ? 50  ASN B CB  1 
ATOM   2169 C CG  . ASN B 1 50  ? -17.170 32.400 62.637 1.00 26.66 ? 50  ASN B CG  1 
ATOM   2170 O OD1 . ASN B 1 50  ? -15.957 32.300 62.942 1.00 26.66 ? 50  ASN B OD1 1 
ATOM   2171 N ND2 . ASN B 1 50  ? -18.093 32.740 63.473 1.00 26.66 ? 50  ASN B ND2 1 
ATOM   2172 N N   . TRP B 1 51  ? -17.699 32.778 57.928 1.00 12.61 ? 51  TRP B N   1 
ATOM   2173 C CA  . TRP B 1 51  ? -18.230 32.159 56.716 1.00 12.61 ? 51  TRP B CA  1 
ATOM   2174 C C   . TRP B 1 51  ? -17.945 32.977 55.472 1.00 12.61 ? 51  TRP B C   1 
ATOM   2175 O O   . TRP B 1 51  ? -18.127 34.232 55.477 1.00 12.61 ? 51  TRP B O   1 
ATOM   2176 C CB  . TRP B 1 51  ? -19.727 31.818 56.759 1.00 12.61 ? 51  TRP B CB  1 
ATOM   2177 C CG  . TRP B 1 51  ? -20.110 30.727 57.772 1.00 22.07 ? 51  TRP B CG  1 
ATOM   2178 C CD1 . TRP B 1 51  ? -20.544 30.844 59.049 1.00 22.07 ? 51  TRP B CD1 1 
ATOM   2179 C CD2 . TRP B 1 51  ? -20.181 29.350 57.490 1.00 22.07 ? 51  TRP B CD2 1 
ATOM   2180 N NE1 . TRP B 1 51  ? -20.855 29.582 59.581 1.00 22.07 ? 51  TRP B NE1 1 
ATOM   2181 C CE2 . TRP B 1 51  ? -20.640 28.707 58.668 1.00 22.07 ? 51  TRP B CE2 1 
ATOM   2182 C CE3 . TRP B 1 51  ? -19.937 28.645 56.319 1.00 22.07 ? 51  TRP B CE3 1 
ATOM   2183 C CZ2 . TRP B 1 51  ? -20.821 27.317 58.727 1.00 22.07 ? 51  TRP B CZ2 1 
ATOM   2184 C CZ3 . TRP B 1 51  ? -20.152 27.256 56.377 1.00 22.07 ? 51  TRP B CZ3 1 
ATOM   2185 C CH2 . TRP B 1 51  ? -20.565 26.613 57.546 1.00 22.07 ? 51  TRP B CH2 1 
ATOM   2186 N N   . VAL B 1 52  ? -17.458 32.244 54.451 1.00 14.87 ? 52  VAL B N   1 
ATOM   2187 C CA  . VAL B 1 52  ? -17.206 32.745 53.072 1.00 14.87 ? 52  VAL B CA  1 
ATOM   2188 C C   . VAL B 1 52  ? -18.015 32.000 52.000 1.00 14.87 ? 52  VAL B C   1 
ATOM   2189 O O   . VAL B 1 52  ? -18.030 30.730 52.001 1.00 14.87 ? 52  VAL B O   1 
ATOM   2190 C CB  . VAL B 1 52  ? -15.703 32.693 52.761 1.00 14.87 ? 52  VAL B CB  1 
ATOM   2191 C CG1 . VAL B 1 52  ? -15.319 33.082 51.304 1.00 14.77 ? 52  VAL B CG1 1 
ATOM   2192 C CG2 . VAL B 1 52  ? -14.955 33.642 53.728 1.00 14.77 ? 52  VAL B CG2 1 
ATOM   2193 N N   . VAL B 1 53  ? -18.602 32.765 51.068 1.00 14.07 ? 53  VAL B N   1 
ATOM   2194 C CA  . VAL B 1 53  ? -19.178 32.133 49.900 1.00 14.07 ? 53  VAL B CA  1 
ATOM   2195 C C   . VAL B 1 53  ? -18.243 32.233 48.710 1.00 14.07 ? 53  VAL B C   1 
ATOM   2196 O O   . VAL B 1 53  ? -17.711 33.341 48.443 1.00 14.07 ? 53  VAL B O   1 
ATOM   2197 C CB  . VAL B 1 53  ? -20.532 32.645 49.391 1.00 14.07 ? 53  VAL B CB  1 
ATOM   2198 C CG1 . VAL B 1 53  ? -21.639 31.593 49.420 1.00 25.92 ? 53  VAL B CG1 1 
ATOM   2199 C CG2 . VAL B 1 53  ? -20.934 34.049 49.837 1.00 25.92 ? 53  VAL B CG2 1 
ATOM   2200 N N   . THR B 1 54  ? -18.135 31.138 47.989 1.00 9.90  ? 54  THR B N   1 
ATOM   2201 C CA  . THR B 1 54  ? -17.436 31.009 46.716 1.00 9.90  ? 54  THR B CA  1 
ATOM   2202 C C   . THR B 1 54  ? -18.163 30.060 45.751 1.00 9.90  ? 54  THR B C   1 
ATOM   2203 O O   . THR B 1 54  ? -19.301 29.628 46.061 1.00 9.90  ? 54  THR B O   1 
ATOM   2204 C CB  . THR B 1 54  ? -15.947 30.729 46.981 1.00 9.90  ? 54  THR B CB  1 
ATOM   2205 O OG1 . THR B 1 54  ? -15.233 31.044 45.811 1.00 8.91  ? 54  THR B OG1 1 
ATOM   2206 C CG2 . THR B 1 54  ? -15.534 29.357 47.510 1.00 8.91  ? 54  THR B CG2 1 
ATOM   2207 N N   . ALA B 1 55  ? -17.652 29.872 44.557 1.00 6.88  ? 55  ALA B N   1 
ATOM   2208 C CA  . ALA B 1 55  ? -18.118 28.929 43.508 1.00 6.88  ? 55  ALA B CA  1 
ATOM   2209 C C   . ALA B 1 55  ? -17.641 27.507 43.767 1.00 6.88  ? 55  ALA B C   1 
ATOM   2210 O O   . ALA B 1 55  ? -16.497 27.312 44.243 1.00 6.88  ? 55  ALA B O   1 
ATOM   2211 C CB  . ALA B 1 55  ? -17.493 29.359 42.169 1.00 6.88  ? 55  ALA B CB  1 
ATOM   2212 N N   . ALA B 1 56  ? -18.426 26.541 43.405 1.00 8.58  ? 56  ALA B N   1 
ATOM   2213 C CA  . ALA B 1 56  ? -18.029 25.148 43.574 1.00 8.58  ? 56  ALA B CA  1 
ATOM   2214 C C   . ALA B 1 56  ? -16.829 24.845 42.687 1.00 8.58  ? 56  ALA B C   1 
ATOM   2215 O O   . ALA B 1 56  ? -15.898 24.106 43.083 1.00 8.58  ? 56  ALA B O   1 
ATOM   2216 C CB  . ALA B 1 56  ? -19.183 24.239 43.176 1.00 8.58  ? 56  ALA B CB  1 
ATOM   2217 N N   . HIS B 1 57  ? -16.909 25.335 41.440 1.00 12.36 ? 57  HIS B N   1 
ATOM   2218 C CA  . HIS B 1 57  ? -15.878 25.035 40.414 1.00 12.36 ? 57  HIS B CA  1 
ATOM   2219 C C   . HIS B 1 57  ? -14.496 25.594 40.727 1.00 12.36 ? 57  HIS B C   1 
ATOM   2220 O O   . HIS B 1 57  ? -13.533 25.252 39.995 1.00 12.36 ? 57  HIS B O   1 
ATOM   2221 C CB  . HIS B 1 57  ? -16.278 25.499 38.988 1.00 12.36 ? 57  HIS B CB  1 
ATOM   2222 C CG  . HIS B 1 57  ? -15.949 26.982 38.738 1.00 13.21 ? 57  HIS B CG  1 
ATOM   2223 N ND1 . HIS B 1 57  ? -16.917 27.962 38.884 1.00 13.21 ? 57  HIS B ND1 1 
ATOM   2224 C CD2 . HIS B 1 57  ? -14.791 27.564 38.356 1.00 13.21 ? 57  HIS B CD2 1 
ATOM   2225 C CE1 . HIS B 1 57  ? -16.340 29.183 38.552 1.00 13.21 ? 57  HIS B CE1 1 
ATOM   2226 N NE2 . HIS B 1 57  ? -15.013 28.942 38.213 1.00 13.21 ? 57  HIS B NE2 1 
ATOM   2227 N N   . CYS B 1 58  ? -14.385 26.312 41.840 1.00 16.63 ? 58  CYS B N   1 
ATOM   2228 C CA  . CYS B 1 58  ? -13.111 26.800 42.393 1.00 16.63 ? 58  CYS B CA  1 
ATOM   2229 C C   . CYS B 1 58  ? -12.276 25.722 43.066 1.00 16.63 ? 58  CYS B C   1 
ATOM   2230 O O   . CYS B 1 58  ? -11.023 25.853 43.061 1.00 16.63 ? 58  CYS B O   1 
ATOM   2231 C CB  . CYS B 1 58  ? -13.309 27.947 43.399 1.00 16.63 ? 58  CYS B CB  1 
ATOM   2232 S SG  . CYS B 1 58  ? -13.554 29.545 42.622 1.00 13.65 ? 58  CYS B SG  1 
ATOM   2233 N N   . GLY B 1 59  ? -12.895 24.618 43.390 1.00 16.14 ? 59  GLY B N   1 
ATOM   2234 C CA  . GLY B 1 59  ? -12.170 23.436 43.896 1.00 16.14 ? 59  GLY B CA  1 
ATOM   2235 C C   . GLY B 1 59  ? -11.402 23.665 45.201 1.00 16.14 ? 59  GLY B C   1 
ATOM   2236 O O   . GLY B 1 59  ? -10.354 23.014 45.405 1.00 16.14 ? 59  GLY B O   1 
ATOM   2237 N N   . VAL B 1 60  ? -11.902 24.478 46.120 1.00 21.55 ? 60  VAL B N   1 
ATOM   2238 C CA  . VAL B 1 60  ? -11.171 24.760 47.370 1.00 21.55 ? 60  VAL B CA  1 
ATOM   2239 C C   . VAL B 1 60  ? -11.015 23.524 48.253 1.00 21.55 ? 60  VAL B C   1 
ATOM   2240 O O   . VAL B 1 60  ? -12.034 22.804 48.479 1.00 21.55 ? 60  VAL B O   1 
ATOM   2241 C CB  . VAL B 1 60  ? -11.855 25.927 48.177 1.00 21.55 ? 60  VAL B CB  1 
ATOM   2242 C CG1 . VAL B 1 60  ? -11.059 26.503 49.377 1.00 15.53 ? 60  VAL B CG1 1 
ATOM   2243 C CG2 . VAL B 1 60  ? -12.289 27.048 47.249 1.00 15.53 ? 60  VAL B CG2 1 
ATOM   2244 N N   . THR B 1 61  ? -9.809  23.424 48.861 1.00 20.19 ? 61  THR B N   1 
ATOM   2245 C CA  . THR B 1 61  ? -9.498  22.461 49.958 1.00 20.19 ? 61  THR B CA  1 
ATOM   2246 C C   . THR B 1 61  ? -9.169  23.124 51.282 1.00 20.19 ? 61  THR B C   1 
ATOM   2247 O O   . THR B 1 61  ? -8.877  24.337 51.319 1.00 20.19 ? 61  THR B O   1 
ATOM   2248 C CB  . THR B 1 61  ? -8.346  21.518 49.561 1.00 20.19 ? 61  THR B CB  1 
ATOM   2249 O OG1 . THR B 1 61  ? -7.114  22.248 49.394 1.00 21.73 ? 61  THR B OG1 1 
ATOM   2250 C CG2 . THR B 1 61  ? -8.688  20.862 48.210 1.00 21.73 ? 61  THR B CG2 1 
ATOM   2251 N N   . THR B 1 62  ? -8.998  22.323 52.302 1.00 14.84 ? 62  THR B N   1 
ATOM   2252 C CA  . THR B 1 62  ? -8.610  22.886 53.589 1.00 14.84 ? 62  THR B CA  1 
ATOM   2253 C C   . THR B 1 62  ? -7.128  23.143 53.633 1.00 14.84 ? 62  THR B C   1 
ATOM   2254 O O   . THR B 1 62  ? -6.687  23.732 54.640 1.00 14.84 ? 62  THR B O   1 
ATOM   2255 C CB  . THR B 1 62  ? -9.004  21.960 54.745 1.00 14.84 ? 62  THR B CB  1 
ATOM   2256 O OG1 . THR B 1 62  ? -8.529  20.678 54.373 1.00 22.88 ? 62  THR B OG1 1 
ATOM   2257 C CG2 . THR B 1 62  ? -10.539 21.832 54.936 1.00 22.88 ? 62  THR B CG2 1 
ATOM   2258 N N   . SER B 1 63  ? -6.460  23.090 52.505 1.00 22.32 ? 63  SER B N   1 
ATOM   2259 C CA  . SER B 1 63  ? -5.107  23.553 52.505 1.00 22.32 ? 63  SER B CA  1 
ATOM   2260 C C   . SER B 1 63  ? -4.961  24.890 51.793 1.00 22.32 ? 63  SER B C   1 
ATOM   2261 O O   . SER B 1 63  ? -3.906  25.565 51.921 1.00 22.32 ? 63  SER B O   1 
ATOM   2262 C CB  . SER B 1 63  ? -4.211  22.528 51.838 1.00 22.32 ? 63  SER B CB  1 
ATOM   2263 O OG  . SER B 1 63  ? -4.542  21.236 52.348 1.00 44.91 ? 63  SER B OG  1 
ATOM   2264 N N   . ASP B 1 64  ? -6.067  25.408 51.335 1.00 21.07 ? 64  ASP B N   1 
ATOM   2265 C CA  . ASP B 1 64  ? -6.102  26.782 50.829 1.00 21.07 ? 64  ASP B CA  1 
ATOM   2266 C C   . ASP B 1 64  ? -6.235  27.789 51.959 1.00 21.07 ? 64  ASP B C   1 
ATOM   2267 O O   . ASP B 1 64  ? -6.558  27.402 53.115 1.00 21.07 ? 64  ASP B O   1 
ATOM   2268 C CB  . ASP B 1 64  ? -7.288  26.917 49.854 1.00 21.07 ? 64  ASP B CB  1 
ATOM   2269 C CG  . ASP B 1 64  ? -7.037  25.990 48.676 1.00 19.04 ? 64  ASP B CG  1 
ATOM   2270 O OD1 . ASP B 1 64  ? -8.002  25.598 47.948 1.00 19.04 ? 64  ASP B OD1 1 
ATOM   2271 O OD2 . ASP B 1 64  ? -5.884  26.090 48.175 1.00 19.04 ? 64  ASP B OD2 1 
ATOM   2272 N N   . VAL B 1 65  ? -6.099  29.054 51.633 1.00 20.38 ? 65  VAL B N   1 
ATOM   2273 C CA  . VAL B 1 65  ? -6.285  30.134 52.629 1.00 20.38 ? 65  VAL B CA  1 
ATOM   2274 C C   . VAL B 1 65  ? -7.215  31.219 52.074 1.00 20.38 ? 65  VAL B C   1 
ATOM   2275 O O   . VAL B 1 65  ? -7.101  31.610 50.875 1.00 20.38 ? 65  VAL B O   1 
ATOM   2276 C CB  . VAL B 1 65  ? -4.882  30.669 53.079 1.00 20.38 ? 65  VAL B CB  1 
ATOM   2277 C CG1 . VAL B 1 65  ? -4.006  31.041 51.890 1.00 28.12 ? 65  VAL B CG1 1 
ATOM   2278 C CG2 . VAL B 1 65  ? -4.910  31.905 53.966 1.00 28.12 ? 65  VAL B CG2 1 
ATOM   2279 N N   . VAL B 1 66  ? -8.000  31.832 52.937 1.00 15.29 ? 66  VAL B N   1 
ATOM   2280 C CA  . VAL B 1 66  ? -8.710  33.040 52.581 1.00 15.29 ? 66  VAL B CA  1 
ATOM   2281 C C   . VAL B 1 66  ? -8.008  34.350 53.004 1.00 15.29 ? 66  VAL B C   1 
ATOM   2282 O O   . VAL B 1 66  ? -7.683  34.572 54.202 1.00 15.29 ? 66  VAL B O   1 
ATOM   2283 C CB  . VAL B 1 66  ? -10.099 32.914 53.250 1.00 15.29 ? 66  VAL B CB  1 
ATOM   2284 C CG1 . VAL B 1 66  ? -10.922 34.213 53.123 1.00 17.88 ? 66  VAL B CG1 1 
ATOM   2285 C CG2 . VAL B 1 66  ? -10.883 31.727 52.688 1.00 17.88 ? 66  VAL B CG2 1 
ATOM   2286 N N   . VAL B 1 67  ? -7.729  35.216 52.044 1.00 13.66 ? 67  VAL B N   1 
ATOM   2287 C CA  . VAL B 1 67  ? -7.142  36.561 52.277 1.00 13.66 ? 67  VAL B CA  1 
ATOM   2288 C C   . VAL B 1 67  ? -8.147  37.715 52.329 1.00 13.66 ? 67  VAL B C   1 
ATOM   2289 O O   . VAL B 1 67  ? -8.854  37.966 51.320 1.00 13.66 ? 67  VAL B O   1 
ATOM   2290 C CB  . VAL B 1 67  ? -5.994  36.882 51.283 1.00 13.66 ? 67  VAL B CB  1 
ATOM   2291 C CG1 . VAL B 1 67  ? -5.221  38.125 51.766 1.00 11.09 ? 67  VAL B CG1 1 
ATOM   2292 C CG2 . VAL B 1 67  ? -5.007  35.741 51.295 1.00 11.09 ? 67  VAL B CG2 1 
ATOM   2293 N N   . ALA B 1 68  ? -8.250  38.373 53.480 1.00 15.01 ? 68  ALA B N   1 
ATOM   2294 C CA  . ALA B 1 68  ? -9.088  39.606 53.624 1.00 15.01 ? 68  ALA B CA  1 
ATOM   2295 C C   . ALA B 1 68  ? -8.373  40.965 53.739 1.00 15.01 ? 68  ALA B C   1 
ATOM   2296 O O   . ALA B 1 68  ? -7.341  41.075 54.445 1.00 15.01 ? 68  ALA B O   1 
ATOM   2297 C CB  . ALA B 1 68  ? -10.163 39.454 54.715 1.00 15.01 ? 68  ALA B CB  1 
ATOM   2298 N N   . GLY B 1 69  ? -8.939  42.024 53.160 1.00 12.58 ? 69  GLY B N   1 
ATOM   2299 C CA  . GLY B 1 69  ? -8.452  43.412 53.270 1.00 12.58 ? 69  GLY B CA  1 
ATOM   2300 C C   . GLY B 1 69  ? -7.288  43.707 52.342 1.00 12.58 ? 69  GLY B C   1 
ATOM   2301 O O   . GLY B 1 69  ? -6.747  44.827 52.439 1.00 12.58 ? 69  GLY B O   1 
ATOM   2302 N N   . GLU B 1 70  ? -7.155  42.971 51.254 1.00 11.85 ? 70  GLU B N   1 
ATOM   2303 C CA  . GLU B 1 70  ? -6.280  43.377 50.128 1.00 11.85 ? 70  GLU B CA  1 
ATOM   2304 C C   . GLU B 1 70  ? -6.902  44.440 49.224 1.00 11.85 ? 70  GLU B C   1 
ATOM   2305 O O   . GLU B 1 70  ? -8.084  44.261 48.833 1.00 11.85 ? 70  GLU B O   1 
ATOM   2306 C CB  . GLU B 1 70  ? -5.951  42.200 49.180 1.00 11.85 ? 70  GLU B CB  1 
ATOM   2307 C CG  . GLU B 1 70  ? -5.244  41.029 49.854 1.00 42.91 ? 70  GLU B CG  1 
ATOM   2308 C CD  . GLU B 1 70  ? -4.745  40.078 48.757 1.00 42.91 ? 70  GLU B CD  1 
ATOM   2309 O OE1 . GLU B 1 70  ? -5.301  38.973 48.604 1.00 42.91 ? 70  GLU B OE1 1 
ATOM   2310 O OE2 . GLU B 1 70  ? -3.975  40.499 47.860 1.00 42.91 ? 70  GLU B OE2 1 
ATOM   2311 N N   . PHE B 1 71  ? -6.032  45.242 48.581 1.00 14.24 ? 71  PHE B N   1 
ATOM   2312 C CA  . PHE B 1 71  ? -6.375  46.060 47.408 1.00 14.24 ? 71  PHE B CA  1 
ATOM   2313 C C   . PHE B 1 71  ? -5.409  45.666 46.288 1.00 14.24 ? 71  PHE B C   1 
ATOM   2314 O O   . PHE B 1 71  ? -5.827  45.316 45.151 1.00 14.24 ? 71  PHE B O   1 
ATOM   2315 C CB  . PHE B 1 71  ? -6.245  47.573 47.809 1.00 14.24 ? 71  PHE B CB  1 
ATOM   2316 C CG  . PHE B 1 71  ? -6.291  48.573 46.627 1.00 11.66 ? 71  PHE B CG  1 
ATOM   2317 C CD1 . PHE B 1 71  ? -7.426  48.729 45.878 1.00 11.66 ? 71  PHE B CD1 1 
ATOM   2318 C CD2 . PHE B 1 71  ? -5.159  49.276 46.264 1.00 11.66 ? 71  PHE B CD2 1 
ATOM   2319 C CE1 . PHE B 1 71  ? -7.484  49.614 44.790 1.00 11.66 ? 71  PHE B CE1 1 
ATOM   2320 C CE2 . PHE B 1 71  ? -5.203  50.153 45.172 1.00 11.66 ? 71  PHE B CE2 1 
ATOM   2321 C CZ  . PHE B 1 71  ? -6.362  50.337 44.443 1.00 11.66 ? 71  PHE B CZ  1 
ATOM   2322 N N   . ASP B 1 72  ? -4.098  45.769 46.599 1.00 16.03 ? 72  ASP B N   1 
ATOM   2323 C CA  . ASP B 1 72  ? -3.038  45.527 45.609 1.00 16.03 ? 72  ASP B CA  1 
ATOM   2324 C C   . ASP B 1 72  ? -2.323  44.219 45.944 1.00 16.03 ? 72  ASP B C   1 
ATOM   2325 O O   . ASP B 1 72  ? -1.604  44.195 46.982 1.00 16.03 ? 72  ASP B O   1 
ATOM   2326 C CB  . ASP B 1 72  ? -2.019  46.734 45.644 1.00 16.03 ? 72  ASP B CB  1 
ATOM   2327 C CG  . ASP B 1 72  ? -0.962  46.699 44.524 1.00 27.87 ? 72  ASP B CG  1 
ATOM   2328 O OD1 . ASP B 1 72  ? -0.741  45.669 43.819 1.00 27.87 ? 72  ASP B OD1 1 
ATOM   2329 O OD2 . ASP B 1 72  ? -0.597  47.808 44.054 1.00 27.87 ? 72  ASP B OD2 1 
ATOM   2330 N N   . GLN B 1 73  ? -2.478  43.195 45.142 1.00 28.53 ? 73  GLN B N   1 
ATOM   2331 C CA  . GLN B 1 73  ? -1.685  41.962 45.347 1.00 28.53 ? 73  GLN B CA  1 
ATOM   2332 C C   . GLN B 1 73  ? -0.146  42.138 45.378 1.00 28.53 ? 73  GLN B C   1 
ATOM   2333 O O   . GLN B 1 73  ? 0.594   41.497 46.176 1.00 28.53 ? 73  GLN B O   1 
ATOM   2334 C CB  . GLN B 1 73  ? -1.948  41.096 44.134 1.00 28.53 ? 73  GLN B CB  1 
ATOM   2335 C CG  . GLN B 1 73  ? -2.512  39.716 44.470 1.00 28.10 ? 73  GLN B CG  1 
ATOM   2336 C CD  . GLN B 1 73  ? -4.016  39.871 44.445 1.00 28.10 ? 73  GLN B CD  1 
ATOM   2337 O OE1 . GLN B 1 73  ? -4.391  41.018 44.769 1.00 28.10 ? 73  GLN B OE1 1 
ATOM   2338 N NE2 . GLN B 1 73  ? -4.615  39.164 43.537 1.00 28.10 ? 73  GLN B NE2 1 
ATOM   2339 N N   . GLY B 1 74  ? 0.301   43.082 44.615 1.00 31.97 ? 74  GLY B N   1 
ATOM   2340 C CA  . GLY B 1 74  ? 1.707   43.448 44.540 1.00 31.97 ? 74  GLY B CA  1 
ATOM   2341 C C   . GLY B 1 74  ? 2.195   44.262 45.724 1.00 31.97 ? 74  GLY B C   1 
ATOM   2342 O O   . GLY B 1 74  ? 3.373   44.700 45.691 1.00 31.97 ? 74  GLY B O   1 
ATOM   2343 N N   . SER B 1 75  ? 1.322   44.512 46.696 1.00 28.73 ? 75  SER B N   1 
ATOM   2344 C CA  . SER B 1 75  ? 1.694   45.370 47.852 1.00 28.73 ? 75  SER B CA  1 
ATOM   2345 C C   . SER B 1 75  ? 2.118   44.624 49.116 1.00 0.00  ? 75  SER B C   1 
ATOM   2346 O O   . SER B 1 75  ? 1.868   43.397 49.179 1.00 28.73 ? 75  SER B O   1 
ATOM   2347 C CB  . SER B 1 75  ? 0.638   46.440 48.163 1.00 28.73 ? 75  SER B CB  1 
ATOM   2348 O OG  . SER B 1 75  ? 1.074   47.339 49.195 1.00 37.17 ? 75  SER B OG  1 
ATOM   2349 N N   . SER B 1 76  ? 2.887   45.298 49.982 1.00 0.00  ? 76  SER B N   1 
ATOM   2350 C CA  . SER B 1 76  ? 3.565   44.750 51.187 1.00 40.04 ? 76  SER B CA  1 
ATOM   2351 C C   . SER B 1 76  ? 3.215   45.439 52.508 1.00 40.04 ? 76  SER B C   1 
ATOM   2352 O O   . SER B 1 76  ? 3.096   44.737 53.536 1.00 40.04 ? 76  SER B O   1 
ATOM   2353 C CB  . SER B 1 76  ? 5.089   44.767 50.986 1.00 0.00  ? 76  SER B CB  1 
ATOM   2354 O OG  . SER B 1 76  ? 5.422   44.031 49.800 1.00 0.00  ? 76  SER B OG  1 
ATOM   2355 N N   . SER B 1 77  ? 2.850   46.704 52.426 1.00 41.79 ? 77  SER B N   1 
ATOM   2356 C CA  . SER B 1 77  ? 2.248   47.535 53.492 1.00 41.79 ? 77  SER B CA  1 
ATOM   2357 C C   . SER B 1 77  ? 0.978   46.985 54.100 1.00 41.79 ? 77  SER B C   1 
ATOM   2358 O O   . SER B 1 77  ? 0.709   47.268 55.297 1.00 0.00  ? 77  SER B O   1 
ATOM   2359 C CB  . SER B 1 77  ? 1.762   48.881 52.921 1.00 41.79 ? 77  SER B CB  1 
ATOM   2360 O OG  . SER B 1 77  ? 2.882   49.737 52.738 1.00 46.35 ? 77  SER B OG  1 
ATOM   2361 N N   . GLU B 1 78  ? 0.121   46.660 53.156 1.00 26.54 ? 78  GLU B N   1 
ATOM   2362 C CA  . GLU B 1 78  ? -1.279  46.375 53.419 1.00 26.54 ? 78  GLU B CA  1 
ATOM   2363 C C   . GLU B 1 78  ? -1.401  45.472 54.626 1.00 26.54 ? 78  GLU B C   1 
ATOM   2364 O O   . GLU B 1 78  ? -0.747  44.394 54.689 1.00 26.54 ? 78  GLU B O   1 
ATOM   2365 C CB  . GLU B 1 78  ? -2.048  45.815 52.191 1.00 26.54 ? 78  GLU B CB  1 
ATOM   2366 C CG  . GLU B 1 78  ? -1.813  46.670 50.914 1.00 31.30 ? 78  GLU B CG  1 
ATOM   2367 C CD  . GLU B 1 78  ? -2.822  46.343 49.802 1.00 31.30 ? 78  GLU B CD  1 
ATOM   2368 O OE1 . GLU B 1 78  ? -3.000  47.149 48.855 1.00 31.30 ? 78  GLU B OE1 1 
ATOM   2369 O OE2 . GLU B 1 78  ? -3.604  45.373 49.900 1.00 31.30 ? 78  GLU B OE2 1 
ATOM   2370 N N   . LYS B 1 79  ? -2.200  45.905 55.546 1.00 25.60 ? 79  LYS B N   1 
ATOM   2371 C CA  . LYS B 1 79  ? -2.472  45.108 56.708 1.00 25.60 ? 79  LYS B CA  1 
ATOM   2372 C C   . LYS B 1 79  ? -3.641  44.181 56.383 1.00 25.60 ? 79  LYS B C   1 
ATOM   2373 O O   . LYS B 1 79  ? -4.844  44.539 56.387 1.00 25.60 ? 79  LYS B O   1 
ATOM   2374 C CB  . LYS B 1 79  ? -2.667  46.011 57.958 1.00 25.60 ? 79  LYS B CB  1 
ATOM   2375 C CG  . LYS B 1 79  ? -2.999  45.176 59.210 1.00 0.00  ? 79  LYS B CG  1 
ATOM   2376 C CD  . LYS B 1 79  ? -3.609  46.031 60.337 1.00 0.00  ? 79  LYS B CD  1 
ATOM   2377 C CE  . LYS B 1 79  ? -2.686  47.184 60.770 1.00 0.00  ? 79  LYS B CE  1 
ATOM   2378 N NZ  . LYS B 1 79  ? -3.333  47.969 61.830 1.00 0.00  ? 79  LYS B NZ  1 
ATOM   2379 N N   . ILE B 1 80  ? -3.297  43.020 55.909 1.00 19.71 ? 80  ILE B N   1 
ATOM   2380 C CA  . ILE B 1 80  ? -4.349  42.077 55.510 1.00 19.71 ? 80  ILE B CA  1 
ATOM   2381 C C   . ILE B 1 80  ? -4.608  40.977 56.530 1.00 19.71 ? 80  ILE B C   1 
ATOM   2382 O O   . ILE B 1 80  ? -4.071  40.992 57.665 1.00 19.71 ? 80  ILE B O   1 
ATOM   2383 C CB  . ILE B 1 80  ? -3.987  41.484 54.143 1.00 19.71 ? 80  ILE B CB  1 
ATOM   2384 C CG1 . ILE B 1 80  ? -2.722  40.638 54.316 1.00 14.91 ? 80  ILE B CG1 1 
ATOM   2385 C CG2 . ILE B 1 80  ? -3.849  42.612 53.099 1.00 14.91 ? 80  ILE B CG2 1 
ATOM   2386 C CD1 . ILE B 1 80  ? -2.372  39.922 53.007 1.00 14.91 ? 80  ILE B CD1 1 
ATOM   2387 N N   . GLN B 1 81  ? -5.546  40.121 56.281 1.00 19.11 ? 81  GLN B N   1 
ATOM   2388 C CA  . GLN B 1 81  ? -5.798  39.010 57.183 1.00 19.11 ? 81  GLN B CA  1 
ATOM   2389 C C   . GLN B 1 81  ? -5.759  37.701 56.417 1.00 19.11 ? 81  GLN B C   1 
ATOM   2390 O O   . GLN B 1 81  ? -6.464  37.571 55.401 1.00 19.11 ? 81  GLN B O   1 
ATOM   2391 C CB  . GLN B 1 81  ? -7.178  39.156 57.815 1.00 19.11 ? 81  GLN B CB  1 
ATOM   2392 C CG  . GLN B 1 81  ? -7.246  40.376 58.722 1.00 26.65 ? 81  GLN B CG  1 
ATOM   2393 C CD  . GLN B 1 81  ? -8.566  40.430 59.516 1.00 26.65 ? 81  GLN B CD  1 
ATOM   2394 O OE1 . GLN B 1 81  ? -9.078  39.386 59.989 1.00 26.65 ? 81  GLN B OE1 1 
ATOM   2395 N NE2 . GLN B 1 81  ? -9.210  41.599 59.423 1.00 26.65 ? 81  GLN B NE2 1 
ATOM   2396 N N   . LYS B 1 82  ? -5.000  36.755 56.891 1.00 15.22 ? 82  LYS B N   1 
ATOM   2397 C CA  . LYS B 1 82  ? -4.868  35.447 56.257 1.00 15.22 ? 82  LYS B CA  1 
ATOM   2398 C C   . LYS B 1 82  ? -5.524  34.327 57.036 1.00 15.22 ? 82  LYS B C   1 
ATOM   2399 O O   . LYS B 1 82  ? -5.145  34.117 58.196 1.00 15.22 ? 82  LYS B O   1 
ATOM   2400 C CB  . LYS B 1 82  ? -3.392  35.109 56.150 1.00 15.22 ? 82  LYS B CB  1 
ATOM   2401 C CG  . LYS B 1 82  ? -2.693  35.723 54.922 1.00 42.39 ? 82  LYS B CG  1 
ATOM   2402 C CD  . LYS B 1 82  ? -1.293  35.096 54.828 1.00 42.39 ? 82  LYS B CD  1 
ATOM   2403 C CE  . LYS B 1 82  ? -0.427  35.673 53.686 1.00 42.39 ? 82  LYS B CE  1 
ATOM   2404 N NZ  . LYS B 1 82  ? -0.845  35.142 52.380 1.00 42.39 ? 82  LYS B NZ  1 
ATOM   2405 N N   . LEU B 1 83  ? -6.634  33.838 56.570 1.00 16.20 ? 83  LEU B N   1 
ATOM   2406 C CA  . LEU B 1 83  ? -7.462  32.948 57.349 1.00 16.20 ? 83  LEU B CA  1 
ATOM   2407 C C   . LEU B 1 83  ? -7.455  31.519 56.820 1.00 16.20 ? 83  LEU B C   1 
ATOM   2408 O O   . LEU B 1 83  ? -7.864  31.276 55.658 1.00 16.20 ? 83  LEU B O   1 
ATOM   2409 C CB  . LEU B 1 83  ? -8.917  33.448 57.288 1.00 16.20 ? 83  LEU B CB  1 
ATOM   2410 C CG  . LEU B 1 83  ? -8.947  34.944 57.605 1.00 16.29 ? 83  LEU B CG  1 
ATOM   2411 C CD1 . LEU B 1 83  ? -10.082 35.638 56.868 1.00 16.29 ? 83  LEU B CD1 1 
ATOM   2412 C CD2 . LEU B 1 83  ? -8.951  35.189 59.129 1.00 16.29 ? 83  LEU B CD2 1 
ATOM   2413 N N   . LYS B 1 84  ? -7.253  30.611 57.743 1.00 16.25 ? 84  LYS B N   1 
ATOM   2414 C CA  . LYS B 1 84  ? -7.399  29.176 57.532 1.00 16.25 ? 84  LYS B CA  1 
ATOM   2415 C C   . LYS B 1 84  ? -8.829  28.692 57.489 1.00 16.25 ? 84  LYS B C   1 
ATOM   2416 O O   . LYS B 1 84  ? -9.686  29.274 58.197 1.00 16.25 ? 84  LYS B O   1 
ATOM   2417 C CB  . LYS B 1 84  ? -6.621  28.407 58.608 1.00 16.25 ? 84  LYS B CB  1 
ATOM   2418 C CG  . LYS B 1 84  ? -5.126  28.758 58.484 1.00 57.07 ? 84  LYS B CG  1 
ATOM   2419 C CD  . LYS B 1 84  ? -4.226  27.671 59.106 1.00 57.07 ? 84  LYS B CD  1 
ATOM   2420 C CE  . LYS B 1 84  ? -4.675  27.286 60.536 1.00 57.07 ? 84  LYS B CE  1 
ATOM   2421 N NZ  . LYS B 1 84  ? -3.571  26.602 61.217 1.00 57.07 ? 84  LYS B NZ  1 
ATOM   2422 N N   . ILE B 1 85  ? -9.040  27.686 56.686 1.00 17.49 ? 85  ILE B N   1 
ATOM   2423 C CA  . ILE B 1 85  ? -10.376 27.114 56.416 1.00 17.49 ? 85  ILE B CA  1 
ATOM   2424 C C   . ILE B 1 85  ? -10.606 25.819 57.203 1.00 17.49 ? 85  ILE B C   1 
ATOM   2425 O O   . ILE B 1 85  ? -9.705  24.951 57.241 1.00 17.49 ? 85  ILE B O   1 
ATOM   2426 C CB  . ILE B 1 85  ? -10.509 26.835 54.898 1.00 17.49 ? 85  ILE B CB  1 
ATOM   2427 C CG1 . ILE B 1 85  ? -10.343 28.079 54.014 1.00 19.01 ? 85  ILE B CG1 1 
ATOM   2428 C CG2 . ILE B 1 85  ? -11.805 26.113 54.532 1.00 19.01 ? 85  ILE B CG2 1 
ATOM   2429 C CD1 . ILE B 1 85  ? -9.938  27.700 52.559 1.00 19.01 ? 85  ILE B CD1 1 
ATOM   2430 N N   . ALA B 1 86  ? -11.619 25.751 58.001 1.00 22.57 ? 86  ALA B N   1 
ATOM   2431 C CA  . ALA B 1 86  ? -11.850 24.573 58.814 1.00 22.57 ? 86  ALA B CA  1 
ATOM   2432 C C   . ALA B 1 86  ? -12.513 23.515 57.957 1.00 22.57 ? 86  ALA B C   1 
ATOM   2433 O O   . ALA B 1 86  ? -12.150 22.314 58.049 1.00 22.57 ? 86  ALA B O   1 
ATOM   2434 C CB  . ALA B 1 86  ? -12.819 24.908 59.944 1.00 22.57 ? 86  ALA B CB  1 
ATOM   2435 N N   . LYS B 1 87  ? -13.519 23.923 57.227 1.00 19.23 ? 87  LYS B N   1 
ATOM   2436 C CA  . LYS B 1 87  ? -14.383 22.980 56.524 1.00 19.23 ? 87  LYS B CA  1 
ATOM   2437 C C   . LYS B 1 87  ? -14.997 23.598 55.253 1.00 19.23 ? 87  LYS B C   1 
ATOM   2438 O O   . LYS B 1 87  ? -15.403 24.767 55.335 1.00 19.23 ? 87  LYS B O   1 
ATOM   2439 C CB  . LYS B 1 87  ? -15.553 22.669 57.490 1.00 19.23 ? 87  LYS B CB  1 
ATOM   2440 C CG  . LYS B 1 87  ? -15.416 21.280 58.126 1.00 52.26 ? 87  LYS B CG  1 
ATOM   2441 C CD  . LYS B 1 87  ? -16.699 20.464 57.876 1.00 52.26 ? 87  LYS B CD  1 
ATOM   2442 C CE  . LYS B 1 87  ? -16.540 18.946 58.068 1.00 52.26 ? 87  LYS B CE  1 
ATOM   2443 N NZ  . LYS B 1 87  ? -17.622 18.262 57.330 1.00 52.26 ? 87  LYS B NZ  1 
ATOM   2444 N N   . VAL B 1 88  ? -14.993 22.861 54.143 1.00 25.82 ? 88  VAL B N   1 
ATOM   2445 C CA  . VAL B 1 88  ? -15.517 23.183 52.801 1.00 25.82 ? 88  VAL B CA  1 
ATOM   2446 C C   . VAL B 1 88  ? -16.789 22.383 52.521 1.00 25.82 ? 88  VAL B C   1 
ATOM   2447 O O   . VAL B 1 88  ? -16.798 21.119 52.578 1.00 25.82 ? 88  VAL B O   1 
ATOM   2448 C CB  . VAL B 1 88  ? -14.477 22.876 51.678 1.00 25.82 ? 88  VAL B CB  1 
ATOM   2449 C CG1 . VAL B 1 88  ? -14.885 23.361 50.298 1.00 15.52 ? 88  VAL B CG1 1 
ATOM   2450 C CG2 . VAL B 1 88  ? -13.044 23.327 51.941 1.00 15.52 ? 88  VAL B CG2 1 
ATOM   2451 N N   . PHE B 1 89  ? -17.848 23.120 52.325 1.00 17.11 ? 89  PHE B N   1 
ATOM   2452 C CA  . PHE B 1 89  ? -19.167 22.579 51.956 1.00 17.11 ? 89  PHE B CA  1 
ATOM   2453 C C   . PHE B 1 89  ? -19.507 22.900 50.494 1.00 17.11 ? 89  PHE B C   1 
ATOM   2454 O O   . PHE B 1 89  ? -19.927 24.026 50.153 1.00 17.11 ? 89  PHE B O   1 
ATOM   2455 C CB  . PHE B 1 89  ? -20.262 23.142 52.888 1.00 17.11 ? 89  PHE B CB  1 
ATOM   2456 C CG  . PHE B 1 89  ? -19.966 22.848 54.375 1.00 20.81 ? 89  PHE B CG  1 
ATOM   2457 C CD1 . PHE B 1 89  ? -19.142 23.683 55.089 1.00 20.81 ? 89  PHE B CD1 1 
ATOM   2458 C CD2 . PHE B 1 89  ? -20.490 21.728 54.982 1.00 20.81 ? 89  PHE B CD2 1 
ATOM   2459 C CE1 . PHE B 1 89  ? -18.834 23.430 56.406 1.00 20.81 ? 89  PHE B CE1 1 
ATOM   2460 C CE2 . PHE B 1 89  ? -20.169 21.448 56.311 1.00 20.81 ? 89  PHE B CE2 1 
ATOM   2461 C CZ  . PHE B 1 89  ? -19.343 22.303 57.027 1.00 20.81 ? 89  PHE B CZ  1 
ATOM   2462 N N   . LYS B 1 90  ? -19.353 21.897 49.628 1.00 23.85 ? 90  LYS B N   1 
ATOM   2463 C CA  . LYS B 1 90  ? -19.777 21.977 48.233 1.00 23.85 ? 90  LYS B CA  1 
ATOM   2464 C C   . LYS B 1 90  ? -21.229 21.588 48.081 1.00 23.85 ? 90  LYS B C   1 
ATOM   2465 O O   . LYS B 1 90  ? -21.583 20.586 48.738 1.00 23.85 ? 90  LYS B O   1 
ATOM   2466 C CB  . LYS B 1 90  ? -18.941 21.041 47.338 1.00 23.85 ? 90  LYS B CB  1 
ATOM   2467 C CG  . LYS B 1 90  ? -19.374 21.173 45.870 1.00 44.92 ? 90  LYS B CG  1 
ATOM   2468 C CD  . LYS B 1 90  ? -18.620 20.232 44.935 1.00 44.92 ? 90  LYS B CD  1 
ATOM   2469 C CE  . LYS B 1 90  ? -18.847 18.762 45.332 1.00 44.92 ? 90  LYS B CE  1 
ATOM   2470 N NZ  . LYS B 1 90  ? -18.509 17.869 44.201 1.00 44.92 ? 90  LYS B NZ  1 
ATOM   2471 N N   . ASN B 1 91  ? -22.033 22.368 47.336 1.00 17.17 ? 91  ASN B N   1 
ATOM   2472 C CA  . ASN B 1 91  ? -23.439 22.062 47.041 1.00 17.17 ? 91  ASN B CA  1 
ATOM   2473 C C   . ASN B 1 91  ? -23.497 20.723 46.317 1.00 17.17 ? 91  ASN B C   1 
ATOM   2474 O O   . ASN B 1 91  ? -22.949 20.635 45.182 1.00 17.17 ? 91  ASN B O   1 
ATOM   2475 C CB  . ASN B 1 91  ? -24.088 23.093 46.112 1.00 17.17 ? 91  ASN B CB  1 
ATOM   2476 C CG  . ASN B 1 91  ? -25.602 22.888 46.108 1.00 18.85 ? 91  ASN B CG  1 
ATOM   2477 O OD1 . ASN B 1 91  ? -26.118 21.892 45.569 1.00 18.85 ? 91  ASN B OD1 1 
ATOM   2478 N ND2 . ASN B 1 91  ? -26.318 23.969 46.168 1.00 18.85 ? 91  ASN B ND2 1 
ATOM   2479 N N   . SER B 1 92  ? -24.188 19.776 46.965 1.00 26.89 ? 92  SER B N   1 
ATOM   2480 C CA  . SER B 1 92  ? -24.454 18.412 46.454 1.00 26.89 ? 92  SER B CA  1 
ATOM   2481 C C   . SER B 1 92  ? -25.130 18.347 45.076 1.00 26.89 ? 92  SER B C   1 
ATOM   2482 O O   . SER B 1 92  ? -24.918 17.390 44.318 1.00 26.89 ? 92  SER B O   1 
ATOM   2483 C CB  . SER B 1 92  ? -25.350 17.619 47.434 1.00 26.89 ? 92  SER B CB  1 
ATOM   2484 O OG  . SER B 1 92  ? -26.707 18.173 47.385 1.00 41.81 ? 92  SER B OG  1 
ATOM   2485 N N   . LYS B 1 93  ? -25.839 19.335 44.625 1.00 16.06 ? 93  LYS B N   1 
ATOM   2486 C CA  . LYS B 1 93  ? -26.368 19.312 43.258 1.00 16.06 ? 93  LYS B CA  1 
ATOM   2487 C C   . LYS B 1 93  ? -25.470 19.979 42.186 1.00 16.06 ? 93  LYS B C   1 
ATOM   2488 O O   . LYS B 1 93  ? -25.899 20.095 40.988 1.00 16.06 ? 93  LYS B O   1 
ATOM   2489 C CB  . LYS B 1 93  ? -27.743 20.014 43.305 1.00 16.06 ? 93  LYS B CB  1 
ATOM   2490 C CG  . LYS B 1 93  ? -28.710 19.266 44.229 1.00 48.17 ? 93  LYS B CG  1 
ATOM   2491 C CD  . LYS B 1 93  ? -29.921 20.128 44.609 1.00 48.17 ? 93  LYS B CD  1 
ATOM   2492 C CE  . LYS B 1 93  ? -29.945 20.426 46.130 1.00 48.17 ? 93  LYS B CE  1 
ATOM   2493 N NZ  . LYS B 1 93  ? -31.059 21.326 46.452 1.00 0.00  ? 93  LYS B NZ  1 
ATOM   2494 N N   . TYR B 1 94  ? -24.216 20.285 42.574 1.00 17.71 ? 94  TYR B N   1 
ATOM   2495 C CA  . TYR B 1 94  ? -23.178 20.707 41.660 1.00 0.00  ? 94  TYR B CA  1 
ATOM   2496 C C   . TYR B 1 94  ? -22.857 19.621 40.656 1.00 17.71 ? 94  TYR B C   1 
ATOM   2497 O O   . TYR B 1 94  ? -22.326 18.528 40.979 1.00 0.00  ? 94  TYR B O   1 
ATOM   2498 C CB  . TYR B 1 94  ? -21.887 21.070 42.389 1.00 17.71 ? 94  TYR B CB  1 
ATOM   2499 C CG  . TYR B 1 94  ? -20.790 21.600 41.422 1.00 14.34 ? 94  TYR B CG  1 
ATOM   2500 C CD1 . TYR B 1 94  ? -21.097 22.614 40.512 1.00 14.34 ? 94  TYR B CD1 1 
ATOM   2501 C CD2 . TYR B 1 94  ? -19.505 21.083 41.474 1.00 14.34 ? 94  TYR B CD2 1 
ATOM   2502 C CE1 . TYR B 1 94  ? -20.167 23.070 39.616 1.00 14.34 ? 94  TYR B CE1 1 
ATOM   2503 C CE2 . TYR B 1 94  ? -18.552 21.555 40.583 1.00 14.34 ? 94  TYR B CE2 1 
ATOM   2504 C CZ  . TYR B 1 94  ? -18.896 22.517 39.648 1.00 14.34 ? 94  TYR B CZ  1 
ATOM   2505 O OH  . TYR B 1 94  ? -17.940 22.936 38.680 1.00 14.34 ? 94  TYR B OH  1 
ATOM   2506 N N   . ASN B 1 95  ? -23.124 20.071 39.447 1.00 24.53 ? 95  ASN B N   1 
ATOM   2507 C CA  . ASN B 1 95  ? -22.761 19.455 38.167 1.00 24.53 ? 95  ASN B CA  1 
ATOM   2508 C C   . ASN B 1 95  ? -21.573 20.116 37.451 1.00 24.53 ? 95  ASN B C   1 
ATOM   2509 O O   . ASN B 1 95  ? -21.689 21.119 36.715 1.00 24.53 ? 95  ASN B O   1 
ATOM   2510 C CB  . ASN B 1 95  ? -24.020 19.321 37.246 1.00 24.53 ? 95  ASN B CB  1 
ATOM   2511 C CG  . ASN B 1 95  ? -23.804 18.193 36.205 1.00 34.59 ? 95  ASN B CG  1 
ATOM   2512 O OD1 . ASN B 1 95  ? -22.710 18.091 35.612 1.00 34.59 ? 95  ASN B OD1 1 
ATOM   2513 N ND2 . ASN B 1 95  ? -24.903 17.752 35.646 1.00 34.59 ? 95  ASN B ND2 1 
ATOM   2514 N N   . SER B 1 96  ? -20.437 19.525 37.606 1.00 18.48 ? 96  SER B N   1 
ATOM   2515 C CA  . SER B 1 96  ? -19.282 20.075 36.948 1.00 18.48 ? 96  SER B CA  1 
ATOM   2516 C C   . SER B 1 96  ? -19.364 20.008 35.429 1.00 18.48 ? 96  SER B C   1 
ATOM   2517 O O   . SER B 1 96  ? -18.519 20.602 34.715 1.00 18.48 ? 96  SER B O   1 
ATOM   2518 C CB  . SER B 1 96  ? -18.030 19.342 37.396 1.00 18.48 ? 96  SER B CB  1 
ATOM   2519 O OG  . SER B 1 96  ? -17.900 18.117 36.691 1.00 32.34 ? 96  SER B OG  1 
ATOM   2520 N N   . LEU B 1 97  ? -20.348 19.288 34.939 1.00 30.87 ? 97  LEU B N   1 
ATOM   2521 C CA  . LEU B 1 97  ? -20.464 19.245 33.495 1.00 30.87 ? 97  LEU B CA  1 
ATOM   2522 C C   . LEU B 1 97  ? -21.193 20.487 33.038 1.00 30.87 ? 97  LEU B C   1 
ATOM   2523 O O   . LEU B 1 97  ? -20.808 21.046 31.990 1.00 30.87 ? 97  LEU B O   1 
ATOM   2524 C CB  . LEU B 1 97  ? -21.268 18.016 33.032 1.00 30.87 ? 97  LEU B CB  1 
ATOM   2525 C CG  . LEU B 1 97  ? -20.496 17.093 32.092 1.00 40.81 ? 97  LEU B CG  1 
ATOM   2526 C CD1 . LEU B 1 97  ? -19.034 16.919 32.504 1.00 40.81 ? 97  LEU B CD1 1 
ATOM   2527 C CD2 . LEU B 1 97  ? -21.199 15.746 32.015 1.00 40.81 ? 97  LEU B CD2 1 
ATOM   2528 N N   . THR B 1 98  ? -22.283 20.804 33.738 1.00 19.07 ? 98  THR B N   1 
ATOM   2529 C CA  . THR B 1 98  ? -23.112 21.936 33.303 1.00 19.07 ? 98  THR B CA  1 
ATOM   2530 C C   . THR B 1 98  ? -22.817 23.241 34.051 1.00 19.07 ? 98  THR B C   1 
ATOM   2531 O O   . THR B 1 98  ? -23.343 24.313 33.680 1.00 19.07 ? 98  THR B O   1 
ATOM   2532 C CB  . THR B 1 98  ? -24.609 21.629 33.482 1.00 19.07 ? 98  THR B CB  1 
ATOM   2533 O OG1 . THR B 1 98  ? -24.761 21.341 34.857 1.00 30.11 ? 98  THR B OG1 1 
ATOM   2534 C CG2 . THR B 1 98  ? -25.091 20.464 32.597 1.00 30.11 ? 98  THR B CG2 1 
ATOM   2535 N N   . ILE B 1 99  ? -21.924 23.171 34.997 1.00 13.43 ? 99  ILE B N   1 
ATOM   2536 C CA  . ILE B 1 99  ? -21.578 24.256 35.950 1.00 13.43 ? 99  ILE B CA  1 
ATOM   2537 C C   . ILE B 1 99  ? -22.807 24.818 36.639 1.00 13.43 ? 99  ILE B C   1 
ATOM   2538 O O   . ILE B 1 99  ? -22.823 26.001 37.033 1.00 13.43 ? 99  ILE B O   1 
ATOM   2539 C CB  . ILE B 1 99  ? -20.723 25.413 35.370 1.00 13.43 ? 99  ILE B CB  1 
ATOM   2540 C CG1 . ILE B 1 99  ? -19.744 24.859 34.300 1.00 21.35 ? 99  ILE B CG1 1 
ATOM   2541 C CG2 . ILE B 1 99  ? -19.948 26.087 36.517 1.00 21.35 ? 99  ILE B CG2 1 
ATOM   2542 C CD1 . ILE B 1 99  ? -18.791 25.894 33.644 1.00 21.35 ? 99  ILE B CD1 1 
ATOM   2543 N N   . ASN B 1 100 ? -23.821 24.002 36.769 1.00 12.41 ? 100 ASN B N   1 
ATOM   2544 C CA  . ASN B 1 100 ? -25.026 24.489 37.465 1.00 12.41 ? 100 ASN B CA  1 
ATOM   2545 C C   . ASN B 1 100 ? -24.972 24.258 38.962 1.00 12.41 ? 100 ASN B C   1 
ATOM   2546 O O   . ASN B 1 100 ? -24.258 23.323 39.363 1.00 12.41 ? 100 ASN B O   1 
ATOM   2547 C CB  . ASN B 1 100 ? -26.209 23.753 36.895 1.00 12.41 ? 100 ASN B CB  1 
ATOM   2548 C CG  . ASN B 1 100 ? -27.444 24.495 37.365 1.00 17.67 ? 100 ASN B CG  1 
ATOM   2549 O OD1 . ASN B 1 100 ? -28.504 23.841 37.351 1.00 17.67 ? 100 ASN B OD1 1 
ATOM   2550 N ND2 . ASN B 1 100 ? -27.432 25.792 37.271 1.00 17.67 ? 100 ASN B ND2 1 
ATOM   2551 N N   . ASN B 1 101 ? -25.690 25.029 39.759 1.00 12.26 ? 101 ASN B N   1 
ATOM   2552 C CA  . ASN B 1 101 ? -25.604 24.954 41.224 1.00 12.26 ? 101 ASN B CA  1 
ATOM   2553 C C   . ASN B 1 101 ? -24.208 25.278 41.759 1.00 12.26 ? 101 ASN B C   1 
ATOM   2554 O O   . ASN B 1 101 ? -23.714 24.623 42.710 1.00 12.26 ? 101 ASN B O   1 
ATOM   2555 C CB  . ASN B 1 101 ? -26.031 23.537 41.673 1.00 12.26 ? 101 ASN B CB  1 
ATOM   2556 C CG  . ASN B 1 101 ? -27.535 23.324 41.421 1.00 30.30 ? 101 ASN B CG  1 
ATOM   2557 O OD1 . ASN B 1 101 ? -28.366 24.250 41.570 1.00 30.30 ? 101 ASN B OD1 1 
ATOM   2558 N ND2 . ASN B 1 101 ? -27.805 22.254 40.698 1.00 30.30 ? 101 ASN B ND2 1 
ATOM   2559 N N   . ASP B 1 102 ? -23.580 26.275 41.180 1.00 15.04 ? 102 ASP B N   1 
ATOM   2560 C CA  . ASP B 1 102 ? -22.156 26.530 41.382 1.00 15.04 ? 102 ASP B CA  1 
ATOM   2561 C C   . ASP B 1 102 ? -21.801 27.328 42.640 1.00 15.04 ? 102 ASP B C   1 
ATOM   2562 O O   . ASP B 1 102 ? -21.524 28.551 42.566 1.00 15.04 ? 102 ASP B O   1 
ATOM   2563 C CB  . ASP B 1 102 ? -21.638 27.178 40.088 1.00 15.04 ? 102 ASP B CB  1 
ATOM   2564 C CG  . ASP B 1 102 ? -20.101 27.202 40.006 1.00 11.99 ? 102 ASP B CG  1 
ATOM   2565 O OD1 . ASP B 1 102 ? -19.501 28.113 39.356 1.00 11.99 ? 102 ASP B OD1 1 
ATOM   2566 O OD2 . ASP B 1 102 ? -19.447 26.592 40.885 1.00 11.99 ? 102 ASP B OD2 1 
ATOM   2567 N N   . ILE B 1 103 ? -21.939 26.685 43.774 1.00 18.17 ? 103 ILE B N   1 
ATOM   2568 C CA  . ILE B 1 103 ? -21.723 27.278 45.077 1.00 18.17 ? 103 ILE B CA  1 
ATOM   2569 C C   . ILE B 1 103 ? -21.087 26.342 46.113 1.00 18.17 ? 103 ILE B C   1 
ATOM   2570 O O   . ILE B 1 103 ? -21.560 25.195 46.255 1.00 18.17 ? 103 ILE B O   1 
ATOM   2571 C CB  . ILE B 1 103 ? -23.021 27.952 45.616 1.00 18.17 ? 103 ILE B CB  1 
ATOM   2572 C CG1 . ILE B 1 103 ? -22.767 28.890 46.837 1.00 11.61 ? 103 ILE B CG1 1 
ATOM   2573 C CG2 . ILE B 1 103 ? -24.146 26.941 45.906 1.00 11.61 ? 103 ILE B CG2 1 
ATOM   2574 C CD1 . ILE B 1 103 ? -24.103 29.401 47.394 1.00 11.61 ? 103 ILE B CD1 1 
ATOM   2575 N N   . THR B 1 104 ? -20.078 26.874 46.808 1.00 13.14 ? 104 THR B N   1 
ATOM   2576 C CA  . THR B 1 104 ? -19.394 26.374 47.990 1.00 13.14 ? 104 THR B CA  1 
ATOM   2577 C C   . THR B 1 104 ? -19.411 27.352 49.159 1.00 13.14 ? 104 THR B C   1 
ATOM   2578 O O   . THR B 1 104 ? -19.275 28.586 48.970 1.00 13.14 ? 104 THR B O   1 
ATOM   2579 C CB  . THR B 1 104 ? -17.966 26.009 47.591 1.00 13.14 ? 104 THR B CB  1 
ATOM   2580 O OG1 . THR B 1 104 ? -18.125 24.870 46.746 1.00 10.84 ? 104 THR B OG1 1 
ATOM   2581 C CG2 . THR B 1 104 ? -17.064 25.613 48.771 1.00 10.84 ? 104 THR B CG2 1 
ATOM   2582 N N   . LEU B 1 105 ? -19.544 26.820 50.365 1.00 14.00 ? 105 LEU B N   1 
ATOM   2583 C CA  . LEU B 1 105 ? -19.381 27.586 51.616 1.00 14.00 ? 105 LEU B CA  1 
ATOM   2584 C C   . LEU B 1 105 ? -18.090 27.200 52.299 1.00 14.00 ? 105 LEU B C   1 
ATOM   2585 O O   . LEU B 1 105 ? -17.790 25.985 52.461 1.00 14.00 ? 105 LEU B O   1 
ATOM   2586 C CB  . LEU B 1 105 ? -20.580 27.310 52.580 1.00 14.00 ? 105 LEU B CB  1 
ATOM   2587 C CG  . LEU B 1 105 ? -21.778 28.202 52.160 1.00 16.39 ? 105 LEU B CG  1 
ATOM   2588 C CD1 . LEU B 1 105 ? -23.087 27.742 52.867 1.00 16.39 ? 105 LEU B CD1 1 
ATOM   2589 C CD2 . LEU B 1 105 ? -21.378 29.689 52.369 1.00 16.39 ? 105 LEU B CD2 1 
ATOM   2590 N N   . LEU B 1 106 ? -17.450 28.152 52.857 1.00 15.73 ? 106 LEU B N   1 
ATOM   2591 C CA  . LEU B 1 106 ? -16.265 27.830 53.629 1.00 15.73 ? 106 LEU B CA  1 
ATOM   2592 C C   . LEU B 1 106 ? -16.452 28.338 55.041 1.00 15.73 ? 106 LEU B C   1 
ATOM   2593 O O   . LEU B 1 106 ? -16.648 29.553 55.197 1.00 15.73 ? 106 LEU B O   1 
ATOM   2594 C CB  . LEU B 1 106 ? -14.967 28.520 53.116 1.00 15.73 ? 106 LEU B CB  1 
ATOM   2595 C CG  . LEU B 1 106 ? -14.701 28.361 51.610 1.00 7.43  ? 106 LEU B CG  1 
ATOM   2596 C CD1 . LEU B 1 106 ? -13.484 29.153 51.189 1.00 7.43  ? 106 LEU B CD1 1 
ATOM   2597 C CD2 . LEU B 1 106 ? -14.603 26.837 51.257 1.00 7.43  ? 106 LEU B CD2 1 
ATOM   2598 N N   . LYS B 1 107 ? -16.232 27.488 56.033 1.00 15.55 ? 107 LYS B N   1 
ATOM   2599 C CA  . LYS B 1 107 ? -16.213 27.867 57.444 1.00 15.55 ? 107 LYS B CA  1 
ATOM   2600 C C   . LYS B 1 107 ? -14.761 27.985 57.849 1.00 15.55 ? 107 LYS B C   1 
ATOM   2601 O O   . LYS B 1 107 ? -13.964 27.117 57.498 1.00 15.55 ? 107 LYS B O   1 
ATOM   2602 C CB  . LYS B 1 107 ? -16.985 26.800 58.284 1.00 15.55 ? 107 LYS B CB  1 
ATOM   2603 C CG  . LYS B 1 107 ? -16.600 26.829 59.767 1.00 28.96 ? 107 LYS B CG  1 
ATOM   2604 C CD  . LYS B 1 107 ? -17.677 27.414 60.660 1.00 28.96 ? 107 LYS B CD  1 
ATOM   2605 C CE  . LYS B 1 107 ? -18.564 26.289 61.207 1.00 28.96 ? 107 LYS B CE  1 
ATOM   2606 N NZ  . LYS B 1 107 ? -19.580 26.855 62.148 1.00 28.96 ? 107 LYS B NZ  1 
ATOM   2607 N N   . LEU B 1 108 ? -14.402 29.072 58.407 1.00 13.92 ? 108 LEU B N   1 
ATOM   2608 C CA  . LEU B 1 108 ? -13.045 29.437 58.646 1.00 13.92 ? 108 LEU B CA  1 
ATOM   2609 C C   . LEU B 1 108 ? -12.530 28.752 59.895 1.00 13.92 ? 108 LEU B C   1 
ATOM   2610 O O   . LEU B 1 108 ? -13.191 28.613 60.934 1.00 13.92 ? 108 LEU B O   1 
ATOM   2611 C CB  . LEU B 1 108 ? -12.924 30.982 58.790 1.00 13.92 ? 108 LEU B CB  1 
ATOM   2612 C CG  . LEU B 1 108 ? -13.348 31.790 57.543 1.00 12.09 ? 108 LEU B CG  1 
ATOM   2613 C CD1 . LEU B 1 108 ? -13.084 33.332 57.706 1.00 12.09 ? 108 LEU B CD1 1 
ATOM   2614 C CD2 . LEU B 1 108 ? -12.802 31.224 56.224 1.00 12.09 ? 108 LEU B CD2 1 
ATOM   2615 N N   . SER B 1 109 ? -11.327 28.469 59.947 1.00 21.67 ? 109 SER B N   1 
ATOM   2616 C CA  . SER B 1 109 ? -10.927 27.915 61.217 1.00 21.67 ? 109 SER B CA  1 
ATOM   2617 C C   . SER B 1 109 ? -10.638 29.032 62.206 1.00 21.67 ? 109 SER B C   1 
ATOM   2618 O O   . SER B 1 109 ? -10.787 28.824 63.434 1.00 21.67 ? 109 SER B O   1 
ATOM   2619 C CB  . SER B 1 109 ? -9.685  27.073 61.021 1.00 21.67 ? 109 SER B CB  1 
ATOM   2620 O OG  . SER B 1 109 ? -8.580  27.850 61.476 1.00 48.10 ? 109 SER B OG  1 
ATOM   2621 N N   . THR B 1 110 ? -10.333 30.196 61.701 1.00 44.81 ? 110 THR B N   1 
ATOM   2622 C CA  . THR B 1 110 ? -10.182 31.429 62.519 1.00 44.81 ? 110 THR B CA  1 
ATOM   2623 C C   . THR B 1 110 ? -11.073 32.570 62.050 1.00 44.81 ? 110 THR B C   1 
ATOM   2624 O O   . THR B 1 110 ? -11.022 32.942 60.856 1.00 44.81 ? 110 THR B O   1 
ATOM   2625 C CB  . THR B 1 110 ? -8.762  32.031 62.431 1.00 44.81 ? 110 THR B CB  1 
ATOM   2626 O OG1 . THR B 1 110 ? -8.864  33.460 62.702 1.00 43.68 ? 110 THR B OG1 1 
ATOM   2627 C CG2 . THR B 1 110 ? -8.061  31.755 61.080 1.00 43.68 ? 110 THR B CG2 1 
ATOM   2628 N N   . ALA B 1 111 ? -11.749 33.163 62.990 1.00 23.96 ? 111 ALA B N   1 
ATOM   2629 C CA  . ALA B 1 111 ? -12.662 34.230 62.688 1.00 23.96 ? 111 ALA B CA  1 
ATOM   2630 C C   . ALA B 1 111 ? -11.926 35.466 62.216 1.00 23.96 ? 111 ALA B C   1 
ATOM   2631 O O   . ALA B 1 111 ? -10.934 35.873 62.860 1.00 23.96 ? 111 ALA B O   1 
ATOM   2632 C CB  . ALA B 1 111 ? -13.621 34.530 63.840 1.00 23.96 ? 111 ALA B CB  1 
ATOM   2633 N N   . ALA B 1 112 ? -12.450 36.043 61.132 1.00 16.77 ? 112 ALA B N   1 
ATOM   2634 C CA  . ALA B 1 112 ? -12.143 37.365 60.608 1.00 16.77 ? 112 ALA B CA  1 
ATOM   2635 C C   . ALA B 1 112 ? -12.451 38.453 61.640 1.00 16.77 ? 112 ALA B C   1 
ATOM   2636 O O   . ALA B 1 112 ? -13.403 38.332 62.462 1.00 16.77 ? 112 ALA B O   1 
ATOM   2637 C CB  . ALA B 1 112 ? -12.938 37.603 59.299 1.00 16.77 ? 112 ALA B CB  1 
ATOM   2638 N N   . SER B 1 113 ? -11.534 39.410 61.666 1.00 20.39 ? 113 SER B N   1 
ATOM   2639 C CA  . SER B 1 113 ? -11.593 40.530 62.583 1.00 20.39 ? 113 SER B CA  1 
ATOM   2640 C C   . SER B 1 113 ? -12.051 41.762 61.820 1.00 20.39 ? 113 SER B C   1 
ATOM   2641 O O   . SER B 1 113 ? -11.262 42.301 61.025 1.00 20.39 ? 113 SER B O   1 
ATOM   2642 C CB  . SER B 1 113 ? -10.241 40.766 63.299 1.00 20.39 ? 113 SER B CB  1 
ATOM   2643 O OG  . SER B 1 113 ? -10.280 42.055 63.926 1.00 48.66 ? 113 SER B OG  1 
ATOM   2644 N N   . PHE B 1 114 ? -13.373 41.984 61.839 1.00 13.54 ? 114 PHE B N   1 
ATOM   2645 C CA  . PHE B 1 114 ? -14.079 43.036 61.083 1.00 13.54 ? 114 PHE B CA  1 
ATOM   2646 C C   . PHE B 1 114 ? -13.756 44.434 61.540 1.00 13.54 ? 114 PHE B C   1 
ATOM   2647 O O   . PHE B 1 114 ? -13.441 44.633 62.740 1.00 13.54 ? 114 PHE B O   1 
ATOM   2648 C CB  . PHE B 1 114 ? -15.620 42.918 61.229 1.00 13.54 ? 114 PHE B CB  1 
ATOM   2649 C CG  . PHE B 1 114 ? -16.260 41.861 60.314 1.00 13.33 ? 114 PHE B CG  1 
ATOM   2650 C CD1 . PHE B 1 114 ? -15.476 40.983 59.583 1.00 13.33 ? 114 PHE B CD1 1 
ATOM   2651 C CD2 . PHE B 1 114 ? -17.625 41.765 60.252 1.00 13.33 ? 114 PHE B CD2 1 
ATOM   2652 C CE1 . PHE B 1 114 ? -16.044 40.002 58.790 1.00 13.33 ? 114 PHE B CE1 1 
ATOM   2653 C CE2 . PHE B 1 114 ? -18.196 40.777 59.473 1.00 13.33 ? 114 PHE B CE2 1 
ATOM   2654 C CZ  . PHE B 1 114 ? -17.420 39.902 58.741 1.00 13.33 ? 114 PHE B CZ  1 
ATOM   2655 N N   . SER B 1 115 ? -13.481 45.258 60.610 1.00 21.38 ? 115 SER B N   1 
ATOM   2656 C CA  . SER B 1 115 ? -12.882 46.577 60.837 1.00 21.38 ? 115 SER B CA  1 
ATOM   2657 C C   . SER B 1 115 ? -13.439 47.571 59.823 1.00 21.38 ? 115 SER B C   1 
ATOM   2658 O O   . SER B 1 115 ? -14.507 47.282 59.241 1.00 21.38 ? 115 SER B O   1 
ATOM   2659 C CB  . SER B 1 115 ? -11.352 46.509 60.687 1.00 21.38 ? 115 SER B CB  1 
ATOM   2660 O OG  . SER B 1 115 ? -10.971 46.364 59.311 1.00 12.73 ? 115 SER B OG  1 
ATOM   2661 N N   . GLN B 1 116 ? -12.754 48.644 59.491 1.00 27.67 ? 116 GLN B N   1 
ATOM   2662 C CA  . GLN B 1 116 ? -13.259 49.477 58.418 1.00 27.67 ? 116 GLN B CA  1 
ATOM   2663 C C   . GLN B 1 116 ? -13.153 48.782 57.063 1.00 27.67 ? 116 GLN B C   1 
ATOM   2664 O O   . GLN B 1 116 ? -13.950 49.122 56.134 1.00 27.67 ? 116 GLN B O   1 
ATOM   2665 C CB  . GLN B 1 116 ? -12.457 50.771 58.333 1.00 27.67 ? 116 GLN B CB  1 
ATOM   2666 C CG  . GLN B 1 116 ? -13.333 51.986 58.664 1.00 53.76 ? 116 GLN B CG  1 
ATOM   2667 C CD  . GLN B 1 116 ? -12.431 53.181 58.955 1.00 53.76 ? 116 GLN B CD  1 
ATOM   2668 O OE1 . GLN B 1 116 ? -12.447 54.182 58.188 1.00 53.76 ? 116 GLN B OE1 1 
ATOM   2669 N NE2 . GLN B 1 116 ? -11.823 53.129 60.139 1.00 53.76 ? 116 GLN B NE2 1 
ATOM   2670 N N   . THR B 1 117 ? -12.129 47.980 56.937 1.00 12.20 ? 117 THR B N   1 
ATOM   2671 C CA  . THR B 1 117 ? -11.795 47.449 55.612 1.00 12.20 ? 117 THR B CA  1 
ATOM   2672 C C   . THR B 1 117 ? -12.249 46.023 55.363 1.00 12.20 ? 117 THR B C   1 
ATOM   2673 O O   . THR B 1 117 ? -12.035 45.484 54.260 1.00 12.20 ? 117 THR B O   1 
ATOM   2674 C CB  . THR B 1 117 ? -10.308 47.565 55.276 1.00 12.20 ? 117 THR B CB  1 
ATOM   2675 O OG1 . THR B 1 117 ? -9.521  47.024 56.292 1.00 27.39 ? 117 THR B OG1 1 
ATOM   2676 C CG2 . THR B 1 117 ? -9.888  49.010 54.966 1.00 27.39 ? 117 THR B CG2 1 
ATOM   2677 N N   . VAL B 1 118 ? -12.760 45.400 56.396 1.00 8.84  ? 118 VAL B N   1 
ATOM   2678 C CA  . VAL B 1 118 ? -13.288 43.991 56.340 1.00 8.84  ? 118 VAL B CA  1 
ATOM   2679 C C   . VAL B 1 118 ? -14.672 43.896 57.003 1.00 8.84  ? 118 VAL B C   1 
ATOM   2680 O O   . VAL B 1 118 ? -14.772 44.180 58.195 1.00 8.84  ? 118 VAL B O   1 
ATOM   2681 C CB  . VAL B 1 118 ? -12.357 43.001 57.028 1.00 8.84  ? 118 VAL B CB  1 
ATOM   2682 C CG1 . VAL B 1 118 ? -12.908 41.561 56.933 1.00 15.19 ? 118 VAL B CG1 1 
ATOM   2683 C CG2 . VAL B 1 118 ? -10.881 43.122 56.596 1.00 15.19 ? 118 VAL B CG2 1 
ATOM   2684 N N   . SER B 1 119 ? -15.659 43.531 56.300 1.00 8.66  ? 119 SER B N   1 
ATOM   2685 C CA  . SER B 1 119 ? -17.012 43.319 56.764 1.00 8.66  ? 119 SER B CA  1 
ATOM   2686 C C   . SER B 1 119 ? -17.817 42.473 55.774 1.00 8.66  ? 119 SER B C   1 
ATOM   2687 O O   . SER B 1 119 ? -17.247 41.883 54.824 1.00 8.66  ? 119 SER B O   1 
ATOM   2688 C CB  . SER B 1 119 ? -17.727 44.679 56.989 1.00 8.66  ? 119 SER B CB  1 
ATOM   2689 O OG  . SER B 1 119 ? -17.667 45.532 55.854 1.00 17.79 ? 119 SER B OG  1 
ATOM   2690 N N   . ALA B 1 120 ? -19.063 42.222 56.092 1.00 7.38  ? 120 ALA B N   1 
ATOM   2691 C CA  . ALA B 1 120 ? -19.920 41.272 55.344 1.00 7.38  ? 120 ALA B CA  1 
ATOM   2692 C C   . ALA B 1 120 ? -20.675 41.954 54.194 1.00 7.38  ? 120 ALA B C   1 
ATOM   2693 O O   . ALA B 1 120 ? -21.239 43.064 54.384 1.00 7.38  ? 120 ALA B O   1 
ATOM   2694 C CB  . ALA B 1 120 ? -20.945 40.634 56.334 1.00 7.38  ? 120 ALA B CB  1 
ATOM   2695 N N   . VAL B 1 121 ? -21.066 41.184 53.214 1.00 12.71 ? 121 VAL B N   1 
ATOM   2696 C CA  . VAL B 1 121 ? -22.213 41.496 52.300 1.00 12.71 ? 121 VAL B CA  1 
ATOM   2697 C C   . VAL B 1 121 ? -23.539 40.908 52.825 1.00 12.71 ? 121 VAL B C   1 
ATOM   2698 O O   . VAL B 1 121 ? -23.484 39.979 53.655 1.00 12.71 ? 121 VAL B O   1 
ATOM   2699 C CB  . VAL B 1 121 ? -21.856 40.931 50.895 1.00 12.71 ? 121 VAL B CB  1 
ATOM   2700 C CG1 . VAL B 1 121 ? -21.961 39.372 50.738 1.00 4.31  ? 121 VAL B CG1 1 
ATOM   2701 C CG2 . VAL B 1 121 ? -22.463 41.730 49.727 1.00 4.31  ? 121 VAL B CG2 1 
ATOM   2702 N N   . CYS B 1 122 ? -24.707 41.331 52.338 1.00 10.88 ? 122 CYS B N   1 
ATOM   2703 C CA  . CYS B 1 122 ? -26.042 40.751 52.688 1.00 10.88 ? 122 CYS B CA  1 
ATOM   2704 C C   . CYS B 1 122 ? -26.464 39.651 51.699 1.00 10.88 ? 122 CYS B C   1 
ATOM   2705 O O   . CYS B 1 122 ? -26.170 39.737 50.487 1.00 10.88 ? 122 CYS B O   1 
ATOM   2706 C CB  . CYS B 1 122 ? -27.147 41.835 52.694 1.00 10.88 ? 122 CYS B CB  1 
ATOM   2707 S SG  . CYS B 1 122 ? -26.929 43.235 53.841 1.00 10.62 ? 122 CYS B SG  1 
ATOM   2708 N N   . LEU B 1 123 ? -27.159 38.633 52.226 1.00 11.98 ? 123 LEU B N   1 
ATOM   2709 C CA  . LEU B 1 123 ? -27.717 37.527 51.421 1.00 11.98 ? 123 LEU B CA  1 
ATOM   2710 C C   . LEU B 1 123 ? -29.163 37.913 51.182 1.00 11.98 ? 123 LEU B C   1 
ATOM   2711 O O   . LEU B 1 123 ? -29.703 38.670 52.025 1.00 11.98 ? 123 LEU B O   1 
ATOM   2712 C CB  . LEU B 1 123 ? -27.717 36.179 52.199 1.00 11.98 ? 123 LEU B CB  1 
ATOM   2713 C CG  . LEU B 1 123 ? -26.356 35.507 52.295 1.00 10.53 ? 123 LEU B CG  1 
ATOM   2714 C CD1 . LEU B 1 123 ? -26.415 34.175 53.015 1.00 10.53 ? 123 LEU B CD1 1 
ATOM   2715 C CD2 . LEU B 1 123 ? -25.902 35.193 50.875 1.00 10.53 ? 123 LEU B CD2 1 
ATOM   2716 N N   . PRO B 1 124 ? -29.604 37.704 49.976 1.00 14.72 ? 124 PRO B N   1 
ATOM   2717 C CA  . PRO B 1 124 ? -31.008 37.958 49.531 1.00 14.72 ? 124 PRO B CA  1 
ATOM   2718 C C   . PRO B 1 124 ? -32.012 36.943 50.138 1.00 14.72 ? 124 PRO B C   1 
ATOM   2719 O O   . PRO B 1 124 ? -31.637 35.793 50.441 1.00 14.72 ? 124 PRO B O   1 
ATOM   2720 C CB  . PRO B 1 124 ? -31.033 37.683 47.995 1.00 14.72 ? 124 PRO B CB  1 
ATOM   2721 C CG  . PRO B 1 124 ? -29.757 36.869 47.703 1.00 7.76  ? 124 PRO B CG  1 
ATOM   2722 C CD  . PRO B 1 124 ? -28.839 36.970 48.940 1.00 7.76  ? 124 PRO B CD  1 
ATOM   2723 N N   . SER B 1 125 ? -33.297 37.165 49.918 1.00 17.79 ? 125 SER B N   1 
ATOM   2724 C CA  . SER B 1 125 ? -34.299 36.126 50.138 1.00 17.79 ? 125 SER B CA  1 
ATOM   2725 C C   . SER B 1 125 ? -34.557 35.376 48.871 1.00 17.79 ? 125 SER B C   1 
ATOM   2726 O O   . SER B 1 125 ? -34.459 35.990 47.789 1.00 17.79 ? 125 SER B O   1 
ATOM   2727 C CB  . SER B 1 125 ? -35.666 36.676 50.617 1.00 17.79 ? 125 SER B CB  1 
ATOM   2728 O OG  . SER B 1 125 ? -35.444 37.231 51.909 1.00 49.38 ? 125 SER B OG  1 
ATOM   2729 N N   . ALA B 1 126 ? -35.038 34.165 49.078 1.00 26.14 ? 126 ALA B N   1 
ATOM   2730 C CA  . ALA B 1 126 ? -35.489 33.263 48.014 1.00 26.14 ? 126 ALA B CA  1 
ATOM   2731 C C   . ALA B 1 126 ? -36.586 33.895 47.134 1.00 26.14 ? 126 ALA B C   1 
ATOM   2732 O O   . ALA B 1 126 ? -36.683 33.591 45.909 1.00 26.14 ? 126 ALA B O   1 
ATOM   2733 C CB  . ALA B 1 126 ? -35.867 31.863 48.568 1.00 26.14 ? 126 ALA B CB  1 
ATOM   2734 N N   . SER B 1 127 ? -37.224 34.909 47.675 1.00 30.20 ? 127 SER B N   1 
ATOM   2735 C CA  . SER B 1 127 ? -38.356 35.616 47.066 1.00 30.20 ? 127 SER B CA  1 
ATOM   2736 C C   . SER B 1 127 ? -37.973 36.904 46.354 1.00 30.20 ? 127 SER B C   1 
ATOM   2737 O O   . SER B 1 127 ? -38.865 37.537 45.735 1.00 30.20 ? 127 SER B O   1 
ATOM   2738 C CB  . SER B 1 127 ? -39.342 36.004 48.198 1.00 30.20 ? 127 SER B CB  1 
ATOM   2739 O OG  . SER B 1 127 ? -38.798 37.080 49.003 1.00 54.17 ? 127 SER B OG  1 
ATOM   2740 N N   . ASP B 1 128 ? -36.762 37.399 46.615 1.00 24.01 ? 128 ASP B N   1 
ATOM   2741 C CA  . ASP B 1 128 ? -36.332 38.715 46.088 1.00 24.01 ? 128 ASP B CA  1 
ATOM   2742 C C   . ASP B 1 128 ? -36.283 38.745 44.564 1.00 24.01 ? 128 ASP B C   1 
ATOM   2743 O O   . ASP B 1 128 ? -35.794 37.787 43.926 1.00 24.01 ? 128 ASP B O   1 
ATOM   2744 C CB  . ASP B 1 128 ? -34.956 39.150 46.644 1.00 24.01 ? 128 ASP B CB  1 
ATOM   2745 C CG  . ASP B 1 128 ? -35.095 39.467 48.113 1.00 27.98 ? 128 ASP B CG  1 
ATOM   2746 O OD1 . ASP B 1 128 ? -34.087 39.645 48.812 1.00 27.98 ? 128 ASP B OD1 1 
ATOM   2747 O OD2 . ASP B 1 128 ? -36.203 39.363 48.688 1.00 27.98 ? 128 ASP B OD2 1 
ATOM   2748 N N   . ASP B 1 129 ? -36.864 39.742 44.000 1.00 33.38 ? 129 ASP B N   1 
ATOM   2749 C CA  . ASP B 1 129 ? -36.829 39.906 42.560 1.00 33.38 ? 129 ASP B CA  1 
ATOM   2750 C C   . ASP B 1 129 ? -35.941 41.088 42.215 1.00 33.38 ? 129 ASP B C   1 
ATOM   2751 O O   . ASP B 1 129 ? -36.187 42.236 42.680 1.00 33.38 ? 129 ASP B O   1 
ATOM   2752 C CB  . ASP B 1 129 ? -38.257 40.100 41.990 1.00 33.38 ? 129 ASP B CB  1 
ATOM   2753 C CG  . ASP B 1 129 ? -38.230 40.325 40.474 1.00 42.83 ? 129 ASP B CG  1 
ATOM   2754 O OD1 . ASP B 1 129 ? -37.415 39.680 39.758 1.00 42.83 ? 129 ASP B OD1 1 
ATOM   2755 O OD2 . ASP B 1 129 ? -38.834 41.307 39.962 1.00 42.83 ? 129 ASP B OD2 1 
ATOM   2756 N N   . PHE B 1 130 ? -34.962 40.767 41.410 1.00 19.81 ? 130 PHE B N   1 
ATOM   2757 C CA  . PHE B 1 130 ? -34.019 41.692 40.827 1.00 19.81 ? 130 PHE B CA  1 
ATOM   2758 C C   . PHE B 1 130 ? -34.271 41.810 39.340 1.00 19.81 ? 130 PHE B C   1 
ATOM   2759 O O   . PHE B 1 130 ? -34.210 40.798 38.615 1.00 19.81 ? 130 PHE B O   1 
ATOM   2760 C CB  . PHE B 1 130 ? -32.563 41.303 41.162 1.00 19.81 ? 130 PHE B CB  1 
ATOM   2761 C CG  . PHE B 1 130 ? -32.227 41.455 42.672 1.00 21.20 ? 130 PHE B CG  1 
ATOM   2762 C CD1 . PHE B 1 130 ? -32.254 40.351 43.506 1.00 21.20 ? 130 PHE B CD1 1 
ATOM   2763 C CD2 . PHE B 1 130 ? -31.841 42.685 43.170 1.00 21.20 ? 130 PHE B CD2 1 
ATOM   2764 C CE1 . PHE B 1 130 ? -31.943 40.498 44.851 1.00 21.20 ? 130 PHE B CE1 1 
ATOM   2765 C CE2 . PHE B 1 130 ? -31.507 42.849 44.505 1.00 21.20 ? 130 PHE B CE2 1 
ATOM   2766 C CZ  . PHE B 1 130 ? -31.586 41.759 45.352 1.00 21.20 ? 130 PHE B CZ  1 
ATOM   2767 N N   . ALA B 1 131 ? -34.971 42.818 38.969 1.00 16.17 ? 131 ALA B N   1 
ATOM   2768 C CA  . ALA B 1 131 ? -35.461 42.831 37.585 1.00 16.17 ? 131 ALA B CA  1 
ATOM   2769 C C   . ALA B 1 131 ? -34.337 42.963 36.554 1.00 16.17 ? 131 ALA B C   1 
ATOM   2770 O O   . ALA B 1 131 ? -33.307 43.610 36.801 1.00 16.17 ? 131 ALA B O   1 
ATOM   2771 C CB  . ALA B 1 131 ? -36.365 44.076 37.400 1.00 16.17 ? 131 ALA B CB  1 
ATOM   2772 N N   . ALA B 1 132 ? -34.616 42.527 35.380 1.00 20.94 ? 132 ALA B N   1 
ATOM   2773 C CA  . ALA B 1 132 ? -33.798 42.747 34.233 1.00 20.94 ? 132 ALA B CA  1 
ATOM   2774 C C   . ALA B 1 132 ? -33.567 44.232 34.031 1.00 20.94 ? 132 ALA B C   1 
ATOM   2775 O O   . ALA B 1 132 ? -34.559 44.979 33.852 1.00 20.94 ? 132 ALA B O   1 
ATOM   2776 C CB  . ALA B 1 132 ? -34.566 42.204 33.009 1.00 20.94 ? 132 ALA B CB  1 
ATOM   2777 N N   . GLY B 1 133 ? -32.352 44.642 33.889 1.00 19.46 ? 133 GLY B N   1 
ATOM   2778 C CA  . GLY B 1 133 ? -32.121 46.022 33.539 1.00 19.46 ? 133 GLY B CA  1 
ATOM   2779 C C   . GLY B 1 133 ? -31.670 46.794 34.760 1.00 19.46 ? 133 GLY B C   1 
ATOM   2780 O O   . GLY B 1 133 ? -31.231 47.963 34.585 1.00 19.46 ? 133 GLY B O   1 
ATOM   2781 N N   . THR B 1 134 ? -31.727 46.136 35.924 1.00 10.51 ? 134 THR B N   1 
ATOM   2782 C CA  . THR B 1 134 ? -31.128 46.677 37.174 1.00 10.51 ? 134 THR B CA  1 
ATOM   2783 C C   . THR B 1 134 ? -29.603 46.700 37.043 1.00 10.51 ? 134 THR B C   1 
ATOM   2784 O O   . THR B 1 134 ? -29.000 45.678 36.585 1.00 10.51 ? 134 THR B O   1 
ATOM   2785 C CB  . THR B 1 134 ? -31.519 45.797 38.373 1.00 10.51 ? 134 THR B CB  1 
ATOM   2786 O OG1 . THR B 1 134 ? -32.910 45.607 38.385 1.00 24.12 ? 134 THR B OG1 1 
ATOM   2787 C CG2 . THR B 1 134 ? -31.033 46.302 39.728 1.00 24.12 ? 134 THR B CG2 1 
ATOM   2788 N N   . THR B 1 135 ? -29.013 47.849 37.386 1.00 15.94 ? 135 THR B N   1 
ATOM   2789 C CA  . THR B 1 135 ? -27.545 47.991 37.351 1.00 15.94 ? 135 THR B CA  1 
ATOM   2790 C C   . THR B 1 135 ? -26.936 47.603 38.678 1.00 15.94 ? 135 THR B C   1 
ATOM   2791 O O   . THR B 1 135 ? -27.481 47.936 39.758 1.00 15.94 ? 135 THR B O   1 
ATOM   2792 C CB  . THR B 1 135 ? -27.101 49.438 37.011 1.00 15.94 ? 135 THR B CB  1 
ATOM   2793 O OG1 . THR B 1 135 ? -27.578 49.761 35.694 1.00 27.31 ? 135 THR B OG1 1 
ATOM   2794 C CG2 . THR B 1 135 ? -25.556 49.573 37.041 1.00 27.31 ? 135 THR B CG2 1 
ATOM   2795 N N   . CYS B 1 136 ? -26.023 46.675 38.568 1.00 11.94 ? 136 CYS B N   1 
ATOM   2796 C CA  . CYS B 1 136 ? -25.293 45.972 39.676 1.00 11.94 ? 136 CYS B CA  1 
ATOM   2797 C C   . CYS B 1 136 ? -23.787 45.915 39.368 1.00 11.94 ? 136 CYS B C   1 
ATOM   2798 O O   . CYS B 1 136 ? -23.383 46.606 38.410 1.00 11.94 ? 136 CYS B O   1 
ATOM   2799 C CB  . CYS B 1 136 ? -25.806 44.540 39.746 1.00 11.94 ? 136 CYS B CB  1 
ATOM   2800 S SG  . CYS B 1 136 ? -27.573 44.465 40.050 1.00 11.71 ? 136 CYS B SG  1 
ATOM   2801 N N   . VAL B 1 137 ? -22.988 45.554 40.344 1.00 11.47 ? 137 VAL B N   1 
ATOM   2802 C CA  . VAL B 1 137 ? -21.555 45.837 40.286 1.00 11.47 ? 137 VAL B CA  1 
ATOM   2803 C C   . VAL B 1 137 ? -20.864 44.491 40.372 1.00 11.47 ? 137 VAL B C   1 
ATOM   2804 O O   . VAL B 1 137 ? -21.247 43.673 41.247 1.00 11.47 ? 137 VAL B O   1 
ATOM   2805 C CB  . VAL B 1 137 ? -21.159 46.782 41.474 1.00 11.47 ? 137 VAL B CB  1 
ATOM   2806 C CG1 . VAL B 1 137 ? -19.652 47.045 41.653 1.00 10.90 ? 137 VAL B CG1 1 
ATOM   2807 C CG2 . VAL B 1 137 ? -21.843 48.167 41.449 1.00 10.90 ? 137 VAL B CG2 1 
ATOM   2808 N N   . THR B 1 138 ? -19.809 44.294 39.643 1.00 8.84  ? 138 THR B N   1 
ATOM   2809 C CA  . THR B 1 138 ? -18.855 43.196 39.953 1.00 8.84  ? 138 THR B CA  1 
ATOM   2810 C C   . THR B 1 138 ? -17.415 43.696 40.222 1.00 8.84  ? 138 THR B C   1 
ATOM   2811 O O   . THR B 1 138 ? -16.942 44.671 39.603 1.00 8.84  ? 138 THR B O   1 
ATOM   2812 C CB  . THR B 1 138 ? -18.856 42.199 38.783 1.00 8.84  ? 138 THR B CB  1 
ATOM   2813 O OG1 . THR B 1 138 ? -18.187 41.006 39.137 1.00 4.42  ? 138 THR B OG1 1 
ATOM   2814 C CG2 . THR B 1 138 ? -18.261 42.732 37.468 1.00 4.42  ? 138 THR B CG2 1 
ATOM   2815 N N   . THR B 1 139 ? -16.757 43.116 41.191 1.00 8.50  ? 139 THR B N   1 
ATOM   2816 C CA  . THR B 1 139 ? -15.381 43.507 41.477 1.00 8.50  ? 139 THR B CA  1 
ATOM   2817 C C   . THR B 1 139 ? -14.449 42.308 41.372 1.00 8.50  ? 139 THR B C   1 
ATOM   2818 O O   . THR B 1 139 ? -14.943 41.143 41.534 1.00 8.50  ? 139 THR B O   1 
ATOM   2819 C CB  . THR B 1 139 ? -15.332 44.107 42.895 1.00 8.50  ? 139 THR B CB  1 
ATOM   2820 O OG1 . THR B 1 139 ? -15.835 43.224 43.863 1.00 6.15  ? 139 THR B OG1 1 
ATOM   2821 C CG2 . THR B 1 139 ? -16.305 45.274 43.060 1.00 6.15  ? 139 THR B CG2 1 
ATOM   2822 N N   . GLY B 1 140 ? -13.142 42.584 41.293 1.00 8.25  ? 140 GLY B N   1 
ATOM   2823 C CA  . GLY B 1 140 ? -12.166 41.505 41.518 1.00 8.25  ? 140 GLY B CA  1 
ATOM   2824 C C   . GLY B 1 140 ? -10.811 41.771 40.875 1.00 8.25  ? 140 GLY B C   1 
ATOM   2825 O O   . GLY B 1 140 ? -10.677 42.834 40.220 1.00 8.25  ? 140 GLY B O   1 
ATOM   2826 N N   . TRP B 1 141 ? -9.933  40.800 40.970 1.00 8.76  ? 141 TRP B N   1 
ATOM   2827 C CA  . TRP B 1 141 ? -8.588  40.826 40.325 1.00 8.76  ? 141 TRP B CA  1 
ATOM   2828 C C   . TRP B 1 141 ? -8.533  39.939 39.058 1.00 8.76  ? 141 TRP B C   1 
ATOM   2829 O O   . TRP B 1 141 ? -7.439  39.498 38.607 1.00 8.76  ? 141 TRP B O   1 
ATOM   2830 C CB  . TRP B 1 141 ? -7.488  40.490 41.324 1.00 8.76  ? 141 TRP B CB  1 
ATOM   2831 C CG  . TRP B 1 141 ? -7.524  41.384 42.582 1.00 11.26 ? 141 TRP B CG  1 
ATOM   2832 C CD1 . TRP B 1 141 ? -6.754  42.447 42.785 1.00 11.26 ? 141 TRP B CD1 1 
ATOM   2833 C CD2 . TRP B 1 141 ? -8.190  41.188 43.827 1.00 11.26 ? 141 TRP B CD2 1 
ATOM   2834 N NE1 . TRP B 1 141 ? -6.870  42.915 44.070 1.00 11.26 ? 141 TRP B NE1 1 
ATOM   2835 C CE2 . TRP B 1 141 ? -7.719  42.180 44.698 1.00 11.26 ? 141 TRP B CE2 1 
ATOM   2836 C CE3 . TRP B 1 141 ? -9.093  40.230 44.255 1.00 11.26 ? 141 TRP B CE3 1 
ATOM   2837 C CZ2 . TRP B 1 141 ? -8.126  42.263 46.025 1.00 11.26 ? 141 TRP B CZ2 1 
ATOM   2838 C CZ3 . TRP B 1 141 ? -9.511  40.299 45.585 1.00 11.26 ? 141 TRP B CZ3 1 
ATOM   2839 C CH2 . TRP B 1 141 ? -9.037  41.293 46.448 1.00 11.26 ? 141 TRP B CH2 1 
ATOM   2840 N N   . GLY B 1 142 ? -9.711  39.774 38.427 1.00 7.32  ? 142 GLY B N   1 
ATOM   2841 C CA  . GLY B 1 142 ? -9.955  39.014 37.228 1.00 7.32  ? 142 GLY B CA  1 
ATOM   2842 C C   . GLY B 1 142 ? -9.055  39.341 36.060 1.00 7.32  ? 142 GLY B C   1 
ATOM   2843 O O   . GLY B 1 142 ? -8.863  38.412 35.201 1.00 7.32  ? 142 GLY B O   1 
ATOM   2844 N N   . LEU B 1 143 ? -8.866  40.634 35.839 1.00 22.67 ? 143 LEU B N   1 
ATOM   2845 C CA  . LEU B 1 143 ? -8.234  41.080 34.591 1.00 22.67 ? 143 LEU B CA  1 
ATOM   2846 C C   . LEU B 1 143 ? -6.749  40.754 34.531 1.00 22.67 ? 143 LEU B C   1 
ATOM   2847 O O   . LEU B 1 143 ? -6.178  40.649 33.421 1.00 22.67 ? 143 LEU B O   1 
ATOM   2848 C CB  . LEU B 1 143 ? -8.313  42.598 34.361 1.00 22.67 ? 143 LEU B CB  1 
ATOM   2849 C CG  . LEU B 1 143 ? -9.746  43.044 34.067 1.00 22.33 ? 143 LEU B CG  1 
ATOM   2850 C CD1 . LEU B 1 143 ? -9.934  44.553 34.309 1.00 22.33 ? 143 LEU B CD1 1 
ATOM   2851 C CD2 . LEU B 1 143 ? -10.218 42.576 32.674 1.00 22.33 ? 143 LEU B CD2 1 
ATOM   2852 N N   . THR B 1 144 ? -6.151  40.408 35.633 1.00 29.53 ? 144 THR B N   1 
ATOM   2853 C CA  . THR B 1 144 ? -4.796  39.990 35.397 1.00 29.53 ? 144 THR B CA  1 
ATOM   2854 C C   . THR B 1 144 ? -4.224  38.753 36.109 1.00 29.53 ? 144 THR B C   1 
ATOM   2855 O O   . THR B 1 144 ? -4.746  38.312 37.165 1.00 29.53 ? 144 THR B O   1 
ATOM   2856 C CB  . THR B 1 144 ? -3.884  41.202 35.543 1.00 29.53 ? 144 THR B CB  1 
ATOM   2857 O OG1 . THR B 1 144 ? -2.634  40.890 34.894 1.00 26.93 ? 144 THR B OG1 1 
ATOM   2858 C CG2 . THR B 1 144 ? -3.669  41.559 37.014 1.00 26.93 ? 144 THR B CG2 1 
ATOM   2859 N N   . ARG B 1 145 ? -3.188  38.311 35.398 1.00 51.00 ? 145 ARG B N   1 
ATOM   2860 C CA  . ARG B 1 145 ? -2.233  37.195 35.278 1.00 0.00  ? 145 ARG B CA  1 
ATOM   2861 C C   . ARG B 1 145 ? -2.324  36.656 33.848 1.00 0.00  ? 145 ARG B C   1 
ATOM   2862 O O   . ARG B 1 145 ? -1.521  35.776 33.449 1.00 0.00  ? 145 ARG B O   1 
ATOM   2863 C CB  . ARG B 1 145 ? -2.141  36.129 36.418 1.00 51.00 ? 145 ARG B CB  1 
ATOM   2864 C CG  . ARG B 1 145 ? -3.125  34.921 36.293 1.00 32.30 ? 145 ARG B CG  1 
ATOM   2865 C CD  . ARG B 1 145 ? -2.650  33.684 35.489 1.00 32.30 ? 145 ARG B CD  1 
ATOM   2866 N NE  . ARG B 1 145 ? -3.821  32.788 35.338 1.00 32.30 ? 145 ARG B NE  1 
ATOM   2867 C CZ  . ARG B 1 145 ? -3.826  31.462 35.144 1.00 32.30 ? 145 ARG B CZ  1 
ATOM   2868 N NH1 . ARG B 1 145 ? -2.721  30.745 35.111 1.00 32.30 ? 145 ARG B NH1 1 
ATOM   2869 N NH2 . ARG B 1 145 ? -4.965  30.844 34.939 1.00 32.30 ? 145 ARG B NH2 1 
ATOM   2870 N N   . TYR B 1 146 ? -3.222  37.326 33.096 1.00 0.00  ? 146 TYR B N   1 
ATOM   2871 C CA  . TYR B 1 146 ? -3.653  37.166 31.672 1.00 37.88 ? 146 TYR B CA  1 
ATOM   2872 C C   . TYR B 1 146 ? -2.564  37.068 30.589 1.00 0.00  ? 146 TYR B C   1 
ATOM   2873 O O   . TYR B 1 146 ? -1.804  36.067 30.555 1.00 0.00  ? 146 TYR B O   1 
ATOM   2874 C CB  . TYR B 1 146 ? -4.702  38.240 31.258 1.00 37.88 ? 146 TYR B CB  1 
ATOM   2875 C CG  . TYR B 1 146 ? -6.161  37.805 31.492 1.00 0.00  ? 146 TYR B CG  1 
ATOM   2876 C CD1 . TYR B 1 146 ? -7.177  38.488 30.859 1.00 0.00  ? 146 TYR B CD1 1 
ATOM   2877 C CD2 . TYR B 1 146 ? -6.456  36.757 32.335 1.00 0.00  ? 146 TYR B CD2 1 
ATOM   2878 C CE1 . TYR B 1 146 ? -8.501  38.134 31.077 1.00 0.00  ? 146 TYR B CE1 1 
ATOM   2879 C CE2 . TYR B 1 146 ? -7.777  36.392 32.559 1.00 0.00  ? 146 TYR B CE2 1 
ATOM   2880 C CZ  . TYR B 1 146 ? -8.797  37.087 31.931 1.00 0.00  ? 146 TYR B CZ  1 
ATOM   2881 O OH  . TYR B 1 146 ? -10.164 36.734 32.184 1.00 0.00  ? 146 TYR B OH  1 
ATOM   2882 N N   . THR B 1 147 ? -2.667  37.898 29.553 1.00 0.00  ? 147 THR B N   1 
ATOM   2883 C CA  . THR B 1 147 ? -1.835  37.816 28.322 1.00 21.44 ? 147 THR B CA  1 
ATOM   2884 C C   . THR B 1 147 ? -1.188  39.133 27.949 1.00 0.00  ? 147 THR B C   1 
ATOM   2885 O O   . THR B 1 147 ? -1.668  40.201 28.410 1.00 0.00  ? 147 THR B O   1 
ATOM   2886 C CB  . THR B 1 147 ? -2.674  37.287 27.135 1.00 0.00  ? 147 THR B CB  1 
ATOM   2887 O OG1 . THR B 1 147 ? -1.862  37.038 25.968 1.00 29.84 ? 147 THR B OG1 1 
ATOM   2888 C CG2 . THR B 1 147 ? -3.848  38.222 26.784 1.00 0.00  ? 147 THR B CG2 1 
ATOM   2889 N N   . ASN B 1 148 ? -0.087  38.978 27.240 1.00 0.00  ? 148 ASN B N   1 
ATOM   2890 C CA  . ASN B 1 148 ? 0.873   40.022 26.903 1.00 0.00  ? 148 ASN B CA  1 
ATOM   2891 C C   . ASN B 1 148 ? 1.004   41.061 28.009 1.00 0.00  ? 148 ASN B C   1 
ATOM   2892 O O   . ASN B 1 148 ? 0.974   42.292 27.753 1.00 0.00  ? 148 ASN B O   1 
ATOM   2893 C CB  . ASN B 1 148 ? 0.617   40.637 25.516 1.00 36.37 ? 148 ASN B CB  1 
ATOM   2894 C CG  . ASN B 1 148 ? 1.817   41.511 25.122 1.00 35.40 ? 148 ASN B CG  1 
ATOM   2895 O OD1 . ASN B 1 148 ? 2.978   41.060 25.296 1.00 0.00  ? 148 ASN B OD1 1 
ATOM   2896 N ND2 . ASN B 1 148 ? 1.548   42.798 25.065 1.00 0.00  ? 148 ASN B ND2 1 
ATOM   2897 N N   . ALA B 1 149 ? 1.300   40.497 29.175 1.00 0.00  ? 149 ALA B N   1 
ATOM   2898 C CA  . ALA B 1 149 ? 1.762   41.167 30.402 1.00 34.33 ? 149 ALA B CA  1 
ATOM   2899 C C   . ALA B 1 149 ? 1.637   40.413 31.727 1.00 34.33 ? 149 ALA B C   1 
ATOM   2900 O O   . ALA B 1 149 ? 1.594   39.157 31.774 1.00 0.00  ? 149 ALA B O   1 
ATOM   2901 C CB  . ALA B 1 149 ? 1.125   42.552 30.639 1.00 0.00  ? 149 ALA B CB  1 
ATOM   2902 N N   . ASN B 1 150 ? 1.600   41.244 32.748 1.00 0.00  ? 150 ASN B N   1 
ATOM   2903 C CA  . ASN B 1 150 ? 1.401   40.979 34.176 1.00 0.00  ? 150 ASN B CA  1 
ATOM   2904 C C   . ASN B 1 150 ? 0.833   42.222 34.837 1.00 0.00  ? 150 ASN B C   1 
ATOM   2905 O O   . ASN B 1 150 ? -0.409  42.344 34.949 1.00 0.00  ? 150 ASN B O   1 
ATOM   2906 C CB  . ASN B 1 150 ? 2.730   40.661 34.883 1.00 0.00  ? 150 ASN B CB  1 
ATOM   2907 C CG  . ASN B 1 150 ? 2.922   39.151 34.906 1.00 0.00  ? 150 ASN B CG  1 
ATOM   2908 O OD1 . ASN B 1 150 ? 2.053   38.453 35.487 1.00 0.00  ? 150 ASN B OD1 1 
ATOM   2909 N ND2 . ASN B 1 150 ? 3.632   38.705 33.891 1.00 0.00  ? 150 ASN B ND2 1 
ATOM   2910 N N   . THR B 1 151 ? 1.753   43.150 35.194 1.00 0.00  ? 151 THR B N   1 
ATOM   2911 C CA  . THR B 1 151 ? 1.500   44.522 35.659 1.00 0.00  ? 151 THR B CA  1 
ATOM   2912 C C   . THR B 1 151 ? 0.840   44.482 37.043 1.00 0.00  ? 151 THR B C   1 
ATOM   2913 O O   . THR B 1 151 ? 0.718   43.408 37.660 1.00 0.00  ? 151 THR B O   1 
ATOM   2914 C CB  . THR B 1 151 ? 0.600   45.240 34.647 1.00 0.00  ? 151 THR B CB  1 
ATOM   2915 O OG1 . THR B 1 151 ? 1.395   45.931 33.693 1.00 0.00  ? 151 THR B OG1 1 
ATOM   2916 C CG2 . THR B 1 151 ? -0.352  46.253 35.282 1.00 0.00  ? 151 THR B CG2 1 
ATOM   2917 N N   . PRO B 1 152 ? 0.829   45.634 37.791 1.00 0.00  ? 152 PRO B N   1 
ATOM   2918 C CA  . PRO B 1 152 ? 0.263   45.753 39.158 1.00 32.30 ? 152 PRO B CA  1 
ATOM   2919 C C   . PRO B 1 152 ? -1.150  45.191 39.264 1.00 32.30 ? 152 PRO B C   1 
ATOM   2920 O O   . PRO B 1 152 ? -1.861  45.123 38.229 1.00 32.30 ? 152 PRO B O   1 
ATOM   2921 C CB  . PRO B 1 152 ? 0.237   47.246 39.546 1.00 32.30 ? 152 PRO B CB  1 
ATOM   2922 C CG  . PRO B 1 152 ? 0.835   47.990 38.339 1.00 30.64 ? 152 PRO B CG  1 
ATOM   2923 C CD  . PRO B 1 152 ? 1.225   46.958 37.285 1.00 0.00  ? 152 PRO B CD  1 
ATOM   2924 N N   . ASP B 1 153 ? -1.516  44.676 40.441 1.00 17.56 ? 153 ASP B N   1 
ATOM   2925 C CA  . ASP B 1 153 ? -2.730  43.924 40.525 1.00 17.56 ? 153 ASP B CA  1 
ATOM   2926 C C   . ASP B 1 153 ? -3.736  44.435 41.529 1.00 17.56 ? 153 ASP B C   1 
ATOM   2927 O O   . ASP B 1 153 ? -3.763  44.021 42.696 1.00 17.56 ? 153 ASP B O   1 
ATOM   2928 C CB  . ASP B 1 153 ? -2.412  42.431 40.680 1.00 17.56 ? 153 ASP B CB  1 
ATOM   2929 C CG  . ASP B 1 153 ? -3.613  41.528 40.419 1.00 48.92 ? 153 ASP B CG  1 
ATOM   2930 O OD1 . ASP B 1 153 ? -3.427  40.292 40.439 1.00 48.92 ? 153 ASP B OD1 1 
ATOM   2931 O OD2 . ASP B 1 153 ? -4.634  41.952 39.830 1.00 48.92 ? 153 ASP B OD2 1 
ATOM   2932 N N   . ARG B 1 154 ? -4.423  45.461 41.098 1.00 12.74 ? 154 ARG B N   1 
ATOM   2933 C CA  . ARG B 1 154 ? -5.259  46.275 42.003 1.00 12.74 ? 154 ARG B CA  1 
ATOM   2934 C C   . ARG B 1 154 ? -6.747  46.049 41.681 1.00 12.74 ? 154 ARG B C   1 
ATOM   2935 O O   . ARG B 1 154 ? -7.111  45.727 40.509 1.00 12.74 ? 154 ARG B O   1 
ATOM   2936 C CB  . ARG B 1 154 ? -4.917  47.761 41.748 1.00 12.74 ? 154 ARG B CB  1 
ATOM   2937 C CG  . ARG B 1 154 ? -3.436  48.189 41.971 1.00 16.18 ? 154 ARG B CG  1 
ATOM   2938 C CD  . ARG B 1 154 ? -3.255  49.647 41.414 1.00 16.18 ? 154 ARG B CD  1 
ATOM   2939 N NE  . ARG B 1 154 ? -2.543  50.392 42.442 1.00 16.18 ? 154 ARG B NE  1 
ATOM   2940 C CZ  . ARG B 1 154 ? -2.582  51.643 42.807 1.00 16.18 ? 154 ARG B CZ  1 
ATOM   2941 N NH1 . ARG B 1 154 ? -3.463  52.533 42.368 1.00 16.18 ? 154 ARG B NH1 1 
ATOM   2942 N NH2 . ARG B 1 154 ? -1.634  51.958 43.645 1.00 16.18 ? 154 ARG B NH2 1 
ATOM   2943 N N   . LEU B 1 155 ? -7.503  46.073 42.734 1.00 11.70 ? 155 LEU B N   1 
ATOM   2944 C CA  . LEU B 1 155 ? -8.925  45.701 42.702 1.00 11.70 ? 155 LEU B CA  1 
ATOM   2945 C C   . LEU B 1 155 ? -9.731  46.599 41.740 1.00 11.70 ? 155 LEU B C   1 
ATOM   2946 O O   . LEU B 1 155 ? -9.673  47.843 41.871 1.00 11.70 ? 155 LEU B O   1 
ATOM   2947 C CB  . LEU B 1 155 ? -9.494  45.739 44.154 1.00 11.70 ? 155 LEU B CB  1 
ATOM   2948 C CG  . LEU B 1 155 ? -10.947 45.234 44.295 1.00 0.10  ? 155 LEU B CG  1 
ATOM   2949 C CD1 . LEU B 1 155 ? -11.151 43.770 43.859 1.00 0.10  ? 155 LEU B CD1 1 
ATOM   2950 C CD2 . LEU B 1 155 ? -11.526 45.419 45.692 1.00 0.10  ? 155 LEU B CD2 1 
ATOM   2951 N N   . GLN B 1 156 ? -10.344 46.003 40.712 1.00 10.83 ? 156 GLN B N   1 
ATOM   2952 C CA  . GLN B 1 156 ? -11.123 46.716 39.727 1.00 10.83 ? 156 GLN B CA  1 
ATOM   2953 C C   . GLN B 1 156 ? -12.596 46.506 40.039 1.00 10.83 ? 156 GLN B C   1 
ATOM   2954 O O   . GLN B 1 156 ? -12.896 45.592 40.826 1.00 10.83 ? 156 GLN B O   1 
ATOM   2955 C CB  . GLN B 1 156 ? -10.836 46.240 38.276 1.00 10.83 ? 156 GLN B CB  1 
ATOM   2956 C CG  . GLN B 1 156 ? -9.322  46.237 37.883 1.00 15.84 ? 156 GLN B CG  1 
ATOM   2957 C CD  . GLN B 1 156 ? -8.751  47.655 37.894 1.00 15.84 ? 156 GLN B CD  1 
ATOM   2958 O OE1 . GLN B 1 156 ? -9.317  48.532 37.181 1.00 15.84 ? 156 GLN B OE1 1 
ATOM   2959 N NE2 . GLN B 1 156 ? -7.685  47.847 38.707 1.00 15.84 ? 156 GLN B NE2 1 
ATOM   2960 N N   . GLN B 1 157 ? -13.419 47.352 39.489 1.00 11.60 ? 157 GLN B N   1 
ATOM   2961 C CA  . GLN B 1 157 ? -14.896 47.413 39.611 1.00 11.60 ? 157 GLN B CA  1 
ATOM   2962 C C   . GLN B 1 157 ? -15.584 47.684 38.259 1.00 11.60 ? 157 GLN B C   1 
ATOM   2963 O O   . GLN B 1 157 ? -15.115 48.519 37.438 1.00 11.60 ? 157 GLN B O   1 
ATOM   2964 C CB  . GLN B 1 157 ? -15.360 48.449 40.670 1.00 11.60 ? 157 GLN B CB  1 
ATOM   2965 C CG  . GLN B 1 157 ? -15.077 49.891 40.239 1.00 9.00  ? 157 GLN B CG  1 
ATOM   2966 C CD  . GLN B 1 157 ? -15.354 50.825 41.411 1.00 9.00  ? 157 GLN B CD  1 
ATOM   2967 O OE1 . GLN B 1 157 ? -15.452 50.407 42.605 1.00 9.00  ? 157 GLN B OE1 1 
ATOM   2968 N NE2 . GLN B 1 157 ? -15.438 52.082 41.080 1.00 9.00  ? 157 GLN B NE2 1 
ATOM   2969 N N   . ALA B 1 158 ? -16.769 47.111 38.086 1.00 8.73  ? 158 ALA B N   1 
ATOM   2970 C CA  . ALA B 1 158 ? -17.562 47.485 36.919 1.00 8.73  ? 158 ALA B CA  1 
ATOM   2971 C C   . ALA B 1 158 ? -19.071 47.532 37.173 1.00 8.73  ? 158 ALA B C   1 
ATOM   2972 O O   . ALA B 1 158 ? -19.587 46.714 37.995 1.00 8.73  ? 158 ALA B O   1 
ATOM   2973 C CB  . ALA B 1 158 ? -17.202 46.622 35.704 1.00 8.73  ? 158 ALA B CB  1 
ATOM   2974 N N   . SER B 1 159 ? -19.787 48.489 36.539 1.00 7.81  ? 159 SER B N   1 
ATOM   2975 C CA  . SER B 1 159 ? -21.277 48.625 36.682 1.00 7.81  ? 159 SER B CA  1 
ATOM   2976 C C   . SER B 1 159 ? -21.943 48.021 35.455 1.00 7.81  ? 159 SER B C   1 
ATOM   2977 O O   . SER B 1 159 ? -21.546 48.349 34.299 1.00 7.81  ? 159 SER B O   1 
ATOM   2978 C CB  . SER B 1 159 ? -21.719 50.098 36.686 1.00 7.81  ? 159 SER B CB  1 
ATOM   2979 O OG  . SER B 1 159 ? -21.176 50.751 37.834 1.00 17.52 ? 159 SER B OG  1 
ATOM   2980 N N   . LEU B 1 160 ? -22.774 47.048 35.692 1.00 14.07 ? 160 LEU B N   1 
ATOM   2981 C CA  . LEU B 1 160 ? -23.393 46.212 34.635 1.00 14.07 ? 160 LEU B CA  1 
ATOM   2982 C C   . LEU B 1 160 ? -24.846 45.804 34.877 1.00 14.07 ? 160 LEU B C   1 
ATOM   2983 O O   . LEU B 1 160 ? -25.295 45.762 36.039 1.00 14.07 ? 160 LEU B O   1 
ATOM   2984 C CB  . LEU B 1 160 ? -22.440 45.057 34.136 1.00 14.07 ? 160 LEU B CB  1 
ATOM   2985 C CG  . LEU B 1 160 ? -22.369 43.841 35.106 1.00 17.34 ? 160 LEU B CG  1 
ATOM   2986 C CD1 . LEU B 1 160 ? -21.561 42.646 34.527 1.00 17.34 ? 160 LEU B CD1 1 
ATOM   2987 C CD2 . LEU B 1 160 ? -21.835 44.198 36.508 1.00 17.34 ? 160 LEU B CD2 1 
ATOM   2988 N N   . PRO B 1 161 ? -25.646 45.725 33.810 1.00 8.87  ? 161 PRO B N   1 
ATOM   2989 C CA  . PRO B 1 161 ? -27.094 45.487 33.908 1.00 8.87  ? 161 PRO B CA  1 
ATOM   2990 C C   . PRO B 1 161 ? -27.348 43.968 34.038 1.00 8.87  ? 161 PRO B C   1 
ATOM   2991 O O   . PRO B 1 161 ? -26.840 43.181 33.185 1.00 8.87  ? 161 PRO B O   1 
ATOM   2992 C CB  . PRO B 1 161 ? -27.703 45.950 32.562 1.00 8.87  ? 161 PRO B CB  1 
ATOM   2993 C CG  . PRO B 1 161 ? -26.579 46.004 31.558 1.00 16.56 ? 161 PRO B CG  1 
ATOM   2994 C CD  . PRO B 1 161 ? -25.277 45.911 32.380 1.00 16.56 ? 161 PRO B CD  1 
ATOM   2995 N N   . LEU B 1 162 ? -28.307 43.633 34.915 1.00 14.14 ? 162 LEU B N   1 
ATOM   2996 C CA  . LEU B 1 162 ? -28.953 42.285 34.872 1.00 14.14 ? 162 LEU B CA  1 
ATOM   2997 C C   . LEU B 1 162 ? -29.703 41.994 33.554 1.00 14.14 ? 162 LEU B C   1 
ATOM   2998 O O   . LEU B 1 162 ? -30.421 42.869 33.012 1.00 14.14 ? 162 LEU B O   1 
ATOM   2999 C CB  . LEU B 1 162 ? -29.919 42.078 36.035 1.00 14.14 ? 162 LEU B CB  1 
ATOM   3000 C CG  . LEU B 1 162 ? -29.265 42.166 37.414 1.00 4.35  ? 162 LEU B CG  1 
ATOM   3001 C CD1 . LEU B 1 162 ? -30.249 41.879 38.599 1.00 4.35  ? 162 LEU B CD1 1 
ATOM   3002 C CD2 . LEU B 1 162 ? -27.960 41.344 37.517 1.00 4.35  ? 162 LEU B CD2 1 
ATOM   3003 N N   . LEU B 1 163 ? -29.563 40.785 33.025 1.00 13.93 ? 163 LEU B N   1 
ATOM   3004 C CA  . LEU B 1 163 ? -30.390 40.327 31.881 1.00 13.93 ? 163 LEU B CA  1 
ATOM   3005 C C   . LEU B 1 163 ? -31.542 39.419 32.337 1.00 13.93 ? 163 LEU B C   1 
ATOM   3006 O O   . LEU B 1 163 ? -31.424 38.819 33.425 1.00 13.93 ? 163 LEU B O   1 
ATOM   3007 C CB  . LEU B 1 163 ? -29.518 39.476 30.946 1.00 13.93 ? 163 LEU B CB  1 
ATOM   3008 C CG  . LEU B 1 163 ? -28.276 40.202 30.386 1.00 12.70 ? 163 LEU B CG  1 
ATOM   3009 C CD1 . LEU B 1 163 ? -27.844 39.359 29.183 1.00 12.70 ? 163 LEU B CD1 1 
ATOM   3010 C CD2 . LEU B 1 163 ? -28.554 41.644 29.910 1.00 12.70 ? 163 LEU B CD2 1 
ATOM   3011 N N   . SER B 1 164 ? -32.534 39.161 31.477 1.00 5.20  ? 164 SER B N   1 
ATOM   3012 C CA  . SER B 1 164 ? -33.413 38.004 31.752 1.00 5.20  ? 164 SER B CA  1 
ATOM   3013 C C   . SER B 1 164 ? -32.656 36.791 31.239 1.00 5.20  ? 164 SER B C   1 
ATOM   3014 O O   . SER B 1 164 ? -31.864 36.938 30.267 1.00 5.20  ? 164 SER B O   1 
ATOM   3015 C CB  . SER B 1 164 ? -34.735 38.168 30.981 1.00 5.20  ? 164 SER B CB  1 
ATOM   3016 O OG  . SER B 1 164 ? -34.392 38.149 29.575 1.00 10.70 ? 164 SER B OG  1 
ATOM   3017 N N   . ASN B 1 165 ? -33.077 35.590 31.610 1.00 5.03  ? 165 ASN B N   1 
ATOM   3018 C CA  . ASN B 1 165 ? -32.561 34.308 31.103 1.00 5.03  ? 165 ASN B CA  1 
ATOM   3019 C C   . ASN B 1 165 ? -33.038 34.004 29.693 1.00 5.03  ? 165 ASN B C   1 
ATOM   3020 O O   . ASN B 1 165 ? -32.191 33.637 28.825 1.00 5.03  ? 165 ASN B O   1 
ATOM   3021 C CB  . ASN B 1 165 ? -32.936 33.181 32.031 1.00 5.03  ? 165 ASN B CB  1 
ATOM   3022 C CG  . ASN B 1 165 ? -31.969 33.080 33.220 1.00 15.18 ? 165 ASN B CG  1 
ATOM   3023 O OD1 . ASN B 1 165 ? -32.080 32.116 34.012 1.00 15.18 ? 165 ASN B OD1 1 
ATOM   3024 N ND2 . ASN B 1 165 ? -31.245 34.088 33.543 1.00 15.18 ? 165 ASN B ND2 1 
ATOM   3025 N N   . THR B 1 166 ? -34.148 34.615 29.317 1.00 13.53 ? 166 THR B N   1 
ATOM   3026 C CA  . THR B 1 166 ? -34.535 34.579 27.869 1.00 13.53 ? 166 THR B CA  1 
ATOM   3027 C C   . THR B 1 166 ? -33.568 35.327 26.962 1.00 13.53 ? 166 THR B C   1 
ATOM   3028 O O   . THR B 1 166 ? -33.264 34.895 25.824 1.00 13.53 ? 166 THR B O   1 
ATOM   3029 C CB  . THR B 1 166 ? -36.000 35.104 27.719 1.00 13.53 ? 166 THR B CB  1 
ATOM   3030 O OG1 . THR B 1 166 ? -36.785 34.300 28.597 1.00 17.61 ? 166 THR B OG1 1 
ATOM   3031 C CG2 . THR B 1 166 ? -36.607 34.941 26.314 1.00 17.61 ? 166 THR B CG2 1 
ATOM   3032 N N   . ASN B 1 167 ? -33.145 36.489 27.409 1.00 15.80 ? 167 ASN B N   1 
ATOM   3033 C CA  . ASN B 1 167 ? -32.225 37.336 26.605 1.00 15.80 ? 167 ASN B CA  1 
ATOM   3034 C C   . ASN B 1 167 ? -30.784 36.805 26.598 1.00 15.80 ? 167 ASN B C   1 
ATOM   3035 O O   . ASN B 1 167 ? -30.151 36.604 25.526 1.00 15.80 ? 167 ASN B O   1 
ATOM   3036 C CB  . ASN B 1 167 ? -32.264 38.766 27.202 1.00 15.80 ? 167 ASN B CB  1 
ATOM   3037 C CG  . ASN B 1 167 ? -31.355 39.714 26.415 1.00 44.79 ? 167 ASN B CG  1 
ATOM   3038 O OD1 . ASN B 1 167 ? -31.099 40.853 26.894 1.00 44.79 ? 167 ASN B OD1 1 
ATOM   3039 N ND2 . ASN B 1 167 ? -31.232 39.454 25.140 1.00 44.79 ? 167 ASN B ND2 1 
ATOM   3040 N N   . CYS B 1 168 ? -30.421 36.275 27.736 1.00 12.88 ? 168 CYS B N   1 
ATOM   3041 C CA  . CYS B 1 168 ? -29.130 35.552 27.860 1.00 12.88 ? 168 CYS B CA  1 
ATOM   3042 C C   . CYS B 1 168 ? -28.973 34.277 27.035 1.00 12.88 ? 168 CYS B C   1 
ATOM   3043 O O   . CYS B 1 168 ? -27.879 33.937 26.540 1.00 12.88 ? 168 CYS B O   1 
ATOM   3044 C CB  . CYS B 1 168 ? -28.776 35.286 29.317 1.00 12.88 ? 168 CYS B CB  1 
ATOM   3045 S SG  . CYS B 1 168 ? -27.058 34.704 29.597 1.00 12.51 ? 168 CYS B SG  1 
ATOM   3046 N N   . LYS B 1 169 ? -30.066 33.614 26.796 1.00 18.95 ? 169 LYS B N   1 
ATOM   3047 C CA  . LYS B 1 169 ? -30.010 32.432 25.925 1.00 18.95 ? 169 LYS B CA  1 
ATOM   3048 C C   . LYS B 1 169 ? -29.644 32.778 24.497 1.00 18.95 ? 169 LYS B C   1 
ATOM   3049 O O   . LYS B 1 169 ? -29.163 31.893 23.751 1.00 18.95 ? 169 LYS B O   1 
ATOM   3050 C CB  . LYS B 1 169 ? -31.369 31.700 25.940 1.00 18.95 ? 169 LYS B CB  1 
ATOM   3051 C CG  . LYS B 1 169 ? -31.562 30.922 27.237 1.00 34.93 ? 169 LYS B CG  1 
ATOM   3052 C CD  . LYS B 1 169 ? -33.016 30.448 27.354 1.00 34.93 ? 169 LYS B CD  1 
ATOM   3053 C CE  . LYS B 1 169 ? -33.257 29.795 28.725 1.00 34.93 ? 169 LYS B CE  1 
ATOM   3054 N NZ  . LYS B 1 169 ? -34.681 29.483 28.901 1.00 34.93 ? 169 LYS B NZ  1 
ATOM   3055 N N   . LYS B 1 170 ? -29.817 34.024 24.132 1.00 14.99 ? 170 LYS B N   1 
ATOM   3056 C CA  . LYS B 1 170 ? -29.406 34.427 22.793 1.00 14.99 ? 170 LYS B CA  1 
ATOM   3057 C C   . LYS B 1 170 ? -27.906 34.538 22.637 1.00 14.99 ? 170 LYS B C   1 
ATOM   3058 O O   . LYS B 1 170 ? -27.397 34.491 21.492 1.00 14.99 ? 170 LYS B O   1 
ATOM   3059 C CB  . LYS B 1 170 ? -29.965 35.772 22.416 1.00 14.99 ? 170 LYS B CB  1 
ATOM   3060 C CG  . LYS B 1 170 ? -31.476 35.860 22.703 1.00 49.82 ? 170 LYS B CG  1 
ATOM   3061 C CD  . LYS B 1 170 ? -31.973 37.299 22.516 1.00 49.82 ? 170 LYS B CD  1 
ATOM   3062 C CE  . LYS B 1 170 ? -33.395 37.476 23.071 1.00 49.82 ? 170 LYS B CE  1 
ATOM   3063 N NZ  . LYS B 1 170 ? -33.706 38.912 23.212 1.00 49.82 ? 170 LYS B NZ  1 
ATOM   3064 N N   . TYR B 1 171 ? -27.204 34.432 23.713 1.00 17.66 ? 171 TYR B N   1 
ATOM   3065 C CA  . TYR B 1 171 ? -25.748 34.415 23.594 1.00 17.66 ? 171 TYR B CA  1 
ATOM   3066 C C   . TYR B 1 171 ? -25.202 33.062 23.965 1.00 17.66 ? 171 TYR B C   1 
ATOM   3067 O O   . TYR B 1 171 ? -24.410 32.532 23.167 1.00 17.66 ? 171 TYR B O   1 
ATOM   3068 C CB  . TYR B 1 171 ? -25.078 35.399 24.569 1.00 17.66 ? 171 TYR B CB  1 
ATOM   3069 C CG  . TYR B 1 171 ? -25.549 36.833 24.376 1.00 17.37 ? 171 TYR B CG  1 
ATOM   3070 C CD1 . TYR B 1 171 ? -24.829 37.665 23.570 1.00 17.37 ? 171 TYR B CD1 1 
ATOM   3071 C CD2 . TYR B 1 171 ? -26.683 37.276 25.035 1.00 17.37 ? 171 TYR B CD2 1 
ATOM   3072 C CE1 . TYR B 1 171 ? -25.254 38.959 23.407 1.00 17.37 ? 171 TYR B CE1 1 
ATOM   3073 C CE2 . TYR B 1 171 ? -27.134 38.563 24.864 1.00 17.37 ? 171 TYR B CE2 1 
ATOM   3074 C CZ  . TYR B 1 171 ? -26.410 39.400 24.056 1.00 17.37 ? 171 TYR B CZ  1 
ATOM   3075 O OH  . TYR B 1 171 ? -26.866 40.742 23.874 1.00 17.37 ? 171 TYR B OH  1 
ATOM   3076 N N   . TRP B 1 172 ? -25.732 32.425 24.991 1.00 11.47 ? 172 TRP B N   1 
ATOM   3077 C CA  . TRP B 1 172 ? -25.194 31.153 25.466 1.00 11.47 ? 172 TRP B CA  1 
ATOM   3078 C C   . TRP B 1 172 ? -25.985 29.898 25.090 1.00 11.47 ? 172 TRP B C   1 
ATOM   3079 O O   . TRP B 1 172 ? -25.517 28.763 25.425 1.00 11.47 ? 172 TRP B O   1 
ATOM   3080 C CB  . TRP B 1 172 ? -25.006 31.224 26.996 1.00 11.47 ? 172 TRP B CB  1 
ATOM   3081 C CG  . TRP B 1 172 ? -23.872 32.195 27.358 1.00 16.21 ? 172 TRP B CG  1 
ATOM   3082 C CD1 . TRP B 1 172 ? -23.919 33.421 27.924 1.00 16.21 ? 172 TRP B CD1 1 
ATOM   3083 C CD2 . TRP B 1 172 ? -22.514 31.991 27.051 1.00 16.21 ? 172 TRP B CD2 1 
ATOM   3084 N NE1 . TRP B 1 172 ? -22.616 34.000 27.976 1.00 16.21 ? 172 TRP B NE1 1 
ATOM   3085 C CE2 . TRP B 1 172 ? -21.793 33.138 27.516 1.00 16.21 ? 172 TRP B CE2 1 
ATOM   3086 C CE3 . TRP B 1 172 ? -21.864 30.914 26.450 1.00 16.21 ? 172 TRP B CE3 1 
ATOM   3087 C CZ2 . TRP B 1 172 ? -20.410 33.215 27.444 1.00 16.21 ? 172 TRP B CZ2 1 
ATOM   3088 C CZ3 . TRP B 1 172 ? -20.461 31.010 26.355 1.00 16.21 ? 172 TRP B CZ3 1 
ATOM   3089 C CH2 . TRP B 1 172 ? -19.763 32.127 26.853 1.00 16.21 ? 172 TRP B CH2 1 
ATOM   3090 N N   . GLY B 1 173 ? -27.185 30.077 24.524 1.00 21.44 ? 173 GLY B N   1 
ATOM   3091 C CA  . GLY B 1 173 ? -28.139 28.951 24.221 1.00 21.44 ? 173 GLY B CA  1 
ATOM   3092 C C   . GLY B 1 173 ? -28.601 28.144 25.434 1.00 21.44 ? 173 GLY B C   1 
ATOM   3093 O O   . GLY B 1 173 ? -28.964 28.696 26.510 1.00 21.44 ? 173 GLY B O   1 
ATOM   3094 N N   . THR B 1 174 ? -28.556 26.848 25.288 1.00 22.01 ? 174 THR B N   1 
ATOM   3095 C CA  . THR B 1 174 ? -29.013 25.861 26.299 1.00 22.01 ? 174 THR B CA  1 
ATOM   3096 C C   . THR B 1 174 ? -28.083 25.676 27.488 1.00 22.01 ? 174 THR B C   1 
ATOM   3097 O O   . THR B 1 174 ? -28.452 24.999 28.456 1.00 22.01 ? 174 THR B O   1 
ATOM   3098 C CB  . THR B 1 174 ? -29.198 24.486 25.634 1.00 22.01 ? 174 THR B CB  1 
ATOM   3099 O OG1 . THR B 1 174 ? -27.928 23.975 25.226 1.00 22.19 ? 174 THR B OG1 1 
ATOM   3100 C CG2 . THR B 1 174 ? -30.097 24.658 24.417 1.00 22.19 ? 174 THR B CG2 1 
ATOM   3101 N N   . LYS B 1 175 ? -26.953 26.304 27.476 1.00 13.31 ? 175 LYS B N   1 
ATOM   3102 C CA  . LYS B 1 175 ? -26.122 26.315 28.646 1.00 13.31 ? 175 LYS B CA  1 
ATOM   3103 C C   . LYS B 1 175 ? -26.812 27.012 29.823 1.00 13.31 ? 175 LYS B C   1 
ATOM   3104 O O   . LYS B 1 175 ? -26.433 26.722 30.988 1.00 13.31 ? 175 LYS B O   1 
ATOM   3105 C CB  . LYS B 1 175 ? -24.749 26.965 28.398 1.00 13.31 ? 175 LYS B CB  1 
ATOM   3106 C CG  . LYS B 1 175 ? -23.954 26.380 27.253 1.00 28.57 ? 175 LYS B CG  1 
ATOM   3107 C CD  . LYS B 1 175 ? -22.765 27.287 26.969 1.00 28.57 ? 175 LYS B CD  1 
ATOM   3108 C CE  . LYS B 1 175 ? -21.923 26.759 25.790 1.00 28.57 ? 175 LYS B CE  1 
ATOM   3109 N NZ  . LYS B 1 175 ? -21.160 25.582 26.223 1.00 28.57 ? 175 LYS B NZ  1 
ATOM   3110 N N   . ILE B 1 176 ? -27.672 27.981 29.585 1.00 20.17 ? 176 ILE B N   1 
ATOM   3111 C CA  . ILE B 1 176 ? -28.331 28.749 30.668 1.00 20.17 ? 176 ILE B CA  1 
ATOM   3112 C C   . ILE B 1 176 ? -29.466 27.968 31.350 1.00 20.17 ? 176 ILE B C   1 
ATOM   3113 O O   . ILE B 1 176 ? -30.539 27.887 30.726 1.00 20.17 ? 176 ILE B O   1 
ATOM   3114 C CB  . ILE B 1 176 ? -28.817 30.150 30.162 1.00 20.17 ? 176 ILE B CB  1 
ATOM   3115 C CG1 . ILE B 1 176 ? -27.702 30.835 29.356 1.00 5.46  ? 176 ILE B CG1 1 
ATOM   3116 C CG2 . ILE B 1 176 ? -29.357 31.094 31.293 1.00 5.46  ? 176 ILE B CG2 1 
ATOM   3117 C CD1 . ILE B 1 176 ? -26.513 31.119 30.315 1.00 5.46  ? 176 ILE B CD1 1 
ATOM   3118 N N   . LYS B 1 177 ? -29.368 27.618 32.661 1.00 10.96 ? 177 LYS B N   1 
ATOM   3119 C CA  . LYS B 1 177 ? -30.455 27.011 33.465 1.00 10.96 ? 177 LYS B CA  1 
ATOM   3120 C C   . LYS B 1 177 ? -30.976 27.993 34.501 1.00 10.96 ? 177 LYS B C   1 
ATOM   3121 O O   . LYS B 1 177 ? -30.329 29.053 34.682 1.00 10.96 ? 177 LYS B O   1 
ATOM   3122 C CB  . LYS B 1 177 ? -29.833 25.938 34.317 1.00 10.96 ? 177 LYS B CB  1 
ATOM   3123 C CG  . LYS B 1 177 ? -28.763 25.106 33.598 1.00 34.36 ? 177 LYS B CG  1 
ATOM   3124 C CD  . LYS B 1 177 ? -29.305 24.383 32.368 1.00 34.36 ? 177 LYS B CD  1 
ATOM   3125 C CE  . LYS B 1 177 ? -28.217 23.428 31.842 1.00 34.36 ? 177 LYS B CE  1 
ATOM   3126 N NZ  . LYS B 1 177 ? -28.719 22.769 30.640 1.00 34.36 ? 177 LYS B NZ  1 
ATOM   3127 N N   . ASP B 1 178 ? -32.091 27.686 35.171 1.00 22.68 ? 178 ASP B N   1 
ATOM   3128 C CA  . ASP B 1 178 ? -32.742 28.572 36.169 1.00 22.68 ? 178 ASP B CA  1 
ATOM   3129 C C   . ASP B 1 178 ? -31.894 28.929 37.369 1.00 22.68 ? 178 ASP B C   1 
ATOM   3130 O O   . ASP B 1 178 ? -32.241 29.885 38.099 1.00 22.68 ? 178 ASP B O   1 
ATOM   3131 C CB  . ASP B 1 178 ? -33.974 27.879 36.806 1.00 22.68 ? 178 ASP B CB  1 
ATOM   3132 C CG  . ASP B 1 178 ? -35.014 27.699 35.709 1.00 39.67 ? 178 ASP B CG  1 
ATOM   3133 O OD1 . ASP B 1 178 ? -35.102 28.560 34.790 1.00 39.67 ? 178 ASP B OD1 1 
ATOM   3134 O OD2 . ASP B 1 178 ? -35.850 26.755 35.800 1.00 39.67 ? 178 ASP B OD2 1 
ATOM   3135 N N   . ALA B 1 179 ? -30.915 28.138 37.709 1.00 10.56 ? 179 ALA B N   1 
ATOM   3136 C CA  . ALA B 1 179 ? -30.108 28.511 38.863 1.00 10.56 ? 179 ALA B CA  1 
ATOM   3137 C C   . ALA B 1 179 ? -28.940 29.446 38.528 1.00 10.56 ? 179 ALA B C   1 
ATOM   3138 O O   . ALA B 1 179 ? -27.961 29.547 39.306 1.00 10.56 ? 179 ALA B O   1 
ATOM   3139 C CB  . ALA B 1 179 ? -29.618 27.276 39.670 1.00 10.56 ? 179 ALA B CB  1 
ATOM   3140 N N   . MET B 1 180 ? -28.996 29.992 37.320 1.00 11.21 ? 180 MET B N   1 
ATOM   3141 C CA  . MET B 1 180 ? -28.048 30.987 36.824 1.00 11.21 ? 180 MET B CA  1 
ATOM   3142 C C   . MET B 1 180 ? -28.724 32.339 36.607 1.00 11.21 ? 180 MET B C   1 
ATOM   3143 O O   . MET B 1 180 ? -29.952 32.383 36.348 1.00 11.21 ? 180 MET B O   1 
ATOM   3144 C CB  . MET B 1 180 ? -27.381 30.520 35.501 1.00 11.21 ? 180 MET B CB  1 
ATOM   3145 C CG  . MET B 1 180 ? -26.531 29.248 35.586 1.00 8.94  ? 180 MET B CG  1 
ATOM   3146 S SD  . MET B 1 180 ? -26.110 28.516 33.962 1.00 8.94  ? 180 MET B SD  1 
ATOM   3147 C CE  . MET B 1 180 ? -25.437 26.898 34.395 1.00 8.94  ? 180 MET B CE  1 
ATOM   3148 N N   . ILE B 1 181 ? -27.904 33.395 36.461 1.00 9.71  ? 181 ILE B N   1 
ATOM   3149 C CA  . ILE B 1 181 ? -28.271 34.763 36.025 1.00 9.71  ? 181 ILE B CA  1 
ATOM   3150 C C   . ILE B 1 181 ? -27.133 35.355 35.187 1.00 9.71  ? 181 ILE B C   1 
ATOM   3151 O O   . ILE B 1 181 ? -25.935 35.189 35.531 1.00 9.71  ? 181 ILE B O   1 
ATOM   3152 C CB  . ILE B 1 181 ? -28.632 35.679 37.249 1.00 9.71  ? 181 ILE B CB  1 
ATOM   3153 C CG1 . ILE B 1 181 ? -29.403 36.981 36.894 1.00 0.74  ? 181 ILE B CG1 1 
ATOM   3154 C CG2 . ILE B 1 181 ? -27.509 35.891 38.314 1.00 0.74  ? 181 ILE B CG2 1 
ATOM   3155 C CD1 . ILE B 1 181 ? -29.924 37.639 38.180 1.00 0.74  ? 181 ILE B CD1 1 
ATOM   3156 N N   . CYS B 1 182 ? -27.456 36.121 34.188 1.00 14.54 ? 182 CYS B N   1 
ATOM   3157 C CA  . CYS B 1 182 ? -26.447 36.790 33.380 1.00 14.54 ? 182 CYS B CA  1 
ATOM   3158 C C   . CYS B 1 182 ? -26.352 38.318 33.564 1.00 14.54 ? 182 CYS B C   1 
ATOM   3159 O O   . CYS B 1 182 ? -27.353 38.965 33.906 1.00 14.54 ? 182 CYS B O   1 
ATOM   3160 C CB  . CYS B 1 182 ? -26.729 36.491 31.912 1.00 14.54 ? 182 CYS B CB  1 
ATOM   3161 S SG  . CYS B 1 182 ? -26.864 34.730 31.615 1.00 11.48 ? 182 CYS B SG  1 
ATOM   3162 N N   . ALA B 1 183 ? -25.205 38.890 33.339 1.00 13.04 ? 183 ALA B N   1 
ATOM   3163 C CA  . ALA B 1 183 ? -25.106 40.330 33.484 1.00 13.04 ? 183 ALA B CA  1 
ATOM   3164 C C   . ALA B 1 183 ? -24.143 40.890 32.452 1.00 13.04 ? 183 ALA B C   1 
ATOM   3165 O O   . ALA B 1 183 ? -23.102 40.226 32.189 1.00 13.04 ? 183 ALA B O   1 
ATOM   3166 C CB  . ALA B 1 183 ? -24.731 40.664 34.948 1.00 13.04 ? 183 ALA B CB  1 
ATOM   3167 N N   . GLY B 1 184 ? -24.426 42.045 31.860 1.00 19.65 ? 184 GLY B N   1 
ATOM   3168 C CA  . GLY B 1 184 ? -23.412 42.631 30.937 1.00 19.65 ? 184 GLY B CA  1 
ATOM   3169 C C   . GLY B 1 184 ? -23.863 42.796 29.497 1.00 19.65 ? 184 GLY B C   1 
ATOM   3170 O O   . GLY B 1 184 ? -25.040 43.202 29.287 1.00 19.65 ? 184 GLY B O   1 
ATOM   3171 N N   . ALA B 1 185 ? -22.942 42.509 28.545 1.00 21.68 ? 185 ALA B N   1 
ATOM   3172 C CA  . ALA B 1 185 ? -23.157 42.690 27.075 1.00 21.68 ? 185 ALA B CA  1 
ATOM   3173 C C   . ALA B 1 185 ? -23.464 44.147 26.715 1.00 21.68 ? 185 ALA B C   1 
ATOM   3174 O O   . ALA B 1 185 ? -24.319 44.450 25.864 1.00 21.68 ? 185 ALA B O   1 
ATOM   3175 C CB  . ALA B 1 185 ? -24.250 41.760 26.475 1.00 21.68 ? 185 ALA B CB  1 
ATOM   3176 N N   . SER B 1 186 ? -23.085 44.992 27.616 1.00 21.68 ? 186 SER B N   1 
ATOM   3177 C CA  . SER B 1 186 ? -23.473 46.372 27.780 1.00 21.68 ? 186 SER B CA  1 
ATOM   3178 C C   . SER B 1 186 ? -22.420 47.342 27.205 1.00 21.68 ? 186 SER B C   1 
ATOM   3179 O O   . SER B 1 186 ? -22.540 48.572 27.390 1.00 21.68 ? 186 SER B O   1 
ATOM   3180 C CB  . SER B 1 186 ? -23.455 46.384 29.328 1.00 21.68 ? 186 SER B CB  1 
ATOM   3181 O OG  . SER B 1 186 ? -23.517 47.678 29.848 1.00 42.04 ? 186 SER B OG  1 
ATOM   3182 N N   . GLY B 1 187 ? -21.289 46.847 26.717 1.00 14.34 ? 187 GLY B N   1 
ATOM   3183 C CA  . GLY B 1 187 ? -20.168 47.730 26.363 1.00 14.34 ? 187 GLY B CA  1 
ATOM   3184 C C   . GLY B 1 187 ? -18.988 47.654 27.348 1.00 14.34 ? 187 GLY B C   1 
ATOM   3185 O O   . GLY B 1 187 ? -17.937 48.319 27.192 1.00 14.34 ? 187 GLY B O   1 
ATOM   3186 N N   . VAL B 1 188 ? -19.151 46.802 28.297 1.00 19.77 ? 188 VAL B N   1 
ATOM   3187 C CA  . VAL B 1 188 ? -18.145 46.458 29.306 1.00 19.77 ? 188 VAL B CA  1 
ATOM   3188 C C   . VAL B 1 188 ? -18.003 44.943 29.501 1.00 19.77 ? 188 VAL B C   1 
ATOM   3189 O O   . VAL B 1 188 ? -19.007 44.204 29.327 1.00 19.77 ? 188 VAL B O   1 
ATOM   3190 C CB  . VAL B 1 188 ? -18.462 47.196 30.622 1.00 19.77 ? 188 VAL B CB  1 
ATOM   3191 C CG1 . VAL B 1 188 ? -19.813 46.774 31.231 1.00 10.16 ? 188 VAL B CG1 1 
ATOM   3192 C CG2 . VAL B 1 188 ? -17.332 47.172 31.645 1.00 10.16 ? 188 VAL B CG2 1 
ATOM   3193 N N   . SER B 1 189 ? -16.766 44.494 29.794 1.00 14.58 ? 189 SER B N   1 
ATOM   3194 C CA  . SER B 1 189 ? -16.502 43.078 29.937 1.00 14.58 ? 189 SER B CA  1 
ATOM   3195 C C   . SER B 1 189 ? -16.837 42.686 31.364 1.00 14.58 ? 189 SER B C   1 
ATOM   3196 O O   . SER B 1 189 ? -16.898 43.600 32.222 1.00 14.58 ? 189 SER B O   1 
ATOM   3197 C CB  . SER B 1 189 ? -15.039 42.752 29.599 1.00 14.58 ? 189 SER B CB  1 
ATOM   3198 O OG  . SER B 1 189 ? -14.220 42.884 30.720 1.00 42.00 ? 189 SER B OG  1 
ATOM   3199 N N   . SER B 1 190 ? -17.019 41.421 31.656 1.00 10.12 ? 190 SER B N   1 
ATOM   3200 C CA  . SER B 1 190 ? -17.188 41.061 33.048 1.00 10.12 ? 190 SER B CA  1 
ATOM   3201 C C   . SER B 1 190 ? -15.941 40.406 33.643 1.00 10.12 ? 190 SER B C   1 
ATOM   3202 O O   . SER B 1 190 ? -16.030 39.824 34.734 1.00 10.12 ? 190 SER B O   1 
ATOM   3203 C CB  . SER B 1 190 ? -18.361 40.095 33.160 1.00 10.12 ? 190 SER B CB  1 
ATOM   3204 O OG  . SER B 1 190 ? -18.086 38.928 32.363 1.00 16.96 ? 190 SER B OG  1 
ATOM   3205 N N   . CYS B 1 191 ? -14.868 40.465 32.928 1.00 14.16 ? 191 CYS B N   1 
ATOM   3206 C CA  . CYS B 1 191 ? -13.753 39.616 33.261 1.00 14.16 ? 191 CYS B CA  1 
ATOM   3207 C C   . CYS B 1 191 ? -12.893 40.146 34.384 1.00 14.16 ? 191 CYS B C   1 
ATOM   3208 O O   . CYS B 1 191 ? -11.855 39.499 34.682 1.00 14.16 ? 191 CYS B O   1 
ATOM   3209 C CB  . CYS B 1 191 ? -12.790 39.436 32.076 1.00 14.16 ? 191 CYS B CB  1 
ATOM   3210 S SG  . CYS B 1 191 ? -13.329 38.190 30.901 1.00 23.76 ? 191 CYS B SG  1 
ATOM   3211 N N   . MET B 1 192 ? -13.279 41.234 34.968 1.00 18.88 ? 192 MET B N   1 
ATOM   3212 C CA  . MET B 1 192 ? -12.601 41.631 36.179 1.00 18.88 ? 192 MET B CA  1 
ATOM   3213 C C   . MET B 1 192 ? -13.036 40.752 37.336 1.00 18.88 ? 192 MET B C   1 
ATOM   3214 O O   . MET B 1 192 ? -12.274 40.623 38.312 1.00 18.88 ? 192 MET B O   1 
ATOM   3215 C CB  . MET B 1 192 ? -12.743 43.128 36.541 1.00 18.88 ? 192 MET B CB  1 
ATOM   3216 C CG  . MET B 1 192 ? -14.161 43.604 36.869 1.00 24.82 ? 192 MET B CG  1 
ATOM   3217 S SD  . MET B 1 192 ? -15.352 43.620 35.525 1.00 24.82 ? 192 MET B SD  1 
ATOM   3218 C CE  . MET B 1 192 ? -14.364 44.294 34.175 1.00 24.82 ? 192 MET B CE  1 
ATOM   3219 N N   . GLY B 1 193 ? -14.220 40.161 37.286 1.00 10.52 ? 193 GLY B N   1 
ATOM   3220 C CA  . GLY B 1 193 ? -14.581 39.402 38.456 1.00 10.52 ? 193 GLY B CA  1 
ATOM   3221 C C   . GLY B 1 193 ? -13.832 38.101 38.413 1.00 10.52 ? 193 GLY B C   1 
ATOM   3222 O O   . GLY B 1 193 ? -13.559 37.634 37.270 1.00 10.52 ? 193 GLY B O   1 
ATOM   3223 N N   . ASP B 1 194 ? -13.328 37.707 39.577 1.00 13.73 ? 194 ASP B N   1 
ATOM   3224 C CA  . ASP B 1 194 ? -12.618 36.401 39.677 1.00 13.73 ? 194 ASP B CA  1 
ATOM   3225 C C   . ASP B 1 194 ? -13.636 35.273 39.667 1.00 13.73 ? 194 ASP B C   1 
ATOM   3226 O O   . ASP B 1 194 ? -14.769 35.495 40.158 1.00 13.73 ? 194 ASP B O   1 
ATOM   3227 C CB  . ASP B 1 194 ? -11.813 36.268 40.975 1.00 13.73 ? 194 ASP B CB  1 
ATOM   3228 C CG  . ASP B 1 194 ? -10.832 37.427 41.141 1.00 16.03 ? 194 ASP B CG  1 
ATOM   3229 O OD1 . ASP B 1 194 ? -9.812  37.485 40.420 1.00 16.03 ? 194 ASP B OD1 1 
ATOM   3230 O OD2 . ASP B 1 194 ? -11.267 38.473 41.645 1.00 16.03 ? 194 ASP B OD2 1 
ATOM   3231 N N   . SER B 1 195 ? -13.240 34.074 39.318 1.00 10.86 ? 195 SER B N   1 
ATOM   3232 C CA  . SER B 1 195 ? -14.249 32.995 39.483 1.00 10.86 ? 195 SER B CA  1 
ATOM   3233 C C   . SER B 1 195 ? -14.639 32.739 40.969 1.00 10.86 ? 195 SER B C   1 
ATOM   3234 O O   . SER B 1 195 ? -13.804 32.916 41.896 1.00 10.86 ? 195 SER B O   1 
ATOM   3235 C CB  . SER B 1 195 ? -13.854 31.741 38.612 1.00 10.86 ? 195 SER B CB  1 
ATOM   3236 O OG  . SER B 1 195 ? -12.777 31.102 39.232 1.00 39.96 ? 195 SER B OG  1 
ATOM   3237 N N   . GLY B 1 196 ? -15.905 32.688 41.326 1.00 4.33  ? 196 GLY B N   1 
ATOM   3238 C CA  . GLY B 1 196 ? -16.319 32.691 42.776 1.00 4.33  ? 196 GLY B CA  1 
ATOM   3239 C C   . GLY B 1 196 ? -16.513 34.099 43.366 1.00 4.33  ? 196 GLY B C   1 
ATOM   3240 O O   . GLY B 1 196 ? -16.944 34.244 44.544 1.00 4.33  ? 196 GLY B O   1 
ATOM   3241 N N   . GLY B 1 197 ? -16.194 35.136 42.610 1.00 9.60  ? 197 GLY B N   1 
ATOM   3242 C CA  . GLY B 1 197 ? -16.307 36.510 43.095 1.00 9.60  ? 197 GLY B CA  1 
ATOM   3243 C C   . GLY B 1 197 ? -17.737 37.048 43.044 1.00 9.60  ? 197 GLY B C   1 
ATOM   3244 O O   . GLY B 1 197 ? -18.686 36.391 42.514 1.00 9.60  ? 197 GLY B O   1 
ATOM   3245 N N   . PRO B 1 198 ? -17.906 38.283 43.571 1.00 13.37 ? 198 PRO B N   1 
ATOM   3246 C CA  . PRO B 1 198 ? -19.216 38.896 43.736 1.00 13.37 ? 198 PRO B CA  1 
ATOM   3247 C C   . PRO B 1 198 ? -19.829 39.553 42.475 1.00 13.37 ? 198 PRO B C   1 
ATOM   3248 O O   . PRO B 1 198 ? -19.180 40.311 41.716 1.00 13.37 ? 198 PRO B O   1 
ATOM   3249 C CB  . PRO B 1 198 ? -19.090 39.907 44.902 1.00 13.37 ? 198 PRO B CB  1 
ATOM   3250 C CG  . PRO B 1 198 ? -17.606 40.144 45.091 1.00 0.10  ? 198 PRO B CG  1 
ATOM   3251 C CD  . PRO B 1 198 ? -16.891 39.071 44.281 1.00 0.10  ? 198 PRO B CD  1 
ATOM   3252 N N   . LEU B 1 199 ? -21.117 39.464 42.434 1.00 7.19  ? 199 LEU B N   1 
ATOM   3253 C CA  . LEU B 1 199 ? -22.026 40.310 41.671 1.00 7.19  ? 199 LEU B CA  1 
ATOM   3254 C C   . LEU B 1 199 ? -23.021 40.924 42.657 1.00 7.19  ? 199 LEU B C   1 
ATOM   3255 O O   . LEU B 1 199 ? -23.834 40.186 43.250 1.00 7.19  ? 199 LEU B O   1 
ATOM   3256 C CB  . LEU B 1 199 ? -22.820 39.484 40.629 1.00 7.19  ? 199 LEU B CB  1 
ATOM   3257 C CG  . LEU B 1 199 ? -23.678 40.423 39.780 1.00 4.08  ? 199 LEU B CG  1 
ATOM   3258 C CD1 . LEU B 1 199 ? -22.815 41.384 38.891 1.00 4.08  ? 199 LEU B CD1 1 
ATOM   3259 C CD2 . LEU B 1 199 ? -24.701 39.699 38.909 1.00 4.08  ? 199 LEU B CD2 1 
ATOM   3260 N N   . VAL B 1 200 ? -22.934 42.172 42.978 1.00 10.08 ? 200 VAL B N   1 
ATOM   3261 C CA  . VAL B 1 200 ? -23.753 42.782 44.015 1.00 10.08 ? 200 VAL B CA  1 
ATOM   3262 C C   . VAL B 1 200 ? -24.734 43.873 43.528 1.00 10.08 ? 200 VAL B C   1 
ATOM   3263 O O   . VAL B 1 200 ? -24.408 44.728 42.645 1.00 10.08 ? 200 VAL B O   1 
ATOM   3264 C CB  . VAL B 1 200 ? -22.935 43.236 45.233 1.00 10.08 ? 200 VAL B CB  1 
ATOM   3265 C CG1 . VAL B 1 200 ? -22.340 42.094 46.063 1.00 2.86  ? 200 VAL B CG1 1 
ATOM   3266 C CG2 . VAL B 1 200 ? -22.047 44.518 45.022 1.00 2.86  ? 200 VAL B CG2 1 
ATOM   3267 N N   . CYS B 1 201 ? -25.925 43.815 44.130 1.00 9.59  ? 201 CYS B N   1 
ATOM   3268 C CA  . CYS B 1 201 ? -27.000 44.822 43.877 1.00 9.59  ? 201 CYS B CA  1 
ATOM   3269 C C   . CYS B 1 201 ? -27.470 45.508 45.153 1.00 9.59  ? 201 CYS B C   1 
ATOM   3270 O O   . CYS B 1 201 ? -27.577 44.809 46.183 1.00 9.59  ? 201 CYS B O   1 
ATOM   3271 C CB  . CYS B 1 201 ? -28.225 44.195 43.159 1.00 9.59  ? 201 CYS B CB  1 
ATOM   3272 S SG  . CYS B 1 201 ? -27.819 43.262 41.688 1.00 10.99 ? 201 CYS B SG  1 
ATOM   3273 N N   . LYS B 1 202 ? -27.762 46.779 45.087 1.00 29.24 ? 202 LYS B N   1 
ATOM   3274 C CA  . LYS B 1 202 ? -28.243 47.457 46.297 1.00 29.24 ? 202 LYS B CA  1 
ATOM   3275 C C   . LYS B 1 202 ? -29.754 47.514 46.542 1.00 29.24 ? 202 LYS B C   1 
ATOM   3276 O O   . LYS B 1 202 ? -30.499 47.795 45.586 1.00 29.24 ? 202 LYS B O   1 
ATOM   3277 C CB  . LYS B 1 202 ? -27.420 48.689 46.725 1.00 29.24 ? 202 LYS B CB  1 
ATOM   3278 C CG  . LYS B 1 202 ? -27.682 49.947 45.913 1.00 40.86 ? 202 LYS B CG  1 
ATOM   3279 C CD  . LYS B 1 202 ? -26.674 51.018 46.360 1.00 40.86 ? 202 LYS B CD  1 
ATOM   3280 C CE  . LYS B 1 202 ? -26.501 51.079 47.894 1.00 40.86 ? 202 LYS B CE  1 
ATOM   3281 N NZ  . LYS B 1 202 ? -25.570 52.193 48.296 1.00 40.86 ? 202 LYS B NZ  1 
ATOM   3282 N N   . LYS B 1 203 ? -30.209 46.888 47.611 1.00 20.84 ? 203 LYS B N   1 
ATOM   3283 C CA  . LYS B 1 203 ? -31.638 46.566 47.913 1.00 20.84 ? 203 LYS B CA  1 
ATOM   3284 C C   . LYS B 1 203 ? -31.931 47.052 49.321 1.00 20.84 ? 203 LYS B C   1 
ATOM   3285 O O   . LYS B 1 203 ? -31.089 46.755 50.189 1.00 20.84 ? 203 LYS B O   1 
ATOM   3286 C CB  . LYS B 1 203 ? -31.739 45.019 47.897 1.00 20.84 ? 203 LYS B CB  1 
ATOM   3287 C CG  . LYS B 1 203 ? -33.024 44.333 48.443 1.00 34.54 ? 203 LYS B CG  1 
ATOM   3288 C CD  . LYS B 1 203 ? -34.272 44.435 47.523 1.00 34.54 ? 203 LYS B CD  1 
ATOM   3289 C CE  . LYS B 1 203 ? -34.063 43.919 46.067 1.00 34.54 ? 203 LYS B CE  1 
ATOM   3290 N NZ  . LYS B 1 203 ? -35.315 43.557 45.335 1.00 34.54 ? 203 LYS B NZ  1 
ATOM   3291 N N   . ASN B 1 204 ? -32.720 48.103 49.491 1.00 22.02 ? 204 ASN B N   1 
ATOM   3292 C CA  . ASN B 1 204 ? -32.906 48.851 50.737 1.00 22.02 ? 204 ASN B CA  1 
ATOM   3293 C C   . ASN B 1 204 ? -31.632 49.467 51.253 1.00 22.02 ? 204 ASN B C   1 
ATOM   3294 O O   . ASN B 1 204 ? -31.449 49.637 52.485 1.00 22.02 ? 204 ASN B O   1 
ATOM   3295 C CB  . ASN B 1 204 ? -33.538 48.003 51.851 1.00 22.02 ? 204 ASN B CB  1 
ATOM   3296 C CG  . ASN B 1 204 ? -34.949 47.563 51.453 1.00 30.14 ? 204 ASN B CG  1 
ATOM   3297 O OD1 . ASN B 1 204 ? -35.462 48.034 50.400 1.00 30.14 ? 204 ASN B OD1 1 
ATOM   3298 N ND2 . ASN B 1 204 ? -35.267 46.375 51.891 1.00 30.14 ? 204 ASN B ND2 1 
ATOM   3299 N N   . GLY B 1 205 ? -30.870 49.989 50.334 1.00 22.62 ? 205 GLY B N   1 
ATOM   3300 C CA  . GLY B 1 205 ? -29.713 50.823 50.731 1.00 22.62 ? 205 GLY B CA  1 
ATOM   3301 C C   . GLY B 1 205 ? -28.506 49.985 51.141 1.00 22.62 ? 205 GLY B C   1 
ATOM   3302 O O   . GLY B 1 205 ? -27.399 50.524 51.295 1.00 22.62 ? 205 GLY B O   1 
ATOM   3303 N N   . ALA B 1 206 ? -28.681 48.695 51.092 1.00 18.19 ? 206 ALA B N   1 
ATOM   3304 C CA  . ALA B 1 206 ? -27.679 47.642 51.405 1.00 18.19 ? 206 ALA B CA  1 
ATOM   3305 C C   . ALA B 1 206 ? -27.204 46.837 50.187 1.00 18.19 ? 206 ALA B C   1 
ATOM   3306 O O   . ALA B 1 206 ? -28.030 46.379 49.378 1.00 18.19 ? 206 ALA B O   1 
ATOM   3307 C CB  . ALA B 1 206 ? -28.374 46.680 52.409 1.00 18.19 ? 206 ALA B CB  1 
ATOM   3308 N N   . TRP B 1 207 ? -25.899 46.706 50.008 1.00 9.66  ? 207 TRP B N   1 
ATOM   3309 C CA  . TRP B 1 207 ? -25.350 45.913 48.919 1.00 9.66  ? 207 TRP B CA  1 
ATOM   3310 C C   . TRP B 1 207 ? -25.595 44.443 49.204 1.00 9.66  ? 207 TRP B C   1 
ATOM   3311 O O   . TRP B 1 207 ? -25.304 43.920 50.310 1.00 9.66  ? 207 TRP B O   1 
ATOM   3312 C CB  . TRP B 1 207 ? -23.820 46.110 48.820 1.00 9.66  ? 207 TRP B CB  1 
ATOM   3313 C CG  . TRP B 1 207 ? -23.454 47.502 48.259 1.00 9.96  ? 207 TRP B CG  1 
ATOM   3314 C CD1 . TRP B 1 207 ? -22.947 48.581 48.879 1.00 9.96  ? 207 TRP B CD1 1 
ATOM   3315 C CD2 . TRP B 1 207 ? -23.594 47.870 46.919 1.00 9.96  ? 207 TRP B CD2 1 
ATOM   3316 N NE1 . TRP B 1 207 ? -22.759 49.605 47.921 1.00 9.96  ? 207 TRP B NE1 1 
ATOM   3317 C CE2 . TRP B 1 207 ? -23.131 49.185 46.792 1.00 9.96  ? 207 TRP B CE2 1 
ATOM   3318 C CE3 . TRP B 1 207 ? -24.053 47.154 45.827 1.00 9.96  ? 207 TRP B CE3 1 
ATOM   3319 C CZ2 . TRP B 1 207 ? -23.119 49.863 45.607 1.00 9.96  ? 207 TRP B CZ2 1 
ATOM   3320 C CZ3 . TRP B 1 207 ? -24.029 47.839 44.598 1.00 9.96  ? 207 TRP B CZ3 1 
ATOM   3321 C CH2 . TRP B 1 207 ? -23.577 49.158 44.516 1.00 9.96  ? 207 TRP B CH2 1 
ATOM   3322 N N   . THR B 1 208 ? -26.189 43.807 48.262 1.00 16.27 ? 208 THR B N   1 
ATOM   3323 C CA  . THR B 1 208 ? -26.594 42.410 48.424 1.00 16.27 ? 208 THR B CA  1 
ATOM   3324 C C   . THR B 1 208 ? -26.143 41.468 47.306 1.00 16.27 ? 208 THR B C   1 
ATOM   3325 O O   . THR B 1 208 ? -26.106 41.871 46.120 1.00 16.27 ? 208 THR B O   1 
ATOM   3326 C CB  . THR B 1 208 ? -28.082 42.275 48.884 1.00 16.27 ? 208 THR B CB  1 
ATOM   3327 O OG1 . THR B 1 208 ? -28.863 41.104 48.496 1.00 6.60  ? 208 THR B OG1 1 
ATOM   3328 C CG2 . THR B 1 208 ? -28.872 43.541 48.940 1.00 6.60  ? 208 THR B CG2 1 
ATOM   3329 N N   . LEU B 1 209 ? -25.714 40.267 47.740 1.00 12.72 ? 209 LEU B N   1 
ATOM   3330 C CA  . LEU B 1 209 ? -25.195 39.198 46.849 1.00 12.72 ? 209 LEU B CA  1 
ATOM   3331 C C   . LEU B 1 209 ? -26.248 38.556 45.940 1.00 12.72 ? 209 LEU B C   1 
ATOM   3332 O O   . LEU B 1 209 ? -27.144 37.810 46.413 1.00 12.72 ? 209 LEU B O   1 
ATOM   3333 C CB  . LEU B 1 209 ? -24.382 38.141 47.617 1.00 12.72 ? 209 LEU B CB  1 
ATOM   3334 C CG  . LEU B 1 209 ? -23.397 37.327 46.716 1.00 8.84  ? 209 LEU B CG  1 
ATOM   3335 C CD1 . LEU B 1 209 ? -22.113 38.115 46.366 1.00 8.84  ? 209 LEU B CD1 1 
ATOM   3336 C CD2 . LEU B 1 209 ? -22.970 35.997 47.395 1.00 8.84  ? 209 LEU B CD2 1 
ATOM   3337 N N   . VAL B 1 210 ? -26.211 38.907 44.718 1.00 9.35  ? 210 VAL B N   1 
ATOM   3338 C CA  . VAL B 1 210 ? -27.102 38.410 43.660 1.00 9.35  ? 210 VAL B CA  1 
ATOM   3339 C C   . VAL B 1 210 ? -26.488 37.348 42.770 1.00 9.35  ? 210 VAL B C   1 
ATOM   3340 O O   . VAL B 1 210 ? -27.192 36.361 42.392 1.00 9.35  ? 210 VAL B O   1 
ATOM   3341 C CB  . VAL B 1 210 ? -27.655 39.636 42.912 1.00 9.35  ? 210 VAL B CB  1 
ATOM   3342 C CG1 . VAL B 1 210 ? -28.221 39.379 41.505 1.00 9.69  ? 210 VAL B CG1 1 
ATOM   3343 C CG2 . VAL B 1 210 ? -28.685 40.328 43.839 1.00 9.69  ? 210 VAL B CG2 1 
ATOM   3344 N N   . GLY B 1 211 ? -25.175 37.448 42.634 1.00 9.05  ? 211 GLY B N   1 
ATOM   3345 C CA  . GLY B 1 211 ? -24.469 36.456 41.796 1.00 9.05  ? 211 GLY B CA  1 
ATOM   3346 C C   . GLY B 1 211 ? -23.045 36.061 42.174 1.00 9.05  ? 211 GLY B C   1 
ATOM   3347 O O   . GLY B 1 211 ? -22.399 36.676 43.043 1.00 9.05  ? 211 GLY B O   1 
ATOM   3348 N N   . ILE B 1 212 ? -22.619 34.931 41.698 1.00 8.22  ? 212 ILE B N   1 
ATOM   3349 C CA  . ILE B 1 212 ? -21.269 34.438 42.005 1.00 8.22  ? 212 ILE B CA  1 
ATOM   3350 C C   . ILE B 1 212 ? -20.624 34.063 40.702 1.00 8.22  ? 212 ILE B C   1 
ATOM   3351 O O   . ILE B 1 212 ? -21.311 33.311 39.960 1.00 8.22  ? 212 ILE B O   1 
ATOM   3352 C CB  . ILE B 1 212 ? -21.335 33.151 42.888 1.00 8.22  ? 212 ILE B CB  1 
ATOM   3353 C CG1 . ILE B 1 212 ? -21.987 33.443 44.280 1.00 10.00 ? 212 ILE B CG1 1 
ATOM   3354 C CG2 . ILE B 1 212 ? -19.970 32.401 43.100 1.00 10.00 ? 212 ILE B CG2 1 
ATOM   3355 C CD1 . ILE B 1 212 ? -22.398 32.117 44.962 1.00 10.00 ? 212 ILE B CD1 1 
ATOM   3356 N N   . VAL B 1 213 ? -19.482 34.664 40.358 1.00 13.38 ? 213 VAL B N   1 
ATOM   3357 C CA  . VAL B 1 213 ? -18.834 34.358 39.051 1.00 13.38 ? 213 VAL B CA  1 
ATOM   3358 C C   . VAL B 1 213 ? -18.658 32.879 38.759 1.00 13.38 ? 213 VAL B C   1 
ATOM   3359 O O   . VAL B 1 213 ? -17.831 32.211 39.436 1.00 13.38 ? 213 VAL B O   1 
ATOM   3360 C CB  . VAL B 1 213 ? -17.442 34.957 38.839 1.00 13.38 ? 213 VAL B CB  1 
ATOM   3361 C CG1 . VAL B 1 213 ? -16.894 34.584 37.422 1.00 8.45  ? 213 VAL B CG1 1 
ATOM   3362 C CG2 . VAL B 1 213 ? -17.513 36.463 39.013 1.00 8.45  ? 213 VAL B CG2 1 
ATOM   3363 N N   . SER B 1 214 ? -19.292 32.475 37.683 1.00 1.79  ? 214 SER B N   1 
ATOM   3364 C CA  . SER B 1 214 ? -19.295 31.146 37.192 1.00 1.79  ? 214 SER B CA  1 
ATOM   3365 C C   . SER B 1 214 ? -18.545 31.024 35.886 1.00 1.79  ? 214 SER B C   1 
ATOM   3366 O O   . SER B 1 214 ? -17.459 30.411 35.905 1.00 1.79  ? 214 SER B O   1 
ATOM   3367 C CB  . SER B 1 214 ? -20.774 30.638 37.211 1.00 1.79  ? 214 SER B CB  1 
ATOM   3368 O OG  . SER B 1 214 ? -20.779 29.235 37.303 1.00 30.59 ? 214 SER B OG  1 
ATOM   3369 N N   . TRP B 1 215 ? -18.889 31.722 34.862 1.00 19.32 ? 215 TRP B N   1 
ATOM   3370 C CA  . TRP B 1 215 ? -18.043 31.745 33.635 1.00 19.32 ? 215 TRP B CA  1 
ATOM   3371 C C   . TRP B 1 215 ? -18.355 32.993 32.771 1.00 19.32 ? 215 TRP B C   1 
ATOM   3372 O O   . TRP B 1 215 ? -19.303 33.740 33.103 1.00 19.32 ? 215 TRP B O   1 
ATOM   3373 C CB  . TRP B 1 215 ? -18.223 30.400 32.796 1.00 19.32 ? 215 TRP B CB  1 
ATOM   3374 C CG  . TRP B 1 215 ? -19.651 29.715 32.814 1.00 18.37 ? 215 TRP B CG  1 
ATOM   3375 C CD1 . TRP B 1 215 ? -20.289 29.005 33.808 1.00 18.37 ? 215 TRP B CD1 1 
ATOM   3376 C CD2 . TRP B 1 215 ? -20.562 29.697 31.783 1.00 18.37 ? 215 TRP B CD2 1 
ATOM   3377 N NE1 . TRP B 1 215 ? -21.591 28.562 33.430 1.00 18.37 ? 215 TRP B NE1 1 
ATOM   3378 C CE2 . TRP B 1 215 ? -21.729 28.971 32.245 1.00 18.37 ? 215 TRP B CE2 1 
ATOM   3379 C CE3 . TRP B 1 215 ? -20.456 30.241 30.545 1.00 18.37 ? 215 TRP B CE3 1 
ATOM   3380 C CZ2 . TRP B 1 215 ? -22.824 28.746 31.480 1.00 18.37 ? 215 TRP B CZ2 1 
ATOM   3381 C CZ3 . TRP B 1 215 ? -21.540 29.968 29.769 1.00 18.37 ? 215 TRP B CZ3 1 
ATOM   3382 C CH2 . TRP B 1 215 ? -22.681 29.244 30.216 1.00 18.37 ? 215 TRP B CH2 1 
ATOM   3383 N N   . GLY B 1 216 ? -17.537 33.301 31.757 1.00 10.10 ? 216 GLY B N   1 
ATOM   3384 C CA  . GLY B 1 216 ? -17.764 34.448 30.844 1.00 10.10 ? 216 GLY B CA  1 
ATOM   3385 C C   . GLY B 1 216 ? -17.304 34.181 29.409 1.00 10.10 ? 216 GLY B C   1 
ATOM   3386 O O   . GLY B 1 216 ? -17.067 33.036 28.977 1.00 10.10 ? 216 GLY B O   1 
ATOM   3387 N N   . SER B 1 217 ? -17.205 35.217 28.622 1.00 8.22  ? 217 SER B N   1 
ATOM   3388 C CA  . SER B 1 217 ? -16.700 35.206 27.254 1.00 8.22  ? 217 SER B CA  1 
ATOM   3389 C C   . SER B 1 217 ? -15.236 34.742 27.183 1.00 8.22  ? 217 SER B C   1 
ATOM   3390 O O   . SER B 1 217 ? -14.374 35.283 27.933 1.00 8.22  ? 217 SER B O   1 
ATOM   3391 C CB  . SER B 1 217 ? -16.791 36.669 26.744 1.00 8.22  ? 217 SER B CB  1 
ATOM   3392 O OG  . SER B 1 217 ? -16.110 36.831 25.486 1.00 21.29 ? 217 SER B OG  1 
ATOM   3393 N N   . SER B 1 218 ? -14.994 33.821 26.287 1.00 20.90 ? 218 SER B N   1 
ATOM   3394 C CA  . SER B 1 218 ? -13.638 33.281 26.054 1.00 20.90 ? 218 SER B CA  1 
ATOM   3395 C C   . SER B 1 218 ? -12.587 34.305 25.636 1.00 20.90 ? 218 SER B C   1 
ATOM   3396 O O   . SER B 1 218 ? -11.359 34.105 25.872 1.00 20.90 ? 218 SER B O   1 
ATOM   3397 C CB  . SER B 1 218 ? -13.606 32.022 25.151 1.00 20.90 ? 218 SER B CB  1 
ATOM   3398 O OG  . SER B 1 218 ? -14.162 32.318 23.855 1.00 33.20 ? 218 SER B OG  1 
ATOM   3399 N N   . THR B 1 219 ? -13.057 35.447 25.256 1.00 15.66 ? 219 THR B N   1 
ATOM   3400 C CA  . THR B 1 219 ? -12.152 36.533 24.886 1.00 15.66 ? 219 THR B CA  1 
ATOM   3401 C C   . THR B 1 219 ? -12.517 37.816 25.617 1.00 15.66 ? 219 THR B C   1 
ATOM   3402 O O   . THR B 1 219 ? -11.917 38.895 25.356 1.00 15.66 ? 219 THR B O   1 
ATOM   3403 C CB  . THR B 1 219 ? -12.172 36.809 23.375 1.00 15.66 ? 219 THR B CB  1 
ATOM   3404 O OG1 . THR B 1 219 ? -13.472 37.275 22.955 1.00 27.44 ? 219 THR B OG1 1 
ATOM   3405 C CG2 . THR B 1 219 ? -11.826 35.548 22.570 1.00 27.44 ? 219 THR B CG2 1 
ATOM   3406 N N   . CYS B 1 220 ? -13.308 37.653 26.629 1.00 14.32 ? 220 CYS B N   1 
ATOM   3407 C CA  . CYS B 1 220 ? -13.598 38.808 27.497 1.00 14.32 ? 220 CYS B CA  1 
ATOM   3408 C C   . CYS B 1 220 ? -14.294 39.950 26.792 1.00 14.32 ? 220 CYS B C   1 
ATOM   3409 O O   . CYS B 1 220 ? -13.975 41.139 27.005 1.00 14.32 ? 220 CYS B O   1 
ATOM   3410 C CB  . CYS B 1 220 ? -12.376 39.278 28.299 1.00 14.32 ? 220 CYS B CB  1 
ATOM   3411 S SG  . CYS B 1 220 ? -11.869 38.054 29.499 1.00 28.16 ? 220 CYS B SG  1 
ATOM   3412 N N   . SER B 1 221 ? -15.079 39.614 25.808 1.00 12.19 ? 221 SER B N   1 
ATOM   3413 C CA  . SER B 1 221 ? -15.726 40.644 25.008 1.00 12.19 ? 221 SER B CA  1 
ATOM   3414 C C   . SER B 1 221 ? -16.733 41.521 25.749 1.00 12.19 ? 221 SER B C   1 
ATOM   3415 O O   . SER B 1 221 ? -17.504 41.022 26.599 1.00 12.19 ? 221 SER B O   1 
ATOM   3416 C CB  . SER B 1 221 ? -16.280 40.038 23.698 1.00 12.19 ? 221 SER B CB  1 
ATOM   3417 O OG  . SER B 1 221 ? -17.612 40.432 23.331 1.00 28.56 ? 221 SER B OG  1 
ATOM   3418 N N   . THR B 1 222 ? -16.836 42.823 25.294 1.00 14.33 ? 222 THR B N   1 
ATOM   3419 C CA  . THR B 1 222 ? -17.764 43.760 25.945 1.00 14.33 ? 222 THR B CA  1 
ATOM   3420 C C   . THR B 1 222 ? -19.181 43.578 25.394 1.00 14.33 ? 222 THR B C   1 
ATOM   3421 O O   . THR B 1 222 ? -20.162 44.037 26.002 1.00 14.33 ? 222 THR B O   1 
ATOM   3422 C CB  . THR B 1 222 ? -17.320 45.204 25.696 1.00 14.33 ? 222 THR B CB  1 
ATOM   3423 O OG1 . THR B 1 222 ? -17.339 45.493 24.304 1.00 7.99  ? 222 THR B OG1 1 
ATOM   3424 C CG2 . THR B 1 222 ? -15.905 45.485 26.207 1.00 7.99  ? 222 THR B CG2 1 
ATOM   3425 N N   . SER B 1 223 ? -19.401 42.657 24.481 1.00 18.40 ? 223 SER B N   1 
ATOM   3426 C CA  . SER B 1 223 ? -20.717 42.277 23.931 1.00 18.40 ? 223 SER B CA  1 
ATOM   3427 C C   . SER B 1 223 ? -21.283 40.937 24.352 1.00 18.40 ? 223 SER B C   1 
ATOM   3428 O O   . SER B 1 223 ? -22.273 40.568 23.694 1.00 18.40 ? 223 SER B O   1 
ATOM   3429 C CB  . SER B 1 223 ? -20.619 42.095 22.399 1.00 18.40 ? 223 SER B CB  1 
ATOM   3430 O OG  . SER B 1 223 ? -20.449 43.378 21.766 1.00 37.65 ? 223 SER B OG  1 
ATOM   3431 N N   . THR B 1 224 ? -20.628 40.179 25.211 1.00 17.11 ? 224 THR B N   1 
ATOM   3432 C CA  . THR B 1 224 ? -21.154 38.891 25.689 1.00 17.11 ? 224 THR B CA  1 
ATOM   3433 C C   . THR B 1 224 ? -21.235 38.904 27.208 1.00 17.11 ? 224 THR B C   1 
ATOM   3434 O O   . THR B 1 224 ? -20.331 39.530 27.808 1.00 17.11 ? 224 THR B O   1 
ATOM   3435 C CB  . THR B 1 224 ? -20.196 37.774 25.306 1.00 17.11 ? 224 THR B CB  1 
ATOM   3436 O OG1 . THR B 1 224 ? -19.983 37.850 23.930 1.00 7.16  ? 224 THR B OG1 1 
ATOM   3437 C CG2 . THR B 1 224 ? -20.687 36.381 25.667 1.00 7.16  ? 224 THR B CG2 1 
ATOM   3438 N N   . PRO B 1 225 ? -22.376 38.523 27.760 1.00 8.89  ? 225 PRO B N   1 
ATOM   3439 C CA  . PRO B 1 225 ? -22.665 38.657 29.160 1.00 8.89  ? 225 PRO B CA  1 
ATOM   3440 C C   . PRO B 1 225 ? -21.777 37.697 29.923 1.00 8.89  ? 225 PRO B C   1 
ATOM   3441 O O   . PRO B 1 225 ? -21.717 36.523 29.485 1.00 8.89  ? 225 PRO B O   1 
ATOM   3442 C CB  . PRO B 1 225 ? -24.072 38.078 29.371 1.00 8.89  ? 225 PRO B CB  1 
ATOM   3443 C CG  . PRO B 1 225 ? -24.657 37.709 28.003 1.00 6.44  ? 225 PRO B CG  1 
ATOM   3444 C CD  . PRO B 1 225 ? -23.577 38.052 27.000 1.00 6.44  ? 225 PRO B CD  1 
ATOM   3445 N N   . GLY B 1 226 ? -21.422 38.043 31.166 1.00 13.51 ? 226 GLY B N   1 
ATOM   3446 C CA  . GLY B 1 226 ? -21.031 36.978 32.120 1.00 13.51 ? 226 GLY B CA  1 
ATOM   3447 C C   . GLY B 1 226 ? -22.204 36.159 32.674 1.00 13.51 ? 226 GLY B C   1 
ATOM   3448 O O   . GLY B 1 226 ? -23.354 36.671 32.714 1.00 13.51 ? 226 GLY B O   1 
ATOM   3449 N N   . VAL B 1 227 ? -21.927 34.914 33.080 1.00 13.10 ? 227 VAL B N   1 
ATOM   3450 C CA  . VAL B 1 227 ? -22.864 33.928 33.700 1.00 13.10 ? 227 VAL B CA  1 
ATOM   3451 C C   . VAL B 1 227 ? -22.477 33.698 35.156 1.00 13.10 ? 227 VAL B C   1 
ATOM   3452 O O   . VAL B 1 227 ? -21.292 33.428 35.497 1.00 13.10 ? 227 VAL B O   1 
ATOM   3453 C CB  . VAL B 1 227 ? -22.936 32.554 32.924 1.00 13.10 ? 227 VAL B CB  1 
ATOM   3454 C CG1 . VAL B 1 227 ? -24.064 31.567 33.326 1.00 0.10  ? 227 VAL B CG1 1 
ATOM   3455 C CG2 . VAL B 1 227 ? -23.108 32.817 31.445 1.00 0.10  ? 227 VAL B CG2 1 
ATOM   3456 N N   . TYR B 1 228 ? -23.430 33.895 35.997 1.00 8.53  ? 228 TYR B N   1 
ATOM   3457 C CA  . TYR B 1 228 ? -23.283 33.856 37.446 1.00 8.53  ? 228 TYR B CA  1 
ATOM   3458 C C   . TYR B 1 228 ? -24.126 32.756 38.031 1.00 8.53  ? 228 TYR B C   1 
ATOM   3459 O O   . TYR B 1 228 ? -25.279 32.580 37.583 1.00 8.53  ? 228 TYR B O   1 
ATOM   3460 C CB  . TYR B 1 228 ? -23.711 35.196 38.132 1.00 8.53  ? 228 TYR B CB  1 
ATOM   3461 C CG  . TYR B 1 228 ? -22.889 36.406 37.561 1.00 5.52  ? 228 TYR B CG  1 
ATOM   3462 C CD1 . TYR B 1 228 ? -23.173 36.904 36.299 1.00 5.52  ? 228 TYR B CD1 1 
ATOM   3463 C CD2 . TYR B 1 228 ? -21.781 36.869 38.256 1.00 5.52  ? 228 TYR B CD2 1 
ATOM   3464 C CE1 . TYR B 1 228 ? -22.346 37.859 35.703 1.00 5.52  ? 228 TYR B CE1 1 
ATOM   3465 C CE2 . TYR B 1 228 ? -20.963 37.856 37.691 1.00 5.52  ? 228 TYR B CE2 1 
ATOM   3466 C CZ  . TYR B 1 228 ? -21.236 38.339 36.416 1.00 5.52  ? 228 TYR B CZ  1 
ATOM   3467 O OH  . TYR B 1 228 ? -20.446 39.391 35.862 1.00 5.52  ? 228 TYR B OH  1 
ATOM   3468 N N   . ALA B 1 229 ? -23.787 32.368 39.225 1.00 9.06  ? 229 ALA B N   1 
ATOM   3469 C CA  . ALA B 1 229 ? -24.651 31.549 40.069 1.00 9.06  ? 229 ALA B CA  1 
ATOM   3470 C C   . ALA B 1 229 ? -25.669 32.461 40.804 1.00 9.06  ? 229 ALA B C   1 
ATOM   3471 O O   . ALA B 1 229 ? -25.276 33.456 41.480 1.00 9.06  ? 229 ALA B O   1 
ATOM   3472 C CB  . ALA B 1 229 ? -23.784 30.749 41.076 1.00 9.06  ? 229 ALA B CB  1 
ATOM   3473 N N   . ARG B 1 230 ? -26.936 32.164 40.567 1.00 13.84 ? 230 ARG B N   1 
ATOM   3474 C CA  . ARG B 1 230 ? -28.136 32.855 41.081 1.00 13.84 ? 230 ARG B CA  1 
ATOM   3475 C C   . ARG B 1 230 ? -28.405 32.485 42.537 1.00 13.84 ? 230 ARG B C   1 
ATOM   3476 O O   . ARG B 1 230 ? -29.006 31.442 42.875 1.00 13.84 ? 230 ARG B O   1 
ATOM   3477 C CB  . ARG B 1 230 ? -29.355 32.663 40.162 1.00 13.84 ? 230 ARG B CB  1 
ATOM   3478 C CG  . ARG B 1 230 ? -30.573 33.513 40.523 1.00 12.69 ? 230 ARG B CG  1 
ATOM   3479 C CD  . ARG B 1 230 ? -31.788 32.986 39.780 1.00 12.69 ? 230 ARG B CD  1 
ATOM   3480 N NE  . ARG B 1 230 ? -31.616 33.153 38.316 1.00 12.69 ? 230 ARG B NE  1 
ATOM   3481 C CZ  . ARG B 1 230 ? -32.271 34.146 37.651 1.00 12.69 ? 230 ARG B CZ  1 
ATOM   3482 N NH1 . ARG B 1 230 ? -32.165 34.384 36.317 1.00 12.69 ? 230 ARG B NH1 1 
ATOM   3483 N NH2 . ARG B 1 230 ? -32.955 34.969 38.411 1.00 12.69 ? 230 ARG B NH2 1 
ATOM   3484 N N   . VAL B 1 231 ? -27.751 33.246 43.370 1.00 8.11  ? 231 VAL B N   1 
ATOM   3485 C CA  . VAL B 1 231 ? -27.779 33.105 44.818 1.00 8.11  ? 231 VAL B CA  1 
ATOM   3486 C C   . VAL B 1 231 ? -29.208 32.980 45.353 1.00 8.11  ? 231 VAL B C   1 
ATOM   3487 O O   . VAL B 1 231 ? -29.420 32.324 46.386 1.00 8.11  ? 231 VAL B O   1 
ATOM   3488 C CB  . VAL B 1 231 ? -27.129 34.327 45.463 1.00 8.11  ? 231 VAL B CB  1 
ATOM   3489 C CG1 . VAL B 1 231 ? -27.319 34.229 46.957 1.00 10.27 ? 231 VAL B CG1 1 
ATOM   3490 C CG2 . VAL B 1 231 ? -25.612 34.324 45.193 1.00 10.27 ? 231 VAL B CG2 1 
ATOM   3491 N N   . THR B 1 232 ? -30.144 33.644 44.755 1.00 21.64 ? 232 THR B N   1 
ATOM   3492 C CA  . THR B 1 232 ? -31.504 33.610 45.281 1.00 21.64 ? 232 THR B CA  1 
ATOM   3493 C C   . THR B 1 232 ? -32.149 32.210 45.153 1.00 21.64 ? 232 THR B C   1 
ATOM   3494 O O   . THR B 1 232 ? -33.039 31.823 45.962 1.00 21.64 ? 232 THR B O   1 
ATOM   3495 C CB  . THR B 1 232 ? -32.291 34.667 44.471 1.00 21.64 ? 232 THR B CB  1 
ATOM   3496 O OG1 . THR B 1 232 ? -32.909 35.737 45.182 1.00 17.86 ? 232 THR B OG1 1 
ATOM   3497 C CG2 . THR B 1 232 ? -32.929 34.292 43.140 1.00 17.86 ? 232 THR B CG2 1 
ATOM   3498 N N   . ALA B 1 233 ? -31.589 31.422 44.211 1.00 14.05 ? 233 ALA B N   1 
ATOM   3499 C CA  . ALA B 1 233 ? -31.937 30.053 43.928 1.00 14.05 ? 233 ALA B CA  1 
ATOM   3500 C C   . ALA B 1 233 ? -31.164 29.128 44.839 1.00 14.05 ? 233 ALA B C   1 
ATOM   3501 O O   . ALA B 1 233 ? -31.422 27.911 44.867 1.00 14.05 ? 233 ALA B O   1 
ATOM   3502 C CB  . ALA B 1 233 ? -31.728 29.751 42.429 1.00 14.05 ? 233 ALA B CB  1 
ATOM   3503 N N   . LEU B 1 234 ? -30.149 29.591 45.486 1.00 15.19 ? 234 LEU B N   1 
ATOM   3504 C CA  . LEU B 1 234 ? -29.245 28.662 46.212 1.00 15.19 ? 234 LEU B CA  1 
ATOM   3505 C C   . LEU B 1 234 ? -29.371 28.849 47.722 1.00 15.19 ? 234 LEU B C   1 
ATOM   3506 O O   . LEU B 1 234 ? -28.649 28.272 48.570 1.00 15.19 ? 234 LEU B O   1 
ATOM   3507 C CB  . LEU B 1 234 ? -27.776 28.868 45.724 1.00 15.19 ? 234 LEU B CB  1 
ATOM   3508 C CG  . LEU B 1 234 ? -27.569 28.681 44.199 1.00 10.03 ? 234 LEU B CG  1 
ATOM   3509 C CD1 . LEU B 1 234 ? -26.177 29.204 43.726 1.00 10.03 ? 234 LEU B CD1 1 
ATOM   3510 C CD2 . LEU B 1 234 ? -27.796 27.213 43.812 1.00 10.03 ? 234 LEU B CD2 1 
ATOM   3511 N N   . VAL B 1 235 ? -30.073 29.879 48.043 1.00 23.82 ? 235 VAL B N   1 
ATOM   3512 C CA  . VAL B 1 235 ? -30.063 30.411 49.405 1.00 23.82 ? 235 VAL B CA  1 
ATOM   3513 C C   . VAL B 1 235 ? -30.740 29.563 50.499 1.00 23.82 ? 235 VAL B C   1 
ATOM   3514 O O   . VAL B 1 235 ? -30.207 29.480 51.637 1.00 23.82 ? 235 VAL B O   1 
ATOM   3515 C CB  . VAL B 1 235 ? -30.607 31.860 49.341 1.00 23.82 ? 235 VAL B CB  1 
ATOM   3516 C CG1 . VAL B 1 235 ? -32.140 31.880 49.446 1.00 14.37 ? 235 VAL B CG1 1 
ATOM   3517 C CG2 . VAL B 1 235 ? -29.946 32.781 50.365 1.00 14.37 ? 235 VAL B CG2 1 
ATOM   3518 N N   . ASN B 1 236 ? -31.802 28.821 50.158 1.00 26.45 ? 236 ASN B N   1 
ATOM   3519 C CA  . ASN B 1 236 ? -32.325 27.813 51.082 1.00 26.45 ? 236 ASN B CA  1 
ATOM   3520 C C   . ASN B 1 236 ? -31.320 26.724 51.486 1.00 26.45 ? 236 ASN B C   1 
ATOM   3521 O O   . ASN B 1 236 ? -31.252 26.392 52.703 1.00 26.45 ? 236 ASN B O   1 
ATOM   3522 C CB  . ASN B 1 236 ? -33.617 27.228 50.542 1.00 26.45 ? 236 ASN B CB  1 
ATOM   3523 C CG  . ASN B 1 236 ? -34.710 28.181 50.995 1.00 52.37 ? 236 ASN B CG  1 
ATOM   3524 O OD1 . ASN B 1 236 ? -35.066 29.104 50.230 1.00 52.37 ? 236 ASN B OD1 1 
ATOM   3525 N ND2 . ASN B 1 236 ? -34.771 28.330 52.296 1.00 52.37 ? 236 ASN B ND2 1 
ATOM   3526 N N   . TRP B 1 237 ? -30.401 26.360 50.535 1.00 16.62 ? 237 TRP B N   1 
ATOM   3527 C CA  . TRP B 1 237 ? -29.273 25.432 50.804 1.00 16.62 ? 237 TRP B CA  1 
ATOM   3528 C C   . TRP B 1 237 ? -28.269 26.057 51.759 1.00 16.62 ? 237 TRP B C   1 
ATOM   3529 O O   . TRP B 1 237 ? -27.878 25.349 52.702 1.00 16.62 ? 237 TRP B O   1 
ATOM   3530 C CB  . TRP B 1 237 ? -28.556 25.015 49.502 1.00 16.62 ? 237 TRP B CB  1 
ATOM   3531 C CG  . TRP B 1 237 ? -27.291 24.205 49.750 1.00 15.96 ? 237 TRP B CG  1 
ATOM   3532 C CD1 . TRP B 1 237 ? -27.184 22.886 49.973 1.00 15.96 ? 237 TRP B CD1 1 
ATOM   3533 C CD2 . TRP B 1 237 ? -25.967 24.702 49.789 1.00 15.96 ? 237 TRP B CD2 1 
ATOM   3534 N NE1 . TRP B 1 237 ? -25.812 22.541 50.199 1.00 15.96 ? 237 TRP B NE1 1 
ATOM   3535 C CE2 . TRP B 1 237 ? -25.120 23.604 50.091 1.00 15.96 ? 237 TRP B CE2 1 
ATOM   3536 C CE3 . TRP B 1 237 ? -25.453 26.000 49.583 1.00 15.96 ? 237 TRP B CE3 1 
ATOM   3537 C CZ2 . TRP B 1 237 ? -23.755 23.737 50.204 1.00 15.96 ? 237 TRP B CZ2 1 
ATOM   3538 C CZ3 . TRP B 1 237 ? -24.052 26.124 49.673 1.00 15.96 ? 237 TRP B CZ3 1 
ATOM   3539 C CH2 . TRP B 1 237 ? -23.247 25.029 49.980 1.00 15.96 ? 237 TRP B CH2 1 
ATOM   3540 N N   . VAL B 1 238 ? -27.911 27.340 51.512 1.00 19.01 ? 238 VAL B N   1 
ATOM   3541 C CA  . VAL B 1 238 ? -26.957 28.097 52.350 1.00 19.01 ? 238 VAL B CA  1 
ATOM   3542 C C   . VAL B 1 238 ? -27.519 28.192 53.750 1.00 19.01 ? 238 VAL B C   1 
ATOM   3543 O O   . VAL B 1 238 ? -26.756 28.003 54.718 1.00 19.01 ? 238 VAL B O   1 
ATOM   3544 C CB  . VAL B 1 238 ? -26.722 29.539 51.843 1.00 19.01 ? 238 VAL B CB  1 
ATOM   3545 C CG1 . VAL B 1 238 ? -26.093 30.512 52.860 1.00 7.87  ? 238 VAL B CG1 1 
ATOM   3546 C CG2 . VAL B 1 238 ? -26.134 29.632 50.432 1.00 7.87  ? 238 VAL B CG2 1 
ATOM   3547 N N   . GLN B 1 239 ? -28.834 28.425 53.833 1.00 15.93 ? 239 GLN B N   1 
ATOM   3548 C CA  . GLN B 1 239 ? -29.477 28.567 55.157 1.00 15.93 ? 239 GLN B CA  1 
ATOM   3549 C C   . GLN B 1 239 ? -29.510 27.264 55.965 1.00 15.93 ? 239 GLN B C   1 
ATOM   3550 O O   . GLN B 1 239 ? -29.116 27.275 57.168 1.00 15.93 ? 239 GLN B O   1 
ATOM   3551 C CB  . GLN B 1 239 ? -30.909 29.105 55.001 1.00 15.93 ? 239 GLN B CB  1 
ATOM   3552 C CG  . GLN B 1 239 ? -31.132 30.322 55.908 1.00 57.95 ? 239 GLN B CG  1 
ATOM   3553 C CD  . GLN B 1 239 ? -31.291 31.567 55.037 1.00 57.95 ? 239 GLN B CD  1 
ATOM   3554 O OE1 . GLN B 1 239 ? -30.291 32.308 54.808 1.00 57.95 ? 239 GLN B OE1 1 
ATOM   3555 N NE2 . GLN B 1 239 ? -32.454 31.620 54.379 1.00 57.95 ? 239 GLN B NE2 1 
ATOM   3556 N N   . GLN B 1 240 ? -29.705 26.154 55.215 1.00 19.28 ? 240 GLN B N   1 
ATOM   3557 C CA  . GLN B 1 240 ? -29.651 24.800 55.824 1.00 19.28 ? 240 GLN B CA  1 
ATOM   3558 C C   . GLN B 1 240 ? -28.274 24.367 56.309 1.00 19.28 ? 240 GLN B C   1 
ATOM   3559 O O   . GLN B 1 240 ? -28.099 23.948 57.496 1.00 19.28 ? 240 GLN B O   1 
ATOM   3560 C CB  . GLN B 1 240 ? -30.198 23.751 54.863 1.00 19.28 ? 240 GLN B CB  1 
ATOM   3561 C CG  . GLN B 1 240 ? -31.539 23.136 55.312 1.00 60.15 ? 240 GLN B CG  1 
ATOM   3562 C CD  . GLN B 1 240 ? -32.602 24.212 55.539 1.00 60.15 ? 240 GLN B CD  1 
ATOM   3563 O OE1 . GLN B 1 240 ? -33.352 24.532 54.580 1.00 60.15 ? 240 GLN B OE1 1 
ATOM   3564 N NE2 . GLN B 1 240 ? -32.999 24.308 56.798 1.00 60.15 ? 240 GLN B NE2 1 
ATOM   3565 N N   . THR B 1 241 ? -27.311 24.592 55.439 1.00 18.15 ? 241 THR B N   1 
ATOM   3566 C CA  . THR B 1 241 ? -25.905 24.370 55.823 1.00 18.15 ? 241 THR B CA  1 
ATOM   3567 C C   . THR B 1 241 ? -25.442 25.146 57.064 1.00 18.15 ? 241 THR B C   1 
ATOM   3568 O O   . THR B 1 241 ? -24.898 24.556 58.047 1.00 18.15 ? 241 THR B O   1 
ATOM   3569 C CB  . THR B 1 241 ? -25.076 24.774 54.623 1.00 18.15 ? 241 THR B CB  1 
ATOM   3570 O OG1 . THR B 1 241 ? -25.633 24.037 53.518 1.00 16.50 ? 241 THR B OG1 1 
ATOM   3571 C CG2 . THR B 1 241 ? -23.590 24.421 54.792 1.00 16.50 ? 241 THR B CG2 1 
ATOM   3572 N N   . LEU B 1 242 ? -25.720 26.443 57.054 1.00 18.03 ? 242 LEU B N   1 
ATOM   3573 C CA  . LEU B 1 242 ? -25.438 27.296 58.214 1.00 18.03 ? 242 LEU B CA  1 
ATOM   3574 C C   . LEU B 1 242 ? -26.192 26.808 59.457 1.00 18.03 ? 242 LEU B C   1 
ATOM   3575 O O   . LEU B 1 242 ? -25.583 26.711 60.551 1.00 18.03 ? 242 LEU B O   1 
ATOM   3576 C CB  . LEU B 1 242 ? -25.768 28.796 57.925 1.00 18.03 ? 242 LEU B CB  1 
ATOM   3577 C CG  . LEU B 1 242 ? -24.589 29.716 57.500 1.00 21.05 ? 242 LEU B CG  1 
ATOM   3578 C CD1 . LEU B 1 242 ? -23.627 29.102 56.520 1.00 21.05 ? 242 LEU B CD1 1 
ATOM   3579 C CD2 . LEU B 1 242 ? -25.043 31.072 56.919 1.00 21.05 ? 242 LEU B CD2 1 
ATOM   3580 N N   . ALA B 1 243 ? -27.459 26.447 59.332 1.00 23.04 ? 243 ALA B N   1 
ATOM   3581 C CA  . ALA B 1 243 ? -28.205 26.109 60.585 1.00 23.04 ? 243 ALA B CA  1 
ATOM   3582 C C   . ALA B 1 243 ? -27.715 24.768 61.128 1.00 23.04 ? 243 ALA B C   1 
ATOM   3583 O O   . ALA B 1 243 ? -28.051 24.342 62.273 1.00 23.04 ? 243 ALA B O   1 
ATOM   3584 C CB  . ALA B 1 243 ? -29.723 26.020 60.396 1.00 23.04 ? 243 ALA B CB  1 
ATOM   3585 N N   . ALA B 1 244 ? -27.060 24.030 60.257 1.00 30.62 ? 244 ALA B N   1 
ATOM   3586 C CA  . ALA B 1 244 ? -26.707 22.688 60.678 1.00 30.62 ? 244 ALA B CA  1 
ATOM   3587 C C   . ALA B 1 244 ? -25.263 22.633 61.090 1.00 30.62 ? 244 ALA B C   1 
ATOM   3588 O O   . ALA B 1 244 ? -24.809 21.552 61.525 1.00 30.62 ? 244 ALA B O   1 
ATOM   3589 C CB  . ALA B 1 244 ? -26.932 21.643 59.570 1.00 30.62 ? 244 ALA B CB  1 
ATOM   3590 N N   . ASN B 1 245 ? -24.472 23.597 60.679 1.00 24.45 ? 245 ASN B N   1 
ATOM   3591 C CA  . ASN B 1 245 ? -23.025 23.470 61.008 1.00 24.45 ? 245 ASN B CA  1 
ATOM   3592 C C   . ASN B 1 245 ? -22.534 24.674 61.786 1.00 24.45 ? 245 ASN B C   1 
ATOM   3593 O O   . ASN B 1 245 ? -21.299 24.818 62.011 1.00 24.45 ? 245 ASN B O   1 
ATOM   3594 C CB  . ASN B 1 245 ? -22.105 23.312 59.783 1.00 24.45 ? 245 ASN B CB  1 
ATOM   3595 C CG  . ASN B 1 245 ? -22.523 22.052 59.044 1.00 45.98 ? 245 ASN B CG  1 
ATOM   3596 O OD1 . ASN B 1 245 ? -22.201 20.950 59.548 1.00 45.98 ? 245 ASN B OD1 1 
ATOM   3597 N ND2 . ASN B 1 245 ? -23.588 22.179 58.259 1.00 45.98 ? 245 ASN B ND2 1 
ATOM   3598 O OXT . ASN B 1 245 ? -23.337 25.613 62.023 1.00 35.32 ? 245 ASN B OXT 1 
HETATM 3599 O O   . HOH C 2 .   ? -20.008 66.224 26.138 1.00 26.69 ? 601 HOH A O   1 
HETATM 3600 O O   . HOH C 2 .   ? -21.333 66.182 28.756 1.00 18.10 ? 602 HOH A O   1 
HETATM 3601 O O   . HOH C 2 .   ? -18.000 68.022 22.774 1.00 34.03 ? 603 HOH A O   1 
HETATM 3602 O O   . HOH C 2 .   ? 4.863   59.097 21.370 1.00 17.97 ? 604 HOH A O   1 
HETATM 3603 O O   . HOH C 2 .   ? 3.800   74.938 30.725 1.00 25.60 ? 608 HOH A O   1 
HETATM 3604 O O   . HOH C 2 .   ? -21.953 73.766 22.859 1.00 30.14 ? 611 HOH A O   1 
HETATM 3605 O O   . HOH C 2 .   ? -26.504 79.908 25.615 1.00 17.85 ? 612 HOH A O   1 
HETATM 3606 O O   . HOH C 2 .   ? -22.033 79.678 24.379 1.00 14.51 ? 613 HOH A O   1 
HETATM 3607 O O   . HOH C 2 .   ? -6.071  84.880 34.037 1.00 20.08 ? 622 HOH A O   1 
HETATM 3608 O O   . HOH C 2 .   ? -5.309  84.522 36.738 1.00 16.65 ? 623 HOH A O   1 
HETATM 3609 O O   . HOH C 2 .   ? -2.644  84.491 36.764 1.00 10.46 ? 624 HOH A O   1 
HETATM 3610 O O   . HOH C 2 .   ? -6.632  84.322 39.731 1.00 9.72  ? 625 HOH A O   1 
HETATM 3611 O O   . HOH C 2 .   ? -4.163  80.635 34.010 1.00 23.40 ? 626 HOH A O   1 
HETATM 3612 O O   . HOH C 2 .   ? -4.525  77.071 36.684 1.00 15.66 ? 627 HOH A O   1 
HETATM 3613 O O   . HOH C 2 .   ? -16.888 70.817 34.916 1.00 15.08 ? 628 HOH A O   1 
HETATM 3614 O O   . HOH C 2 .   ? -19.313 72.314 35.793 1.00 28.39 ? 629 HOH A O   1 
HETATM 3615 O O   . HOH C 2 .   ? -21.227 73.510 37.430 1.00 25.62 ? 630 HOH A O   1 
HETATM 3616 O O   . HOH C 2 .   ? -22.420 61.672 32.123 1.00 28.15 ? 631 HOH A O   1 
HETATM 3617 O O   . HOH C 2 .   ? -11.031 58.418 36.106 1.00 18.54 ? 632 HOH A O   1 
HETATM 3618 O O   . HOH C 2 .   ? -13.737 58.911 36.372 1.00 24.13 ? 636 HOH A O   1 
HETATM 3619 O O   . HOH C 2 .   ? -8.995  50.352 32.556 1.00 40.97 ? 638 HOH A O   1 
HETATM 3620 O O   . HOH C 2 .   ? -4.146  49.189 25.268 1.00 29.09 ? 641 HOH A O   1 
HETATM 3621 O O   . HOH C 2 .   ? -20.333 77.813 37.846 1.00 24.03 ? 642 HOH A O   1 
HETATM 3622 O O   . HOH C 2 .   ? -22.424 79.780 35.832 1.00 30.31 ? 643 HOH A O   1 
HETATM 3623 O O   . HOH C 2 .   ? -23.868 82.373 35.449 1.00 17.33 ? 644 HOH A O   1 
HETATM 3624 O O   . HOH C 2 .   ? -17.184 80.595 35.612 1.00 11.15 ? 645 HOH A O   1 
HETATM 3625 O O   . HOH C 2 .   ? -24.621 83.178 32.686 1.00 38.34 ? 646 HOH A O   1 
HETATM 3626 O O   . HOH C 2 .   ? -27.033 84.451 33.620 1.00 42.11 ? 647 HOH A O   1 
HETATM 3627 O O   . HOH C 2 .   ? -27.188 83.617 36.289 1.00 49.33 ? 648 HOH A O   1 
HETATM 3628 O O   . HOH C 2 .   ? 1.857   61.453 37.506 1.00 7.30  ? 649 HOH A O   1 
HETATM 3629 O O   . HOH C 2 .   ? 3.265   63.946 39.104 1.00 17.44 ? 650 HOH A O   1 
HETATM 3630 O O   . HOH C 2 .   ? 4.269   64.113 36.393 1.00 16.70 ? 651 HOH A O   1 
HETATM 3631 O O   . HOH C 2 .   ? -24.068 69.799 35.156 1.00 29.44 ? 652 HOH A O   1 
HETATM 3632 O O   . HOH C 2 .   ? -26.930 72.414 35.896 1.00 46.18 ? 653 HOH A O   1 
HETATM 3633 O O   . HOH C 2 .   ? -26.288 71.304 32.875 1.00 37.24 ? 654 HOH A O   1 
HETATM 3634 O O   . HOH C 2 .   ? 7.212   58.832 40.663 1.00 31.71 ? 655 HOH A O   1 
HETATM 3635 O O   . HOH C 2 .   ? 6.632   55.846 38.755 1.00 33.41 ? 656 HOH A O   1 
HETATM 3636 O O   . HOH C 2 .   ? 7.516   62.487 42.795 1.00 38.12 ? 657 HOH A O   1 
HETATM 3637 O O   . HOH C 2 .   ? -4.415  68.382 40.614 1.00 0.10  ? 666 HOH A O   1 
HETATM 3638 O O   . HOH C 2 .   ? -13.023 54.605 42.038 1.00 6.42  ? 673 HOH A O   1 
HETATM 3639 O O   . HOH C 2 .   ? -0.508  59.853 45.845 1.00 10.72 ? 675 HOH A O   1 
HETATM 3640 O O   . HOH C 2 .   ? 2.182   64.660 42.222 1.00 10.07 ? 676 HOH A O   1 
HETATM 3641 O O   . HOH C 2 .   ? 4.577   65.521 42.553 1.00 19.62 ? 677 HOH A O   1 
HETATM 3642 O O   . HOH C 2 .   ? 3.538   51.852 47.829 1.00 41.65 ? 678 HOH A O   1 
HETATM 3643 O O   . HOH C 2 .   ? 2.323   50.661 45.504 1.00 50.94 ? 679 HOH A O   1 
HETATM 3644 O O   . HOH C 2 .   ? 5.591   56.054 47.752 1.00 40.81 ? 680 HOH A O   1 
HETATM 3645 O O   . HOH C 2 .   ? 7.182   58.278 47.263 1.00 44.59 ? 681 HOH A O   1 
HETATM 3646 O O   . HOH C 2 .   ? 0.120   68.749 48.394 1.00 12.25 ? 682 HOH A O   1 
HETATM 3647 O O   . HOH C 2 .   ? -5.760  54.664 45.581 1.00 31.46 ? 696 HOH A O   1 
HETATM 3648 O O   . HOH C 2 .   ? -6.220  58.408 42.363 1.00 20.58 ? 698 HOH A O   1 
HETATM 3649 O O   . HOH C 2 .   ? -7.472  56.666 43.911 1.00 19.76 ? 699 HOH A O   1 
HETATM 3650 O O   . HOH C 2 .   ? -8.862  54.265 43.136 1.00 17.73 ? 700 HOH A O   1 
HETATM 3651 O O   . HOH C 2 .   ? -1.773  57.182 44.089 1.00 21.16 ? 701 HOH A O   1 
HETATM 3652 O O   . HOH C 2 .   ? -2.437  87.858 47.848 1.00 30.57 ? 702 HOH A O   1 
HETATM 3653 O O   . HOH C 2 .   ? 12.058  64.755 37.218 1.00 34.53 ? 705 HOH A O   1 
HETATM 3654 O O   . HOH C 2 .   ? 14.920  60.449 36.324 1.00 32.05 ? 706 HOH A O   1 
HETATM 3655 O O   . HOH C 2 .   ? 14.831  62.830 34.778 1.00 45.08 ? 707 HOH A O   1 
HETATM 3656 O O   . HOH C 2 .   ? 7.123   75.266 39.136 1.00 19.24 ? 712 HOH A O   1 
HETATM 3657 O O   . HOH C 2 .   ? 4.721   76.493 38.842 1.00 15.93 ? 713 HOH A O   1 
HETATM 3658 O O   . HOH C 2 .   ? -0.632  71.543 35.163 1.00 7.77  ? 714 HOH A O   1 
HETATM 3659 O O   . HOH C 2 .   ? -21.551 88.470 42.556 1.00 41.65 ? 728 HOH A O   1 
HETATM 3660 O O   . HOH C 2 .   ? -17.394 90.581 40.264 1.00 42.15 ? 729 HOH A O   1 
HETATM 3661 O O   . HOH C 2 .   ? 16.588  67.064 34.678 1.00 38.70 ? 730 HOH A O   1 
HETATM 3662 O O   . HOH C 2 .   ? -1.633  50.403 36.217 1.00 25.36 ? 731 HOH A O   1 
HETATM 3663 O O   . HOH C 2 .   ? -19.439 84.307 19.216 1.00 36.96 ? 732 HOH A O   1 
HETATM 3664 O O   . HOH C 2 .   ? -18.842 81.584 18.460 1.00 43.66 ? 733 HOH A O   1 
HETATM 3665 O O   . HOH C 2 .   ? -14.374 91.110 24.794 1.00 43.44 ? 734 HOH A O   1 
HETATM 3666 O O   . HOH C 2 .   ? -13.112 71.085 46.744 1.00 24.44 ? 759 HOH A O   1 
HETATM 3667 O O   . HOH C 2 .   ? -10.611 71.932 48.926 1.00 34.39 ? 760 HOH A O   1 
HETATM 3668 O O   . HOH C 2 .   ? 7.739   73.540 49.965 1.00 37.86 ? 761 HOH A O   1 
HETATM 3669 O O   . HOH C 2 .   ? 3.090   62.169 41.176 1.00 18.90 ? 765 HOH A O   1 
HETATM 3670 O O   . HOH C 2 .   ? -17.310 83.205 43.484 1.00 30.98 ? 767 HOH A O   1 
HETATM 3671 O O   . HOH C 2 .   ? 1.351   87.224 41.395 1.00 38.31 ? 769 HOH A O   1 
HETATM 3672 O O   . HOH C 2 .   ? -18.976 84.173 41.163 1.00 31.65 ? 770 HOH A O   1 
HETATM 3673 O O   . HOH C 2 .   ? -18.522 60.100 36.441 1.00 24.90 ? 776 HOH A O   1 
HETATM 3674 O O   . HOH C 2 .   ? -19.493 60.475 33.833 1.00 30.91 ? 777 HOH A O   1 
HETATM 3675 O O   . HOH C 2 .   ? 7.464   58.721 20.561 1.00 37.65 ? 778 HOH A O   1 
HETATM 3676 O O   . HOH C 2 .   ? -3.557  68.936 22.052 1.00 23.87 ? 779 HOH A O   1 
HETATM 3677 O O   . HOH C 2 .   ? -5.010  68.848 19.945 1.00 25.98 ? 780 HOH A O   1 
HETATM 3678 O O   . HOH C 2 .   ? -3.443  67.920 18.090 1.00 27.00 ? 781 HOH A O   1 
HETATM 3679 O O   . HOH C 2 .   ? -5.396  65.895 16.040 1.00 40.08 ? 782 HOH A O   1 
HETATM 3680 O O   . HOH C 2 .   ? -1.660  69.525 16.452 1.00 30.51 ? 783 HOH A O   1 
HETATM 3681 O O   . HOH C 2 .   ? -4.170  70.990 15.951 1.00 44.09 ? 784 HOH A O   1 
HETATM 3682 O O   . HOH C 2 .   ? -2.979  74.827 18.555 1.00 29.14 ? 785 HOH A O   1 
HETATM 3683 O O   . HOH C 2 .   ? -5.148  76.395 17.705 1.00 33.43 ? 786 HOH A O   1 
HETATM 3684 O O   . HOH C 2 .   ? -2.024  79.246 33.220 1.00 25.41 ? 788 HOH A O   1 
HETATM 3685 O O   . HOH C 2 .   ? -5.967  68.089 32.561 1.00 11.19 ? 791 HOH A O   1 
HETATM 3686 O O   . HOH C 2 .   ? -6.458  79.076 33.215 1.00 29.44 ? 792 HOH A O   1 
HETATM 3687 O O   . HOH C 2 .   ? -13.800 83.066 23.445 1.00 17.82 ? 793 HOH A O   1 
HETATM 3688 O O   . HOH C 2 .   ? -14.988 85.280 21.417 1.00 36.86 ? 794 HOH A O   1 
HETATM 3689 O O   . HOH C 2 .   ? -10.384 83.916 23.844 1.00 17.32 ? 795 HOH A O   1 
HETATM 3690 O O   . HOH C 2 .   ? -21.033 66.534 22.749 1.00 41.53 ? 797 HOH A O   1 
HETATM 3691 O O   . HOH C 2 .   ? -12.432 94.207 34.344 1.00 37.71 ? 799 HOH A O   1 
HETATM 3692 O O   . HOH C 2 .   ? -11.991 76.972 26.816 1.00 15.91 ? 802 HOH A O   1 
HETATM 3693 O O   . HOH C 2 .   ? -13.989 74.843 26.573 1.00 16.63 ? 803 HOH A O   1 
HETATM 3694 O O   . HOH C 2 .   ? -10.536 52.482 25.680 1.00 23.99 ? 805 HOH A O   1 
HETATM 3695 O O   . HOH C 2 .   ? 6.331   67.092 16.691 1.00 36.29 ? 809 HOH A O   1 
HETATM 3696 O O   . HOH C 2 .   ? -17.553 66.140 19.259 1.00 32.35 ? 813 HOH A O   1 
HETATM 3697 O O   . HOH C 2 .   ? -15.093 79.682 13.547 1.00 39.76 ? 814 HOH A O   1 
HETATM 3698 O O   . HOH C 2 .   ? -18.218 74.924 17.710 1.00 40.93 ? 815 HOH A O   1 
HETATM 3699 O O   . HOH C 2 .   ? -14.725 70.959 49.599 1.00 35.73 ? 816 HOH A O   1 
HETATM 3700 O O   . HOH C 2 .   ? -4.289  69.858 54.195 1.00 22.24 ? 832 HOH A O   1 
HETATM 3701 O O   . HOH C 2 .   ? -5.644  68.998 52.025 1.00 38.34 ? 833 HOH A O   1 
HETATM 3702 O O   . HOH C 2 .   ? -2.228  71.725 57.350 1.00 35.71 ? 834 HOH A O   1 
HETATM 3703 O O   . HOH C 2 .   ? -17.872 58.791 48.582 1.00 34.56 ? 841 HOH A O   1 
HETATM 3704 O O   . HOH C 2 .   ? -18.281 58.872 51.286 1.00 40.10 ? 842 HOH A O   1 
HETATM 3705 O O   . HOH C 2 .   ? 7.513   52.433 37.178 1.00 31.12 ? 844 HOH A O   1 
HETATM 3706 O O   . HOH C 2 .   ? 9.671   52.919 35.426 1.00 35.97 ? 845 HOH A O   1 
HETATM 3707 O O   . HOH C 2 .   ? 6.762   50.571 35.258 1.00 39.45 ? 846 HOH A O   1 
HETATM 3708 O O   . HOH C 2 .   ? 8.148   52.750 33.010 1.00 30.99 ? 847 HOH A O   1 
HETATM 3709 O O   . HOH C 2 .   ? 5.369   51.876 33.061 1.00 32.76 ? 848 HOH A O   1 
HETATM 3710 O O   . HOH C 2 .   ? 12.293  51.972 35.388 1.00 37.43 ? 849 HOH A O   1 
HETATM 3711 O O   . HOH C 2 .   ? 6.560   75.581 31.178 1.00 34.02 ? 850 HOH A O   1 
HETATM 3712 O O   . HOH C 2 .   ? 5.317   77.471 26.983 1.00 36.87 ? 851 HOH A O   1 
HETATM 3713 O O   . HOH C 2 .   ? 0.879   63.738 53.764 1.00 22.62 ? 852 HOH A O   1 
HETATM 3714 O O   . HOH C 2 .   ? -7.230  64.261 49.531 1.00 30.38 ? 862 HOH A O   1 
HETATM 3715 O O   . HOH C 2 .   ? -5.892  61.902 50.809 1.00 32.01 ? 863 HOH A O   1 
HETATM 3716 O O   . HOH C 2 .   ? -9.435  61.709 48.754 1.00 32.07 ? 864 HOH A O   1 
HETATM 3717 O O   . HOH C 2 .   ? -19.460 59.936 44.464 1.00 31.05 ? 865 HOH A O   1 
HETATM 3718 O O   . HOH C 2 .   ? -18.331 59.888 41.838 1.00 39.81 ? 866 HOH A O   1 
HETATM 3719 O O   . HOH C 2 .   ? -16.142 61.485 42.107 1.00 30.55 ? 867 HOH A O   1 
HETATM 3720 O O   . HOH C 2 .   ? -17.475 61.154 39.565 1.00 32.97 ? 868 HOH A O   1 
HETATM 3721 O O   . HOH C 2 .   ? -23.546 59.605 39.336 1.00 36.45 ? 869 HOH A O   1 
HETATM 3722 O O   . HOH C 2 .   ? -25.315 62.059 38.925 1.00 33.74 ? 870 HOH A O   1 
HETATM 3723 O O   . HOH C 2 .   ? -2.837  83.523 34.144 1.00 28.20 ? 875 HOH A O   1 
HETATM 3724 O O   . HOH C 2 .   ? -13.482 85.569 43.522 1.00 33.80 ? 881 HOH A O   1 
HETATM 3725 O O   . HOH C 2 .   ? -17.657 87.079 44.790 1.00 38.07 ? 882 HOH A O   1 
HETATM 3726 O O   . HOH C 2 .   ? -23.367 67.026 42.034 1.00 31.03 ? 883 HOH A O   1 
HETATM 3727 O O   . HOH C 2 .   ? -0.352  91.030 36.563 1.00 27.71 ? 884 HOH A O   1 
HETATM 3728 O O   . HOH C 2 .   ? -2.842  92.289 36.686 1.00 39.28 ? 885 HOH A O   1 
HETATM 3729 O O   . HOH C 2 .   ? -16.341 95.240 34.156 1.00 31.59 ? 889 HOH A O   1 
HETATM 3730 O O   . HOH C 2 .   ? -15.269 93.248 30.446 1.00 26.08 ? 890 HOH A O   1 
HETATM 3731 O O   . HOH C 2 .   ? -9.374  92.102 29.823 1.00 37.15 ? 891 HOH A O   1 
HETATM 3732 O O   . HOH C 2 .   ? -12.050 92.379 28.429 1.00 33.22 ? 892 HOH A O   1 
HETATM 3733 O O   . HOH C 2 .   ? -8.109  91.937 26.968 1.00 32.46 ? 893 HOH A O   1 
HETATM 3734 O O   . HOH C 2 .   ? -8.529  53.646 17.657 1.00 30.76 ? 897 HOH A O   1 
HETATM 3735 O O   . HOH C 2 .   ? -5.169  52.619 19.601 1.00 33.68 ? 898 HOH A O   1 
HETATM 3736 O O   . HOH C 2 .   ? -4.455  48.545 19.269 1.00 25.25 ? 899 HOH A O   1 
HETATM 3737 O O   . HOH C 2 .   ? 7.394   82.371 27.773 1.00 40.02 ? 900 HOH A O   1 
HETATM 3738 O O   . HOH C 2 .   ? 1.119   57.707 52.274 1.00 34.11 ? 906 HOH A O   1 
HETATM 3739 O O   . HOH C 2 .   ? 11.849  63.741 27.393 1.00 33.47 ? 908 HOH A O   1 
HETATM 3740 O O   . HOH C 2 .   ? -25.786 65.064 44.014 1.00 33.55 ? 911 HOH A O   1 
HETATM 3741 O O   . HOH C 2 .   ? -9.747  60.991 15.374 1.00 33.06 ? 912 HOH A O   1 
HETATM 3742 O O   . HOH C 2 .   ? -8.650  63.826 16.028 1.00 32.84 ? 913 HOH A O   1 
HETATM 3743 O O   . HOH C 2 .   ? -18.234 88.602 20.806 1.00 33.81 ? 915 HOH A O   1 
HETATM 3744 O O   . HOH C 2 .   ? -20.408 76.965 24.714 1.00 32.69 ? 921 HOH A O   1 
HETATM 3745 O O   . HOH C 2 .   ? -15.591 74.628 15.258 1.00 33.45 ? 927 HOH A O   1 
HETATM 3746 O O   . HOH C 2 .   ? -3.235  60.381 16.180 1.00 32.49 ? 928 HOH A O   1 
HETATM 3747 O O   . HOH C 2 .   ? -12.032 72.574 14.128 1.00 34.67 ? 929 HOH A O   1 
HETATM 3748 O O   . HOH C 2 .   ? -19.507 74.328 47.986 1.00 33.37 ? 930 HOH A O   1 
HETATM 3749 O O   . HOH D 2 .   ? 3.846   41.268 28.271 1.00 31.85 ? 605 HOH B O   1 
HETATM 3750 O O   . HOH D 2 .   ? -25.630 33.383 64.346 1.00 25.37 ? 606 HOH B O   1 
HETATM 3751 O O   . HOH D 2 .   ? -23.278 34.144 65.709 1.00 34.17 ? 607 HOH B O   1 
HETATM 3752 O O   . HOH D 2 .   ? -22.862 31.701 67.178 1.00 30.00 ? 609 HOH B O   1 
HETATM 3753 O O   . HOH D 2 .   ? -36.778 31.459 28.819 1.00 14.91 ? 610 HOH B O   1 
HETATM 3754 O O   . HOH D 2 .   ? -36.840 37.808 23.630 1.00 23.84 ? 614 HOH B O   1 
HETATM 3755 O O   . HOH D 2 .   ? -36.089 35.398 22.171 1.00 32.22 ? 615 HOH B O   1 
HETATM 3756 O O   . HOH D 2 .   ? -37.067 32.918 23.218 1.00 29.18 ? 616 HOH B O   1 
HETATM 3757 O O   . HOH D 2 .   ? -18.434 37.816 29.579 1.00 12.77 ? 617 HOH B O   1 
HETATM 3758 O O   . HOH D 2 .   ? -14.494 31.910 31.387 1.00 19.53 ? 618 HOH B O   1 
HETATM 3759 O O   . HOH D 2 .   ? -17.321 36.551 33.612 1.00 10.66 ? 619 HOH B O   1 
HETATM 3760 O O   . HOH D 2 .   ? -17.886 39.227 36.686 1.00 10.94 ? 620 HOH B O   1 
HETATM 3761 O O   . HOH D 2 .   ? -19.371 35.836 35.172 1.00 12.89 ? 621 HOH B O   1 
HETATM 3762 O O   . HOH D 2 .   ? -10.639 52.855 33.819 1.00 26.32 ? 633 HOH B O   1 
HETATM 3763 O O   . HOH D 2 .   ? -9.019  53.375 36.291 1.00 17.01 ? 634 HOH B O   1 
HETATM 3764 O O   . HOH D 2 .   ? -11.468 55.844 36.874 1.00 19.37 ? 635 HOH B O   1 
HETATM 3765 O O   . HOH D 2 .   ? -9.134  55.259 38.484 1.00 40.60 ? 637 HOH B O   1 
HETATM 3766 O O   . HOH D 2 .   ? -9.834  48.467 34.470 1.00 38.53 ? 639 HOH B O   1 
HETATM 3767 O O   . HOH D 2 .   ? -9.447  51.891 28.705 1.00 40.91 ? 640 HOH B O   1 
HETATM 3768 O O   . HOH D 2 .   ? -27.110 38.179 55.220 1.00 10.51 ? 658 HOH B O   1 
HETATM 3769 O O   . HOH D 2 .   ? -24.551 38.761 55.762 1.00 14.53 ? 659 HOH B O   1 
HETATM 3770 O O   . HOH D 2 .   ? -25.451 39.656 58.529 1.00 20.06 ? 660 HOH B O   1 
HETATM 3771 O O   . HOH D 2 .   ? -23.905 38.800 60.698 1.00 18.54 ? 661 HOH B O   1 
HETATM 3772 O O   . HOH D 2 .   ? -24.441 42.090 59.559 1.00 11.90 ? 662 HOH B O   1 
HETATM 3773 O O   . HOH D 2 .   ? -27.146 44.022 59.448 1.00 18.62 ? 663 HOH B O   1 
HETATM 3774 O O   . HOH D 2 .   ? -22.094 46.804 57.966 1.00 2.79  ? 664 HOH B O   1 
HETATM 3775 O O   . HOH D 2 .   ? -20.961 43.541 58.292 1.00 29.56 ? 665 HOH B O   1 
HETATM 3776 O O   . HOH D 2 .   ? -33.613 37.847 36.502 1.00 23.12 ? 667 HOH B O   1 
HETATM 3777 O O   . HOH D 2 .   ? -32.327 36.489 41.083 1.00 20.75 ? 668 HOH B O   1 
HETATM 3778 O O   . HOH D 2 .   ? -9.247  42.944 37.775 1.00 10.79 ? 669 HOH B O   1 
HETATM 3779 O O   . HOH D 2 .   ? -6.789  43.614 38.753 1.00 17.15 ? 670 HOH B O   1 
HETATM 3780 O O   . HOH D 2 .   ? -18.905 35.612 45.884 1.00 10.26 ? 671 HOH B O   1 
HETATM 3781 O O   . HOH D 2 .   ? -14.832 52.026 44.704 1.00 12.97 ? 672 HOH B O   1 
HETATM 3782 O O   . HOH D 2 .   ? -18.132 43.600 45.405 1.00 12.35 ? 674 HOH B O   1 
HETATM 3783 O O   . HOH D 2 .   ? -12.214 46.313 49.141 1.00 12.02 ? 683 HOH B O   1 
HETATM 3784 O O   . HOH D 2 .   ? -10.948 45.507 51.677 1.00 15.77 ? 684 HOH B O   1 
HETATM 3785 O O   . HOH D 2 .   ? -10.683 43.439 49.467 1.00 20.30 ? 685 HOH B O   1 
HETATM 3786 O O   . HOH D 2 .   ? -11.750 42.011 52.475 1.00 18.31 ? 686 HOH B O   1 
HETATM 3787 O O   . HOH D 2 .   ? -24.321 19.708 50.135 1.00 25.41 ? 687 HOH B O   1 
HETATM 3788 O O   . HOH D 2 .   ? -16.747 48.265 56.475 1.00 15.38 ? 688 HOH B O   1 
HETATM 3789 O O   . HOH D 2 .   ? -18.431 47.909 58.571 1.00 36.98 ? 689 HOH B O   1 
HETATM 3790 O O   . HOH D 2 .   ? -15.362 49.791 53.849 1.00 7.24  ? 690 HOH B O   1 
HETATM 3791 O O   . HOH D 2 .   ? -25.265 21.307 53.917 1.00 37.71 ? 691 HOH B O   1 
HETATM 3792 O O   . HOH D 2 .   ? -27.855 21.202 53.084 1.00 39.25 ? 692 HOH B O   1 
HETATM 3793 O O   . HOH D 2 .   ? -27.892 18.811 51.649 1.00 44.87 ? 693 HOH B O   1 
HETATM 3794 O O   . HOH D 2 .   ? -9.145  40.876 50.055 1.00 14.84 ? 694 HOH B O   1 
HETATM 3795 O O   . HOH D 2 .   ? -13.396 29.311 64.903 1.00 37.10 ? 695 HOH B O   1 
HETATM 3796 O O   . HOH D 2 .   ? -3.247  54.790 44.757 1.00 29.36 ? 697 HOH B O   1 
HETATM 3797 O O   . HOH D 2 .   ? -5.469  49.987 38.181 1.00 15.74 ? 703 HOH B O   1 
HETATM 3798 O O   . HOH D 2 .   ? -7.900  50.812 36.171 1.00 23.38 ? 704 HOH B O   1 
HETATM 3799 O O   . HOH D 2 .   ? -1.878  40.320 49.393 1.00 38.18 ? 708 HOH B O   1 
HETATM 3800 O O   . HOH D 2 .   ? -2.011  43.032 49.713 1.00 27.85 ? 709 HOH B O   1 
HETATM 3801 O O   . HOH D 2 .   ? 0.488   42.572 51.354 1.00 36.77 ? 710 HOH B O   1 
HETATM 3802 O O   . HOH D 2 .   ? -21.903 32.047 62.610 1.00 34.75 ? 711 HOH B O   1 
HETATM 3803 O O   . HOH D 2 .   ? -17.240 49.841 25.038 1.00 30.02 ? 715 HOH B O   1 
HETATM 3804 O O   . HOH D 2 .   ? -16.534 39.895 29.021 1.00 13.36 ? 716 HOH B O   1 
HETATM 3805 O O   . HOH D 2 .   ? -13.741 38.551 42.461 1.00 13.66 ? 717 HOH B O   1 
HETATM 3806 O O   . HOH D 2 .   ? -8.788  35.186 39.263 1.00 28.63 ? 718 HOH B O   1 
HETATM 3807 O O   . HOH D 2 .   ? -10.478 33.217 39.239 1.00 26.55 ? 719 HOH B O   1 
HETATM 3808 O O   . HOH D 2 .   ? -5.811  35.831 38.504 1.00 27.22 ? 720 HOH B O   1 
HETATM 3809 O O   . HOH D 2 .   ? -17.354 35.760 23.227 1.00 28.06 ? 721 HOH B O   1 
HETATM 3810 O O   . HOH D 2 .   ? -11.172 30.486 23.176 1.00 35.60 ? 722 HOH B O   1 
HETATM 3811 O O   . HOH D 2 .   ? -16.863 32.605 24.533 1.00 30.78 ? 723 HOH B O   1 
HETATM 3812 O O   . HOH D 2 .   ? -9.030  38.052 25.815 1.00 36.10 ? 724 HOH B O   1 
HETATM 3813 O O   . HOH D 2 .   ? -24.375 42.160 22.612 1.00 33.02 ? 725 HOH B O   1 
HETATM 3814 O O   . HOH D 2 .   ? -22.719 39.102 20.781 1.00 39.23 ? 726 HOH B O   1 
HETATM 3815 O O   . HOH D 2 .   ? -20.198 41.706 29.285 1.00 17.68 ? 727 HOH B O   1 
HETATM 3816 O O   . HOH D 2 .   ? -23.191 28.360 61.592 1.00 30.67 ? 735 HOH B O   1 
HETATM 3817 O O   . HOH D 2 .   ? -24.159 35.846 61.550 1.00 27.91 ? 736 HOH B O   1 
HETATM 3818 O O   . HOH D 2 .   ? -22.610 36.906 63.946 1.00 34.99 ? 737 HOH B O   1 
HETATM 3819 O O   . HOH D 2 .   ? -26.728 33.557 61.376 1.00 27.56 ? 738 HOH B O   1 
HETATM 3820 O O   . HOH D 2 .   ? -24.517 31.773 61.479 1.00 36.09 ? 739 HOH B O   1 
HETATM 3821 O O   . HOH D 2 .   ? -9.685  50.934 60.479 1.00 38.03 ? 740 HOH B O   1 
HETATM 3822 O O   . HOH D 2 .   ? -22.144 45.029 61.306 1.00 22.29 ? 741 HOH B O   1 
HETATM 3823 O O   . HOH D 2 .   ? -20.381 45.480 54.907 1.00 26.89 ? 742 HOH B O   1 
HETATM 3824 O O   . HOH D 2 .   ? -22.595 52.135 49.589 1.00 20.43 ? 743 HOH B O   1 
HETATM 3825 O O   . HOH D 2 .   ? -6.696  26.261 55.531 1.00 28.92 ? 744 HOH B O   1 
HETATM 3826 O O   . HOH D 2 .   ? -19.428 45.487 61.433 1.00 33.34 ? 745 HOH B O   1 
HETATM 3827 O O   . HOH D 2 .   ? -17.397 50.379 61.176 1.00 37.88 ? 746 HOH B O   1 
HETATM 3828 O O   . HOH D 2 .   ? -19.807 51.123 58.998 1.00 32.87 ? 747 HOH B O   1 
HETATM 3829 O O   . HOH D 2 .   ? -21.363 53.051 57.365 1.00 37.88 ? 748 HOH B O   1 
HETATM 3830 O O   . HOH D 2 .   ? -23.398 53.170 60.080 1.00 32.62 ? 749 HOH B O   1 
HETATM 3831 O O   . HOH D 2 .   ? -30.511 21.491 52.270 1.00 36.58 ? 750 HOH B O   1 
HETATM 3832 O O   . HOH D 2 .   ? -35.474 39.439 53.573 1.00 38.45 ? 751 HOH B O   1 
HETATM 3833 O O   . HOH D 2 .   ? -32.084 34.490 53.131 1.00 37.78 ? 752 HOH B O   1 
HETATM 3834 O O   . HOH D 2 .   ? -24.233 50.967 51.555 1.00 34.08 ? 753 HOH B O   1 
HETATM 3835 O O   . HOH D 2 .   ? -22.122 56.566 40.842 1.00 38.63 ? 754 HOH B O   1 
HETATM 3836 O O   . HOH D 2 .   ? -23.164 53.064 37.931 1.00 37.91 ? 755 HOH B O   1 
HETATM 3837 O O   . HOH D 2 .   ? -20.403 56.722 43.260 1.00 18.25 ? 756 HOH B O   1 
HETATM 3838 O O   . HOH D 2 .   ? -2.044  49.634 48.483 1.00 34.74 ? 757 HOH B O   1 
HETATM 3839 O O   . HOH D 2 .   ? -40.921 36.020 43.428 1.00 38.36 ? 758 HOH B O   1 
HETATM 3840 O O   . HOH D 2 .   ? -31.628 25.340 43.261 1.00 37.01 ? 762 HOH B O   1 
HETATM 3841 O O   . HOH D 2 .   ? -32.597 47.007 43.713 1.00 36.57 ? 763 HOH B O   1 
HETATM 3842 O O   . HOH D 2 .   ? -29.788 36.008 42.920 1.00 17.85 ? 764 HOH B O   1 
HETATM 3843 O O   . HOH D 2 .   ? -28.276 18.178 39.581 1.00 33.38 ? 766 HOH B O   1 
HETATM 3844 O O   . HOH D 2 .   ? -9.395  35.694 36.668 1.00 40.20 ? 768 HOH B O   1 
HETATM 3845 O O   . HOH D 2 .   ? -5.412  45.391 36.589 1.00 36.98 ? 771 HOH B O   1 
HETATM 3846 O O   . HOH D 2 .   ? -25.525 27.890 39.397 1.00 16.03 ? 772 HOH B O   1 
HETATM 3847 O O   . HOH D 2 .   ? -23.580 28.530 37.616 1.00 16.86 ? 773 HOH B O   1 
HETATM 3848 O O   . HOH D 2 .   ? -14.629 33.090 34.892 1.00 37.25 ? 774 HOH B O   1 
HETATM 3849 O O   . HOH D 2 .   ? -14.911 36.477 34.730 1.00 25.11 ? 775 HOH B O   1 
HETATM 3850 O O   . HOH D 2 .   ? -37.611 39.993 33.522 1.00 34.23 ? 787 HOH B O   1 
HETATM 3851 O O   . HOH D 2 .   ? -29.439 50.403 42.332 1.00 35.05 ? 789 HOH B O   1 
HETATM 3852 O O   . HOH D 2 .   ? -26.325 50.966 41.591 1.00 36.35 ? 790 HOH B O   1 
HETATM 3853 O O   . HOH D 2 .   ? -35.123 32.650 35.728 1.00 34.85 ? 796 HOH B O   1 
HETATM 3854 O O   . HOH D 2 .   ? -35.201 35.508 34.293 1.00 25.79 ? 798 HOH B O   1 
HETATM 3855 O O   . HOH D 2 .   ? -24.640 24.623 31.425 1.00 24.57 ? 800 HOH B O   1 
HETATM 3856 O O   . HOH D 2 .   ? -15.910 30.531 28.391 1.00 27.13 ? 804 HOH B O   1 
HETATM 3857 O O   . HOH D 2 .   ? -23.066 29.050 23.334 1.00 41.31 ? 806 HOH B O   1 
HETATM 3858 O O   . HOH D 2 .   ? -21.707 33.805 22.051 1.00 37.94 ? 807 HOH B O   1 
HETATM 3859 O O   . HOH D 2 .   ? -20.510 29.409 23.142 1.00 35.96 ? 808 HOH B O   1 
HETATM 3860 O O   . HOH D 2 .   ? -27.970 47.968 42.377 1.00 22.64 ? 810 HOH B O   1 
HETATM 3861 O O   . HOH D 2 .   ? -31.860 50.418 41.121 1.00 36.63 ? 811 HOH B O   1 
HETATM 3862 O O   . HOH D 2 .   ? -30.731 50.786 38.529 1.00 35.86 ? 812 HOH B O   1 
HETATM 3863 O O   . HOH D 2 .   ? -35.342 31.110 24.733 1.00 34.68 ? 817 HOH B O   1 
HETATM 3864 O O   . HOH D 2 .   ? -36.577 31.357 31.849 1.00 32.59 ? 818 HOH B O   1 
HETATM 3865 O O   . HOH D 2 .   ? -33.673 29.530 32.557 1.00 31.69 ? 819 HOH B O   1 
HETATM 3866 O O   . HOH D 2 .   ? -32.788 26.413 29.852 1.00 32.44 ? 820 HOH B O   1 
HETATM 3867 O O   . HOH D 2 .   ? -33.388 24.720 34.071 1.00 35.36 ? 821 HOH B O   1 
HETATM 3868 O O   . HOH D 2 .   ? -32.955 23.652 29.513 1.00 41.39 ? 822 HOH B O   1 
HETATM 3869 O O   . HOH D 2 .   ? -9.594  47.111 48.514 1.00 23.72 ? 823 HOH B O   1 
HETATM 3870 O O   . HOH D 2 .   ? -16.605 46.619 61.030 1.00 35.39 ? 824 HOH B O   1 
HETATM 3871 O O   . HOH D 2 .   ? -6.950  48.091 51.675 1.00 34.62 ? 825 HOH B O   1 
HETATM 3872 O O   . HOH D 2 .   ? -14.402 21.417 46.421 1.00 30.58 ? 826 HOH B O   1 
HETATM 3873 O O   . HOH D 2 .   ? -9.140  20.571 44.130 1.00 30.55 ? 827 HOH B O   1 
HETATM 3874 O O   . HOH D 2 .   ? -11.838 20.004 44.746 1.00 38.41 ? 828 HOH B O   1 
HETATM 3875 O O   . HOH D 2 .   ? -15.285 19.383 48.988 1.00 26.95 ? 829 HOH B O   1 
HETATM 3876 O O   . HOH D 2 .   ? -18.856 15.191 45.005 1.00 40.73 ? 830 HOH B O   1 
HETATM 3877 O O   . HOH D 2 .   ? -20.259 17.266 39.636 1.00 27.55 ? 831 HOH B O   1 
HETATM 3878 O O   . HOH D 2 .   ? -35.892 38.688 56.817 1.00 28.89 ? 835 HOH B O   1 
HETATM 3879 O O   . HOH D 2 .   ? -8.150  51.753 58.359 1.00 28.54 ? 836 HOH B O   1 
HETATM 3880 O O   . HOH D 2 .   ? -8.131  49.059 58.897 1.00 32.29 ? 837 HOH B O   1 
HETATM 3881 O O   . HOH D 2 .   ? -10.739 56.424 51.384 1.00 27.34 ? 838 HOH B O   1 
HETATM 3882 O O   . HOH D 2 .   ? -9.447  54.165 51.481 1.00 27.61 ? 839 HOH B O   1 
HETATM 3883 O O   . HOH D 2 .   ? -14.599 57.111 49.836 1.00 29.47 ? 840 HOH B O   1 
HETATM 3884 O O   . HOH D 2 .   ? -35.079 32.659 52.049 1.00 33.87 ? 843 HOH B O   1 
HETATM 3885 O O   . HOH D 2 .   ? -8.915  44.332 59.821 1.00 36.40 ? 853 HOH B O   1 
HETATM 3886 O O   . HOH D 2 .   ? -7.035  43.662 57.909 1.00 37.75 ? 854 HOH B O   1 
HETATM 3887 O O   . HOH D 2 .   ? -8.553  44.940 63.305 1.00 34.31 ? 855 HOH B O   1 
HETATM 3888 O O   . HOH D 2 .   ? -36.253 27.990 47.875 1.00 34.81 ? 856 HOH B O   1 
HETATM 3889 O O   . HOH D 2 .   ? -10.685 19.742 52.145 1.00 29.94 ? 857 HOH B O   1 
HETATM 3890 O O   . HOH D 2 .   ? -13.659 19.911 53.866 1.00 32.01 ? 858 HOH B O   1 
HETATM 3891 O O   . HOH D 2 .   ? -10.767 16.562 52.740 1.00 37.05 ? 859 HOH B O   1 
HETATM 3892 O O   . HOH D 2 .   ? -31.250 41.542 52.616 1.00 40.09 ? 860 HOH B O   1 
HETATM 3893 O O   . HOH D 2 .   ? 1.351   42.093 54.073 1.00 33.41 ? 861 HOH B O   1 
HETATM 3894 O O   . HOH D 2 .   ? -25.585 58.057 35.144 1.00 39.01 ? 871 HOH B O   1 
HETATM 3895 O O   . HOH D 2 .   ? -31.341 51.337 47.638 1.00 39.08 ? 872 HOH B O   1 
HETATM 3896 O O   . HOH D 2 .   ? -29.122 24.111 45.603 1.00 34.70 ? 873 HOH B O   1 
HETATM 3897 O O   . HOH D 2 .   ? 3.080   34.513 42.660 1.00 35.03 ? 874 HOH B O   1 
HETATM 3898 O O   . HOH D 2 .   ? -15.429 23.862 45.940 1.00 34.86 ? 876 HOH B O   1 
HETATM 3899 O O   . HOH D 2 .   ? 2.516   40.403 42.516 1.00 28.59 ? 877 HOH B O   1 
HETATM 3900 O O   . HOH D 2 .   ? 2.055   37.405 39.841 1.00 28.84 ? 878 HOH B O   1 
HETATM 3901 O O   . HOH D 2 .   ? -4.310  25.916 41.990 1.00 36.98 ? 879 HOH B O   1 
HETATM 3902 O O   . HOH D 2 .   ? -39.714 31.780 44.708 1.00 36.25 ? 880 HOH B O   1 
HETATM 3903 O O   . HOH D 2 .   ? -2.179  36.921 40.908 1.00 32.00 ? 886 HOH B O   1 
HETATM 3904 O O   . HOH D 2 .   ? -5.152  38.239 39.957 1.00 27.98 ? 887 HOH B O   1 
HETATM 3905 O O   . HOH D 2 .   ? -6.883  55.488 40.275 1.00 28.37 ? 888 HOH B O   1 
HETATM 3906 O O   . HOH D 2 .   ? -30.703 30.433 21.681 1.00 35.16 ? 894 HOH B O   1 
HETATM 3907 O O   . HOH D 2 .   ? -31.726 28.322 23.472 1.00 27.87 ? 895 HOH B O   1 
HETATM 3908 O O   . HOH D 2 .   ? -30.655 26.324 21.980 1.00 30.18 ? 896 HOH B O   1 
HETATM 3909 O O   . HOH D 2 .   ? -12.392 46.944 64.697 1.00 33.42 ? 901 HOH B O   1 
HETATM 3910 O O   . HOH D 2 .   ? -10.469 45.736 66.504 1.00 33.76 ? 902 HOH B O   1 
HETATM 3911 O O   . HOH D 2 .   ? -18.950 29.774 64.281 1.00 34.17 ? 903 HOH B O   1 
HETATM 3912 O O   . HOH D 2 .   ? -18.044 33.108 66.263 1.00 33.32 ? 904 HOH B O   1 
HETATM 3913 O O   . HOH D 2 .   ? -17.160 35.426 65.388 1.00 34.07 ? 905 HOH B O   1 
HETATM 3914 O O   . HOH D 2 .   ? -2.752  53.065 46.868 1.00 33.53 ? 907 HOH B O   1 
HETATM 3915 O O   . HOH D 2 .   ? -5.043  21.469 40.163 1.00 33.10 ? 909 HOH B O   1 
HETATM 3916 O O   . HOH D 2 .   ? -4.034  23.886 40.271 1.00 32.27 ? 910 HOH B O   1 
HETATM 3917 O O   . HOH D 2 .   ? -27.233 20.191 35.412 1.00 33.06 ? 914 HOH B O   1 
HETATM 3918 O O   . HOH D 2 .   ? -8.498  49.307 29.596 1.00 34.84 ? 916 HOH B O   1 
HETATM 3919 O O   . HOH D 2 .   ? -6.747  47.418 27.653 1.00 34.25 ? 917 HOH B O   1 
HETATM 3920 O O   . HOH D 2 .   ? -30.090 36.420 33.044 1.00 31.35 ? 918 HOH B O   1 
HETATM 3921 O O   . HOH D 2 .   ? -11.181 50.004 30.647 1.00 31.93 ? 919 HOH B O   1 
HETATM 3922 O O   . HOH D 2 .   ? -12.904 52.213 31.353 1.00 30.96 ? 920 HOH B O   1 
HETATM 3923 O O   . HOH D 2 .   ? -16.740 27.936 28.942 1.00 33.49 ? 922 HOH B O   1 
HETATM 3924 O O   . HOH D 2 .   ? -18.902 26.654 29.792 1.00 32.88 ? 923 HOH B O   1 
HETATM 3925 O O   . HOH D 2 .   ? -27.245 44.259 27.754 1.00 31.28 ? 924 HOH B O   1 
HETATM 3926 O O   . HOH D 2 .   ? -29.391 45.279 29.018 1.00 34.42 ? 925 HOH B O   1 
HETATM 3927 O O   . HOH D 2 .   ? -31.496 44.151 30.341 1.00 32.20 ? 926 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   CYS 1   1   1   CYS CYS A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   ALA 5   5   5   ALA ALA A . n 
A 1 6   ILE 6   6   6   ILE ILE A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   PRO 8   8   8   PRO PRO A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  SER 26  26  26  SER SER A . n 
A 1 27  TRP 27  27  27  TRP TRP A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  TRP 29  29  29  TRP TRP A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  SER 32  32  32  SER SER A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  GLY 38  38  38  GLY GLY A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  CYS 42  42  42  CYS CYS A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  GLY 44  44  44  GLY GLY A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  TRP 51  51  51  TRP TRP A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  VAL 53  53  53  VAL VAL A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  HIS 57  57  57  HIS HIS A . n 
A 1 58  CYS 58  58  58  CYS CYS A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  VAL 60  60  60  VAL VAL A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  ALA 68  68  68  ALA ALA A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  TYR 94  94  94  TYR TYR A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 ASP 102 102 102 ASP ASP A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 SER 115 115 115 SER SER A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 CYS 122 122 122 CYS CYS A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 SER 127 127 127 SER SER A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 ALA 131 131 131 ALA ALA A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 CYS 136 136 136 CYS CYS A . n 
A 1 137 VAL 137 137 137 VAL VAL A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 TRP 141 141 141 TRP TRP A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 ASN 148 148 148 ASN ASN A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 THR 151 151 151 THR THR A . n 
A 1 152 PRO 152 152 152 PRO PRO A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 GLN 156 156 156 GLN GLN A . n 
A 1 157 GLN 157 157 157 GLN GLN A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 SER 159 159 159 SER SER A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 PRO 161 161 161 PRO PRO A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 THR 166 166 166 THR THR A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 LYS 170 170 170 LYS LYS A . n 
A 1 171 TYR 171 171 171 TYR TYR A . n 
A 1 172 TRP 172 172 172 TRP TRP A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 THR 174 174 174 THR THR A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 ILE 176 176 176 ILE ILE A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 MET 180 180 180 MET MET A . n 
A 1 181 ILE 181 181 181 ILE ILE A . n 
A 1 182 CYS 182 182 182 CYS CYS A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 ALA 185 185 185 ALA ALA A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 GLY 187 187 187 GLY GLY A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 SER 189 189 189 SER SER A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 CYS 191 191 191 CYS CYS A . n 
A 1 192 MET 192 192 192 MET MET A . n 
A 1 193 GLY 193 193 193 GLY GLY A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 PRO 198 198 198 PRO PRO A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 VAL 200 200 200 VAL VAL A . n 
A 1 201 CYS 201 201 201 CYS CYS A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 LYS 203 203 203 LYS LYS A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 TRP 207 207 207 TRP TRP A . n 
A 1 208 THR 208 208 208 THR THR A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 VAL 210 210 210 VAL VAL A . n 
A 1 211 GLY 211 211 211 GLY GLY A . n 
A 1 212 ILE 212 212 212 ILE ILE A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 SER 214 214 214 SER SER A . n 
A 1 215 TRP 215 215 215 TRP TRP A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 SER 217 217 217 SER SER A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 THR 219 219 219 THR THR A . n 
A 1 220 CYS 220 220 220 CYS CYS A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 THR 222 222 222 THR THR A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 TYR 228 228 228 TYR TYR A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 ARG 230 230 230 ARG ARG A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 THR 232 232 232 THR THR A . n 
A 1 233 ALA 233 233 233 ALA ALA A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 VAL 235 235 235 VAL VAL A . n 
A 1 236 ASN 236 236 236 ASN ASN A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 GLN 239 239 239 GLN GLN A . n 
A 1 240 GLN 240 240 240 GLN GLN A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ASN 245 245 245 ASN ASN A . n 
B 1 1   CYS 1   1   1   CYS CYS B . n 
B 1 2   GLY 2   2   2   GLY GLY B . n 
B 1 3   VAL 3   3   3   VAL VAL B . n 
B 1 4   PRO 4   4   4   PRO PRO B . n 
B 1 5   ALA 5   5   5   ALA ALA B . n 
B 1 6   ILE 6   6   6   ILE ILE B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   PRO 8   8   8   PRO PRO B . n 
B 1 9   VAL 9   9   9   VAL VAL B . n 
B 1 10  LEU 10  10  10  LEU LEU B . n 
B 1 11  SER 11  11  11  SER SER B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  LEU 13  13  13  LEU LEU B . n 
B 1 14  SER 14  14  14  SER SER B . n 
B 1 15  ARG 15  15  15  ARG ARG B . n 
B 1 16  ILE 16  16  16  ILE ILE B . n 
B 1 17  VAL 17  17  17  VAL VAL B . n 
B 1 18  ASN 18  18  18  ASN ASN B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  GLU 20  20  20  GLU GLU B . n 
B 1 21  GLU 21  21  21  GLU GLU B . n 
B 1 22  ALA 22  22  22  ALA ALA B . n 
B 1 23  VAL 23  23  23  VAL VAL B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  SER 26  26  26  SER SER B . n 
B 1 27  TRP 27  27  27  TRP TRP B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  TRP 29  29  29  TRP TRP B . n 
B 1 30  GLN 30  30  30  GLN GLN B . n 
B 1 31  VAL 31  31  31  VAL VAL B . n 
B 1 32  SER 32  32  32  SER SER B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLN 34  34  34  GLN GLN B . n 
B 1 35  ASP 35  35  35  ASP ASP B . n 
B 1 36  LYS 36  36  36  LYS LYS B . n 
B 1 37  THR 37  37  37  THR THR B . n 
B 1 38  GLY 38  38  38  GLY GLY B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  HIS 40  40  40  HIS HIS B . n 
B 1 41  PHE 41  41  41  PHE PHE B . n 
B 1 42  CYS 42  42  42  CYS CYS B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  GLY 44  44  44  GLY GLY B . n 
B 1 45  SER 45  45  45  SER SER B . n 
B 1 46  LEU 46  46  46  LEU LEU B . n 
B 1 47  ILE 47  47  47  ILE ILE B . n 
B 1 48  ASN 48  48  48  ASN ASN B . n 
B 1 49  GLU 49  49  49  GLU GLU B . n 
B 1 50  ASN 50  50  50  ASN ASN B . n 
B 1 51  TRP 51  51  51  TRP TRP B . n 
B 1 52  VAL 52  52  52  VAL VAL B . n 
B 1 53  VAL 53  53  53  VAL VAL B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  ALA 56  56  56  ALA ALA B . n 
B 1 57  HIS 57  57  57  HIS HIS B . n 
B 1 58  CYS 58  58  58  CYS CYS B . n 
B 1 59  GLY 59  59  59  GLY GLY B . n 
B 1 60  VAL 60  60  60  VAL VAL B . n 
B 1 61  THR 61  61  61  THR THR B . n 
B 1 62  THR 62  62  62  THR THR B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  ASP 64  64  64  ASP ASP B . n 
B 1 65  VAL 65  65  65  VAL VAL B . n 
B 1 66  VAL 66  66  66  VAL VAL B . n 
B 1 67  VAL 67  67  67  VAL VAL B . n 
B 1 68  ALA 68  68  68  ALA ALA B . n 
B 1 69  GLY 69  69  69  GLY GLY B . n 
B 1 70  GLU 70  70  70  GLU GLU B . n 
B 1 71  PHE 71  71  71  PHE PHE B . n 
B 1 72  ASP 72  72  72  ASP ASP B . n 
B 1 73  GLN 73  73  73  GLN GLN B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  SER 76  76  76  SER SER B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  GLU 78  78  78  GLU GLU B . n 
B 1 79  LYS 79  79  79  LYS LYS B . n 
B 1 80  ILE 80  80  80  ILE ILE B . n 
B 1 81  GLN 81  81  81  GLN GLN B . n 
B 1 82  LYS 82  82  82  LYS LYS B . n 
B 1 83  LEU 83  83  83  LEU LEU B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  ILE 85  85  85  ILE ILE B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  LYS 87  87  87  LYS LYS B . n 
B 1 88  VAL 88  88  88  VAL VAL B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  ASN 91  91  91  ASN ASN B . n 
B 1 92  SER 92  92  92  SER SER B . n 
B 1 93  LYS 93  93  93  LYS LYS B . n 
B 1 94  TYR 94  94  94  TYR TYR B . n 
B 1 95  ASN 95  95  95  ASN ASN B . n 
B 1 96  SER 96  96  96  SER SER B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  THR 98  98  98  THR THR B . n 
B 1 99  ILE 99  99  99  ILE ILE B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 ASN 101 101 101 ASN ASN B . n 
B 1 102 ASP 102 102 102 ASP ASP B . n 
B 1 103 ILE 103 103 103 ILE ILE B . n 
B 1 104 THR 104 104 104 THR THR B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 LYS 107 107 107 LYS LYS B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 THR 110 110 110 THR THR B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 SER 113 113 113 SER SER B . n 
B 1 114 PHE 114 114 114 PHE PHE B . n 
B 1 115 SER 115 115 115 SER SER B . n 
B 1 116 GLN 116 116 116 GLN GLN B . n 
B 1 117 THR 117 117 117 THR THR B . n 
B 1 118 VAL 118 118 118 VAL VAL B . n 
B 1 119 SER 119 119 119 SER SER B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 VAL 121 121 121 VAL VAL B . n 
B 1 122 CYS 122 122 122 CYS CYS B . n 
B 1 123 LEU 123 123 123 LEU LEU B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 ALA 126 126 126 ALA ALA B . n 
B 1 127 SER 127 127 127 SER SER B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 ASP 129 129 129 ASP ASP B . n 
B 1 130 PHE 130 130 130 PHE PHE B . n 
B 1 131 ALA 131 131 131 ALA ALA B . n 
B 1 132 ALA 132 132 132 ALA ALA B . n 
B 1 133 GLY 133 133 133 GLY GLY B . n 
B 1 134 THR 134 134 134 THR THR B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 CYS 136 136 136 CYS CYS B . n 
B 1 137 VAL 137 137 137 VAL VAL B . n 
B 1 138 THR 138 138 138 THR THR B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 GLY 140 140 140 GLY GLY B . n 
B 1 141 TRP 141 141 141 TRP TRP B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 THR 144 144 144 THR THR B . n 
B 1 145 ARG 145 145 145 ARG ARG B . n 
B 1 146 TYR 146 146 146 TYR TYR B . n 
B 1 147 THR 147 147 147 THR THR B . n 
B 1 148 ASN 148 148 148 ASN ASN B . n 
B 1 149 ALA 149 149 149 ALA ALA B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 THR 151 151 151 THR THR B . n 
B 1 152 PRO 152 152 152 PRO PRO B . n 
B 1 153 ASP 153 153 153 ASP ASP B . n 
B 1 154 ARG 154 154 154 ARG ARG B . n 
B 1 155 LEU 155 155 155 LEU LEU B . n 
B 1 156 GLN 156 156 156 GLN GLN B . n 
B 1 157 GLN 157 157 157 GLN GLN B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 SER 159 159 159 SER SER B . n 
B 1 160 LEU 160 160 160 LEU LEU B . n 
B 1 161 PRO 161 161 161 PRO PRO B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 LEU 163 163 163 LEU LEU B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ASN 165 165 165 ASN ASN B . n 
B 1 166 THR 166 166 166 THR THR B . n 
B 1 167 ASN 167 167 167 ASN ASN B . n 
B 1 168 CYS 168 168 168 CYS CYS B . n 
B 1 169 LYS 169 169 169 LYS LYS B . n 
B 1 170 LYS 170 170 170 LYS LYS B . n 
B 1 171 TYR 171 171 171 TYR TYR B . n 
B 1 172 TRP 172 172 172 TRP TRP B . n 
B 1 173 GLY 173 173 173 GLY GLY B . n 
B 1 174 THR 174 174 174 THR THR B . n 
B 1 175 LYS 175 175 175 LYS LYS B . n 
B 1 176 ILE 176 176 176 ILE ILE B . n 
B 1 177 LYS 177 177 177 LYS LYS B . n 
B 1 178 ASP 178 178 178 ASP ASP B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 MET 180 180 180 MET MET B . n 
B 1 181 ILE 181 181 181 ILE ILE B . n 
B 1 182 CYS 182 182 182 CYS CYS B . n 
B 1 183 ALA 183 183 183 ALA ALA B . n 
B 1 184 GLY 184 184 184 GLY GLY B . n 
B 1 185 ALA 185 185 185 ALA ALA B . n 
B 1 186 SER 186 186 186 SER SER B . n 
B 1 187 GLY 187 187 187 GLY GLY B . n 
B 1 188 VAL 188 188 188 VAL VAL B . n 
B 1 189 SER 189 189 189 SER SER B . n 
B 1 190 SER 190 190 190 SER SER B . n 
B 1 191 CYS 191 191 191 CYS CYS B . n 
B 1 192 MET 192 192 192 MET MET B . n 
B 1 193 GLY 193 193 193 GLY GLY B . n 
B 1 194 ASP 194 194 194 ASP ASP B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 GLY 196 196 196 GLY GLY B . n 
B 1 197 GLY 197 197 197 GLY GLY B . n 
B 1 198 PRO 198 198 198 PRO PRO B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 VAL 200 200 200 VAL VAL B . n 
B 1 201 CYS 201 201 201 CYS CYS B . n 
B 1 202 LYS 202 202 202 LYS LYS B . n 
B 1 203 LYS 203 203 203 LYS LYS B . n 
B 1 204 ASN 204 204 204 ASN ASN B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 TRP 207 207 207 TRP TRP B . n 
B 1 208 THR 208 208 208 THR THR B . n 
B 1 209 LEU 209 209 209 LEU LEU B . n 
B 1 210 VAL 210 210 210 VAL VAL B . n 
B 1 211 GLY 211 211 211 GLY GLY B . n 
B 1 212 ILE 212 212 212 ILE ILE B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 SER 214 214 214 SER SER B . n 
B 1 215 TRP 215 215 215 TRP TRP B . n 
B 1 216 GLY 216 216 216 GLY GLY B . n 
B 1 217 SER 217 217 217 SER SER B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 THR 219 219 219 THR THR B . n 
B 1 220 CYS 220 220 220 CYS CYS B . n 
B 1 221 SER 221 221 221 SER SER B . n 
B 1 222 THR 222 222 222 THR THR B . n 
B 1 223 SER 223 223 223 SER SER B . n 
B 1 224 THR 224 224 224 THR THR B . n 
B 1 225 PRO 225 225 225 PRO PRO B . n 
B 1 226 GLY 226 226 226 GLY GLY B . n 
B 1 227 VAL 227 227 227 VAL VAL B . n 
B 1 228 TYR 228 228 228 TYR TYR B . n 
B 1 229 ALA 229 229 229 ALA ALA B . n 
B 1 230 ARG 230 230 230 ARG ARG B . n 
B 1 231 VAL 231 231 231 VAL VAL B . n 
B 1 232 THR 232 232 232 THR THR B . n 
B 1 233 ALA 233 233 233 ALA ALA B . n 
B 1 234 LEU 234 234 234 LEU LEU B . n 
B 1 235 VAL 235 235 235 VAL VAL B . n 
B 1 236 ASN 236 236 236 ASN ASN B . n 
B 1 237 TRP 237 237 237 TRP TRP B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 GLN 239 239 239 GLN GLN B . n 
B 1 240 GLN 240 240 240 GLN GLN B . n 
B 1 241 THR 241 241 241 THR THR B . n 
B 1 242 LEU 242 242 242 LEU LEU B . n 
B 1 243 ALA 243 243 243 ALA ALA B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ASN 245 245 245 ASN ASN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   601 601 HOH HOH A . 
C 2 HOH 2   602 602 HOH HOH A . 
C 2 HOH 3   603 603 HOH HOH A . 
C 2 HOH 4   604 604 HOH HOH A . 
C 2 HOH 5   608 608 HOH HOH A . 
C 2 HOH 6   611 611 HOH HOH A . 
C 2 HOH 7   612 612 HOH HOH A . 
C 2 HOH 8   613 613 HOH HOH A . 
C 2 HOH 9   622 622 HOH HOH A . 
C 2 HOH 10  623 623 HOH HOH A . 
C 2 HOH 11  624 624 HOH HOH A . 
C 2 HOH 12  625 625 HOH HOH A . 
C 2 HOH 13  626 626 HOH HOH A . 
C 2 HOH 14  627 627 HOH HOH A . 
C 2 HOH 15  628 628 HOH HOH A . 
C 2 HOH 16  629 629 HOH HOH A . 
C 2 HOH 17  630 630 HOH HOH A . 
C 2 HOH 18  631 631 HOH HOH A . 
C 2 HOH 19  632 632 HOH HOH A . 
C 2 HOH 20  636 636 HOH HOH A . 
C 2 HOH 21  638 638 HOH HOH A . 
C 2 HOH 22  641 641 HOH HOH A . 
C 2 HOH 23  642 642 HOH HOH A . 
C 2 HOH 24  643 643 HOH HOH A . 
C 2 HOH 25  644 644 HOH HOH A . 
C 2 HOH 26  645 645 HOH HOH A . 
C 2 HOH 27  646 646 HOH HOH A . 
C 2 HOH 28  647 647 HOH HOH A . 
C 2 HOH 29  648 648 HOH HOH A . 
C 2 HOH 30  649 649 HOH HOH A . 
C 2 HOH 31  650 650 HOH HOH A . 
C 2 HOH 32  651 651 HOH HOH A . 
C 2 HOH 33  652 652 HOH HOH A . 
C 2 HOH 34  653 653 HOH HOH A . 
C 2 HOH 35  654 654 HOH HOH A . 
C 2 HOH 36  655 655 HOH HOH A . 
C 2 HOH 37  656 656 HOH HOH A . 
C 2 HOH 38  657 657 HOH HOH A . 
C 2 HOH 39  666 666 HOH HOH A . 
C 2 HOH 40  673 673 HOH HOH A . 
C 2 HOH 41  675 675 HOH HOH A . 
C 2 HOH 42  676 676 HOH HOH A . 
C 2 HOH 43  677 677 HOH HOH A . 
C 2 HOH 44  678 678 HOH HOH A . 
C 2 HOH 45  679 679 HOH HOH A . 
C 2 HOH 46  680 680 HOH HOH A . 
C 2 HOH 47  681 681 HOH HOH A . 
C 2 HOH 48  682 682 HOH HOH A . 
C 2 HOH 49  696 696 HOH HOH A . 
C 2 HOH 50  698 698 HOH HOH A . 
C 2 HOH 51  699 699 HOH HOH A . 
C 2 HOH 52  700 700 HOH HOH A . 
C 2 HOH 53  701 701 HOH HOH A . 
C 2 HOH 54  702 702 HOH HOH A . 
C 2 HOH 55  705 705 HOH HOH A . 
C 2 HOH 56  706 706 HOH HOH A . 
C 2 HOH 57  707 707 HOH HOH A . 
C 2 HOH 58  712 712 HOH HOH A . 
C 2 HOH 59  713 713 HOH HOH A . 
C 2 HOH 60  714 714 HOH HOH A . 
C 2 HOH 61  728 728 HOH HOH A . 
C 2 HOH 62  729 729 HOH HOH A . 
C 2 HOH 63  730 730 HOH HOH A . 
C 2 HOH 64  731 731 HOH HOH A . 
C 2 HOH 65  732 732 HOH HOH A . 
C 2 HOH 66  733 733 HOH HOH A . 
C 2 HOH 67  734 734 HOH HOH A . 
C 2 HOH 68  759 759 HOH HOH A . 
C 2 HOH 69  760 760 HOH HOH A . 
C 2 HOH 70  761 761 HOH HOH A . 
C 2 HOH 71  765 765 HOH HOH A . 
C 2 HOH 72  767 767 HOH HOH A . 
C 2 HOH 73  769 769 HOH HOH A . 
C 2 HOH 74  770 770 HOH HOH A . 
C 2 HOH 75  776 776 HOH HOH A . 
C 2 HOH 76  777 777 HOH HOH A . 
C 2 HOH 77  778 778 HOH HOH A . 
C 2 HOH 78  779 779 HOH HOH A . 
C 2 HOH 79  780 780 HOH HOH A . 
C 2 HOH 80  781 781 HOH HOH A . 
C 2 HOH 81  782 782 HOH HOH A . 
C 2 HOH 82  783 783 HOH HOH A . 
C 2 HOH 83  784 784 HOH HOH A . 
C 2 HOH 84  785 785 HOH HOH A . 
C 2 HOH 85  786 786 HOH HOH A . 
C 2 HOH 86  788 788 HOH HOH A . 
C 2 HOH 87  791 791 HOH HOH A . 
C 2 HOH 88  792 792 HOH HOH A . 
C 2 HOH 89  793 793 HOH HOH A . 
C 2 HOH 90  794 794 HOH HOH A . 
C 2 HOH 91  795 795 HOH HOH A . 
C 2 HOH 92  797 797 HOH HOH A . 
C 2 HOH 93  799 799 HOH HOH A . 
C 2 HOH 94  802 802 HOH HOH A . 
C 2 HOH 95  803 803 HOH HOH A . 
C 2 HOH 96  805 805 HOH HOH A . 
C 2 HOH 97  809 809 HOH HOH A . 
C 2 HOH 98  813 813 HOH HOH A . 
C 2 HOH 99  814 814 HOH HOH A . 
C 2 HOH 100 815 815 HOH HOH A . 
C 2 HOH 101 816 816 HOH HOH A . 
C 2 HOH 102 832 832 HOH HOH A . 
C 2 HOH 103 833 833 HOH HOH A . 
C 2 HOH 104 834 834 HOH HOH A . 
C 2 HOH 105 841 841 HOH HOH A . 
C 2 HOH 106 842 842 HOH HOH A . 
C 2 HOH 107 844 844 HOH HOH A . 
C 2 HOH 108 845 845 HOH HOH A . 
C 2 HOH 109 846 846 HOH HOH A . 
C 2 HOH 110 847 847 HOH HOH A . 
C 2 HOH 111 848 848 HOH HOH A . 
C 2 HOH 112 849 849 HOH HOH A . 
C 2 HOH 113 850 850 HOH HOH A . 
C 2 HOH 114 851 851 HOH HOH A . 
C 2 HOH 115 852 852 HOH HOH A . 
C 2 HOH 116 862 862 HOH HOH A . 
C 2 HOH 117 863 863 HOH HOH A . 
C 2 HOH 118 864 864 HOH HOH A . 
C 2 HOH 119 865 865 HOH HOH A . 
C 2 HOH 120 866 866 HOH HOH A . 
C 2 HOH 121 867 867 HOH HOH A . 
C 2 HOH 122 868 868 HOH HOH A . 
C 2 HOH 123 869 869 HOH HOH A . 
C 2 HOH 124 870 870 HOH HOH A . 
C 2 HOH 125 875 875 HOH HOH A . 
C 2 HOH 126 881 881 HOH HOH A . 
C 2 HOH 127 882 882 HOH HOH A . 
C 2 HOH 128 883 883 HOH HOH A . 
C 2 HOH 129 884 884 HOH HOH A . 
C 2 HOH 130 885 885 HOH HOH A . 
C 2 HOH 131 889 889 HOH HOH A . 
C 2 HOH 132 890 890 HOH HOH A . 
C 2 HOH 133 891 891 HOH HOH A . 
C 2 HOH 134 892 892 HOH HOH A . 
C 2 HOH 135 893 893 HOH HOH A . 
C 2 HOH 136 897 897 HOH HOH A . 
C 2 HOH 137 898 898 HOH HOH A . 
C 2 HOH 138 899 899 HOH HOH A . 
C 2 HOH 139 900 900 HOH HOH A . 
C 2 HOH 140 906 906 HOH HOH A . 
C 2 HOH 141 908 908 HOH HOH A . 
C 2 HOH 142 911 911 HOH HOH A . 
C 2 HOH 143 912 912 HOH HOH A . 
C 2 HOH 144 913 913 HOH HOH A . 
C 2 HOH 145 915 915 HOH HOH A . 
C 2 HOH 146 921 921 HOH HOH A . 
C 2 HOH 147 927 927 HOH HOH A . 
C 2 HOH 148 928 928 HOH HOH A . 
C 2 HOH 149 929 929 HOH HOH A . 
C 2 HOH 150 930 930 HOH HOH A . 
D 2 HOH 1   605 605 HOH HOH B . 
D 2 HOH 2   606 606 HOH HOH B . 
D 2 HOH 3   607 607 HOH HOH B . 
D 2 HOH 4   609 609 HOH HOH B . 
D 2 HOH 5   610 610 HOH HOH B . 
D 2 HOH 6   614 614 HOH HOH B . 
D 2 HOH 7   615 615 HOH HOH B . 
D 2 HOH 8   616 616 HOH HOH B . 
D 2 HOH 9   617 617 HOH HOH B . 
D 2 HOH 10  618 618 HOH HOH B . 
D 2 HOH 11  619 619 HOH HOH B . 
D 2 HOH 12  620 620 HOH HOH B . 
D 2 HOH 13  621 621 HOH HOH B . 
D 2 HOH 14  633 633 HOH HOH B . 
D 2 HOH 15  634 634 HOH HOH B . 
D 2 HOH 16  635 635 HOH HOH B . 
D 2 HOH 17  637 637 HOH HOH B . 
D 2 HOH 18  639 639 HOH HOH B . 
D 2 HOH 19  640 640 HOH HOH B . 
D 2 HOH 20  658 658 HOH HOH B . 
D 2 HOH 21  659 659 HOH HOH B . 
D 2 HOH 22  660 660 HOH HOH B . 
D 2 HOH 23  661 661 HOH HOH B . 
D 2 HOH 24  662 662 HOH HOH B . 
D 2 HOH 25  663 663 HOH HOH B . 
D 2 HOH 26  664 664 HOH HOH B . 
D 2 HOH 27  665 665 HOH HOH B . 
D 2 HOH 28  667 667 HOH HOH B . 
D 2 HOH 29  668 668 HOH HOH B . 
D 2 HOH 30  669 669 HOH HOH B . 
D 2 HOH 31  670 670 HOH HOH B . 
D 2 HOH 32  671 671 HOH HOH B . 
D 2 HOH 33  672 672 HOH HOH B . 
D 2 HOH 34  674 674 HOH HOH B . 
D 2 HOH 35  683 683 HOH HOH B . 
D 2 HOH 36  684 684 HOH HOH B . 
D 2 HOH 37  685 685 HOH HOH B . 
D 2 HOH 38  686 686 HOH HOH B . 
D 2 HOH 39  687 687 HOH HOH B . 
D 2 HOH 40  688 688 HOH HOH B . 
D 2 HOH 41  689 689 HOH HOH B . 
D 2 HOH 42  690 690 HOH HOH B . 
D 2 HOH 43  691 691 HOH HOH B . 
D 2 HOH 44  692 692 HOH HOH B . 
D 2 HOH 45  693 693 HOH HOH B . 
D 2 HOH 46  694 694 HOH HOH B . 
D 2 HOH 47  695 695 HOH HOH B . 
D 2 HOH 48  697 697 HOH HOH B . 
D 2 HOH 49  703 703 HOH HOH B . 
D 2 HOH 50  704 704 HOH HOH B . 
D 2 HOH 51  708 708 HOH HOH B . 
D 2 HOH 52  709 709 HOH HOH B . 
D 2 HOH 53  710 710 HOH HOH B . 
D 2 HOH 54  711 711 HOH HOH B . 
D 2 HOH 55  715 715 HOH HOH B . 
D 2 HOH 56  716 716 HOH HOH B . 
D 2 HOH 57  717 717 HOH HOH B . 
D 2 HOH 58  718 718 HOH HOH B . 
D 2 HOH 59  719 719 HOH HOH B . 
D 2 HOH 60  720 720 HOH HOH B . 
D 2 HOH 61  721 721 HOH HOH B . 
D 2 HOH 62  722 722 HOH HOH B . 
D 2 HOH 63  723 723 HOH HOH B . 
D 2 HOH 64  724 724 HOH HOH B . 
D 2 HOH 65  725 725 HOH HOH B . 
D 2 HOH 66  726 726 HOH HOH B . 
D 2 HOH 67  727 727 HOH HOH B . 
D 2 HOH 68  735 735 HOH HOH B . 
D 2 HOH 69  736 736 HOH HOH B . 
D 2 HOH 70  737 737 HOH HOH B . 
D 2 HOH 71  738 738 HOH HOH B . 
D 2 HOH 72  739 739 HOH HOH B . 
D 2 HOH 73  740 740 HOH HOH B . 
D 2 HOH 74  741 741 HOH HOH B . 
D 2 HOH 75  742 742 HOH HOH B . 
D 2 HOH 76  743 743 HOH HOH B . 
D 2 HOH 77  744 744 HOH HOH B . 
D 2 HOH 78  745 745 HOH HOH B . 
D 2 HOH 79  746 746 HOH HOH B . 
D 2 HOH 80  747 747 HOH HOH B . 
D 2 HOH 81  748 748 HOH HOH B . 
D 2 HOH 82  749 749 HOH HOH B . 
D 2 HOH 83  750 750 HOH HOH B . 
D 2 HOH 84  751 751 HOH HOH B . 
D 2 HOH 85  752 752 HOH HOH B . 
D 2 HOH 86  753 753 HOH HOH B . 
D 2 HOH 87  754 754 HOH HOH B . 
D 2 HOH 88  755 755 HOH HOH B . 
D 2 HOH 89  756 756 HOH HOH B . 
D 2 HOH 90  757 757 HOH HOH B . 
D 2 HOH 91  758 758 HOH HOH B . 
D 2 HOH 92  762 762 HOH HOH B . 
D 2 HOH 93  763 763 HOH HOH B . 
D 2 HOH 94  764 764 HOH HOH B . 
D 2 HOH 95  766 766 HOH HOH B . 
D 2 HOH 96  768 768 HOH HOH B . 
D 2 HOH 97  771 771 HOH HOH B . 
D 2 HOH 98  772 772 HOH HOH B . 
D 2 HOH 99  773 773 HOH HOH B . 
D 2 HOH 100 774 774 HOH HOH B . 
D 2 HOH 101 775 775 HOH HOH B . 
D 2 HOH 102 787 787 HOH HOH B . 
D 2 HOH 103 789 789 HOH HOH B . 
D 2 HOH 104 790 790 HOH HOH B . 
D 2 HOH 105 796 796 HOH HOH B . 
D 2 HOH 106 798 798 HOH HOH B . 
D 2 HOH 107 800 800 HOH HOH B . 
D 2 HOH 108 804 804 HOH HOH B . 
D 2 HOH 109 806 806 HOH HOH B . 
D 2 HOH 110 807 807 HOH HOH B . 
D 2 HOH 111 808 808 HOH HOH B . 
D 2 HOH 112 810 810 HOH HOH B . 
D 2 HOH 113 811 811 HOH HOH B . 
D 2 HOH 114 812 812 HOH HOH B . 
D 2 HOH 115 817 817 HOH HOH B . 
D 2 HOH 116 818 818 HOH HOH B . 
D 2 HOH 117 819 819 HOH HOH B . 
D 2 HOH 118 820 820 HOH HOH B . 
D 2 HOH 119 821 821 HOH HOH B . 
D 2 HOH 120 822 822 HOH HOH B . 
D 2 HOH 121 823 823 HOH HOH B . 
D 2 HOH 122 824 824 HOH HOH B . 
D 2 HOH 123 825 825 HOH HOH B . 
D 2 HOH 124 826 826 HOH HOH B . 
D 2 HOH 125 827 827 HOH HOH B . 
D 2 HOH 126 828 828 HOH HOH B . 
D 2 HOH 127 829 829 HOH HOH B . 
D 2 HOH 128 830 830 HOH HOH B . 
D 2 HOH 129 831 831 HOH HOH B . 
D 2 HOH 130 835 835 HOH HOH B . 
D 2 HOH 131 836 836 HOH HOH B . 
D 2 HOH 132 837 837 HOH HOH B . 
D 2 HOH 133 838 838 HOH HOH B . 
D 2 HOH 134 839 839 HOH HOH B . 
D 2 HOH 135 840 840 HOH HOH B . 
D 2 HOH 136 843 843 HOH HOH B . 
D 2 HOH 137 853 853 HOH HOH B . 
D 2 HOH 138 854 854 HOH HOH B . 
D 2 HOH 139 855 855 HOH HOH B . 
D 2 HOH 140 856 856 HOH HOH B . 
D 2 HOH 141 857 857 HOH HOH B . 
D 2 HOH 142 858 858 HOH HOH B . 
D 2 HOH 143 859 859 HOH HOH B . 
D 2 HOH 144 860 860 HOH HOH B . 
D 2 HOH 145 861 861 HOH HOH B . 
D 2 HOH 146 871 871 HOH HOH B . 
D 2 HOH 147 872 872 HOH HOH B . 
D 2 HOH 148 873 873 HOH HOH B . 
D 2 HOH 149 874 874 HOH HOH B . 
D 2 HOH 150 876 876 HOH HOH B . 
D 2 HOH 151 877 877 HOH HOH B . 
D 2 HOH 152 878 878 HOH HOH B . 
D 2 HOH 153 879 879 HOH HOH B . 
D 2 HOH 154 880 880 HOH HOH B . 
D 2 HOH 155 886 886 HOH HOH B . 
D 2 HOH 156 887 887 HOH HOH B . 
D 2 HOH 157 888 888 HOH HOH B . 
D 2 HOH 158 894 894 HOH HOH B . 
D 2 HOH 159 895 895 HOH HOH B . 
D 2 HOH 160 896 896 HOH HOH B . 
D 2 HOH 161 901 901 HOH HOH B . 
D 2 HOH 162 902 902 HOH HOH B . 
D 2 HOH 163 903 903 HOH HOH B . 
D 2 HOH 164 904 904 HOH HOH B . 
D 2 HOH 165 905 905 HOH HOH B . 
D 2 HOH 166 907 907 HOH HOH B . 
D 2 HOH 167 909 909 HOH HOH B . 
D 2 HOH 168 910 910 HOH HOH B . 
D 2 HOH 169 914 914 HOH HOH B . 
D 2 HOH 170 916 916 HOH HOH B . 
D 2 HOH 171 917 917 HOH HOH B . 
D 2 HOH 172 918 918 HOH HOH B . 
D 2 HOH 173 919 919 HOH HOH B . 
D 2 HOH 174 920 920 HOH HOH B . 
D 2 HOH 175 922 922 HOH HOH B . 
D 2 HOH 176 923 923 HOH HOH B . 
D 2 HOH 177 924 924 HOH HOH B . 
D 2 HOH 178 925 925 HOH HOH B . 
D 2 HOH 179 926 926 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1987-04-16 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
_software.name             EREF 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 NH1 A ARG 154 ? ? 1_555 O  B HOH 745 ? ? 4_566 2.05 
2 1 CG2 B THR 147 ? ? 1_555 O  A HOH 851 ? ? 3_545 2.07 
3 1 CE2 A PHE 39  ? ? 1_555 CZ B TYR 146 ? ? 3_555 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 NE1 A TRP 27  ? ? CE2 A TRP 27  ? ? 1.254 1.371 -0.117 0.013 N 
2  1 NE1 A TRP 29  ? ? CE2 A TRP 29  ? ? 1.291 1.371 -0.080 0.013 N 
3  1 NE1 A TRP 51  ? ? CE2 A TRP 51  ? ? 1.284 1.371 -0.087 0.013 N 
4  1 NE1 A TRP 141 ? ? CE2 A TRP 141 ? ? 1.282 1.371 -0.089 0.013 N 
5  1 NE1 A TRP 172 ? ? CE2 A TRP 172 ? ? 1.273 1.371 -0.098 0.013 N 
6  1 NE1 A TRP 207 ? ? CE2 A TRP 207 ? ? 1.290 1.371 -0.081 0.013 N 
7  1 NE1 A TRP 215 ? ? CE2 A TRP 215 ? ? 1.264 1.371 -0.107 0.013 N 
8  1 C   A VAL 231 ? ? N   A THR 232 ? ? 1.480 1.336 0.144  0.023 Y 
9  1 NE1 A TRP 237 ? ? CE2 A TRP 237 ? ? 1.283 1.371 -0.088 0.013 N 
10 1 NE1 B TRP 27  ? ? CE2 B TRP 27  ? ? 1.285 1.371 -0.086 0.013 N 
11 1 NE1 B TRP 29  ? ? CE2 B TRP 29  ? ? 1.284 1.371 -0.087 0.013 N 
12 1 NE1 B TRP 51  ? ? CE2 B TRP 51  ? ? 1.283 1.371 -0.088 0.013 N 
13 1 NE1 B TRP 141 ? ? CE2 B TRP 141 ? ? 1.287 1.371 -0.084 0.013 N 
14 1 NE1 B TRP 172 ? ? CE2 B TRP 172 ? ? 1.277 1.371 -0.094 0.013 N 
15 1 NE1 B TRP 207 ? ? CE2 B TRP 207 ? ? 1.261 1.371 -0.110 0.013 N 
16 1 NE1 B TRP 215 ? ? CE2 B TRP 215 ? ? 1.261 1.371 -0.110 0.013 N 
17 1 NE1 B TRP 237 ? ? CE2 B TRP 237 ? ? 1.273 1.371 -0.098 0.013 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A LYS 87  ? ? CA A LYS 87  ? ? C   A LYS 87  ? ? 98.17  110.40 -12.23 2.00 N 
2  1 CB A TYR 171 ? ? CG A TYR 171 ? ? CD1 A TYR 171 ? ? 117.31 121.00 -3.69  0.60 N 
3  1 NE A ARG 230 ? ? CZ A ARG 230 ? ? NH2 A ARG 230 ? ? 123.61 120.30 3.31   0.50 N 
4  1 CA B ILE 6   ? ? CB B ILE 6   ? ? CG1 B ILE 6   ? ? 122.51 111.00 11.51  1.90 N 
5  1 C  B THR 144 ? ? N  B ARG 145 ? ? CA  B ARG 145 ? ? 143.01 121.70 21.31  2.50 Y 
6  1 CD B ARG 154 ? ? NE B ARG 154 ? ? CZ  B ARG 154 ? ? 132.39 123.60 8.79   1.40 N 
7  1 NE B ARG 154 ? ? CZ B ARG 154 ? ? NH1 B ARG 154 ? ? 124.81 120.30 4.51   0.50 N 
8  1 NE B ARG 154 ? ? CZ B ARG 154 ? ? NH2 B ARG 154 ? ? 112.95 120.30 -7.35  0.50 N 
9  1 N  B SER 186 ? ? CA B SER 186 ? ? CB  B SER 186 ? ? 96.77  110.50 -13.73 1.50 N 
10 1 NE B ARG 230 ? ? CZ B ARG 230 ? ? NH1 B ARG 230 ? ? 124.68 120.30 4.38   0.50 N 
11 1 NE B ARG 230 ? ? CZ B ARG 230 ? ? NH2 B ARG 230 ? ? 115.14 120.30 -5.16  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 17  ? ? 49.77   -106.48 
2  1 TRP A 27  ? ? -119.74 71.73   
3  1 ASN A 48  ? ? -173.01 -177.23 
4  1 PHE A 71  ? ? -122.07 -61.70  
5  1 ASN A 150 ? ? 66.93   -50.62  
6  1 THR A 151 ? ? 78.58   159.78  
7  1 SER A 189 ? ? -49.09  160.44  
8  1 VAL B 17  ? ? 46.33   -103.52 
9  1 ASP B 35  ? ? -91.15  -158.22 
10 1 ASN B 48  ? ? -171.54 -169.62 
11 1 PHE B 71  ? ? -123.72 -55.38  
12 1 SER B 115 ? ? -145.21 -155.33 
13 1 ARG B 145 ? ? 124.70  0.23    
14 1 TYR B 146 ? ? -49.37  -127.84 
15 1 ASN B 148 ? ? 33.80   54.64   
16 1 ALA B 149 ? ? 161.64  -156.46 
17 1 ASN B 150 ? ? -154.87 -83.49  
18 1 THR B 151 ? ? 68.47   163.89  
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1  1 GLY A 25  ? ? 14.82  
2  1 ASN A 91  ? ? 11.65  
3  1 ALA A 126 ? ? -10.74 
4  1 ALA A 131 ? ? -14.05 
5  1 CYS A 136 ? ? 11.31  
6  1 ASN A 148 ? ? -10.59 
7  1 GLN A 156 ? ? -10.37 
8  1 LEU A 160 ? ? 14.51  
9  1 VAL A 188 ? ? 10.34  
10 1 SER A 189 ? ? -12.11 
11 1 PRO B 4   ? ? -11.63 
12 1 LYS B 36  ? ? -10.50 
13 1 THR B 62  ? ? -10.57 
14 1 GLY B 69  ? ? -10.88 
15 1 GLU B 70  ? ? -11.22 
16 1 SER B 77  ? ? 11.40  
17 1 ALA B 120 ? ? -11.65 
18 1 PRO B 124 ? ? -11.58 
19 1 PHE B 130 ? ? 12.65  
20 1 CYS B 136 ? ? 12.77  
21 1 GLY B 142 ? ? 10.25  
22 1 THR B 151 ? ? 12.48  
23 1 ASN B 165 ? ? -13.95 
24 1 ALA B 185 ? ? 10.37  
25 1 SER B 195 ? ? 10.09  
26 1 LYS B 202 ? ? 10.84  
27 1 LYS B 203 ? ? 13.58  
28 1 TYR B 228 ? ? -12.07 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 GLU A 21  ? ? 0.074 'SIDE CHAIN' 
2  1 ASP A 35  ? ? 0.075 'SIDE CHAIN' 
3  1 ASP A 64  ? ? 0.089 'SIDE CHAIN' 
4  1 GLU A 78  ? ? 0.091 'SIDE CHAIN' 
5  1 ASN A 91  ? ? 0.098 'SIDE CHAIN' 
6  1 ASP A 129 ? ? 0.070 'SIDE CHAIN' 
7  1 ASN A 148 ? ? 0.079 'SIDE CHAIN' 
8  1 GLN A 156 ? ? 0.071 'SIDE CHAIN' 
9  1 ASN A 167 ? ? 0.088 'SIDE CHAIN' 
10 1 GLN A 240 ? ? 0.097 'SIDE CHAIN' 
11 1 ASN A 245 ? ? 0.090 'SIDE CHAIN' 
12 1 GLU B 21  ? ? 0.074 'SIDE CHAIN' 
13 1 ASP B 64  ? ? 0.082 'SIDE CHAIN' 
14 1 GLN B 73  ? ? 0.105 'SIDE CHAIN' 
15 1 ASN B 91  ? ? 0.081 'SIDE CHAIN' 
16 1 ASN B 95  ? ? 0.077 'SIDE CHAIN' 
17 1 ASN B 100 ? ? 0.075 'SIDE CHAIN' 
18 1 ASN B 150 ? ? 0.084 'SIDE CHAIN' 
19 1 ASN B 204 ? ? 0.085 'SIDE CHAIN' 
20 1 ASN B 236 ? ? 0.088 'SIDE CHAIN' 
21 1 GLN B 240 ? ? 0.083 'SIDE CHAIN' 
22 1 ASN B 245 ? ? 0.078 'SIDE CHAIN' 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#