data_2CH0
# 
_entry.id   2CH0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CH0         
PDBE  EBI-27997    
WWPDB D_1290027997 
BMRB  6919         
# 
_pdbx_database_related.db_id          6919 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CH0 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-03-10 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Caputo, S.'        1 ? 
'Couprie, J.'       2 ? 
'Duband-Goulet, I.' 3 ? 
'Lin, F.'           4 ? 
'Braud, S.'         5 ? 
'Gondry, M.'        6 ? 
'Worman, H.J.'      7 ? 
'Gilquin, B.'       8 ? 
'Zinn-Justin, S.'   9 ? 
# 
_citation.id                        primary 
_citation.title                     
'The carboxyl-terminal nucleoplasmic region of MAN1 exhibits a DNA binding winged helix domain.' 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_volume            281 
_citation.page_first                18208 
_citation.page_last                 18215 
_citation.year                      2006 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16648637 
_citation.pdbx_database_id_DOI      10.1074/jbc.M601980200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Caputo, S.'        1  
primary 'Couprie, J.'       2  
primary 'Duband-Goulet, I.' 3  
primary 'Konde, E.'         4  
primary 'Lin, F.'           5  
primary 'Braud, S.'         6  
primary 'Gondry, M.'        7  
primary 'Gilquin, B.'       8  
primary 'Worman, H.J.'      9  
primary 'Zinn-Justin, S.'   10 
# 
_cell.entry_id           2CH0 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2CH0 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'INNER NUCLEAR MEMBRANE PROTEIN MAN1' 
_entity.formula_weight             15921.214 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              655-775 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'LEM DOMAIN CONTAINING PROTEIN 3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSPEFRWTKEEEETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDFLAANESR
VRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRLERPHRD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSPEFRWTKEEEETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDFLAANESR
VRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRLERPHRD
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   PRO n 
1 4   GLU n 
1 5   PHE n 
1 6   ARG n 
1 7   TRP n 
1 8   THR n 
1 9   LYS n 
1 10  GLU n 
1 11  GLU n 
1 12  GLU n 
1 13  GLU n 
1 14  THR n 
1 15  ARG n 
1 16  GLN n 
1 17  MET n 
1 18  TYR n 
1 19  ASP n 
1 20  MET n 
1 21  VAL n 
1 22  VAL n 
1 23  LYS n 
1 24  ILE n 
1 25  ILE n 
1 26  ASP n 
1 27  VAL n 
1 28  LEU n 
1 29  ARG n 
1 30  SER n 
1 31  HIS n 
1 32  ASN n 
1 33  GLU n 
1 34  ALA n 
1 35  CYS n 
1 36  GLN n 
1 37  GLU n 
1 38  ASN n 
1 39  LYS n 
1 40  ASP n 
1 41  LEU n 
1 42  GLN n 
1 43  PRO n 
1 44  TYR n 
1 45  MET n 
1 46  PRO n 
1 47  ILE n 
1 48  PRO n 
1 49  HIS n 
1 50  VAL n 
1 51  ARG n 
1 52  ASP n 
1 53  SER n 
1 54  LEU n 
1 55  ILE n 
1 56  GLN n 
1 57  PRO n 
1 58  HIS n 
1 59  ASP n 
1 60  ARG n 
1 61  LYS n 
1 62  LYS n 
1 63  MET n 
1 64  LYS n 
1 65  LYS n 
1 66  VAL n 
1 67  TRP n 
1 68  ASP n 
1 69  ARG n 
1 70  ALA n 
1 71  VAL n 
1 72  ASP n 
1 73  PHE n 
1 74  LEU n 
1 75  ALA n 
1 76  ALA n 
1 77  ASN n 
1 78  GLU n 
1 79  SER n 
1 80  ARG n 
1 81  VAL n 
1 82  ARG n 
1 83  THR n 
1 84  GLU n 
1 85  THR n 
1 86  ARG n 
1 87  ARG n 
1 88  ILE n 
1 89  GLY n 
1 90  GLY n 
1 91  ALA n 
1 92  ASP n 
1 93  PHE n 
1 94  LEU n 
1 95  VAL n 
1 96  TRP n 
1 97  ARG n 
1 98  TRP n 
1 99  ILE n 
1 100 GLN n 
1 101 PRO n 
1 102 SER n 
1 103 ALA n 
1 104 SER n 
1 105 CYS n 
1 106 ASP n 
1 107 LYS n 
1 108 ILE n 
1 109 LEU n 
1 110 VAL n 
1 111 ILE n 
1 112 PRO n 
1 113 SER n 
1 114 LYS n 
1 115 VAL n 
1 116 TRP n 
1 117 GLN n 
1 118 GLY n 
1 119 GLN n 
1 120 ALA n 
1 121 PHE n 
1 122 HIS n 
1 123 LEU n 
1 124 ASP n 
1 125 ARG n 
1 126 ARG n 
1 127 LEU n 
1 128 GLU n 
1 129 ARG n 
1 130 PRO n 
1 131 HIS n 
1 132 ARG n 
1 133 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PGEX-4T-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 2CH0       1 ? ? 2CH0   ? 
2 UNP MAN1_HUMAN 1 ? ? Q9Y2U8 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2CH0 A 1   ? 5   ? 2CH0   1   ? 5   ? 1   5   
2 2 2CH0 A 6   ? 126 ? Q9Y2U8 655 ? 775 ? 6   126 
3 1 2CH0 A 127 ? 133 ? 2CH0   127 ? 133 ? 127 133 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '15N HSQC-NOESY'                             1 
2 2 '15N HSQC- NOESY'                            1 
3 3 '13C HSQC-NOESY'                             1 
4 4 '13C HSQC-NOESY'                             1 
5 5 '13C HSQC- NOESY IN THE 13C AROMATIC REGION' 1 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units 
_pdbx_nmr_exptl_sample_conditions.pH_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
_pdbx_nmr_exptl_sample_conditions.label 
1 303.0 ? ? 6.0 '50 MM PHOSPHATE, 150MM NACL' ? pH K ? 
2 303.0 ? ? 6.0 '50 MM PHOSPHATE, 150MM NACL' ? pH K ? 
3 303.0 ? ? 6.0 '50 MM PHOSPHATE, 150MM NACL' ? pH K ? 
4 303.0 ? ? 6.0 '50 MM PHOSPHATE, 150MM NACL' ? pH K ? 
5 303.0 ? ? 6.0 '50 MM PHOSPHATE, 150MM NACL' ? pH K ? 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   ? 
_pdbx_nmr_sample_details.label            ? 
_pdbx_nmr_sample_details.type             ? 
_pdbx_nmr_sample_details.details          ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DRX Bruker 600 ? 
2 DRX Bruker 900 ? 
3 DRX Bruker 600 ? 
4 DRX Bruker 900 ? 
5 DRX Bruker 600 ? 
# 
_pdbx_nmr_refine.entry_id           2CH0 
_pdbx_nmr_refine.method             'DISTANCE GEOMETRY, SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            
'THE STRUCTURE ARE BASED ON A TOTAL OF 1811 NOE-DERIVED CONSTRAINTS, 169 DIHEDRAL ANGLE RESTRAINTS.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2CH0 
_pdbx_nmr_details.text       'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY.' 
# 
_pdbx_nmr_ensemble.entry_id                             2CH0 
_pdbx_nmr_ensemble.conformers_calculated_total_number   1000 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         
;BACK CALCULATED DATA AGREE WITH EXPERIMENTAL NOESY SPECTRUM, STRUCTURES WITH ACCEPTABLE COVALENT GEOMETRY, STRUCTURES WITH FAVORABLE NON-BOND ENERGY, STRUCTURES WITH THE LEAST RESTRAINT VIOLATIONS, STRUCTURES WITH THE LOWEST ENERGY
;
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS     1.0    
'BRUNGER,ADAMS,CLORE,DELANO,GROS, GROSSE- KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,READ, RICE,SIMONSON,WARREN' 1 
'structure solution' XWINNMR 2.5    ? 2 
'structure solution' NMRPIPE 2.0    ? 3 
'structure solution' FELIX   2000.1 ? 4 
'structure solution' CNS     1.0    ? 5 
# 
_exptl.entry_id          2CH0 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2CH0 
_struct.title                     'Solution structure of the human MAN1 C-terminal domain (residues 655- 775)' 
_struct.pdbx_descriptor           'INNER NUCLEAR MEMBRANE PROTEIN MAN1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CH0 
_struct_keywords.pdbx_keywords   'NUCLEAR PROTEIN' 
_struct_keywords.text            'MAN1, WINGED HELIX MOTIF, DNA, NUCLEAR PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 17 ? GLU A 37 ? MET A 17 GLU A 37 1 ? 21 
HELX_P HELX_P2 2 ILE A 47 ? LEU A 54 ? ILE A 47 LEU A 54 1 ? 8  
HELX_P HELX_P3 3 HIS A 58 ? ALA A 76 ? HIS A 58 ALA A 76 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 VAL A 81 ? ILE A 88 ? VAL A 81 ILE A 88 
AA 2 ASP A 92 ? ILE A 99 ? ASP A 92 ILE A 99 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    88 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     88 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   ASP 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    92 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    ASP 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     92 
# 
_database_PDB_matrix.entry_id          2CH0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CH0 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? -19.112 6.360   10.607  1.00 0.00 ? 1   GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? -20.410 6.855   10.203  1.00 0.00 ? 1   GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? -20.272 8.219   9.606   1.00 0.00 ? 1   GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? -21.258 8.905   9.357   1.00 0.00 ? 1   GLY A O    1  
ATOM 5     H H    . GLY A 1 1   ? -19.027 5.915   11.498  1.00 0.00 ? 1   GLY A H    1  
ATOM 6     H HA2  . GLY A 1 1   ? -20.797 6.194   9.442   1.00 0.00 ? 1   GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1   ? -21.037 6.935   11.078  1.00 0.00 ? 1   GLY A HA3  1  
ATOM 8     N N    . SER A 1 2   ? -19.013 8.641   9.361   1.00 0.00 ? 2   SER A N    1  
ATOM 9     C CA   . SER A 1 2   ? -18.634 9.922   8.788   1.00 0.00 ? 2   SER A CA   1  
ATOM 10    C C    . SER A 1 2   ? -17.273 9.723   8.127   1.00 0.00 ? 2   SER A C    1  
ATOM 11    O O    . SER A 1 2   ? -16.490 8.935   8.658   1.00 0.00 ? 2   SER A O    1  
ATOM 12    C CB   . SER A 1 2   ? -18.516 11.045  9.876   1.00 0.00 ? 2   SER A CB   1  
ATOM 13    O OG   . SER A 1 2   ? -18.171 12.334  9.349   1.00 0.00 ? 2   SER A OG   1  
ATOM 14    H H    . SER A 1 2   ? -18.263 8.018   9.591   1.00 0.00 ? 2   SER A H    1  
ATOM 15    H HA   . SER A 1 2   ? -19.376 10.209  8.058   1.00 0.00 ? 2   SER A HA   1  
ATOM 16    H HB2  . SER A 1 2   ? -19.511 11.140  10.365  1.00 0.00 ? 2   SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2   ? -17.791 10.751  10.667  1.00 0.00 ? 2   SER A HB3  1  
ATOM 18    H HG   . SER A 1 2   ? -17.229 12.328  9.115   1.00 0.00 ? 2   SER A HG   1  
ATOM 19    N N    . PRO A 1 3   ? -16.915 10.374  6.991   1.00 0.00 ? 3   PRO A N    1  
ATOM 20    C CA   . PRO A 1 3   ? -15.573 10.349  6.406   1.00 0.00 ? 3   PRO A CA   1  
ATOM 21    C C    . PRO A 1 3   ? -14.595 11.288  7.153   1.00 0.00 ? 3   PRO A C    1  
ATOM 22    O O    . PRO A 1 3   ? -14.997 12.036  8.044   1.00 0.00 ? 3   PRO A O    1  
ATOM 23    C CB   . PRO A 1 3   ? -15.801 10.799  4.934   1.00 0.00 ? 3   PRO A CB   1  
ATOM 24    C CG   . PRO A 1 3   ? -17.326 10.870  4.762   1.00 0.00 ? 3   PRO A CG   1  
ATOM 25    C CD   . PRO A 1 3   ? -17.803 11.190  6.174   1.00 0.00 ? 3   PRO A CD   1  
ATOM 26    H HA   . PRO A 1 3   ? -15.171 9.345   6.448   1.00 0.00 ? 3   PRO A HA   1  
ATOM 27    H HB2  . PRO A 1 3   ? -15.408 11.835  4.733   1.00 0.00 ? 3   PRO A HB2  1  
ATOM 28    H HB3  . PRO A 1 3   ? -15.375 10.036  4.228   1.00 0.00 ? 3   PRO A HB3  1  
ATOM 29    H HG2  . PRO A 1 3   ? -17.636 11.626  4.015   1.00 0.00 ? 3   PRO A HG2  1  
ATOM 30    H HG3  . PRO A 1 3   ? -17.715 9.869   4.464   1.00 0.00 ? 3   PRO A HG3  1  
ATOM 31    H HD2  . PRO A 1 3   ? -17.596 12.256  6.418   1.00 0.00 ? 3   PRO A HD2  1  
ATOM 32    H HD3  . PRO A 1 3   ? -18.888 10.968  6.279   1.00 0.00 ? 3   PRO A HD3  1  
ATOM 33    N N    . GLU A 1 4   ? -13.299 11.239  6.769   1.00 0.00 ? 4   GLU A N    1  
ATOM 34    C CA   . GLU A 1 4   ? -12.182 11.978  7.360   1.00 0.00 ? 4   GLU A CA   1  
ATOM 35    C C    . GLU A 1 4   ? -11.942 13.373  6.788   1.00 0.00 ? 4   GLU A C    1  
ATOM 36    O O    . GLU A 1 4   ? -11.409 14.257  7.454   1.00 0.00 ? 4   GLU A O    1  
ATOM 37    C CB   . GLU A 1 4   ? -10.873 11.163  7.157   1.00 0.00 ? 4   GLU A CB   1  
ATOM 38    C CG   . GLU A 1 4   ? -10.861 9.800   7.876   1.00 0.00 ? 4   GLU A CG   1  
ATOM 39    C CD   . GLU A 1 4   ? -10.939 9.997   9.389   1.00 0.00 ? 4   GLU A CD   1  
ATOM 40    O OE1  . GLU A 1 4   ? -9.992  10.607  9.956   1.00 0.00 ? 4   GLU A OE1  1  
ATOM 41    O OE2  . GLU A 1 4   ? -11.943 9.541   9.997   1.00 0.00 ? 4   GLU A OE2  1  
ATOM 42    H H    . GLU A 1 4   ? -13.069 10.593  6.049   1.00 0.00 ? 4   GLU A H    1  
ATOM 43    H HA   . GLU A 1 4   ? -12.349 12.110  8.421   1.00 0.00 ? 4   GLU A HA   1  
ATOM 44    H HB2  . GLU A 1 4   ? -10.719 10.966  6.070   1.00 0.00 ? 4   GLU A HB2  1  
ATOM 45    H HB3  . GLU A 1 4   ? -9.990  11.743  7.504   1.00 0.00 ? 4   GLU A HB3  1  
ATOM 46    H HG2  . GLU A 1 4   ? -11.714 9.178   7.530   1.00 0.00 ? 4   GLU A HG2  1  
ATOM 47    H HG3  . GLU A 1 4   ? -9.919  9.263   7.631   1.00 0.00 ? 4   GLU A HG3  1  
ATOM 48    N N    . PHE A 1 5   ? -12.258 13.563  5.483   1.00 0.00 ? 5   PHE A N    1  
ATOM 49    C CA   . PHE A 1 5   ? -12.056 14.759  4.657   1.00 0.00 ? 5   PHE A CA   1  
ATOM 50    C C    . PHE A 1 5   ? -10.643 14.830  4.092   1.00 0.00 ? 5   PHE A C    1  
ATOM 51    O O    . PHE A 1 5   ? -10.427 14.765  2.888   1.00 0.00 ? 5   PHE A O    1  
ATOM 52    C CB   . PHE A 1 5   ? -12.632 16.095  5.283   1.00 0.00 ? 5   PHE A CB   1  
ATOM 53    C CG   . PHE A 1 5   ? -12.551 17.373  4.446   1.00 0.00 ? 5   PHE A CG   1  
ATOM 54    C CD1  . PHE A 1 5   ? -12.994 17.425  3.129   1.00 0.00 ? 5   PHE A CD1  1  
ATOM 55    C CD2  . PHE A 1 5   ? -12.067 18.556  5.002   1.00 0.00 ? 5   PHE A CD2  1  
ATOM 56    C CE1  . PHE A 1 5   ? -12.896 18.584  2.384   1.00 0.00 ? 5   PHE A CE1  1  
ATOM 57    C CE2  . PHE A 1 5   ? -11.965 19.711  4.255   1.00 0.00 ? 5   PHE A CE2  1  
ATOM 58    C CZ   . PHE A 1 5   ? -12.368 19.728  2.939   1.00 0.00 ? 5   PHE A CZ   1  
ATOM 59    H H    . PHE A 1 5   ? -12.661 12.781  5.025   1.00 0.00 ? 5   PHE A H    1  
ATOM 60    H HA   . PHE A 1 5   ? -12.616 14.540  3.790   1.00 0.00 ? 5   PHE A HA   1  
ATOM 61    H HB2  . PHE A 1 5   ? -13.707 15.929  5.509   1.00 0.00 ? 5   PHE A HB2  1  
ATOM 62    H HB3  . PHE A 1 5   ? -12.127 16.286  6.252   1.00 0.00 ? 5   PHE A HB3  1  
ATOM 63    H HD1  . PHE A 1 5   ? -13.435 16.561  2.652   1.00 0.00 ? 5   PHE A HD1  1  
ATOM 64    H HD2  . PHE A 1 5   ? -11.745 18.617  6.035   1.00 0.00 ? 5   PHE A HD2  1  
ATOM 65    H HE1  . PHE A 1 5   ? -13.237 18.594  1.356   1.00 0.00 ? 5   PHE A HE1  1  
ATOM 66    H HE2  . PHE A 1 5   ? -11.563 20.606  4.709   1.00 0.00 ? 5   PHE A HE2  1  
ATOM 67    H HZ   . PHE A 1 5   ? -12.295 20.635  2.353   1.00 0.00 ? 5   PHE A HZ   1  
ATOM 68    N N    . ARG A 1 6   ? -9.690  14.933  5.029   1.00 0.00 ? 6   ARG A N    1  
ATOM 69    C CA   . ARG A 1 6   ? -8.222  14.977  4.931   1.00 0.00 ? 6   ARG A CA   1  
ATOM 70    C C    . ARG A 1 6   ? -7.629  16.138  4.154   1.00 0.00 ? 6   ARG A C    1  
ATOM 71    O O    . ARG A 1 6   ? -7.405  16.109  2.947   1.00 0.00 ? 6   ARG A O    1  
ATOM 72    C CB   . ARG A 1 6   ? -7.654  13.624  4.489   1.00 0.00 ? 6   ARG A CB   1  
ATOM 73    C CG   . ARG A 1 6   ? -6.129  13.433  4.593   1.00 0.00 ? 6   ARG A CG   1  
ATOM 74    C CD   . ARG A 1 6   ? -5.704  11.957  4.564   1.00 0.00 ? 6   ARG A CD   1  
ATOM 75    N NE   . ARG A 1 6   ? -6.138  11.314  3.276   1.00 0.00 ? 6   ARG A NE   1  
ATOM 76    C CZ   . ARG A 1 6   ? -5.871  10.003  2.979   1.00 0.00 ? 6   ARG A CZ   1  
ATOM 77    N NH1  . ARG A 1 6   ? -5.175  9.214   3.848   1.00 0.00 ? 6   ARG A NH1  1  
ATOM 78    N NH2  . ARG A 1 6   ? -6.308  9.480   1.796   1.00 0.00 ? 6   ARG A NH2  1  
ATOM 79    H H    . ARG A 1 6   ? -10.138 14.933  5.923   1.00 0.00 ? 6   ARG A H    1  
ATOM 80    H HA   . ARG A 1 6   ? -7.852  15.097  5.939   1.00 0.00 ? 6   ARG A HA   1  
ATOM 81    H HB2  . ARG A 1 6   ? -8.130  12.895  5.173   1.00 0.00 ? 6   ARG A HB2  1  
ATOM 82    H HB3  . ARG A 1 6   ? -7.999  13.450  3.453   1.00 0.00 ? 6   ARG A HB3  1  
ATOM 83    H HG2  . ARG A 1 6   ? -5.627  13.983  3.766   1.00 0.00 ? 6   ARG A HG2  1  
ATOM 84    H HG3  . ARG A 1 6   ? -5.769  13.848  5.561   1.00 0.00 ? 6   ARG A HG3  1  
ATOM 85    H HD2  . ARG A 1 6   ? -4.597  11.897  4.638   1.00 0.00 ? 6   ARG A HD2  1  
ATOM 86    H HD3  . ARG A 1 6   ? -6.174  11.420  5.418   1.00 0.00 ? 6   ARG A HD3  1  
ATOM 87    H HE   . ARG A 1 6   ? -6.651  11.863  2.617   1.00 0.00 ? 6   ARG A HE   1  
ATOM 88    H HH11 . ARG A 1 6   ? -4.850  9.593   4.715   1.00 0.00 ? 6   ARG A HH11 1  
ATOM 89    H HH12 . ARG A 1 6   ? -4.989  8.258   3.618   1.00 0.00 ? 6   ARG A HH12 1  
ATOM 90    H HH21 . ARG A 1 6   ? -6.821  10.052  1.156   1.00 0.00 ? 6   ARG A HH21 1  
ATOM 91    H HH22 . ARG A 1 6   ? -6.120  8.523   1.573   1.00 0.00 ? 6   ARG A HH22 1  
ATOM 92    N N    . TRP A 1 7   ? -7.385  17.225  4.912   1.00 0.00 ? 7   TRP A N    1  
ATOM 93    C CA   . TRP A 1 7   ? -6.912  18.509  4.458   1.00 0.00 ? 7   TRP A CA   1  
ATOM 94    C C    . TRP A 1 7   ? -5.655  18.897  5.274   1.00 0.00 ? 7   TRP A C    1  
ATOM 95    O O    . TRP A 1 7   ? -4.966  18.034  5.810   1.00 0.00 ? 7   TRP A O    1  
ATOM 96    C CB   . TRP A 1 7   ? -8.150  19.459  4.554   1.00 0.00 ? 7   TRP A CB   1  
ATOM 97    C CG   . TRP A 1 7   ? -8.566  19.858  5.963   1.00 0.00 ? 7   TRP A CG   1  
ATOM 98    C CD1  . TRP A 1 7   ? -8.272  21.060  6.515   1.00 0.00 ? 7   TRP A CD1  1  
ATOM 99    C CD2  . TRP A 1 7   ? -9.091  19.040  7.039   1.00 0.00 ? 7   TRP A CD2  1  
ATOM 100   N NE1  . TRP A 1 7   ? -8.504  21.023  7.855   1.00 0.00 ? 7   TRP A NE1  1  
ATOM 101   C CE2  . TRP A 1 7   ? -9.001  19.797  8.201   1.00 0.00 ? 7   TRP A CE2  1  
ATOM 102   C CE3  . TRP A 1 7   ? -9.600  17.770  7.078   1.00 0.00 ? 7   TRP A CE3  1  
ATOM 103   C CZ2  . TRP A 1 7   ? -9.379  19.301  9.415   1.00 0.00 ? 7   TRP A CZ2  1  
ATOM 104   C CZ3  . TRP A 1 7   ? -9.957  17.259  8.310   1.00 0.00 ? 7   TRP A CZ3  1  
ATOM 105   C CH2  . TRP A 1 7   ? -9.840  18.005  9.466   1.00 0.00 ? 7   TRP A CH2  1  
ATOM 106   H H    . TRP A 1 7   ? -7.571  17.196  5.890   1.00 0.00 ? 7   TRP A H    1  
ATOM 107   H HA   . TRP A 1 7   ? -6.603  18.449  3.418   1.00 0.00 ? 7   TRP A HA   1  
ATOM 108   H HB2  . TRP A 1 7   ? -7.991  20.363  3.929   1.00 0.00 ? 7   TRP A HB2  1  
ATOM 109   H HB3  . TRP A 1 7   ? -9.012  18.925  4.095   1.00 0.00 ? 7   TRP A HB3  1  
ATOM 110   H HD1  . TRP A 1 7   ? -7.846  21.883  5.965   1.00 0.00 ? 7   TRP A HD1  1  
ATOM 111   H HE1  . TRP A 1 7   ? -8.522  21.788  8.427   1.00 0.00 ? 7   TRP A HE1  1  
ATOM 112   H HE3  . TRP A 1 7   ? -9.821  17.209  6.187   1.00 0.00 ? 7   TRP A HE3  1  
ATOM 113   H HZ2  . TRP A 1 7   ? -9.309  19.885  10.320  1.00 0.00 ? 7   TRP A HZ2  1  
ATOM 114   H HZ3  . TRP A 1 7   ? -10.334 16.249  8.382   1.00 0.00 ? 7   TRP A HZ3  1  
ATOM 115   H HH2  . TRP A 1 7   ? -10.143 17.578  10.416  1.00 0.00 ? 7   TRP A HH2  1  
ATOM 116   N N    . THR A 1 8   ? -5.306  20.212  5.423   1.00 0.00 ? 8   THR A N    1  
ATOM 117   C CA   . THR A 1 8   ? -4.104  20.724  6.106   1.00 0.00 ? 8   THR A CA   1  
ATOM 118   C C    . THR A 1 8   ? -4.102  20.652  7.642   1.00 0.00 ? 8   THR A C    1  
ATOM 119   O O    . THR A 1 8   ? -3.054  20.432  8.243   1.00 0.00 ? 8   THR A O    1  
ATOM 120   C CB   . THR A 1 8   ? -3.688  22.119  5.568   1.00 0.00 ? 8   THR A CB   1  
ATOM 121   O OG1  . THR A 1 8   ? -2.338  22.487  5.847   1.00 0.00 ? 8   THR A OG1  1  
ATOM 122   C CG2  . THR A 1 8   ? -4.609  23.264  6.030   1.00 0.00 ? 8   THR A CG2  1  
ATOM 123   H H    . THR A 1 8   ? -5.865  20.914  5.004   1.00 0.00 ? 8   THR A H    1  
ATOM 124   H HA   . THR A 1 8   ? -3.289  20.077  5.808   1.00 0.00 ? 8   THR A HA   1  
ATOM 125   H HB   . THR A 1 8   ? -3.757  22.061  4.454   1.00 0.00 ? 8   THR A HB   1  
ATOM 126   H HG1  . THR A 1 8   ? -2.235  22.448  6.804   1.00 0.00 ? 8   THR A HG1  1  
ATOM 127   H HG21 . THR A 1 8   ? -5.670  23.048  5.792   1.00 0.00 ? 8   THR A HG21 1  
ATOM 128   H HG22 . THR A 1 8   ? -4.515  23.445  7.120   1.00 0.00 ? 8   THR A HG22 1  
ATOM 129   H HG23 . THR A 1 8   ? -4.322  24.203  5.505   1.00 0.00 ? 8   THR A HG23 1  
ATOM 130   N N    . LYS A 1 9   ? -5.255  20.865  8.350   1.00 0.00 ? 9   LYS A N    1  
ATOM 131   C CA   . LYS A 1 9   ? -5.367  20.787  9.819   1.00 0.00 ? 9   LYS A CA   1  
ATOM 132   C C    . LYS A 1 9   ? -5.312  19.420  10.472  1.00 0.00 ? 9   LYS A C    1  
ATOM 133   O O    . LYS A 1 9   ? -4.845  19.292  11.601  1.00 0.00 ? 9   LYS A O    1  
ATOM 134   C CB   . LYS A 1 9   ? -6.452  21.679  10.475  1.00 0.00 ? 9   LYS A CB   1  
ATOM 135   C CG   . LYS A 1 9   ? -6.509  23.101  9.894   1.00 0.00 ? 9   LYS A CG   1  
ATOM 136   C CD   . LYS A 1 9   ? -7.604  23.978  10.525  1.00 0.00 ? 9   LYS A CD   1  
ATOM 137   C CE   . LYS A 1 9   ? -7.334  24.349  11.991  1.00 0.00 ? 9   LYS A CE   1  
ATOM 138   N NZ   . LYS A 1 9   ? -8.398  25.237  12.517  1.00 0.00 ? 9   LYS A NZ   1  
ATOM 139   H H    . LYS A 1 9   ? -6.114  21.038  7.870   1.00 0.00 ? 9   LYS A H    1  
ATOM 140   H HA   . LYS A 1 9   ? -4.421  21.191  10.172  1.00 0.00 ? 9   LYS A HA   1  
ATOM 141   H HB2  . LYS A 1 9   ? -7.445  21.194  10.402  1.00 0.00 ? 9   LYS A HB2  1  
ATOM 142   H HB3  . LYS A 1 9   ? -6.228  21.769  11.565  1.00 0.00 ? 9   LYS A HB3  1  
ATOM 143   H HG2  . LYS A 1 9   ? -5.520  23.591  10.036  1.00 0.00 ? 9   LYS A HG2  1  
ATOM 144   H HG3  . LYS A 1 9   ? -6.695  23.045  8.799   1.00 0.00 ? 9   LYS A HG3  1  
ATOM 145   H HD2  . LYS A 1 9   ? -7.670  24.918  9.931   1.00 0.00 ? 9   LYS A HD2  1  
ATOM 146   H HD3  . LYS A 1 9   ? -8.582  23.457  10.448  1.00 0.00 ? 9   LYS A HD3  1  
ATOM 147   H HE2  . LYS A 1 9   ? -7.308  23.445  12.633  1.00 0.00 ? 9   LYS A HE2  1  
ATOM 148   H HE3  . LYS A 1 9   ? -6.369  24.891  12.082  1.00 0.00 ? 9   LYS A HE3  1  
ATOM 149   H HZ1  . LYS A 1 9   ? -8.438  26.105  11.944  1.00 0.00 ? 9   LYS A HZ1  1  
ATOM 150   H HZ2  . LYS A 1 9   ? -9.314  24.746  12.466  1.00 0.00 ? 9   LYS A HZ2  1  
ATOM 151   H HZ3  . LYS A 1 9   ? -8.189  25.482  13.506  1.00 0.00 ? 9   LYS A HZ3  1  
ATOM 152   N N    . GLU A 1 10  ? -5.759  18.333  9.772   1.00 0.00 ? 10  GLU A N    1  
ATOM 153   C CA   . GLU A 1 10  ? -5.722  16.931  10.217  1.00 0.00 ? 10  GLU A CA   1  
ATOM 154   C C    . GLU A 1 10  ? -4.337  16.371  10.622  1.00 0.00 ? 10  GLU A C    1  
ATOM 155   O O    . GLU A 1 10  ? -4.236  15.414  11.375  1.00 0.00 ? 10  GLU A O    1  
ATOM 156   C CB   . GLU A 1 10  ? -6.464  16.010  9.227   1.00 0.00 ? 10  GLU A CB   1  
ATOM 157   C CG   . GLU A 1 10  ? -7.037  14.749  9.904   1.00 0.00 ? 10  GLU A CG   1  
ATOM 158   C CD   . GLU A 1 10  ? -7.899  13.945  8.937   1.00 0.00 ? 10  GLU A CD   1  
ATOM 159   O OE1  . GLU A 1 10  ? -7.354  13.468  7.907   1.00 0.00 ? 10  GLU A OE1  1  
ATOM 160   O OE2  . GLU A 1 10  ? -9.114  13.783  9.225   1.00 0.00 ? 10  GLU A OE2  1  
ATOM 161   H H    . GLU A 1 10  ? -6.176  18.439  8.869   1.00 0.00 ? 10  GLU A H    1  
ATOM 162   H HA   . GLU A 1 10  ? -6.334  16.868  11.091  1.00 0.00 ? 10  GLU A HA   1  
ATOM 163   H HB2  . GLU A 1 10  ? -7.317  16.579  8.795   1.00 0.00 ? 10  GLU A HB2  1  
ATOM 164   H HB3  . GLU A 1 10  ? -5.781  15.745  8.409   1.00 0.00 ? 10  GLU A HB3  1  
ATOM 165   H HG2  . GLU A 1 10  ? -6.220  14.101  10.284  1.00 0.00 ? 10  GLU A HG2  1  
ATOM 166   H HG3  . GLU A 1 10  ? -7.655  15.085  10.765  1.00 0.00 ? 10  GLU A HG3  1  
ATOM 167   N N    . GLU A 1 11  ? -3.261  17.090  10.187  1.00 0.00 ? 11  GLU A N    1  
ATOM 168   C CA   . GLU A 1 11  ? -1.840  17.034  10.485  1.00 0.00 ? 11  GLU A CA   1  
ATOM 169   C C    . GLU A 1 11  ? -1.509  17.465  11.915  1.00 0.00 ? 11  GLU A C    1  
ATOM 170   O O    . GLU A 1 11  ? -0.568  16.946  12.510  1.00 0.00 ? 11  GLU A O    1  
ATOM 171   C CB   . GLU A 1 11  ? -1.114  18.018  9.525   1.00 0.00 ? 11  GLU A CB   1  
ATOM 172   C CG   . GLU A 1 11  ? -1.220  17.576  8.052   1.00 0.00 ? 11  GLU A CG   1  
ATOM 173   C CD   . GLU A 1 11  ? -0.352  18.481  7.178   1.00 0.00 ? 11  GLU A CD   1  
ATOM 174   O OE1  . GLU A 1 11  ? 0.885   18.523  7.413   1.00 0.00 ? 11  GLU A OE1  1  
ATOM 175   O OE2  . GLU A 1 11  ? -0.910  19.136  6.258   1.00 0.00 ? 11  GLU A OE2  1  
ATOM 176   H H    . GLU A 1 11  ? -3.454  17.860  9.591   1.00 0.00 ? 11  GLU A H    1  
ATOM 177   H HA   . GLU A 1 11  ? -1.474  16.014  10.360  1.00 0.00 ? 11  GLU A HA   1  
ATOM 178   H HB2  . GLU A 1 11  ? -1.554  19.053  9.632   1.00 0.00 ? 11  GLU A HB2  1  
ATOM 179   H HB3  . GLU A 1 11  ? -0.029  18.066  9.779   1.00 0.00 ? 11  GLU A HB3  1  
ATOM 180   H HG2  . GLU A 1 11  ? -0.829  16.526  7.965   1.00 0.00 ? 11  GLU A HG2  1  
ATOM 181   H HG3  . GLU A 1 11  ? -2.288  17.654  7.718   1.00 0.00 ? 11  GLU A HG3  1  
ATOM 182   N N    . GLU A 1 12  ? -2.305  18.410  12.515  1.00 0.00 ? 12  GLU A N    1  
ATOM 183   C CA   . GLU A 1 12  ? -2.174  18.919  13.887  1.00 0.00 ? 12  GLU A CA   1  
ATOM 184   C C    . GLU A 1 12  ? -2.478  17.868  14.954  1.00 0.00 ? 12  GLU A C    1  
ATOM 185   O O    . GLU A 1 12  ? -1.836  17.842  15.998  1.00 0.00 ? 12  GLU A O    1  
ATOM 186   C CB   . GLU A 1 12  ? -3.012  20.205  14.106  1.00 0.00 ? 12  GLU A CB   1  
ATOM 187   C CG   . GLU A 1 12  ? -2.565  21.355  13.182  1.00 0.00 ? 12  GLU A CG   1  
ATOM 188   C CD   . GLU A 1 12  ? -3.399  22.607  13.451  1.00 0.00 ? 12  GLU A CD   1  
ATOM 189   O OE1  . GLU A 1 12  ? -3.392  23.087  14.616  1.00 0.00 ? 12  GLU A OE1  1  
ATOM 190   O OE2  . GLU A 1 12  ? -4.045  23.106  12.492  1.00 0.00 ? 12  GLU A OE2  1  
ATOM 191   H H    . GLU A 1 12  ? -3.085  18.806  12.010  1.00 0.00 ? 12  GLU A H    1  
ATOM 192   H HA   . GLU A 1 12  ? -1.136  19.189  14.037  1.00 0.00 ? 12  GLU A HA   1  
ATOM 193   H HB2  . GLU A 1 12  ? -4.086  19.984  13.923  1.00 0.00 ? 12  GLU A HB2  1  
ATOM 194   H HB3  . GLU A 1 12  ? -2.906  20.555  15.157  1.00 0.00 ? 12  GLU A HB3  1  
ATOM 195   H HG2  . GLU A 1 12  ? -1.496  21.588  13.374  1.00 0.00 ? 12  GLU A HG2  1  
ATOM 196   H HG3  . GLU A 1 12  ? -2.674  21.056  12.118  1.00 0.00 ? 12  GLU A HG3  1  
ATOM 197   N N    . GLU A 1 13  ? -3.413  16.924  14.652  1.00 0.00 ? 13  GLU A N    1  
ATOM 198   C CA   . GLU A 1 13  ? -3.736  15.704  15.416  1.00 0.00 ? 13  GLU A CA   1  
ATOM 199   C C    . GLU A 1 13  ? -2.596  14.648  15.450  1.00 0.00 ? 13  GLU A C    1  
ATOM 200   O O    . GLU A 1 13  ? -2.247  14.099  16.494  1.00 0.00 ? 13  GLU A O    1  
ATOM 201   C CB   . GLU A 1 13  ? -5.008  15.020  14.818  1.00 0.00 ? 13  GLU A CB   1  
ATOM 202   C CG   . GLU A 1 13  ? -6.348  15.649  15.248  1.00 0.00 ? 13  GLU A CG   1  
ATOM 203   C CD   . GLU A 1 13  ? -6.478  17.111  14.824  1.00 0.00 ? 13  GLU A CD   1  
ATOM 204   O OE1  . GLU A 1 13  ? -6.512  17.370  13.592  1.00 0.00 ? 13  GLU A OE1  1  
ATOM 205   O OE2  . GLU A 1 13  ? -6.548  17.989  15.726  1.00 0.00 ? 13  GLU A OE2  1  
ATOM 206   H H    . GLU A 1 13  ? -3.927  17.070  13.806  1.00 0.00 ? 13  GLU A H    1  
ATOM 207   H HA   . GLU A 1 13  ? -3.931  15.977  16.446  1.00 0.00 ? 13  GLU A HA   1  
ATOM 208   H HB2  . GLU A 1 13  ? -4.936  15.008  13.709  1.00 0.00 ? 13  GLU A HB2  1  
ATOM 209   H HB3  . GLU A 1 13  ? -5.092  13.959  15.161  1.00 0.00 ? 13  GLU A HB3  1  
ATOM 210   H HG2  . GLU A 1 13  ? -7.183  15.069  14.756  1.00 0.00 ? 13  GLU A HG2  1  
ATOM 211   H HG3  . GLU A 1 13  ? -6.360  15.578  16.371  1.00 0.00 ? 13  GLU A HG3  1  
ATOM 212   N N    . THR A 1 14  ? -1.975  14.352  14.278  1.00 0.00 ? 14  THR A N    1  
ATOM 213   C CA   . THR A 1 14  ? -0.902  13.429  13.986  1.00 0.00 ? 14  THR A CA   1  
ATOM 214   C C    . THR A 1 14  ? 0.489   13.929  14.429  1.00 0.00 ? 14  THR A C    1  
ATOM 215   O O    . THR A 1 14  ? 1.358   13.138  14.786  1.00 0.00 ? 14  THR A O    1  
ATOM 216   C CB   . THR A 1 14  ? -1.067  13.029  12.525  1.00 0.00 ? 14  THR A CB   1  
ATOM 217   O OG1  . THR A 1 14  ? -1.315  14.155  11.697  1.00 0.00 ? 14  THR A OG1  1  
ATOM 218   C CG2  . THR A 1 14  ? -2.306  12.123  12.399  1.00 0.00 ? 14  THR A CG2  1  
ATOM 219   H H    . THR A 1 14  ? -2.232  14.743  13.393  1.00 0.00 ? 14  THR A H    1  
ATOM 220   H HA   . THR A 1 14  ? -1.052  12.512  14.537  1.00 0.00 ? 14  THR A HA   1  
ATOM 221   H HB   . THR A 1 14  ? -0.199  12.493  12.119  1.00 0.00 ? 14  THR A HB   1  
ATOM 222   H HG1  . THR A 1 14  ? -0.460  14.613  11.609  1.00 0.00 ? 14  THR A HG1  1  
ATOM 223   H HG21 . THR A 1 14  ? -3.228  12.654  12.736  1.00 0.00 ? 14  THR A HG21 1  
ATOM 224   H HG22 . THR A 1 14  ? -2.449  11.833  11.335  1.00 0.00 ? 14  THR A HG22 1  
ATOM 225   H HG23 . THR A 1 14  ? -2.188  11.201  13.005  1.00 0.00 ? 14  THR A HG23 1  
ATOM 226   N N    . ARG A 1 15  ? 0.749   15.265  14.465  1.00 0.00 ? 15  ARG A N    1  
ATOM 227   C CA   . ARG A 1 15  ? 1.991   15.905  14.934  1.00 0.00 ? 15  ARG A CA   1  
ATOM 228   C C    . ARG A 1 15  ? 2.340   15.732  16.443  1.00 0.00 ? 15  ARG A C    1  
ATOM 229   O O    . ARG A 1 15  ? 1.758   16.383  17.309  1.00 0.00 ? 15  ARG A O    1  
ATOM 230   C CB   . ARG A 1 15  ? 1.928   17.411  14.555  1.00 0.00 ? 15  ARG A CB   1  
ATOM 231   C CG   . ARG A 1 15  ? 3.241   18.204  14.704  1.00 0.00 ? 15  ARG A CG   1  
ATOM 232   C CD   . ARG A 1 15  ? 3.177   19.619  14.099  1.00 0.00 ? 15  ARG A CD   1  
ATOM 233   N NE   . ARG A 1 15  ? 3.108   19.521  12.591  1.00 0.00 ? 15  ARG A NE   1  
ATOM 234   C CZ   . ARG A 1 15  ? 2.049   19.933  11.822  1.00 0.00 ? 15  ARG A CZ   1  
ATOM 235   N NH1  . ARG A 1 15  ? 0.926   20.462  12.387  1.00 0.00 ? 15  ARG A NH1  1  
ATOM 236   N NH2  . ARG A 1 15  ? 2.120   19.802  10.465  1.00 0.00 ? 15  ARG A NH2  1  
ATOM 237   H H    . ARG A 1 15  ? 0.049   15.913  14.152  1.00 0.00 ? 15  ARG A H    1  
ATOM 238   H HA   . ARG A 1 15  ? 2.805   15.472  14.365  1.00 0.00 ? 15  ARG A HA   1  
ATOM 239   H HB2  . ARG A 1 15  ? 1.636   17.448  13.481  1.00 0.00 ? 15  ARG A HB2  1  
ATOM 240   H HB3  . ARG A 1 15  ? 1.116   17.916  15.127  1.00 0.00 ? 15  ARG A HB3  1  
ATOM 241   H HG2  . ARG A 1 15  ? 3.475   18.309  15.788  1.00 0.00 ? 15  ARG A HG2  1  
ATOM 242   H HG3  . ARG A 1 15  ? 4.074   17.639  14.228  1.00 0.00 ? 15  ARG A HG3  1  
ATOM 243   H HD2  . ARG A 1 15  ? 2.316   20.182  14.521  1.00 0.00 ? 15  ARG A HD2  1  
ATOM 244   H HD3  . ARG A 1 15  ? 4.112   20.165  14.344  1.00 0.00 ? 15  ARG A HD3  1  
ATOM 245   H HE   . ARG A 1 15  ? 3.901   19.134  12.120  1.00 0.00 ? 15  ARG A HE   1  
ATOM 246   H HH11 . ARG A 1 15  ? 0.864   20.555  13.381  1.00 0.00 ? 15  ARG A HH11 1  
ATOM 247   H HH12 . ARG A 1 15  ? 0.164   20.750  11.808  1.00 0.00 ? 15  ARG A HH12 1  
ATOM 248   H HH21 . ARG A 1 15  ? 2.938   19.412  10.043  1.00 0.00 ? 15  ARG A HH21 1  
ATOM 249   H HH22 . ARG A 1 15  ? 1.352   20.093  9.894   1.00 0.00 ? 15  ARG A HH22 1  
ATOM 250   N N    . GLN A 1 16  ? 3.320   14.816  16.727  1.00 0.00 ? 16  GLN A N    1  
ATOM 251   C CA   . GLN A 1 16  ? 3.887   14.335  18.002  1.00 0.00 ? 16  GLN A CA   1  
ATOM 252   C C    . GLN A 1 16  ? 3.957   12.815  17.922  1.00 0.00 ? 16  GLN A C    1  
ATOM 253   O O    . GLN A 1 16  ? 4.843   12.175  18.481  1.00 0.00 ? 16  GLN A O    1  
ATOM 254   C CB   . GLN A 1 16  ? 3.182   14.740  19.334  1.00 0.00 ? 16  GLN A CB   1  
ATOM 255   C CG   . GLN A 1 16  ? 3.558   16.161  19.809  1.00 0.00 ? 16  GLN A CG   1  
ATOM 256   C CD   . GLN A 1 16  ? 2.459   16.714  20.712  1.00 0.00 ? 16  GLN A CD   1  
ATOM 257   O OE1  . GLN A 1 16  ? 2.561   16.718  21.939  1.00 0.00 ? 16  GLN A OE1  1  
ATOM 258   N NE2  . GLN A 1 16  ? 1.364   17.198  20.077  1.00 0.00 ? 16  GLN A NE2  1  
ATOM 259   H H    . GLN A 1 16  ? 3.724   14.356  15.943  1.00 0.00 ? 16  GLN A H    1  
ATOM 260   H HA   . GLN A 1 16  ? 4.910   14.681  18.049  1.00 0.00 ? 16  GLN A HA   1  
ATOM 261   H HB2  . GLN A 1 16  ? 2.082   14.645  19.189  1.00 0.00 ? 16  GLN A HB2  1  
ATOM 262   H HB3  . GLN A 1 16  ? 3.455   14.060  20.175  1.00 0.00 ? 16  GLN A HB3  1  
ATOM 263   H HG2  . GLN A 1 16  ? 4.513   16.143  20.371  1.00 0.00 ? 16  GLN A HG2  1  
ATOM 264   H HG3  . GLN A 1 16  ? 3.676   16.840  18.940  1.00 0.00 ? 16  GLN A HG3  1  
ATOM 265   H HE21 . GLN A 1 16  ? 1.309   17.115  19.075  1.00 0.00 ? 16  GLN A HE21 1  
ATOM 266   H HE22 . GLN A 1 16  ? 0.616   17.530  20.644  1.00 0.00 ? 16  GLN A HE22 1  
ATOM 267   N N    . MET A 1 17  ? 2.993   12.216  17.185  1.00 0.00 ? 17  MET A N    1  
ATOM 268   C CA   . MET A 1 17  ? 2.760   10.802  16.915  1.00 0.00 ? 17  MET A CA   1  
ATOM 269   C C    . MET A 1 17  ? 3.778   10.131  16.017  1.00 0.00 ? 17  MET A C    1  
ATOM 270   O O    . MET A 1 17  ? 4.057   8.946   16.157  1.00 0.00 ? 17  MET A O    1  
ATOM 271   C CB   . MET A 1 17  ? 1.299   10.502  16.542  1.00 0.00 ? 17  MET A CB   1  
ATOM 272   C CG   . MET A 1 17  ? 0.286   11.137  17.521  1.00 0.00 ? 17  MET A CG   1  
ATOM 273   S SD   . MET A 1 17  ? -1.301  10.251  17.646  1.00 0.00 ? 17  MET A SD   1  
ATOM 274   C CE   . MET A 1 17  ? -1.900  10.459  15.944  1.00 0.00 ? 17  MET A CE   1  
ATOM 275   H H    . MET A 1 17  ? 2.314   12.804  16.745  1.00 0.00 ? 17  MET A H    1  
ATOM 276   H HA   . MET A 1 17  ? 2.902   10.271  17.842  1.00 0.00 ? 17  MET A HA   1  
ATOM 277   H HB2  . MET A 1 17  ? 1.082   10.838  15.506  1.00 0.00 ? 17  MET A HB2  1  
ATOM 278   H HB3  . MET A 1 17  ? 1.158   9.402   16.587  1.00 0.00 ? 17  MET A HB3  1  
ATOM 279   H HG2  . MET A 1 17  ? 0.753   11.140  18.532  1.00 0.00 ? 17  MET A HG2  1  
ATOM 280   H HG3  . MET A 1 17  ? 0.115   12.200  17.239  1.00 0.00 ? 17  MET A HG3  1  
ATOM 281   H HE1  . MET A 1 17  ? -1.095  10.357  15.183  1.00 0.00 ? 17  MET A HE1  1  
ATOM 282   H HE2  . MET A 1 17  ? -2.681  9.708   15.706  1.00 0.00 ? 17  MET A HE2  1  
ATOM 283   H HE3  . MET A 1 17  ? -2.352  11.465  15.819  1.00 0.00 ? 17  MET A HE3  1  
ATOM 284   N N    . TYR A 1 18  ? 4.351   10.877  15.042  1.00 0.00 ? 18  TYR A N    1  
ATOM 285   C CA   . TYR A 1 18  ? 5.278   10.482  13.990  1.00 0.00 ? 18  TYR A CA   1  
ATOM 286   C C    . TYR A 1 18  ? 6.566   9.703   14.300  1.00 0.00 ? 18  TYR A C    1  
ATOM 287   O O    . TYR A 1 18  ? 7.103   9.121   13.368  1.00 0.00 ? 18  TYR A O    1  
ATOM 288   C CB   . TYR A 1 18  ? 5.595   11.670  13.022  1.00 0.00 ? 18  TYR A CB   1  
ATOM 289   C CG   . TYR A 1 18  ? 4.364   12.304  12.363  1.00 0.00 ? 18  TYR A CG   1  
ATOM 290   C CD1  . TYR A 1 18  ? 3.295   11.538  11.898  1.00 0.00 ? 18  TYR A CD1  1  
ATOM 291   C CD2  . TYR A 1 18  ? 4.312   13.675  12.101  1.00 0.00 ? 18  TYR A CD2  1  
ATOM 292   C CE1  . TYR A 1 18  ? 2.220   12.104  11.256  1.00 0.00 ? 18  TYR A CE1  1  
ATOM 293   C CE2  . TYR A 1 18  ? 3.247   14.238  11.419  1.00 0.00 ? 18  TYR A CE2  1  
ATOM 294   C CZ   . TYR A 1 18  ? 2.201   13.453  10.996  1.00 0.00 ? 18  TYR A CZ   1  
ATOM 295   O OH   . TYR A 1 18  ? 1.133   14.016  10.273  1.00 0.00 ? 18  TYR A OH   1  
ATOM 296   H H    . TYR A 1 18  ? 4.057   11.824  14.961  1.00 0.00 ? 18  TYR A H    1  
ATOM 297   H HA   . TYR A 1 18  ? 4.747   9.757   13.430  1.00 0.00 ? 18  TYR A HA   1  
ATOM 298   H HB2  . TYR A 1 18  ? 6.162   12.433  13.603  1.00 0.00 ? 18  TYR A HB2  1  
ATOM 299   H HB3  . TYR A 1 18  ? 6.234   11.333  12.175  1.00 0.00 ? 18  TYR A HB3  1  
ATOM 300   H HD1  . TYR A 1 18  ? 3.246   10.467  11.981  1.00 0.00 ? 18  TYR A HD1  1  
ATOM 301   H HD2  . TYR A 1 18  ? 5.120   14.338  12.379  1.00 0.00 ? 18  TYR A HD2  1  
ATOM 302   H HE1  . TYR A 1 18  ? 1.392   11.463  10.971  1.00 0.00 ? 18  TYR A HE1  1  
ATOM 303   H HE2  . TYR A 1 18  ? 3.237   15.297  11.193  1.00 0.00 ? 18  TYR A HE2  1  
ATOM 304   H HH   . TYR A 1 18  ? 0.571   13.264  9.950   1.00 0.00 ? 18  TYR A HH   1  
ATOM 305   N N    . ASP A 1 19  ? 7.087   9.634   15.566  1.00 0.00 ? 19  ASP A N    1  
ATOM 306   C CA   . ASP A 1 19  ? 8.265   8.897   16.085  1.00 0.00 ? 19  ASP A CA   1  
ATOM 307   C C    . ASP A 1 19  ? 8.742   7.637   15.324  1.00 0.00 ? 19  ASP A C    1  
ATOM 308   O O    . ASP A 1 19  ? 9.710   7.718   14.580  1.00 0.00 ? 19  ASP A O    1  
ATOM 309   C CB   . ASP A 1 19  ? 8.056   8.593   17.607  1.00 0.00 ? 19  ASP A CB   1  
ATOM 310   C CG   . ASP A 1 19  ? 9.356   8.271   18.361  1.00 0.00 ? 19  ASP A CG   1  
ATOM 311   O OD1  . ASP A 1 19  ? 10.259  9.149   18.388  1.00 0.00 ? 19  ASP A OD1  1  
ATOM 312   O OD2  . ASP A 1 19  ? 9.454   7.145   18.916  1.00 0.00 ? 19  ASP A OD2  1  
ATOM 313   H H    . ASP A 1 19  ? 6.583   10.110  16.279  1.00 0.00 ? 19  ASP A H    1  
ATOM 314   H HA   . ASP A 1 19  ? 9.082   9.599   16.006  1.00 0.00 ? 19  ASP A HA   1  
ATOM 315   H HB2  . ASP A 1 19  ? 7.622   9.503   18.077  1.00 0.00 ? 19  ASP A HB2  1  
ATOM 316   H HB3  . ASP A 1 19  ? 7.319   7.775   17.746  1.00 0.00 ? 19  ASP A HB3  1  
ATOM 317   N N    . MET A 1 20  ? 8.058   6.460   15.455  1.00 0.00 ? 20  MET A N    1  
ATOM 318   C CA   . MET A 1 20  ? 8.344   5.229   14.695  1.00 0.00 ? 20  MET A CA   1  
ATOM 319   C C    . MET A 1 20  ? 7.837   5.201   13.254  1.00 0.00 ? 20  MET A C    1  
ATOM 320   O O    . MET A 1 20  ? 8.342   4.491   12.387  1.00 0.00 ? 20  MET A O    1  
ATOM 321   C CB   . MET A 1 20  ? 8.027   3.908   15.475  1.00 0.00 ? 20  MET A CB   1  
ATOM 322   C CG   . MET A 1 20  ? 6.670   3.203   15.236  1.00 0.00 ? 20  MET A CG   1  
ATOM 323   S SD   . MET A 1 20  ? 6.798   1.437   14.775  1.00 0.00 ? 20  MET A SD   1  
ATOM 324   C CE   . MET A 1 20  ? 7.782   1.514   13.248  1.00 0.00 ? 20  MET A CE   1  
ATOM 325   H H    . MET A 1 20  ? 7.276   6.431   16.071  1.00 0.00 ? 20  MET A H    1  
ATOM 326   H HA   . MET A 1 20  ? 9.417   5.209   14.541  1.00 0.00 ? 20  MET A HA   1  
ATOM 327   H HB2  . MET A 1 20  ? 8.833   3.182   15.232  1.00 0.00 ? 20  MET A HB2  1  
ATOM 328   H HB3  . MET A 1 20  ? 8.111   4.114   16.564  1.00 0.00 ? 20  MET A HB3  1  
ATOM 329   H HG2  . MET A 1 20  ? 6.073   3.292   16.172  1.00 0.00 ? 20  MET A HG2  1  
ATOM 330   H HG3  . MET A 1 20  ? 6.079   3.715   14.456  1.00 0.00 ? 20  MET A HG3  1  
ATOM 331   H HE1  . MET A 1 20  ? 7.341   2.169   12.464  1.00 0.00 ? 20  MET A HE1  1  
ATOM 332   H HE2  . MET A 1 20  ? 8.816   1.874   13.444  1.00 0.00 ? 20  MET A HE2  1  
ATOM 333   H HE3  . MET A 1 20  ? 7.858   0.500   12.810  1.00 0.00 ? 20  MET A HE3  1  
ATOM 334   N N    . VAL A 1 21  ? 6.759   5.971   12.967  1.00 0.00 ? 21  VAL A N    1  
ATOM 335   C CA   . VAL A 1 21  ? 6.055   6.021   11.652  1.00 0.00 ? 21  VAL A CA   1  
ATOM 336   C C    . VAL A 1 21  ? 6.835   6.778   10.582  1.00 0.00 ? 21  VAL A C    1  
ATOM 337   O O    . VAL A 1 21  ? 6.769   6.429   9.401   1.00 0.00 ? 21  VAL A O    1  
ATOM 338   C CB   . VAL A 1 21  ? 4.517   6.048   11.737  1.00 0.00 ? 21  VAL A CB   1  
ATOM 339   C CG1  . VAL A 1 21  ? 3.977   7.430   12.144  1.00 0.00 ? 21  VAL A CG1  1  
ATOM 340   C CG2  . VAL A 1 21  ? 3.816   5.502   10.478  1.00 0.00 ? 21  VAL A CG2  1  
ATOM 341   H H    . VAL A 1 21  ? 6.432   6.574   13.730  1.00 0.00 ? 21  VAL A H    1  
ATOM 342   H HA   . VAL A 1 21  ? 6.184   5.024   11.174  1.00 0.00 ? 21  VAL A HA   1  
ATOM 343   H HB   . VAL A 1 21  ? 4.243   5.279   12.501  1.00 0.00 ? 21  VAL A HB   1  
ATOM 344   H HG11 . VAL A 1 21  ? 4.378   8.219   11.475  1.00 0.00 ? 21  VAL A HG11 1  
ATOM 345   H HG12 . VAL A 1 21  ? 2.872   7.474   12.055  1.00 0.00 ? 21  VAL A HG12 1  
ATOM 346   H HG13 . VAL A 1 21  ? 4.256   7.666   13.195  1.00 0.00 ? 21  VAL A HG13 1  
ATOM 347   H HG21 . VAL A 1 21  ? 4.425   4.732   9.965   1.00 0.00 ? 21  VAL A HG21 1  
ATOM 348   H HG22 . VAL A 1 21  ? 2.839   5.012   10.769  1.00 0.00 ? 21  VAL A HG22 1  
ATOM 349   H HG23 . VAL A 1 21  ? 3.633   6.343   9.779   1.00 0.00 ? 21  VAL A HG23 1  
ATOM 350   N N    . VAL A 1 22  ? 7.662   7.807   10.989  1.00 0.00 ? 22  VAL A N    1  
ATOM 351   C CA   . VAL A 1 22  ? 8.573   8.627   10.151  1.00 0.00 ? 22  VAL A CA   1  
ATOM 352   C C    . VAL A 1 22  ? 9.522   7.803   9.245   1.00 0.00 ? 22  VAL A C    1  
ATOM 353   O O    . VAL A 1 22  ? 9.770   8.192   8.109   1.00 0.00 ? 22  VAL A O    1  
ATOM 354   C CB   . VAL A 1 22  ? 9.268   9.775   10.908  1.00 0.00 ? 22  VAL A CB   1  
ATOM 355   C CG1  . VAL A 1 22  ? 10.509  9.351   11.720  1.00 0.00 ? 22  VAL A CG1  1  
ATOM 356   C CG2  . VAL A 1 22  ? 9.599   10.950  9.957   1.00 0.00 ? 22  VAL A CG2  1  
ATOM 357   H H    . VAL A 1 22  ? 7.670   8.057   11.968  1.00 0.00 ? 22  VAL A H    1  
ATOM 358   H HA   . VAL A 1 22  ? 7.932   9.162   9.481   1.00 0.00 ? 22  VAL A HA   1  
ATOM 359   H HB   . VAL A 1 22  ? 8.521   10.149  11.647  1.00 0.00 ? 22  VAL A HB   1  
ATOM 360   H HG11 . VAL A 1 22  ? 10.249  8.496   12.372  1.00 0.00 ? 22  VAL A HG11 1  
ATOM 361   H HG12 . VAL A 1 22  ? 11.350  9.067   11.052  1.00 0.00 ? 22  VAL A HG12 1  
ATOM 362   H HG13 . VAL A 1 22  ? 10.847  10.192  12.366  1.00 0.00 ? 22  VAL A HG13 1  
ATOM 363   H HG21 . VAL A 1 22  ? 8.699   11.271  9.394   1.00 0.00 ? 22  VAL A HG21 1  
ATOM 364   H HG22 . VAL A 1 22  ? 9.979   11.817  10.537  1.00 0.00 ? 22  VAL A HG22 1  
ATOM 365   H HG23 . VAL A 1 22  ? 10.381  10.655  9.226   1.00 0.00 ? 22  VAL A HG23 1  
ATOM 366   N N    . LYS A 1 23  ? 9.968   6.581   9.692   1.00 0.00 ? 23  LYS A N    1  
ATOM 367   C CA   . LYS A 1 23  ? 10.672  5.570   8.881   1.00 0.00 ? 23  LYS A CA   1  
ATOM 368   C C    . LYS A 1 23  ? 9.810   4.894   7.785   1.00 0.00 ? 23  LYS A C    1  
ATOM 369   O O    . LYS A 1 23  ? 10.245  4.728   6.651   1.00 0.00 ? 23  LYS A O    1  
ATOM 370   C CB   . LYS A 1 23  ? 11.260  4.431   9.769   1.00 0.00 ? 23  LYS A CB   1  
ATOM 371   C CG   . LYS A 1 23  ? 12.571  4.795   10.494  1.00 0.00 ? 23  LYS A CG   1  
ATOM 372   C CD   . LYS A 1 23  ? 12.492  5.904   11.557  1.00 0.00 ? 23  LYS A CD   1  
ATOM 373   C CE   . LYS A 1 23  ? 11.454  5.654   12.654  1.00 0.00 ? 23  LYS A CE   1  
ATOM 374   N NZ   . LYS A 1 23  ? 11.671  4.349   13.319  1.00 0.00 ? 23  LYS A NZ   1  
ATOM 375   H H    . LYS A 1 23  ? 9.769   6.265   10.626  1.00 0.00 ? 23  LYS A H    1  
ATOM 376   H HA   . LYS A 1 23  ? 11.491  6.057   8.369   1.00 0.00 ? 23  LYS A HA   1  
ATOM 377   H HB2  . LYS A 1 23  ? 10.491  4.109   10.505  1.00 0.00 ? 23  LYS A HB2  1  
ATOM 378   H HB3  . LYS A 1 23  ? 11.527  3.532   9.161   1.00 0.00 ? 23  LYS A HB3  1  
ATOM 379   H HG2  . LYS A 1 23  ? 12.971  3.872   10.974  1.00 0.00 ? 23  LYS A HG2  1  
ATOM 380   H HG3  . LYS A 1 23  ? 13.299  5.116   9.720   1.00 0.00 ? 23  LYS A HG3  1  
ATOM 381   H HD2  . LYS A 1 23  ? 13.494  6.015   12.032  1.00 0.00 ? 23  LYS A HD2  1  
ATOM 382   H HD3  . LYS A 1 23  ? 12.264  6.872   11.061  1.00 0.00 ? 23  LYS A HD3  1  
ATOM 383   H HE2  . LYS A 1 23  ? 11.523  6.439   13.434  1.00 0.00 ? 23  LYS A HE2  1  
ATOM 384   H HE3  . LYS A 1 23  ? 10.425  5.658   12.226  1.00 0.00 ? 23  LYS A HE3  1  
ATOM 385   H HZ1  . LYS A 1 23  ? 12.618  4.333   13.751  1.00 0.00 ? 23  LYS A HZ1  1  
ATOM 386   H HZ2  . LYS A 1 23  ? 10.950  4.211   14.057  1.00 0.00 ? 23  LYS A HZ2  1  
ATOM 387   H HZ3  . LYS A 1 23  ? 11.598  3.587   12.616  1.00 0.00 ? 23  LYS A HZ3  1  
ATOM 388   N N    . ILE A 1 24  ? 8.545   4.485   8.087   1.00 0.00 ? 24  ILE A N    1  
ATOM 389   C CA   . ILE A 1 24  ? 7.576   3.863   7.174   1.00 0.00 ? 24  ILE A CA   1  
ATOM 390   C C    . ILE A 1 24  ? 6.917   4.873   6.208   1.00 0.00 ? 24  ILE A C    1  
ATOM 391   O O    . ILE A 1 24  ? 6.751   4.594   5.017   1.00 0.00 ? 24  ILE A O    1  
ATOM 392   C CB   . ILE A 1 24  ? 6.669   2.852   7.877   1.00 0.00 ? 24  ILE A CB   1  
ATOM 393   C CG1  . ILE A 1 24  ? 7.482   1.519   8.053   1.00 0.00 ? 24  ILE A CG1  1  
ATOM 394   C CG2  . ILE A 1 24  ? 5.334   2.647   7.107   1.00 0.00 ? 24  ILE A CG2  1  
ATOM 395   C CD1  . ILE A 1 24  ? 6.810   0.496   8.972   1.00 0.00 ? 24  ILE A CD1  1  
ATOM 396   H H    . ILE A 1 24  ? 8.198   4.646   9.006   1.00 0.00 ? 24  ILE A H    1  
ATOM 397   H HA   . ILE A 1 24  ? 8.128   3.202   6.525   1.00 0.00 ? 24  ILE A HA   1  
ATOM 398   H HB   . ILE A 1 24  ? 6.440   3.240   8.898   1.00 0.00 ? 24  ILE A HB   1  
ATOM 399   H HG12 . ILE A 1 24  ? 7.720   1.053   7.052   1.00 0.00 ? 24  ILE A HG12 1  
ATOM 400   H HG13 . ILE A 1 24  ? 8.447   1.743   8.591   1.00 0.00 ? 24  ILE A HG13 1  
ATOM 401   H HG21 . ILE A 1 24  ? 5.531   2.457   6.034   1.00 0.00 ? 24  ILE A HG21 1  
ATOM 402   H HG22 . ILE A 1 24  ? 4.782   1.770   7.493   1.00 0.00 ? 24  ILE A HG22 1  
ATOM 403   H HG23 . ILE A 1 24  ? 4.643   3.518   7.210   1.00 0.00 ? 24  ILE A HG23 1  
ATOM 404   H HD11 . ILE A 1 24  ? 5.773   0.256   8.673   1.00 0.00 ? 24  ILE A HD11 1  
ATOM 405   H HD12 . ILE A 1 24  ? 7.396   -0.443  9.002   1.00 0.00 ? 24  ILE A HD12 1  
ATOM 406   H HD13 . ILE A 1 24  ? 6.779   0.897   10.006  1.00 0.00 ? 24  ILE A HD13 1  
ATOM 407   N N    . ILE A 1 25  ? 6.617   6.142   6.645   1.00 0.00 ? 25  ILE A N    1  
ATOM 408   C CA   . ILE A 1 25  ? 6.162   7.253   5.763   1.00 0.00 ? 25  ILE A CA   1  
ATOM 409   C C    . ILE A 1 25  ? 7.278   7.683   4.802   1.00 0.00 ? 25  ILE A C    1  
ATOM 410   O O    . ILE A 1 25  ? 7.015   8.029   3.652   1.00 0.00 ? 25  ILE A O    1  
ATOM 411   C CB   . ILE A 1 25  ? 5.441   8.452   6.403   1.00 0.00 ? 25  ILE A CB   1  
ATOM 412   C CG1  . ILE A 1 25  ? 6.306   9.185   7.447   1.00 0.00 ? 25  ILE A CG1  1  
ATOM 413   C CG2  . ILE A 1 25  ? 4.106   7.957   6.995   1.00 0.00 ? 25  ILE A CG2  1  
ATOM 414   C CD1  . ILE A 1 25  ? 5.558   10.232  8.279   1.00 0.00 ? 25  ILE A CD1  1  
ATOM 415   H H    . ILE A 1 25  ? 6.754   6.365   7.619   1.00 0.00 ? 25  ILE A H    1  
ATOM 416   H HA   . ILE A 1 25  ? 5.407   6.828   5.113   1.00 0.00 ? 25  ILE A HA   1  
ATOM 417   H HB   . ILE A 1 25  ? 5.171   9.199   5.616   1.00 0.00 ? 25  ILE A HB   1  
ATOM 418   H HG12 . ILE A 1 25  ? 6.711   8.414   8.123   1.00 0.00 ? 25  ILE A HG12 1  
ATOM 419   H HG13 . ILE A 1 25  ? 7.170   9.668   6.939   1.00 0.00 ? 25  ILE A HG13 1  
ATOM 420   H HG21 . ILE A 1 25  ? 3.482   7.482   6.210   1.00 0.00 ? 25  ILE A HG21 1  
ATOM 421   H HG22 . ILE A 1 25  ? 4.298   7.218   7.800   1.00 0.00 ? 25  ILE A HG22 1  
ATOM 422   H HG23 . ILE A 1 25  ? 3.517   8.794   7.426   1.00 0.00 ? 25  ILE A HG23 1  
ATOM 423   H HD11 . ILE A 1 25  ? 5.051   10.964  7.614   1.00 0.00 ? 25  ILE A HD11 1  
ATOM 424   H HD12 . ILE A 1 25  ? 4.793   9.748   8.926   1.00 0.00 ? 25  ILE A HD12 1  
ATOM 425   H HD13 . ILE A 1 25  ? 6.261   10.784  8.941   1.00 0.00 ? 25  ILE A HD13 1  
ATOM 426   N N    . ASP A 1 26  ? 8.570   7.539   5.260   1.00 0.00 ? 26  ASP A N    1  
ATOM 427   C CA   . ASP A 1 26  ? 9.796   7.661   4.456   1.00 0.00 ? 26  ASP A CA   1  
ATOM 428   C C    . ASP A 1 26  ? 9.925   6.520   3.430   1.00 0.00 ? 26  ASP A C    1  
ATOM 429   O O    . ASP A 1 26  ? 10.107  6.850   2.271   1.00 0.00 ? 26  ASP A O    1  
ATOM 430   C CB   . ASP A 1 26  ? 11.101  7.837   5.298   1.00 0.00 ? 26  ASP A CB   1  
ATOM 431   C CG   . ASP A 1 26  ? 12.317  8.292   4.473   1.00 0.00 ? 26  ASP A CG   1  
ATOM 432   O OD1  . ASP A 1 26  ? 12.245  9.402   3.881   1.00 0.00 ? 26  ASP A OD1  1  
ATOM 433   O OD2  . ASP A 1 26  ? 13.323  7.535   4.431   1.00 0.00 ? 26  ASP A OD2  1  
ATOM 434   H H    . ASP A 1 26  ? 8.716   7.256   6.211   1.00 0.00 ? 26  ASP A H    1  
ATOM 435   H HA   . ASP A 1 26  ? 9.691   8.567   3.873   1.00 0.00 ? 26  ASP A HA   1  
ATOM 436   H HB2  . ASP A 1 26  ? 10.914  8.637   6.048   1.00 0.00 ? 26  ASP A HB2  1  
ATOM 437   H HB3  . ASP A 1 26  ? 11.344  6.902   5.844   1.00 0.00 ? 26  ASP A HB3  1  
ATOM 438   N N    . VAL A 1 27  ? 9.742   5.198   3.779   1.00 0.00 ? 27  VAL A N    1  
ATOM 439   C CA   . VAL A 1 27  ? 9.673   3.984   2.910   1.00 0.00 ? 27  VAL A CA   1  
ATOM 440   C C    . VAL A 1 27  ? 8.679   4.161   1.753   1.00 0.00 ? 27  VAL A C    1  
ATOM 441   O O    . VAL A 1 27  ? 9.039   4.092   0.576   1.00 0.00 ? 27  VAL A O    1  
ATOM 442   C CB   . VAL A 1 27  ? 9.277   2.738   3.759   1.00 0.00 ? 27  VAL A CB   1  
ATOM 443   C CG1  . VAL A 1 27  ? 8.641   1.500   3.082   1.00 0.00 ? 27  VAL A CG1  1  
ATOM 444   C CG2  . VAL A 1 27  ? 10.485  2.211   4.553   1.00 0.00 ? 27  VAL A CG2  1  
ATOM 445   H H    . VAL A 1 27  ? 9.645   4.982   4.747   1.00 0.00 ? 27  VAL A H    1  
ATOM 446   H HA   . VAL A 1 27  ? 10.646  3.821   2.467   1.00 0.00 ? 27  VAL A HA   1  
ATOM 447   H HB   . VAL A 1 27  ? 8.501   3.067   4.467   1.00 0.00 ? 27  VAL A HB   1  
ATOM 448   H HG11 . VAL A 1 27  ? 7.714   1.725   2.518   1.00 0.00 ? 27  VAL A HG11 1  
ATOM 449   H HG12 . VAL A 1 27  ? 9.371   0.999   2.412   1.00 0.00 ? 27  VAL A HG12 1  
ATOM 450   H HG13 . VAL A 1 27  ? 8.363   0.795   3.914   1.00 0.00 ? 27  VAL A HG13 1  
ATOM 451   H HG21 . VAL A 1 27  ? 11.071  3.022   5.030   1.00 0.00 ? 27  VAL A HG21 1  
ATOM 452   H HG22 . VAL A 1 27  ? 10.129  1.515   5.348   1.00 0.00 ? 27  VAL A HG22 1  
ATOM 453   H HG23 . VAL A 1 27  ? 11.135  1.628   3.862   1.00 0.00 ? 27  VAL A HG23 1  
ATOM 454   N N    . LEU A 1 28  ? 7.398   4.517   2.069   1.00 0.00 ? 28  LEU A N    1  
ATOM 455   C CA   . LEU A 1 28  ? 6.375   4.769   1.047   1.00 0.00 ? 28  LEU A CA   1  
ATOM 456   C C    . LEU A 1 28  ? 6.524   6.050   0.200   1.00 0.00 ? 28  LEU A C    1  
ATOM 457   O O    . LEU A 1 28  ? 6.595   5.947   -1.025  1.00 0.00 ? 28  LEU A O    1  
ATOM 458   C CB   . LEU A 1 28  ? 4.925   4.688   1.627   1.00 0.00 ? 28  LEU A CB   1  
ATOM 459   C CG   . LEU A 1 28  ? 4.400   3.288   2.065   1.00 0.00 ? 28  LEU A CG   1  
ATOM 460   C CD1  . LEU A 1 28  ? 4.768   2.183   1.078   1.00 0.00 ? 28  LEU A CD1  1  
ATOM 461   C CD2  . LEU A 1 28  ? 4.849   2.821   3.451   1.00 0.00 ? 28  LEU A CD2  1  
ATOM 462   H H    . LEU A 1 28  ? 7.123   4.597   3.037   1.00 0.00 ? 28  LEU A H    1  
ATOM 463   H HA   . LEU A 1 28  ? 6.503   3.997   0.307   1.00 0.00 ? 28  LEU A HA   1  
ATOM 464   H HB2  . LEU A 1 28  ? 4.828   5.389   2.482   1.00 0.00 ? 28  LEU A HB2  1  
ATOM 465   H HB3  . LEU A 1 28  ? 4.199   5.014   0.850   1.00 0.00 ? 28  LEU A HB3  1  
ATOM 466   H HG   . LEU A 1 28  ? 3.280   3.374   2.086   1.00 0.00 ? 28  LEU A HG   1  
ATOM 467   H HD11 . LEU A 1 28  ? 4.491   2.483   0.045   1.00 0.00 ? 28  LEU A HD11 1  
ATOM 468   H HD12 . LEU A 1 28  ? 5.860   1.984   1.120   1.00 0.00 ? 28  LEU A HD12 1  
ATOM 469   H HD13 . LEU A 1 28  ? 4.255   1.231   1.335   1.00 0.00 ? 28  LEU A HD13 1  
ATOM 470   H HD21 . LEU A 1 28  ? 4.512   3.517   4.248   1.00 0.00 ? 28  LEU A HD21 1  
ATOM 471   H HD22 . LEU A 1 28  ? 4.448   1.803   3.652   1.00 0.00 ? 28  LEU A HD22 1  
ATOM 472   H HD23 . LEU A 1 28  ? 5.954   2.741   3.487   1.00 0.00 ? 28  LEU A HD23 1  
ATOM 473   N N    . ARG A 1 29  ? 6.679   7.274   0.787   1.00 0.00 ? 29  ARG A N    1  
ATOM 474   C CA   . ARG A 1 29  ? 6.917   8.550   0.042   1.00 0.00 ? 29  ARG A CA   1  
ATOM 475   C C    . ARG A 1 29  ? 8.171   8.618   -0.872  1.00 0.00 ? 29  ARG A C    1  
ATOM 476   O O    . ARG A 1 29  ? 8.236   9.373   -1.839  1.00 0.00 ? 29  ARG A O    1  
ATOM 477   C CB   . ARG A 1 29  ? 6.902   9.699   1.089   1.00 0.00 ? 29  ARG A CB   1  
ATOM 478   C CG   . ARG A 1 29  ? 6.965   11.151  0.568   1.00 0.00 ? 29  ARG A CG   1  
ATOM 479   C CD   . ARG A 1 29  ? 6.722   12.210  1.660   1.00 0.00 ? 29  ARG A CD   1  
ATOM 480   N NE   . ARG A 1 29  ? 5.321   12.087  2.209   1.00 0.00 ? 29  ARG A NE   1  
ATOM 481   C CZ   . ARG A 1 29  ? 4.219   12.671  1.639   1.00 0.00 ? 29  ARG A CZ   1  
ATOM 482   N NH1  . ARG A 1 29  ? 4.323   13.429  0.511   1.00 0.00 ? 29  ARG A NH1  1  
ATOM 483   N NH2  . ARG A 1 29  ? 2.994   12.491  2.216   1.00 0.00 ? 29  ARG A NH2  1  
ATOM 484   H H    . ARG A 1 29  ? 6.610   7.365   1.810   1.00 0.00 ? 29  ARG A H    1  
ATOM 485   H HA   . ARG A 1 29  ? 6.094   8.736   -0.660  1.00 0.00 ? 29  ARG A HA   1  
ATOM 486   H HB2  . ARG A 1 29  ? 5.947   9.586   1.653   1.00 0.00 ? 29  ARG A HB2  1  
ATOM 487   H HB3  . ARG A 1 29  ? 7.729   9.549   1.819   1.00 0.00 ? 29  ARG A HB3  1  
ATOM 488   H HG2  . ARG A 1 29  ? 7.976   11.333  0.137   1.00 0.00 ? 29  ARG A HG2  1  
ATOM 489   H HG3  . ARG A 1 29  ? 6.226   11.284  -0.251  1.00 0.00 ? 29  ARG A HG3  1  
ATOM 490   H HD2  . ARG A 1 29  ? 7.426   12.044  2.504   1.00 0.00 ? 29  ARG A HD2  1  
ATOM 491   H HD3  . ARG A 1 29  ? 6.889   13.235  1.259   1.00 0.00 ? 29  ARG A HD3  1  
ATOM 492   H HE   . ARG A 1 29  ? 5.191   11.540  3.035   1.00 0.00 ? 29  ARG A HE   1  
ATOM 493   H HH11 . ARG A 1 29  ? 5.217   13.566  0.083   1.00 0.00 ? 29  ARG A HH11 1  
ATOM 494   H HH12 . ARG A 1 29  ? 3.508   13.848  0.112   1.00 0.00 ? 29  ARG A HH12 1  
ATOM 495   H HH21 . ARG A 1 29  ? 2.907   11.936  3.043   1.00 0.00 ? 29  ARG A HH21 1  
ATOM 496   H HH22 . ARG A 1 29  ? 2.183   12.913  1.809   1.00 0.00 ? 29  ARG A HH22 1  
ATOM 497   N N    . SER A 1 30  ? 9.213   7.843   -0.494  1.00 0.00 ? 30  SER A N    1  
ATOM 498   C CA   . SER A 1 30  ? 10.554  7.665   -1.105  1.00 0.00 ? 30  SER A CA   1  
ATOM 499   C C    . SER A 1 30  ? 10.605  6.773   -2.310  1.00 0.00 ? 30  SER A C    1  
ATOM 500   O O    . SER A 1 30  ? 11.089  7.180   -3.359  1.00 0.00 ? 30  SER A O    1  
ATOM 501   C CB   . SER A 1 30  ? 11.643  7.118   -0.150  1.00 0.00 ? 30  SER A CB   1  
ATOM 502   O OG   . SER A 1 30  ? 11.896  8.068   0.875   1.00 0.00 ? 30  SER A OG   1  
ATOM 503   H H    . SER A 1 30  ? 8.875   7.189   0.178   1.00 0.00 ? 30  SER A H    1  
ATOM 504   H HA   . SER A 1 30  ? 10.873  8.637   -1.472  1.00 0.00 ? 30  SER A HA   1  
ATOM 505   H HB2  . SER A 1 30  ? 11.240  6.165   0.310   1.00 0.00 ? 30  SER A HB2  1  
ATOM 506   H HB3  . SER A 1 30  ? 12.627  6.939   -0.648  1.00 0.00 ? 30  SER A HB3  1  
ATOM 507   H HG   . SER A 1 30  ? 11.259  7.805   1.572   1.00 0.00 ? 30  SER A HG   1  
ATOM 508   N N    . HIS A 1 31  ? 10.054  5.513   -2.195  1.00 0.00 ? 31  HIS A N    1  
ATOM 509   C CA   . HIS A 1 31  ? 9.883   4.500   -3.232  1.00 0.00 ? 31  HIS A CA   1  
ATOM 510   C C    . HIS A 1 31  ? 8.925   5.048   -4.297  1.00 0.00 ? 31  HIS A C    1  
ATOM 511   O O    . HIS A 1 31  ? 9.123   4.808   -5.474  1.00 0.00 ? 31  HIS A O    1  
ATOM 512   C CB   . HIS A 1 31  ? 9.294   3.171   -2.649  1.00 0.00 ? 31  HIS A CB   1  
ATOM 513   C CG   . HIS A 1 31  ? 10.123  2.132   -1.919  1.00 0.00 ? 31  HIS A CG   1  
ATOM 514   N ND1  . HIS A 1 31  ? 9.837   0.805   -2.160  1.00 0.00 ? 31  HIS A ND1  1  
ATOM 515   C CD2  . HIS A 1 31  ? 10.723  2.146   -0.691  1.00 0.00 ? 31  HIS A CD2  1  
ATOM 516   C CE1  . HIS A 1 31  ? 10.236  0.093   -1.080  1.00 0.00 ? 31  HIS A CE1  1  
ATOM 517   N NE2  . HIS A 1 31  ? 10.785  0.863   -0.161  1.00 0.00 ? 31  HIS A NE2  1  
ATOM 518   H H    . HIS A 1 31  ? 9.688   5.168   -1.334  1.00 0.00 ? 31  HIS A H    1  
ATOM 519   H HA   . HIS A 1 31  ? 10.834  4.307   -3.712  1.00 0.00 ? 31  HIS A HA   1  
ATOM 520   H HB2  . HIS A 1 31  ? 8.558   3.449   -1.867  1.00 0.00 ? 31  HIS A HB2  1  
ATOM 521   H HB3  . HIS A 1 31  ? 8.715   2.592   -3.408  1.00 0.00 ? 31  HIS A HB3  1  
ATOM 522   H HD1  . HIS A 1 31  ? 9.331   0.453   -2.947  1.00 0.00 ? 31  HIS A HD1  1  
ATOM 523   H HD2  . HIS A 1 31  ? 11.054  2.980   -0.086  1.00 0.00 ? 31  HIS A HD2  1  
ATOM 524   H HE1  . HIS A 1 31  ? 9.967   -0.959  -0.960  1.00 0.00 ? 31  HIS A HE1  1  
ATOM 525   N N    . ASN A 1 32  ? 7.925   5.890   -3.886  1.00 0.00 ? 32  ASN A N    1  
ATOM 526   C CA   . ASN A 1 32  ? 6.966   6.607   -4.723  1.00 0.00 ? 32  ASN A CA   1  
ATOM 527   C C    . ASN A 1 32  ? 7.492   7.513   -5.823  1.00 0.00 ? 32  ASN A C    1  
ATOM 528   O O    . ASN A 1 32  ? 6.956   7.471   -6.926  1.00 0.00 ? 32  ASN A O    1  
ATOM 529   C CB   . ASN A 1 32  ? 5.992   7.473   -3.859  1.00 0.00 ? 32  ASN A CB   1  
ATOM 530   C CG   . ASN A 1 32  ? 4.674   6.740   -3.683  1.00 0.00 ? 32  ASN A CG   1  
ATOM 531   O OD1  . ASN A 1 32  ? 3.705   7.066   -4.364  1.00 0.00 ? 32  ASN A OD1  1  
ATOM 532   N ND2  . ASN A 1 32  ? 4.643   5.714   -2.810  1.00 0.00 ? 32  ASN A ND2  1  
ATOM 533   H H    . ASN A 1 32  ? 7.839   6.079   -2.908  1.00 0.00 ? 32  ASN A H    1  
ATOM 534   H HA   . ASN A 1 32  ? 6.471   5.826   -5.290  1.00 0.00 ? 32  ASN A HA   1  
ATOM 535   H HB2  . ASN A 1 32  ? 6.443   7.709   -2.875  1.00 0.00 ? 32  ASN A HB2  1  
ATOM 536   H HB3  . ASN A 1 32  ? 5.701   8.452   -4.304  1.00 0.00 ? 32  ASN A HB3  1  
ATOM 537   H HD21 . ASN A 1 32  ? 5.509   5.574   -2.257  1.00 0.00 ? 32  ASN A HD21 1  
ATOM 538   H HD22 . ASN A 1 32  ? 3.745   5.215   -2.698  1.00 0.00 ? 32  ASN A HD22 1  
ATOM 539   N N    . GLU A 1 33  ? 8.555   8.336   -5.589  1.00 0.00 ? 33  GLU A N    1  
ATOM 540   C CA   . GLU A 1 33  ? 9.116   9.299   -6.551  1.00 0.00 ? 33  GLU A CA   1  
ATOM 541   C C    . GLU A 1 33  ? 9.784   8.655   -7.774  1.00 0.00 ? 33  GLU A C    1  
ATOM 542   O O    . GLU A 1 33  ? 9.624   9.079   -8.917  1.00 0.00 ? 33  GLU A O    1  
ATOM 543   C CB   . GLU A 1 33  ? 9.968   10.374  -5.819  1.00 0.00 ? 33  GLU A CB   1  
ATOM 544   C CG   . GLU A 1 33  ? 11.345  9.944   -5.275  1.00 0.00 ? 33  GLU A CG   1  
ATOM 545   C CD   . GLU A 1 33  ? 12.465  10.122  -6.303  1.00 0.00 ? 33  GLU A CD   1  
ATOM 546   O OE1  . GLU A 1 33  ? 12.651  11.272  -6.785  1.00 0.00 ? 33  GLU A OE1  1  
ATOM 547   O OE2  . GLU A 1 33  ? 13.157  9.115   -6.611  1.00 0.00 ? 33  GLU A OE2  1  
ATOM 548   H H    . GLU A 1 33  ? 8.993   8.342   -4.689  1.00 0.00 ? 33  GLU A H    1  
ATOM 549   H HA   . GLU A 1 33  ? 8.283   9.854   -6.949  1.00 0.00 ? 33  GLU A HA   1  
ATOM 550   H HB2  . GLU A 1 33  ? 10.066  11.283  -6.447  1.00 0.00 ? 33  GLU A HB2  1  
ATOM 551   H HB3  . GLU A 1 33  ? 9.377   10.660  -4.912  1.00 0.00 ? 33  GLU A HB3  1  
ATOM 552   H HG2  . GLU A 1 33  ? 11.592  10.559  -4.382  1.00 0.00 ? 33  GLU A HG2  1  
ATOM 553   H HG3  . GLU A 1 33  ? 11.269  8.888   -4.965  1.00 0.00 ? 33  GLU A HG3  1  
ATOM 554   N N    . ALA A 1 34  ? 10.479  7.520   -7.504  1.00 0.00 ? 34  ALA A N    1  
ATOM 555   C CA   . ALA A 1 34  ? 11.052  6.563   -8.438  1.00 0.00 ? 34  ALA A CA   1  
ATOM 556   C C    . ALA A 1 34  ? 10.001  5.697   -9.122  1.00 0.00 ? 34  ALA A C    1  
ATOM 557   O O    . ALA A 1 34  ? 10.197  5.121   -10.192 1.00 0.00 ? 34  ALA A O    1  
ATOM 558   C CB   . ALA A 1 34  ? 12.087  5.690   -7.716  1.00 0.00 ? 34  ALA A CB   1  
ATOM 559   H H    . ALA A 1 34  ? 10.547  7.233   -6.545  1.00 0.00 ? 34  ALA A H    1  
ATOM 560   H HA   . ALA A 1 34  ? 11.540  7.105   -9.242  1.00 0.00 ? 34  ALA A HA   1  
ATOM 561   H HB1  . ALA A 1 34  ? 12.903  6.332   -7.326  1.00 0.00 ? 34  ALA A HB1  1  
ATOM 562   H HB2  . ALA A 1 34  ? 12.525  4.952   -8.424  1.00 0.00 ? 34  ALA A HB2  1  
ATOM 563   H HB3  . ALA A 1 34  ? 11.612  5.156   -6.867  1.00 0.00 ? 34  ALA A HB3  1  
ATOM 564   N N    . CYS A 1 35  ? 8.848   5.519   -8.435  1.00 0.00 ? 35  CYS A N    1  
ATOM 565   C CA   . CYS A 1 35  ? 7.728   4.689   -8.857  1.00 0.00 ? 35  CYS A CA   1  
ATOM 566   C C    . CYS A 1 35  ? 6.829   5.272   -9.922  1.00 0.00 ? 35  CYS A C    1  
ATOM 567   O O    . CYS A 1 35  ? 6.425   4.530   -10.803 1.00 0.00 ? 35  CYS A O    1  
ATOM 568   C CB   . CYS A 1 35  ? 6.931   4.222   -7.626  1.00 0.00 ? 35  CYS A CB   1  
ATOM 569   S SG   . CYS A 1 35  ? 6.036   2.693   -7.849  1.00 0.00 ? 35  CYS A SG   1  
ATOM 570   H H    . CYS A 1 35  ? 8.746   5.981   -7.549  1.00 0.00 ? 35  CYS A H    1  
ATOM 571   H HA   . CYS A 1 35  ? 8.128   3.804   -9.327  1.00 0.00 ? 35  CYS A HA   1  
ATOM 572   H HB2  . CYS A 1 35  ? 7.691   3.952   -6.857  1.00 0.00 ? 35  CYS A HB2  1  
ATOM 573   H HB3  . CYS A 1 35  ? 6.252   5.040   -7.264  1.00 0.00 ? 35  CYS A HB3  1  
ATOM 574   H HG   . CYS A 1 35  ? 5.966   2.417   -6.552  1.00 0.00 ? 35  CYS A HG   1  
ATOM 575   N N    . GLN A 1 36  ? 6.538   6.601   -9.885  1.00 0.00 ? 36  GLN A N    1  
ATOM 576   C CA   . GLN A 1 36  ? 5.716   7.370   -10.843 1.00 0.00 ? 36  GLN A CA   1  
ATOM 577   C C    . GLN A 1 36  ? 6.373   7.569   -12.215 1.00 0.00 ? 36  GLN A C    1  
ATOM 578   O O    . GLN A 1 36  ? 5.791   7.975   -13.212 1.00 0.00 ? 36  GLN A O    1  
ATOM 579   C CB   . GLN A 1 36  ? 5.180   8.690   -10.202 1.00 0.00 ? 36  GLN A CB   1  
ATOM 580   C CG   . GLN A 1 36  ? 6.199   9.791   -9.809  1.00 0.00 ? 36  GLN A CG   1  
ATOM 581   C CD   . GLN A 1 36  ? 6.662   10.660  -10.985 1.00 0.00 ? 36  GLN A CD   1  
ATOM 582   O OE1  . GLN A 1 36  ? 5.948   11.535  -11.479 1.00 0.00 ? 36  GLN A OE1  1  
ATOM 583   N NE2  . GLN A 1 36  ? 7.937   10.455  -11.397 1.00 0.00 ? 36  GLN A NE2  1  
ATOM 584   H H    . GLN A 1 36  ? 6.891   7.137   -9.111  1.00 0.00 ? 36  GLN A H    1  
ATOM 585   H HA   . GLN A 1 36  ? 4.833   6.779   -11.052 1.00 0.00 ? 36  GLN A HA   1  
ATOM 586   H HB2  . GLN A 1 36  ? 4.395   9.132   -10.853 1.00 0.00 ? 36  GLN A HB2  1  
ATOM 587   H HB3  . GLN A 1 36  ? 4.675   8.397   -9.252  1.00 0.00 ? 36  GLN A HB3  1  
ATOM 588   H HG2  . GLN A 1 36  ? 5.704   10.481  -9.089  1.00 0.00 ? 36  GLN A HG2  1  
ATOM 589   H HG3  . GLN A 1 36  ? 7.070   9.334   -9.304  1.00 0.00 ? 36  GLN A HG3  1  
ATOM 590   H HE21 . GLN A 1 36  ? 8.537   9.849   -10.875 1.00 0.00 ? 36  GLN A HE21 1  
ATOM 591   H HE22 . GLN A 1 36  ? 8.159   10.778  -12.311 1.00 0.00 ? 36  GLN A HE22 1  
ATOM 592   N N    . GLU A 1 37  ? 7.684   7.264   -12.234 1.00 0.00 ? 37  GLU A N    1  
ATOM 593   C CA   . GLU A 1 37  ? 8.626   7.318   -13.364 1.00 0.00 ? 37  GLU A CA   1  
ATOM 594   C C    . GLU A 1 37  ? 8.529   6.108   -14.280 1.00 0.00 ? 37  GLU A C    1  
ATOM 595   O O    . GLU A 1 37  ? 8.688   6.127   -15.502 1.00 0.00 ? 37  GLU A O    1  
ATOM 596   C CB   . GLU A 1 37  ? 10.033  7.247   -12.711 1.00 0.00 ? 37  GLU A CB   1  
ATOM 597   C CG   . GLU A 1 37  ? 11.261  6.764   -13.524 1.00 0.00 ? 37  GLU A CG   1  
ATOM 598   C CD   . GLU A 1 37  ? 11.645  7.772   -14.599 1.00 0.00 ? 37  GLU A CD   1  
ATOM 599   O OE1  . GLU A 1 37  ? 11.969  8.935   -14.233 1.00 0.00 ? 37  GLU A OE1  1  
ATOM 600   O OE2  . GLU A 1 37  ? 11.624  7.398   -15.802 1.00 0.00 ? 37  GLU A OE2  1  
ATOM 601   H H    . GLU A 1 37  ? 7.981   6.909   -11.326 1.00 0.00 ? 37  GLU A H    1  
ATOM 602   H HA   . GLU A 1 37  ? 8.483   8.218   -13.949 1.00 0.00 ? 37  GLU A HA   1  
ATOM 603   H HB2  . GLU A 1 37  ? 10.223  8.213   -12.222 1.00 0.00 ? 37  GLU A HB2  1  
ATOM 604   H HB3  . GLU A 1 37  ? 9.961   6.509   -11.891 1.00 0.00 ? 37  GLU A HB3  1  
ATOM 605   H HG2  . GLU A 1 37  ? 12.095  6.619   -12.807 1.00 0.00 ? 37  GLU A HG2  1  
ATOM 606   H HG3  . GLU A 1 37  ? 11.068  5.753   -13.960 1.00 0.00 ? 37  GLU A HG3  1  
ATOM 607   N N    . ASN A 1 38  ? 8.352   4.993   -13.550 1.00 0.00 ? 38  ASN A N    1  
ATOM 608   C CA   . ASN A 1 38  ? 8.289   3.616   -13.924 1.00 0.00 ? 38  ASN A CA   1  
ATOM 609   C C    . ASN A 1 38  ? 6.833   3.285   -13.809 1.00 0.00 ? 38  ASN A C    1  
ATOM 610   O O    . ASN A 1 38  ? 6.012   4.139   -13.490 1.00 0.00 ? 38  ASN A O    1  
ATOM 611   C CB   . ASN A 1 38  ? 9.134   2.801   -12.915 1.00 0.00 ? 38  ASN A CB   1  
ATOM 612   C CG   . ASN A 1 38  ? 10.601  3.083   -13.196 1.00 0.00 ? 38  ASN A CG   1  
ATOM 613   O OD1  . ASN A 1 38  ? 11.101  2.788   -14.283 1.00 0.00 ? 38  ASN A OD1  1  
ATOM 614   N ND2  . ASN A 1 38  ? 11.331  3.653   -12.204 1.00 0.00 ? 38  ASN A ND2  1  
ATOM 615   H H    . ASN A 1 38  ? 8.212   5.114   -12.564 1.00 0.00 ? 38  ASN A H    1  
ATOM 616   H HA   . ASN A 1 38  ? 8.593   3.468   -14.953 1.00 0.00 ? 38  ASN A HA   1  
ATOM 617   H HB2  . ASN A 1 38  ? 8.911   3.122   -11.874 1.00 0.00 ? 38  ASN A HB2  1  
ATOM 618   H HB3  . ASN A 1 38  ? 8.980   1.706   -13.021 1.00 0.00 ? 38  ASN A HB3  1  
ATOM 619   H HD21 . ASN A 1 38  ? 10.877  4.127   -11.431 1.00 0.00 ? 38  ASN A HD21 1  
ATOM 620   H HD22 . ASN A 1 38  ? 12.304  3.760   -12.385 1.00 0.00 ? 38  ASN A HD22 1  
ATOM 621   N N    . LYS A 1 39  ? 6.424   2.027   -14.063 1.00 0.00 ? 39  LYS A N    1  
ATOM 622   C CA   . LYS A 1 39  ? 5.034   1.614   -13.949 1.00 0.00 ? 39  LYS A CA   1  
ATOM 623   C C    . LYS A 1 39  ? 4.545   1.559   -12.497 1.00 0.00 ? 39  LYS A C    1  
ATOM 624   O O    . LYS A 1 39  ? 3.712   2.345   -12.059 1.00 0.00 ? 39  LYS A O    1  
ATOM 625   C CB   . LYS A 1 39  ? 4.768   0.334   -14.811 1.00 0.00 ? 39  LYS A CB   1  
ATOM 626   C CG   . LYS A 1 39  ? 5.501   -0.978  -14.429 1.00 0.00 ? 39  LYS A CG   1  
ATOM 627   C CD   . LYS A 1 39  ? 4.614   -1.893  -13.568 1.00 0.00 ? 39  LYS A CD   1  
ATOM 628   C CE   . LYS A 1 39  ? 3.665   -2.775  -14.389 1.00 0.00 ? 39  LYS A CE   1  
ATOM 629   N NZ   . LYS A 1 39  ? 2.814   -3.602  -13.503 1.00 0.00 ? 39  LYS A NZ   1  
ATOM 630   H H    . LYS A 1 39  ? 7.088   1.347   -14.331 1.00 0.00 ? 39  LYS A H    1  
ATOM 631   H HA   . LYS A 1 39  ? 4.459   2.421   -14.370 1.00 0.00 ? 39  LYS A HA   1  
ATOM 632   H HB2  . LYS A 1 39  ? 3.673   0.146   -14.867 1.00 0.00 ? 39  LYS A HB2  1  
ATOM 633   H HB3  . LYS A 1 39  ? 5.092   0.586   -15.847 1.00 0.00 ? 39  LYS A HB3  1  
ATOM 634   H HG2  . LYS A 1 39  ? 5.775   -1.533  -15.354 1.00 0.00 ? 39  LYS A HG2  1  
ATOM 635   H HG3  . LYS A 1 39  ? 6.444   -0.750  -13.888 1.00 0.00 ? 39  LYS A HG3  1  
ATOM 636   H HD2  . LYS A 1 39  ? 5.199   -2.522  -12.857 1.00 0.00 ? 39  LYS A HD2  1  
ATOM 637   H HD3  . LYS A 1 39  ? 4.023   -1.181  -12.958 1.00 0.00 ? 39  LYS A HD3  1  
ATOM 638   H HE2  . LYS A 1 39  ? 2.992   -2.151  -15.014 1.00 0.00 ? 39  LYS A HE2  1  
ATOM 639   H HE3  . LYS A 1 39  ? 4.243   -3.459  -15.043 1.00 0.00 ? 39  LYS A HE3  1  
ATOM 640   H HZ1  . LYS A 1 39  ? 2.253   -2.982  -12.885 1.00 0.00 ? 39  LYS A HZ1  1  
ATOM 641   H HZ2  . LYS A 1 39  ? 2.176   -4.186  -14.081 1.00 0.00 ? 39  LYS A HZ2  1  
ATOM 642   H HZ3  . LYS A 1 39  ? 3.416   -4.218  -12.920 1.00 0.00 ? 39  LYS A HZ3  1  
ATOM 643   N N    . ASP A 1 40  ? 5.084   0.621   -11.706 1.00 0.00 ? 40  ASP A N    1  
ATOM 644   C CA   . ASP A 1 40  ? 5.007   0.549   -10.290 1.00 0.00 ? 40  ASP A CA   1  
ATOM 645   C C    . ASP A 1 40  ? 6.301   -0.203  -10.054 1.00 0.00 ? 40  ASP A C    1  
ATOM 646   O O    . ASP A 1 40  ? 6.404   -1.304  -10.574 1.00 0.00 ? 40  ASP A O    1  
ATOM 647   C CB   . ASP A 1 40  ? 3.731   -0.092  -9.648  1.00 0.00 ? 40  ASP A CB   1  
ATOM 648   C CG   . ASP A 1 40  ? 2.987   -1.109  -10.518 1.00 0.00 ? 40  ASP A CG   1  
ATOM 649   O OD1  . ASP A 1 40  ? 3.355   -2.310  -10.473 1.00 0.00 ? 40  ASP A OD1  1  
ATOM 650   O OD2  . ASP A 1 40  ? 2.025   -0.697  -11.221 1.00 0.00 ? 40  ASP A OD2  1  
ATOM 651   H H    . ASP A 1 40  ? 5.792   -0.001  -12.030 1.00 0.00 ? 40  ASP A H    1  
ATOM 652   H HA   . ASP A 1 40  ? 5.090   1.551   -9.911  1.00 0.00 ? 40  ASP A HA   1  
ATOM 653   H HB2  . ASP A 1 40  ? 3.970   -0.563  -8.673  1.00 0.00 ? 40  ASP A HB2  1  
ATOM 654   H HB3  . ASP A 1 40  ? 3.023   0.742   -9.439  1.00 0.00 ? 40  ASP A HB3  1  
ATOM 655   N N    . LEU A 1 41  ? 7.333   0.275   -9.325  1.00 0.00 ? 41  LEU A N    1  
ATOM 656   C CA   . LEU A 1 41  ? 8.556   -0.501  -9.031  1.00 0.00 ? 41  LEU A CA   1  
ATOM 657   C C    . LEU A 1 41  ? 8.396   -1.709  -8.081  1.00 0.00 ? 41  LEU A C    1  
ATOM 658   O O    . LEU A 1 41  ? 9.208   -2.629  -8.084  1.00 0.00 ? 41  LEU A O    1  
ATOM 659   C CB   . LEU A 1 41  ? 9.770   0.372   -8.672  1.00 0.00 ? 41  LEU A CB   1  
ATOM 660   C CG   . LEU A 1 41  ? 9.575   1.290   -7.462  1.00 0.00 ? 41  LEU A CG   1  
ATOM 661   C CD1  . LEU A 1 41  ? 10.106  0.694   -6.155  1.00 0.00 ? 41  LEU A CD1  1  
ATOM 662   C CD2  . LEU A 1 41  ? 10.267  2.607   -7.775  1.00 0.00 ? 41  LEU A CD2  1  
ATOM 663   H H    . LEU A 1 41  ? 7.261   1.217   -9.020  1.00 0.00 ? 41  LEU A H    1  
ATOM 664   H HA   . LEU A 1 41  ? 8.915   -0.900  -9.957  1.00 0.00 ? 41  LEU A HA   1  
ATOM 665   H HB2  . LEU A 1 41  ? 10.690  -0.256  -8.520  1.00 0.00 ? 41  LEU A HB2  1  
ATOM 666   H HB3  . LEU A 1 41  ? 9.921   1.028   -9.575  1.00 0.00 ? 41  LEU A HB3  1  
ATOM 667   H HG   . LEU A 1 41  ? 8.491   1.503   -7.339  1.00 0.00 ? 41  LEU A HG   1  
ATOM 668   H HD11 . LEU A 1 41  ? 9.645   -0.301  -5.979  1.00 0.00 ? 41  LEU A HD11 1  
ATOM 669   H HD12 . LEU A 1 41  ? 11.204  0.553   -6.232  1.00 0.00 ? 41  LEU A HD12 1  
ATOM 670   H HD13 . LEU A 1 41  ? 9.883   1.364   -5.298  1.00 0.00 ? 41  LEU A HD13 1  
ATOM 671   H HD21 . LEU A 1 41  ? 10.035  2.898   -8.828  1.00 0.00 ? 41  LEU A HD21 1  
ATOM 672   H HD22 . LEU A 1 41  ? 9.882   3.402   -7.100  1.00 0.00 ? 41  LEU A HD22 1  
ATOM 673   H HD23 . LEU A 1 41  ? 11.366  2.510   -7.699  1.00 0.00 ? 41  LEU A HD23 1  
ATOM 674   N N    . GLN A 1 42  ? 7.309   -1.735  -7.268  1.00 0.00 ? 42  GLN A N    1  
ATOM 675   C CA   . GLN A 1 42  ? 6.809   -2.715  -6.327  1.00 0.00 ? 42  GLN A CA   1  
ATOM 676   C C    . GLN A 1 42  ? 5.653   -3.637  -6.698  1.00 0.00 ? 42  GLN A C    1  
ATOM 677   O O    . GLN A 1 42  ? 4.898   -3.787  -5.736  1.00 0.00 ? 42  GLN A O    1  
ATOM 678   C CB   . GLN A 1 42  ? 6.911   -2.354  -4.819  1.00 0.00 ? 42  GLN A CB   1  
ATOM 679   C CG   . GLN A 1 42  ? 8.109   -3.050  -4.117  1.00 0.00 ? 42  GLN A CG   1  
ATOM 680   C CD   . GLN A 1 42  ? 8.064   -4.584  -4.015  1.00 0.00 ? 42  GLN A CD   1  
ATOM 681   O OE1  . GLN A 1 42  ? 9.081   -5.222  -3.749  1.00 0.00 ? 42  GLN A OE1  1  
ATOM 682   N NE2  . GLN A 1 42  ? 6.880   -5.192  -4.220  1.00 0.00 ? 42  GLN A NE2  1  
ATOM 683   H H    . GLN A 1 42  ? 6.672   -0.982  -7.322  1.00 0.00 ? 42  GLN A H    1  
ATOM 684   H HA   . GLN A 1 42  ? 7.590   -3.465  -6.362  1.00 0.00 ? 42  GLN A HA   1  
ATOM 685   H HB2  . GLN A 1 42  ? 7.023   -1.252  -4.735  1.00 0.00 ? 42  GLN A HB2  1  
ATOM 686   H HB3  . GLN A 1 42  ? 6.004   -2.589  -4.225  1.00 0.00 ? 42  GLN A HB3  1  
ATOM 687   H HG2  . GLN A 1 42  ? 9.027   -2.816  -4.689  1.00 0.00 ? 42  GLN A HG2  1  
ATOM 688   H HG3  . GLN A 1 42  ? 8.191   -2.674  -3.079  1.00 0.00 ? 42  GLN A HG3  1  
ATOM 689   H HE21 . GLN A 1 42  ? 6.108   -4.651  -4.562  1.00 0.00 ? 42  GLN A HE21 1  
ATOM 690   H HE22 . GLN A 1 42  ? 6.811   -6.190  -4.124  1.00 0.00 ? 42  GLN A HE22 1  
ATOM 691   N N    . PRO A 1 43  ? 5.307   -4.249  -7.872  1.00 0.00 ? 43  PRO A N    1  
ATOM 692   C CA   . PRO A 1 43  ? 4.004   -4.867  -8.207  1.00 0.00 ? 43  PRO A CA   1  
ATOM 693   C C    . PRO A 1 43  ? 3.241   -5.710  -7.146  1.00 0.00 ? 43  PRO A C    1  
ATOM 694   O O    . PRO A 1 43  ? 2.016   -5.682  -7.191  1.00 0.00 ? 43  PRO A O    1  
ATOM 695   C CB   . PRO A 1 43  ? 4.341   -5.743  -9.426  1.00 0.00 ? 43  PRO A CB   1  
ATOM 696   C CG   . PRO A 1 43  ? 5.421   -4.954  -10.164 1.00 0.00 ? 43  PRO A CG   1  
ATOM 697   C CD   . PRO A 1 43  ? 6.203   -4.288  -9.026  1.00 0.00 ? 43  PRO A CD   1  
ATOM 698   H HA   . PRO A 1 43  ? 3.358   -4.054  -8.530  1.00 0.00 ? 43  PRO A HA   1  
ATOM 699   H HB2  . PRO A 1 43  ? 4.770   -6.725  -9.121  1.00 0.00 ? 43  PRO A HB2  1  
ATOM 700   H HB3  . PRO A 1 43  ? 3.450   -5.913  -10.067 1.00 0.00 ? 43  PRO A HB3  1  
ATOM 701   H HG2  . PRO A 1 43  ? 6.058   -5.601  -10.803 1.00 0.00 ? 43  PRO A HG2  1  
ATOM 702   H HG3  . PRO A 1 43  ? 4.941   -4.177  -10.797 1.00 0.00 ? 43  PRO A HG3  1  
ATOM 703   H HD2  . PRO A 1 43  ? 7.099   -4.901  -8.774  1.00 0.00 ? 43  PRO A HD2  1  
ATOM 704   H HD3  . PRO A 1 43  ? 6.521   -3.272  -9.333  1.00 0.00 ? 43  PRO A HD3  1  
ATOM 705   N N    . TYR A 1 44  ? 3.924   -6.375  -6.169  1.00 0.00 ? 44  TYR A N    1  
ATOM 706   C CA   . TYR A 1 44  ? 3.314   -7.053  -5.034  1.00 0.00 ? 44  TYR A CA   1  
ATOM 707   C C    . TYR A 1 44  ? 4.423   -7.273  -3.992  1.00 0.00 ? 44  TYR A C    1  
ATOM 708   O O    . TYR A 1 44  ? 5.533   -7.687  -4.332  1.00 0.00 ? 44  TYR A O    1  
ATOM 709   C CB   . TYR A 1 44  ? 2.722   -8.479  -5.340  1.00 0.00 ? 44  TYR A CB   1  
ATOM 710   C CG   . TYR A 1 44  ? 1.418   -8.482  -6.145  1.00 0.00 ? 44  TYR A CG   1  
ATOM 711   C CD1  . TYR A 1 44  ? 0.177   -8.371  -5.516  1.00 0.00 ? 44  TYR A CD1  1  
ATOM 712   C CD2  . TYR A 1 44  ? 1.413   -8.655  -7.528  1.00 0.00 ? 44  TYR A CD2  1  
ATOM 713   C CE1  . TYR A 1 44  ? -1.006  -8.552  -6.216  1.00 0.00 ? 44  TYR A CE1  1  
ATOM 714   C CE2  . TYR A 1 44  ? 0.228   -8.779  -8.231  1.00 0.00 ? 44  TYR A CE2  1  
ATOM 715   C CZ   . TYR A 1 44  ? -0.984  -8.763  -7.580  1.00 0.00 ? 44  TYR A CZ   1  
ATOM 716   O OH   . TYR A 1 44  ? -2.163  -8.966  -8.338  1.00 0.00 ? 44  TYR A OH   1  
ATOM 717   H H    . TYR A 1 44  ? 4.917   -6.283  -6.130  1.00 0.00 ? 44  TYR A H    1  
ATOM 718   H HA   . TYR A 1 44  ? 2.571   -6.377  -4.617  1.00 0.00 ? 44  TYR A HA   1  
ATOM 719   H HB2  . TYR A 1 44  ? 3.492   -9.089  -5.865  1.00 0.00 ? 44  TYR A HB2  1  
ATOM 720   H HB3  . TYR A 1 44  ? 2.522   -9.049  -4.402  1.00 0.00 ? 44  TYR A HB3  1  
ATOM 721   H HD1  . TYR A 1 44  ? 0.098   -8.167  -4.454  1.00 0.00 ? 44  TYR A HD1  1  
ATOM 722   H HD2  . TYR A 1 44  ? 2.336   -8.675  -8.096  1.00 0.00 ? 44  TYR A HD2  1  
ATOM 723   H HE1  . TYR A 1 44  ? -1.941  -8.537  -5.671  1.00 0.00 ? 44  TYR A HE1  1  
ATOM 724   H HE2  . TYR A 1 44  ? 0.253   -8.917  -9.304  1.00 0.00 ? 44  TYR A HE2  1  
ATOM 725   H HH   . TYR A 1 44  ? -2.886  -9.185  -7.746  1.00 0.00 ? 44  TYR A HH   1  
ATOM 726   N N    . MET A 1 45  ? 4.120   -7.043  -2.686  1.00 0.00 ? 45  MET A N    1  
ATOM 727   C CA   . MET A 1 45  ? 4.979   -7.278  -1.522  1.00 0.00 ? 45  MET A CA   1  
ATOM 728   C C    . MET A 1 45  ? 4.102   -7.741  -0.344  1.00 0.00 ? 45  MET A C    1  
ATOM 729   O O    . MET A 1 45  ? 2.900   -7.480  -0.377  1.00 0.00 ? 45  MET A O    1  
ATOM 730   C CB   . MET A 1 45  ? 5.862   -6.051  -1.105  1.00 0.00 ? 45  MET A CB   1  
ATOM 731   C CG   . MET A 1 45  ? 5.341   -4.609  -1.330  1.00 0.00 ? 45  MET A CG   1  
ATOM 732   S SD   . MET A 1 45  ? 4.805   -3.735  0.176   1.00 0.00 ? 45  MET A SD   1  
ATOM 733   C CE   . MET A 1 45  ? 5.449   -2.091  -0.261  1.00 0.00 ? 45  MET A CE   1  
ATOM 734   H H    . MET A 1 45  ? 3.218   -6.686  -2.445  1.00 0.00 ? 45  MET A H    1  
ATOM 735   H HA   . MET A 1 45  ? 5.642   -8.103  -1.756  1.00 0.00 ? 45  MET A HA   1  
ATOM 736   H HB2  . MET A 1 45  ? 6.142   -6.126  -0.042  1.00 0.00 ? 45  MET A HB2  1  
ATOM 737   H HB3  . MET A 1 45  ? 6.833   -6.142  -1.639  1.00 0.00 ? 45  MET A HB3  1  
ATOM 738   H HG2  . MET A 1 45  ? 6.196   -4.041  -1.768  1.00 0.00 ? 45  MET A HG2  1  
ATOM 739   H HG3  . MET A 1 45  ? 4.533   -4.601  -2.088  1.00 0.00 ? 45  MET A HG3  1  
ATOM 740   H HE1  . MET A 1 45  ? 6.549   -2.105  -0.443  1.00 0.00 ? 45  MET A HE1  1  
ATOM 741   H HE2  . MET A 1 45  ? 4.973   -1.700  -1.184  1.00 0.00 ? 45  MET A HE2  1  
ATOM 742   H HE3  . MET A 1 45  ? 5.278   -1.332  0.541   1.00 0.00 ? 45  MET A HE3  1  
ATOM 743   N N    . PRO A 1 46  ? 4.586   -8.448  0.722   1.00 0.00 ? 46  PRO A N    1  
ATOM 744   C CA   . PRO A 1 46  ? 3.783   -8.841  1.895   1.00 0.00 ? 46  PRO A CA   1  
ATOM 745   C C    . PRO A 1 46  ? 3.575   -7.672  2.874   1.00 0.00 ? 46  PRO A C    1  
ATOM 746   O O    . PRO A 1 46  ? 4.137   -6.595  2.685   1.00 0.00 ? 46  PRO A O    1  
ATOM 747   C CB   . PRO A 1 46  ? 4.688   -9.911  2.561   1.00 0.00 ? 46  PRO A CB   1  
ATOM 748   C CG   . PRO A 1 46  ? 6.116   -9.420  2.292   1.00 0.00 ? 46  PRO A CG   1  
ATOM 749   C CD   . PRO A 1 46  ? 5.976   -8.922  0.843   1.00 0.00 ? 46  PRO A CD   1  
ATOM 750   H HA   . PRO A 1 46  ? 2.809   -9.228  1.609   1.00 0.00 ? 46  PRO A HA   1  
ATOM 751   H HB2  . PRO A 1 46  ? 4.493   -10.091 3.636   1.00 0.00 ? 46  PRO A HB2  1  
ATOM 752   H HB3  . PRO A 1 46  ? 4.547   -10.876 2.023   1.00 0.00 ? 46  PRO A HB3  1  
ATOM 753   H HG2  . PRO A 1 46  ? 6.391   -8.601  3.004   1.00 0.00 ? 46  PRO A HG2  1  
ATOM 754   H HG3  . PRO A 1 46  ? 6.881   -10.211 2.406   1.00 0.00 ? 46  PRO A HG3  1  
ATOM 755   H HD2  . PRO A 1 46  ? 6.723   -8.085  0.677   1.00 0.00 ? 46  PRO A HD2  1  
ATOM 756   H HD3  . PRO A 1 46  ? 6.078   -9.839  0.171   1.00 0.00 ? 46  PRO A HD3  1  
ATOM 757   N N    . ILE A 1 47  ? 2.824   -7.886  3.994   1.00 0.00 ? 47  ILE A N    1  
ATOM 758   C CA   . ILE A 1 47  ? 2.585   -6.958  5.118   1.00 0.00 ? 47  ILE A CA   1  
ATOM 759   C C    . ILE A 1 47  ? 3.917   -6.662  5.851   1.00 0.00 ? 47  ILE A C    1  
ATOM 760   O O    . ILE A 1 47  ? 4.286   -5.495  5.988   1.00 0.00 ? 47  ILE A O    1  
ATOM 761   C CB   . ILE A 1 47  ? 1.428   -7.449  5.992   1.00 0.00 ? 47  ILE A CB   1  
ATOM 762   C CG1  . ILE A 1 47  ? 0.144   -7.711  5.163   1.00 0.00 ? 47  ILE A CG1  1  
ATOM 763   C CG2  . ILE A 1 47  ? 1.148   -6.487  7.165   1.00 0.00 ? 47  ILE A CG2  1  
ATOM 764   C CD1  . ILE A 1 47  ? -0.585  -6.448  4.684   1.00 0.00 ? 47  ILE A CD1  1  
ATOM 765   H H    . ILE A 1 47  ? 2.391   -8.774  4.110   1.00 0.00 ? 47  ILE A H    1  
ATOM 766   H HA   . ILE A 1 47  ? 2.271   -6.018  4.694   1.00 0.00 ? 47  ILE A HA   1  
ATOM 767   H HB   . ILE A 1 47  ? 1.687   -8.443  6.423   1.00 0.00 ? 47  ILE A HB   1  
ATOM 768   H HG12 . ILE A 1 47  ? 0.423   -8.293  4.212   1.00 0.00 ? 47  ILE A HG12 1  
ATOM 769   H HG13 . ILE A 1 47  ? -0.546  -8.257  5.905   1.00 0.00 ? 47  ILE A HG13 1  
ATOM 770   H HG21 . ILE A 1 47  ? 1.001   -5.449  6.800   1.00 0.00 ? 47  ILE A HG21 1  
ATOM 771   H HG22 . ILE A 1 47  ? 0.230   -6.799  7.710   1.00 0.00 ? 47  ILE A HG22 1  
ATOM 772   H HG23 . ILE A 1 47  ? 1.990   -6.502  7.881   1.00 0.00 ? 47  ILE A HG23 1  
ATOM 773   H HD11 . ILE A 1 47  ? 0.087   -5.790  4.091   1.00 0.00 ? 47  ILE A HD11 1  
ATOM 774   H HD12 . ILE A 1 47  ? -1.447  -6.725  4.034   1.00 0.00 ? 47  ILE A HD12 1  
ATOM 775   H HD13 . ILE A 1 47  ? -0.991  -5.865  5.538   1.00 0.00 ? 47  ILE A HD13 1  
ATOM 776   N N    . PRO A 1 48  ? 4.724   -7.660  6.295   1.00 0.00 ? 48  PRO A N    1  
ATOM 777   C CA   . PRO A 1 48  ? 6.136   -7.581  6.604   1.00 0.00 ? 48  PRO A CA   1  
ATOM 778   C C    . PRO A 1 48  ? 7.097   -6.948  5.601   1.00 0.00 ? 48  PRO A C    1  
ATOM 779   O O    . PRO A 1 48  ? 8.201   -6.725  6.046   1.00 0.00 ? 48  PRO A O    1  
ATOM 780   C CB   . PRO A 1 48  ? 6.539   -8.666  7.613   1.00 0.00 ? 48  PRO A CB   1  
ATOM 781   C CG   . PRO A 1 48  ? 5.443   -9.714  7.353   1.00 0.00 ? 48  PRO A CG   1  
ATOM 782   C CD   . PRO A 1 48  ? 4.242   -8.973  6.713   1.00 0.00 ? 48  PRO A CD   1  
ATOM 783   H HA   . PRO A 1 48  ? 6.146   -6.735  7.265   1.00 0.00 ? 48  PRO A HA   1  
ATOM 784   H HB2  . PRO A 1 48  ? 7.527   -9.120  7.334   1.00 0.00 ? 48  PRO A HB2  1  
ATOM 785   H HB3  . PRO A 1 48  ? 6.581   -8.210  8.695   1.00 0.00 ? 48  PRO A HB3  1  
ATOM 786   H HG2  . PRO A 1 48  ? 5.827   -10.456 6.618   1.00 0.00 ? 48  PRO A HG2  1  
ATOM 787   H HG3  . PRO A 1 48  ? 5.150   -10.251 8.275   1.00 0.00 ? 48  PRO A HG3  1  
ATOM 788   H HD2  . PRO A 1 48  ? 3.759   -9.543  5.876   1.00 0.00 ? 48  PRO A HD2  1  
ATOM 789   H HD3  . PRO A 1 48  ? 3.525   -8.800  7.555   1.00 0.00 ? 48  PRO A HD3  1  
ATOM 790   N N    . HIS A 1 49  ? 6.888   -6.647  4.263   1.00 0.00 ? 49  HIS A N    1  
ATOM 791   C CA   . HIS A 1 49  ? 7.878   -5.780  3.509   1.00 0.00 ? 49  HIS A CA   1  
ATOM 792   C C    . HIS A 1 49  ? 8.069   -4.432  4.226   1.00 0.00 ? 49  HIS A C    1  
ATOM 793   O O    . HIS A 1 49  ? 9.162   -4.009  4.578   1.00 0.00 ? 49  HIS A O    1  
ATOM 794   C CB   . HIS A 1 49  ? 7.408   -5.360  2.059   1.00 0.00 ? 49  HIS A CB   1  
ATOM 795   C CG   . HIS A 1 49  ? 8.173   -4.215  1.320   1.00 0.00 ? 49  HIS A CG   1  
ATOM 796   N ND1  . HIS A 1 49  ? 8.006   -2.880  1.662   1.00 0.00 ? 49  HIS A ND1  1  
ATOM 797   C CD2  . HIS A 1 49  ? 9.213   -4.214  0.435   1.00 0.00 ? 49  HIS A CD2  1  
ATOM 798   C CE1  . HIS A 1 49  ? 8.967   -2.155  1.051   1.00 0.00 ? 49  HIS A CE1  1  
ATOM 799   N NE2  . HIS A 1 49  ? 9.702   -2.921  0.265   1.00 0.00 ? 49  HIS A NE2  1  
ATOM 800   H H    . HIS A 1 49  ? 5.998   -6.819  3.835   1.00 0.00 ? 49  HIS A H    1  
ATOM 801   H HA   . HIS A 1 49  ? 8.830   -6.270  3.401   1.00 0.00 ? 49  HIS A HA   1  
ATOM 802   H HB2  . HIS A 1 49  ? 7.399   -6.279  1.444   1.00 0.00 ? 49  HIS A HB2  1  
ATOM 803   H HB3  . HIS A 1 49  ? 6.341   -5.059  2.095   1.00 0.00 ? 49  HIS A HB3  1  
ATOM 804   H HD1  . HIS A 1 49  ? 7.279   -2.549  2.262   1.00 0.00 ? 49  HIS A HD1  1  
ATOM 805   H HD2  . HIS A 1 49  ? 9.703   -5.041  -0.063  1.00 0.00 ? 49  HIS A HD2  1  
ATOM 806   H HE1  . HIS A 1 49  ? 9.160   -1.098  1.327   1.00 0.00 ? 49  HIS A HE1  1  
ATOM 807   N N    . VAL A 1 50  ? 6.882   -3.854  4.539   1.00 0.00 ? 50  VAL A N    1  
ATOM 808   C CA   . VAL A 1 50  ? 6.640   -2.663  5.324   1.00 0.00 ? 50  VAL A CA   1  
ATOM 809   C C    . VAL A 1 50  ? 6.806   -2.971  6.818   1.00 0.00 ? 50  VAL A C    1  
ATOM 810   O O    . VAL A 1 50  ? 7.539   -2.247  7.480   1.00 0.00 ? 50  VAL A O    1  
ATOM 811   C CB   . VAL A 1 50  ? 5.282   -2.097  4.924   1.00 0.00 ? 50  VAL A CB   1  
ATOM 812   C CG1  . VAL A 1 50  ? 4.988   -0.776  5.644   1.00 0.00 ? 50  VAL A CG1  1  
ATOM 813   C CG2  . VAL A 1 50  ? 5.212   -1.879  3.396   1.00 0.00 ? 50  VAL A CG2  1  
ATOM 814   H H    . VAL A 1 50  ? 6.040   -4.303  4.236   1.00 0.00 ? 50  VAL A H    1  
ATOM 815   H HA   . VAL A 1 50  ? 7.431   -1.929  5.113   1.00 0.00 ? 50  VAL A HA   1  
ATOM 816   H HB   . VAL A 1 50  ? 4.495   -2.839  5.175   1.00 0.00 ? 50  VAL A HB   1  
ATOM 817   H HG11 . VAL A 1 50  ? 5.859   -0.092  5.535   1.00 0.00 ? 50  VAL A HG11 1  
ATOM 818   H HG12 . VAL A 1 50  ? 4.085   -0.299  5.208   1.00 0.00 ? 50  VAL A HG12 1  
ATOM 819   H HG13 . VAL A 1 50  ? 4.782   -0.970  6.715   1.00 0.00 ? 50  VAL A HG13 1  
ATOM 820   H HG21 . VAL A 1 50  ? 5.989   -1.157  3.066   1.00 0.00 ? 50  VAL A HG21 1  
ATOM 821   H HG22 . VAL A 1 50  ? 5.329   -2.831  2.837   1.00 0.00 ? 50  VAL A HG22 1  
ATOM 822   H HG23 . VAL A 1 50  ? 4.214   -1.464  3.134   1.00 0.00 ? 50  VAL A HG23 1  
ATOM 823   N N    . ARG A 1 51  ? 6.234   -4.081  7.409   1.00 0.00 ? 51  ARG A N    1  
ATOM 824   C CA   . ARG A 1 51  ? 6.510   -4.475  8.809   1.00 0.00 ? 51  ARG A CA   1  
ATOM 825   C C    . ARG A 1 51  ? 7.945   -4.955  9.120   1.00 0.00 ? 51  ARG A C    1  
ATOM 826   O O    . ARG A 1 51  ? 8.397   -4.807  10.236  1.00 0.00 ? 51  ARG A O    1  
ATOM 827   C CB   . ARG A 1 51  ? 5.524   -5.437  9.526   1.00 0.00 ? 51  ARG A CB   1  
ATOM 828   C CG   . ARG A 1 51  ? 4.029   -5.182  9.360   1.00 0.00 ? 51  ARG A CG   1  
ATOM 829   C CD   . ARG A 1 51  ? 3.247   -6.016  10.391  1.00 0.00 ? 51  ARG A CD   1  
ATOM 830   N NE   . ARG A 1 51  ? 1.778   -5.709  10.317  1.00 0.00 ? 51  ARG A NE   1  
ATOM 831   C CZ   . ARG A 1 51  ? 0.855   -6.300  11.138  1.00 0.00 ? 51  ARG A CZ   1  
ATOM 832   N NH1  . ARG A 1 51  ? 1.235   -7.235  12.057  1.00 0.00 ? 51  ARG A NH1  1  
ATOM 833   N NH2  . ARG A 1 51  ? -0.459  -5.947  11.035  1.00 0.00 ? 51  ARG A NH2  1  
ATOM 834   H H    . ARG A 1 51  ? 5.596   -4.679  6.911   1.00 0.00 ? 51  ARG A H    1  
ATOM 835   H HA   . ARG A 1 51  ? 6.401   -3.565  9.388   1.00 0.00 ? 51  ARG A HA   1  
ATOM 836   H HB2  . ARG A 1 51  ? 5.710   -6.495  9.264   1.00 0.00 ? 51  ARG A HB2  1  
ATOM 837   H HB3  . ARG A 1 51  ? 5.709   -5.342  10.623  1.00 0.00 ? 51  ARG A HB3  1  
ATOM 838   H HG2  . ARG A 1 51  ? 3.843   -4.102  9.496   1.00 0.00 ? 51  ARG A HG2  1  
ATOM 839   H HG3  . ARG A 1 51  ? 3.709   -5.436  8.336   1.00 0.00 ? 51  ARG A HG3  1  
ATOM 840   H HD2  . ARG A 1 51  ? 3.403   -7.099  10.189  1.00 0.00 ? 51  ARG A HD2  1  
ATOM 841   H HD3  . ARG A 1 51  ? 3.605   -5.767  11.414  1.00 0.00 ? 51  ARG A HD3  1  
ATOM 842   H HE   . ARG A 1 51  ? 1.467   -5.029  9.654   1.00 0.00 ? 51  ARG A HE   1  
ATOM 843   H HH11 . ARG A 1 51  ? 2.196   -7.496  12.137  1.00 0.00 ? 51  ARG A HH11 1  
ATOM 844   H HH12 . ARG A 1 51  ? 0.550   -7.657  12.652  1.00 0.00 ? 51  ARG A HH12 1  
ATOM 845   H HH21 . ARG A 1 51  ? -0.740  -5.261  10.363  1.00 0.00 ? 51  ARG A HH21 1  
ATOM 846   H HH22 . ARG A 1 51  ? -1.140  -6.372  11.631  1.00 0.00 ? 51  ARG A HH22 1  
ATOM 847   N N    . ASP A 1 52  ? 8.775   -5.521  8.207   1.00 0.00 ? 52  ASP A N    1  
ATOM 848   C CA   . ASP A 1 52  ? 10.219  -5.704  8.415   1.00 0.00 ? 52  ASP A CA   1  
ATOM 849   C C    . ASP A 1 52  ? 11.007  -4.405  8.224   1.00 0.00 ? 52  ASP A C    1  
ATOM 850   O O    . ASP A 1 52  ? 12.007  -4.198  8.888   1.00 0.00 ? 52  ASP A O    1  
ATOM 851   C CB   . ASP A 1 52  ? 10.879  -6.957  7.726   1.00 0.00 ? 52  ASP A CB   1  
ATOM 852   C CG   . ASP A 1 52  ? 11.151  -6.932  6.205   1.00 0.00 ? 52  ASP A CG   1  
ATOM 853   O OD1  . ASP A 1 52  ? 11.856  -6.009  5.720   1.00 0.00 ? 52  ASP A OD1  1  
ATOM 854   O OD2  . ASP A 1 52  ? 10.687  -7.882  5.517   1.00 0.00 ? 52  ASP A OD2  1  
ATOM 855   H H    . ASP A 1 52  ? 8.462   -5.815  7.269   1.00 0.00 ? 52  ASP A H    1  
ATOM 856   H HA   . ASP A 1 52  ? 10.371  -5.936  9.464   1.00 0.00 ? 52  ASP A HA   1  
ATOM 857   H HB2  . ASP A 1 52  ? 11.847  -7.169  8.231   1.00 0.00 ? 52  ASP A HB2  1  
ATOM 858   H HB3  . ASP A 1 52  ? 10.197  -7.812  7.936   1.00 0.00 ? 52  ASP A HB3  1  
ATOM 859   N N    . SER A 1 53  ? 10.555  -3.458  7.340   1.00 0.00 ? 53  SER A N    1  
ATOM 860   C CA   . SER A 1 53  ? 11.177  -2.185  6.960   1.00 0.00 ? 53  SER A CA   1  
ATOM 861   C C    . SER A 1 53  ? 11.493  -1.176  8.041   1.00 0.00 ? 53  SER A C    1  
ATOM 862   O O    . SER A 1 53  ? 12.301  -0.283  7.802   1.00 0.00 ? 53  SER A O    1  
ATOM 863   C CB   . SER A 1 53  ? 10.396  -1.377  5.895   1.00 0.00 ? 53  SER A CB   1  
ATOM 864   O OG   . SER A 1 53  ? 10.550  -1.911  4.585   1.00 0.00 ? 53  SER A OG   1  
ATOM 865   H H    . SER A 1 53  ? 9.717   -3.609  6.824   1.00 0.00 ? 53  SER A H    1  
ATOM 866   H HA   . SER A 1 53  ? 12.135  -2.430  6.520   1.00 0.00 ? 53  SER A HA   1  
ATOM 867   H HB2  . SER A 1 53  ? 9.326   -1.252  6.151   1.00 0.00 ? 53  SER A HB2  1  
ATOM 868   H HB3  . SER A 1 53  ? 10.808  -0.365  5.858   1.00 0.00 ? 53  SER A HB3  1  
ATOM 869   H HG   . SER A 1 53  ? 10.082  -2.783  4.580   1.00 0.00 ? 53  SER A HG   1  
ATOM 870   N N    . LEU A 1 54  ? 10.899  -1.281  9.262   1.00 0.00 ? 54  LEU A N    1  
ATOM 871   C CA   . LEU A 1 54  ? 11.151  -0.413  10.403  1.00 0.00 ? 54  LEU A CA   1  
ATOM 872   C C    . LEU A 1 54  ? 12.572  -0.631  10.961  1.00 0.00 ? 54  LEU A C    1  
ATOM 873   O O    . LEU A 1 54  ? 13.116  0.251   11.622  1.00 0.00 ? 54  LEU A O    1  
ATOM 874   C CB   . LEU A 1 54  ? 10.076  -0.563  11.564  1.00 0.00 ? 54  LEU A CB   1  
ATOM 875   C CG   . LEU A 1 54  ? 9.415   -1.937  11.924  1.00 0.00 ? 54  LEU A CG   1  
ATOM 876   C CD1  . LEU A 1 54  ? 8.008   -2.160  11.360  1.00 0.00 ? 54  LEU A CD1  1  
ATOM 877   C CD2  . LEU A 1 54  ? 10.289  -3.174  11.843  1.00 0.00 ? 54  LEU A CD2  1  
ATOM 878   H H    . LEU A 1 54  ? 10.213  -1.980  9.427   1.00 0.00 ? 54  LEU A H    1  
ATOM 879   H HA   . LEU A 1 54  ? 11.079  0.616   10.062  1.00 0.00 ? 54  LEU A HA   1  
ATOM 880   H HB2  . LEU A 1 54  ? 10.572  -0.218  12.535  1.00 0.00 ? 54  LEU A HB2  1  
ATOM 881   H HB3  . LEU A 1 54  ? 9.207   0.086   11.206  1.00 0.00 ? 54  LEU A HB3  1  
ATOM 882   H HG   . LEU A 1 54  ? 9.172   -1.967  13.011  1.00 0.00 ? 54  LEU A HG   1  
ATOM 883   H HD11 . LEU A 1 54  ? 7.301   -1.377  11.699  1.00 0.00 ? 54  LEU A HD11 1  
ATOM 884   H HD12 . LEU A 1 54  ? 8.018   -2.188  10.255  1.00 0.00 ? 54  LEU A HD12 1  
ATOM 885   H HD13 . LEU A 1 54  ? 7.656   -3.157  11.745  1.00 0.00 ? 54  LEU A HD13 1  
ATOM 886   H HD21 . LEU A 1 54  ? 11.225  -3.033  12.417  1.00 0.00 ? 54  LEU A HD21 1  
ATOM 887   H HD22 . LEU A 1 54  ? 9.726   -4.028  12.295  1.00 0.00 ? 54  LEU A HD22 1  
ATOM 888   H HD23 . LEU A 1 54  ? 10.547  -3.495  10.826  1.00 0.00 ? 54  LEU A HD23 1  
ATOM 889   N N    . ILE A 1 55  ? 13.139  -1.840  10.682  1.00 0.00 ? 55  ILE A N    1  
ATOM 890   C CA   . ILE A 1 55  ? 14.486  -2.304  11.093  1.00 0.00 ? 55  ILE A CA   1  
ATOM 891   C C    . ILE A 1 55  ? 15.000  -3.413  10.148  1.00 0.00 ? 55  ILE A C    1  
ATOM 892   O O    . ILE A 1 55  ? 14.373  -4.449  9.999   1.00 0.00 ? 55  ILE A O    1  
ATOM 893   C CB   . ILE A 1 55  ? 14.557  -2.793  12.560  1.00 0.00 ? 55  ILE A CB   1  
ATOM 894   C CG1  . ILE A 1 55  ? 14.362  -1.732  13.663  1.00 0.00 ? 55  ILE A CG1  1  
ATOM 895   C CG2  . ILE A 1 55  ? 15.857  -3.538  12.933  1.00 0.00 ? 55  ILE A CG2  1  
ATOM 896   C CD1  . ILE A 1 55  ? 13.003  -1.890  14.325  1.00 0.00 ? 55  ILE A CD1  1  
ATOM 897   H H    . ILE A 1 55  ? 12.580  -2.346  9.993   1.00 0.00 ? 55  ILE A H    1  
ATOM 898   H HA   . ILE A 1 55  ? 15.174  -1.474  10.990  1.00 0.00 ? 55  ILE A HA   1  
ATOM 899   H HB   . ILE A 1 55  ? 13.709  -3.494  12.663  1.00 0.00 ? 55  ILE A HB   1  
ATOM 900   H HG12 . ILE A 1 55  ? 15.134  -1.896  14.462  1.00 0.00 ? 55  ILE A HG12 1  
ATOM 901   H HG13 . ILE A 1 55  ? 14.452  -0.684  13.294  1.00 0.00 ? 55  ILE A HG13 1  
ATOM 902   H HG21 . ILE A 1 55  ? 16.739  -2.897  12.723  1.00 0.00 ? 55  ILE A HG21 1  
ATOM 903   H HG22 . ILE A 1 55  ? 15.854  -3.765  14.019  1.00 0.00 ? 55  ILE A HG22 1  
ATOM 904   H HG23 . ILE A 1 55  ? 15.957  -4.507  12.408  1.00 0.00 ? 55  ILE A HG23 1  
ATOM 905   H HD11 . ILE A 1 55  ? 12.809  -2.961  14.562  1.00 0.00 ? 55  ILE A HD11 1  
ATOM 906   H HD12 . ILE A 1 55  ? 13.018  -1.294  15.253  1.00 0.00 ? 55  ILE A HD12 1  
ATOM 907   H HD13 . ILE A 1 55  ? 12.192  -1.497  13.672  1.00 0.00 ? 55  ILE A HD13 1  
ATOM 908   N N    . GLN A 1 56  ? 16.200  -3.302  9.537   1.00 0.00 ? 56  GLN A N    1  
ATOM 909   C CA   . GLN A 1 56  ? 16.795  -4.304  8.622   1.00 0.00 ? 56  GLN A CA   1  
ATOM 910   C C    . GLN A 1 56  ? 17.305  -5.716  9.100   1.00 0.00 ? 56  GLN A C    1  
ATOM 911   O O    . GLN A 1 56  ? 17.038  -6.660  8.358   1.00 0.00 ? 56  GLN A O    1  
ATOM 912   C CB   . GLN A 1 56  ? 17.879  -3.632  7.715   1.00 0.00 ? 56  GLN A CB   1  
ATOM 913   C CG   . GLN A 1 56  ? 17.327  -2.809  6.516   1.00 0.00 ? 56  GLN A CG   1  
ATOM 914   C CD   . GLN A 1 56  ? 16.863  -1.380  6.828   1.00 0.00 ? 56  GLN A CD   1  
ATOM 915   O OE1  . GLN A 1 56  ? 17.587  -0.417  6.561   1.00 0.00 ? 56  GLN A OE1  1  
ATOM 916   N NE2  . GLN A 1 56  ? 15.619  -1.231  7.358   1.00 0.00 ? 56  GLN A NE2  1  
ATOM 917   H H    . GLN A 1 56  ? 16.717  -2.473  9.703   1.00 0.00 ? 56  GLN A H    1  
ATOM 918   H HA   . GLN A 1 56  ? 16.010  -4.572  7.928   1.00 0.00 ? 56  GLN A HA   1  
ATOM 919   H HB2  . GLN A 1 56  ? 18.511  -2.945  8.365   1.00 0.00 ? 56  GLN A HB2  1  
ATOM 920   H HB3  . GLN A 1 56  ? 18.465  -4.453  7.173   1.00 0.00 ? 56  GLN A HB3  1  
ATOM 921   H HG2  . GLN A 1 56  ? 18.153  -2.697  5.778   1.00 0.00 ? 56  GLN A HG2  1  
ATOM 922   H HG3  . GLN A 1 56  ? 16.511  -3.367  6.015   1.00 0.00 ? 56  GLN A HG3  1  
ATOM 923   H HE21 . GLN A 1 56  ? 15.060  -2.028  7.592   1.00 0.00 ? 56  GLN A HE21 1  
ATOM 924   H HE22 . GLN A 1 56  ? 15.270  -0.303  7.473   1.00 0.00 ? 56  GLN A HE22 1  
ATOM 925   N N    . PRO A 1 57  ? 18.068  -5.969  10.190  1.00 0.00 ? 57  PRO A N    1  
ATOM 926   C CA   . PRO A 1 57  ? 18.720  -7.269  10.501  1.00 0.00 ? 57  PRO A CA   1  
ATOM 927   C C    . PRO A 1 57  ? 17.846  -8.304  11.258  1.00 0.00 ? 57  PRO A C    1  
ATOM 928   O O    . PRO A 1 57  ? 16.732  -8.609  10.862  1.00 0.00 ? 57  PRO A O    1  
ATOM 929   C CB   . PRO A 1 57  ? 19.877  -6.779  11.403  1.00 0.00 ? 57  PRO A CB   1  
ATOM 930   C CG   . PRO A 1 57  ? 19.194  -5.671  12.202  1.00 0.00 ? 57  PRO A CG   1  
ATOM 931   C CD   . PRO A 1 57  ? 18.569  -4.901  11.045  1.00 0.00 ? 57  PRO A CD   1  
ATOM 932   H HA   . PRO A 1 57  ? 19.086  -7.748  9.601   1.00 0.00 ? 57  PRO A HA   1  
ATOM 933   H HB2  . PRO A 1 57  ? 20.395  -7.537  12.016  1.00 0.00 ? 57  PRO A HB2  1  
ATOM 934   H HB3  . PRO A 1 57  ? 20.662  -6.321  10.756  1.00 0.00 ? 57  PRO A HB3  1  
ATOM 935   H HG2  . PRO A 1 57  ? 18.386  -6.127  12.842  1.00 0.00 ? 57  PRO A HG2  1  
ATOM 936   H HG3  . PRO A 1 57  ? 19.900  -5.080  12.817  1.00 0.00 ? 57  PRO A HG3  1  
ATOM 937   H HD2  . PRO A 1 57  ? 17.742  -4.220  11.378  1.00 0.00 ? 57  PRO A HD2  1  
ATOM 938   H HD3  . PRO A 1 57  ? 19.384  -4.365  10.471  1.00 0.00 ? 57  PRO A HD3  1  
ATOM 939   N N    . HIS A 1 58  ? 18.374  -8.870  12.383  1.00 0.00 ? 58  HIS A N    1  
ATOM 940   C CA   . HIS A 1 58  ? 17.782  -9.848  13.303  1.00 0.00 ? 58  HIS A CA   1  
ATOM 941   C C    . HIS A 1 58  ? 16.745  -9.256  14.266  1.00 0.00 ? 58  HIS A C    1  
ATOM 942   O O    . HIS A 1 58  ? 15.814  -9.914  14.709  1.00 0.00 ? 58  HIS A O    1  
ATOM 943   C CB   . HIS A 1 58  ? 18.893  -10.603 14.083  1.00 0.00 ? 58  HIS A CB   1  
ATOM 944   C CG   . HIS A 1 58  ? 18.372  -11.647 15.029  1.00 0.00 ? 58  HIS A CG   1  
ATOM 945   N ND1  . HIS A 1 58  ? 17.880  -12.882 14.666  1.00 0.00 ? 58  HIS A ND1  1  
ATOM 946   C CD2  . HIS A 1 58  ? 18.114  -11.519 16.355  1.00 0.00 ? 58  HIS A CD2  1  
ATOM 947   C CE1  . HIS A 1 58  ? 17.366  -13.442 15.791  1.00 0.00 ? 58  HIS A CE1  1  
ATOM 948   N NE2  . HIS A 1 58  ? 17.486  -12.649 16.836  1.00 0.00 ? 58  HIS A NE2  1  
ATOM 949   H H    . HIS A 1 58  ? 19.297  -8.592  12.629  1.00 0.00 ? 58  HIS A H    1  
ATOM 950   H HA   . HIS A 1 58  ? 17.251  -10.590 12.727  1.00 0.00 ? 58  HIS A HA   1  
ATOM 951   H HB2  . HIS A 1 58  ? 19.569  -11.100 13.352  1.00 0.00 ? 58  HIS A HB2  1  
ATOM 952   H HB3  . HIS A 1 58  ? 19.502  -9.880  14.668  1.00 0.00 ? 58  HIS A HB3  1  
ATOM 953   H HD1  . HIS A 1 58  ? 17.849  -13.259 13.740  1.00 0.00 ? 58  HIS A HD1  1  
ATOM 954   H HD2  . HIS A 1 58  ? 18.276  -10.659 16.988  1.00 0.00 ? 58  HIS A HD2  1  
ATOM 955   H HE1  . HIS A 1 58  ? 16.897  -14.426 15.810  1.00 0.00 ? 58  HIS A HE1  1  
ATOM 956   N N    . ASP A 1 59  ? 16.881  -7.951  14.587  1.00 0.00 ? 59  ASP A N    1  
ATOM 957   C CA   . ASP A 1 59  ? 16.054  -7.099  15.414  1.00 0.00 ? 59  ASP A CA   1  
ATOM 958   C C    . ASP A 1 59  ? 14.893  -6.525  14.627  1.00 0.00 ? 59  ASP A C    1  
ATOM 959   O O    . ASP A 1 59  ? 14.177  -5.668  15.132  1.00 0.00 ? 59  ASP A O    1  
ATOM 960   C CB   . ASP A 1 59  ? 16.927  -5.924  15.941  1.00 0.00 ? 59  ASP A CB   1  
ATOM 961   C CG   . ASP A 1 59  ? 18.010  -6.471  16.876  1.00 0.00 ? 59  ASP A CG   1  
ATOM 962   O OD1  . ASP A 1 59  ? 17.641  -7.024  17.947  1.00 0.00 ? 59  ASP A OD1  1  
ATOM 963   O OD2  . ASP A 1 59  ? 19.215  -6.345  16.530  1.00 0.00 ? 59  ASP A OD2  1  
ATOM 964   H H    . ASP A 1 59  ? 17.634  -7.429  14.227  1.00 0.00 ? 59  ASP A H    1  
ATOM 965   H HA   . ASP A 1 59  ? 15.634  -7.643  16.249  1.00 0.00 ? 59  ASP A HA   1  
ATOM 966   H HB2  . ASP A 1 59  ? 17.427  -5.415  15.079  1.00 0.00 ? 59  ASP A HB2  1  
ATOM 967   H HB3  . ASP A 1 59  ? 16.325  -5.185  16.513  1.00 0.00 ? 59  ASP A HB3  1  
ATOM 968   N N    . ARG A 1 60  ? 14.692  -6.967  13.340  1.00 0.00 ? 60  ARG A N    1  
ATOM 969   C CA   . ARG A 1 60  ? 13.707  -6.542  12.343  1.00 0.00 ? 60  ARG A CA   1  
ATOM 970   C C    . ARG A 1 60  ? 12.301  -6.419  12.815  1.00 0.00 ? 60  ARG A C    1  
ATOM 971   O O    . ARG A 1 60  ? 11.709  -5.360  12.768  1.00 0.00 ? 60  ARG A O    1  
ATOM 972   C CB   . ARG A 1 60  ? 13.751  -7.295  10.979  1.00 0.00 ? 60  ARG A CB   1  
ATOM 973   C CG   . ARG A 1 60  ? 13.174  -8.713  10.824  1.00 0.00 ? 60  ARG A CG   1  
ATOM 974   C CD   . ARG A 1 60  ? 13.691  -9.682  11.882  1.00 0.00 ? 60  ARG A CD   1  
ATOM 975   N NE   . ARG A 1 60  ? 13.328  -11.082 11.463  1.00 0.00 ? 60  ARG A NE   1  
ATOM 976   C CZ   . ARG A 1 60  ? 13.831  -12.218 12.037  1.00 0.00 ? 60  ARG A CZ   1  
ATOM 977   N NH1  . ARG A 1 60  ? 14.740  -12.160 13.050  1.00 0.00 ? 60  ARG A NH1  1  
ATOM 978   N NH2  . ARG A 1 60  ? 13.412  -13.436 11.581  1.00 0.00 ? 60  ARG A NH2  1  
ATOM 979   H H    . ARG A 1 60  ? 15.309  -7.673  13.000  1.00 0.00 ? 60  ARG A H    1  
ATOM 980   H HA   . ARG A 1 60  ? 13.996  -5.543  12.099  1.00 0.00 ? 60  ARG A HA   1  
ATOM 981   H HB2  . ARG A 1 60  ? 13.262  -6.663  10.206  1.00 0.00 ? 60  ARG A HB2  1  
ATOM 982   H HB3  . ARG A 1 60  ? 14.816  -7.380  10.710  1.00 0.00 ? 60  ARG A HB3  1  
ATOM 983   H HG2  . ARG A 1 60  ? 12.063  -8.680  10.855  1.00 0.00 ? 60  ARG A HG2  1  
ATOM 984   H HG3  . ARG A 1 60  ? 13.471  -9.070  9.810   1.00 0.00 ? 60  ARG A HG3  1  
ATOM 985   H HD2  . ARG A 1 60  ? 14.772  -9.536  12.051  1.00 0.00 ? 60  ARG A HD2  1  
ATOM 986   H HD3  . ARG A 1 60  ? 13.202  -9.427  12.831  1.00 0.00 ? 60  ARG A HD3  1  
ATOM 987   H HE   . ARG A 1 60  ? 12.665  -11.185 10.722  1.00 0.00 ? 60  ARG A HE   1  
ATOM 988   H HH11 . ARG A 1 60  ? 15.056  -11.273 13.387  1.00 0.00 ? 60  ARG A HH11 1  
ATOM 989   H HH12 . ARG A 1 60  ? 15.096  -13.004 13.452  1.00 0.00 ? 60  ARG A HH12 1  
ATOM 990   H HH21 . ARG A 1 60  ? 12.744  -13.488 10.838  1.00 0.00 ? 60  ARG A HH21 1  
ATOM 991   H HH22 . ARG A 1 60  ? 13.771  -14.274 11.992  1.00 0.00 ? 60  ARG A HH22 1  
ATOM 992   N N    . LYS A 1 61  ? 11.740  -7.506  13.367  1.00 0.00 ? 61  LYS A N    1  
ATOM 993   C CA   . LYS A 1 61  ? 10.432  -7.613  13.958  1.00 0.00 ? 61  LYS A CA   1  
ATOM 994   C C    . LYS A 1 61  ? 10.206  -6.848  15.235  1.00 0.00 ? 61  LYS A C    1  
ATOM 995   O O    . LYS A 1 61  ? 9.072   -6.540  15.572  1.00 0.00 ? 61  LYS A O    1  
ATOM 996   C CB   . LYS A 1 61  ? 9.691   -8.941  13.701  1.00 0.00 ? 61  LYS A CB   1  
ATOM 997   C CG   . LYS A 1 61  ? 8.553   -9.374  14.679  1.00 0.00 ? 61  LYS A CG   1  
ATOM 998   C CD   . LYS A 1 61  ? 9.072   -9.986  15.991  1.00 0.00 ? 61  LYS A CD   1  
ATOM 999   C CE   . LYS A 1 61  ? 7.993   -10.719 16.797  1.00 0.00 ? 61  LYS A CE   1  
ATOM 1000  N NZ   . LYS A 1 61  ? 8.558   -11.304 18.036  1.00 0.00 ? 61  LYS A NZ   1  
ATOM 1001  H H    . LYS A 1 61  ? 12.298  -8.336  13.391  1.00 0.00 ? 61  LYS A H    1  
ATOM 1002  H HA   . LYS A 1 61  ? 9.848   -7.001  13.290  1.00 0.00 ? 61  LYS A HA   1  
ATOM 1003  H HB2  . LYS A 1 61  ? 9.190   -8.729  12.711  1.00 0.00 ? 61  LYS A HB2  1  
ATOM 1004  H HB3  . LYS A 1 61  ? 10.476  -9.725  13.534  1.00 0.00 ? 61  LYS A HB3  1  
ATOM 1005  H HG2  . LYS A 1 61  ? 7.825   -8.543  14.928  1.00 0.00 ? 61  LYS A HG2  1  
ATOM 1006  H HG3  . LYS A 1 61  ? 7.944   -10.152 14.167  1.00 0.00 ? 61  LYS A HG3  1  
ATOM 1007  H HD2  . LYS A 1 61  ? 9.888   -10.700 15.748  1.00 0.00 ? 61  LYS A HD2  1  
ATOM 1008  H HD3  . LYS A 1 61  ? 9.502   -9.174  16.620  1.00 0.00 ? 61  LYS A HD3  1  
ATOM 1009  H HE2  . LYS A 1 61  ? 7.189   -10.017 17.097  1.00 0.00 ? 61  LYS A HE2  1  
ATOM 1010  H HE3  . LYS A 1 61  ? 7.555   -11.547 16.201  1.00 0.00 ? 61  LYS A HE3  1  
ATOM 1011  H HZ1  . LYS A 1 61  ? 8.959   -10.547 18.624  1.00 0.00 ? 61  LYS A HZ1  1  
ATOM 1012  H HZ2  . LYS A 1 61  ? 7.805   -11.791 18.563  1.00 0.00 ? 61  LYS A HZ2  1  
ATOM 1013  H HZ3  . LYS A 1 61  ? 9.304   -11.985 17.788  1.00 0.00 ? 61  LYS A HZ3  1  
ATOM 1014  N N    . LYS A 1 62  ? 11.242  -6.520  16.039  1.00 0.00 ? 62  LYS A N    1  
ATOM 1015  C CA   . LYS A 1 62  ? 11.112  -5.781  17.302  1.00 0.00 ? 62  LYS A CA   1  
ATOM 1016  C C    . LYS A 1 62  ? 10.335  -4.444  17.336  1.00 0.00 ? 62  LYS A C    1  
ATOM 1017  O O    . LYS A 1 62  ? 9.890   -4.029  18.403  1.00 0.00 ? 62  LYS A O    1  
ATOM 1018  C CB   . LYS A 1 62  ? 12.523  -5.664  17.975  1.00 0.00 ? 62  LYS A CB   1  
ATOM 1019  C CG   . LYS A 1 62  ? 13.176  -4.271  17.956  1.00 0.00 ? 62  LYS A CG   1  
ATOM 1020  C CD   . LYS A 1 62  ? 14.578  -4.272  18.563  1.00 0.00 ? 62  LYS A CD   1  
ATOM 1021  C CE   . LYS A 1 62  ? 15.334  -2.997  18.181  1.00 0.00 ? 62  LYS A CE   1  
ATOM 1022  N NZ   . LYS A 1 62  ? 14.807  -1.814  18.897  1.00 0.00 ? 62  LYS A NZ   1  
ATOM 1023  H H    . LYS A 1 62  ? 12.169  -6.748  15.744  1.00 0.00 ? 62  LYS A H    1  
ATOM 1024  H HA   . LYS A 1 62  ? 10.429  -6.398  17.884  1.00 0.00 ? 62  LYS A HA   1  
ATOM 1025  H HB2  . LYS A 1 62  ? 12.461  -5.989  19.034  1.00 0.00 ? 62  LYS A HB2  1  
ATOM 1026  H HB3  . LYS A 1 62  ? 13.237  -6.345  17.430  1.00 0.00 ? 62  LYS A HB3  1  
ATOM 1027  H HG2  . LYS A 1 62  ? 13.241  -3.937  16.895  1.00 0.00 ? 62  LYS A HG2  1  
ATOM 1028  H HG3  . LYS A 1 62  ? 12.571  -3.527  18.521  1.00 0.00 ? 62  LYS A HG3  1  
ATOM 1029  H HD2  . LYS A 1 62  ? 14.526  -4.388  19.667  1.00 0.00 ? 62  LYS A HD2  1  
ATOM 1030  H HD3  . LYS A 1 62  ? 15.130  -5.149  18.166  1.00 0.00 ? 62  LYS A HD3  1  
ATOM 1031  H HE2  . LYS A 1 62  ? 16.410  -3.102  18.422  1.00 0.00 ? 62  LYS A HE2  1  
ATOM 1032  H HE3  . LYS A 1 62  ? 15.196  -2.819  17.092  1.00 0.00 ? 62  LYS A HE3  1  
ATOM 1033  H HZ1  . LYS A 1 62  ? 13.799  -1.694  18.671  1.00 0.00 ? 62  LYS A HZ1  1  
ATOM 1034  H HZ2  . LYS A 1 62  ? 14.920  -1.949  19.921  1.00 0.00 ? 62  LYS A HZ2  1  
ATOM 1035  H HZ3  . LYS A 1 62  ? 15.332  -0.966  18.598  1.00 0.00 ? 62  LYS A HZ3  1  
ATOM 1036  N N    . MET A 1 63  ? 10.103  -3.779  16.169  1.00 0.00 ? 63  MET A N    1  
ATOM 1037  C CA   . MET A 1 63  ? 9.169   -2.667  16.061  1.00 0.00 ? 63  MET A CA   1  
ATOM 1038  C C    . MET A 1 63  ? 7.990   -3.019  15.142  1.00 0.00 ? 63  MET A C    1  
ATOM 1039  O O    . MET A 1 63  ? 7.117   -2.185  14.942  1.00 0.00 ? 63  MET A O    1  
ATOM 1040  C CB   . MET A 1 63  ? 9.791   -1.271  15.784  1.00 0.00 ? 63  MET A CB   1  
ATOM 1041  C CG   . MET A 1 63  ? 10.550  -0.682  16.998  1.00 0.00 ? 63  MET A CG   1  
ATOM 1042  S SD   . MET A 1 63  ? 10.644  1.141   16.975  1.00 0.00 ? 63  MET A SD   1  
ATOM 1043  C CE   . MET A 1 63  ? 11.597  1.367   15.446  1.00 0.00 ? 63  MET A CE   1  
ATOM 1044  H H    . MET A 1 63  ? 10.484  -4.126  15.314  1.00 0.00 ? 63  MET A H    1  
ATOM 1045  H HA   . MET A 1 63  ? 8.684   -2.513  17.015  1.00 0.00 ? 63  MET A HA   1  
ATOM 1046  H HB2  . MET A 1 63  ? 10.462  -1.330  14.906  1.00 0.00 ? 63  MET A HB2  1  
ATOM 1047  H HB3  . MET A 1 63  ? 8.973   -0.542  15.553  1.00 0.00 ? 63  MET A HB3  1  
ATOM 1048  H HG2  . MET A 1 63  ? 9.948   -0.963  17.915  1.00 0.00 ? 63  MET A HG2  1  
ATOM 1049  H HG3  . MET A 1 63  ? 11.597  -1.116  17.034  1.00 0.00 ? 63  MET A HG3  1  
ATOM 1050  H HE1  . MET A 1 63  ? 12.580  0.857   15.515  1.00 0.00 ? 63  MET A HE1  1  
ATOM 1051  H HE2  . MET A 1 63  ? 11.064  0.961   14.562  1.00 0.00 ? 63  MET A HE2  1  
ATOM 1052  H HE3  . MET A 1 63  ? 11.787  2.446   15.260  1.00 0.00 ? 63  MET A HE3  1  
ATOM 1053  N N    . LYS A 1 64  ? 7.855   -4.273  14.582  1.00 0.00 ? 64  LYS A N    1  
ATOM 1054  C CA   . LYS A 1 64  ? 6.707   -4.763  13.776  1.00 0.00 ? 64  LYS A CA   1  
ATOM 1055  C C    . LYS A 1 64  ? 5.490   -4.988  14.683  1.00 0.00 ? 64  LYS A C    1  
ATOM 1056  O O    . LYS A 1 64  ? 4.334   -4.801  14.312  1.00 0.00 ? 64  LYS A O    1  
ATOM 1057  C CB   . LYS A 1 64  ? 7.113   -6.055  13.001  1.00 0.00 ? 64  LYS A CB   1  
ATOM 1058  C CG   . LYS A 1 64  ? 6.089   -7.190  12.937  1.00 0.00 ? 64  LYS A CG   1  
ATOM 1059  C CD   . LYS A 1 64  ? 6.382   -8.291  11.912  1.00 0.00 ? 64  LYS A CD   1  
ATOM 1060  C CE   . LYS A 1 64  ? 5.231   -9.302  11.793  1.00 0.00 ? 64  LYS A CE   1  
ATOM 1061  N NZ   . LYS A 1 64  ? 5.598   -10.421 10.898  1.00 0.00 ? 64  LYS A NZ   1  
ATOM 1062  H H    . LYS A 1 64  ? 8.528   -5.012  14.744  1.00 0.00 ? 64  LYS A H    1  
ATOM 1063  H HA   . LYS A 1 64  ? 6.404   -4.010  13.065  1.00 0.00 ? 64  LYS A HA   1  
ATOM 1064  H HB2  . LYS A 1 64  ? 7.467   -5.904  11.930  1.00 0.00 ? 64  LYS A HB2  1  
ATOM 1065  H HB3  . LYS A 1 64  ? 7.913   -6.434  13.677  1.00 0.00 ? 64  LYS A HB3  1  
ATOM 1066  H HG2  . LYS A 1 64  ? 6.096   -7.598  13.973  1.00 0.00 ? 64  LYS A HG2  1  
ATOM 1067  H HG3  . LYS A 1 64  ? 5.098   -6.764  12.680  1.00 0.00 ? 64  LYS A HG3  1  
ATOM 1068  H HD2  . LYS A 1 64  ? 6.571   -7.827  10.920  1.00 0.00 ? 64  LYS A HD2  1  
ATOM 1069  H HD3  . LYS A 1 64  ? 7.295   -8.837  12.208  1.00 0.00 ? 64  LYS A HD3  1  
ATOM 1070  H HE2  . LYS A 1 64  ? 4.993   -9.737  12.785  1.00 0.00 ? 64  LYS A HE2  1  
ATOM 1071  H HE3  . LYS A 1 64  ? 4.324   -8.817  11.379  1.00 0.00 ? 64  LYS A HE3  1  
ATOM 1072  H HZ1  . LYS A 1 64  ? 6.438   -10.905 11.274  1.00 0.00 ? 64  LYS A HZ1  1  
ATOM 1073  H HZ2  . LYS A 1 64  ? 4.806   -11.094 10.842  1.00 0.00 ? 64  LYS A HZ2  1  
ATOM 1074  H HZ3  . LYS A 1 64  ? 5.807   -10.053 9.948   1.00 0.00 ? 64  LYS A HZ3  1  
ATOM 1075  N N    . LYS A 1 65  ? 5.758   -5.348  15.965  1.00 0.00 ? 65  LYS A N    1  
ATOM 1076  C CA   . LYS A 1 65  ? 4.735   -5.451  17.026  1.00 0.00 ? 65  LYS A CA   1  
ATOM 1077  C C    . LYS A 1 65  ? 4.178   -4.075  17.516  1.00 0.00 ? 65  LYS A C    1  
ATOM 1078  O O    . LYS A 1 65  ? 3.017   -3.924  17.894  1.00 0.00 ? 65  LYS A O    1  
ATOM 1079  C CB   . LYS A 1 65  ? 5.254   -6.281  18.225  1.00 0.00 ? 65  LYS A CB   1  
ATOM 1080  C CG   . LYS A 1 65  ? 5.528   -7.760  17.889  1.00 0.00 ? 65  LYS A CG   1  
ATOM 1081  C CD   . LYS A 1 65  ? 4.252   -8.567  17.573  1.00 0.00 ? 65  LYS A CD   1  
ATOM 1082  C CE   . LYS A 1 65  ? 3.951   -8.796  16.082  1.00 0.00 ? 65  LYS A CE   1  
ATOM 1083  N NZ   . LYS A 1 65  ? 4.958   -9.685  15.463  1.00 0.00 ? 65  LYS A NZ   1  
ATOM 1084  H H    . LYS A 1 65  ? 6.727   -5.554  16.174  1.00 0.00 ? 65  LYS A H    1  
ATOM 1085  H HA   . LYS A 1 65  ? 3.894   -5.982  16.584  1.00 0.00 ? 65  LYS A HA   1  
ATOM 1086  H HB2  . LYS A 1 65  ? 6.193   -5.822  18.607  1.00 0.00 ? 65  LYS A HB2  1  
ATOM 1087  H HB3  . LYS A 1 65  ? 4.512   -6.271  19.057  1.00 0.00 ? 65  LYS A HB3  1  
ATOM 1088  H HG2  . LYS A 1 65  ? 6.265   -7.853  17.065  1.00 0.00 ? 65  LYS A HG2  1  
ATOM 1089  H HG3  . LYS A 1 65  ? 5.988   -8.217  18.798  1.00 0.00 ? 65  LYS A HG3  1  
ATOM 1090  H HD2  . LYS A 1 65  ? 4.336   -9.567  18.056  1.00 0.00 ? 65  LYS A HD2  1  
ATOM 1091  H HD3  . LYS A 1 65  ? 3.379   -8.059  18.041  1.00 0.00 ? 65  LYS A HD3  1  
ATOM 1092  H HE2  . LYS A 1 65  ? 2.962   -9.288  15.968  1.00 0.00 ? 65  LYS A HE2  1  
ATOM 1093  H HE3  . LYS A 1 65  ? 3.946   -7.842  15.516  1.00 0.00 ? 65  LYS A HE3  1  
ATOM 1094  H HZ1  . LYS A 1 65  ? 4.956   -10.603 15.950  1.00 0.00 ? 65  LYS A HZ1  1  
ATOM 1095  H HZ2  . LYS A 1 65  ? 4.728   -9.824  14.459  1.00 0.00 ? 65  LYS A HZ2  1  
ATOM 1096  H HZ3  . LYS A 1 65  ? 5.900   -9.251  15.546  1.00 0.00 ? 65  LYS A HZ3  1  
ATOM 1097  N N    . VAL A 1 66  ? 5.047   -3.024  17.436  1.00 0.00 ? 66  VAL A N    1  
ATOM 1098  C CA   . VAL A 1 66  ? 4.804   -1.586  17.673  1.00 0.00 ? 66  VAL A CA   1  
ATOM 1099  C C    . VAL A 1 66  ? 4.015   -0.974  16.519  1.00 0.00 ? 66  VAL A C    1  
ATOM 1100  O O    . VAL A 1 66  ? 3.201   -0.070  16.714  1.00 0.00 ? 66  VAL A O    1  
ATOM 1101  C CB   . VAL A 1 66  ? 6.086   -0.763  17.902  1.00 0.00 ? 66  VAL A CB   1  
ATOM 1102  C CG1  . VAL A 1 66  ? 5.775   0.739   18.158  1.00 0.00 ? 66  VAL A CG1  1  
ATOM 1103  C CG2  . VAL A 1 66  ? 6.851   -1.351  19.108  1.00 0.00 ? 66  VAL A CG2  1  
ATOM 1104  H H    . VAL A 1 66  ? 5.970   -3.235  17.139  1.00 0.00 ? 66  VAL A H    1  
ATOM 1105  H HA   . VAL A 1 66  ? 4.185   -1.490  18.556  1.00 0.00 ? 66  VAL A HA   1  
ATOM 1106  H HB   . VAL A 1 66  ? 6.753   -0.843  17.012  1.00 0.00 ? 66  VAL A HB   1  
ATOM 1107  H HG11 . VAL A 1 66  ? 5.097   0.843   19.030  1.00 0.00 ? 66  VAL A HG11 1  
ATOM 1108  H HG12 . VAL A 1 66  ? 6.713   1.290   18.385  1.00 0.00 ? 66  VAL A HG12 1  
ATOM 1109  H HG13 . VAL A 1 66  ? 5.289   1.255   17.294  1.00 0.00 ? 66  VAL A HG13 1  
ATOM 1110  H HG21 . VAL A 1 66  ? 7.135   -2.409  18.937  1.00 0.00 ? 66  VAL A HG21 1  
ATOM 1111  H HG22 . VAL A 1 66  ? 7.785   -0.776  19.291  1.00 0.00 ? 66  VAL A HG22 1  
ATOM 1112  H HG23 . VAL A 1 66  ? 6.216   -1.296  20.019  1.00 0.00 ? 66  VAL A HG23 1  
ATOM 1113  N N    . TRP A 1 67  ? 4.222   -1.486  15.269  1.00 0.00 ? 67  TRP A N    1  
ATOM 1114  C CA   . TRP A 1 67  ? 3.597   -1.137  13.994  1.00 0.00 ? 67  TRP A CA   1  
ATOM 1115  C C    . TRP A 1 67  ? 2.063   -1.179  13.999  1.00 0.00 ? 67  TRP A C    1  
ATOM 1116  O O    . TRP A 1 67  ? 1.387   -0.357  13.384  1.00 0.00 ? 67  TRP A O    1  
ATOM 1117  C CB   . TRP A 1 67  ? 4.216   -1.953  12.820  1.00 0.00 ? 67  TRP A CB   1  
ATOM 1118  C CG   . TRP A 1 67  ? 3.633   -1.676  11.459  1.00 0.00 ? 67  TRP A CG   1  
ATOM 1119  C CD1  . TRP A 1 67  ? 2.690   -2.410  10.817  1.00 0.00 ? 67  TRP A CD1  1  
ATOM 1120  C CD2  . TRP A 1 67  ? 3.659   -0.399  10.822  1.00 0.00 ? 67  TRP A CD2  1  
ATOM 1121  N NE1  . TRP A 1 67  ? 2.248   -1.742  9.714   1.00 0.00 ? 67  TRP A NE1  1  
ATOM 1122  C CE2  . TRP A 1 67  ? 2.794   -0.474  9.735   1.00 0.00 ? 67  TRP A CE2  1  
ATOM 1123  C CE3  . TRP A 1 67  ? 4.306   0.748   11.154  1.00 0.00 ? 67  TRP A CE3  1  
ATOM 1124  C CZ2  . TRP A 1 67  ? 2.555   0.623   8.964   1.00 0.00 ? 67  TRP A CZ2  1  
ATOM 1125  C CZ3  . TRP A 1 67  ? 4.009   1.872   10.429  1.00 0.00 ? 67  TRP A CZ3  1  
ATOM 1126  C CH2  . TRP A 1 67  ? 3.124   1.818   9.368   1.00 0.00 ? 67  TRP A CH2  1  
ATOM 1127  H H    . TRP A 1 67  ? 4.903   -2.203  15.163  1.00 0.00 ? 67  TRP A H    1  
ATOM 1128  H HA   . TRP A 1 67  ? 3.862   -0.121  13.818  1.00 0.00 ? 67  TRP A HA   1  
ATOM 1129  H HB2  . TRP A 1 67  ? 5.319   -1.745  12.785  1.00 0.00 ? 67  TRP A HB2  1  
ATOM 1130  H HB3  . TRP A 1 67  ? 4.021   -3.035  12.998  1.00 0.00 ? 67  TRP A HB3  1  
ATOM 1131  H HD1  . TRP A 1 67  ? 2.294   -3.340  11.194  1.00 0.00 ? 67  TRP A HD1  1  
ATOM 1132  H HE1  . TRP A 1 67  ? 1.639   -2.122  9.053   1.00 0.00 ? 67  TRP A HE1  1  
ATOM 1133  H HE3  . TRP A 1 67  ? 4.982   0.802   11.992  1.00 0.00 ? 67  TRP A HE3  1  
ATOM 1134  H HZ2  . TRP A 1 67  ? 1.868   0.585   8.133   1.00 0.00 ? 67  TRP A HZ2  1  
ATOM 1135  H HZ3  . TRP A 1 67  ? 4.489   2.798   10.702  1.00 0.00 ? 67  TRP A HZ3  1  
ATOM 1136  H HH2  . TRP A 1 67  ? 2.922   2.722   8.817   1.00 0.00 ? 67  TRP A HH2  1  
ATOM 1137  N N    . ASP A 1 68  ? 1.518   -2.112  14.811  1.00 0.00 ? 68  ASP A N    1  
ATOM 1138  C CA   . ASP A 1 68  ? 0.126   -2.374  15.178  1.00 0.00 ? 68  ASP A CA   1  
ATOM 1139  C C    . ASP A 1 68  ? -0.571  -1.114  15.756  1.00 0.00 ? 68  ASP A C    1  
ATOM 1140  O O    . ASP A 1 68  ? -1.662  -0.726  15.352  1.00 0.00 ? 68  ASP A O    1  
ATOM 1141  C CB   . ASP A 1 68  ? 0.191   -3.521  16.230  1.00 0.00 ? 68  ASP A CB   1  
ATOM 1142  C CG   . ASP A 1 68  ? 0.830   -4.815  15.684  1.00 0.00 ? 68  ASP A CG   1  
ATOM 1143  O OD1  . ASP A 1 68  ? 1.047   -4.932  14.450  1.00 0.00 ? 68  ASP A OD1  1  
ATOM 1144  O OD2  . ASP A 1 68  ? 1.077   -5.726  16.520  1.00 0.00 ? 68  ASP A OD2  1  
ATOM 1145  H H    . ASP A 1 68  ? 2.164   -2.733  15.257  1.00 0.00 ? 68  ASP A H    1  
ATOM 1146  H HA   . ASP A 1 68  ? -0.412  -2.676  14.289  1.00 0.00 ? 68  ASP A HA   1  
ATOM 1147  H HB2  . ASP A 1 68  ? 0.773   -3.142  17.100  1.00 0.00 ? 68  ASP A HB2  1  
ATOM 1148  H HB3  . ASP A 1 68  ? -0.780  -3.833  16.614  1.00 0.00 ? 68  ASP A HB3  1  
ATOM 1149  N N    . ARG A 1 69  ? 0.158   -0.403  16.662  1.00 0.00 ? 69  ARG A N    1  
ATOM 1150  C CA   . ARG A 1 69  ? -0.105  0.943   17.170  1.00 0.00 ? 69  ARG A CA   1  
ATOM 1151  C C    . ARG A 1 69  ? 0.278   2.073   16.197  1.00 0.00 ? 69  ARG A C    1  
ATOM 1152  O O    . ARG A 1 69  ? -0.505  2.999   15.998  1.00 0.00 ? 69  ARG A O    1  
ATOM 1153  C CB   . ARG A 1 69  ? 0.572   1.107   18.559  1.00 0.00 ? 69  ARG A CB   1  
ATOM 1154  C CG   . ARG A 1 69  ? 0.420   2.467   19.282  1.00 0.00 ? 69  ARG A CG   1  
ATOM 1155  C CD   . ARG A 1 69  ? -1.035  2.921   19.480  1.00 0.00 ? 69  ARG A CD   1  
ATOM 1156  N NE   . ARG A 1 69  ? -1.026  4.246   20.190  1.00 0.00 ? 69  ARG A NE   1  
ATOM 1157  C CZ   . ARG A 1 69  ? -2.165  4.957   20.458  1.00 0.00 ? 69  ARG A CZ   1  
ATOM 1158  N NH1  . ARG A 1 69  ? -3.392  4.470   20.115  1.00 0.00 ? 69  ARG A NH1  1  
ATOM 1159  N NH2  . ARG A 1 69  ? -2.070  6.173   21.073  1.00 0.00 ? 69  ARG A NH2  1  
ATOM 1160  H H    . ARG A 1 69  ? 1.037   -0.776  16.957  1.00 0.00 ? 69  ARG A H    1  
ATOM 1161  H HA   . ARG A 1 69  ? -1.178  1.060   17.284  1.00 0.00 ? 69  ARG A HA   1  
ATOM 1162  H HB2  . ARG A 1 69  ? 0.137   0.328   19.228  1.00 0.00 ? 69  ARG A HB2  1  
ATOM 1163  H HB3  . ARG A 1 69  ? 1.657   0.879   18.459  1.00 0.00 ? 69  ARG A HB3  1  
ATOM 1164  H HG2  . ARG A 1 69  ? 0.904   2.363   20.281  1.00 0.00 ? 69  ARG A HG2  1  
ATOM 1165  H HG3  . ARG A 1 69  ? 0.980   3.249   18.722  1.00 0.00 ? 69  ARG A HG3  1  
ATOM 1166  H HD2  . ARG A 1 69  ? -1.535  3.055   18.492  1.00 0.00 ? 69  ARG A HD2  1  
ATOM 1167  H HD3  . ARG A 1 69  ? -1.588  2.178   20.098  1.00 0.00 ? 69  ARG A HD3  1  
ATOM 1168  H HE   . ARG A 1 69  ? -0.145  4.636   20.456  1.00 0.00 ? 69  ARG A HE   1  
ATOM 1169  H HH11 . ARG A 1 69  ? -3.467  3.581   19.661  1.00 0.00 ? 69  ARG A HH11 1  
ATOM 1170  H HH12 . ARG A 1 69  ? -4.216  5.000   20.314  1.00 0.00 ? 69  ARG A HH12 1  
ATOM 1171  H HH21 . ARG A 1 69  ? -1.173  6.535   21.325  1.00 0.00 ? 69  ARG A HH21 1  
ATOM 1172  H HH22 . ARG A 1 69  ? -2.896  6.699   21.271  1.00 0.00 ? 69  ARG A HH22 1  
ATOM 1173  N N    . ALA A 1 70  ? 1.479   2.044   15.534  1.00 0.00 ? 70  ALA A N    1  
ATOM 1174  C CA   . ALA A 1 70  ? 2.017   3.063   14.601  1.00 0.00 ? 70  ALA A CA   1  
ATOM 1175  C C    . ALA A 1 70  ? 1.120   3.495   13.423  1.00 0.00 ? 70  ALA A C    1  
ATOM 1176  O O    . ALA A 1 70  ? 1.036   4.668   13.061  1.00 0.00 ? 70  ALA A O    1  
ATOM 1177  C CB   . ALA A 1 70  ? 3.332   2.570   13.997  1.00 0.00 ? 70  ALA A CB   1  
ATOM 1178  H H    . ALA A 1 70  ? 2.106   1.275   15.700  1.00 0.00 ? 70  ALA A H    1  
ATOM 1179  H HA   . ALA A 1 70  ? 2.268   3.934   15.200  1.00 0.00 ? 70  ALA A HA   1  
ATOM 1180  H HB1  . ALA A 1 70  ? 3.893   3.384   13.494  1.00 0.00 ? 70  ALA A HB1  1  
ATOM 1181  H HB2  . ALA A 1 70  ? 3.148   1.782   13.241  1.00 0.00 ? 70  ALA A HB2  1  
ATOM 1182  H HB3  . ALA A 1 70  ? 3.964   2.152   14.806  1.00 0.00 ? 70  ALA A HB3  1  
ATOM 1183  N N    . VAL A 1 71  ? 0.385   2.491   12.854  1.00 0.00 ? 71  VAL A N    1  
ATOM 1184  C CA   . VAL A 1 71  ? -0.710  2.511   11.867  1.00 0.00 ? 71  VAL A CA   1  
ATOM 1185  C C    . VAL A 1 71  ? -1.850  3.450   12.232  1.00 0.00 ? 71  VAL A C    1  
ATOM 1186  O O    . VAL A 1 71  ? -2.389  4.093   11.341  1.00 0.00 ? 71  VAL A O    1  
ATOM 1187  C CB   . VAL A 1 71  ? -1.268  1.113   11.539  1.00 0.00 ? 71  VAL A CB   1  
ATOM 1188  C CG1  . VAL A 1 71  ? -2.621  1.088   10.777  1.00 0.00 ? 71  VAL A CG1  1  
ATOM 1189  C CG2  . VAL A 1 71  ? -0.237  0.423   10.641  1.00 0.00 ? 71  VAL A CG2  1  
ATOM 1190  H H    . VAL A 1 71  ? 0.624   1.584   13.176  1.00 0.00 ? 71  VAL A H    1  
ATOM 1191  H HA   . VAL A 1 71  ? -0.298  2.902   10.949  1.00 0.00 ? 71  VAL A HA   1  
ATOM 1192  H HB   . VAL A 1 71  ? -1.386  0.527   12.481  1.00 0.00 ? 71  VAL A HB   1  
ATOM 1193  H HG11 . VAL A 1 71  ? -2.580  1.743   9.881   1.00 0.00 ? 71  VAL A HG11 1  
ATOM 1194  H HG12 . VAL A 1 71  ? -2.829  0.049   10.439  1.00 0.00 ? 71  VAL A HG12 1  
ATOM 1195  H HG13 . VAL A 1 71  ? -3.471  1.398   11.419  1.00 0.00 ? 71  VAL A HG13 1  
ATOM 1196  H HG21 . VAL A 1 71  ? 0.753   0.380   11.140  1.00 0.00 ? 71  VAL A HG21 1  
ATOM 1197  H HG22 . VAL A 1 71  ? -0.551  -0.619  10.420  1.00 0.00 ? 71  VAL A HG22 1  
ATOM 1198  H HG23 . VAL A 1 71  ? -0.132  0.966   9.677   1.00 0.00 ? 71  VAL A HG23 1  
ATOM 1199  N N    . ASP A 1 72  ? -2.194  3.630   13.554  1.00 0.00 ? 72  ASP A N    1  
ATOM 1200  C CA   . ASP A 1 72  ? -3.171  4.599   14.095  1.00 0.00 ? 72  ASP A CA   1  
ATOM 1201  C C    . ASP A 1 72  ? -2.802  6.058   13.720  1.00 0.00 ? 72  ASP A C    1  
ATOM 1202  O O    . ASP A 1 72  ? -3.639  6.826   13.259  1.00 0.00 ? 72  ASP A O    1  
ATOM 1203  C CB   . ASP A 1 72  ? -3.412  4.318   15.622  1.00 0.00 ? 72  ASP A CB   1  
ATOM 1204  C CG   . ASP A 1 72  ? -4.368  5.296   16.320  1.00 0.00 ? 72  ASP A CG   1  
ATOM 1205  O OD1  . ASP A 1 72  ? -5.563  5.342   15.923  1.00 0.00 ? 72  ASP A OD1  1  
ATOM 1206  O OD2  . ASP A 1 72  ? -3.909  6.008   17.253  1.00 0.00 ? 72  ASP A OD2  1  
ATOM 1207  H H    . ASP A 1 72  ? -1.714  3.094   14.254  1.00 0.00 ? 72  ASP A H    1  
ATOM 1208  H HA   . ASP A 1 72  ? -4.113  4.412   13.595  1.00 0.00 ? 72  ASP A HA   1  
ATOM 1209  H HB2  . ASP A 1 72  ? -3.867  3.304   15.696  1.00 0.00 ? 72  ASP A HB2  1  
ATOM 1210  H HB3  . ASP A 1 72  ? -2.451  4.254   16.178  1.00 0.00 ? 72  ASP A HB3  1  
ATOM 1211  N N    . PHE A 1 73  ? -1.487  6.393   13.797  1.00 0.00 ? 73  PHE A N    1  
ATOM 1212  C CA   . PHE A 1 73  ? -0.792  7.592   13.301  1.00 0.00 ? 73  PHE A CA   1  
ATOM 1213  C C    . PHE A 1 73  ? -0.731  7.666   11.747  1.00 0.00 ? 73  PHE A C    1  
ATOM 1214  O O    . PHE A 1 73  ? -1.175  8.663   11.182  1.00 0.00 ? 73  PHE A O    1  
ATOM 1215  C CB   . PHE A 1 73  ? 0.659   7.665   13.912  1.00 0.00 ? 73  PHE A CB   1  
ATOM 1216  C CG   . PHE A 1 73  ? 0.816   7.144   15.346  1.00 0.00 ? 73  PHE A CG   1  
ATOM 1217  C CD1  . PHE A 1 73  ? -0.183  7.256   16.308  1.00 0.00 ? 73  PHE A CD1  1  
ATOM 1218  C CD2  . PHE A 1 73  ? 2.018   6.571   15.757  1.00 0.00 ? 73  PHE A CD2  1  
ATOM 1219  C CE1  . PHE A 1 73  ? 0.004   6.816   17.604  1.00 0.00 ? 73  PHE A CE1  1  
ATOM 1220  C CE2  . PHE A 1 73  ? 2.208   6.127   17.051  1.00 0.00 ? 73  PHE A CE2  1  
ATOM 1221  C CZ   . PHE A 1 73  ? 1.200   6.251   17.980  1.00 0.00 ? 73  PHE A CZ   1  
ATOM 1222  H H    . PHE A 1 73  ? -0.900  5.720   14.248  1.00 0.00 ? 73  PHE A H    1  
ATOM 1223  H HA   . PHE A 1 73  ? -1.353  8.493   13.566  1.00 0.00 ? 73  PHE A HA   1  
ATOM 1224  H HB2  . PHE A 1 73  ? 1.336   7.046   13.288  1.00 0.00 ? 73  PHE A HB2  1  
ATOM 1225  H HB3  . PHE A 1 73  ? 1.020   8.715   13.897  1.00 0.00 ? 73  PHE A HB3  1  
ATOM 1226  H HD1  . PHE A 1 73  ? -1.132  7.714   16.065  1.00 0.00 ? 73  PHE A HD1  1  
ATOM 1227  H HD2  . PHE A 1 73  ? 2.848   6.451   15.079  1.00 0.00 ? 73  PHE A HD2  1  
ATOM 1228  H HE1  . PHE A 1 73  ? -0.790  6.932   18.330  1.00 0.00 ? 73  PHE A HE1  1  
ATOM 1229  H HE2  . PHE A 1 73  ? 3.156   5.689   17.338  1.00 0.00 ? 73  PHE A HE2  1  
ATOM 1230  H HZ   . PHE A 1 73  ? 1.348   5.908   18.995  1.00 0.00 ? 73  PHE A HZ   1  
ATOM 1231  N N    . LEU A 1 74  ? -0.224  6.614   11.006  1.00 0.00 ? 74  LEU A N    1  
ATOM 1232  C CA   . LEU A 1 74  ? -0.185  6.506   9.502   1.00 0.00 ? 74  LEU A CA   1  
ATOM 1233  C C    . LEU A 1 74  ? -1.491  6.763   8.769   1.00 0.00 ? 74  LEU A C    1  
ATOM 1234  O O    . LEU A 1 74  ? -1.589  7.610   7.884   1.00 0.00 ? 74  LEU A O    1  
ATOM 1235  C CB   . LEU A 1 74  ? 0.105   5.021   9.031   1.00 0.00 ? 74  LEU A CB   1  
ATOM 1236  C CG   . LEU A 1 74  ? 0.626   4.887   7.578   1.00 0.00 ? 74  LEU A CG   1  
ATOM 1237  C CD1  . LEU A 1 74  ? 2.085   5.318   7.498   1.00 0.00 ? 74  LEU A CD1  1  
ATOM 1238  C CD2  . LEU A 1 74  ? 0.406   3.473   7.011   1.00 0.00 ? 74  LEU A CD2  1  
ATOM 1239  H H    . LEU A 1 74  ? 0.170   5.851   11.551  1.00 0.00 ? 74  LEU A H    1  
ATOM 1240  H HA   . LEU A 1 74  ? 0.530   7.215   9.056   1.00 0.00 ? 74  LEU A HA   1  
ATOM 1241  H HB2  . LEU A 1 74  ? 0.875   4.580   9.701   1.00 0.00 ? 74  LEU A HB2  1  
ATOM 1242  H HB3  . LEU A 1 74  ? -0.798  4.332   9.103   1.00 0.00 ? 74  LEU A HB3  1  
ATOM 1243  H HG   . LEU A 1 74  ? 0.060   5.578   6.916   1.00 0.00 ? 74  LEU A HG   1  
ATOM 1244  H HD11 . LEU A 1 74  ? 2.696   4.700   8.187   1.00 0.00 ? 74  LEU A HD11 1  
ATOM 1245  H HD12 . LEU A 1 74  ? 2.482   5.202   6.470   1.00 0.00 ? 74  LEU A HD12 1  
ATOM 1246  H HD13 . LEU A 1 74  ? 2.181   6.377   7.815   1.00 0.00 ? 74  LEU A HD13 1  
ATOM 1247  H HD21 . LEU A 1 74  ? 0.859   2.714   7.674   1.00 0.00 ? 74  LEU A HD21 1  
ATOM 1248  H HD22 . LEU A 1 74  ? -0.684  3.269   6.939   1.00 0.00 ? 74  LEU A HD22 1  
ATOM 1249  H HD23 . LEU A 1 74  ? 0.847   3.380   5.994   1.00 0.00 ? 74  LEU A HD23 1  
ATOM 1250  N N    . ALA A 1 75  ? -2.526  6.008   9.183   1.00 0.00 ? 75  ALA A N    1  
ATOM 1251  C CA   . ALA A 1 75  ? -3.839  5.894   8.625   1.00 0.00 ? 75  ALA A CA   1  
ATOM 1252  C C    . ALA A 1 75  ? -4.757  7.109   8.743   1.00 0.00 ? 75  ALA A C    1  
ATOM 1253  O O    . ALA A 1 75  ? -5.759  7.194   8.043   1.00 0.00 ? 75  ALA A O    1  
ATOM 1254  C CB   . ALA A 1 75  ? -4.358  4.546   9.142   1.00 0.00 ? 75  ALA A CB   1  
ATOM 1255  H H    . ALA A 1 75  ? -2.388  5.334   9.917   1.00 0.00 ? 75  ALA A H    1  
ATOM 1256  H HA   . ALA A 1 75  ? -3.712  5.756   7.558   1.00 0.00 ? 75  ALA A HA   1  
ATOM 1257  H HB1  . ALA A 1 75  ? -5.230  4.190   8.558   1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1258  H HB2  . ALA A 1 75  ? -3.504  3.819   9.027   1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1259  H HB3  . ALA A 1 75  ? -4.613  4.601   10.221  1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1260  N N    . ALA A 1 76  ? -4.399  8.133   9.579   1.00 0.00 ? 76  ALA A N    1  
ATOM 1261  C CA   . ALA A 1 76  ? -5.093  9.407   9.651   1.00 0.00 ? 76  ALA A CA   1  
ATOM 1262  C C    . ALA A 1 76  ? -4.564  10.418  8.609   1.00 0.00 ? 76  ALA A C    1  
ATOM 1263  O O    . ALA A 1 76  ? -5.168  11.464  8.394   1.00 0.00 ? 76  ALA A O    1  
ATOM 1264  C CB   . ALA A 1 76  ? -4.953  9.961   11.087  1.00 0.00 ? 76  ALA A CB   1  
ATOM 1265  H H    . ALA A 1 76  ? -3.594  8.107   10.178  1.00 0.00 ? 76  ALA A H    1  
ATOM 1266  H HA   . ALA A 1 76  ? -6.148  9.272   9.449   1.00 0.00 ? 76  ALA A HA   1  
ATOM 1267  H HB1  . ALA A 1 76  ? -3.884  10.070  11.370  1.00 0.00 ? 76  ALA A HB1  1  
ATOM 1268  H HB2  . ALA A 1 76  ? -5.423  9.250   11.803  1.00 0.00 ? 76  ALA A HB2  1  
ATOM 1269  H HB3  . ALA A 1 76  ? -5.457  10.945  11.197  1.00 0.00 ? 76  ALA A HB3  1  
ATOM 1270  N N    . ASN A 1 77  ? -3.422  10.119  7.932   1.00 0.00 ? 77  ASN A N    1  
ATOM 1271  C CA   . ASN A 1 77  ? -2.803  11.006  6.951   1.00 0.00 ? 77  ASN A CA   1  
ATOM 1272  C C    . ASN A 1 77  ? -2.176  10.370  5.708   1.00 0.00 ? 77  ASN A C    1  
ATOM 1273  O O    . ASN A 1 77  ? -2.030  11.055  4.695   1.00 0.00 ? 77  ASN A O    1  
ATOM 1274  C CB   . ASN A 1 77  ? -1.799  11.995  7.622   1.00 0.00 ? 77  ASN A CB   1  
ATOM 1275  C CG   . ASN A 1 77  ? -0.751  11.414  8.583   1.00 0.00 ? 77  ASN A CG   1  
ATOM 1276  O OD1  . ASN A 1 77  ? -0.364  12.136  9.501   1.00 0.00 ? 77  ASN A OD1  1  
ATOM 1277  N ND2  . ASN A 1 77  ? -0.229  10.186  8.395   1.00 0.00 ? 77  ASN A ND2  1  
ATOM 1278  H H    . ASN A 1 77  ? -2.965  9.255   8.131   1.00 0.00 ? 77  ASN A H    1  
ATOM 1279  H HA   . ASN A 1 77  ? -3.574  11.637  6.521   1.00 0.00 ? 77  ASN A HA   1  
ATOM 1280  H HB2  . ASN A 1 77  ? -1.278  12.624  6.870   1.00 0.00 ? 77  ASN A HB2  1  
ATOM 1281  H HB3  . ASN A 1 77  ? -2.407  12.690  8.245   1.00 0.00 ? 77  ASN A HB3  1  
ATOM 1282  H HD21 . ASN A 1 77  ? -0.658  9.530   7.779   1.00 0.00 ? 77  ASN A HD21 1  
ATOM 1283  H HD22 . ASN A 1 77  ? 0.380   9.845   9.102   1.00 0.00 ? 77  ASN A HD22 1  
ATOM 1284  N N    . GLU A 1 78  ? -1.752  9.078   5.706   1.00 0.00 ? 78  GLU A N    1  
ATOM 1285  C CA   . GLU A 1 78  ? -1.041  8.505   4.567   1.00 0.00 ? 78  GLU A CA   1  
ATOM 1286  C C    . GLU A 1 78  ? -1.324  7.023   4.333   1.00 0.00 ? 78  GLU A C    1  
ATOM 1287  O O    . GLU A 1 78  ? -1.400  6.201   5.243   1.00 0.00 ? 78  GLU A O    1  
ATOM 1288  C CB   . GLU A 1 78  ? 0.502   8.710   4.734   1.00 0.00 ? 78  GLU A CB   1  
ATOM 1289  C CG   . GLU A 1 78  ? 1.336   8.419   3.465   1.00 0.00 ? 78  GLU A CG   1  
ATOM 1290  C CD   . GLU A 1 78  ? 2.807   8.785   3.657   1.00 0.00 ? 78  GLU A CD   1  
ATOM 1291  O OE1  . GLU A 1 78  ? 3.085   9.938   4.082   1.00 0.00 ? 78  GLU A OE1  1  
ATOM 1292  O OE2  . GLU A 1 78  ? 3.672   7.917   3.365   1.00 0.00 ? 78  GLU A OE2  1  
ATOM 1293  H H    . GLU A 1 78  ? -1.846  8.445   6.492   1.00 0.00 ? 78  GLU A H    1  
ATOM 1294  H HA   . GLU A 1 78  ? -1.346  9.010   3.657   1.00 0.00 ? 78  GLU A HA   1  
ATOM 1295  H HB2  . GLU A 1 78  ? 0.658   9.781   5.003   1.00 0.00 ? 78  GLU A HB2  1  
ATOM 1296  H HB3  . GLU A 1 78  ? 0.878   8.096   5.582   1.00 0.00 ? 78  GLU A HB3  1  
ATOM 1297  H HG2  . GLU A 1 78  ? 1.266   7.344   3.191   1.00 0.00 ? 78  GLU A HG2  1  
ATOM 1298  H HG3  . GLU A 1 78  ? 0.928   9.017   2.625   1.00 0.00 ? 78  GLU A HG3  1  
ATOM 1299  N N    . SER A 1 79  ? -1.411  6.660   3.032   1.00 0.00 ? 79  SER A N    1  
ATOM 1300  C CA   . SER A 1 79  ? -1.523  5.309   2.495   1.00 0.00 ? 79  SER A CA   1  
ATOM 1301  C C    . SER A 1 79  ? -1.013  5.394   1.060   1.00 0.00 ? 79  SER A C    1  
ATOM 1302  O O    . SER A 1 79  ? -1.802  5.352   0.119   1.00 0.00 ? 79  SER A O    1  
ATOM 1303  C CB   . SER A 1 79  ? -2.969  4.713   2.545   1.00 0.00 ? 79  SER A CB   1  
ATOM 1304  O OG   . SER A 1 79  ? -3.019  3.319   2.210   1.00 0.00 ? 79  SER A OG   1  
ATOM 1305  H H    . SER A 1 79  ? -1.339  7.393   2.361   1.00 0.00 ? 79  SER A H    1  
ATOM 1306  H HA   . SER A 1 79  ? -0.858  4.650   3.039   1.00 0.00 ? 79  SER A HA   1  
ATOM 1307  H HB2  . SER A 1 79  ? -3.345  4.819   3.590   1.00 0.00 ? 79  SER A HB2  1  
ATOM 1308  H HB3  . SER A 1 79  ? -3.662  5.287   1.892   1.00 0.00 ? 79  SER A HB3  1  
ATOM 1309  H HG   . SER A 1 79  ? -2.707  3.223   1.297   1.00 0.00 ? 79  SER A HG   1  
ATOM 1310  N N    . ARG A 1 80  ? 0.329   5.524   0.856   1.00 0.00 ? 80  ARG A N    1  
ATOM 1311  C CA   . ARG A 1 80  ? 0.986   5.687   -0.441  1.00 0.00 ? 80  ARG A CA   1  
ATOM 1312  C C    . ARG A 1 80  ? 1.482   4.352   -1.062  1.00 0.00 ? 80  ARG A C    1  
ATOM 1313  O O    . ARG A 1 80  ? 2.523   4.317   -1.728  1.00 0.00 ? 80  ARG A O    1  
ATOM 1314  C CB   . ARG A 1 80  ? 2.100   6.769   -0.304  1.00 0.00 ? 80  ARG A CB   1  
ATOM 1315  C CG   . ARG A 1 80  ? 2.081   7.847   -1.413  1.00 0.00 ? 80  ARG A CG   1  
ATOM 1316  C CD   . ARG A 1 80  ? 0.867   8.794   -1.407  1.00 0.00 ? 80  ARG A CD   1  
ATOM 1317  N NE   . ARG A 1 80  ? 0.845   9.586   -0.126  1.00 0.00 ? 80  ARG A NE   1  
ATOM 1318  C CZ   . ARG A 1 80  ? -0.124  10.512  0.158   1.00 0.00 ? 80  ARG A CZ   1  
ATOM 1319  N NH1  . ARG A 1 80  ? -1.135  10.760  -0.724  1.00 0.00 ? 80  ARG A NH1  1  
ATOM 1320  N NH2  . ARG A 1 80  ? -0.079  11.196  1.339   1.00 0.00 ? 80  ARG A NH2  1  
ATOM 1321  H H    . ARG A 1 80  ? 0.945   5.557   1.639   1.00 0.00 ? 80  ARG A H    1  
ATOM 1322  H HA   . ARG A 1 80  ? 0.286   6.135   -1.146  1.00 0.00 ? 80  ARG A HA   1  
ATOM 1323  H HB2  . ARG A 1 80  ? 1.973   7.289   0.670   1.00 0.00 ? 80  ARG A HB2  1  
ATOM 1324  H HB3  . ARG A 1 80  ? 3.110   6.310   -0.285  1.00 0.00 ? 80  ARG A HB3  1  
ATOM 1325  H HG2  . ARG A 1 80  ? 3.007   8.461   -1.329  1.00 0.00 ? 80  ARG A HG2  1  
ATOM 1326  H HG3  . ARG A 1 80  ? 2.120   7.335   -2.400  1.00 0.00 ? 80  ARG A HG3  1  
ATOM 1327  H HD2  . ARG A 1 80  ? 0.956   9.503   -2.259  1.00 0.00 ? 80  ARG A HD2  1  
ATOM 1328  H HD3  . ARG A 1 80  ? -0.081  8.220   -1.501  1.00 0.00 ? 80  ARG A HD3  1  
ATOM 1329  H HE   . ARG A 1 80  ? 1.569   9.427   0.545   1.00 0.00 ? 80  ARG A HE   1  
ATOM 1330  H HH11 . ARG A 1 80  ? -1.172  10.265  -1.592  1.00 0.00 ? 80  ARG A HH11 1  
ATOM 1331  H HH12 . ARG A 1 80  ? -1.833  11.441  -0.504  1.00 0.00 ? 80  ARG A HH12 1  
ATOM 1332  H HH21 . ARG A 1 80  ? 0.660   11.019  1.990   1.00 0.00 ? 80  ARG A HH21 1  
ATOM 1333  H HH22 . ARG A 1 80  ? -0.782  11.874  1.551   1.00 0.00 ? 80  ARG A HH22 1  
ATOM 1334  N N    . VAL A 1 81  ? 0.702   3.240   -0.841  1.00 0.00 ? 81  VAL A N    1  
ATOM 1335  C CA   . VAL A 1 81  ? 0.799   1.876   -1.353  1.00 0.00 ? 81  VAL A CA   1  
ATOM 1336  C C    . VAL A 1 81  ? -0.675  1.468   -1.227  1.00 0.00 ? 81  VAL A C    1  
ATOM 1337  O O    . VAL A 1 81  ? -1.387  2.047   -0.407  1.00 0.00 ? 81  VAL A O    1  
ATOM 1338  C CB   . VAL A 1 81  ? 1.796   0.966   -0.588  1.00 0.00 ? 81  VAL A CB   1  
ATOM 1339  C CG1  . VAL A 1 81  ? 1.247   -0.412  -0.162  1.00 0.00 ? 81  VAL A CG1  1  
ATOM 1340  C CG2  . VAL A 1 81  ? 3.051   0.707   -1.449  1.00 0.00 ? 81  VAL A CG2  1  
ATOM 1341  H H    . VAL A 1 81  ? -0.139  3.276   -0.286  1.00 0.00 ? 81  VAL A H    1  
ATOM 1342  H HA   . VAL A 1 81  ? 1.047   1.895   -2.405  1.00 0.00 ? 81  VAL A HA   1  
ATOM 1343  H HB   . VAL A 1 81  ? 2.094   1.509   0.340   1.00 0.00 ? 81  VAL A HB   1  
ATOM 1344  H HG11 . VAL A 1 81  ? 0.907   -1.013  -1.036  1.00 0.00 ? 81  VAL A HG11 1  
ATOM 1345  H HG12 . VAL A 1 81  ? 2.049   -0.986  0.345   1.00 0.00 ? 81  VAL A HG12 1  
ATOM 1346  H HG13 . VAL A 1 81  ? 0.409   -0.290  0.549   1.00 0.00 ? 81  VAL A HG13 1  
ATOM 1347  H HG21 . VAL A 1 81  ? 3.405   1.638   -1.938  1.00 0.00 ? 81  VAL A HG21 1  
ATOM 1348  H HG22 . VAL A 1 81  ? 3.892   0.308   -0.835  1.00 0.00 ? 81  VAL A HG22 1  
ATOM 1349  H HG23 . VAL A 1 81  ? 2.860   -0.063  -2.227  1.00 0.00 ? 81  VAL A HG23 1  
ATOM 1350  N N    . ARG A 1 82  ? -1.172  0.493   -2.028  1.00 0.00 ? 82  ARG A N    1  
ATOM 1351  C CA   . ARG A 1 82  ? -2.525  -0.065  -2.067  1.00 0.00 ? 82  ARG A CA   1  
ATOM 1352  C C    . ARG A 1 82  ? -2.654  -1.363  -1.264  1.00 0.00 ? 82  ARG A C    1  
ATOM 1353  O O    . ARG A 1 82  ? -1.791  -2.238  -1.359  1.00 0.00 ? 82  ARG A O    1  
ATOM 1354  C CB   . ARG A 1 82  ? -2.872  -0.418  -3.546  1.00 0.00 ? 82  ARG A CB   1  
ATOM 1355  C CG   . ARG A 1 82  ? -4.271  -1.006  -3.820  1.00 0.00 ? 82  ARG A CG   1  
ATOM 1356  C CD   . ARG A 1 82  ? -4.478  -1.278  -5.317  1.00 0.00 ? 82  ARG A CD   1  
ATOM 1357  N NE   . ARG A 1 82  ? -5.827  -1.914  -5.512  1.00 0.00 ? 82  ARG A NE   1  
ATOM 1358  C CZ   . ARG A 1 82  ? -6.216  -2.498  -6.688  1.00 0.00 ? 82  ARG A CZ   1  
ATOM 1359  N NH1  . ARG A 1 82  ? -5.372  -2.549  -7.759  1.00 0.00 ? 82  ARG A NH1  1  
ATOM 1360  N NH2  . ARG A 1 82  ? -7.465  -3.040  -6.788  1.00 0.00 ? 82  ARG A NH2  1  
ATOM 1361  H H    . ARG A 1 82  ? -0.544  0.047   -2.673  1.00 0.00 ? 82  ARG A H    1  
ATOM 1362  H HA   . ARG A 1 82  ? -3.235  0.655   -1.685  1.00 0.00 ? 82  ARG A HA   1  
ATOM 1363  H HB2  . ARG A 1 82  ? -2.779  0.509   -4.143  1.00 0.00 ? 82  ARG A HB2  1  
ATOM 1364  H HB3  . ARG A 1 82  ? -2.111  -1.128  -3.951  1.00 0.00 ? 82  ARG A HB3  1  
ATOM 1365  H HG2  . ARG A 1 82  ? -4.394  -1.976  -3.288  1.00 0.00 ? 82  ARG A HG2  1  
ATOM 1366  H HG3  . ARG A 1 82  ? -5.048  -0.302  -3.451  1.00 0.00 ? 82  ARG A HG3  1  
ATOM 1367  H HD2  . ARG A 1 82  ? -4.438  -0.328  -5.890  1.00 0.00 ? 82  ARG A HD2  1  
ATOM 1368  H HD3  . ARG A 1 82  ? -3.683  -1.972  -5.672  1.00 0.00 ? 82  ARG A HD3  1  
ATOM 1369  H HE   . ARG A 1 82  ? -6.472  -1.901  -4.748  1.00 0.00 ? 82  ARG A HE   1  
ATOM 1370  H HH11 . ARG A 1 82  ? -4.454  -2.159  -7.691  1.00 0.00 ? 82  ARG A HH11 1  
ATOM 1371  H HH12 . ARG A 1 82  ? -5.669  -2.982  -8.610  1.00 0.00 ? 82  ARG A HH12 1  
ATOM 1372  H HH21 . ARG A 1 82  ? -8.087  -3.009  -6.005  1.00 0.00 ? 82  ARG A HH21 1  
ATOM 1373  H HH22 . ARG A 1 82  ? -7.756  -3.471  -7.641  1.00 0.00 ? 82  ARG A HH22 1  
ATOM 1374  N N    . THR A 1 83  ? -3.766  -1.553  -0.494  1.00 0.00 ? 83  THR A N    1  
ATOM 1375  C CA   . THR A 1 83  ? -4.078  -2.780  0.256   1.00 0.00 ? 83  THR A CA   1  
ATOM 1376  C C    . THR A 1 83  ? -5.066  -3.609  -0.556  1.00 0.00 ? 83  THR A C    1  
ATOM 1377  O O    . THR A 1 83  ? -6.106  -3.126  -1.005  1.00 0.00 ? 83  THR A O    1  
ATOM 1378  C CB   . THR A 1 83  ? -4.627  -2.604  1.690   1.00 0.00 ? 83  THR A CB   1  
ATOM 1379  O OG1  . THR A 1 83  ? -4.415  -1.284  2.173   1.00 0.00 ? 83  THR A OG1  1  
ATOM 1380  C CG2  . THR A 1 83  ? -3.901  -3.579  2.639   1.00 0.00 ? 83  THR A CG2  1  
ATOM 1381  H H    . THR A 1 83  ? -4.465  -0.845  -0.430  1.00 0.00 ? 83  THR A H    1  
ATOM 1382  H HA   . THR A 1 83  ? -3.172  -3.365  0.359   1.00 0.00 ? 83  THR A HA   1  
ATOM 1383  H HB   . THR A 1 83  ? -5.712  -2.841  1.785   1.00 0.00 ? 83  THR A HB   1  
ATOM 1384  H HG1  . THR A 1 83  ? -4.608  -1.316  3.116   1.00 0.00 ? 83  THR A HG1  1  
ATOM 1385  H HG21 . THR A 1 83  ? -3.999  -4.621  2.270   1.00 0.00 ? 83  THR A HG21 1  
ATOM 1386  H HG22 . THR A 1 83  ? -2.818  -3.342  2.696   1.00 0.00 ? 83  THR A HG22 1  
ATOM 1387  H HG23 . THR A 1 83  ? -4.330  -3.528  3.661   1.00 0.00 ? 83  THR A HG23 1  
ATOM 1388  N N    . GLU A 1 84  ? -4.753  -4.910  -0.742  1.00 0.00 ? 84  GLU A N    1  
ATOM 1389  C CA   . GLU A 1 84  ? -5.558  -5.847  -1.506  1.00 0.00 ? 84  GLU A CA   1  
ATOM 1390  C C    . GLU A 1 84  ? -5.497  -7.247  -0.890  1.00 0.00 ? 84  GLU A C    1  
ATOM 1391  O O    . GLU A 1 84  ? -4.465  -7.656  -0.358  1.00 0.00 ? 84  GLU A O    1  
ATOM 1392  C CB   . GLU A 1 84  ? -4.984  -5.852  -2.954  1.00 0.00 ? 84  GLU A CB   1  
ATOM 1393  C CG   . GLU A 1 84  ? -5.673  -6.802  -3.950  1.00 0.00 ? 84  GLU A CG   1  
ATOM 1394  C CD   . GLU A 1 84  ? -5.158  -6.484  -5.351  1.00 0.00 ? 84  GLU A CD   1  
ATOM 1395  O OE1  . GLU A 1 84  ? -3.966  -6.782  -5.627  1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1396  O OE2  . GLU A 1 84  ? -5.949  -5.938  -6.164  1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1397  H H    . GLU A 1 84  ? -3.898  -5.295  -0.382  1.00 0.00 ? 84  GLU A H    1  
ATOM 1398  H HA   . GLU A 1 84  ? -6.601  -5.549  -1.519  1.00 0.00 ? 84  GLU A HA   1  
ATOM 1399  H HB2  . GLU A 1 84  ? -5.158  -4.796  -3.343  1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1400  H HB3  . GLU A 1 84  ? -3.886  -6.135  -2.898  1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1401  H HG2  . GLU A 1 84  ? -5.385  -7.871  -3.710  1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1402  H HG3  . GLU A 1 84  ? -6.782  -6.586  -3.912  1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1403  N N    . THR A 1 85  ? -6.599  -8.046  -0.991  1.00 0.00 ? 85  THR A N    1  
ATOM 1404  C CA   . THR A 1 85  ? -6.679  -9.468  -0.608  1.00 0.00 ? 85  THR A CA   1  
ATOM 1405  C C    . THR A 1 85  ? -6.521  -10.261 -1.904  1.00 0.00 ? 85  THR A C    1  
ATOM 1406  O O    . THR A 1 85  ? -7.327  -10.118 -2.822  1.00 0.00 ? 85  THR A O    1  
ATOM 1407  C CB   . THR A 1 85  ? -7.965  -9.886  0.132   1.00 0.00 ? 85  THR A CB   1  
ATOM 1408  O OG1  . THR A 1 85  ? -8.660  -8.765  0.667   1.00 0.00 ? 85  THR A OG1  1  
ATOM 1409  C CG2  . THR A 1 85  ? -7.553  -10.777 1.317   1.00 0.00 ? 85  THR A CG2  1  
ATOM 1410  H H    . THR A 1 85  ? -7.442  -7.701  -1.391  1.00 0.00 ? 85  THR A H    1  
ATOM 1411  H HA   . THR A 1 85  ? -5.843  -9.710  0.035   1.00 0.00 ? 85  THR A HA   1  
ATOM 1412  H HB   . THR A 1 85  ? -8.689  -10.434 -0.516  1.00 0.00 ? 85  THR A HB   1  
ATOM 1413  H HG1  . THR A 1 85  ? -9.514  -9.082  0.980   1.00 0.00 ? 85  THR A HG1  1  
ATOM 1414  H HG21 . THR A 1 85  ? -6.837  -10.230 1.973   1.00 0.00 ? 85  THR A HG21 1  
ATOM 1415  H HG22 . THR A 1 85  ? -8.433  -11.077 1.920   1.00 0.00 ? 85  THR A HG22 1  
ATOM 1416  H HG23 . THR A 1 85  ? -7.040  -11.691 0.951   1.00 0.00 ? 85  THR A HG23 1  
ATOM 1417  N N    . ARG A 1 86  ? -5.451  -11.073 -2.065  1.00 0.00 ? 86  ARG A N    1  
ATOM 1418  C CA   . ARG A 1 86  ? -5.140  -11.701 -3.351  1.00 0.00 ? 86  ARG A CA   1  
ATOM 1419  C C    . ARG A 1 86  ? -4.875  -13.179 -3.153  1.00 0.00 ? 86  ARG A C    1  
ATOM 1420  O O    . ARG A 1 86  ? -4.370  -13.589 -2.111  1.00 0.00 ? 86  ARG A O    1  
ATOM 1421  C CB   . ARG A 1 86  ? -3.946  -10.927 -3.993  1.00 0.00 ? 86  ARG A CB   1  
ATOM 1422  C CG   . ARG A 1 86  ? -3.528  -11.348 -5.418  1.00 0.00 ? 86  ARG A CG   1  
ATOM 1423  C CD   . ARG A 1 86  ? -4.643  -11.258 -6.482  1.00 0.00 ? 86  ARG A CD   1  
ATOM 1424  N NE   . ARG A 1 86  ? -4.879  -9.824  -6.875  1.00 0.00 ? 86  ARG A NE   1  
ATOM 1425  C CZ   . ARG A 1 86  ? -5.703  -9.477  -7.914  1.00 0.00 ? 86  ARG A CZ   1  
ATOM 1426  N NH1  . ARG A 1 86  ? -6.428  -10.424 -8.579  1.00 0.00 ? 86  ARG A NH1  1  
ATOM 1427  N NH2  . ARG A 1 86  ? -5.793  -8.171  -8.298  1.00 0.00 ? 86  ARG A NH2  1  
ATOM 1428  H H    . ARG A 1 86  ? -4.786  -11.215 -1.326  1.00 0.00 ? 86  ARG A H    1  
ATOM 1429  H HA   . ARG A 1 86  ? -5.971  -11.640 -4.045  1.00 0.00 ? 86  ARG A HA   1  
ATOM 1430  H HB2  . ARG A 1 86  ? -4.336  -9.853  -4.118  1.00 0.00 ? 86  ARG A HB2  1  
ATOM 1431  H HB3  . ARG A 1 86  ? -3.032  -11.074 -3.311  1.00 0.00 ? 86  ARG A HB3  1  
ATOM 1432  H HG2  . ARG A 1 86  ? -2.682  -10.676 -5.746  1.00 0.00 ? 86  ARG A HG2  1  
ATOM 1433  H HG3  . ARG A 1 86  ? -3.183  -12.419 -5.367  1.00 0.00 ? 86  ARG A HG3  1  
ATOM 1434  H HD2  . ARG A 1 86  ? -4.323  -11.825 -7.380  1.00 0.00 ? 86  ARG A HD2  1  
ATOM 1435  H HD3  . ARG A 1 86  ? -5.603  -11.677 -6.123  1.00 0.00 ? 86  ARG A HD3  1  
ATOM 1436  H HE   . ARG A 1 86  ? -4.362  -9.107  -6.408  1.00 0.00 ? 86  ARG A HE   1  
ATOM 1437  H HH11 . ARG A 1 86  ? -6.363  -11.384 -8.306  1.00 0.00 ? 86  ARG A HH11 1  
ATOM 1438  H HH12 . ARG A 1 86  ? -7.022  -10.157 -9.337  1.00 0.00 ? 86  ARG A HH12 1  
ATOM 1439  H HH21 . ARG A 1 86  ? -5.264  -7.471  -7.817  1.00 0.00 ? 86  ARG A HH21 1  
ATOM 1440  H HH22 . ARG A 1 86  ? -6.391  -7.913  -9.057  1.00 0.00 ? 86  ARG A HH22 1  
ATOM 1441  N N    . ARG A 1 87  ? -5.216  -14.042 -4.155  1.00 0.00 ? 87  ARG A N    1  
ATOM 1442  C CA   . ARG A 1 87  ? -5.025  -15.489 -4.113  1.00 0.00 ? 87  ARG A CA   1  
ATOM 1443  C C    . ARG A 1 87  ? -3.654  -15.914 -4.649  1.00 0.00 ? 87  ARG A C    1  
ATOM 1444  O O    . ARG A 1 87  ? -3.322  -15.643 -5.800  1.00 0.00 ? 87  ARG A O    1  
ATOM 1445  C CB   . ARG A 1 87  ? -6.152  -16.232 -4.874  1.00 0.00 ? 87  ARG A CB   1  
ATOM 1446  C CG   . ARG A 1 87  ? -6.237  -17.735 -4.531  1.00 0.00 ? 87  ARG A CG   1  
ATOM 1447  C CD   . ARG A 1 87  ? -7.422  -18.467 -5.187  1.00 0.00 ? 87  ARG A CD   1  
ATOM 1448  N NE   . ARG A 1 87  ? -8.727  -17.878 -4.712  1.00 0.00 ? 87  ARG A NE   1  
ATOM 1449  C CZ   . ARG A 1 87  ? -9.311  -18.168 -3.505  1.00 0.00 ? 87  ARG A CZ   1  
ATOM 1450  N NH1  . ARG A 1 87  ? -8.745  -19.056 -2.638  1.00 0.00 ? 87  ARG A NH1  1  
ATOM 1451  N NH2  . ARG A 1 87  ? -10.482 -17.551 -3.165  1.00 0.00 ? 87  ARG A NH2  1  
ATOM 1452  H H    . ARG A 1 87  ? -5.618  -13.702 -4.997  1.00 0.00 ? 87  ARG A H    1  
ATOM 1453  H HA   . ARG A 1 87  ? -5.124  -15.808 -3.086  1.00 0.00 ? 87  ARG A HA   1  
ATOM 1454  H HB2  . ARG A 1 87  ? -7.110  -15.764 -4.555  1.00 0.00 ? 87  ARG A HB2  1  
ATOM 1455  H HB3  . ARG A 1 87  ? -6.067  -16.087 -5.975  1.00 0.00 ? 87  ARG A HB3  1  
ATOM 1456  H HG2  . ARG A 1 87  ? -5.291  -18.256 -4.822  1.00 0.00 ? 87  ARG A HG2  1  
ATOM 1457  H HG3  . ARG A 1 87  ? -6.345  -17.821 -3.423  1.00 0.00 ? 87  ARG A HG3  1  
ATOM 1458  H HD2  . ARG A 1 87  ? -7.379  -18.341 -6.290  1.00 0.00 ? 87  ARG A HD2  1  
ATOM 1459  H HD3  . ARG A 1 87  ? -7.394  -19.554 -4.954  1.00 0.00 ? 87  ARG A HD3  1  
ATOM 1460  H HE   . ARG A 1 87  ? -9.184  -17.219 -5.310  1.00 0.00 ? 87  ARG A HE   1  
ATOM 1461  H HH11 . ARG A 1 87  ? -7.887  -19.509 -2.878  1.00 0.00 ? 87  ARG A HH11 1  
ATOM 1462  H HH12 . ARG A 1 87  ? -9.187  -19.252 -1.763  1.00 0.00 ? 87  ARG A HH12 1  
ATOM 1463  H HH21 . ARG A 1 87  ? -10.902 -16.898 -3.795  1.00 0.00 ? 87  ARG A HH21 1  
ATOM 1464  H HH22 . ARG A 1 87  ? -10.917 -17.753 -2.288  1.00 0.00 ? 87  ARG A HH22 1  
ATOM 1465  N N    . ILE A 1 88  ? -2.818  -16.588 -3.820  1.00 0.00 ? 88  ILE A N    1  
ATOM 1466  C CA   . ILE A 1 88  ? -1.469  -17.032 -4.174  1.00 0.00 ? 88  ILE A CA   1  
ATOM 1467  C C    . ILE A 1 88  ? -1.329  -18.466 -3.707  1.00 0.00 ? 88  ILE A C    1  
ATOM 1468  O O    . ILE A 1 88  ? -1.571  -18.774 -2.542  1.00 0.00 ? 88  ILE A O    1  
ATOM 1469  C CB   . ILE A 1 88  ? -0.337  -16.142 -3.627  1.00 0.00 ? 88  ILE A CB   1  
ATOM 1470  C CG1  . ILE A 1 88  ? -0.568  -15.617 -2.178  1.00 0.00 ? 88  ILE A CG1  1  
ATOM 1471  C CG2  . ILE A 1 88  ? -0.125  -15.007 -4.652  1.00 0.00 ? 88  ILE A CG2  1  
ATOM 1472  C CD1  . ILE A 1 88  ? -1.180  -14.207 -2.089  1.00 0.00 ? 88  ILE A CD1  1  
ATOM 1473  H H    . ILE A 1 88  ? -3.115  -16.802 -2.869  1.00 0.00 ? 88  ILE A H    1  
ATOM 1474  H HA   . ILE A 1 88  ? -1.364  -17.070 -5.250  1.00 0.00 ? 88  ILE A HA   1  
ATOM 1475  H HB   . ILE A 1 88  ? 0.626   -16.713 -3.619  1.00 0.00 ? 88  ILE A HB   1  
ATOM 1476  H HG12 . ILE A 1 88  ? -1.230  -16.335 -1.630  1.00 0.00 ? 88  ILE A HG12 1  
ATOM 1477  H HG13 . ILE A 1 88  ? 0.431   -15.571 -1.670  1.00 0.00 ? 88  ILE A HG13 1  
ATOM 1478  H HG21 . ILE A 1 88  ? 0.129   -15.432 -5.646  1.00 0.00 ? 88  ILE A HG21 1  
ATOM 1479  H HG22 . ILE A 1 88  ? -1.059  -14.414 -4.758  1.00 0.00 ? 88  ILE A HG22 1  
ATOM 1480  H HG23 . ILE A 1 88  ? 0.699   -14.336 -4.330  1.00 0.00 ? 88  ILE A HG23 1  
ATOM 1481  H HD11 . ILE A 1 88  ? -2.068  -14.131 -2.747  1.00 0.00 ? 88  ILE A HD11 1  
ATOM 1482  H HD12 . ILE A 1 88  ? -1.509  -13.967 -1.057  1.00 0.00 ? 88  ILE A HD12 1  
ATOM 1483  H HD13 . ILE A 1 88  ? -0.444  -13.437 -2.402  1.00 0.00 ? 88  ILE A HD13 1  
ATOM 1484  N N    . GLY A 1 89  ? -0.999  -19.415 -4.647  1.00 0.00 ? 89  GLY A N    1  
ATOM 1485  C CA   . GLY A 1 89  ? -0.880  -20.889 -4.390  1.00 0.00 ? 89  GLY A CA   1  
ATOM 1486  C C    . GLY A 1 89  ? -2.187  -21.567 -4.029  1.00 0.00 ? 89  GLY A C    1  
ATOM 1487  O O    . GLY A 1 89  ? -2.213  -22.601 -3.373  1.00 0.00 ? 89  GLY A O    1  
ATOM 1488  H H    . GLY A 1 89  ? -0.846  -19.039 -5.565  1.00 0.00 ? 89  GLY A H    1  
ATOM 1489  H HA2  . GLY A 1 89  ? -0.519  -21.446 -5.277  1.00 0.00 ? 89  GLY A HA2  1  
ATOM 1490  H HA3  . GLY A 1 89  ? -0.257  -20.991 -3.488  1.00 0.00 ? 89  GLY A HA3  1  
ATOM 1491  N N    . GLY A 1 90  ? -3.312  -20.923 -4.425  1.00 0.00 ? 90  GLY A N    1  
ATOM 1492  C CA   . GLY A 1 90  ? -4.689  -21.303 -4.058  1.00 0.00 ? 90  GLY A CA   1  
ATOM 1493  C C    . GLY A 1 90  ? -5.185  -20.732 -2.736  1.00 0.00 ? 90  GLY A C    1  
ATOM 1494  O O    . GLY A 1 90  ? -6.218  -21.172 -2.245  1.00 0.00 ? 90  GLY A O    1  
ATOM 1495  H H    . GLY A 1 90  ? -3.137  -20.108 -4.982  1.00 0.00 ? 90  GLY A H    1  
ATOM 1496  H HA2  . GLY A 1 90  ? -5.394  -20.975 -4.816  1.00 0.00 ? 90  GLY A HA2  1  
ATOM 1497  H HA3  . GLY A 1 90  ? -4.737  -22.380 -3.950  1.00 0.00 ? 90  GLY A HA3  1  
ATOM 1498  N N    . ALA A 1 91  ? -4.488  -19.749 -2.096  1.00 0.00 ? 91  ALA A N    1  
ATOM 1499  C CA   . ALA A 1 91  ? -4.872  -19.225 -0.796  1.00 0.00 ? 91  ALA A CA   1  
ATOM 1500  C C    . ALA A 1 91  ? -4.873  -17.692 -0.819  1.00 0.00 ? 91  ALA A C    1  
ATOM 1501  O O    . ALA A 1 91  ? -3.970  -17.067 -1.369  1.00 0.00 ? 91  ALA A O    1  
ATOM 1502  C CB   . ALA A 1 91  ? -3.903  -19.773 0.268   1.00 0.00 ? 91  ALA A CB   1  
ATOM 1503  H H    . ALA A 1 91  ? -3.633  -19.353 -2.433  1.00 0.00 ? 91  ALA A H    1  
ATOM 1504  H HA   . ALA A 1 91  ? -5.865  -19.564 -0.528  1.00 0.00 ? 91  ALA A HA   1  
ATOM 1505  H HB1  . ALA A 1 91  ? -2.854  -19.501 0.015   1.00 0.00 ? 91  ALA A HB1  1  
ATOM 1506  H HB2  . ALA A 1 91  ? -4.147  -19.392 1.282   1.00 0.00 ? 91  ALA A HB2  1  
ATOM 1507  H HB3  . ALA A 1 91  ? -3.968  -20.882 0.297   1.00 0.00 ? 91  ALA A HB3  1  
ATOM 1508  N N    . ASP A 1 92  ? -5.920  -17.058 -0.230  1.00 0.00 ? 92  ASP A N    1  
ATOM 1509  C CA   . ASP A 1 92  ? -6.213  -15.635 -0.140  1.00 0.00 ? 92  ASP A CA   1  
ATOM 1510  C C    . ASP A 1 92  ? -5.670  -15.015 1.158   1.00 0.00 ? 92  ASP A C    1  
ATOM 1511  O O    . ASP A 1 92  ? -6.172  -15.276 2.251   1.00 0.00 ? 92  ASP A O    1  
ATOM 1512  C CB   . ASP A 1 92  ? -7.765  -15.474 -0.250  1.00 0.00 ? 92  ASP A CB   1  
ATOM 1513  C CG   . ASP A 1 92  ? -8.239  -14.039 -0.509  1.00 0.00 ? 92  ASP A CG   1  
ATOM 1514  O OD1  . ASP A 1 92  ? -7.852  -13.468 -1.562  1.00 0.00 ? 92  ASP A OD1  1  
ATOM 1515  O OD2  . ASP A 1 92  ? -9.011  -13.510 0.334   1.00 0.00 ? 92  ASP A OD2  1  
ATOM 1516  H H    . ASP A 1 92  ? -6.630  -17.587 0.199   1.00 0.00 ? 92  ASP A H    1  
ATOM 1517  H HA   . ASP A 1 92  ? -5.769  -15.137 -0.986  1.00 0.00 ? 92  ASP A HA   1  
ATOM 1518  H HB2  . ASP A 1 92  ? -8.096  -16.081 -1.132  1.00 0.00 ? 92  ASP A HB2  1  
ATOM 1519  H HB3  . ASP A 1 92  ? -8.259  -15.869 0.674   1.00 0.00 ? 92  ASP A HB3  1  
ATOM 1520  N N    . PHE A 1 93  ? -4.623  -14.155 1.063   1.00 0.00 ? 93  PHE A N    1  
ATOM 1521  C CA   . PHE A 1 93  ? -4.001  -13.456 2.187   1.00 0.00 ? 93  PHE A CA   1  
ATOM 1522  C C    . PHE A 1 93  ? -4.031  -11.969 1.867   1.00 0.00 ? 93  PHE A C    1  
ATOM 1523  O O    . PHE A 1 93  ? -4.318  -11.584 0.732   1.00 0.00 ? 93  PHE A O    1  
ATOM 1524  C CB   . PHE A 1 93  ? -2.511  -13.868 2.437   1.00 0.00 ? 93  PHE A CB   1  
ATOM 1525  C CG   . PHE A 1 93  ? -2.327  -15.366 2.442   1.00 0.00 ? 93  PHE A CG   1  
ATOM 1526  C CD1  . PHE A 1 93  ? -2.901  -16.176 3.408   1.00 0.00 ? 93  PHE A CD1  1  
ATOM 1527  C CD2  . PHE A 1 93  ? -1.558  -15.961 1.456   1.00 0.00 ? 93  PHE A CD2  1  
ATOM 1528  C CE1  . PHE A 1 93  ? -2.718  -17.549 3.374   1.00 0.00 ? 93  PHE A CE1  1  
ATOM 1529  C CE2  . PHE A 1 93  ? -1.387  -17.326 1.406   1.00 0.00 ? 93  PHE A CE2  1  
ATOM 1530  C CZ   . PHE A 1 93  ? -1.961  -18.123 2.373   1.00 0.00 ? 93  PHE A CZ   1  
ATOM 1531  H H    . PHE A 1 93  ? -4.234  -13.924 0.171   1.00 0.00 ? 93  PHE A H    1  
ATOM 1532  H HA   . PHE A 1 93  ? -4.576  -13.597 3.095   1.00 0.00 ? 93  PHE A HA   1  
ATOM 1533  H HB2  . PHE A 1 93  ? -1.856  -13.467 1.615   1.00 0.00 ? 93  PHE A HB2  1  
ATOM 1534  H HB3  . PHE A 1 93  ? -2.173  -13.494 3.439   1.00 0.00 ? 93  PHE A HB3  1  
ATOM 1535  H HD1  . PHE A 1 93  ? -3.509  -15.737 4.187   1.00 0.00 ? 93  PHE A HD1  1  
ATOM 1536  H HD2  . PHE A 1 93  ? -1.095  -15.346 0.700   1.00 0.00 ? 93  PHE A HD2  1  
ATOM 1537  H HE1  . PHE A 1 93  ? -3.179  -18.174 4.127   1.00 0.00 ? 93  PHE A HE1  1  
ATOM 1538  H HE2  . PHE A 1 93  ? -0.809  -17.776 0.607   1.00 0.00 ? 93  PHE A HE2  1  
ATOM 1539  H HZ   . PHE A 1 93  ? -1.846  -19.196 2.306   1.00 0.00 ? 93  PHE A HZ   1  
ATOM 1540  N N    . LEU A 1 94  ? -3.692  -11.084 2.846   1.00 0.00 ? 94  LEU A N    1  
ATOM 1541  C CA   . LEU A 1 94  ? -3.621  -9.639  2.636   1.00 0.00 ? 94  LEU A CA   1  
ATOM 1542  C C    . LEU A 1 94  ? -2.165  -9.259  2.327   1.00 0.00 ? 94  LEU A C    1  
ATOM 1543  O O    . LEU A 1 94  ? -1.238  -9.672  3.026   1.00 0.00 ? 94  LEU A O    1  
ATOM 1544  C CB   . LEU A 1 94  ? -4.208  -8.860  3.845   1.00 0.00 ? 94  LEU A CB   1  
ATOM 1545  C CG   . LEU A 1 94  ? -4.850  -7.484  3.518   1.00 0.00 ? 94  LEU A CG   1  
ATOM 1546  C CD1  . LEU A 1 94  ? -6.246  -7.638  2.878   1.00 0.00 ? 94  LEU A CD1  1  
ATOM 1547  C CD2  . LEU A 1 94  ? -5.028  -6.685  4.826   1.00 0.00 ? 94  LEU A CD2  1  
ATOM 1548  H H    . LEU A 1 94  ? -3.432  -11.397 3.757   1.00 0.00 ? 94  LEU A H    1  
ATOM 1549  H HA   . LEU A 1 94  ? -4.230  -9.367  1.782   1.00 0.00 ? 94  LEU A HA   1  
ATOM 1550  H HB2  . LEU A 1 94  ? -5.033  -9.490  4.267   1.00 0.00 ? 94  LEU A HB2  1  
ATOM 1551  H HB3  . LEU A 1 94  ? -3.431  -8.724  4.639   1.00 0.00 ? 94  LEU A HB3  1  
ATOM 1552  H HG   . LEU A 1 94  ? -4.177  -6.940  2.798   1.00 0.00 ? 94  LEU A HG   1  
ATOM 1553  H HD11 . LEU A 1 94  ? -6.905  -8.244  3.536   1.00 0.00 ? 94  LEU A HD11 1  
ATOM 1554  H HD12 . LEU A 1 94  ? -6.741  -6.652  2.732   1.00 0.00 ? 94  LEU A HD12 1  
ATOM 1555  H HD13 . LEU A 1 94  ? -6.195  -8.138  1.890   1.00 0.00 ? 94  LEU A HD13 1  
ATOM 1556  H HD21 . LEU A 1 94  ? -4.063  -6.543  5.358   1.00 0.00 ? 94  LEU A HD21 1  
ATOM 1557  H HD22 . LEU A 1 94  ? -5.485  -5.688  4.634   1.00 0.00 ? 94  LEU A HD22 1  
ATOM 1558  H HD23 . LEU A 1 94  ? -5.713  -7.235  5.508   1.00 0.00 ? 94  LEU A HD23 1  
ATOM 1559  N N    . VAL A 1 95  ? -1.951  -8.484  1.235   1.00 0.00 ? 95  VAL A N    1  
ATOM 1560  C CA   . VAL A 1 95  ? -0.660  -8.046  0.711   1.00 0.00 ? 95  VAL A CA   1  
ATOM 1561  C C    . VAL A 1 95  ? -0.736  -6.533  0.496   1.00 0.00 ? 95  VAL A C    1  
ATOM 1562  O O    . VAL A 1 95  ? -1.833  -5.978  0.372   1.00 0.00 ? 95  VAL A O    1  
ATOM 1563  C CB   . VAL A 1 95  ? -0.303  -8.759  -0.612  1.00 0.00 ? 95  VAL A CB   1  
ATOM 1564  C CG1  . VAL A 1 95  ? -0.083  -10.269 -0.340  1.00 0.00 ? 95  VAL A CG1  1  
ATOM 1565  C CG2  . VAL A 1 95  ? -1.403  -8.565  -1.699  1.00 0.00 ? 95  VAL A CG2  1  
ATOM 1566  H H    . VAL A 1 95  ? -2.725  -8.145  0.688   1.00 0.00 ? 95  VAL A H    1  
ATOM 1567  H HA   . VAL A 1 95  ? 0.143   -8.237  1.420   1.00 0.00 ? 95  VAL A HA   1  
ATOM 1568  H HB   . VAL A 1 95  ? 0.685   -8.372  -0.971  1.00 0.00 ? 95  VAL A HB   1  
ATOM 1569  H HG11 . VAL A 1 95  ? 0.612   -10.420 0.514   1.00 0.00 ? 95  VAL A HG11 1  
ATOM 1570  H HG12 . VAL A 1 95  ? -1.050  -10.764 -0.107  1.00 0.00 ? 95  VAL A HG12 1  
ATOM 1571  H HG13 . VAL A 1 95  ? 0.358   -10.757 -1.235  1.00 0.00 ? 95  VAL A HG13 1  
ATOM 1572  H HG21 . VAL A 1 95  ? -2.386  -8.933  -1.335  1.00 0.00 ? 95  VAL A HG21 1  
ATOM 1573  H HG22 . VAL A 1 95  ? -1.544  -7.506  -2.008  1.00 0.00 ? 95  VAL A HG22 1  
ATOM 1574  H HG23 . VAL A 1 95  ? -1.164  -9.157  -2.611  1.00 0.00 ? 95  VAL A HG23 1  
ATOM 1575  N N    . TRP A 1 96  ? 0.429   -5.824  0.426   1.00 0.00 ? 96  TRP A N    1  
ATOM 1576  C CA   . TRP A 1 96  ? 0.436   -4.350  0.141   1.00 0.00 ? 96  TRP A CA   1  
ATOM 1577  C C    . TRP A 1 96  ? 1.172   -4.201  -1.223  1.00 0.00 ? 96  TRP A C    1  
ATOM 1578  O O    . TRP A 1 96  ? 2.161   -4.896  -1.447  1.00 0.00 ? 96  TRP A O    1  
ATOM 1579  C CB   . TRP A 1 96  ? 1.204   -3.652  1.312   1.00 0.00 ? 96  TRP A CB   1  
ATOM 1580  C CG   . TRP A 1 96  ? 0.424   -2.781  2.303   1.00 0.00 ? 96  TRP A CG   1  
ATOM 1581  C CD1  . TRP A 1 96  ? -0.612  -1.910  2.099   1.00 0.00 ? 96  TRP A CD1  1  
ATOM 1582  C CD2  . TRP A 1 96  ? 0.828   -2.599  3.670   1.00 0.00 ? 96  TRP A CD2  1  
ATOM 1583  N NE1  . TRP A 1 96  ? -0.792  -1.098  3.205   1.00 0.00 ? 96  TRP A NE1  1  
ATOM 1584  C CE2  . TRP A 1 96  ? 0.074   -1.540  4.192   1.00 0.00 ? 96  TRP A CE2  1  
ATOM 1585  C CE3  . TRP A 1 96  ? 1.767   -3.250  4.424   1.00 0.00 ? 96  TRP A CE3  1  
ATOM 1586  C CZ2  . TRP A 1 96  ? 0.269   -1.116  5.477   1.00 0.00 ? 96  TRP A CZ2  1  
ATOM 1587  C CZ3  . TRP A 1 96  ? 1.894   -2.882  5.743   1.00 0.00 ? 96  TRP A CZ3  1  
ATOM 1588  C CH2  . TRP A 1 96  ? 1.187   -1.810  6.244   1.00 0.00 ? 96  TRP A CH2  1  
ATOM 1589  H H    . TRP A 1 96  ? 1.334   -6.323  0.549   1.00 0.00 ? 96  TRP A H    1  
ATOM 1590  H HA   . TRP A 1 96  ? -0.570  -3.857  0.056   1.00 0.00 ? 96  TRP A HA   1  
ATOM 1591  H HB2  . TRP A 1 96  ? 1.717   -4.448  1.892   1.00 0.00 ? 96  TRP A HB2  1  
ATOM 1592  H HB3  . TRP A 1 96  ? 2.008   -2.989  0.937   1.00 0.00 ? 96  TRP A HB3  1  
ATOM 1593  H HD1  . TRP A 1 96  ? -1.164  -1.844  1.176   1.00 0.00 ? 96  TRP A HD1  1  
ATOM 1594  H HE1  . TRP A 1 96  ? -1.356  -0.295  3.231   1.00 0.00 ? 96  TRP A HE1  1  
ATOM 1595  H HE3  . TRP A 1 96  ? 2.378   -4.044  4.019   1.00 0.00 ? 96  TRP A HE3  1  
ATOM 1596  H HZ2  . TRP A 1 96  ? -0.283  -0.287  5.896   1.00 0.00 ? 96  TRP A HZ2  1  
ATOM 1597  H HZ3  . TRP A 1 96  ? 2.569   -3.421  6.399   1.00 0.00 ? 96  TRP A HZ3  1  
ATOM 1598  H HH2  . TRP A 1 96  ? 1.383   -1.517  7.259   1.00 0.00 ? 96  TRP A HH2  1  
ATOM 1599  N N    . ARG A 1 97  ? 0.737   -3.350  -2.202  1.00 0.00 ? 97  ARG A N    1  
ATOM 1600  C CA   . ARG A 1 97  ? 1.272   -3.313  -3.572  1.00 0.00 ? 97  ARG A CA   1  
ATOM 1601  C C    . ARG A 1 97  ? 1.381   -1.868  -4.046  1.00 0.00 ? 97  ARG A C    1  
ATOM 1602  O O    . ARG A 1 97  ? 0.706   -1.013  -3.494  1.00 0.00 ? 97  ARG A O    1  
ATOM 1603  C CB   . ARG A 1 97  ? 0.264   -4.176  -4.384  1.00 0.00 ? 97  ARG A CB   1  
ATOM 1604  C CG   . ARG A 1 97  ? -0.403  -3.611  -5.649  1.00 0.00 ? 97  ARG A CG   1  
ATOM 1605  C CD   . ARG A 1 97  ? -1.613  -4.461  -6.065  1.00 0.00 ? 97  ARG A CD   1  
ATOM 1606  N NE   . ARG A 1 97  ? -2.190  -3.941  -7.354  1.00 0.00 ? 97  ARG A NE   1  
ATOM 1607  C CZ   . ARG A 1 97  ? -1.826  -4.393  -8.596  1.00 0.00 ? 97  ARG A CZ   1  
ATOM 1608  N NH1  . ARG A 1 97  ? -0.879  -5.363  -8.746  1.00 0.00 ? 97  ARG A NH1  1  
ATOM 1609  N NH2  . ARG A 1 97  ? -2.427  -3.861  -9.701  1.00 0.00 ? 97  ARG A NH2  1  
ATOM 1610  H H    . ARG A 1 97  ? -0.080  -2.771  -2.085  1.00 0.00 ? 97  ARG A H    1  
ATOM 1611  H HA   . ARG A 1 97  ? 2.270   -3.739  -3.622  1.00 0.00 ? 97  ARG A HA   1  
ATOM 1612  H HB2  . ARG A 1 97  ? 0.755   -5.147  -4.639  1.00 0.00 ? 97  ARG A HB2  1  
ATOM 1613  H HB3  . ARG A 1 97  ? -0.569  -4.380  -3.665  1.00 0.00 ? 97  ARG A HB3  1  
ATOM 1614  H HG2  . ARG A 1 97  ? -0.793  -2.584  -5.475  1.00 0.00 ? 97  ARG A HG2  1  
ATOM 1615  H HG3  . ARG A 1 97  ? 0.360   -3.590  -6.460  1.00 0.00 ? 97  ARG A HG3  1  
ATOM 1616  H HD2  . ARG A 1 97  ? -1.342  -5.535  -6.154  1.00 0.00 ? 97  ARG A HD2  1  
ATOM 1617  H HD3  . ARG A 1 97  ? -2.405  -4.352  -5.291  1.00 0.00 ? 97  ARG A HD3  1  
ATOM 1618  H HE   . ARG A 1 97  ? -2.892  -3.230  -7.297  1.00 0.00 ? 97  ARG A HE   1  
ATOM 1619  H HH11 . ARG A 1 97  ? -0.436  -5.758  -7.941  1.00 0.00 ? 97  ARG A HH11 1  
ATOM 1620  H HH12 . ARG A 1 97  ? -0.630  -5.681  -9.661  1.00 0.00 ? 97  ARG A HH12 1  
ATOM 1621  H HH21 . ARG A 1 97  ? -3.124  -3.152  -9.596  1.00 0.00 ? 97  ARG A HH21 1  
ATOM 1622  H HH22 . ARG A 1 97  ? -2.172  -4.184  -10.612 1.00 0.00 ? 97  ARG A HH22 1  
ATOM 1623  N N    . TRP A 1 98  ? 2.221   -1.475  -5.051  1.00 0.00 ? 98  TRP A N    1  
ATOM 1624  C CA   . TRP A 1 98  ? 2.427   -0.039  -5.368  1.00 0.00 ? 98  TRP A CA   1  
ATOM 1625  C C    . TRP A 1 98  ? 1.476   0.810   -6.268  1.00 0.00 ? 98  TRP A C    1  
ATOM 1626  O O    . TRP A 1 98  ? 1.165   0.471   -7.409  1.00 0.00 ? 98  TRP A O    1  
ATOM 1627  C CB   . TRP A 1 98  ? 3.903   0.201   -5.784  1.00 0.00 ? 98  TRP A CB   1  
ATOM 1628  C CG   . TRP A 1 98  ? 4.511   1.389   -5.066  1.00 0.00 ? 98  TRP A CG   1  
ATOM 1629  C CD1  . TRP A 1 98  ? 4.344   2.723   -5.284  1.00 0.00 ? 98  TRP A CD1  1  
ATOM 1630  C CD2  . TRP A 1 98  ? 5.280   1.293   -3.861  1.00 0.00 ? 98  TRP A CD2  1  
ATOM 1631  N NE1  . TRP A 1 98  ? 5.105   3.432   -4.459  1.00 0.00 ? 98  TRP A NE1  1  
ATOM 1632  C CE2  . TRP A 1 98  ? 5.575   2.590   -3.479  1.00 0.00 ? 98  TRP A CE2  1  
ATOM 1633  C CE3  . TRP A 1 98  ? 5.672   0.225   -3.114  1.00 0.00 ? 98  TRP A CE3  1  
ATOM 1634  C CZ2  . TRP A 1 98  ? 6.186   2.835   -2.301  1.00 0.00 ? 98  TRP A CZ2  1  
ATOM 1635  C CZ3  . TRP A 1 98  ? 6.460   0.477   -2.016  1.00 0.00 ? 98  TRP A CZ3  1  
ATOM 1636  C CH2  . TRP A 1 98  ? 6.663   1.761   -1.581  1.00 0.00 ? 98  TRP A CH2  1  
ATOM 1637  H H    . TRP A 1 98  ? 2.788   -2.151  -5.526  1.00 0.00 ? 98  TRP A H    1  
ATOM 1638  H HA   . TRP A 1 98  ? 2.362   0.457   -4.413  1.00 0.00 ? 98  TRP A HA   1  
ATOM 1639  H HB2  . TRP A 1 98  ? 4.487   -0.707  -5.403  1.00 0.00 ? 98  TRP A HB2  1  
ATOM 1640  H HB3  . TRP A 1 98  ? 3.980   0.430   -6.900  1.00 0.00 ? 98  TRP A HB3  1  
ATOM 1641  H HD1  . TRP A 1 98  ? 3.736   3.266   -5.967  1.00 0.00 ? 98  TRP A HD1  1  
ATOM 1642  H HE1  . TRP A 1 98  ? 4.984   4.406   -4.551  1.00 0.00 ? 98  TRP A HE1  1  
ATOM 1643  H HE3  . TRP A 1 98  ? 5.379   -0.783  -3.346  1.00 0.00 ? 98  TRP A HE3  1  
ATOM 1644  H HZ2  . TRP A 1 98  ? 6.387   3.833   -1.970  1.00 0.00 ? 98  TRP A HZ2  1  
ATOM 1645  H HZ3  . TRP A 1 98  ? 6.923   -0.328  -1.470  1.00 0.00 ? 98  TRP A HZ3  1  
ATOM 1646  H HH2  . TRP A 1 98  ? 7.251   1.933   -0.687  1.00 0.00 ? 98  TRP A HH2  1  
ATOM 1647  N N    . ILE A 1 99  ? 1.076   2.014   -5.744  1.00 0.00 ? 99  ILE A N    1  
ATOM 1648  C CA   . ILE A 1 99  ? 0.317   3.082   -6.399  1.00 0.00 ? 99  ILE A CA   1  
ATOM 1649  C C    . ILE A 1 99  ? 1.182   4.335   -6.244  1.00 0.00 ? 99  ILE A C    1  
ATOM 1650  O O    . ILE A 1 99  ? 1.698   4.622   -5.166  1.00 0.00 ? 99  ILE A O    1  
ATOM 1651  C CB   . ILE A 1 99  ? -1.101  3.301   -5.861  1.00 0.00 ? 99  ILE A CB   1  
ATOM 1652  C CG1  . ILE A 1 99  ? -1.114  3.545   -4.330  1.00 0.00 ? 99  ILE A CG1  1  
ATOM 1653  C CG2  . ILE A 1 99  ? -1.952  2.087   -6.306  1.00 0.00 ? 99  ILE A CG2  1  
ATOM 1654  C CD1  . ILE A 1 99  ? -2.516  3.695   -3.730  1.00 0.00 ? 99  ILE A CD1  1  
ATOM 1655  H H    . ILE A 1 99  ? 1.360   2.313   -4.838  1.00 0.00 ? 99  ILE A H    1  
ATOM 1656  H HA   . ILE A 1 99  ? 0.240   2.871   -7.456  1.00 0.00 ? 99  ILE A HA   1  
ATOM 1657  H HB   . ILE A 1 99  ? -1.554  4.197   -6.348  1.00 0.00 ? 99  ILE A HB   1  
ATOM 1658  H HG12 . ILE A 1 99  ? -0.583  2.693   -3.841  1.00 0.00 ? 99  ILE A HG12 1  
ATOM 1659  H HG13 . ILE A 1 99  ? -0.574  4.503   -4.104  1.00 0.00 ? 99  ILE A HG13 1  
ATOM 1660  H HG21 . ILE A 1 99  ? -1.895  1.964   -7.408  1.00 0.00 ? 99  ILE A HG21 1  
ATOM 1661  H HG22 . ILE A 1 99  ? -1.575  1.157   -5.833  1.00 0.00 ? 99  ILE A HG22 1  
ATOM 1662  H HG23 . ILE A 1 99  ? -3.019  2.219   -6.025  1.00 0.00 ? 99  ILE A HG23 1  
ATOM 1663  H HD11 . ILE A 1 99  ? -3.077  4.492   -4.261  1.00 0.00 ? 99  ILE A HD11 1  
ATOM 1664  H HD12 . ILE A 1 99  ? -3.094  2.752   -3.801  1.00 0.00 ? 99  ILE A HD12 1  
ATOM 1665  H HD13 . ILE A 1 99  ? -2.442  3.976   -2.657  1.00 0.00 ? 99  ILE A HD13 1  
ATOM 1666  N N    . GLN A 1 100 ? 1.424   5.058   -7.363  1.00 0.00 ? 100 GLN A N    1  
ATOM 1667  C CA   . GLN A 1 100 ? 2.342   6.182   -7.497  1.00 0.00 ? 100 GLN A CA   1  
ATOM 1668  C C    . GLN A 1 100 ? 1.576   7.413   -8.038  1.00 0.00 ? 100 GLN A C    1  
ATOM 1669  O O    . GLN A 1 100 ? 1.207   7.407   -9.211  1.00 0.00 ? 100 GLN A O    1  
ATOM 1670  C CB   . GLN A 1 100 ? 3.519   5.778   -8.470  1.00 0.00 ? 100 GLN A CB   1  
ATOM 1671  C CG   . GLN A 1 100 ? 3.357   4.386   -9.153  1.00 0.00 ? 100 GLN A CG   1  
ATOM 1672  C CD   . GLN A 1 100 ? 2.390   4.476   -10.338 1.00 0.00 ? 100 GLN A CD   1  
ATOM 1673  O OE1  . GLN A 1 100 ? 2.649   5.201   -11.304 1.00 0.00 ? 100 GLN A OE1  1  
ATOM 1674  N NE2  . GLN A 1 100 ? 1.230   3.771   -10.283 1.00 0.00 ? 100 GLN A NE2  1  
ATOM 1675  H H    . GLN A 1 100 ? 1.016   4.789   -8.232  1.00 0.00 ? 100 GLN A H    1  
ATOM 1676  H HA   . GLN A 1 100 ? 2.770   6.426   -6.532  1.00 0.00 ? 100 GLN A HA   1  
ATOM 1677  H HB2  . GLN A 1 100 ? 3.619   6.515   -9.276  1.00 0.00 ? 100 GLN A HB2  1  
ATOM 1678  H HB3  . GLN A 1 100 ? 4.544   5.884   -8.037  1.00 0.00 ? 100 GLN A HB3  1  
ATOM 1679  H HG2  . GLN A 1 100 ? 4.324   4.070   -9.590  1.00 0.00 ? 100 GLN A HG2  1  
ATOM 1680  H HG3  . GLN A 1 100 ? 3.111   3.606   -8.405  1.00 0.00 ? 100 GLN A HG3  1  
ATOM 1681  H HE21 . GLN A 1 100 ? 1.188   2.948   -9.722  1.00 0.00 ? 100 GLN A HE21 1  
ATOM 1682  H HE22 . GLN A 1 100 ? 0.603   3.920   -11.048 1.00 0.00 ? 100 GLN A HE22 1  
ATOM 1683  N N    . PRO A 1 101 ? 1.263   8.491   -7.273  1.00 0.00 ? 101 PRO A N    1  
ATOM 1684  C CA   . PRO A 1 101 ? 0.563   9.683   -7.766  1.00 0.00 ? 101 PRO A CA   1  
ATOM 1685  C C    . PRO A 1 101 ? 1.383   10.561  -8.715  1.00 0.00 ? 101 PRO A C    1  
ATOM 1686  O O    . PRO A 1 101 ? 2.587   10.721  -8.500  1.00 0.00 ? 101 PRO A O    1  
ATOM 1687  C CB   . PRO A 1 101 ? 0.270   10.482  -6.476  1.00 0.00 ? 101 PRO A CB   1  
ATOM 1688  C CG   . PRO A 1 101 ? 0.216   9.414   -5.390  1.00 0.00 ? 101 PRO A CG   1  
ATOM 1689  C CD   . PRO A 1 101 ? 1.382   8.528   -5.819  1.00 0.00 ? 101 PRO A CD   1  
ATOM 1690  H HA   . PRO A 1 101 ? -0.346  9.386   -8.272  1.00 0.00 ? 101 PRO A HA   1  
ATOM 1691  H HB2  . PRO A 1 101 ? 1.145   11.118  -6.184  1.00 0.00 ? 101 PRO A HB2  1  
ATOM 1692  H HB3  . PRO A 1 101 ? -0.638  11.113  -6.569  1.00 0.00 ? 101 PRO A HB3  1  
ATOM 1693  H HG2  . PRO A 1 101 ? 0.340   9.836   -4.374  1.00 0.00 ? 101 PRO A HG2  1  
ATOM 1694  H HG3  . PRO A 1 101 ? -0.736  8.843   -5.445  1.00 0.00 ? 101 PRO A HG3  1  
ATOM 1695  H HD2  . PRO A 1 101 ? 2.354   8.999   -5.548  1.00 0.00 ? 101 PRO A HD2  1  
ATOM 1696  H HD3  . PRO A 1 101 ? 1.306   7.538   -5.331  1.00 0.00 ? 101 PRO A HD3  1  
ATOM 1697  N N    . SER A 1 102 ? 0.717   11.172  -9.733  1.00 0.00 ? 102 SER A N    1  
ATOM 1698  C CA   . SER A 1 102 ? 1.276   12.128  -10.697 1.00 0.00 ? 102 SER A CA   1  
ATOM 1699  C C    . SER A 1 102 ? 2.020   11.488  -11.869 1.00 0.00 ? 102 SER A C    1  
ATOM 1700  O O    . SER A 1 102 ? 2.363   10.312  -11.828 1.00 0.00 ? 102 SER A O    1  
ATOM 1701  C CB   . SER A 1 102 ? 2.015   13.334  -10.032 1.00 0.00 ? 102 SER A CB   1  
ATOM 1702  O OG   . SER A 1 102 ? 3.288   12.994  -9.485  1.00 0.00 ? 102 SER A OG   1  
ATOM 1703  H H    . SER A 1 102 ? -0.257  10.992  -9.859  1.00 0.00 ? 102 SER A H    1  
ATOM 1704  H HA   . SER A 1 102 ? 0.402   12.569  -11.151 1.00 0.00 ? 102 SER A HA   1  
ATOM 1705  H HB2  . SER A 1 102 ? 2.143   14.170  -10.750 1.00 0.00 ? 102 SER A HB2  1  
ATOM 1706  H HB3  . SER A 1 102 ? 1.365   13.680  -9.192  1.00 0.00 ? 102 SER A HB3  1  
ATOM 1707  H HG   . SER A 1 102 ? 3.198   12.059  -9.174  1.00 0.00 ? 102 SER A HG   1  
ATOM 1708  N N    . ALA A 1 103 ? 2.238   12.228  -12.989 1.00 0.00 ? 103 ALA A N    1  
ATOM 1709  C CA   . ALA A 1 103 ? 2.906   11.798  -14.233 1.00 0.00 ? 103 ALA A CA   1  
ATOM 1710  C C    . ALA A 1 103 ? 2.323   10.629  -15.058 1.00 0.00 ? 103 ALA A C    1  
ATOM 1711  O O    . ALA A 1 103 ? 2.380   10.647  -16.285 1.00 0.00 ? 103 ALA A O    1  
ATOM 1712  C CB   . ALA A 1 103 ? 4.432   11.638  -14.067 1.00 0.00 ? 103 ALA A CB   1  
ATOM 1713  H H    . ALA A 1 103 ? 1.951   13.181  -12.987 1.00 0.00 ? 103 ALA A H    1  
ATOM 1714  H HA   . ALA A 1 103 ? 2.798   12.648  -14.892 1.00 0.00 ? 103 ALA A HA   1  
ATOM 1715  H HB1  . ALA A 1 103 ? 4.845   12.522  -13.535 1.00 0.00 ? 103 ALA A HB1  1  
ATOM 1716  H HB2  . ALA A 1 103 ? 4.948   11.558  -15.046 1.00 0.00 ? 103 ALA A HB2  1  
ATOM 1717  H HB3  . ALA A 1 103 ? 4.676   10.735  -13.464 1.00 0.00 ? 103 ALA A HB3  1  
ATOM 1718  N N    . SER A 1 104 ? 1.734   9.594   -14.407 1.00 0.00 ? 104 SER A N    1  
ATOM 1719  C CA   . SER A 1 104 ? 1.127   8.399   -15.004 1.00 0.00 ? 104 SER A CA   1  
ATOM 1720  C C    . SER A 1 104 ? -0.357  8.607   -15.272 1.00 0.00 ? 104 SER A C    1  
ATOM 1721  O O    . SER A 1 104 ? -0.902  8.272   -16.323 1.00 0.00 ? 104 SER A O    1  
ATOM 1722  C CB   . SER A 1 104 ? 1.287   7.159   -14.077 1.00 0.00 ? 104 SER A CB   1  
ATOM 1723  O OG   . SER A 1 104 ? 2.666   6.843   -13.928 1.00 0.00 ? 104 SER A OG   1  
ATOM 1724  H H    . SER A 1 104 ? 1.779   9.622   -13.398 1.00 0.00 ? 104 SER A H    1  
ATOM 1725  H HA   . SER A 1 104 ? 1.608   8.176   -15.947 1.00 0.00 ? 104 SER A HA   1  
ATOM 1726  H HB2  . SER A 1 104 ? 0.866   7.379   -13.068 1.00 0.00 ? 104 SER A HB2  1  
ATOM 1727  H HB3  . SER A 1 104 ? 0.780   6.263   -14.498 1.00 0.00 ? 104 SER A HB3  1  
ATOM 1728  H HG   . SER A 1 104 ? 2.751   6.213   -13.189 1.00 0.00 ? 104 SER A HG   1  
ATOM 1729  N N    . CYS A 1 105 ? -1.046  9.204   -14.267 1.00 0.00 ? 105 CYS A N    1  
ATOM 1730  C CA   . CYS A 1 105 ? -2.465  9.509   -14.238 1.00 0.00 ? 105 CYS A CA   1  
ATOM 1731  C C    . CYS A 1 105 ? -2.777  10.841  -14.916 1.00 0.00 ? 105 CYS A C    1  
ATOM 1732  O O    . CYS A 1 105 ? -2.919  11.882  -14.275 1.00 0.00 ? 105 CYS A O    1  
ATOM 1733  C CB   . CYS A 1 105 ? -3.004  9.448   -12.774 1.00 0.00 ? 105 CYS A CB   1  
ATOM 1734  S SG   . CYS A 1 105 ? -2.107  10.515  -11.587 1.00 0.00 ? 105 CYS A SG   1  
ATOM 1735  H H    . CYS A 1 105 ? -0.555  9.472   -13.442 1.00 0.00 ? 105 CYS A H    1  
ATOM 1736  H HA   . CYS A 1 105 ? -3.001  8.749   -14.793 1.00 0.00 ? 105 CYS A HA   1  
ATOM 1737  H HB2  . CYS A 1 105 ? -4.091  9.682   -12.762 1.00 0.00 ? 105 CYS A HB2  1  
ATOM 1738  H HB3  . CYS A 1 105 ? -2.910  8.392   -12.436 1.00 0.00 ? 105 CYS A HB3  1  
ATOM 1739  H HG   . CYS A 1 105 ? -2.294  11.595  -12.345 1.00 0.00 ? 105 CYS A HG   1  
ATOM 1740  N N    . ASP A 1 106 ? -2.888  10.801  -16.262 1.00 0.00 ? 106 ASP A N    1  
ATOM 1741  C CA   . ASP A 1 106 ? -3.211  11.926  -17.118 1.00 0.00 ? 106 ASP A CA   1  
ATOM 1742  C C    . ASP A 1 106 ? -4.291  11.427  -18.060 1.00 0.00 ? 106 ASP A C    1  
ATOM 1743  O O    . ASP A 1 106 ? -4.252  10.293  -18.529 1.00 0.00 ? 106 ASP A O    1  
ATOM 1744  C CB   . ASP A 1 106 ? -1.952  12.438  -17.881 1.00 0.00 ? 106 ASP A CB   1  
ATOM 1745  C CG   . ASP A 1 106 ? -2.183  13.801  -18.544 1.00 0.00 ? 106 ASP A CG   1  
ATOM 1746  O OD1  . ASP A 1 106 ? -2.561  14.749  -17.805 1.00 0.00 ? 106 ASP A OD1  1  
ATOM 1747  O OD2  . ASP A 1 106 ? -1.988  13.906  -19.783 1.00 0.00 ? 106 ASP A OD2  1  
ATOM 1748  H H    . ASP A 1 106 ? -2.743  9.935   -16.746 1.00 0.00 ? 106 ASP A H    1  
ATOM 1749  H HA   . ASP A 1 106 ? -3.637  12.733  -16.531 1.00 0.00 ? 106 ASP A HA   1  
ATOM 1750  H HB2  . ASP A 1 106 ? -1.126  12.561  -17.145 1.00 0.00 ? 106 ASP A HB2  1  
ATOM 1751  H HB3  . ASP A 1 106 ? -1.616  11.695  -18.634 1.00 0.00 ? 106 ASP A HB3  1  
ATOM 1752  N N    . LYS A 1 107 ? -5.301  12.270  -18.357 1.00 0.00 ? 107 LYS A N    1  
ATOM 1753  C CA   . LYS A 1 107 ? -6.412  11.894  -19.215 1.00 0.00 ? 107 LYS A CA   1  
ATOM 1754  C C    . LYS A 1 107 ? -7.031  13.147  -19.805 1.00 0.00 ? 107 LYS A C    1  
ATOM 1755  O O    . LYS A 1 107 ? -6.748  14.257  -19.360 1.00 0.00 ? 107 LYS A O    1  
ATOM 1756  C CB   . LYS A 1 107 ? -7.490  11.055  -18.460 1.00 0.00 ? 107 LYS A CB   1  
ATOM 1757  C CG   . LYS A 1 107 ? -8.049  11.703  -17.175 1.00 0.00 ? 107 LYS A CG   1  
ATOM 1758  C CD   . LYS A 1 107 ? -9.247  10.944  -16.575 1.00 0.00 ? 107 LYS A CD   1  
ATOM 1759  C CE   . LYS A 1 107 ? -10.530 10.983  -17.425 1.00 0.00 ? 107 LYS A CE   1  
ATOM 1760  N NZ   . LYS A 1 107 ? -10.993 12.372  -17.662 1.00 0.00 ? 107 LYS A NZ   1  
ATOM 1761  H H    . LYS A 1 107 ? -5.345  13.196  -17.993 1.00 0.00 ? 107 LYS A H    1  
ATOM 1762  H HA   . LYS A 1 107 ? -6.037  11.322  -20.056 1.00 0.00 ? 107 LYS A HA   1  
ATOM 1763  H HB2  . LYS A 1 107 ? -8.324  10.801  -19.148 1.00 0.00 ? 107 LYS A HB2  1  
ATOM 1764  H HB3  . LYS A 1 107 ? -7.020  10.087  -18.167 1.00 0.00 ? 107 LYS A HB3  1  
ATOM 1765  H HG2  . LYS A 1 107 ? -7.231  11.729  -16.417 1.00 0.00 ? 107 LYS A HG2  1  
ATOM 1766  H HG3  . LYS A 1 107 ? -8.359  12.754  -17.363 1.00 0.00 ? 107 LYS A HG3  1  
ATOM 1767  H HD2  . LYS A 1 107 ? -8.955  9.884   -16.417 1.00 0.00 ? 107 LYS A HD2  1  
ATOM 1768  H HD3  . LYS A 1 107 ? -9.478  11.379  -15.576 1.00 0.00 ? 107 LYS A HD3  1  
ATOM 1769  H HE2  . LYS A 1 107 ? -10.367 10.511  -18.416 1.00 0.00 ? 107 LYS A HE2  1  
ATOM 1770  H HE3  . LYS A 1 107 ? -11.348 10.444  -16.902 1.00 0.00 ? 107 LYS A HE3  1  
ATOM 1771  H HZ1  . LYS A 1 107 ? -11.185 12.833  -16.750 1.00 0.00 ? 107 LYS A HZ1  1  
ATOM 1772  H HZ2  . LYS A 1 107 ? -10.255 12.900  -18.169 1.00 0.00 ? 107 LYS A HZ2  1  
ATOM 1773  H HZ3  . LYS A 1 107 ? -11.863 12.356  -18.233 1.00 0.00 ? 107 LYS A HZ3  1  
ATOM 1774  N N    . ILE A 1 108 ? -7.910  12.978  -20.829 1.00 0.00 ? 108 ILE A N    1  
ATOM 1775  C CA   . ILE A 1 108 ? -8.639  14.021  -21.543 1.00 0.00 ? 108 ILE A CA   1  
ATOM 1776  C C    . ILE A 1 108 ? -10.121 13.711  -21.352 1.00 0.00 ? 108 ILE A C    1  
ATOM 1777  O O    . ILE A 1 108 ? -10.544 12.562  -21.446 1.00 0.00 ? 108 ILE A O    1  
ATOM 1778  C CB   . ILE A 1 108 ? -8.256  14.069  -23.039 1.00 0.00 ? 108 ILE A CB   1  
ATOM 1779  C CG1  . ILE A 1 108 ? -6.755  14.432  -23.228 1.00 0.00 ? 108 ILE A CG1  1  
ATOM 1780  C CG2  . ILE A 1 108 ? -9.152  15.039  -23.855 1.00 0.00 ? 108 ILE A CG2  1  
ATOM 1781  C CD1  . ILE A 1 108 ? -6.372  15.839  -22.732 1.00 0.00 ? 108 ILE A CD1  1  
ATOM 1782  H H    . ILE A 1 108 ? -8.134  12.061  -21.144 1.00 0.00 ? 108 ILE A H    1  
ATOM 1783  H HA   . ILE A 1 108 ? -8.448  14.991  -21.100 1.00 0.00 ? 108 ILE A HA   1  
ATOM 1784  H HB   . ILE A 1 108 ? -8.387  13.045  -23.464 1.00 0.00 ? 108 ILE A HB   1  
ATOM 1785  H HG12 . ILE A 1 108 ? -6.133  13.687  -22.679 1.00 0.00 ? 108 ILE A HG12 1  
ATOM 1786  H HG13 . ILE A 1 108 ? -6.502  14.334  -24.312 1.00 0.00 ? 108 ILE A HG13 1  
ATOM 1787  H HG21 . ILE A 1 108 ? -9.182  16.040  -23.378 1.00 0.00 ? 108 ILE A HG21 1  
ATOM 1788  H HG22 . ILE A 1 108 ? -8.774  15.151  -24.893 1.00 0.00 ? 108 ILE A HG22 1  
ATOM 1789  H HG23 . ILE A 1 108 ? -10.192 14.661  -23.939 1.00 0.00 ? 108 ILE A HG23 1  
ATOM 1790  H HD11 . ILE A 1 108 ? -6.983  16.629  -23.218 1.00 0.00 ? 108 ILE A HD11 1  
ATOM 1791  H HD12 . ILE A 1 108 ? -6.499  15.918  -21.631 1.00 0.00 ? 108 ILE A HD12 1  
ATOM 1792  H HD13 . ILE A 1 108 ? -5.304  16.051  -22.957 1.00 0.00 ? 108 ILE A HD13 1  
ATOM 1793  N N    . LEU A 1 109 ? -10.942 14.758  -21.082 1.00 0.00 ? 109 LEU A N    1  
ATOM 1794  C CA   . LEU A 1 109 ? -12.392 14.708  -20.903 1.00 0.00 ? 109 LEU A CA   1  
ATOM 1795  C C    . LEU A 1 109 ? -13.117 15.136  -22.184 1.00 0.00 ? 109 LEU A C    1  
ATOM 1796  O O    . LEU A 1 109 ? -12.580 15.004  -23.281 1.00 0.00 ? 109 LEU A O    1  
ATOM 1797  C CB   . LEU A 1 109 ? -12.830 15.497  -19.626 1.00 0.00 ? 109 LEU A CB   1  
ATOM 1798  C CG   . LEU A 1 109 ? -12.786 17.055  -19.616 1.00 0.00 ? 109 LEU A CG   1  
ATOM 1799  C CD1  . LEU A 1 109 ? -13.143 17.565  -18.205 1.00 0.00 ? 109 LEU A CD1  1  
ATOM 1800  C CD2  . LEU A 1 109 ? -11.465 17.696  -20.087 1.00 0.00 ? 109 LEU A CD2  1  
ATOM 1801  H H    . LEU A 1 109 ? -10.552 15.669  -21.004 1.00 0.00 ? 109 LEU A H    1  
ATOM 1802  H HA   . LEU A 1 109 ? -12.687 13.679  -20.733 1.00 0.00 ? 109 LEU A HA   1  
ATOM 1803  H HB2  . LEU A 1 109 ? -13.859 15.183  -19.342 1.00 0.00 ? 109 LEU A HB2  1  
ATOM 1804  H HB3  . LEU A 1 109 ? -12.168 15.146  -18.802 1.00 0.00 ? 109 LEU A HB3  1  
ATOM 1805  H HG   . LEU A 1 109 ? -13.586 17.428  -20.297 1.00 0.00 ? 109 LEU A HG   1  
ATOM 1806  H HD11 . LEU A 1 109 ? -14.135 17.177  -17.891 1.00 0.00 ? 109 LEU A HD11 1  
ATOM 1807  H HD12 . LEU A 1 109 ? -12.383 17.228  -17.467 1.00 0.00 ? 109 LEU A HD12 1  
ATOM 1808  H HD13 . LEU A 1 109 ? -13.177 18.675  -18.195 1.00 0.00 ? 109 LEU A HD13 1  
ATOM 1809  H HD21 . LEU A 1 109 ? -10.613 17.350  -19.467 1.00 0.00 ? 109 LEU A HD21 1  
ATOM 1810  H HD22 . LEU A 1 109 ? -11.267 17.469  -21.155 1.00 0.00 ? 109 LEU A HD22 1  
ATOM 1811  H HD23 . LEU A 1 109 ? -11.528 18.805  -20.009 1.00 0.00 ? 109 LEU A HD23 1  
ATOM 1812  N N    . VAL A 1 110 ? -14.367 15.673  -22.099 1.00 0.00 ? 110 VAL A N    1  
ATOM 1813  C CA   . VAL A 1 110 ? -15.206 16.118  -23.222 1.00 0.00 ? 110 VAL A CA   1  
ATOM 1814  C C    . VAL A 1 110 ? -14.673 17.314  -24.036 1.00 0.00 ? 110 VAL A C    1  
ATOM 1815  O O    . VAL A 1 110 ? -14.846 17.371  -25.250 1.00 0.00 ? 110 VAL A O    1  
ATOM 1816  C CB   . VAL A 1 110 ? -16.655 16.312  -22.745 1.00 0.00 ? 110 VAL A CB   1  
ATOM 1817  C CG1  . VAL A 1 110 ? -16.809 17.510  -21.778 1.00 0.00 ? 110 VAL A CG1  1  
ATOM 1818  C CG2  . VAL A 1 110 ? -17.647 16.391  -23.930 1.00 0.00 ? 110 VAL A CG2  1  
ATOM 1819  H H    . VAL A 1 110 ? -14.800 15.756  -21.208 1.00 0.00 ? 110 VAL A H    1  
ATOM 1820  H HA   . VAL A 1 110 ? -15.237 15.299  -23.928 1.00 0.00 ? 110 VAL A HA   1  
ATOM 1821  H HB   . VAL A 1 110 ? -16.925 15.391  -22.173 1.00 0.00 ? 110 VAL A HB   1  
ATOM 1822  H HG11 . VAL A 1 110 ? -16.101 17.445  -20.928 1.00 0.00 ? 110 VAL A HG11 1  
ATOM 1823  H HG12 . VAL A 1 110 ? -16.650 18.473  -22.306 1.00 0.00 ? 110 VAL A HG12 1  
ATOM 1824  H HG13 . VAL A 1 110 ? -17.841 17.524  -21.366 1.00 0.00 ? 110 VAL A HG13 1  
ATOM 1825  H HG21 . VAL A 1 110 ? -17.533 15.508  -24.594 1.00 0.00 ? 110 VAL A HG21 1  
ATOM 1826  H HG22 . VAL A 1 110 ? -18.691 16.410  -23.551 1.00 0.00 ? 110 VAL A HG22 1  
ATOM 1827  H HG23 . VAL A 1 110 ? -17.483 17.311  -24.530 1.00 0.00 ? 110 VAL A HG23 1  
ATOM 1828  N N    . ILE A 1 111 ? -13.990 18.282  -23.379 1.00 0.00 ? 111 ILE A N    1  
ATOM 1829  C CA   . ILE A 1 111 ? -13.383 19.461  -23.981 1.00 0.00 ? 111 ILE A CA   1  
ATOM 1830  C C    . ILE A 1 111 ? -11.855 19.338  -23.843 1.00 0.00 ? 111 ILE A C    1  
ATOM 1831  O O    . ILE A 1 111 ? -11.351 19.592  -22.743 1.00 0.00 ? 111 ILE A O    1  
ATOM 1832  C CB   . ILE A 1 111 ? -13.963 20.762  -23.389 1.00 0.00 ? 111 ILE A CB   1  
ATOM 1833  C CG1  . ILE A 1 111 ? -13.198 22.058  -23.791 1.00 0.00 ? 111 ILE A CG1  1  
ATOM 1834  C CG2  . ILE A 1 111 ? -14.173 20.678  -21.850 1.00 0.00 ? 111 ILE A CG2  1  
ATOM 1835  C CD1  . ILE A 1 111 ? -13.107 22.295  -25.307 1.00 0.00 ? 111 ILE A CD1  1  
ATOM 1836  H H    . ILE A 1 111 ? -13.856 18.199  -22.398 1.00 0.00 ? 111 ILE A H    1  
ATOM 1837  H HA   . ILE A 1 111 ? -13.632 19.516  -25.032 1.00 0.00 ? 111 ILE A HA   1  
ATOM 1838  H HB   . ILE A 1 111 ? -14.987 20.860  -23.829 1.00 0.00 ? 111 ILE A HB   1  
ATOM 1839  H HG12 . ILE A 1 111 ? -13.751 22.919  -23.342 1.00 0.00 ? 111 ILE A HG12 1  
ATOM 1840  H HG13 . ILE A 1 111 ? -12.180 22.044  -23.331 1.00 0.00 ? 111 ILE A HG13 1  
ATOM 1841  H HG21 . ILE A 1 111 ? -13.218 20.481  -21.320 1.00 0.00 ? 111 ILE A HG21 1  
ATOM 1842  H HG22 . ILE A 1 111 ? -14.578 21.643  -21.474 1.00 0.00 ? 111 ILE A HG22 1  
ATOM 1843  H HG23 . ILE A 1 111 ? -14.904 19.889  -21.579 1.00 0.00 ? 111 ILE A HG23 1  
ATOM 1844  H HD11 . ILE A 1 111 ? -14.122 22.255  -25.761 1.00 0.00 ? 111 ILE A HD11 1  
ATOM 1845  H HD12 . ILE A 1 111 ? -12.680 23.298  -25.526 1.00 0.00 ? 111 ILE A HD12 1  
ATOM 1846  H HD13 . ILE A 1 111 ? -12.475 21.532  -25.807 1.00 0.00 ? 111 ILE A HD13 1  
ATOM 1847  N N    . PRO A 1 112 ? -11.045 18.960  -24.890 1.00 0.00 ? 112 PRO A N    1  
ATOM 1848  C CA   . PRO A 1 112 ? -9.578  18.776  -24.834 1.00 0.00 ? 112 PRO A CA   1  
ATOM 1849  C C    . PRO A 1 112 ? -8.805  20.059  -24.501 1.00 0.00 ? 112 PRO A C    1  
ATOM 1850  O O    . PRO A 1 112 ? -8.363  20.800  -25.375 1.00 0.00 ? 112 PRO A O    1  
ATOM 1851  C CB   . PRO A 1 112 ? -9.209  18.173  -26.207 1.00 0.00 ? 112 PRO A CB   1  
ATOM 1852  C CG   . PRO A 1 112 ? -10.506 17.512  -26.677 1.00 0.00 ? 112 PRO A CG   1  
ATOM 1853  C CD   . PRO A 1 112 ? -11.565 18.493  -26.177 1.00 0.00 ? 112 PRO A CD   1  
ATOM 1854  H HA   . PRO A 1 112 ? -9.362  18.067  -24.049 1.00 0.00 ? 112 PRO A HA   1  
ATOM 1855  H HB2  . PRO A 1 112 ? -8.930  18.953  -26.953 1.00 0.00 ? 112 PRO A HB2  1  
ATOM 1856  H HB3  . PRO A 1 112 ? -8.382  17.441  -26.118 1.00 0.00 ? 112 PRO A HB3  1  
ATOM 1857  H HG2  . PRO A 1 112 ? -10.544 17.357  -27.773 1.00 0.00 ? 112 PRO A HG2  1  
ATOM 1858  H HG3  . PRO A 1 112 ? -10.639 16.533  -26.160 1.00 0.00 ? 112 PRO A HG3  1  
ATOM 1859  H HD2  . PRO A 1 112 ? -11.637 19.361  -26.869 1.00 0.00 ? 112 PRO A HD2  1  
ATOM 1860  H HD3  . PRO A 1 112 ? -12.551 17.978  -26.111 1.00 0.00 ? 112 PRO A HD3  1  
ATOM 1861  N N    . SER A 1 113 ? -8.687  20.320  -23.179 1.00 0.00 ? 113 SER A N    1  
ATOM 1862  C CA   . SER A 1 113 ? -8.173  21.529  -22.554 1.00 0.00 ? 113 SER A CA   1  
ATOM 1863  C C    . SER A 1 113 ? -6.685  21.469  -22.283 1.00 0.00 ? 113 SER A C    1  
ATOM 1864  O O    . SER A 1 113 ? -6.245  21.404  -21.139 1.00 0.00 ? 113 SER A O    1  
ATOM 1865  C CB   . SER A 1 113 ? -8.950  21.816  -21.238 1.00 0.00 ? 113 SER A CB   1  
ATOM 1866  O OG   . SER A 1 113 ? -10.356 21.908  -21.495 1.00 0.00 ? 113 SER A OG   1  
ATOM 1867  H H    . SER A 1 113 ? -9.090  19.655  -22.552 1.00 0.00 ? 113 SER A H    1  
ATOM 1868  H HA   . SER A 1 113 ? -8.344  22.374  -23.212 1.00 0.00 ? 113 SER A HA   1  
ATOM 1869  H HB2  . SER A 1 113 ? -8.782  20.999  -20.500 1.00 0.00 ? 113 SER A HB2  1  
ATOM 1870  H HB3  . SER A 1 113 ? -8.618  22.776  -20.782 1.00 0.00 ? 113 SER A HB3  1  
ATOM 1871  H HG   . SER A 1 113 ? -10.620 21.113  -21.994 1.00 0.00 ? 113 SER A HG   1  
ATOM 1872  N N    . LYS A 1 114 ? -5.890  21.492  -23.374 1.00 0.00 ? 114 LYS A N    1  
ATOM 1873  C CA   . LYS A 1 114 ? -4.447  21.452  -23.360 1.00 0.00 ? 114 LYS A CA   1  
ATOM 1874  C C    . LYS A 1 114 ? -3.935  22.092  -24.637 1.00 0.00 ? 114 LYS A C    1  
ATOM 1875  O O    . LYS A 1 114 ? -4.670  22.345  -25.590 1.00 0.00 ? 114 LYS A O    1  
ATOM 1876  C CB   . LYS A 1 114 ? -3.860  20.015  -23.145 1.00 0.00 ? 114 LYS A CB   1  
ATOM 1877  C CG   . LYS A 1 114 ? -4.540  18.828  -23.869 1.00 0.00 ? 114 LYS A CG   1  
ATOM 1878  C CD   . LYS A 1 114 ? -4.532  18.830  -25.406 1.00 0.00 ? 114 LYS A CD   1  
ATOM 1879  C CE   . LYS A 1 114 ? -5.158  17.556  -25.992 1.00 0.00 ? 114 LYS A CE   1  
ATOM 1880  N NZ   . LYS A 1 114 ? -5.255  17.638  -27.467 1.00 0.00 ? 114 LYS A NZ   1  
ATOM 1881  H H    . LYS A 1 114 ? -6.293  21.538  -24.291 1.00 0.00 ? 114 LYS A H    1  
ATOM 1882  H HA   . LYS A 1 114 ? -4.088  22.088  -22.559 1.00 0.00 ? 114 LYS A HA   1  
ATOM 1883  H HB2  . LYS A 1 114 ? -2.768  19.986  -23.348 1.00 0.00 ? 114 LYS A HB2  1  
ATOM 1884  H HB3  . LYS A 1 114 ? -3.976  19.796  -22.056 1.00 0.00 ? 114 LYS A HB3  1  
ATOM 1885  H HG2  . LYS A 1 114 ? -4.021  17.899  -23.531 1.00 0.00 ? 114 LYS A HG2  1  
ATOM 1886  H HG3  . LYS A 1 114 ? -5.595  18.759  -23.524 1.00 0.00 ? 114 LYS A HG3  1  
ATOM 1887  H HD2  . LYS A 1 114 ? -5.110  19.709  -25.773 1.00 0.00 ? 114 LYS A HD2  1  
ATOM 1888  H HD3  . LYS A 1 114 ? -3.482  18.926  -25.763 1.00 0.00 ? 114 LYS A HD3  1  
ATOM 1889  H HE2  . LYS A 1 114 ? -4.544  16.667  -25.738 1.00 0.00 ? 114 LYS A HE2  1  
ATOM 1890  H HE3  . LYS A 1 114 ? -6.185  17.417  -25.596 1.00 0.00 ? 114 LYS A HE3  1  
ATOM 1891  H HZ1  . LYS A 1 114 ? -5.842  18.455  -27.731 1.00 0.00 ? 114 LYS A HZ1  1  
ATOM 1892  H HZ2  . LYS A 1 114 ? -4.304  17.748  -27.872 1.00 0.00 ? 114 LYS A HZ2  1  
ATOM 1893  H HZ3  . LYS A 1 114 ? -5.689  16.767  -27.834 1.00 0.00 ? 114 LYS A HZ3  1  
ATOM 1894  N N    . VAL A 1 115 ? -2.612  22.347  -24.675 1.00 0.00 ? 115 VAL A N    1  
ATOM 1895  C CA   . VAL A 1 115 ? -1.877  22.906  -25.796 1.00 0.00 ? 115 VAL A CA   1  
ATOM 1896  C C    . VAL A 1 115 ? -0.825  21.877  -26.180 1.00 0.00 ? 115 VAL A C    1  
ATOM 1897  O O    . VAL A 1 115 ? -0.349  21.141  -25.316 1.00 0.00 ? 115 VAL A O    1  
ATOM 1898  C CB   . VAL A 1 115 ? -1.299  24.290  -25.458 1.00 0.00 ? 115 VAL A CB   1  
ATOM 1899  C CG1  . VAL A 1 115 ? -0.313  24.250  -24.267 1.00 0.00 ? 115 VAL A CG1  1  
ATOM 1900  C CG2  . VAL A 1 115 ? -0.675  24.968  -26.701 1.00 0.00 ? 115 VAL A CG2  1  
ATOM 1901  H H    . VAL A 1 115 ? -2.039  22.121  -23.893 1.00 0.00 ? 115 VAL A H    1  
ATOM 1902  H HA   . VAL A 1 115 ? -2.531  23.022  -26.653 1.00 0.00 ? 115 VAL A HA   1  
ATOM 1903  H HB   . VAL A 1 115 ? -2.166  24.921  -25.144 1.00 0.00 ? 115 VAL A HB   1  
ATOM 1904  H HG11 . VAL A 1 115 ? -0.786  23.804  -23.368 1.00 0.00 ? 115 VAL A HG11 1  
ATOM 1905  H HG12 . VAL A 1 115 ? 0.597   23.665  -24.516 1.00 0.00 ? 115 VAL A HG12 1  
ATOM 1906  H HG13 . VAL A 1 115 ? 0.007   25.282  -24.009 1.00 0.00 ? 115 VAL A HG13 1  
ATOM 1907  H HG21 . VAL A 1 115 ? -1.383  24.946  -27.555 1.00 0.00 ? 115 VAL A HG21 1  
ATOM 1908  H HG22 . VAL A 1 115 ? -0.441  26.030  -26.472 1.00 0.00 ? 115 VAL A HG22 1  
ATOM 1909  H HG23 . VAL A 1 115 ? 0.271   24.469  -26.998 1.00 0.00 ? 115 VAL A HG23 1  
ATOM 1910  N N    . TRP A 1 116 ? -0.473  21.839  -27.499 1.00 0.00 ? 116 TRP A N    1  
ATOM 1911  C CA   . TRP A 1 116 ? 0.456   21.014  -28.280 1.00 0.00 ? 116 TRP A CA   1  
ATOM 1912  C C    . TRP A 1 116 ? 1.493   20.111  -27.592 1.00 0.00 ? 116 TRP A C    1  
ATOM 1913  O O    . TRP A 1 116 ? 1.426   18.888  -27.700 1.00 0.00 ? 116 TRP A O    1  
ATOM 1914  C CB   . TRP A 1 116 ? 1.152   21.886  -29.384 1.00 0.00 ? 116 TRP A CB   1  
ATOM 1915  C CG   . TRP A 1 116 ? 0.224   22.631  -30.356 1.00 0.00 ? 116 TRP A CG   1  
ATOM 1916  C CD1  . TRP A 1 116 ? 0.170   23.973  -30.645 1.00 0.00 ? 116 TRP A CD1  1  
ATOM 1917  C CD2  . TRP A 1 116 ? -0.735  21.997  -31.230 1.00 0.00 ? 116 TRP A CD2  1  
ATOM 1918  N NE1  . TRP A 1 116 ? -0.766  24.217  -31.637 1.00 0.00 ? 116 TRP A NE1  1  
ATOM 1919  C CE2  . TRP A 1 116 ? -1.342  23.009  -31.981 1.00 0.00 ? 116 TRP A CE2  1  
ATOM 1920  C CE3  . TRP A 1 116 ? -1.080  20.680  -31.406 1.00 0.00 ? 116 TRP A CE3  1  
ATOM 1921  C CZ2  . TRP A 1 116 ? -2.320  22.718  -32.885 1.00 0.00 ? 116 TRP A CZ2  1  
ATOM 1922  C CZ3  . TRP A 1 116 ? -2.066  20.392  -32.330 1.00 0.00 ? 116 TRP A CZ3  1  
ATOM 1923  C CH2  . TRP A 1 116 ? -2.684  21.396  -33.047 1.00 0.00 ? 116 TRP A CH2  1  
ATOM 1924  H H    . TRP A 1 116 ? -0.935  22.494  -28.087 1.00 0.00 ? 116 TRP A H    1  
ATOM 1925  H HA   . TRP A 1 116 ? -0.183  20.310  -28.790 1.00 0.00 ? 116 TRP A HA   1  
ATOM 1926  H HB2  . TRP A 1 116 ? 1.806   22.642  -28.896 1.00 0.00 ? 116 TRP A HB2  1  
ATOM 1927  H HB3  . TRP A 1 116 ? 1.798   21.245  -30.022 1.00 0.00 ? 116 TRP A HB3  1  
ATOM 1928  H HD1  . TRP A 1 116 ? 0.786   24.723  -30.169 1.00 0.00 ? 116 TRP A HD1  1  
ATOM 1929  H HE1  . TRP A 1 116 ? -0.947  25.067  -32.092 1.00 0.00 ? 116 TRP A HE1  1  
ATOM 1930  H HE3  . TRP A 1 116 ? -0.615  19.871  -30.861 1.00 0.00 ? 116 TRP A HE3  1  
ATOM 1931  H HZ2  . TRP A 1 116 ? -2.806  23.489  -33.466 1.00 0.00 ? 116 TRP A HZ2  1  
ATOM 1932  H HZ3  . TRP A 1 116 ? -2.360  19.363  -32.498 1.00 0.00 ? 116 TRP A HZ3  1  
ATOM 1933  H HH2  . TRP A 1 116 ? -3.461  21.136  -33.755 1.00 0.00 ? 116 TRP A HH2  1  
ATOM 1934  N N    . GLN A 1 117 ? 2.490   20.691  -26.877 1.00 0.00 ? 117 GLN A N    1  
ATOM 1935  C CA   . GLN A 1 117 ? 3.527   19.949  -26.189 1.00 0.00 ? 117 GLN A CA   1  
ATOM 1936  C C    . GLN A 1 117 ? 3.708   20.531  -24.802 1.00 0.00 ? 117 GLN A C    1  
ATOM 1937  O O    . GLN A 1 117 ? 3.592   21.733  -24.570 1.00 0.00 ? 117 GLN A O    1  
ATOM 1938  C CB   . GLN A 1 117 ? 4.860   19.908  -26.984 1.00 0.00 ? 117 GLN A CB   1  
ATOM 1939  C CG   . GLN A 1 117 ? 5.962   19.035  -26.335 1.00 0.00 ? 117 GLN A CG   1  
ATOM 1940  C CD   . GLN A 1 117 ? 7.138   18.836  -27.288 1.00 0.00 ? 117 GLN A CD   1  
ATOM 1941  O OE1  . GLN A 1 117 ? 7.986   19.714  -27.458 1.00 0.00 ? 117 GLN A OE1  1  
ATOM 1942  N NE2  . GLN A 1 117 ? 7.190   17.638  -27.929 1.00 0.00 ? 117 GLN A NE2  1  
ATOM 1943  H H    . GLN A 1 117 ? 2.557   21.679  -26.764 1.00 0.00 ? 117 GLN A H    1  
ATOM 1944  H HA   . GLN A 1 117 ? 3.209   18.922  -26.040 1.00 0.00 ? 117 GLN A HA   1  
ATOM 1945  H HB2  . GLN A 1 117 ? 4.625   19.488  -27.988 1.00 0.00 ? 117 GLN A HB2  1  
ATOM 1946  H HB3  . GLN A 1 117 ? 5.243   20.941  -27.141 1.00 0.00 ? 117 GLN A HB3  1  
ATOM 1947  H HG2  . GLN A 1 117 ? 6.361   19.536  -25.426 1.00 0.00 ? 117 GLN A HG2  1  
ATOM 1948  H HG3  . GLN A 1 117 ? 5.542   18.050  -26.042 1.00 0.00 ? 117 GLN A HG3  1  
ATOM 1949  H HE21 . GLN A 1 117 ? 6.506   16.939  -27.741 1.00 0.00 ? 117 GLN A HE21 1  
ATOM 1950  H HE22 . GLN A 1 117 ? 7.955   17.485  -28.550 1.00 0.00 ? 117 GLN A HE22 1  
ATOM 1951  N N    . GLY A 1 118 ? 3.975   19.605  -23.855 1.00 0.00 ? 118 GLY A N    1  
ATOM 1952  C CA   . GLY A 1 118 ? 4.140   19.825  -22.434 1.00 0.00 ? 118 GLY A CA   1  
ATOM 1953  C C    . GLY A 1 118 ? 3.939   18.487  -21.787 1.00 0.00 ? 118 GLY A C    1  
ATOM 1954  O O    . GLY A 1 118 ? 4.822   17.973  -21.104 1.00 0.00 ? 118 GLY A O    1  
ATOM 1955  H H    . GLY A 1 118 ? 4.064   18.654  -24.146 1.00 0.00 ? 118 GLY A H    1  
ATOM 1956  H HA2  . GLY A 1 118 ? 5.154   20.146  -22.246 1.00 0.00 ? 118 GLY A HA2  1  
ATOM 1957  H HA3  . GLY A 1 118 ? 3.373   20.498  -22.071 1.00 0.00 ? 118 GLY A HA3  1  
ATOM 1958  N N    . GLN A 1 119 ? 2.732   17.898  -22.029 1.00 0.00 ? 119 GLN A N    1  
ATOM 1959  C CA   . GLN A 1 119 ? 2.262   16.601  -21.535 1.00 0.00 ? 119 GLN A CA   1  
ATOM 1960  C C    . GLN A 1 119 ? 2.760   15.390  -22.348 1.00 0.00 ? 119 GLN A C    1  
ATOM 1961  O O    . GLN A 1 119 ? 3.835   14.862  -22.077 1.00 0.00 ? 119 GLN A O    1  
ATOM 1962  C CB   . GLN A 1 119 ? 0.702   16.560  -21.413 1.00 0.00 ? 119 GLN A CB   1  
ATOM 1963  C CG   . GLN A 1 119 ? 0.085   17.607  -20.451 1.00 0.00 ? 119 GLN A CG   1  
ATOM 1964  C CD   . GLN A 1 119 ? -1.429  17.371  -20.341 1.00 0.00 ? 119 GLN A CD   1  
ATOM 1965  O OE1  . GLN A 1 119 ? -2.111  17.123  -21.338 1.00 0.00 ? 119 GLN A OE1  1  
ATOM 1966  N NE2  . GLN A 1 119 ? -1.978  17.407  -19.100 1.00 0.00 ? 119 GLN A NE2  1  
ATOM 1967  H H    . GLN A 1 119 ? 2.066   18.399  -22.574 1.00 0.00 ? 119 GLN A H    1  
ATOM 1968  H HA   . GLN A 1 119 ? 2.660   16.460  -20.537 1.00 0.00 ? 119 GLN A HA   1  
ATOM 1969  H HB2  . GLN A 1 119 ? 0.244   16.723  -22.414 1.00 0.00 ? 119 GLN A HB2  1  
ATOM 1970  H HB3  . GLN A 1 119 ? 0.383   15.555  -21.047 1.00 0.00 ? 119 GLN A HB3  1  
ATOM 1971  H HG2  . GLN A 1 119 ? 0.559   17.524  -19.452 1.00 0.00 ? 119 GLN A HG2  1  
ATOM 1972  H HG3  . GLN A 1 119 ? 0.245   18.633  -20.842 1.00 0.00 ? 119 GLN A HG3  1  
ATOM 1973  H HE21 . GLN A 1 119 ? -1.394  17.564  -18.308 1.00 0.00 ? 119 GLN A HE21 1  
ATOM 1974  H HE22 . GLN A 1 119 ? -2.927  17.105  -19.007 1.00 0.00 ? 119 GLN A HE22 1  
ATOM 1975  N N    . ALA A 1 120 ? 1.957   14.894  -23.334 1.00 0.00 ? 120 ALA A N    1  
ATOM 1976  C CA   . ALA A 1 120 ? 2.255   13.705  -24.136 1.00 0.00 ? 120 ALA A CA   1  
ATOM 1977  C C    . ALA A 1 120 ? 2.146   13.938  -25.648 1.00 0.00 ? 120 ALA A C    1  
ATOM 1978  O O    . ALA A 1 120 ? 2.824   14.796  -26.208 1.00 0.00 ? 120 ALA A O    1  
ATOM 1979  C CB   . ALA A 1 120 ? 1.324   12.556  -23.684 1.00 0.00 ? 120 ALA A CB   1  
ATOM 1980  H H    . ALA A 1 120 ? 1.085   15.334  -23.517 1.00 0.00 ? 120 ALA A H    1  
ATOM 1981  H HA   . ALA A 1 120 ? 3.282   13.395  -23.978 1.00 0.00 ? 120 ALA A HA   1  
ATOM 1982  H HB1  . ALA A 1 120 ? 0.249   12.788  -23.851 1.00 0.00 ? 120 ALA A HB1  1  
ATOM 1983  H HB2  . ALA A 1 120 ? 1.462   12.393  -22.594 1.00 0.00 ? 120 ALA A HB2  1  
ATOM 1984  H HB3  . ALA A 1 120 ? 1.580   11.595  -24.181 1.00 0.00 ? 120 ALA A HB3  1  
ATOM 1985  N N    . PHE A 1 121 ? 1.273   13.160  -26.341 1.00 0.00 ? 121 PHE A N    1  
ATOM 1986  C CA   . PHE A 1 121 ? 0.992   13.221  -27.768 1.00 0.00 ? 121 PHE A CA   1  
ATOM 1987  C C    . PHE A 1 121 ? -0.501  12.919  -27.909 1.00 0.00 ? 121 PHE A C    1  
ATOM 1988  O O    . PHE A 1 121 ? -1.148  12.509  -26.942 1.00 0.00 ? 121 PHE A O    1  
ATOM 1989  C CB   . PHE A 1 121 ? 1.823   12.184  -28.592 1.00 0.00 ? 121 PHE A CB   1  
ATOM 1990  C CG   . PHE A 1 121 ? 3.286   12.544  -28.679 1.00 0.00 ? 121 PHE A CG   1  
ATOM 1991  C CD1  . PHE A 1 121 ? 3.736   13.431  -29.644 1.00 0.00 ? 121 PHE A CD1  1  
ATOM 1992  C CD2  . PHE A 1 121 ? 4.219   11.960  -27.839 1.00 0.00 ? 121 PHE A CD2  1  
ATOM 1993  C CE1  . PHE A 1 121 ? 5.083   13.714  -29.779 1.00 0.00 ? 121 PHE A CE1  1  
ATOM 1994  C CE2  . PHE A 1 121 ? 5.565   12.245  -27.960 1.00 0.00 ? 121 PHE A CE2  1  
ATOM 1995  C CZ   . PHE A 1 121 ? 6.001   13.115  -28.939 1.00 0.00 ? 121 PHE A CZ   1  
ATOM 1996  H H    . PHE A 1 121 ? 0.725   12.495  -25.833 1.00 0.00 ? 121 PHE A H    1  
ATOM 1997  H HA   . PHE A 1 121 ? 1.161   14.226  -28.141 1.00 0.00 ? 121 PHE A HA   1  
ATOM 1998  H HB2  . PHE A 1 121 ? 1.739   11.168  -28.147 1.00 0.00 ? 121 PHE A HB2  1  
ATOM 1999  H HB3  . PHE A 1 121 ? 1.459   12.130  -29.640 1.00 0.00 ? 121 PHE A HB3  1  
ATOM 2000  H HD1  . PHE A 1 121 ? 3.022   13.896  -30.312 1.00 0.00 ? 121 PHE A HD1  1  
ATOM 2001  H HD2  . PHE A 1 121 ? 3.892   11.260  -27.081 1.00 0.00 ? 121 PHE A HD2  1  
ATOM 2002  H HE1  . PHE A 1 121 ? 5.419   14.406  -30.542 1.00 0.00 ? 121 PHE A HE1  1  
ATOM 2003  H HE2  . PHE A 1 121 ? 6.277   11.768  -27.297 1.00 0.00 ? 121 PHE A HE2  1  
ATOM 2004  H HZ   . PHE A 1 121 ? 7.056   13.332  -29.045 1.00 0.00 ? 121 PHE A HZ   1  
ATOM 2005  N N    . HIS A 1 122 ? -1.096  13.106  -29.113 1.00 0.00 ? 122 HIS A N    1  
ATOM 2006  C CA   . HIS A 1 122 ? -2.497  12.805  -29.368 1.00 0.00 ? 122 HIS A CA   1  
ATOM 2007  C C    . HIS A 1 122 ? -2.595  12.293  -30.790 1.00 0.00 ? 122 HIS A C    1  
ATOM 2008  O O    . HIS A 1 122 ? -2.002  12.865  -31.704 1.00 0.00 ? 122 HIS A O    1  
ATOM 2009  C CB   . HIS A 1 122 ? -3.450  14.004  -29.087 1.00 0.00 ? 122 HIS A CB   1  
ATOM 2010  C CG   . HIS A 1 122 ? -3.039  15.337  -29.671 1.00 0.00 ? 122 HIS A CG   1  
ATOM 2011  N ND1  . HIS A 1 122 ? -2.538  16.380  -28.919 1.00 0.00 ? 122 HIS A ND1  1  
ATOM 2012  C CD2  . HIS A 1 122 ? -3.141  15.816  -30.941 1.00 0.00 ? 122 HIS A CD2  1  
ATOM 2013  C CE1  . HIS A 1 122 ? -2.372  17.433  -29.759 1.00 0.00 ? 122 HIS A CE1  1  
ATOM 2014  N NE2  . HIS A 1 122 ? -2.728  17.139  -30.993 1.00 0.00 ? 122 HIS A NE2  1  
ATOM 2015  H H    . HIS A 1 122 ? -0.583  13.444  -29.899 1.00 0.00 ? 122 HIS A H    1  
ATOM 2016  H HA   . HIS A 1 122 ? -2.814  11.981  -28.740 1.00 0.00 ? 122 HIS A HA   1  
ATOM 2017  H HB2  . HIS A 1 122 ? -4.484  13.767  -29.419 1.00 0.00 ? 122 HIS A HB2  1  
ATOM 2018  H HB3  . HIS A 1 122 ? -3.492  14.132  -27.981 1.00 0.00 ? 122 HIS A HB3  1  
ATOM 2019  H HD1  . HIS A 1 122 ? -2.352  16.367  -27.935 1.00 0.00 ? 122 HIS A HD1  1  
ATOM 2020  H HD2  . HIS A 1 122 ? -3.484  15.316  -31.838 1.00 0.00 ? 122 HIS A HD2  1  
ATOM 2021  H HE1  . HIS A 1 122 ? -1.983  18.398  -29.436 1.00 0.00 ? 122 HIS A HE1  1  
ATOM 2022  N N    . LEU A 1 123 ? -3.320  11.153  -30.992 1.00 0.00 ? 123 LEU A N    1  
ATOM 2023  C CA   . LEU A 1 123 ? -3.526  10.414  -32.247 1.00 0.00 ? 123 LEU A CA   1  
ATOM 2024  C C    . LEU A 1 123 ? -2.311  9.586   -32.678 1.00 0.00 ? 123 LEU A C    1  
ATOM 2025  O O    . LEU A 1 123 ? -2.357  8.363   -32.781 1.00 0.00 ? 123 LEU A O    1  
ATOM 2026  C CB   . LEU A 1 123 ? -4.100  11.293  -33.401 1.00 0.00 ? 123 LEU A CB   1  
ATOM 2027  C CG   . LEU A 1 123 ? -4.523  10.564  -34.700 1.00 0.00 ? 123 LEU A CG   1  
ATOM 2028  C CD1  . LEU A 1 123 ? -5.540  9.439   -34.448 1.00 0.00 ? 123 LEU A CD1  1  
ATOM 2029  C CD2  . LEU A 1 123 ? -5.089  11.582  -35.704 1.00 0.00 ? 123 LEU A CD2  1  
ATOM 2030  H H    . LEU A 1 123 ? -3.764  10.740  -30.202 1.00 0.00 ? 123 LEU A H    1  
ATOM 2031  H HA   . LEU A 1 123 ? -4.284  9.683   -32.009 1.00 0.00 ? 123 LEU A HA   1  
ATOM 2032  H HB2  . LEU A 1 123 ? -5.000  11.813  -33.004 1.00 0.00 ? 123 LEU A HB2  1  
ATOM 2033  H HB3  . LEU A 1 123 ? -3.365  12.082  -33.670 1.00 0.00 ? 123 LEU A HB3  1  
ATOM 2034  H HG   . LEU A 1 123 ? -3.617  10.108  -35.166 1.00 0.00 ? 123 LEU A HG   1  
ATOM 2035  H HD11 . LEU A 1 123 ? -6.446  9.838   -33.944 1.00 0.00 ? 123 LEU A HD11 1  
ATOM 2036  H HD12 . LEU A 1 123 ? -5.849  8.982   -35.412 1.00 0.00 ? 123 LEU A HD12 1  
ATOM 2037  H HD13 . LEU A 1 123 ? -5.101  8.637   -33.817 1.00 0.00 ? 123 LEU A HD13 1  
ATOM 2038  H HD21 . LEU A 1 123 ? -4.350  12.386  -35.906 1.00 0.00 ? 123 LEU A HD21 1  
ATOM 2039  H HD22 . LEU A 1 123 ? -5.340  11.082  -36.664 1.00 0.00 ? 123 LEU A HD22 1  
ATOM 2040  H HD23 . LEU A 1 123 ? -6.013  12.049  -35.299 1.00 0.00 ? 123 LEU A HD23 1  
ATOM 2041  N N    . ASP A 1 124 ? -1.166  10.275  -32.901 1.00 0.00 ? 124 ASP A N    1  
ATOM 2042  C CA   . ASP A 1 124 ? 0.145   9.742   -33.248 1.00 0.00 ? 124 ASP A CA   1  
ATOM 2043  C C    . ASP A 1 124 ? 0.926   9.387   -31.982 1.00 0.00 ? 124 ASP A C    1  
ATOM 2044  O O    . ASP A 1 124 ? 0.926   10.141  -31.011 1.00 0.00 ? 124 ASP A O    1  
ATOM 2045  C CB   . ASP A 1 124 ? 0.947   10.718  -34.172 1.00 0.00 ? 124 ASP A CB   1  
ATOM 2046  C CG   . ASP A 1 124 ? 0.966   12.175  -33.676 1.00 0.00 ? 124 ASP A CG   1  
ATOM 2047  O OD1  . ASP A 1 124 ? 1.769   12.486  -32.757 1.00 0.00 ? 124 ASP A OD1  1  
ATOM 2048  O OD2  . ASP A 1 124 ? 0.178   12.993  -34.222 1.00 0.00 ? 124 ASP A OD2  1  
ATOM 2049  H H    . ASP A 1 124 ? -1.197  11.268  -32.764 1.00 0.00 ? 124 ASP A H    1  
ATOM 2050  H HA   . ASP A 1 124 ? 0.014   8.825   -33.809 1.00 0.00 ? 124 ASP A HA   1  
ATOM 2051  H HB2  . ASP A 1 124 ? 1.986   10.364  -34.333 1.00 0.00 ? 124 ASP A HB2  1  
ATOM 2052  H HB3  . ASP A 1 124 ? 0.445   10.709  -35.166 1.00 0.00 ? 124 ASP A HB3  1  
ATOM 2053  N N    . ARG A 1 125 ? 1.589   8.199   -31.975 1.00 0.00 ? 125 ARG A N    1  
ATOM 2054  C CA   . ARG A 1 125 ? 2.380   7.642   -30.872 1.00 0.00 ? 125 ARG A CA   1  
ATOM 2055  C C    . ARG A 1 125 ? 1.537   7.153   -29.683 1.00 0.00 ? 125 ARG A C    1  
ATOM 2056  O O    . ARG A 1 125 ? 1.574   7.678   -28.570 1.00 0.00 ? 125 ARG A O    1  
ATOM 2057  C CB   . ARG A 1 125 ? 3.580   8.537   -30.443 1.00 0.00 ? 125 ARG A CB   1  
ATOM 2058  C CG   . ARG A 1 125 ? 4.719   7.779   -29.731 1.00 0.00 ? 125 ARG A CG   1  
ATOM 2059  C CD   . ARG A 1 125 ? 5.859   8.705   -29.284 1.00 0.00 ? 125 ARG A CD   1  
ATOM 2060  N NE   . ARG A 1 125 ? 6.875   7.881   -28.540 1.00 0.00 ? 125 ARG A NE   1  
ATOM 2061  C CZ   . ARG A 1 125 ? 7.974   8.417   -27.924 1.00 0.00 ? 125 ARG A CZ   1  
ATOM 2062  N NH1  . ARG A 1 125 ? 8.235   9.755   -27.994 1.00 0.00 ? 125 ARG A NH1  1  
ATOM 2063  N NH2  . ARG A 1 125 ? 8.817   7.600   -27.227 1.00 0.00 ? 125 ARG A NH2  1  
ATOM 2064  H H    . ARG A 1 125 ? 1.550   7.629   -32.789 1.00 0.00 ? 125 ARG A H    1  
ATOM 2065  H HA   . ARG A 1 125 ? 2.829   6.753   -31.288 1.00 0.00 ? 125 ARG A HA   1  
ATOM 2066  H HB2  . ARG A 1 125 ? 4.006   9.004   -31.360 1.00 0.00 ? 125 ARG A HB2  1  
ATOM 2067  H HB3  . ARG A 1 125 ? 3.221   9.369   -29.796 1.00 0.00 ? 125 ARG A HB3  1  
ATOM 2068  H HG2  . ARG A 1 125 ? 4.307   7.266   -28.833 1.00 0.00 ? 125 ARG A HG2  1  
ATOM 2069  H HG3  . ARG A 1 125 ? 5.126   7.002   -30.417 1.00 0.00 ? 125 ARG A HG3  1  
ATOM 2070  H HD2  . ARG A 1 125 ? 6.343   9.179   -30.164 1.00 0.00 ? 125 ARG A HD2  1  
ATOM 2071  H HD3  . ARG A 1 125 ? 5.457   9.485   -28.602 1.00 0.00 ? 125 ARG A HD3  1  
ATOM 2072  H HE   . ARG A 1 125 ? 6.718   6.896   -28.464 1.00 0.00 ? 125 ARG A HE   1  
ATOM 2073  H HH11 . ARG A 1 125 ? 7.619   10.357  -28.501 1.00 0.00 ? 125 ARG A HH11 1  
ATOM 2074  H HH12 . ARG A 1 125 ? 9.041   10.130  -27.539 1.00 0.00 ? 125 ARG A HH12 1  
ATOM 2075  H HH21 . ARG A 1 125 ? 8.628   6.620   -27.169 1.00 0.00 ? 125 ARG A HH21 1  
ATOM 2076  H HH22 . ARG A 1 125 ? 9.621   7.983   -26.771 1.00 0.00 ? 125 ARG A HH22 1  
ATOM 2077  N N    . ARG A 1 126 ? 0.727   6.085   -29.914 1.00 0.00 ? 126 ARG A N    1  
ATOM 2078  C CA   . ARG A 1 126 ? -0.185  5.478   -28.947 1.00 0.00 ? 126 ARG A CA   1  
ATOM 2079  C C    . ARG A 1 126 ? 0.478   4.557   -27.929 1.00 0.00 ? 126 ARG A C    1  
ATOM 2080  O O    . ARG A 1 126 ? 0.340   3.337   -27.954 1.00 0.00 ? 126 ARG A O    1  
ATOM 2081  C CB   . ARG A 1 126 ? -1.380  4.784   -29.659 1.00 0.00 ? 126 ARG A CB   1  
ATOM 2082  C CG   . ARG A 1 126 ? -2.249  5.709   -30.544 1.00 0.00 ? 126 ARG A CG   1  
ATOM 2083  C CD   . ARG A 1 126 ? -3.069  6.783   -29.796 1.00 0.00 ? 126 ARG A CD   1  
ATOM 2084  N NE   . ARG A 1 126 ? -2.165  7.931   -29.426 1.00 0.00 ? 126 ARG A NE   1  
ATOM 2085  C CZ   . ARG A 1 126 ? -2.293  8.678   -28.286 1.00 0.00 ? 126 ARG A CZ   1  
ATOM 2086  N NH1  . ARG A 1 126 ? -3.385  8.561   -27.479 1.00 0.00 ? 126 ARG A NH1  1  
ATOM 2087  N NH2  . ARG A 1 126 ? -1.288  9.539   -27.947 1.00 0.00 ? 126 ARG A NH2  1  
ATOM 2088  H H    . ARG A 1 126 ? 0.698   5.671   -30.818 1.00 0.00 ? 126 ARG A H    1  
ATOM 2089  H HA   . ARG A 1 126 ? -0.611  6.261   -28.339 1.00 0.00 ? 126 ARG A HA   1  
ATOM 2090  H HB2  . ARG A 1 126 ? -0.991  3.960   -30.299 1.00 0.00 ? 126 ARG A HB2  1  
ATOM 2091  H HB3  . ARG A 1 126 ? -2.061  4.329   -28.903 1.00 0.00 ? 126 ARG A HB3  1  
ATOM 2092  H HG2  . ARG A 1 126 ? -1.635  6.192   -31.335 1.00 0.00 ? 126 ARG A HG2  1  
ATOM 2093  H HG3  . ARG A 1 126 ? -2.986  5.052   -31.063 1.00 0.00 ? 126 ARG A HG3  1  
ATOM 2094  H HD2  . ARG A 1 126 ? -3.855  7.189   -30.468 1.00 0.00 ? 126 ARG A HD2  1  
ATOM 2095  H HD3  . ARG A 1 126 ? -3.545  6.332   -28.898 1.00 0.00 ? 126 ARG A HD3  1  
ATOM 2096  H HE   . ARG A 1 126 ? -1.348  8.069   -29.985 1.00 0.00 ? 126 ARG A HE   1  
ATOM 2097  H HH11 . ARG A 1 126 ? -4.118  7.926   -27.722 1.00 0.00 ? 126 ARG A HH11 1  
ATOM 2098  H HH12 . ARG A 1 126 ? -3.453  9.111   -26.648 1.00 0.00 ? 126 ARG A HH12 1  
ATOM 2099  H HH21 . ARG A 1 126 ? -0.482  9.620   -28.533 1.00 0.00 ? 126 ARG A HH21 1  
ATOM 2100  H HH22 . ARG A 1 126 ? -1.361  10.088  -27.116 1.00 0.00 ? 126 ARG A HH22 1  
ATOM 2101  N N    . LEU A 1 127 ? 1.203   5.205   -26.984 1.00 0.00 ? 127 LEU A N    1  
ATOM 2102  C CA   . LEU A 1 127 ? 1.886   4.640   -25.832 1.00 0.00 ? 127 LEU A CA   1  
ATOM 2103  C C    . LEU A 1 127 ? 1.245   5.249   -24.590 1.00 0.00 ? 127 LEU A C    1  
ATOM 2104  O O    . LEU A 1 127 ? 0.148   5.804   -24.640 1.00 0.00 ? 127 LEU A O    1  
ATOM 2105  C CB   . LEU A 1 127 ? 3.413   4.963   -25.866 1.00 0.00 ? 127 LEU A CB   1  
ATOM 2106  C CG   . LEU A 1 127 ? 4.175   4.337   -27.055 1.00 0.00 ? 127 LEU A CG   1  
ATOM 2107  C CD1  . LEU A 1 127 ? 5.639   4.809   -27.042 1.00 0.00 ? 127 LEU A CD1  1  
ATOM 2108  C CD2  . LEU A 1 127 ? 4.108   2.800   -27.047 1.00 0.00 ? 127 LEU A CD2  1  
ATOM 2109  H H    . LEU A 1 127 ? 1.271   6.204   -27.067 1.00 0.00 ? 127 LEU A H    1  
ATOM 2110  H HA   . LEU A 1 127 ? 1.730   3.569   -25.777 1.00 0.00 ? 127 LEU A HA   1  
ATOM 2111  H HB2  . LEU A 1 127 ? 3.548   6.069   -25.928 1.00 0.00 ? 127 LEU A HB2  1  
ATOM 2112  H HB3  . LEU A 1 127 ? 3.925   4.606   -24.945 1.00 0.00 ? 127 LEU A HB3  1  
ATOM 2113  H HG   . LEU A 1 127 ? 3.708   4.701   -28.002 1.00 0.00 ? 127 LEU A HG   1  
ATOM 2114  H HD11 . LEU A 1 127 ? 5.680   5.919   -27.013 1.00 0.00 ? 127 LEU A HD11 1  
ATOM 2115  H HD12 . LEU A 1 127 ? 6.164   4.415   -26.146 1.00 0.00 ? 127 LEU A HD12 1  
ATOM 2116  H HD13 . LEU A 1 127 ? 6.167   4.456   -27.951 1.00 0.00 ? 127 LEU A HD13 1  
ATOM 2117  H HD21 . LEU A 1 127 ? 4.508   2.405   -26.088 1.00 0.00 ? 127 LEU A HD21 1  
ATOM 2118  H HD22 . LEU A 1 127 ? 3.065   2.442   -27.182 1.00 0.00 ? 127 LEU A HD22 1  
ATOM 2119  H HD23 . LEU A 1 127 ? 4.719   2.390   -27.879 1.00 0.00 ? 127 LEU A HD23 1  
ATOM 2120  N N    . GLU A 1 128 ? 1.936   5.178   -23.429 1.00 0.00 ? 128 GLU A N    1  
ATOM 2121  C CA   . GLU A 1 128 ? 1.529   5.786   -22.175 1.00 0.00 ? 128 GLU A CA   1  
ATOM 2122  C C    . GLU A 1 128 ? 2.469   6.950   -21.929 1.00 0.00 ? 128 GLU A C    1  
ATOM 2123  O O    . GLU A 1 128 ? 3.455   7.133   -22.640 1.00 0.00 ? 128 GLU A O    1  
ATOM 2124  C CB   . GLU A 1 128 ? 1.579   4.780   -20.990 1.00 0.00 ? 128 GLU A CB   1  
ATOM 2125  C CG   . GLU A 1 128 ? 0.646   3.565   -21.165 1.00 0.00 ? 128 GLU A CG   1  
ATOM 2126  C CD   . GLU A 1 128 ? -0.810  4.023   -21.264 1.00 0.00 ? 128 GLU A CD   1  
ATOM 2127  O OE1  . GLU A 1 128 ? -1.308  4.634   -20.281 1.00 0.00 ? 128 GLU A OE1  1  
ATOM 2128  O OE2  . GLU A 1 128 ? -1.442  3.767   -22.323 1.00 0.00 ? 128 GLU A OE2  1  
ATOM 2129  H H    . GLU A 1 128 ? 2.829   4.740   -23.405 1.00 0.00 ? 128 GLU A H    1  
ATOM 2130  H HA   . GLU A 1 128 ? 0.530   6.199   -22.247 1.00 0.00 ? 128 GLU A HA   1  
ATOM 2131  H HB2  . GLU A 1 128 ? 2.616   4.388   -20.877 1.00 0.00 ? 128 GLU A HB2  1  
ATOM 2132  H HB3  . GLU A 1 128 ? 1.306   5.282   -20.035 1.00 0.00 ? 128 GLU A HB3  1  
ATOM 2133  H HG2  . GLU A 1 128 ? 0.928   3.000   -22.078 1.00 0.00 ? 128 GLU A HG2  1  
ATOM 2134  H HG3  . GLU A 1 128 ? 0.754   2.887   -20.290 1.00 0.00 ? 128 GLU A HG3  1  
ATOM 2135  N N    . ARG A 1 129 ? 2.177   7.769   -20.891 1.00 0.00 ? 129 ARG A N    1  
ATOM 2136  C CA   . ARG A 1 129 ? 2.908   8.955   -20.441 1.00 0.00 ? 129 ARG A CA   1  
ATOM 2137  C C    . ARG A 1 129 ? 4.350   8.694   -19.961 1.00 0.00 ? 129 ARG A C    1  
ATOM 2138  O O    . ARG A 1 129 ? 5.235   9.328   -20.537 1.00 0.00 ? 129 ARG A O    1  
ATOM 2139  C CB   . ARG A 1 129 ? 2.072   9.777   -19.415 1.00 0.00 ? 129 ARG A CB   1  
ATOM 2140  C CG   . ARG A 1 129 ? 0.919   10.633  -19.991 1.00 0.00 ? 129 ARG A CG   1  
ATOM 2141  C CD   . ARG A 1 129 ? -0.238  9.905   -20.706 1.00 0.00 ? 129 ARG A CD   1  
ATOM 2142  N NE   . ARG A 1 129 ? 0.085   9.775   -22.173 1.00 0.00 ? 129 ARG A NE   1  
ATOM 2143  C CZ   . ARG A 1 129 ? -0.697  9.095   -23.068 1.00 0.00 ? 129 ARG A CZ   1  
ATOM 2144  N NH1  . ARG A 1 129 ? -1.816  8.431   -22.659 1.00 0.00 ? 129 ARG A NH1  1  
ATOM 2145  N NH2  . ARG A 1 129 ? -0.342  9.075   -24.387 1.00 0.00 ? 129 ARG A NH2  1  
ATOM 2146  H H    . ARG A 1 129 ? 1.368   7.582   -20.349 1.00 0.00 ? 129 ARG A H    1  
ATOM 2147  H HA   . ARG A 1 129 ? 3.028   9.600   -21.305 1.00 0.00 ? 129 ARG A HA   1  
ATOM 2148  H HB2  . ARG A 1 129 ? 1.660   9.097   -18.637 1.00 0.00 ? 129 ARG A HB2  1  
ATOM 2149  H HB3  . ARG A 1 129 ? 2.736   10.504  -18.889 1.00 0.00 ? 129 ARG A HB3  1  
ATOM 2150  H HG2  . ARG A 1 129 ? 0.471   11.152  -19.110 1.00 0.00 ? 129 ARG A HG2  1  
ATOM 2151  H HG3  . ARG A 1 129 ? 1.337   11.425  -20.650 1.00 0.00 ? 129 ARG A HG3  1  
ATOM 2152  H HD2  . ARG A 1 129 ? -0.410  8.903   -20.254 1.00 0.00 ? 129 ARG A HD2  1  
ATOM 2153  H HD3  . ARG A 1 129 ? -1.163  10.517  -20.621 1.00 0.00 ? 129 ARG A HD3  1  
ATOM 2154  H HE   . ARG A 1 129 ? 0.902   10.240  -22.515 1.00 0.00 ? 129 ARG A HE   1  
ATOM 2155  H HH11 . ARG A 1 129 ? -2.077  8.438   -21.694 1.00 0.00 ? 129 ARG A HH11 1  
ATOM 2156  H HH12 . ARG A 1 129 ? -2.373  7.935   -23.326 1.00 0.00 ? 129 ARG A HH12 1  
ATOM 2157  H HH21 . ARG A 1 129 ? 0.481   9.558   -24.689 1.00 0.00 ? 129 ARG A HH21 1  
ATOM 2158  H HH22 . ARG A 1 129 ? -0.902  8.579   -25.049 1.00 0.00 ? 129 ARG A HH22 1  
ATOM 2159  N N    . PRO A 1 130 ? 4.681   7.816   -18.967 1.00 0.00 ? 130 PRO A N    1  
ATOM 2160  C CA   . PRO A 1 130 ? 6.058   7.470   -18.595 1.00 0.00 ? 130 PRO A CA   1  
ATOM 2161  C C    . PRO A 1 130 ? 6.686   6.527   -19.637 1.00 0.00 ? 130 PRO A C    1  
ATOM 2162  O O    . PRO A 1 130 ? 5.991   5.783   -20.336 1.00 0.00 ? 130 PRO A O    1  
ATOM 2163  C CB   . PRO A 1 130 ? 5.889   6.817   -17.216 1.00 0.00 ? 130 PRO A CB   1  
ATOM 2164  C CG   . PRO A 1 130 ? 4.531   6.117   -17.281 1.00 0.00 ? 130 PRO A CG   1  
ATOM 2165  C CD   . PRO A 1 130 ? 3.711   7.063   -18.163 1.00 0.00 ? 130 PRO A CD   1  
ATOM 2166  H HA   . PRO A 1 130 ? 6.678   8.357   -18.545 1.00 0.00 ? 130 PRO A HA   1  
ATOM 2167  H HB2  . PRO A 1 130 ? 6.709   6.128   -16.927 1.00 0.00 ? 130 PRO A HB2  1  
ATOM 2168  H HB3  . PRO A 1 130 ? 5.823   7.620   -16.444 1.00 0.00 ? 130 PRO A HB3  1  
ATOM 2169  H HG2  . PRO A 1 130 ? 4.642   5.126   -17.772 1.00 0.00 ? 130 PRO A HG2  1  
ATOM 2170  H HG3  . PRO A 1 130 ? 4.088   5.979   -16.271 1.00 0.00 ? 130 PRO A HG3  1  
ATOM 2171  H HD2  . PRO A 1 130 ? 3.016   6.477   -18.803 1.00 0.00 ? 130 PRO A HD2  1  
ATOM 2172  H HD3  . PRO A 1 130 ? 3.149   7.769   -17.513 1.00 0.00 ? 130 PRO A HD3  1  
ATOM 2173  N N    . HIS A 1 131 ? 8.024   6.588   -19.839 1.00 0.00 ? 131 HIS A N    1  
ATOM 2174  C CA   . HIS A 1 131 ? 8.724   5.847   -20.891 1.00 0.00 ? 131 HIS A CA   1  
ATOM 2175  C C    . HIS A 1 131 ? 9.936   5.139   -20.280 1.00 0.00 ? 131 HIS A C    1  
ATOM 2176  O O    . HIS A 1 131 ? 10.155  5.166   -19.072 1.00 0.00 ? 131 HIS A O    1  
ATOM 2177  C CB   . HIS A 1 131 ? 9.151   6.779   -22.080 1.00 0.00 ? 131 HIS A CB   1  
ATOM 2178  C CG   . HIS A 1 131 ? 8.041   7.481   -22.852 1.00 0.00 ? 131 HIS A CG   1  
ATOM 2179  N ND1  . HIS A 1 131 ? 6.686   7.260   -22.720 1.00 0.00 ? 131 HIS A ND1  1  
ATOM 2180  C CD2  . HIS A 1 131 ? 8.150   8.461   -23.794 1.00 0.00 ? 131 HIS A CD2  1  
ATOM 2181  C CE1  . HIS A 1 131 ? 6.052   8.116   -23.560 1.00 0.00 ? 131 HIS A CE1  1  
ATOM 2182  N NE2  . HIS A 1 131 ? 6.900   8.859   -24.240 1.00 0.00 ? 131 HIS A NE2  1  
ATOM 2183  H H    . HIS A 1 131 ? 8.592   7.175   -19.264 1.00 0.00 ? 131 HIS A H    1  
ATOM 2184  H HA   . HIS A 1 131 ? 8.098   5.060   -21.297 1.00 0.00 ? 131 HIS A HA   1  
ATOM 2185  H HB2  . HIS A 1 131 ? 9.822   7.578   -21.692 1.00 0.00 ? 131 HIS A HB2  1  
ATOM 2186  H HB3  . HIS A 1 131 ? 9.715   6.204   -22.843 1.00 0.00 ? 131 HIS A HB3  1  
ATOM 2187  H HD1  . HIS A 1 131 ? 6.244   6.680   -22.017 1.00 0.00 ? 131 HIS A HD1  1  
ATOM 2188  H HD2  . HIS A 1 131 ? 9.037   8.935   -24.196 1.00 0.00 ? 131 HIS A HD2  1  
ATOM 2189  H HE1  . HIS A 1 131 ? 4.968   8.229   -23.607 1.00 0.00 ? 131 HIS A HE1  1  
ATOM 2190  N N    . ARG A 1 132 ? 10.783  4.475   -21.116 1.00 0.00 ? 132 ARG A N    1  
ATOM 2191  C CA   . ARG A 1 132 ? 11.971  3.691   -20.755 1.00 0.00 ? 132 ARG A CA   1  
ATOM 2192  C C    . ARG A 1 132 ? 13.198  4.462   -20.217 1.00 0.00 ? 132 ARG A C    1  
ATOM 2193  O O    . ARG A 1 132 ? 14.278  4.467   -20.805 1.00 0.00 ? 132 ARG A O    1  
ATOM 2194  C CB   . ARG A 1 132 ? 12.348  2.775   -21.955 1.00 0.00 ? 132 ARG A CB   1  
ATOM 2195  C CG   . ARG A 1 132 ? 12.561  3.496   -23.306 1.00 0.00 ? 132 ARG A CG   1  
ATOM 2196  C CD   . ARG A 1 132 ? 13.030  2.556   -24.430 1.00 0.00 ? 132 ARG A CD   1  
ATOM 2197  N NE   . ARG A 1 132 ? 11.952  1.540   -24.699 1.00 0.00 ? 132 ARG A NE   1  
ATOM 2198  C CZ   . ARG A 1 132 ? 12.109  0.494   -25.568 1.00 0.00 ? 132 ARG A CZ   1  
ATOM 2199  N NH1  . ARG A 1 132 ? 13.276  0.321   -26.255 1.00 0.00 ? 132 ARG A NH1  1  
ATOM 2200  N NH2  . ARG A 1 132 ? 11.082  -0.390  -25.747 1.00 0.00 ? 132 ARG A NH2  1  
ATOM 2201  H H    . ARG A 1 132 ? 10.588  4.467   -22.089 1.00 0.00 ? 132 ARG A H    1  
ATOM 2202  H HA   . ARG A 1 132 ? 11.685  3.021   -19.956 1.00 0.00 ? 132 ARG A HA   1  
ATOM 2203  H HB2  . ARG A 1 132 ? 13.257  2.178   -21.717 1.00 0.00 ? 132 ARG A HB2  1  
ATOM 2204  H HB3  . ARG A 1 132 ? 11.517  2.047   -22.088 1.00 0.00 ? 132 ARG A HB3  1  
ATOM 2205  H HG2  . ARG A 1 132 ? 11.629  4.006   -23.632 1.00 0.00 ? 132 ARG A HG2  1  
ATOM 2206  H HG3  . ARG A 1 132 ? 13.345  4.278   -23.178 1.00 0.00 ? 132 ARG A HG3  1  
ATOM 2207  H HD2  . ARG A 1 132 ? 13.213  3.139   -25.359 1.00 0.00 ? 132 ARG A HD2  1  
ATOM 2208  H HD3  . ARG A 1 132 ? 13.963  2.036   -24.120 1.00 0.00 ? 132 ARG A HD3  1  
ATOM 2209  H HE   . ARG A 1 132 ? 11.083  1.632   -24.213 1.00 0.00 ? 132 ARG A HE   1  
ATOM 2210  H HH11 . ARG A 1 132 ? 14.030  0.965   -26.127 1.00 0.00 ? 132 ARG A HH11 1  
ATOM 2211  H HH12 . ARG A 1 132 ? 13.375  -0.449  -26.884 1.00 0.00 ? 132 ARG A HH12 1  
ATOM 2212  H HH21 . ARG A 1 132 ? 10.226  -0.268  -25.245 1.00 0.00 ? 132 ARG A HH21 1  
ATOM 2213  H HH22 . ARG A 1 132 ? 11.189  -1.158  -26.378 1.00 0.00 ? 132 ARG A HH22 1  
ATOM 2214  N N    . ASP A 1 133 ? 13.008  5.127   -19.045 1.00 0.00 ? 133 ASP A N    1  
ATOM 2215  C CA   . ASP A 1 133 ? 13.935  5.957   -18.271 1.00 0.00 ? 133 ASP A CA   1  
ATOM 2216  C C    . ASP A 1 133 ? 14.013  7.381   -18.799 1.00 0.00 ? 133 ASP A C    1  
ATOM 2217  O O    . ASP A 1 133 ? 12.993  8.065   -18.917 1.00 0.00 ? 133 ASP A O    1  
ATOM 2218  C CB   . ASP A 1 133 ? 15.364  5.377   -18.027 1.00 0.00 ? 133 ASP A CB   1  
ATOM 2219  C CG   . ASP A 1 133 ? 15.268  4.009   -17.344 1.00 0.00 ? 133 ASP A CG   1  
ATOM 2220  O OD1  . ASP A 1 133 ? 14.716  3.949   -16.213 1.00 0.00 ? 133 ASP A OD1  1  
ATOM 2221  O OD2  . ASP A 1 133 ? 15.746  3.009   -17.945 1.00 0.00 ? 133 ASP A OD2  1  
ATOM 2222  H H    . ASP A 1 133 ? 12.078  5.076   -18.666 1.00 0.00 ? 133 ASP A H    1  
ATOM 2223  H HA   . ASP A 1 133 ? 13.478  6.051   -17.297 1.00 0.00 ? 133 ASP A HA   1  
ATOM 2224  H HB2  . ASP A 1 133 ? 15.916  5.274   -18.986 1.00 0.00 ? 133 ASP A HB2  1  
ATOM 2225  H HB3  . ASP A 1 133 ? 15.949  6.049   -17.361 1.00 0.00 ? 133 ASP A HB3  1  
ATOM 2226  N N    . GLY A 1 1   ? -10.544 29.058  25.299  1.00 0.00 ? 1   GLY A N    2  
ATOM 2227  C CA   . GLY A 1 1   ? -11.137 29.048  26.617  1.00 0.00 ? 1   GLY A CA   2  
ATOM 2228  C C    . GLY A 1 1   ? -12.109 27.918  26.730  1.00 0.00 ? 1   GLY A C    2  
ATOM 2229  O O    . GLY A 1 1   ? -12.836 27.802  27.712  1.00 0.00 ? 1   GLY A O    2  
ATOM 2230  H H    . GLY A 1 1   ? -10.427 29.939  24.837  1.00 0.00 ? 1   GLY A H    2  
ATOM 2231  H HA2  . GLY A 1 1   ? -10.350 28.885  27.338  1.00 0.00 ? 1   GLY A HA2  2  
ATOM 2232  H HA3  . GLY A 1 1   ? -11.679 29.972  26.758  1.00 0.00 ? 1   GLY A HA3  2  
ATOM 2233  N N    . SER A 1 2   ? -12.136 27.047  25.700  1.00 0.00 ? 2   SER A N    2  
ATOM 2234  C CA   . SER A 1 2   ? -12.993 25.877  25.583  1.00 0.00 ? 2   SER A CA   2  
ATOM 2235  C C    . SER A 1 2   ? -12.276 24.896  24.658  1.00 0.00 ? 2   SER A C    2  
ATOM 2236  O O    . SER A 1 2   ? -11.638 25.367  23.715  1.00 0.00 ? 2   SER A O    2  
ATOM 2237  C CB   . SER A 1 2   ? -14.391 26.229  24.968  1.00 0.00 ? 2   SER A CB   2  
ATOM 2238  O OG   . SER A 1 2   ? -15.280 25.109  24.859  1.00 0.00 ? 2   SER A OG   2  
ATOM 2239  H H    . SER A 1 2   ? -11.507 27.213  24.938  1.00 0.00 ? 2   SER A H    2  
ATOM 2240  H HA   . SER A 1 2   ? -13.133 25.448  26.564  1.00 0.00 ? 2   SER A HA   2  
ATOM 2241  H HB2  . SER A 1 2   ? -14.874 26.974  25.639  1.00 0.00 ? 2   SER A HB2  2  
ATOM 2242  H HB3  . SER A 1 2   ? -14.271 26.717  23.973  1.00 0.00 ? 2   SER A HB3  2  
ATOM 2243  H HG   . SER A 1 2   ? -14.966 24.534  24.145  1.00 0.00 ? 2   SER A HG   2  
ATOM 2244  N N    . PRO A 1 3   ? -12.319 23.552  24.840  1.00 0.00 ? 3   PRO A N    2  
ATOM 2245  C CA   . PRO A 1 3   ? -11.791 22.569  23.890  1.00 0.00 ? 3   PRO A CA   2  
ATOM 2246  C C    . PRO A 1 3   ? -12.759 22.339  22.706  1.00 0.00 ? 3   PRO A C    2  
ATOM 2247  O O    . PRO A 1 3   ? -13.854 22.902  22.659  1.00 0.00 ? 3   PRO A O    2  
ATOM 2248  C CB   . PRO A 1 3   ? -11.609 21.283  24.746  1.00 0.00 ? 3   PRO A CB   2  
ATOM 2249  C CG   . PRO A 1 3   ? -11.952 21.695  26.187  1.00 0.00 ? 3   PRO A CG   2  
ATOM 2250  C CD   . PRO A 1 3   ? -12.899 22.877  25.994  1.00 0.00 ? 3   PRO A CD   2  
ATOM 2251  H HA   . PRO A 1 3   ? -10.845 22.909  23.489  1.00 0.00 ? 3   PRO A HA   2  
ATOM 2252  H HB2  . PRO A 1 3   ? -12.324 20.461  24.460  1.00 0.00 ? 3   PRO A HB2  2  
ATOM 2253  H HB3  . PRO A 1 3   ? -10.537 20.946  24.703  1.00 0.00 ? 3   PRO A HB3  2  
ATOM 2254  H HG2  . PRO A 1 3   ? -12.404 20.866  26.769  1.00 0.00 ? 3   PRO A HG2  2  
ATOM 2255  H HG3  . PRO A 1 3   ? -11.030 22.050  26.701  1.00 0.00 ? 3   PRO A HG3  2  
ATOM 2256  H HD2  . PRO A 1 3   ? -13.914 22.521  25.707  1.00 0.00 ? 3   PRO A HD2  2  
ATOM 2257  H HD3  . PRO A 1 3   ? -12.948 23.489  26.922  1.00 0.00 ? 3   PRO A HD3  2  
ATOM 2258  N N    . GLU A 1 4   ? -12.361 21.490  21.733  1.00 0.00 ? 4   GLU A N    2  
ATOM 2259  C CA   . GLU A 1 4   ? -13.132 21.173  20.542  1.00 0.00 ? 4   GLU A CA   2  
ATOM 2260  C C    . GLU A 1 4   ? -13.817 19.817  20.651  1.00 0.00 ? 4   GLU A C    2  
ATOM 2261  O O    . GLU A 1 4   ? -13.458 18.952  21.448  1.00 0.00 ? 4   GLU A O    2  
ATOM 2262  C CB   . GLU A 1 4   ? -12.224 21.148  19.277  1.00 0.00 ? 4   GLU A CB   2  
ATOM 2263  C CG   . GLU A 1 4   ? -11.439 22.454  19.050  1.00 0.00 ? 4   GLU A CG   2  
ATOM 2264  C CD   . GLU A 1 4   ? -10.613 22.328  17.769  1.00 0.00 ? 4   GLU A CD   2  
ATOM 2265  O OE1  . GLU A 1 4   ? -11.228 22.209  16.676  1.00 0.00 ? 4   GLU A OE1  2  
ATOM 2266  O OE2  . GLU A 1 4   ? -9.356  22.348  17.867  1.00 0.00 ? 4   GLU A OE2  2  
ATOM 2267  H H    . GLU A 1 4   ? -11.482 21.033  21.813  1.00 0.00 ? 4   GLU A H    2  
ATOM 2268  H HA   . GLU A 1 4   ? -13.906 21.915  20.376  1.00 0.00 ? 4   GLU A HA   2  
ATOM 2269  H HB2  . GLU A 1 4   ? -11.490 20.314  19.354  1.00 0.00 ? 4   GLU A HB2  2  
ATOM 2270  H HB3  . GLU A 1 4   ? -12.842 20.963  18.369  1.00 0.00 ? 4   GLU A HB3  2  
ATOM 2271  H HG2  . GLU A 1 4   ? -12.143 23.308  18.954  1.00 0.00 ? 4   GLU A HG2  2  
ATOM 2272  H HG3  . GLU A 1 4   ? -10.764 22.646  19.910  1.00 0.00 ? 4   GLU A HG3  2  
ATOM 2273  N N    . PHE A 1 5   ? -14.796 19.566  19.743  1.00 0.00 ? 5   PHE A N    2  
ATOM 2274  C CA   . PHE A 1 5   ? -15.497 18.297  19.564  1.00 0.00 ? 5   PHE A CA   2  
ATOM 2275  C C    . PHE A 1 5   ? -14.697 17.496  18.527  1.00 0.00 ? 5   PHE A C    2  
ATOM 2276  O O    . PHE A 1 5   ? -14.989 17.475  17.336  1.00 0.00 ? 5   PHE A O    2  
ATOM 2277  C CB   . PHE A 1 5   ? -16.970 18.551  19.121  1.00 0.00 ? 5   PHE A CB   2  
ATOM 2278  C CG   . PHE A 1 5   ? -17.817 17.305  19.276  1.00 0.00 ? 5   PHE A CG   2  
ATOM 2279  C CD1  . PHE A 1 5   ? -18.242 16.904  20.534  1.00 0.00 ? 5   PHE A CD1  2  
ATOM 2280  C CD2  . PHE A 1 5   ? -18.143 16.516  18.181  1.00 0.00 ? 5   PHE A CD2  2  
ATOM 2281  C CE1  . PHE A 1 5   ? -18.973 15.743  20.693  1.00 0.00 ? 5   PHE A CE1  2  
ATOM 2282  C CE2  . PHE A 1 5   ? -18.893 15.368  18.340  1.00 0.00 ? 5   PHE A CE2  2  
ATOM 2283  C CZ   . PHE A 1 5   ? -19.303 14.977  19.595  1.00 0.00 ? 5   PHE A CZ   2  
ATOM 2284  H H    . PHE A 1 5   ? -15.038 20.260  19.074  1.00 0.00 ? 5   PHE A H    2  
ATOM 2285  H HA   . PHE A 1 5   ? -15.499 17.744  20.496  1.00 0.00 ? 5   PHE A HA   2  
ATOM 2286  H HB2  . PHE A 1 5   ? -17.412 19.335  19.771  1.00 0.00 ? 5   PHE A HB2  2  
ATOM 2287  H HB3  . PHE A 1 5   ? -17.030 18.936  18.079  1.00 0.00 ? 5   PHE A HB3  2  
ATOM 2288  H HD1  . PHE A 1 5   ? -17.995 17.491  21.410  1.00 0.00 ? 5   PHE A HD1  2  
ATOM 2289  H HD2  . PHE A 1 5   ? -17.797 16.776  17.188  1.00 0.00 ? 5   PHE A HD2  2  
ATOM 2290  H HE1  . PHE A 1 5   ? -19.294 15.436  21.680  1.00 0.00 ? 5   PHE A HE1  2  
ATOM 2291  H HE2  . PHE A 1 5   ? -19.153 14.770  17.478  1.00 0.00 ? 5   PHE A HE2  2  
ATOM 2292  H HZ   . PHE A 1 5   ? -19.890 14.076  19.718  1.00 0.00 ? 5   PHE A HZ   2  
ATOM 2293  N N    . ARG A 1 6   ? -13.590 16.867  18.986  1.00 0.00 ? 6   ARG A N    2  
ATOM 2294  C CA   . ARG A 1 6   ? -12.553 16.246  18.177  1.00 0.00 ? 6   ARG A CA   2  
ATOM 2295  C C    . ARG A 1 6   ? -12.691 14.747  17.958  1.00 0.00 ? 6   ARG A C    2  
ATOM 2296  O O    . ARG A 1 6   ? -11.730 13.996  18.044  1.00 0.00 ? 6   ARG A O    2  
ATOM 2297  C CB   . ARG A 1 6   ? -11.192 16.588  18.827  1.00 0.00 ? 6   ARG A CB   2  
ATOM 2298  C CG   . ARG A 1 6   ? -9.997  16.699  17.862  1.00 0.00 ? 6   ARG A CG   2  
ATOM 2299  C CD   . ARG A 1 6   ? -10.066 17.948  16.970  1.00 0.00 ? 6   ARG A CD   2  
ATOM 2300  N NE   . ARG A 1 6   ? -8.836  17.994  16.106  1.00 0.00 ? 6   ARG A NE   2  
ATOM 2301  C CZ   . ARG A 1 6   ? -8.655  18.929  15.121  1.00 0.00 ? 6   ARG A CZ   2  
ATOM 2302  N NH1  . ARG A 1 6   ? -9.632  19.836  14.827  1.00 0.00 ? 6   ARG A NH1  2  
ATOM 2303  N NH2  . ARG A 1 6   ? -7.483  18.950  14.424  1.00 0.00 ? 6   ARG A NH2  2  
ATOM 2304  H H    . ARG A 1 6   ? -13.378 16.929  19.958  1.00 0.00 ? 6   ARG A H    2  
ATOM 2305  H HA   . ARG A 1 6   ? -12.572 16.699  17.196  1.00 0.00 ? 6   ARG A HA   2  
ATOM 2306  H HB2  . ARG A 1 6   ? -11.312 17.580  19.312  1.00 0.00 ? 6   ARG A HB2  2  
ATOM 2307  H HB3  . ARG A 1 6   ? -10.979 15.860  19.640  1.00 0.00 ? 6   ARG A HB3  2  
ATOM 2308  H HG2  . ARG A 1 6   ? -9.064  16.750  18.470  1.00 0.00 ? 6   ARG A HG2  2  
ATOM 2309  H HG3  . ARG A 1 6   ? -9.945  15.782  17.238  1.00 0.00 ? 6   ARG A HG3  2  
ATOM 2310  H HD2  . ARG A 1 6   ? -10.967 17.917  16.323  1.00 0.00 ? 6   ARG A HD2  2  
ATOM 2311  H HD3  . ARG A 1 6   ? -10.092 18.864  17.601  1.00 0.00 ? 6   ARG A HD3  2  
ATOM 2312  H HE   . ARG A 1 6   ? -8.101  17.342  16.289  1.00 0.00 ? 6   ARG A HE   2  
ATOM 2313  H HH11 . ARG A 1 6   ? -10.494 19.823  15.335  1.00 0.00 ? 6   ARG A HH11 2  
ATOM 2314  H HH12 . ARG A 1 6   ? -9.486  20.511  14.104  1.00 0.00 ? 6   ARG A HH12 2  
ATOM 2315  H HH21 . ARG A 1 6   ? -6.764  18.288  14.636  1.00 0.00 ? 6   ARG A HH21 2  
ATOM 2316  H HH22 . ARG A 1 6   ? -7.343  19.628  13.702  1.00 0.00 ? 6   ARG A HH22 2  
ATOM 2317  N N    . TRP A 1 7   ? -13.931 14.333  17.640  1.00 0.00 ? 7   TRP A N    2  
ATOM 2318  C CA   . TRP A 1 7   ? -14.493 13.022  17.326  1.00 0.00 ? 7   TRP A CA   2  
ATOM 2319  C C    . TRP A 1 7   ? -13.799 12.224  16.193  1.00 0.00 ? 7   TRP A C    2  
ATOM 2320  O O    . TRP A 1 7   ? -12.772 11.579  16.382  1.00 0.00 ? 7   TRP A O    2  
ATOM 2321  C CB   . TRP A 1 7   ? -16.015 13.264  17.041  1.00 0.00 ? 7   TRP A CB   2  
ATOM 2322  C CG   . TRP A 1 7   ? -16.415 14.167  15.854  1.00 0.00 ? 7   TRP A CG   2  
ATOM 2323  C CD1  . TRP A 1 7   ? -15.715 15.139  15.186  1.00 0.00 ? 7   TRP A CD1  2  
ATOM 2324  C CD2  . TRP A 1 7   ? -17.598 13.928  15.072  1.00 0.00 ? 7   TRP A CD2  2  
ATOM 2325  N NE1  . TRP A 1 7   ? -16.327 15.433  13.998  1.00 0.00 ? 7   TRP A NE1  2  
ATOM 2326  C CE2  . TRP A 1 7   ? -17.511 14.728  13.935  1.00 0.00 ? 7   TRP A CE2  2  
ATOM 2327  C CE3  . TRP A 1 7   ? -18.650 13.082  15.273  1.00 0.00 ? 7   TRP A CE3  2  
ATOM 2328  C CZ2  . TRP A 1 7   ? -18.487 14.697  12.980  1.00 0.00 ? 7   TRP A CZ2  2  
ATOM 2329  C CZ3  . TRP A 1 7   ? -19.644 13.052  14.313  1.00 0.00 ? 7   TRP A CZ3  2  
ATOM 2330  C CH2  . TRP A 1 7   ? -19.560 13.847  13.181  1.00 0.00 ? 7   TRP A CH2  2  
ATOM 2331  H H    . TRP A 1 7   ? -14.597 15.072  17.647  1.00 0.00 ? 7   TRP A H    2  
ATOM 2332  H HA   . TRP A 1 7   ? -14.406 12.420  18.221  1.00 0.00 ? 7   TRP A HA   2  
ATOM 2333  H HB2  . TRP A 1 7   ? -16.524 12.280  16.931  1.00 0.00 ? 7   TRP A HB2  2  
ATOM 2334  H HB3  . TRP A 1 7   ? -16.447 13.736  17.949  1.00 0.00 ? 7   TRP A HB3  2  
ATOM 2335  H HD1  . TRP A 1 7   ? -14.774 15.571  15.488  1.00 0.00 ? 7   TRP A HD1  2  
ATOM 2336  H HE1  . TRP A 1 7   ? -15.836 15.794  13.228  1.00 0.00 ? 7   TRP A HE1  2  
ATOM 2337  H HE3  . TRP A 1 7   ? -18.708 12.475  16.165  1.00 0.00 ? 7   TRP A HE3  2  
ATOM 2338  H HZ2  . TRP A 1 7   ? -18.431 15.308  12.091  1.00 0.00 ? 7   TRP A HZ2  2  
ATOM 2339  H HZ3  . TRP A 1 7   ? -20.505 12.408  14.445  1.00 0.00 ? 7   TRP A HZ3  2  
ATOM 2340  H HH2  . TRP A 1 7   ? -20.352 13.806  12.445  1.00 0.00 ? 7   TRP A HH2  2  
ATOM 2341  N N    . THR A 1 8   ? -14.330 12.324  14.942  1.00 0.00 ? 8   THR A N    2  
ATOM 2342  C CA   . THR A 1 8   ? -13.822 11.783  13.677  1.00 0.00 ? 8   THR A CA   2  
ATOM 2343  C C    . THR A 1 8   ? -12.735 12.672  13.106  1.00 0.00 ? 8   THR A C    2  
ATOM 2344  O O    . THR A 1 8   ? -11.955 12.284  12.248  1.00 0.00 ? 8   THR A O    2  
ATOM 2345  C CB   . THR A 1 8   ? -14.898 11.389  12.674  1.00 0.00 ? 8   THR A CB   2  
ATOM 2346  O OG1  . THR A 1 8   ? -15.841 12.426  12.441  1.00 0.00 ? 8   THR A OG1  2  
ATOM 2347  C CG2  . THR A 1 8   ? -15.650 10.219  13.317  1.00 0.00 ? 8   THR A CG2  2  
ATOM 2348  H H    . THR A 1 8   ? -15.172 12.850  14.808  1.00 0.00 ? 8   THR A H    2  
ATOM 2349  H HA   . THR A 1 8   ? -13.307 10.858  13.904  1.00 0.00 ? 8   THR A HA   2  
ATOM 2350  H HB   . THR A 1 8   ? -14.457 11.052  11.706  1.00 0.00 ? 8   THR A HB   2  
ATOM 2351  H HG1  . THR A 1 8   ? -16.637 11.995  12.115  1.00 0.00 ? 8   THR A HG1  2  
ATOM 2352  H HG21 . THR A 1 8   ? -14.928 9.409   13.563  1.00 0.00 ? 8   THR A HG21 2  
ATOM 2353  H HG22 . THR A 1 8   ? -16.131 10.544  14.265  1.00 0.00 ? 8   THR A HG22 2  
ATOM 2354  H HG23 . THR A 1 8   ? -16.427 9.813   12.637  1.00 0.00 ? 8   THR A HG23 2  
ATOM 2355  N N    . LYS A 1 9   ? -12.619 13.899  13.676  1.00 0.00 ? 9   LYS A N    2  
ATOM 2356  C CA   . LYS A 1 9   ? -11.574 14.906  13.529  1.00 0.00 ? 9   LYS A CA   2  
ATOM 2357  C C    . LYS A 1 9   ? -10.231 14.434  14.082  1.00 0.00 ? 9   LYS A C    2  
ATOM 2358  O O    . LYS A 1 9   ? -9.170  14.878  13.643  1.00 0.00 ? 9   LYS A O    2  
ATOM 2359  C CB   . LYS A 1 9   ? -11.952 16.283  14.113  1.00 0.00 ? 9   LYS A CB   2  
ATOM 2360  C CG   . LYS A 1 9   ? -13.079 16.969  13.335  1.00 0.00 ? 9   LYS A CG   2  
ATOM 2361  C CD   . LYS A 1 9   ? -13.583 18.236  14.041  1.00 0.00 ? 9   LYS A CD   2  
ATOM 2362  C CE   . LYS A 1 9   ? -14.784 18.893  13.348  1.00 0.00 ? 9   LYS A CE   2  
ATOM 2363  N NZ   . LYS A 1 9   ? -14.434 19.356  11.985  1.00 0.00 ? 9   LYS A NZ   2  
ATOM 2364  H H    . LYS A 1 9   ? -13.299 14.118  14.366  1.00 0.00 ? 9   LYS A H    2  
ATOM 2365  H HA   . LYS A 1 9   ? -11.418 14.980  12.455  1.00 0.00 ? 9   LYS A HA   2  
ATOM 2366  H HB2  . LYS A 1 9   ? -12.263 16.157  15.172  1.00 0.00 ? 9   LYS A HB2  2  
ATOM 2367  H HB3  . LYS A 1 9   ? -11.081 16.980  14.095  1.00 0.00 ? 9   LYS A HB3  2  
ATOM 2368  H HG2  . LYS A 1 9   ? -12.707 17.223  12.318  1.00 0.00 ? 9   LYS A HG2  2  
ATOM 2369  H HG3  . LYS A 1 9   ? -13.917 16.255  13.210  1.00 0.00 ? 9   LYS A HG3  2  
ATOM 2370  H HD2  . LYS A 1 9   ? -13.890 17.971  15.079  1.00 0.00 ? 9   LYS A HD2  2  
ATOM 2371  H HD3  . LYS A 1 9   ? -12.751 18.970  14.115  1.00 0.00 ? 9   LYS A HD3  2  
ATOM 2372  H HE2  . LYS A 1 9   ? -15.622 18.171  13.255  1.00 0.00 ? 9   LYS A HE2  2  
ATOM 2373  H HE3  . LYS A 1 9   ? -15.126 19.778  13.925  1.00 0.00 ? 9   LYS A HE3  2  
ATOM 2374  H HZ1  . LYS A 1 9   ? -14.107 18.548  11.419  1.00 0.00 ? 9   LYS A HZ1  2  
ATOM 2375  H HZ2  . LYS A 1 9   ? -15.271 19.779  11.536  1.00 0.00 ? 9   LYS A HZ2  2  
ATOM 2376  H HZ3  . LYS A 1 9   ? -13.676 20.066  12.044  1.00 0.00 ? 9   LYS A HZ3  2  
ATOM 2377  N N    . GLU A 1 10  ? -10.260 13.481  15.078  1.00 0.00 ? 10  GLU A N    2  
ATOM 2378  C CA   . GLU A 1 10  ? -9.108  12.849  15.754  1.00 0.00 ? 10  GLU A CA   2  
ATOM 2379  C C    . GLU A 1 10  ? -8.059  12.186  14.836  1.00 0.00 ? 10  GLU A C    2  
ATOM 2380  O O    . GLU A 1 10  ? -6.921  11.944  15.224  1.00 0.00 ? 10  GLU A O    2  
ATOM 2381  C CB   . GLU A 1 10  ? -9.579  11.833  16.808  1.00 0.00 ? 10  GLU A CB   2  
ATOM 2382  C CG   . GLU A 1 10  ? -8.602  11.632  17.980  1.00 0.00 ? 10  GLU A CG   2  
ATOM 2383  C CD   . GLU A 1 10  ? -9.218  10.681  19.005  1.00 0.00 ? 10  GLU A CD   2  
ATOM 2384  O OE1  . GLU A 1 10  ? -10.288 11.031  19.572  1.00 0.00 ? 10  GLU A OE1  2  
ATOM 2385  O OE2  . GLU A 1 10  ? -8.627  9.591   19.236  1.00 0.00 ? 10  GLU A OE2  2  
ATOM 2386  H H    . GLU A 1 10  ? -11.152 13.150  15.415  1.00 0.00 ? 10  GLU A H    2  
ATOM 2387  H HA   . GLU A 1 10  ? -8.609  13.597  16.327  1.00 0.00 ? 10  GLU A HA   2  
ATOM 2388  H HB2  . GLU A 1 10  ? -10.534 12.203  17.237  1.00 0.00 ? 10  GLU A HB2  2  
ATOM 2389  H HB3  . GLU A 1 10  ? -9.816  10.878  16.319  1.00 0.00 ? 10  GLU A HB3  2  
ATOM 2390  H HG2  . GLU A 1 10  ? -7.636  11.222  17.622  1.00 0.00 ? 10  GLU A HG2  2  
ATOM 2391  H HG3  . GLU A 1 10  ? -8.420  12.618  18.457  1.00 0.00 ? 10  GLU A HG3  2  
ATOM 2392  N N    . GLU A 1 11  ? -8.442  11.986  13.548  1.00 0.00 ? 11  GLU A N    2  
ATOM 2393  C CA   . GLU A 1 11  ? -7.675  11.619  12.365  1.00 0.00 ? 11  GLU A CA   2  
ATOM 2394  C C    . GLU A 1 11  ? -6.672  12.698  11.926  1.00 0.00 ? 11  GLU A C    2  
ATOM 2395  O O    . GLU A 1 11  ? -5.611  12.378  11.402  1.00 0.00 ? 11  GLU A O    2  
ATOM 2396  C CB   . GLU A 1 11  ? -8.679  11.404  11.192  1.00 0.00 ? 11  GLU A CB   2  
ATOM 2397  C CG   . GLU A 1 11  ? -9.538  10.142  11.405  1.00 0.00 ? 11  GLU A CG   2  
ATOM 2398  C CD   . GLU A 1 11  ? -10.438 9.914   10.191  1.00 0.00 ? 11  GLU A CD   2  
ATOM 2399  O OE1  . GLU A 1 11  ? -9.887  9.726   9.073   1.00 0.00 ? 11  GLU A OE1  2  
ATOM 2400  O OE2  . GLU A 1 11  ? -11.686 9.914   10.364  1.00 0.00 ? 11  GLU A OE2  2  
ATOM 2401  H H    . GLU A 1 11  ? -9.388  12.203  13.333  1.00 0.00 ? 11  GLU A H    2  
ATOM 2402  H HA   . GLU A 1 11  ? -7.086  10.727  12.589  1.00 0.00 ? 11  GLU A HA   2  
ATOM 2403  H HB2  . GLU A 1 11  ? -9.359  12.305  11.098  1.00 0.00 ? 11  GLU A HB2  2  
ATOM 2404  H HB3  . GLU A 1 11  ? -8.130  11.266  10.228  1.00 0.00 ? 11  GLU A HB3  2  
ATOM 2405  H HG2  . GLU A 1 11  ? -8.854  9.257   11.507  1.00 0.00 ? 11  GLU A HG2  2  
ATOM 2406  H HG3  . GLU A 1 11  ? -10.177 10.282  12.317  1.00 0.00 ? 11  GLU A HG3  2  
ATOM 2407  N N    . GLU A 1 12  ? -6.978  14.011  12.188  1.00 0.00 ? 12  GLU A N    2  
ATOM 2408  C CA   . GLU A 1 12  ? -6.129  15.179  11.910  1.00 0.00 ? 12  GLU A CA   2  
ATOM 2409  C C    . GLU A 1 12  ? -4.966  15.293  12.907  1.00 0.00 ? 12  GLU A C    2  
ATOM 2410  O O    . GLU A 1 12  ? -3.842  15.650  12.563  1.00 0.00 ? 12  GLU A O    2  
ATOM 2411  C CB   . GLU A 1 12  ? -6.975  16.484  11.886  1.00 0.00 ? 12  GLU A CB   2  
ATOM 2412  C CG   . GLU A 1 12  ? -8.065  16.459  10.797  1.00 0.00 ? 12  GLU A CG   2  
ATOM 2413  C CD   . GLU A 1 12  ? -8.899  17.738  10.862  1.00 0.00 ? 12  GLU A CD   2  
ATOM 2414  O OE1  . GLU A 1 12  ? -9.628  17.918  11.874  1.00 0.00 ? 12  GLU A OE1  2  
ATOM 2415  O OE2  . GLU A 1 12  ? -8.824  18.546  9.899   1.00 0.00 ? 12  GLU A OE2  2  
ATOM 2416  H H    . GLU A 1 12  ? -7.857  14.249  12.632  1.00 0.00 ? 12  GLU A H    2  
ATOM 2417  H HA   . GLU A 1 12  ? -5.685  15.055  10.930  1.00 0.00 ? 12  GLU A HA   2  
ATOM 2418  H HB2  . GLU A 1 12  ? -7.464  16.618  12.878  1.00 0.00 ? 12  GLU A HB2  2  
ATOM 2419  H HB3  . GLU A 1 12  ? -6.319  17.364  11.697  1.00 0.00 ? 12  GLU A HB3  2  
ATOM 2420  H HG2  . GLU A 1 12  ? -7.582  16.373  9.800   1.00 0.00 ? 12  GLU A HG2  2  
ATOM 2421  H HG3  . GLU A 1 12  ? -8.737  15.585  10.937  1.00 0.00 ? 12  GLU A HG3  2  
ATOM 2422  N N    . GLU A 1 13  ? -5.244  14.918  14.181  1.00 0.00 ? 13  GLU A N    2  
ATOM 2423  C CA   . GLU A 1 13  ? -4.325  14.794  15.306  1.00 0.00 ? 13  GLU A CA   2  
ATOM 2424  C C    . GLU A 1 13  ? -3.314  13.633  15.261  1.00 0.00 ? 13  GLU A C    2  
ATOM 2425  O O    . GLU A 1 13  ? -2.255  13.745  15.882  1.00 0.00 ? 13  GLU A O    2  
ATOM 2426  C CB   . GLU A 1 13  ? -5.160  14.573  16.606  1.00 0.00 ? 13  GLU A CB   2  
ATOM 2427  C CG   . GLU A 1 13  ? -6.041  15.773  17.007  1.00 0.00 ? 13  GLU A CG   2  
ATOM 2428  C CD   . GLU A 1 13  ? -5.162  16.973  17.353  1.00 0.00 ? 13  GLU A CD   2  
ATOM 2429  O OE1  . GLU A 1 13  ? -4.370  16.866  18.329  1.00 0.00 ? 13  GLU A OE1  2  
ATOM 2430  O OE2  . GLU A 1 13  ? -5.269  18.014  16.651  1.00 0.00 ? 13  GLU A OE2  2  
ATOM 2431  H H    . GLU A 1 13  ? -6.194  14.701  14.392  1.00 0.00 ? 13  GLU A H    2  
ATOM 2432  H HA   . GLU A 1 13  ? -3.747  15.706  15.391  1.00 0.00 ? 13  GLU A HA   2  
ATOM 2433  H HB2  . GLU A 1 13  ? -5.857  13.721  16.436  1.00 0.00 ? 13  GLU A HB2  2  
ATOM 2434  H HB3  . GLU A 1 13  ? -4.517  14.282  17.474  1.00 0.00 ? 13  GLU A HB3  2  
ATOM 2435  H HG2  . GLU A 1 13  ? -6.702  16.042  16.133  1.00 0.00 ? 13  GLU A HG2  2  
ATOM 2436  H HG3  . GLU A 1 13  ? -6.623  15.489  17.931  1.00 0.00 ? 13  GLU A HG3  2  
ATOM 2437  N N    . THR A 1 14  ? -3.676  12.473  14.642  1.00 0.00 ? 14  THR A N    2  
ATOM 2438  C CA   . THR A 1 14  ? -2.962  11.211  14.597  1.00 0.00 ? 14  THR A CA   2  
ATOM 2439  C C    . THR A 1 14  ? -1.807  11.046  13.627  1.00 0.00 ? 14  THR A C    2  
ATOM 2440  O O    . THR A 1 14  ? -0.716  10.716  14.078  1.00 0.00 ? 14  THR A O    2  
ATOM 2441  C CB   . THR A 1 14  ? -3.978  10.072  14.684  1.00 0.00 ? 14  THR A CB   2  
ATOM 2442  O OG1  . THR A 1 14  ? -5.181  10.364  13.997  1.00 0.00 ? 14  THR A OG1  2  
ATOM 2443  C CG2  . THR A 1 14  ? -4.308  9.907   16.181  1.00 0.00 ? 14  THR A CG2  2  
ATOM 2444  H H    . THR A 1 14  ? -4.527  12.323  14.148  1.00 0.00 ? 14  THR A H    2  
ATOM 2445  H HA   . THR A 1 14  ? -2.404  11.155  15.519  1.00 0.00 ? 14  THR A HA   2  
ATOM 2446  H HB   . THR A 1 14  ? -3.651  9.128   14.231  1.00 0.00 ? 14  THR A HB   2  
ATOM 2447  H HG1  . THR A 1 14  ? -5.797  10.782  14.634  1.00 0.00 ? 14  THR A HG1  2  
ATOM 2448  H HG21 . THR A 1 14  ? -4.660  10.876  16.614  1.00 0.00 ? 14  THR A HG21 2  
ATOM 2449  H HG22 . THR A 1 14  ? -5.086  9.131   16.331  1.00 0.00 ? 14  THR A HG22 2  
ATOM 2450  H HG23 . THR A 1 14  ? -3.394  9.610   16.742  1.00 0.00 ? 14  THR A HG23 2  
ATOM 2451  N N    . ARG A 1 15  ? -2.014  11.330  12.314  1.00 0.00 ? 15  ARG A N    2  
ATOM 2452  C CA   . ARG A 1 15  ? -1.079  11.360  11.168  1.00 0.00 ? 15  ARG A CA   2  
ATOM 2453  C C    . ARG A 1 15  ? 0.269   10.574  11.183  1.00 0.00 ? 15  ARG A C    2  
ATOM 2454  O O    . ARG A 1 15  ? 0.339   9.374   11.428  1.00 0.00 ? 15  ARG A O    2  
ATOM 2455  C CB   . ARG A 1 15  ? -0.862  12.849  10.747  1.00 0.00 ? 15  ARG A CB   2  
ATOM 2456  C CG   . ARG A 1 15  ? -0.680  13.090  9.237   1.00 0.00 ? 15  ARG A CG   2  
ATOM 2457  C CD   . ARG A 1 15  ? -0.018  14.424  8.859   1.00 0.00 ? 15  ARG A CD   2  
ATOM 2458  N NE   . ARG A 1 15  ? 1.456   14.315  9.129   1.00 0.00 ? 15  ARG A NE   2  
ATOM 2459  C CZ   . ARG A 1 15  ? 2.382   15.207  8.659   1.00 0.00 ? 15  ARG A CZ   2  
ATOM 2460  N NH1  . ARG A 1 15  ? 2.002   16.296  7.930   1.00 0.00 ? 15  ARG A NH1  2  
ATOM 2461  N NH2  . ARG A 1 15  ? 3.705   15.002  8.932   1.00 0.00 ? 15  ARG A NH2  2  
ATOM 2462  H H    . ARG A 1 15  ? -2.947  11.621  12.096  1.00 0.00 ? 15  ARG A H    2  
ATOM 2463  H HA   . ARG A 1 15  ? -1.648  10.893  10.375  1.00 0.00 ? 15  ARG A HA   2  
ATOM 2464  H HB2  . ARG A 1 15  ? -1.777  13.416  11.045  1.00 0.00 ? 15  ARG A HB2  2  
ATOM 2465  H HB3  . ARG A 1 15  ? -0.038  13.320  11.319  1.00 0.00 ? 15  ARG A HB3  2  
ATOM 2466  H HG2  . ARG A 1 15  ? -0.128  12.250  8.760   1.00 0.00 ? 15  ARG A HG2  2  
ATOM 2467  H HG3  . ARG A 1 15  ? -1.702  13.104  8.794   1.00 0.00 ? 15  ARG A HG3  2  
ATOM 2468  H HD2  . ARG A 1 15  ? -0.176  14.610  7.773   1.00 0.00 ? 15  ARG A HD2  2  
ATOM 2469  H HD3  . ARG A 1 15  ? -0.442  15.261  9.453   1.00 0.00 ? 15  ARG A HD3  2  
ATOM 2470  H HE   . ARG A 1 15  ? 1.778   13.534  9.665   1.00 0.00 ? 15  ARG A HE   2  
ATOM 2471  H HH11 . ARG A 1 15  ? 1.035   16.454  7.735   1.00 0.00 ? 15  ARG A HH11 2  
ATOM 2472  H HH12 . ARG A 1 15  ? 2.693   16.937  7.595   1.00 0.00 ? 15  ARG A HH12 2  
ATOM 2473  H HH21 . ARG A 1 15  ? 3.987   14.209  9.472   1.00 0.00 ? 15  ARG A HH21 2  
ATOM 2474  H HH22 . ARG A 1 15  ? 4.389   15.648  8.594   1.00 0.00 ? 15  ARG A HH22 2  
ATOM 2475  N N    . GLN A 1 16  ? 1.421   11.228  10.922  1.00 0.00 ? 16  GLN A N    2  
ATOM 2476  C CA   . GLN A 1 16  ? 2.676   10.505  10.875  1.00 0.00 ? 16  GLN A CA   2  
ATOM 2477  C C    . GLN A 1 16  ? 3.793   11.387  11.340  1.00 0.00 ? 16  GLN A C    2  
ATOM 2478  O O    . GLN A 1 16  ? 4.954   11.171  11.007  1.00 0.00 ? 16  GLN A O    2  
ATOM 2479  C CB   . GLN A 1 16  ? 2.893   9.915   9.454   1.00 0.00 ? 16  GLN A CB   2  
ATOM 2480  C CG   . GLN A 1 16  ? 2.798   10.924  8.281   1.00 0.00 ? 16  GLN A CG   2  
ATOM 2481  C CD   . GLN A 1 16  ? 2.021   10.337  7.101   1.00 0.00 ? 16  GLN A CD   2  
ATOM 2482  O OE1  . GLN A 1 16  ? 0.846   9.975   7.226   1.00 0.00 ? 16  GLN A OE1  2  
ATOM 2483  N NE2  . GLN A 1 16  ? 2.638   10.258  5.900   1.00 0.00 ? 16  GLN A NE2  2  
ATOM 2484  H H    . GLN A 1 16  ? 1.420   12.196  10.687  1.00 0.00 ? 16  GLN A H    2  
ATOM 2485  H HA   . GLN A 1 16  ? 2.681   9.686   11.583  1.00 0.00 ? 16  GLN A HA   2  
ATOM 2486  H HB2  . GLN A 1 16  ? 3.852   9.355   9.413   1.00 0.00 ? 16  GLN A HB2  2  
ATOM 2487  H HB3  . GLN A 1 16  ? 2.089   9.151   9.330   1.00 0.00 ? 16  GLN A HB3  2  
ATOM 2488  H HG2  . GLN A 1 16  ? 2.251   11.833  8.597   1.00 0.00 ? 16  GLN A HG2  2  
ATOM 2489  H HG3  . GLN A 1 16  ? 3.815   11.242  7.974   1.00 0.00 ? 16  GLN A HG3  2  
ATOM 2490  H HE21 . GLN A 1 16  ? 3.576   10.581  5.792   1.00 0.00 ? 16  GLN A HE21 2  
ATOM 2491  H HE22 . GLN A 1 16  ? 2.118   9.809   5.170   1.00 0.00 ? 16  GLN A HE22 2  
ATOM 2492  N N    . MET A 1 17  ? 3.454   12.423  12.151  1.00 0.00 ? 17  MET A N    2  
ATOM 2493  C CA   . MET A 1 17  ? 4.386   13.410  12.665  1.00 0.00 ? 17  MET A CA   2  
ATOM 2494  C C    . MET A 1 17  ? 5.383   12.957  13.728  1.00 0.00 ? 17  MET A C    2  
ATOM 2495  O O    . MET A 1 17  ? 6.576   13.177  13.581  1.00 0.00 ? 17  MET A O    2  
ATOM 2496  C CB   . MET A 1 17  ? 3.638   14.653  13.254  1.00 0.00 ? 17  MET A CB   2  
ATOM 2497  C CG   . MET A 1 17  ? 2.381   15.112  12.485  1.00 0.00 ? 17  MET A CG   2  
ATOM 2498  S SD   . MET A 1 17  ? 0.858   15.246  13.488  1.00 0.00 ? 17  MET A SD   2  
ATOM 2499  C CE   . MET A 1 17  ? 0.710   13.523  14.050  1.00 0.00 ? 17  MET A CE   2  
ATOM 2500  H H    . MET A 1 17  ? 2.503   12.556  12.410  1.00 0.00 ? 17  MET A H    2  
ATOM 2501  H HA   . MET A 1 17  ? 4.975   13.764  11.826  1.00 0.00 ? 17  MET A HA   2  
ATOM 2502  H HB2  . MET A 1 17  ? 3.342   14.496  14.314  1.00 0.00 ? 17  MET A HB2  2  
ATOM 2503  H HB3  . MET A 1 17  ? 4.348   15.513  13.272  1.00 0.00 ? 17  MET A HB3  2  
ATOM 2504  H HG2  . MET A 1 17  ? 2.609   16.112  12.049  1.00 0.00 ? 17  MET A HG2  2  
ATOM 2505  H HG3  . MET A 1 17  ? 2.189   14.455  11.619  1.00 0.00 ? 17  MET A HG3  2  
ATOM 2506  H HE1  . MET A 1 17  ? 0.727   12.807  13.207  1.00 0.00 ? 17  MET A HE1  2  
ATOM 2507  H HE2  . MET A 1 17  ? 1.521   13.234  14.745  1.00 0.00 ? 17  MET A HE2  2  
ATOM 2508  H HE3  . MET A 1 17  ? -0.250  13.352  14.587  1.00 0.00 ? 17  MET A HE3  2  
ATOM 2509  N N    . TYR A 1 18  ? 4.895   12.421  14.881  1.00 0.00 ? 18  TYR A N    2  
ATOM 2510  C CA   . TYR A 1 18  ? 5.694   12.119  16.073  1.00 0.00 ? 18  TYR A CA   2  
ATOM 2511  C C    . TYR A 1 18  ? 6.657   10.962  16.363  1.00 0.00 ? 18  TYR A C    2  
ATOM 2512  O O    . TYR A 1 18  ? 7.823   11.216  16.639  1.00 0.00 ? 18  TYR A O    2  
ATOM 2513  C CB   . TYR A 1 18  ? 4.960   12.596  17.382  1.00 0.00 ? 18  TYR A CB   2  
ATOM 2514  C CG   . TYR A 1 18  ? 3.437   12.489  17.312  1.00 0.00 ? 18  TYR A CG   2  
ATOM 2515  C CD1  . TYR A 1 18  ? 2.850   11.250  17.092  1.00 0.00 ? 18  TYR A CD1  2  
ATOM 2516  C CD2  . TYR A 1 18  ? 2.587   13.584  17.486  1.00 0.00 ? 18  TYR A CD2  2  
ATOM 2517  C CE1  . TYR A 1 18  ? 1.480   11.109  17.009  1.00 0.00 ? 18  TYR A CE1  2  
ATOM 2518  C CE2  . TYR A 1 18  ? 1.210   13.437  17.412  1.00 0.00 ? 18  TYR A CE2  2  
ATOM 2519  C CZ   . TYR A 1 18  ? 0.661   12.200  17.165  1.00 0.00 ? 18  TYR A CZ   2  
ATOM 2520  O OH   . TYR A 1 18  ? -0.727  11.996  17.064  1.00 0.00 ? 18  TYR A OH   2  
ATOM 2521  H H    . TYR A 1 18  ? 3.918   12.281  14.998  1.00 0.00 ? 18  TYR A H    2  
ATOM 2522  H HA   . TYR A 1 18  ? 6.498   12.828  15.947  1.00 0.00 ? 18  TYR A HA   2  
ATOM 2523  H HB2  . TYR A 1 18  ? 5.280   12.054  18.298  1.00 0.00 ? 18  TYR A HB2  2  
ATOM 2524  H HB3  . TYR A 1 18  ? 5.257   13.657  17.536  1.00 0.00 ? 18  TYR A HB3  2  
ATOM 2525  H HD1  . TYR A 1 18  ? 3.469   10.371  16.984  1.00 0.00 ? 18  TYR A HD1  2  
ATOM 2526  H HD2  . TYR A 1 18  ? 2.967   14.577  17.692  1.00 0.00 ? 18  TYR A HD2  2  
ATOM 2527  H HE1  . TYR A 1 18  ? 1.025   10.146  16.808  1.00 0.00 ? 18  TYR A HE1  2  
ATOM 2528  H HE2  . TYR A 1 18  ? 0.561   14.295  17.541  1.00 0.00 ? 18  TYR A HE2  2  
ATOM 2529  H HH   . TYR A 1 18  ? -1.175  12.802  16.733  1.00 0.00 ? 18  TYR A HH   2  
ATOM 2530  N N    . ASP A 1 19  ? 6.232   9.673   16.398  1.00 0.00 ? 19  ASP A N    2  
ATOM 2531  C CA   . ASP A 1 19  ? 7.044   8.609   17.026  1.00 0.00 ? 19  ASP A CA   2  
ATOM 2532  C C    . ASP A 1 19  ? 7.781   7.694   16.056  1.00 0.00 ? 19  ASP A C    2  
ATOM 2533  O O    . ASP A 1 19  ? 8.445   8.145   15.125  1.00 0.00 ? 19  ASP A O    2  
ATOM 2534  C CB   . ASP A 1 19  ? 6.116   7.826   18.020  1.00 0.00 ? 19  ASP A CB   2  
ATOM 2535  C CG   . ASP A 1 19  ? 6.864   7.080   19.138  1.00 0.00 ? 19  ASP A CG   2  
ATOM 2536  O OD1  . ASP A 1 19  ? 7.630   7.745   19.884  1.00 0.00 ? 19  ASP A OD1  2  
ATOM 2537  O OD2  . ASP A 1 19  ? 6.669   5.841   19.257  1.00 0.00 ? 19  ASP A OD2  2  
ATOM 2538  H H    . ASP A 1 19  ? 5.292   9.437   16.170  1.00 0.00 ? 19  ASP A H    2  
ATOM 2539  H HA   . ASP A 1 19  ? 7.824   9.052   17.637  1.00 0.00 ? 19  ASP A HA   2  
ATOM 2540  H HB2  . ASP A 1 19  ? 5.468   8.578   18.526  1.00 0.00 ? 19  ASP A HB2  2  
ATOM 2541  H HB3  . ASP A 1 19  ? 5.435   7.138   17.477  1.00 0.00 ? 19  ASP A HB3  2  
ATOM 2542  N N    . MET A 1 20  ? 7.630   6.334   16.223  1.00 0.00 ? 20  MET A N    2  
ATOM 2543  C CA   . MET A 1 20  ? 8.194   5.207   15.453  1.00 0.00 ? 20  MET A CA   2  
ATOM 2544  C C    . MET A 1 20  ? 7.878   5.265   13.960  1.00 0.00 ? 20  MET A C    2  
ATOM 2545  O O    . MET A 1 20  ? 8.585   4.762   13.097  1.00 0.00 ? 20  MET A O    2  
ATOM 2546  C CB   . MET A 1 20  ? 8.035   3.803   16.114  1.00 0.00 ? 20  MET A CB   2  
ATOM 2547  C CG   . MET A 1 20  ? 6.866   2.916   15.651  1.00 0.00 ? 20  MET A CG   2  
ATOM 2548  S SD   . MET A 1 20  ? 7.332   1.216   15.204  1.00 0.00 ? 20  MET A SD   2  
ATOM 2549  C CE   . MET A 1 20  ? 8.603   1.487   13.927  1.00 0.00 ? 20  MET A CE   2  
ATOM 2550  H H    . MET A 1 20  ? 7.070   6.039   16.991  1.00 0.00 ? 20  MET A H    2  
ATOM 2551  H HA   . MET A 1 20  ? 9.259   5.369   15.499  1.00 0.00 ? 20  MET A HA   2  
ATOM 2552  H HB2  . MET A 1 20  ? 8.978   3.232   15.944  1.00 0.00 ? 20  MET A HB2  2  
ATOM 2553  H HB3  . MET A 1 20  ? 7.946   3.927   17.216  1.00 0.00 ? 20  MET A HB3  2  
ATOM 2554  H HG2  . MET A 1 20  ? 6.140   2.907   16.493  1.00 0.00 ? 20  MET A HG2  2  
ATOM 2555  H HG3  . MET A 1 20  ? 6.348   3.351   14.779  1.00 0.00 ? 20  MET A HG3  2  
ATOM 2556  H HE1  . MET A 1 20  ? 8.263   2.161   13.108  1.00 0.00 ? 20  MET A HE1  2  
ATOM 2557  H HE2  . MET A 1 20  ? 9.543   1.908   14.348  1.00 0.00 ? 20  MET A HE2  2  
ATOM 2558  H HE3  . MET A 1 20  ? 8.846   0.517   13.453  1.00 0.00 ? 20  MET A HE3  2  
ATOM 2559  N N    . VAL A 1 21  ? 6.766   5.974   13.672  1.00 0.00 ? 21  VAL A N    2  
ATOM 2560  C CA   . VAL A 1 21  ? 6.267   6.388   12.335  1.00 0.00 ? 21  VAL A CA   2  
ATOM 2561  C C    . VAL A 1 21  ? 7.238   7.242   11.496  1.00 0.00 ? 21  VAL A C    2  
ATOM 2562  O O    . VAL A 1 21  ? 7.283   7.094   10.274  1.00 0.00 ? 21  VAL A O    2  
ATOM 2563  C CB   . VAL A 1 21  ? 4.865   7.052   12.431  1.00 0.00 ? 21  VAL A CB   2  
ATOM 2564  C CG1  . VAL A 1 21  ? 3.864   6.070   13.091  1.00 0.00 ? 21  VAL A CG1  2  
ATOM 2565  C CG2  . VAL A 1 21  ? 4.855   8.405   13.221  1.00 0.00 ? 21  VAL A CG2  2  
ATOM 2566  H H    . VAL A 1 21  ? 6.343   6.341   14.528  1.00 0.00 ? 21  VAL A H    2  
ATOM 2567  H HA   . VAL A 1 21  ? 6.262   5.509   11.664  1.00 0.00 ? 21  VAL A HA   2  
ATOM 2568  H HB   . VAL A 1 21  ? 4.502   7.235   11.390  1.00 0.00 ? 21  VAL A HB   2  
ATOM 2569  H HG11 . VAL A 1 21  ? 3.946   5.040   12.686  1.00 0.00 ? 21  VAL A HG11 2  
ATOM 2570  H HG12 . VAL A 1 21  ? 4.025   6.006   14.187  1.00 0.00 ? 21  VAL A HG12 2  
ATOM 2571  H HG13 . VAL A 1 21  ? 2.813   6.397   12.933  1.00 0.00 ? 21  VAL A HG13 2  
ATOM 2572  H HG21 . VAL A 1 21  ? 5.219   8.306   14.258  1.00 0.00 ? 21  VAL A HG21 2  
ATOM 2573  H HG22 . VAL A 1 21  ? 5.487   9.183   12.741  1.00 0.00 ? 21  VAL A HG22 2  
ATOM 2574  H HG23 . VAL A 1 21  ? 3.821   8.808   13.299  1.00 0.00 ? 21  VAL A HG23 2  
ATOM 2575  N N    . VAL A 1 22  ? 8.072   8.124   12.134  1.00 0.00 ? 22  VAL A N    2  
ATOM 2576  C CA   . VAL A 1 22  ? 9.079   9.016   11.517  1.00 0.00 ? 22  VAL A CA   2  
ATOM 2577  C C    . VAL A 1 22  ? 10.159  8.341   10.645  1.00 0.00 ? 22  VAL A C    2  
ATOM 2578  O O    . VAL A 1 22  ? 10.515  8.833   9.581   1.00 0.00 ? 22  VAL A O    2  
ATOM 2579  C CB   . VAL A 1 22  ? 9.709   9.956   12.553  1.00 0.00 ? 22  VAL A CB   2  
ATOM 2580  C CG1  . VAL A 1 22  ? 10.728  10.947  11.945  1.00 0.00 ? 22  VAL A CG1  2  
ATOM 2581  C CG2  . VAL A 1 22  ? 8.587   10.776  13.215  1.00 0.00 ? 22  VAL A CG2  2  
ATOM 2582  H H    . VAL A 1 22  ? 8.034   8.191   13.138  1.00 0.00 ? 22  VAL A H    2  
ATOM 2583  H HA   . VAL A 1 22  ? 8.536   9.651   10.837  1.00 0.00 ? 22  VAL A HA   2  
ATOM 2584  H HB   . VAL A 1 22  ? 10.218  9.354   13.338  1.00 0.00 ? 22  VAL A HB   2  
ATOM 2585  H HG11 . VAL A 1 22  ? 10.263  11.494  11.098  1.00 0.00 ? 22  VAL A HG11 2  
ATOM 2586  H HG12 . VAL A 1 22  ? 11.045  11.684  12.713  1.00 0.00 ? 22  VAL A HG12 2  
ATOM 2587  H HG13 . VAL A 1 22  ? 11.637  10.426  11.574  1.00 0.00 ? 22  VAL A HG13 2  
ATOM 2588  H HG21 . VAL A 1 22  ? 7.830   10.133  13.702  1.00 0.00 ? 22  VAL A HG21 2  
ATOM 2589  H HG22 . VAL A 1 22  ? 9.009   11.450  13.991  1.00 0.00 ? 22  VAL A HG22 2  
ATOM 2590  H HG23 . VAL A 1 22  ? 8.070   11.401  12.456  1.00 0.00 ? 22  VAL A HG23 2  
ATOM 2591  N N    . LYS A 1 23  ? 10.698  7.174   11.056  1.00 0.00 ? 23  LYS A N    2  
ATOM 2592  C CA   . LYS A 1 23  ? 11.636  6.329   10.320  1.00 0.00 ? 23  LYS A CA   2  
ATOM 2593  C C    . LYS A 1 23  ? 11.033  5.521   9.163   1.00 0.00 ? 23  LYS A C    2  
ATOM 2594  O O    . LYS A 1 23  ? 11.709  5.248   8.177   1.00 0.00 ? 23  LYS A O    2  
ATOM 2595  C CB   . LYS A 1 23  ? 12.539  5.489   11.269  1.00 0.00 ? 23  LYS A CB   2  
ATOM 2596  C CG   . LYS A 1 23  ? 11.802  4.633   12.316  1.00 0.00 ? 23  LYS A CG   2  
ATOM 2597  C CD   . LYS A 1 23  ? 11.906  5.165   13.760  1.00 0.00 ? 23  LYS A CD   2  
ATOM 2598  C CE   . LYS A 1 23  ? 11.277  6.547   13.987  1.00 0.00 ? 23  LYS A CE   2  
ATOM 2599  N NZ   . LYS A 1 23  ? 11.348  6.946   15.410  1.00 0.00 ? 23  LYS A NZ   2  
ATOM 2600  H H    . LYS A 1 23  ? 10.402  6.815   11.939  1.00 0.00 ? 23  LYS A H    2  
ATOM 2601  H HA   . LYS A 1 23  ? 12.318  6.994   9.802   1.00 0.00 ? 23  LYS A HA   2  
ATOM 2602  H HB2  . LYS A 1 23  ? 13.207  4.835   10.667  1.00 0.00 ? 23  LYS A HB2  2  
ATOM 2603  H HB3  . LYS A 1 23  ? 13.205  6.194   11.815  1.00 0.00 ? 23  LYS A HB3  2  
ATOM 2604  H HG2  . LYS A 1 23  ? 10.737  4.510   12.029  1.00 0.00 ? 23  LYS A HG2  2  
ATOM 2605  H HG3  . LYS A 1 23  ? 12.258  3.615   12.310  1.00 0.00 ? 23  LYS A HG3  2  
ATOM 2606  H HD2  . LYS A 1 23  ? 11.399  4.430   14.425  1.00 0.00 ? 23  LYS A HD2  2  
ATOM 2607  H HD3  . LYS A 1 23  ? 12.980  5.203   14.052  1.00 0.00 ? 23  LYS A HD3  2  
ATOM 2608  H HE2  . LYS A 1 23  ? 11.819  7.323   13.408  1.00 0.00 ? 23  LYS A HE2  2  
ATOM 2609  H HE3  . LYS A 1 23  ? 10.204  6.548   13.656  1.00 0.00 ? 23  LYS A HE3  2  
ATOM 2610  H HZ1  . LYS A 1 23  ? 12.343  6.982   15.711  1.00 0.00 ? 23  LYS A HZ1  2  
ATOM 2611  H HZ2  . LYS A 1 23  ? 10.913  7.883   15.529  1.00 0.00 ? 23  LYS A HZ2  2  
ATOM 2612  H HZ3  . LYS A 1 23  ? 10.835  6.250   15.989  1.00 0.00 ? 23  LYS A HZ3  2  
ATOM 2613  N N    . ILE A 1 24  ? 9.723   5.134   9.236   1.00 0.00 ? 24  ILE A N    2  
ATOM 2614  C CA   . ILE A 1 24  ? 8.971   4.396   8.197   1.00 0.00 ? 24  ILE A CA   2  
ATOM 2615  C C    . ILE A 1 24  ? 8.533   5.242   7.004   1.00 0.00 ? 24  ILE A C    2  
ATOM 2616  O O    . ILE A 1 24  ? 8.584   4.783   5.862   1.00 0.00 ? 24  ILE A O    2  
ATOM 2617  C CB   . ILE A 1 24  ? 7.869   3.467   8.759   1.00 0.00 ? 24  ILE A CB   2  
ATOM 2618  C CG1  . ILE A 1 24  ? 8.443   2.014   8.790   1.00 0.00 ? 24  ILE A CG1  2  
ATOM 2619  C CG2  . ILE A 1 24  ? 6.494   3.563   8.008   1.00 0.00 ? 24  ILE A CG2  2  
ATOM 2620  C CD1  . ILE A 1 24  ? 7.561   1.040   9.566   1.00 0.00 ? 24  ILE A CD1  2  
ATOM 2621  H H    . ILE A 1 24  ? 9.208   5.394   10.049  1.00 0.00 ? 24  ILE A H    2  
ATOM 2622  H HA   . ILE A 1 24  ? 9.678   3.714   7.741   1.00 0.00 ? 24  ILE A HA   2  
ATOM 2623  H HB   . ILE A 1 24  ? 7.681   3.776   9.817   1.00 0.00 ? 24  ILE A HB   2  
ATOM 2624  H HG12 . ILE A 1 24  ? 8.569   1.638   7.742   1.00 0.00 ? 24  ILE A HG12 2  
ATOM 2625  H HG13 . ILE A 1 24  ? 9.453   1.997   9.294   1.00 0.00 ? 24  ILE A HG13 2  
ATOM 2626  H HG21 . ILE A 1 24  ? 6.044   4.581   8.055   1.00 0.00 ? 24  ILE A HG21 2  
ATOM 2627  H HG22 . ILE A 1 24  ? 6.584   3.251   6.946   1.00 0.00 ? 24  ILE A HG22 2  
ATOM 2628  H HG23 . ILE A 1 24  ? 5.731   2.902   8.456   1.00 0.00 ? 24  ILE A HG23 2  
ATOM 2629  H HD11 . ILE A 1 24  ? 6.502   1.058   9.250   1.00 0.00 ? 24  ILE A HD11 2  
ATOM 2630  H HD12 . ILE A 1 24  ? 7.937   0.010   9.438   1.00 0.00 ? 24  ILE A HD12 2  
ATOM 2631  H HD13 . ILE A 1 24  ? 7.584   1.289   10.645  1.00 0.00 ? 24  ILE A HD13 2  
ATOM 2632  N N    . ILE A 1 25  ? 8.140   6.543   7.229   1.00 0.00 ? 25  ILE A N    2  
ATOM 2633  C CA   . ILE A 1 25  ? 7.708   7.566   6.234   1.00 0.00 ? 25  ILE A CA   2  
ATOM 2634  C C    . ILE A 1 25  ? 8.710   7.789   5.104   1.00 0.00 ? 25  ILE A C    2  
ATOM 2635  O O    . ILE A 1 25  ? 8.343   8.064   3.965   1.00 0.00 ? 25  ILE A O    2  
ATOM 2636  C CB   . ILE A 1 25  ? 7.141   8.893   6.794   1.00 0.00 ? 25  ILE A CB   2  
ATOM 2637  C CG1  . ILE A 1 25  ? 8.083   9.582   7.812   1.00 0.00 ? 25  ILE A CG1  2  
ATOM 2638  C CG2  . ILE A 1 25  ? 5.757   8.587   7.406   1.00 0.00 ? 25  ILE A CG2  2  
ATOM 2639  C CD1  . ILE A 1 25  ? 7.479   10.749  8.626   1.00 0.00 ? 25  ILE A CD1  2  
ATOM 2640  H H    . ILE A 1 25  ? 8.132   6.865   8.178   1.00 0.00 ? 25  ILE A H    2  
ATOM 2641  H HA   . ILE A 1 25  ? 6.873   7.110   5.716   1.00 0.00 ? 25  ILE A HA   2  
ATOM 2642  H HB   . ILE A 1 25  ? 6.958   9.620   5.967   1.00 0.00 ? 25  ILE A HB   2  
ATOM 2643  H HG12 . ILE A 1 25  ? 8.376   8.809   8.551   1.00 0.00 ? 25  ILE A HG12 2  
ATOM 2644  H HG13 . ILE A 1 25  ? 9.012   9.917   7.297   1.00 0.00 ? 25  ILE A HG13 2  
ATOM 2645  H HG21 . ILE A 1 25  ? 5.074   8.136   6.656   1.00 0.00 ? 25  ILE A HG21 2  
ATOM 2646  H HG22 . ILE A 1 25  ? 5.863   7.888   8.263   1.00 0.00 ? 25  ILE A HG22 2  
ATOM 2647  H HG23 . ILE A 1 25  ? 5.283   9.519   7.771   1.00 0.00 ? 25  ILE A HG23 2  
ATOM 2648  H HD11 . ILE A 1 25  ? 7.117   11.574  7.981   1.00 0.00 ? 25  ILE A HD11 2  
ATOM 2649  H HD12 . ILE A 1 25  ? 6.634   10.388  9.258   1.00 0.00 ? 25  ILE A HD12 2  
ATOM 2650  H HD13 . ILE A 1 25  ? 8.221   11.158  9.354   1.00 0.00 ? 25  ILE A HD13 2  
ATOM 2651  N N    . ASP A 1 26  ? 10.018  7.584   5.427   1.00 0.00 ? 26  ASP A N    2  
ATOM 2652  C CA   . ASP A 1 26  ? 11.172  7.555   4.535   1.00 0.00 ? 26  ASP A CA   2  
ATOM 2653  C C    . ASP A 1 26  ? 11.255  6.328   3.608   1.00 0.00 ? 26  ASP A C    2  
ATOM 2654  O O    . ASP A 1 26  ? 11.934  6.412   2.589   1.00 0.00 ? 26  ASP A O    2  
ATOM 2655  C CB   . ASP A 1 26  ? 12.511  7.652   5.324   1.00 0.00 ? 26  ASP A CB   2  
ATOM 2656  C CG   . ASP A 1 26  ? 12.520  8.912   6.196   1.00 0.00 ? 26  ASP A CG   2  
ATOM 2657  O OD1  . ASP A 1 26  ? 12.409  10.029  5.626   1.00 0.00 ? 26  ASP A OD1  2  
ATOM 2658  O OD2  . ASP A 1 26  ? 12.643  8.768   7.442   1.00 0.00 ? 26  ASP A OD2  2  
ATOM 2659  H H    . ASP A 1 26  ? 10.238  7.364   6.380   1.00 0.00 ? 26  ASP A H    2  
ATOM 2660  H HA   . ASP A 1 26  ? 11.111  8.414   3.878   1.00 0.00 ? 26  ASP A HA   2  
ATOM 2661  H HB2  . ASP A 1 26  ? 12.636  6.761   5.980   1.00 0.00 ? 26  ASP A HB2  2  
ATOM 2662  H HB3  . ASP A 1 26  ? 13.380  7.710   4.631   1.00 0.00 ? 26  ASP A HB3  2  
ATOM 2663  N N    . VAL A 1 27  ? 10.554  5.168   3.894   1.00 0.00 ? 27  VAL A N    2  
ATOM 2664  C CA   . VAL A 1 27  ? 10.515  3.986   2.999   1.00 0.00 ? 27  VAL A CA   2  
ATOM 2665  C C    . VAL A 1 27  ? 9.602   4.253   1.792   1.00 0.00 ? 27  VAL A C    2  
ATOM 2666  O O    . VAL A 1 27  ? 10.039  4.161   0.649   1.00 0.00 ? 27  VAL A O    2  
ATOM 2667  C CB   . VAL A 1 27  ? 10.292  2.563   3.602   1.00 0.00 ? 27  VAL A CB   2  
ATOM 2668  C CG1  . VAL A 1 27  ? 11.092  2.311   4.898   1.00 0.00 ? 27  VAL A CG1  2  
ATOM 2669  C CG2  . VAL A 1 27  ? 8.830   2.136   3.827   1.00 0.00 ? 27  VAL A CG2  2  
ATOM 2670  H H    . VAL A 1 27  ? 10.002  5.106   4.738   1.00 0.00 ? 27  VAL A H    2  
ATOM 2671  H HA   . VAL A 1 27  ? 11.509  3.897   2.575   1.00 0.00 ? 27  VAL A HA   2  
ATOM 2672  H HB   . VAL A 1 27  ? 10.680  1.834   2.848   1.00 0.00 ? 27  VAL A HB   2  
ATOM 2673  H HG11 . VAL A 1 27  ? 12.153  2.601   4.782   1.00 0.00 ? 27  VAL A HG11 2  
ATOM 2674  H HG12 . VAL A 1 27  ? 10.645  2.828   5.777   1.00 0.00 ? 27  VAL A HG12 2  
ATOM 2675  H HG13 . VAL A 1 27  ? 11.063  1.213   5.110   1.00 0.00 ? 27  VAL A HG13 2  
ATOM 2676  H HG21 . VAL A 1 27  ? 8.254   2.153   2.873   1.00 0.00 ? 27  VAL A HG21 2  
ATOM 2677  H HG22 . VAL A 1 27  ? 8.806   1.094   4.216   1.00 0.00 ? 27  VAL A HG22 2  
ATOM 2678  H HG23 . VAL A 1 27  ? 8.351   2.783   4.588   1.00 0.00 ? 27  VAL A HG23 2  
ATOM 2679  N N    . LEU A 1 28  ? 8.310   4.663   1.993   1.00 0.00 ? 28  LEU A N    2  
ATOM 2680  C CA   . LEU A 1 28  ? 7.303   4.970   0.968   1.00 0.00 ? 28  LEU A CA   2  
ATOM 2681  C C    . LEU A 1 28  ? 7.639   6.067   -0.020  1.00 0.00 ? 28  LEU A C    2  
ATOM 2682  O O    . LEU A 1 28  ? 7.558   5.855   -1.228  1.00 0.00 ? 28  LEU A O    2  
ATOM 2683  C CB   . LEU A 1 28  ? 5.868   5.276   1.514   1.00 0.00 ? 28  LEU A CB   2  
ATOM 2684  C CG   . LEU A 1 28  ? 5.123   4.159   2.286   1.00 0.00 ? 28  LEU A CG   2  
ATOM 2685  C CD1  . LEU A 1 28  ? 5.089   2.822   1.543   1.00 0.00 ? 28  LEU A CD1  2  
ATOM 2686  C CD2  . LEU A 1 28  ? 5.682   3.897   3.678   1.00 0.00 ? 28  LEU A CD2  2  
ATOM 2687  H H    . LEU A 1 28  ? 7.972   4.689   2.932   1.00 0.00 ? 28  LEU A H    2  
ATOM 2688  H HA   . LEU A 1 28  ? 7.328   4.103   0.340   1.00 0.00 ? 28  LEU A HA   2  
ATOM 2689  H HB2  . LEU A 1 28  ? 5.921   6.165   2.182   1.00 0.00 ? 28  LEU A HB2  2  
ATOM 2690  H HB3  . LEU A 1 28  ? 5.181   5.538   0.673   1.00 0.00 ? 28  LEU A HB3  2  
ATOM 2691  H HG   . LEU A 1 28  ? 4.068   4.526   2.404   1.00 0.00 ? 28  LEU A HG   2  
ATOM 2692  H HD11 . LEU A 1 28  ? 4.572   2.936   0.567   1.00 0.00 ? 28  LEU A HD11 2  
ATOM 2693  H HD12 . LEU A 1 28  ? 6.117   2.434   1.375   1.00 0.00 ? 28  LEU A HD12 2  
ATOM 2694  H HD13 . LEU A 1 28  ? 4.539   2.072   2.152   1.00 0.00 ? 28  LEU A HD13 2  
ATOM 2695  H HD21 . LEU A 1 28  ? 5.842   4.836   4.247   1.00 0.00 ? 28  LEU A HD21 2  
ATOM 2696  H HD22 . LEU A 1 28  ? 5.005   3.219   4.241   1.00 0.00 ? 28  LEU A HD22 2  
ATOM 2697  H HD23 . LEU A 1 28  ? 6.638   3.356   3.550   1.00 0.00 ? 28  LEU A HD23 2  
ATOM 2698  N N    . ARG A 1 29  ? 8.104   7.249   0.460   1.00 0.00 ? 29  ARG A N    2  
ATOM 2699  C CA   . ARG A 1 29  ? 8.586   8.404   -0.340  1.00 0.00 ? 29  ARG A CA   2  
ATOM 2700  C C    . ARG A 1 29  ? 9.647   8.072   -1.407  1.00 0.00 ? 29  ARG A C    2  
ATOM 2701  O O    . ARG A 1 29  ? 9.790   8.764   -2.399  1.00 0.00 ? 29  ARG A O    2  
ATOM 2702  C CB   . ARG A 1 29  ? 9.062   9.522   0.626   1.00 0.00 ? 29  ARG A CB   2  
ATOM 2703  C CG   . ARG A 1 29  ? 9.363   10.912  0.015   1.00 0.00 ? 29  ARG A CG   2  
ATOM 2704  C CD   . ARG A 1 29  ? 8.234   11.523  -0.839  1.00 0.00 ? 29  ARG A CD   2  
ATOM 2705  N NE   . ARG A 1 29  ? 6.975   11.632  -0.013  1.00 0.00 ? 29  ARG A NE   2  
ATOM 2706  C CZ   . ARG A 1 29  ? 5.733   11.230  -0.433  1.00 0.00 ? 29  ARG A CZ   2  
ATOM 2707  N NH1  . ARG A 1 29  ? 5.546   10.672  -1.664  1.00 0.00 ? 29  ARG A NH1  2  
ATOM 2708  N NH2  . ARG A 1 29  ? 4.663   11.386  0.402   1.00 0.00 ? 29  ARG A NH2  2  
ATOM 2709  H H    . ARG A 1 29  ? 8.151   7.361   1.469   1.00 0.00 ? 29  ARG A H    2  
ATOM 2710  H HA   . ARG A 1 29  ? 7.762   8.807   -0.946  1.00 0.00 ? 29  ARG A HA   2  
ATOM 2711  H HB2  . ARG A 1 29  ? 8.260   9.663   1.387   1.00 0.00 ? 29  ARG A HB2  2  
ATOM 2712  H HB3  . ARG A 1 29  ? 9.959   9.171   1.187   1.00 0.00 ? 29  ARG A HB3  2  
ATOM 2713  H HG2  . ARG A 1 29  ? 9.602   11.616  0.843   1.00 0.00 ? 29  ARG A HG2  2  
ATOM 2714  H HG3  . ARG A 1 29  ? 10.273  10.835  -0.622  1.00 0.00 ? 29  ARG A HG3  2  
ATOM 2715  H HD2  . ARG A 1 29  ? 8.521   12.550  -1.155  1.00 0.00 ? 29  ARG A HD2  2  
ATOM 2716  H HD3  . ARG A 1 29  ? 8.077   10.905  -1.750  1.00 0.00 ? 29  ARG A HD3  2  
ATOM 2717  H HE   . ARG A 1 29  ? 7.054   12.034  0.899   1.00 0.00 ? 29  ARG A HE   2  
ATOM 2718  H HH11 . ARG A 1 29  ? 6.325   10.549  -2.279  1.00 0.00 ? 29  ARG A HH11 2  
ATOM 2719  H HH12 . ARG A 1 29  ? 4.632   10.383  -1.948  1.00 0.00 ? 29  ARG A HH12 2  
ATOM 2720  H HH21 . ARG A 1 29  ? 4.789   11.793  1.307   1.00 0.00 ? 29  ARG A HH21 2  
ATOM 2721  H HH22 . ARG A 1 29  ? 3.753   11.092  0.108   1.00 0.00 ? 29  ARG A HH22 2  
ATOM 2722  N N    . SER A 1 30  ? 10.430  6.992   -1.177  1.00 0.00 ? 30  SER A N    2  
ATOM 2723  C CA   . SER A 1 30  ? 11.586  6.505   -1.934  1.00 0.00 ? 30  SER A CA   2  
ATOM 2724  C C    . SER A 1 30  ? 11.255  5.866   -3.279  1.00 0.00 ? 30  SER A C    2  
ATOM 2725  O O    . SER A 1 30  ? 11.725  6.292   -4.333  1.00 0.00 ? 30  SER A O    2  
ATOM 2726  C CB   . SER A 1 30  ? 12.413  5.530   -1.012  1.00 0.00 ? 30  SER A CB   2  
ATOM 2727  O OG   . SER A 1 30  ? 12.004  4.153   -0.956  1.00 0.00 ? 30  SER A OG   2  
ATOM 2728  H H    . SER A 1 30  ? 10.086  6.438   -0.422  1.00 0.00 ? 30  SER A H    2  
ATOM 2729  H HA   . SER A 1 30  ? 12.195  7.375   -2.159  1.00 0.00 ? 30  SER A HA   2  
ATOM 2730  H HB2  . SER A 1 30  ? 13.480  5.562   -1.346  1.00 0.00 ? 30  SER A HB2  2  
ATOM 2731  H HB3  . SER A 1 30  ? 12.261  5.909   0.032   1.00 0.00 ? 30  SER A HB3  2  
ATOM 2732  H HG   . SER A 1 30  ? 11.262  4.089   -0.305  1.00 0.00 ? 30  SER A HG   2  
ATOM 2733  N N    . HIS A 1 31  ? 10.321  4.872   -3.243  1.00 0.00 ? 31  HIS A N    2  
ATOM 2734  C CA   . HIS A 1 31  ? 9.711   4.170   -4.360  1.00 0.00 ? 31  HIS A CA   2  
ATOM 2735  C C    . HIS A 1 31  ? 8.695   5.047   -5.086  1.00 0.00 ? 31  HIS A C    2  
ATOM 2736  O O    . HIS A 1 31  ? 8.504   4.955   -6.294  1.00 0.00 ? 31  HIS A O    2  
ATOM 2737  C CB   . HIS A 1 31  ? 9.246   2.750   -3.966  1.00 0.00 ? 31  HIS A CB   2  
ATOM 2738  C CG   . HIS A 1 31  ? 8.534   2.584   -2.664  1.00 0.00 ? 31  HIS A CG   2  
ATOM 2739  N ND1  . HIS A 1 31  ? 7.250   3.005   -2.425  1.00 0.00 ? 31  HIS A ND1  2  
ATOM 2740  C CD2  . HIS A 1 31  ? 8.883   1.825   -1.588  1.00 0.00 ? 31  HIS A CD2  2  
ATOM 2741  C CE1  . HIS A 1 31  ? 6.871   2.459   -1.248  1.00 0.00 ? 31  HIS A CE1  2  
ATOM 2742  N NE2  . HIS A 1 31  ? 7.832   1.750   -0.697  1.00 0.00 ? 31  HIS A NE2  2  
ATOM 2743  H H    . HIS A 1 31  ? 10.009  4.524   -2.347  1.00 0.00 ? 31  HIS A H    2  
ATOM 2744  H HA   . HIS A 1 31  ? 10.486  4.020   -5.104  1.00 0.00 ? 31  HIS A HA   2  
ATOM 2745  H HB2  . HIS A 1 31  ? 8.635   2.281   -4.762  1.00 0.00 ? 31  HIS A HB2  2  
ATOM 2746  H HB3  . HIS A 1 31  ? 10.154  2.119   -3.842  1.00 0.00 ? 31  HIS A HB3  2  
ATOM 2747  H HD1  . HIS A 1 31  ? 6.737   3.669   -2.972  1.00 0.00 ? 31  HIS A HD1  2  
ATOM 2748  H HD2  . HIS A 1 31  ? 9.796   1.270   -1.397  1.00 0.00 ? 31  HIS A HD2  2  
ATOM 2749  H HE1  . HIS A 1 31  ? 5.879   2.588   -0.817  1.00 0.00 ? 31  HIS A HE1  2  
ATOM 2750  N N    . ASN A 1 32  ? 8.041   5.974   -4.328  1.00 0.00 ? 32  ASN A N    2  
ATOM 2751  C CA   . ASN A 1 32  ? 7.172   7.046   -4.810  1.00 0.00 ? 32  ASN A CA   2  
ATOM 2752  C C    . ASN A 1 32  ? 7.858   8.151   -5.663  1.00 0.00 ? 32  ASN A C    2  
ATOM 2753  O O    . ASN A 1 32  ? 7.241   8.700   -6.566  1.00 0.00 ? 32  ASN A O    2  
ATOM 2754  C CB   . ASN A 1 32  ? 6.239   7.601   -3.701  1.00 0.00 ? 32  ASN A CB   2  
ATOM 2755  C CG   . ASN A 1 32  ? 5.139   6.564   -3.447  1.00 0.00 ? 32  ASN A CG   2  
ATOM 2756  O OD1  . ASN A 1 32  ? 4.280   6.424   -4.318  1.00 0.00 ? 32  ASN A OD1  2  
ATOM 2757  N ND2  . ASN A 1 32  ? 5.146   5.808   -2.323  1.00 0.00 ? 32  ASN A ND2  2  
ATOM 2758  H H    . ASN A 1 32  ? 8.209   6.030   -3.343  1.00 0.00 ? 32  ASN A H    2  
ATOM 2759  H HA   . ASN A 1 32  ? 6.532   6.569   -5.545  1.00 0.00 ? 32  ASN A HA   2  
ATOM 2760  H HB2  . ASN A 1 32  ? 6.804   7.847   -2.784  1.00 0.00 ? 32  ASN A HB2  2  
ATOM 2761  H HB3  . ASN A 1 32  ? 5.706   8.518   -4.044  1.00 0.00 ? 32  ASN A HB3  2  
ATOM 2762  H HD21 . ASN A 1 32  ? 6.017   5.795   -1.759  1.00 0.00 ? 32  ASN A HD21 2  
ATOM 2763  H HD22 . ASN A 1 32  ? 4.313   5.241   -2.211  1.00 0.00 ? 32  ASN A HD22 2  
ATOM 2764  N N    . GLU A 1 33  ? 9.165   8.527   -5.497  1.00 0.00 ? 33  GLU A N    2  
ATOM 2765  C CA   . GLU A 1 33  ? 9.819   9.459   -6.456  1.00 0.00 ? 33  GLU A CA   2  
ATOM 2766  C C    . GLU A 1 33  ? 10.105  8.849   -7.829  1.00 0.00 ? 33  GLU A C    2  
ATOM 2767  O O    . GLU A 1 33  ? 9.980   9.509   -8.850  1.00 0.00 ? 33  GLU A O    2  
ATOM 2768  C CB   . GLU A 1 33  ? 11.148  10.099  -5.943  1.00 0.00 ? 33  GLU A CB   2  
ATOM 2769  C CG   . GLU A 1 33  ? 11.072  10.738  -4.546  1.00 0.00 ? 33  GLU A CG   2  
ATOM 2770  C CD   . GLU A 1 33  ? 12.252  11.674  -4.261  1.00 0.00 ? 33  GLU A CD   2  
ATOM 2771  O OE1  . GLU A 1 33  ? 13.160  11.801  -5.124  1.00 0.00 ? 33  GLU A OE1  2  
ATOM 2772  O OE2  . GLU A 1 33  ? 12.254  12.275  -3.153  1.00 0.00 ? 33  GLU A OE2  2  
ATOM 2773  H H    . GLU A 1 33  ? 9.742   8.155   -4.769  1.00 0.00 ? 33  GLU A H    2  
ATOM 2774  H HA   . GLU A 1 33  ? 9.094   10.220  -6.741  1.00 0.00 ? 33  GLU A HA   2  
ATOM 2775  H HB2  . GLU A 1 33  ? 11.957  9.332   -5.901  1.00 0.00 ? 33  GLU A HB2  2  
ATOM 2776  H HB3  . GLU A 1 33  ? 11.453  10.887  -6.671  1.00 0.00 ? 33  GLU A HB3  2  
ATOM 2777  H HG2  . GLU A 1 33  ? 10.122  11.301  -4.433  1.00 0.00 ? 33  GLU A HG2  2  
ATOM 2778  H HG3  . GLU A 1 33  ? 11.118  9.919   -3.798  1.00 0.00 ? 33  GLU A HG3  2  
ATOM 2779  N N    . ALA A 1 34  ? 10.443  7.543   -7.856  1.00 0.00 ? 34  ALA A N    2  
ATOM 2780  C CA   . ALA A 1 34  ? 10.601  6.653   -9.007  1.00 0.00 ? 34  ALA A CA   2  
ATOM 2781  C C    . ALA A 1 34  ? 9.302   6.233   -9.694  1.00 0.00 ? 34  ALA A C    2  
ATOM 2782  O O    . ALA A 1 34  ? 9.259   5.865   -10.873 1.00 0.00 ? 34  ALA A O    2  
ATOM 2783  C CB   . ALA A 1 34  ? 11.576  5.521   -8.648  1.00 0.00 ? 34  ALA A CB   2  
ATOM 2784  H H    . ALA A 1 34  ? 10.507  7.074   -6.976  1.00 0.00 ? 34  ALA A H    2  
ATOM 2785  H HA   . ALA A 1 34  ? 11.029  7.232   -9.822  1.00 0.00 ? 34  ALA A HA   2  
ATOM 2786  H HB1  . ALA A 1 34  ? 12.546  5.971   -8.336  1.00 0.00 ? 34  ALA A HB1  2  
ATOM 2787  H HB2  . ALA A 1 34  ? 11.202  4.946   -7.775  1.00 0.00 ? 34  ALA A HB2  2  
ATOM 2788  H HB3  . ALA A 1 34  ? 11.780  4.852   -9.510  1.00 0.00 ? 34  ALA A HB3  2  
ATOM 2789  N N    . CYS A 1 35  ? 8.160   6.255   -8.939  1.00 0.00 ? 35  CYS A N    2  
ATOM 2790  C CA   . CYS A 1 35  ? 6.801   5.889   -9.357  1.00 0.00 ? 35  CYS A CA   2  
ATOM 2791  C C    . CYS A 1 35  ? 6.278   6.648   -10.554 1.00 0.00 ? 35  CYS A C    2  
ATOM 2792  O O    . CYS A 1 35  ? 5.526   6.109   -11.361 1.00 0.00 ? 35  CYS A O    2  
ATOM 2793  C CB   . CYS A 1 35  ? 5.677   5.925   -8.267  1.00 0.00 ? 35  CYS A CB   2  
ATOM 2794  S SG   . CYS A 1 35  ? 4.828   7.459   -7.708  1.00 0.00 ? 35  CYS A SG   2  
ATOM 2795  H H    . CYS A 1 35  ? 8.249   6.543   -7.990  1.00 0.00 ? 35  CYS A H    2  
ATOM 2796  H HA   . CYS A 1 35  ? 6.911   4.839   -9.649  1.00 0.00 ? 35  CYS A HA   2  
ATOM 2797  H HB2  . CYS A 1 35  ? 4.847   5.315   -8.719  1.00 0.00 ? 35  CYS A HB2  2  
ATOM 2798  H HB3  . CYS A 1 35  ? 6.111   5.409   -7.372  1.00 0.00 ? 35  CYS A HB3  2  
ATOM 2799  H HG   . CYS A 1 35  ? 5.910   8.151   -7.415  1.00 0.00 ? 35  CYS A HG   2  
ATOM 2800  N N    . GLN A 1 36  ? 6.748   7.927   -10.721 1.00 0.00 ? 36  GLN A N    2  
ATOM 2801  C CA   . GLN A 1 36  ? 6.558   8.861   -11.839 1.00 0.00 ? 36  GLN A CA   2  
ATOM 2802  C C    . GLN A 1 36  ? 6.903   8.315   -13.213 1.00 0.00 ? 36  GLN A C    2  
ATOM 2803  O O    . GLN A 1 36  ? 6.735   9.004   -14.209 1.00 0.00 ? 36  GLN A O    2  
ATOM 2804  C CB   . GLN A 1 36  ? 7.358   10.198  -11.659 1.00 0.00 ? 36  GLN A CB   2  
ATOM 2805  C CG   . GLN A 1 36  ? 8.919   10.138  -11.636 1.00 0.00 ? 36  GLN A CG   2  
ATOM 2806  C CD   . GLN A 1 36  ? 9.754   10.308  -12.929 1.00 0.00 ? 36  GLN A CD   2  
ATOM 2807  O OE1  . GLN A 1 36  ? 10.968  10.506  -12.812 1.00 0.00 ? 36  GLN A OE1  2  
ATOM 2808  N NE2  . GLN A 1 36  ? 9.179   10.163  -14.142 1.00 0.00 ? 36  GLN A NE2  2  
ATOM 2809  H H    . GLN A 1 36  ? 7.359   8.307   -10.008 1.00 0.00 ? 36  GLN A H    2  
ATOM 2810  H HA   . GLN A 1 36  ? 5.505   9.109   -11.868 1.00 0.00 ? 36  GLN A HA   2  
ATOM 2811  H HB2  . GLN A 1 36  ? 7.028   10.962  -12.395 1.00 0.00 ? 36  GLN A HB2  2  
ATOM 2812  H HB3  . GLN A 1 36  ? 7.061   10.582  -10.655 1.00 0.00 ? 36  GLN A HB3  2  
ATOM 2813  H HG2  . GLN A 1 36  ? 9.267   10.960  -10.968 1.00 0.00 ? 36  GLN A HG2  2  
ATOM 2814  H HG3  . GLN A 1 36  ? 9.244   9.186   -11.167 1.00 0.00 ? 36  GLN A HG3  2  
ATOM 2815  H HE21 . GLN A 1 36  ? 8.184   10.011  -14.199 1.00 0.00 ? 36  GLN A HE21 2  
ATOM 2816  H HE22 . GLN A 1 36  ? 9.764   9.799   -14.860 1.00 0.00 ? 36  GLN A HE22 2  
ATOM 2817  N N    . GLU A 1 37  ? 7.560   7.138   -13.255 1.00 0.00 ? 37  GLU A N    2  
ATOM 2818  C CA   . GLU A 1 37  ? 8.174   6.566   -14.441 1.00 0.00 ? 37  GLU A CA   2  
ATOM 2819  C C    . GLU A 1 37  ? 7.687   5.159   -14.659 1.00 0.00 ? 37  GLU A C    2  
ATOM 2820  O O    . GLU A 1 37  ? 7.333   4.757   -15.765 1.00 0.00 ? 37  GLU A O    2  
ATOM 2821  C CB   . GLU A 1 37  ? 9.709   6.525   -14.185 1.00 0.00 ? 37  GLU A CB   2  
ATOM 2822  C CG   . GLU A 1 37  ? 10.600  5.833   -15.238 1.00 0.00 ? 37  GLU A CG   2  
ATOM 2823  C CD   . GLU A 1 37  ? 10.973  6.824   -16.335 1.00 0.00 ? 37  GLU A CD   2  
ATOM 2824  O OE1  . GLU A 1 37  ? 10.085  7.155   -17.166 1.00 0.00 ? 37  GLU A OE1  2  
ATOM 2825  O OE2  . GLU A 1 37  ? 12.152  7.270   -16.354 1.00 0.00 ? 37  GLU A OE2  2  
ATOM 2826  H H    . GLU A 1 37  ? 7.543   6.643   -12.365 1.00 0.00 ? 37  GLU A H    2  
ATOM 2827  H HA   . GLU A 1 37  ? 7.946   7.137   -15.335 1.00 0.00 ? 37  GLU A HA   2  
ATOM 2828  H HB2  . GLU A 1 37  ? 10.071  7.563   -14.016 1.00 0.00 ? 37  GLU A HB2  2  
ATOM 2829  H HB3  . GLU A 1 37  ? 9.893   5.995   -13.223 1.00 0.00 ? 37  GLU A HB3  2  
ATOM 2830  H HG2  . GLU A 1 37  ? 11.497  5.463   -14.696 1.00 0.00 ? 37  GLU A HG2  2  
ATOM 2831  H HG3  . GLU A 1 37  ? 10.127  4.939   -15.691 1.00 0.00 ? 37  GLU A HG3  2  
ATOM 2832  N N    . ASN A 1 38  ? 7.710   4.380   -13.565 1.00 0.00 ? 38  ASN A N    2  
ATOM 2833  C CA   . ASN A 1 38  ? 7.346   2.988   -13.500 1.00 0.00 ? 38  ASN A CA   2  
ATOM 2834  C C    . ASN A 1 38  ? 6.202   2.920   -12.505 1.00 0.00 ? 38  ASN A C    2  
ATOM 2835  O O    . ASN A 1 38  ? 6.381   3.022   -11.287 1.00 0.00 ? 38  ASN A O    2  
ATOM 2836  C CB   . ASN A 1 38  ? 8.529   2.157   -12.980 1.00 0.00 ? 38  ASN A CB   2  
ATOM 2837  C CG   . ASN A 1 38  ? 9.812   2.346   -13.790 1.00 0.00 ? 38  ASN A CG   2  
ATOM 2838  O OD1  . ASN A 1 38  ? 9.849   2.322   -15.015 1.00 0.00 ? 38  ASN A OD1  2  
ATOM 2839  N ND2  . ASN A 1 38  ? 10.927  2.518   -13.029 1.00 0.00 ? 38  ASN A ND2  2  
ATOM 2840  H H    . ASN A 1 38  ? 8.013   4.784   -12.701 1.00 0.00 ? 38  ASN A H    2  
ATOM 2841  H HA   . ASN A 1 38  ? 7.013   2.610   -14.462 1.00 0.00 ? 38  ASN A HA   2  
ATOM 2842  H HB2  . ASN A 1 38  ? 8.732   2.570   -11.980 1.00 0.00 ? 38  ASN A HB2  2  
ATOM 2843  H HB3  . ASN A 1 38  ? 8.295   1.074   -12.920 1.00 0.00 ? 38  ASN A HB3  2  
ATOM 2844  H HD21 . ASN A 1 38  ? 10.857  2.453   -12.036 1.00 0.00 ? 38  ASN A HD21 2  
ATOM 2845  H HD22 . ASN A 1 38  ? 11.795  2.662   -13.493 1.00 0.00 ? 38  ASN A HD22 2  
ATOM 2846  N N    . LYS A 1 39  ? 4.980   2.751   -13.071 1.00 0.00 ? 39  LYS A N    2  
ATOM 2847  C CA   . LYS A 1 39  ? 3.601   2.738   -12.571 1.00 0.00 ? 39  LYS A CA   2  
ATOM 2848  C C    . LYS A 1 39  ? 3.389   2.117   -11.206 1.00 0.00 ? 39  LYS A C    2  
ATOM 2849  O O    . LYS A 1 39  ? 2.649   2.552   -10.346 1.00 0.00 ? 39  LYS A O    2  
ATOM 2850  C CB   . LYS A 1 39  ? 2.658   2.157   -13.672 1.00 0.00 ? 39  LYS A CB   2  
ATOM 2851  C CG   . LYS A 1 39  ? 2.926   0.712   -14.145 1.00 0.00 ? 39  LYS A CG   2  
ATOM 2852  C CD   . LYS A 1 39  ? 2.160   -0.335  -13.322 1.00 0.00 ? 39  LYS A CD   2  
ATOM 2853  C CE   . LYS A 1 39  ? 0.701   -0.528  -13.761 1.00 0.00 ? 39  LYS A CE   2  
ATOM 2854  N NZ   . LYS A 1 39  ? 0.013   -1.522  -12.905 1.00 0.00 ? 39  LYS A NZ   2  
ATOM 2855  H H    . LYS A 1 39  ? 5.012   2.615   -14.049 1.00 0.00 ? 39  LYS A H    2  
ATOM 2856  H HA   . LYS A 1 39  ? 3.303   3.760   -12.458 1.00 0.00 ? 39  LYS A HA   2  
ATOM 2857  H HB2  . LYS A 1 39  ? 1.598   2.240   -13.340 1.00 0.00 ? 39  LYS A HB2  2  
ATOM 2858  H HB3  . LYS A 1 39  ? 2.765   2.812   -14.567 1.00 0.00 ? 39  LYS A HB3  2  
ATOM 2859  H HG2  . LYS A 1 39  ? 2.606   0.609   -15.206 1.00 0.00 ? 39  LYS A HG2  2  
ATOM 2860  H HG3  . LYS A 1 39  ? 4.015   0.491   -14.104 1.00 0.00 ? 39  LYS A HG3  2  
ATOM 2861  H HD2  . LYS A 1 39  ? 2.681   -1.321  -13.329 1.00 0.00 ? 39  LYS A HD2  2  
ATOM 2862  H HD3  . LYS A 1 39  ? 2.203   0.028   -12.274 1.00 0.00 ? 39  LYS A HD3  2  
ATOM 2863  H HE2  . LYS A 1 39  ? 0.132   0.423   -13.689 1.00 0.00 ? 39  LYS A HE2  2  
ATOM 2864  H HE3  . LYS A 1 39  ? 0.660   -0.900  -14.806 1.00 0.00 ? 39  LYS A HE3  2  
ATOM 2865  H HZ1  . LYS A 1 39  ? 0.507   -2.436  -12.970 1.00 0.00 ? 39  LYS A HZ1  2  
ATOM 2866  H HZ2  . LYS A 1 39  ? 0.019   -1.195  -11.918 1.00 0.00 ? 39  LYS A HZ2  2  
ATOM 2867  H HZ3  . LYS A 1 39  ? -0.969  -1.636  -13.226 1.00 0.00 ? 39  LYS A HZ3  2  
ATOM 2868  N N    . ASP A 1 40  ? 4.113   1.030   -11.008 1.00 0.00 ? 40  ASP A N    2  
ATOM 2869  C CA   . ASP A 1 40  ? 4.311   0.354   -9.774  1.00 0.00 ? 40  ASP A CA   2  
ATOM 2870  C C    . ASP A 1 40  ? 5.664   -0.318  -9.839  1.00 0.00 ? 40  ASP A C    2  
ATOM 2871  O O    . ASP A 1 40  ? 5.739   -1.501  -10.125 1.00 0.00 ? 40  ASP A O    2  
ATOM 2872  C CB   . ASP A 1 40  ? 3.098   -0.525  -9.315  1.00 0.00 ? 40  ASP A CB   2  
ATOM 2873  C CG   . ASP A 1 40  ? 2.552   -1.628  -10.239 1.00 0.00 ? 40  ASP A CG   2  
ATOM 2874  O OD1  . ASP A 1 40  ? 3.284   -2.135  -11.124 1.00 0.00 ? 40  ASP A OD1  2  
ATOM 2875  O OD2  . ASP A 1 40  ? 1.364   -1.997  -10.028 1.00 0.00 ? 40  ASP A OD2  2  
ATOM 2876  H H    . ASP A 1 40  ? 4.718   0.861   -11.767 1.00 0.00 ? 40  ASP A H    2  
ATOM 2877  H HA   . ASP A 1 40  ? 4.403   1.092   -8.994  1.00 0.00 ? 40  ASP A HA   2  
ATOM 2878  H HB2  . ASP A 1 40  ? 3.264   -0.954  -8.303  1.00 0.00 ? 40  ASP A HB2  2  
ATOM 2879  H HB3  . ASP A 1 40  ? 2.260   0.202   -9.205  1.00 0.00 ? 40  ASP A HB3  2  
ATOM 2880  N N    . LEU A 1 41  ? 6.810   0.340   -9.513  1.00 0.00 ? 41  LEU A N    2  
ATOM 2881  C CA   . LEU A 1 41  ? 8.108   -0.373  -9.363  1.00 0.00 ? 41  LEU A CA   2  
ATOM 2882  C C    . LEU A 1 41  ? 8.221   -1.354  -8.129  1.00 0.00 ? 41  LEU A C    2  
ATOM 2883  O O    . LEU A 1 41  ? 9.051   -2.256  -8.050  1.00 0.00 ? 41  LEU A O    2  
ATOM 2884  C CB   . LEU A 1 41  ? 9.281   0.600   -9.504  1.00 0.00 ? 41  LEU A CB   2  
ATOM 2885  C CG   . LEU A 1 41  ? 9.375   1.587   -8.354  1.00 0.00 ? 41  LEU A CG   2  
ATOM 2886  C CD1  . LEU A 1 41  ? 10.745  1.522   -7.696  1.00 0.00 ? 41  LEU A CD1  2  
ATOM 2887  C CD2  . LEU A 1 41  ? 9.013   2.955   -8.889  1.00 0.00 ? 41  LEU A CD2  2  
ATOM 2888  H H    . LEU A 1 41  ? 6.811   1.344   -9.432  1.00 0.00 ? 41  LEU A H    2  
ATOM 2889  H HA   . LEU A 1 41  ? 8.256   -0.972  -10.238 1.00 0.00 ? 41  LEU A HA   2  
ATOM 2890  H HB2  . LEU A 1 41  ? 10.243  0.049   -9.584  1.00 0.00 ? 41  LEU A HB2  2  
ATOM 2891  H HB3  . LEU A 1 41  ? 9.118   1.176   -10.454 1.00 0.00 ? 41  LEU A HB3  2  
ATOM 2892  H HG   . LEU A 1 41  ? 8.634   1.301   -7.583  1.00 0.00 ? 41  LEU A HG   2  
ATOM 2893  H HD11 . LEU A 1 41  ? 10.923  0.474   -7.369  1.00 0.00 ? 41  LEU A HD11 2  
ATOM 2894  H HD12 . LEU A 1 41  ? 11.527  1.800   -8.434  1.00 0.00 ? 41  LEU A HD12 2  
ATOM 2895  H HD13 . LEU A 1 41  ? 10.798  2.193   -6.815  1.00 0.00 ? 41  LEU A HD13 2  
ATOM 2896  H HD21 . LEU A 1 41  ? 8.022   2.908   -9.379  1.00 0.00 ? 41  LEU A HD21 2  
ATOM 2897  H HD22 . LEU A 1 41  ? 8.952   3.688   -8.068  1.00 0.00 ? 41  LEU A HD22 2  
ATOM 2898  H HD23 . LEU A 1 41  ? 9.755   3.278   -9.648  1.00 0.00 ? 41  LEU A HD23 2  
ATOM 2899  N N    . GLN A 1 42  ? 7.247   -1.193  -7.192  1.00 0.00 ? 42  GLN A N    2  
ATOM 2900  C CA   . GLN A 1 42  ? 6.730   -1.891  -6.016  1.00 0.00 ? 42  GLN A CA   2  
ATOM 2901  C C    . GLN A 1 42  ? 5.457   -2.688  -6.354  1.00 0.00 ? 42  GLN A C    2  
ATOM 2902  O O    . GLN A 1 42  ? 4.544   -2.601  -5.529  1.00 0.00 ? 42  GLN A O    2  
ATOM 2903  C CB   . GLN A 1 42  ? 6.611   -1.062  -4.700  1.00 0.00 ? 42  GLN A CB   2  
ATOM 2904  C CG   . GLN A 1 42  ? 7.681   -1.412  -3.638  1.00 0.00 ? 42  GLN A CG   2  
ATOM 2905  C CD   . GLN A 1 42  ? 9.122   -1.248  -4.111  1.00 0.00 ? 42  GLN A CD   2  
ATOM 2906  O OE1  . GLN A 1 42  ? 10.025  -1.946  -3.654  1.00 0.00 ? 42  GLN A OE1  2  
ATOM 2907  N NE2  . GLN A 1 42  ? 9.316   -0.310  -5.061  1.00 0.00 ? 42  GLN A NE2  2  
ATOM 2908  H H    . GLN A 1 42  ? 6.648   -0.425  -7.330  1.00 0.00 ? 42  GLN A H    2  
ATOM 2909  H HA   . GLN A 1 42  ? 7.456   -2.663  -5.793  1.00 0.00 ? 42  GLN A HA   2  
ATOM 2910  H HB2  . GLN A 1 42  ? 6.613   0.010   -4.927  1.00 0.00 ? 42  GLN A HB2  2  
ATOM 2911  H HB3  . GLN A 1 42  ? 5.651   -1.221  -4.162  1.00 0.00 ? 42  GLN A HB3  2  
ATOM 2912  H HG2  . GLN A 1 42  ? 7.545   -0.762  -2.747  1.00 0.00 ? 42  GLN A HG2  2  
ATOM 2913  H HG3  . GLN A 1 42  ? 7.561   -2.474  -3.339  1.00 0.00 ? 42  GLN A HG3  2  
ATOM 2914  H HE21 . GLN A 1 42  ? 8.487   0.032   -5.504  1.00 0.00 ? 42  GLN A HE21 2  
ATOM 2915  H HE22 . GLN A 1 42  ? 10.229  -0.234  -5.454  1.00 0.00 ? 42  GLN A HE22 2  
ATOM 2916  N N    . PRO A 1 43  ? 5.220   -3.391  -7.534  1.00 0.00 ? 43  PRO A N    2  
ATOM 2917  C CA   . PRO A 1 43  ? 3.934   -3.932  -8.043  1.00 0.00 ? 43  PRO A CA   2  
ATOM 2918  C C    . PRO A 1 43  ? 3.140   -4.760  -7.027  1.00 0.00 ? 43  PRO A C    2  
ATOM 2919  O O    . PRO A 1 43  ? 1.922   -4.798  -7.140  1.00 0.00 ? 43  PRO A O    2  
ATOM 2920  C CB   . PRO A 1 43  ? 4.339   -4.782  -9.266  1.00 0.00 ? 43  PRO A CB   2  
ATOM 2921  C CG   . PRO A 1 43  ? 5.755   -5.250  -8.951  1.00 0.00 ? 43  PRO A CG   2  
ATOM 2922  C CD   . PRO A 1 43  ? 6.326   -3.995  -8.295  1.00 0.00 ? 43  PRO A CD   2  
ATOM 2923  H HA   . PRO A 1 43  ? 3.298   -3.116  -8.390  1.00 0.00 ? 43  PRO A HA   2  
ATOM 2924  H HB2  . PRO A 1 43  ? 3.646   -5.615  -9.502  1.00 0.00 ? 43  PRO A HB2  2  
ATOM 2925  H HB3  . PRO A 1 43  ? 4.390   -4.119  -10.158 1.00 0.00 ? 43  PRO A HB3  2  
ATOM 2926  H HG2  . PRO A 1 43  ? 5.738   -6.101  -8.237  1.00 0.00 ? 43  PRO A HG2  2  
ATOM 2927  H HG3  . PRO A 1 43  ? 6.316   -5.546  -9.861  1.00 0.00 ? 43  PRO A HG3  2  
ATOM 2928  H HD2  . PRO A 1 43  ? 7.217   -4.239  -7.671  1.00 0.00 ? 43  PRO A HD2  2  
ATOM 2929  H HD3  . PRO A 1 43  ? 6.627   -3.313  -9.113  1.00 0.00 ? 43  PRO A HD3  2  
ATOM 2930  N N    . TYR A 1 44  ? 3.833   -5.367  -6.022  1.00 0.00 ? 44  TYR A N    2  
ATOM 2931  C CA   . TYR A 1 44  ? 3.305   -6.045  -4.857  1.00 0.00 ? 44  TYR A CA   2  
ATOM 2932  C C    . TYR A 1 44  ? 4.438   -6.024  -3.818  1.00 0.00 ? 44  TYR A C    2  
ATOM 2933  O O    . TYR A 1 44  ? 5.613   -6.070  -4.187  1.00 0.00 ? 44  TYR A O    2  
ATOM 2934  C CB   . TYR A 1 44  ? 2.928   -7.542  -5.120  1.00 0.00 ? 44  TYR A CB   2  
ATOM 2935  C CG   . TYR A 1 44  ? 1.638   -7.696  -5.924  1.00 0.00 ? 44  TYR A CG   2  
ATOM 2936  C CD1  . TYR A 1 44  ? 0.405   -7.561  -5.296  1.00 0.00 ? 44  TYR A CD1  2  
ATOM 2937  C CD2  . TYR A 1 44  ? 1.633   -7.983  -7.290  1.00 0.00 ? 44  TYR A CD2  2  
ATOM 2938  C CE1  . TYR A 1 44  ? -0.780  -7.798  -5.973  1.00 0.00 ? 44  TYR A CE1  2  
ATOM 2939  C CE2  . TYR A 1 44  ? 0.445   -8.169  -7.974  1.00 0.00 ? 44  TYR A CE2  2  
ATOM 2940  C CZ   . TYR A 1 44  ? -0.759  -8.100  -7.313  1.00 0.00 ? 44  TYR A CZ   2  
ATOM 2941  O OH   . TYR A 1 44  ? -1.961  -8.291  -8.023  1.00 0.00 ? 44  TYR A OH   2  
ATOM 2942  H H    . TYR A 1 44  ? 4.830   -5.279  -6.010  1.00 0.00 ? 44  TYR A H    2  
ATOM 2943  H HA   . TYR A 1 44  ? 2.482   -5.445  -4.464  1.00 0.00 ? 44  TYR A HA   2  
ATOM 2944  H HB2  . TYR A 1 44  ? 3.771   -8.047  -5.644  1.00 0.00 ? 44  TYR A HB2  2  
ATOM 2945  H HB3  . TYR A 1 44  ? 2.804   -8.116  -4.171  1.00 0.00 ? 44  TYR A HB3  2  
ATOM 2946  H HD1  . TYR A 1 44  ? 0.344   -7.265  -4.257  1.00 0.00 ? 44  TYR A HD1  2  
ATOM 2947  H HD2  . TYR A 1 44  ? 2.546   -8.045  -7.865  1.00 0.00 ? 44  TYR A HD2  2  
ATOM 2948  H HE1  . TYR A 1 44  ? -1.730  -7.730  -5.456  1.00 0.00 ? 44  TYR A HE1  2  
ATOM 2949  H HE2  . TYR A 1 44  ? 0.474   -8.381  -9.034  1.00 0.00 ? 44  TYR A HE2  2  
ATOM 2950  H HH   . TYR A 1 44  ? -1.742  -8.231  -8.955  1.00 0.00 ? 44  TYR A HH   2  
ATOM 2951  N N    . MET A 1 45  ? 4.069   -5.973  -2.507  1.00 0.00 ? 45  MET A N    2  
ATOM 2952  C CA   . MET A 1 45  ? 4.895   -6.029  -1.296  1.00 0.00 ? 45  MET A CA   2  
ATOM 2953  C C    . MET A 1 45  ? 4.123   -6.887  -0.247  1.00 0.00 ? 45  MET A C    2  
ATOM 2954  O O    . MET A 1 45  ? 2.891   -6.831  -0.287  1.00 0.00 ? 45  MET A O    2  
ATOM 2955  C CB   . MET A 1 45  ? 5.098   -4.614  -0.626  1.00 0.00 ? 45  MET A CB   2  
ATOM 2956  C CG   . MET A 1 45  ? 5.668   -3.458  -1.490  1.00 0.00 ? 45  MET A CG   2  
ATOM 2957  S SD   . MET A 1 45  ? 4.964   -1.794  -1.115  1.00 0.00 ? 45  MET A SD   2  
ATOM 2958  C CE   . MET A 1 45  ? 6.190   -1.005  -0.011  1.00 0.00 ? 45  MET A CE   2  
ATOM 2959  H H    . MET A 1 45  ? 3.097   -5.898  -2.304  1.00 0.00 ? 45  MET A H    2  
ATOM 2960  H HA   . MET A 1 45  ? 5.842   -6.498  -1.535  1.00 0.00 ? 45  MET A HA   2  
ATOM 2961  H HB2  . MET A 1 45  ? 4.120   -4.251  -0.234  1.00 0.00 ? 45  MET A HB2  2  
ATOM 2962  H HB3  . MET A 1 45  ? 5.767   -4.721  0.248   1.00 0.00 ? 45  MET A HB3  2  
ATOM 2963  H HG2  . MET A 1 45  ? 6.775   -3.447  -1.383  1.00 0.00 ? 45  MET A HG2  2  
ATOM 2964  H HG3  . MET A 1 45  ? 5.453   -3.675  -2.559  1.00 0.00 ? 45  MET A HG3  2  
ATOM 2965  H HE1  . MET A 1 45  ? 6.431   -1.663  0.846   1.00 0.00 ? 45  MET A HE1  2  
ATOM 2966  H HE2  . MET A 1 45  ? 7.141   -0.773  -0.549  1.00 0.00 ? 45  MET A HE2  2  
ATOM 2967  H HE3  . MET A 1 45  ? 5.820   -0.041  0.419   1.00 0.00 ? 45  MET A HE3  2  
ATOM 2968  N N    . PRO A 1 46  ? 4.660   -7.707  0.705   1.00 0.00 ? 46  PRO A N    2  
ATOM 2969  C CA   . PRO A 1 46  ? 3.873   -8.304  1.813   1.00 0.00 ? 46  PRO A CA   2  
ATOM 2970  C C    . PRO A 1 46  ? 3.671   -7.266  2.957   1.00 0.00 ? 46  PRO A C    2  
ATOM 2971  O O    . PRO A 1 46  ? 4.308   -6.209  2.927   1.00 0.00 ? 46  PRO A O    2  
ATOM 2972  C CB   . PRO A 1 46  ? 4.846   -9.404  2.297   1.00 0.00 ? 46  PRO A CB   2  
ATOM 2973  C CG   . PRO A 1 46  ? 6.240   -8.772  2.150   1.00 0.00 ? 46  PRO A CG   2  
ATOM 2974  C CD   . PRO A 1 46  ? 6.089   -8.033  0.805   1.00 0.00 ? 46  PRO A CD   2  
ATOM 2975  H HA   . PRO A 1 46  ? 2.898   -8.693  1.488   1.00 0.00 ? 46  PRO A HA   2  
ATOM 2976  H HB2  . PRO A 1 46  ? 4.647   -9.782  3.319   1.00 0.00 ? 46  PRO A HB2  2  
ATOM 2977  H HB3  . PRO A 1 46  ? 4.781   -10.268 1.600   1.00 0.00 ? 46  PRO A HB3  2  
ATOM 2978  H HG2  . PRO A 1 46  ? 6.448   -8.068  2.994   1.00 0.00 ? 46  PRO A HG2  2  
ATOM 2979  H HG3  . PRO A 1 46  ? 7.058   -9.517  2.138   1.00 0.00 ? 46  PRO A HG3  2  
ATOM 2980  H HD2  . PRO A 1 46  ? 6.724   -7.095  0.820   1.00 0.00 ? 46  PRO A HD2  2  
ATOM 2981  H HD3  . PRO A 1 46  ? 6.317   -8.789  -0.020  1.00 0.00 ? 46  PRO A HD3  2  
ATOM 2982  N N    . ILE A 1 47  ? 2.854   -7.544  4.031   1.00 0.00 ? 47  ILE A N    2  
ATOM 2983  C CA   . ILE A 1 47  ? 2.648   -6.653  5.207   1.00 0.00 ? 47  ILE A CA   2  
ATOM 2984  C C    . ILE A 1 47  ? 3.950   -6.391  5.990   1.00 0.00 ? 47  ILE A C    2  
ATOM 2985  O O    . ILE A 1 47  ? 4.245   -5.233  6.290   1.00 0.00 ? 47  ILE A O    2  
ATOM 2986  C CB   . ILE A 1 47  ? 1.399   -6.919  6.054   1.00 0.00 ? 47  ILE A CB   2  
ATOM 2987  C CG1  . ILE A 1 47  ? 0.252   -7.435  5.143   1.00 0.00 ? 47  ILE A CG1  2  
ATOM 2988  C CG2  . ILE A 1 47  ? 0.997   -5.604  6.775   1.00 0.00 ? 47  ILE A CG2  2  
ATOM 2989  C CD1  . ILE A 1 47  ? -1.154  -7.175  5.704   1.00 0.00 ? 47  ILE A CD1  2  
ATOM 2990  H H    . ILE A 1 47  ? 2.359   -8.405  4.063   1.00 0.00 ? 47  ILE A H    2  
ATOM 2991  H HA   . ILE A 1 47  ? 2.423   -5.690  4.773   1.00 0.00 ? 47  ILE A HA   2  
ATOM 2992  H HB   . ILE A 1 47  ? 1.594   -7.701  6.820   1.00 0.00 ? 47  ILE A HB   2  
ATOM 2993  H HG12 . ILE A 1 47  ? 0.289   -6.835  4.158   1.00 0.00 ? 47  ILE A HG12 2  
ATOM 2994  H HG13 . ILE A 1 47  ? 0.370   -8.581  5.087   1.00 0.00 ? 47  ILE A HG13 2  
ATOM 2995  H HG21 . ILE A 1 47  ? 1.837   -5.169  7.348   1.00 0.00 ? 47  ILE A HG21 2  
ATOM 2996  H HG22 . ILE A 1 47  ? 0.654   -4.855  6.031   1.00 0.00 ? 47  ILE A HG22 2  
ATOM 2997  H HG23 . ILE A 1 47  ? 0.168   -5.776  7.495   1.00 0.00 ? 47  ILE A HG23 2  
ATOM 2998  H HD11 . ILE A 1 47  ? -1.224  -7.479  6.768   1.00 0.00 ? 47  ILE A HD11 2  
ATOM 2999  H HD12 . ILE A 1 47  ? -1.415  -6.095  5.611   1.00 0.00 ? 47  ILE A HD12 2  
ATOM 3000  H HD13 . ILE A 1 47  ? -1.897  -7.749  5.117   1.00 0.00 ? 47  ILE A HD13 2  
ATOM 3001  N N    . PRO A 1 48  ? 4.814   -7.393  6.309   1.00 0.00 ? 48  PRO A N    2  
ATOM 3002  C CA   . PRO A 1 48  ? 6.231   -7.272  6.588   1.00 0.00 ? 48  PRO A CA   2  
ATOM 3003  C C    . PRO A 1 48  ? 7.122   -6.484  5.626   1.00 0.00 ? 48  PRO A C    2  
ATOM 3004  O O    . PRO A 1 48  ? 8.227   -6.240  6.052   1.00 0.00 ? 48  PRO A O    2  
ATOM 3005  C CB   . PRO A 1 48  ? 6.688   -8.376  7.569   1.00 0.00 ? 48  PRO A CB   2  
ATOM 3006  C CG   . PRO A 1 48  ? 5.403   -9.230  7.676   1.00 0.00 ? 48  PRO A CG   2  
ATOM 3007  C CD   . PRO A 1 48  ? 4.473   -8.796  6.501   1.00 0.00 ? 48  PRO A CD   2  
ATOM 3008  H HA   . PRO A 1 48  ? 6.233   -6.475  7.297   1.00 0.00 ? 48  PRO A HA   2  
ATOM 3009  H HB2  . PRO A 1 48  ? 7.474   -9.000  7.080   1.00 0.00 ? 48  PRO A HB2  2  
ATOM 3010  H HB3  . PRO A 1 48  ? 7.025   -7.941  8.615   1.00 0.00 ? 48  PRO A HB3  2  
ATOM 3011  H HG2  . PRO A 1 48  ? 5.626   -10.314 7.638   1.00 0.00 ? 48  PRO A HG2  2  
ATOM 3012  H HG3  . PRO A 1 48  ? 4.893   -9.007  8.639   1.00 0.00 ? 48  PRO A HG3  2  
ATOM 3013  H HD2  . PRO A 1 48  ? 4.722   -9.364  5.570   1.00 0.00 ? 48  PRO A HD2  2  
ATOM 3014  H HD3  . PRO A 1 48  ? 3.413   -8.948  6.821   1.00 0.00 ? 48  PRO A HD3  2  
ATOM 3015  N N    . HIS A 1 49  ? 6.862   -6.055  4.335   1.00 0.00 ? 49  HIS A N    2  
ATOM 3016  C CA   . HIS A 1 49  ? 7.800   -5.038  3.736   1.00 0.00 ? 49  HIS A CA   2  
ATOM 3017  C C    . HIS A 1 49  ? 7.844   -3.740  4.574   1.00 0.00 ? 49  HIS A C    2  
ATOM 3018  O O    . HIS A 1 49  ? 8.904   -3.304  5.003   1.00 0.00 ? 49  HIS A O    2  
ATOM 3019  C CB   . HIS A 1 49  ? 7.440   -4.513  2.296   1.00 0.00 ? 49  HIS A CB   2  
ATOM 3020  C CG   . HIS A 1 49  ? 8.491   -3.581  1.640   1.00 0.00 ? 49  HIS A CG   2  
ATOM 3021  N ND1  . HIS A 1 49  ? 8.731   -2.264  2.018   1.00 0.00 ? 49  HIS A ND1  2  
ATOM 3022  C CD2  . HIS A 1 49  ? 9.457   -3.854  0.715   1.00 0.00 ? 49  HIS A CD2  2  
ATOM 3023  C CE1  . HIS A 1 49  ? 9.824   -1.832  1.347   1.00 0.00 ? 49  HIS A CE1  2  
ATOM 3024  N NE2  . HIS A 1 49  ? 10.289  -2.759  0.538   1.00 0.00 ? 49  HIS A NE2  2  
ATOM 3025  H H    . HIS A 1 49  ? 5.983   -6.207  3.870   1.00 0.00 ? 49  HIS A H    2  
ATOM 3026  H HA   . HIS A 1 49  ? 8.801   -5.453  3.706   1.00 0.00 ? 49  HIS A HA   2  
ATOM 3027  H HB2  . HIS A 1 49  ? 7.260   -5.390  1.647   1.00 0.00 ? 49  HIS A HB2  2  
ATOM 3028  H HB3  . HIS A 1 49  ? 6.466   -3.976  2.301   1.00 0.00 ? 49  HIS A HB3  2  
ATOM 3029  H HD1  . HIS A 1 49  ? 8.225   -1.718  2.687   1.00 0.00 ? 49  HIS A HD1  2  
ATOM 3030  H HD2  . HIS A 1 49  ? 9.653   -4.767  0.168   1.00 0.00 ? 49  HIS A HD2  2  
ATOM 3031  H HE1  . HIS A 1 49  ? 10.289  -0.863  1.564   1.00 0.00 ? 49  HIS A HE1  2  
ATOM 3032  N N    . VAL A 1 50  ? 6.635   -3.209  4.914   1.00 0.00 ? 50  VAL A N    2  
ATOM 3033  C CA   . VAL A 1 50  ? 6.480   -2.103  5.857   1.00 0.00 ? 50  VAL A CA   2  
ATOM 3034  C C    . VAL A 1 50  ? 6.628   -2.541  7.332   1.00 0.00 ? 50  VAL A C    2  
ATOM 3035  O O    . VAL A 1 50  ? 7.307   -1.852  8.081   1.00 0.00 ? 50  VAL A O    2  
ATOM 3036  C CB   . VAL A 1 50  ? 5.375   -1.103  5.517   1.00 0.00 ? 50  VAL A CB   2  
ATOM 3037  C CG1  . VAL A 1 50  ? 5.901   0.316   5.820   1.00 0.00 ? 50  VAL A CG1  2  
ATOM 3038  C CG2  . VAL A 1 50  ? 5.016   -1.169  4.011   1.00 0.00 ? 50  VAL A CG2  2  
ATOM 3039  H H    . VAL A 1 50  ? 5.785   -3.597  4.552   1.00 0.00 ? 50  VAL A H    2  
ATOM 3040  H HA   . VAL A 1 50  ? 7.361   -1.487  5.724   1.00 0.00 ? 50  VAL A HA   2  
ATOM 3041  H HB   . VAL A 1 50  ? 4.464   -1.294  6.121   1.00 0.00 ? 50  VAL A HB   2  
ATOM 3042  H HG11 . VAL A 1 50  ? 6.198   0.410   6.880   1.00 0.00 ? 50  VAL A HG11 2  
ATOM 3043  H HG12 . VAL A 1 50  ? 6.786   0.559   5.184   1.00 0.00 ? 50  VAL A HG12 2  
ATOM 3044  H HG13 . VAL A 1 50  ? 5.114   1.067   5.613   1.00 0.00 ? 50  VAL A HG13 2  
ATOM 3045  H HG21 . VAL A 1 50  ? 5.921   -0.972  3.396   1.00 0.00 ? 50  VAL A HG21 2  
ATOM 3046  H HG22 . VAL A 1 50  ? 4.577   -2.145  3.722   1.00 0.00 ? 50  VAL A HG22 2  
ATOM 3047  H HG23 . VAL A 1 50  ? 4.268   -0.381  3.772   1.00 0.00 ? 50  VAL A HG23 2  
ATOM 3048  N N    . ARG A 1 51  ? 6.096   -3.738  7.769   1.00 0.00 ? 51  ARG A N    2  
ATOM 3049  C CA   . ARG A 1 51  ? 6.344   -4.328  9.098   1.00 0.00 ? 51  ARG A CA   2  
ATOM 3050  C C    . ARG A 1 51  ? 7.814   -4.782  9.354   1.00 0.00 ? 51  ARG A C    2  
ATOM 3051  O O    . ARG A 1 51  ? 8.272   -4.602  10.459  1.00 0.00 ? 51  ARG A O    2  
ATOM 3052  C CB   . ARG A 1 51  ? 5.360   -5.463  9.582   1.00 0.00 ? 51  ARG A CB   2  
ATOM 3053  C CG   . ARG A 1 51  ? 3.832   -5.257  9.550   1.00 0.00 ? 51  ARG A CG   2  
ATOM 3054  C CD   . ARG A 1 51  ? 3.118   -6.589  9.845   1.00 0.00 ? 51  ARG A CD   2  
ATOM 3055  N NE   . ARG A 1 51  ? 1.636   -6.363  9.952   1.00 0.00 ? 51  ARG A NE   2  
ATOM 3056  C CZ   . ARG A 1 51  ? 0.772   -7.323  10.411  1.00 0.00 ? 51  ARG A CZ   2  
ATOM 3057  N NH1  . ARG A 1 51  ? 1.236   -8.527  10.854  1.00 0.00 ? 51  ARG A NH1  2  
ATOM 3058  N NH2  . ARG A 1 51  ? -0.569  -7.068  10.426  1.00 0.00 ? 51  ARG A NH2  2  
ATOM 3059  H H    . ARG A 1 51  ? 5.509   -4.299  7.176   1.00 0.00 ? 51  ARG A H    2  
ATOM 3060  H HA   . ARG A 1 51  ? 6.195   -3.527  9.808   1.00 0.00 ? 51  ARG A HA   2  
ATOM 3061  H HB2  . ARG A 1 51  ? 5.552   -6.408  9.054   1.00 0.00 ? 51  ARG A HB2  2  
ATOM 3062  H HB3  . ARG A 1 51  ? 5.572   -5.684  10.646  1.00 0.00 ? 51  ARG A HB3  2  
ATOM 3063  H HG2  . ARG A 1 51  ? 3.513   -4.537  10.328  1.00 0.00 ? 51  ARG A HG2  2  
ATOM 3064  H HG3  . ARG A 1 51  ? 3.517   -4.858  8.568   1.00 0.00 ? 51  ARG A HG3  2  
ATOM 3065  H HD2  . ARG A 1 51  ? 3.309   -7.315  9.026   1.00 0.00 ? 51  ARG A HD2  2  
ATOM 3066  H HD3  . ARG A 1 51  ? 3.499   -6.999  10.807  1.00 0.00 ? 51  ARG A HD3  2  
ATOM 3067  H HE   . ARG A 1 51  ? 1.262   -5.492  9.636   1.00 0.00 ? 51  ARG A HE   2  
ATOM 3068  H HH11 . ARG A 1 51  ? 2.218   -8.715  10.850  1.00 0.00 ? 51  ARG A HH11 2  
ATOM 3069  H HH12 . ARG A 1 51  ? 0.596   -9.218  11.192  1.00 0.00 ? 51  ARG A HH12 2  
ATOM 3070  H HH21 . ARG A 1 51  ? -0.917  -6.189  10.098  1.00 0.00 ? 51  ARG A HH21 2  
ATOM 3071  H HH22 . ARG A 1 51  ? -1.206  -7.764  10.760  1.00 0.00 ? 51  ARG A HH22 2  
ATOM 3072  N N    . ASP A 1 52  ? 8.618   -5.383  8.433   1.00 0.00 ? 52  ASP A N    2  
ATOM 3073  C CA   . ASP A 1 52  ? 10.054  -5.711  8.568   1.00 0.00 ? 52  ASP A CA   2  
ATOM 3074  C C    . ASP A 1 52  ? 11.030  -4.538  8.372   1.00 0.00 ? 52  ASP A C    2  
ATOM 3075  O O    . ASP A 1 52  ? 12.183  -4.648  8.751   1.00 0.00 ? 52  ASP A O    2  
ATOM 3076  C CB   . ASP A 1 52  ? 10.475  -6.946  7.694   1.00 0.00 ? 52  ASP A CB   2  
ATOM 3077  C CG   . ASP A 1 52  ? 11.629  -7.807  8.230   1.00 0.00 ? 52  ASP A CG   2  
ATOM 3078  O OD1  . ASP A 1 52  ? 12.806  -7.367  8.159   1.00 0.00 ? 52  ASP A OD1  2  
ATOM 3079  O OD2  . ASP A 1 52  ? 11.334  -8.946  8.685   1.00 0.00 ? 52  ASP A OD2  2  
ATOM 3080  H H    . ASP A 1 52  ? 8.296   -5.613  7.485   1.00 0.00 ? 52  ASP A H    2  
ATOM 3081  H HA   . ASP A 1 52  ? 10.200  -6.023  9.597   1.00 0.00 ? 52  ASP A HA   2  
ATOM 3082  H HB2  . ASP A 1 52  ? 9.584   -7.614  7.652   1.00 0.00 ? 52  ASP A HB2  2  
ATOM 3083  H HB3  . ASP A 1 52  ? 10.696  -6.644  6.649   1.00 0.00 ? 52  ASP A HB3  2  
ATOM 3084  N N    . SER A 1 53  ? 10.633  -3.374  7.777   1.00 0.00 ? 53  SER A N    2  
ATOM 3085  C CA   . SER A 1 53  ? 11.447  -2.183  7.426   1.00 0.00 ? 53  SER A CA   2  
ATOM 3086  C C    . SER A 1 53  ? 12.233  -1.464  8.498   1.00 0.00 ? 53  SER A C    2  
ATOM 3087  O O    . SER A 1 53  ? 13.298  -0.919  8.240   1.00 0.00 ? 53  SER A O    2  
ATOM 3088  C CB   . SER A 1 53  ? 10.515  -1.039  6.990   1.00 0.00 ? 53  SER A CB   2  
ATOM 3089  O OG   . SER A 1 53  ? 10.041  -1.184  5.658   1.00 0.00 ? 53  SER A OG   2  
ATOM 3090  H H    . SER A 1 53  ? 9.687   -3.297  7.474   1.00 0.00 ? 53  SER A H    2  
ATOM 3091  H HA   . SER A 1 53  ? 12.095  -2.408  6.609   1.00 0.00 ? 53  SER A HA   2  
ATOM 3092  H HB2  . SER A 1 53  ? 9.738   -1.127  7.777   1.00 0.00 ? 53  SER A HB2  2  
ATOM 3093  H HB3  . SER A 1 53  ? 10.929  -0.004  6.997   1.00 0.00 ? 53  SER A HB3  2  
ATOM 3094  H HG   . SER A 1 53  ? 9.651   -2.082  5.539   1.00 0.00 ? 53  SER A HG   2  
ATOM 3095  N N    . LEU A 1 54  ? 11.639  -1.415  9.717   1.00 0.00 ? 54  LEU A N    2  
ATOM 3096  C CA   . LEU A 1 54  ? 11.941  -0.636  10.904  1.00 0.00 ? 54  LEU A CA   2  
ATOM 3097  C C    . LEU A 1 54  ? 13.279  -1.043  11.537  1.00 0.00 ? 54  LEU A C    2  
ATOM 3098  O O    . LEU A 1 54  ? 13.982  -0.208  12.100  1.00 0.00 ? 54  LEU A O    2  
ATOM 3099  C CB   . LEU A 1 54  ? 10.766  -0.746  11.979  1.00 0.00 ? 54  LEU A CB   2  
ATOM 3100  C CG   . LEU A 1 54  ? 9.833   -2.012  12.037  1.00 0.00 ? 54  LEU A CG   2  
ATOM 3101  C CD1  . LEU A 1 54  ? 8.502   -1.787  11.301  1.00 0.00 ? 54  LEU A CD1  2  
ATOM 3102  C CD2  . LEU A 1 54  ? 10.517  -3.362  11.856  1.00 0.00 ? 54  LEU A CD2  2  
ATOM 3103  H H    . LEU A 1 54  ? 10.763  -1.852  9.778   1.00 0.00 ? 54  LEU A H    2  
ATOM 3104  H HA   . LEU A 1 54  ? 11.983  0.410   10.602  1.00 0.00 ? 54  LEU A HA   2  
ATOM 3105  H HB2  . LEU A 1 54  ? 11.219  -0.659  13.021  1.00 0.00 ? 54  LEU A HB2  2  
ATOM 3106  H HB3  . LEU A 1 54  ? 10.067  0.114   11.698  1.00 0.00 ? 54  LEU A HB3  2  
ATOM 3107  H HG   . LEU A 1 54  ? 9.440   -2.233  13.074  1.00 0.00 ? 54  LEU A HG   2  
ATOM 3108  H HD11 . LEU A 1 54  ? 8.034   -0.836  11.628  1.00 0.00 ? 54  LEU A HD11 2  
ATOM 3109  H HD12 . LEU A 1 54  ? 8.547   -1.789  10.201  1.00 0.00 ? 54  LEU A HD12 2  
ATOM 3110  H HD13 . LEU A 1 54  ? 7.790   -2.587  11.575  1.00 0.00 ? 54  LEU A HD13 2  
ATOM 3111  H HD21 . LEU A 1 54  ? 11.397  -3.439  12.523  1.00 0.00 ? 54  LEU A HD21 2  
ATOM 3112  H HD22 . LEU A 1 54  ? 9.797   -4.152  12.161  1.00 0.00 ? 54  LEU A HD22 2  
ATOM 3113  H HD23 . LEU A 1 54  ? 10.808  -3.617  10.834  1.00 0.00 ? 54  LEU A HD23 2  
ATOM 3114  N N    . ILE A 1 55  ? 13.664  -2.343  11.412  1.00 0.00 ? 55  ILE A N    2  
ATOM 3115  C CA   . ILE A 1 55  ? 14.943  -2.909  11.845  1.00 0.00 ? 55  ILE A CA   2  
ATOM 3116  C C    . ILE A 1 55  ? 15.217  -4.016  10.827  1.00 0.00 ? 55  ILE A C    2  
ATOM 3117  O O    . ILE A 1 55  ? 14.293  -4.682  10.388  1.00 0.00 ? 55  ILE A O    2  
ATOM 3118  C CB   . ILE A 1 55  ? 15.083  -3.522  13.275  1.00 0.00 ? 55  ILE A CB   2  
ATOM 3119  C CG1  . ILE A 1 55  ? 13.932  -3.439  14.304  1.00 0.00 ? 55  ILE A CG1  2  
ATOM 3120  C CG2  . ILE A 1 55  ? 16.409  -3.119  13.950  1.00 0.00 ? 55  ILE A CG2  2  
ATOM 3121  C CD1  . ILE A 1 55  ? 13.376  -2.090  14.635  1.00 0.00 ? 55  ILE A CD1  2  
ATOM 3122  H H    . ILE A 1 55  ? 13.051  -2.946  10.888  1.00 0.00 ? 55  ILE A H    2  
ATOM 3123  H HA   . ILE A 1 55  ? 15.713  -2.159  11.717  1.00 0.00 ? 55  ILE A HA   2  
ATOM 3124  H HB   . ILE A 1 55  ? 15.193  -4.614  13.156  1.00 0.00 ? 55  ILE A HB   2  
ATOM 3125  H HG12 . ILE A 1 55  ? 13.089  -4.092  13.973  1.00 0.00 ? 55  ILE A HG12 2  
ATOM 3126  H HG13 . ILE A 1 55  ? 14.323  -3.791  15.294  1.00 0.00 ? 55  ILE A HG13 2  
ATOM 3127  H HG21 . ILE A 1 55  ? 17.267  -3.271  13.267  1.00 0.00 ? 55  ILE A HG21 2  
ATOM 3128  H HG22 . ILE A 1 55  ? 16.375  -2.062  14.286  1.00 0.00 ? 55  ILE A HG22 2  
ATOM 3129  H HG23 . ILE A 1 55  ? 16.522  -3.786  14.841  1.00 0.00 ? 55  ILE A HG23 2  
ATOM 3130  H HD11 . ILE A 1 55  ? 14.127  -1.289  14.495  1.00 0.00 ? 55  ILE A HD11 2  
ATOM 3131  H HD12 . ILE A 1 55  ? 12.509  -1.927  13.972  1.00 0.00 ? 55  ILE A HD12 2  
ATOM 3132  H HD13 . ILE A 1 55  ? 13.024  -2.097  15.685  1.00 0.00 ? 55  ILE A HD13 2  
ATOM 3133  N N    . GLN A 1 56  ? 16.501  -4.271  10.487  1.00 0.00 ? 56  GLN A N    2  
ATOM 3134  C CA   . GLN A 1 56  ? 16.956  -5.306  9.557   1.00 0.00 ? 56  GLN A CA   2  
ATOM 3135  C C    . GLN A 1 56  ? 17.304  -6.722  10.097  1.00 0.00 ? 56  GLN A C    2  
ATOM 3136  O O    . GLN A 1 56  ? 16.946  -7.657  9.385   1.00 0.00 ? 56  GLN A O    2  
ATOM 3137  C CB   . GLN A 1 56  ? 18.154  -4.803  8.689   1.00 0.00 ? 56  GLN A CB   2  
ATOM 3138  C CG   . GLN A 1 56  ? 17.874  -3.545  7.826   1.00 0.00 ? 56  GLN A CG   2  
ATOM 3139  C CD   . GLN A 1 56  ? 17.964  -2.234  8.615   1.00 0.00 ? 56  GLN A CD   2  
ATOM 3140  O OE1  . GLN A 1 56  ? 19.038  -1.810  9.038   1.00 0.00 ? 56  GLN A OE1  2  
ATOM 3141  N NE2  . GLN A 1 56  ? 16.802  -1.571  8.842   1.00 0.00 ? 56  GLN A NE2  2  
ATOM 3142  H H    . GLN A 1 56  ? 17.225  -3.719  10.886  1.00 0.00 ? 56  GLN A H    2  
ATOM 3143  H HA   . GLN A 1 56  ? 16.159  -5.484  8.843   1.00 0.00 ? 56  GLN A HA   2  
ATOM 3144  H HB2  . GLN A 1 56  ? 19.024  -4.551  9.379   1.00 0.00 ? 56  GLN A HB2  2  
ATOM 3145  H HB3  . GLN A 1 56  ? 18.372  -5.613  7.909   1.00 0.00 ? 56  GLN A HB3  2  
ATOM 3146  H HG2  . GLN A 1 56  ? 18.662  -3.486  7.042   1.00 0.00 ? 56  GLN A HG2  2  
ATOM 3147  H HG3  . GLN A 1 56  ? 16.894  -3.635  7.318   1.00 0.00 ? 56  GLN A HG3  2  
ATOM 3148  H HE21 . GLN A 1 56  ? 15.924  -2.006  8.650   1.00 0.00 ? 56  GLN A HE21 2  
ATOM 3149  H HE22 . GLN A 1 56  ? 16.865  -0.694  9.308   1.00 0.00 ? 56  GLN A HE22 2  
ATOM 3150  N N    . PRO A 1 57  ? 17.992  -6.993  11.242  1.00 0.00 ? 57  PRO A N    2  
ATOM 3151  C CA   . PRO A 1 57  ? 18.574  -8.314  11.560  1.00 0.00 ? 57  PRO A CA   2  
ATOM 3152  C C    . PRO A 1 57  ? 17.625  -9.260  12.321  1.00 0.00 ? 57  PRO A C    2  
ATOM 3153  O O    . PRO A 1 57  ? 16.608  -9.681  11.789  1.00 0.00 ? 57  PRO A O    2  
ATOM 3154  C CB   . PRO A 1 57  ? 19.777  -7.887  12.434  1.00 0.00 ? 57  PRO A CB   2  
ATOM 3155  C CG   . PRO A 1 57  ? 19.210  -6.723  13.255  1.00 0.00 ? 57  PRO A CG   2  
ATOM 3156  C CD   . PRO A 1 57  ? 18.467  -5.953  12.159  1.00 0.00 ? 57  PRO A CD   2  
ATOM 3157  H HA   . PRO A 1 57  ? 18.899  -8.831  10.666  1.00 0.00 ? 57  PRO A HA   2  
ATOM 3158  H HB2  . PRO A 1 57  ? 20.255  -8.688  13.028  1.00 0.00 ? 57  PRO A HB2  2  
ATOM 3159  H HB3  . PRO A 1 57  ? 20.568  -7.482  11.760  1.00 0.00 ? 57  PRO A HB3  2  
ATOM 3160  H HG2  . PRO A 1 57  ? 18.484  -7.128  14.005  1.00 0.00 ? 57  PRO A HG2  2  
ATOM 3161  H HG3  . PRO A 1 57  ? 19.995  -6.138  13.771  1.00 0.00 ? 57  PRO A HG3  2  
ATOM 3162  H HD2  . PRO A 1 57  ? 17.584  -5.377  12.569  1.00 0.00 ? 57  PRO A HD2  2  
ATOM 3163  H HD3  . PRO A 1 57  ? 19.218  -5.311  11.611  1.00 0.00 ? 57  PRO A HD3  2  
ATOM 3164  N N    . HIS A 1 58  ? 17.983  -9.612  13.586  1.00 0.00 ? 58  HIS A N    2  
ATOM 3165  C CA   . HIS A 1 58  ? 17.279  -10.443 14.556  1.00 0.00 ? 58  HIS A CA   2  
ATOM 3166  C C    . HIS A 1 58  ? 16.106  -9.729  15.236  1.00 0.00 ? 58  HIS A C    2  
ATOM 3167  O O    . HIS A 1 58  ? 15.074  -10.332 15.508  1.00 0.00 ? 58  HIS A O    2  
ATOM 3168  C CB   . HIS A 1 58  ? 18.297  -10.965 15.615  1.00 0.00 ? 58  HIS A CB   2  
ATOM 3169  C CG   . HIS A 1 58  ? 17.702  -11.768 16.740  1.00 0.00 ? 58  HIS A CG   2  
ATOM 3170  N ND1  . HIS A 1 58  ? 17.409  -13.114 16.712  1.00 0.00 ? 58  HIS A ND1  2  
ATOM 3171  C CD2  . HIS A 1 58  ? 17.218  -11.306 17.922  1.00 0.00 ? 58  HIS A CD2  2  
ATOM 3172  C CE1  . HIS A 1 58  ? 16.768  -13.397 17.875  1.00 0.00 ? 58  HIS A CE1  2  
ATOM 3173  N NE2  . HIS A 1 58  ? 16.629  -12.328 18.634  1.00 0.00 ? 58  HIS A NE2  2  
ATOM 3174  H H    . HIS A 1 58  ? 18.845  -9.244  13.919  1.00 0.00 ? 58  HIS A H    2  
ATOM 3175  H HA   . HIS A 1 58  ? 16.861  -11.305 14.057  1.00 0.00 ? 58  HIS A HA   2  
ATOM 3176  H HB2  . HIS A 1 58  ? 19.059  -11.592 15.100  1.00 0.00 ? 58  HIS A HB2  2  
ATOM 3177  H HB3  . HIS A 1 58  ? 18.829  -10.101 16.072  1.00 0.00 ? 58  HIS A HB3  2  
ATOM 3178  H HD1  . HIS A 1 58  ? 17.624  -13.759 15.978  1.00 0.00 ? 58  HIS A HD1  2  
ATOM 3179  H HD2  . HIS A 1 58  ? 17.210  -10.294 18.301  1.00 0.00 ? 58  HIS A HD2  2  
ATOM 3180  H HE1  . HIS A 1 58  ? 16.409  -14.393 18.135  1.00 0.00 ? 58  HIS A HE1  2  
ATOM 3181  N N    . ASP A 1 59  ? 16.237  -8.411  15.546  1.00 0.00 ? 59  ASP A N    2  
ATOM 3182  C CA   . ASP A 1 59  ? 15.272  -7.583  16.247  1.00 0.00 ? 59  ASP A CA   2  
ATOM 3183  C C    . ASP A 1 59  ? 14.241  -6.946  15.343  1.00 0.00 ? 59  ASP A C    2  
ATOM 3184  O O    . ASP A 1 59  ? 13.434  -6.168  15.819  1.00 0.00 ? 59  ASP A O    2  
ATOM 3185  C CB   . ASP A 1 59  ? 15.989  -6.459  17.052  1.00 0.00 ? 59  ASP A CB   2  
ATOM 3186  C CG   . ASP A 1 59  ? 16.902  -7.086  18.109  1.00 0.00 ? 59  ASP A CG   2  
ATOM 3187  O OD1  . ASP A 1 59  ? 16.366  -7.760  19.028  1.00 0.00 ? 59  ASP A OD1  2  
ATOM 3188  O OD2  . ASP A 1 59  ? 18.144  -6.894  18.013  1.00 0.00 ? 59  ASP A OD2  2  
ATOM 3189  H H    . ASP A 1 59  ? 17.059  -7.901  15.344  1.00 0.00 ? 59  ASP A H    2  
ATOM 3190  H HA   . ASP A 1 59  ? 14.711  -8.185  16.955  1.00 0.00 ? 59  ASP A HA   2  
ATOM 3191  H HB2  . ASP A 1 59  ? 16.609  -5.837  16.361  1.00 0.00 ? 59  ASP A HB2  2  
ATOM 3192  H HB3  . ASP A 1 59  ? 15.254  -5.815  17.590  1.00 0.00 ? 59  ASP A HB3  2  
ATOM 3193  N N    . ARG A 1 60  ? 14.182  -7.258  14.016  1.00 0.00 ? 60  ARG A N    2  
ATOM 3194  C CA   . ARG A 1 60  ? 13.236  -6.776  12.987  1.00 0.00 ? 60  ARG A CA   2  
ATOM 3195  C C    . ARG A 1 60  ? 11.768  -6.773  13.349  1.00 0.00 ? 60  ARG A C    2  
ATOM 3196  O O    . ARG A 1 60  ? 11.070  -5.784  13.200  1.00 0.00 ? 60  ARG A O    2  
ATOM 3197  C CB   . ARG A 1 60  ? 13.479  -7.503  11.629  1.00 0.00 ? 60  ARG A CB   2  
ATOM 3198  C CG   . ARG A 1 60  ? 12.981  -8.951  11.430  1.00 0.00 ? 60  ARG A CG   2  
ATOM 3199  C CD   . ARG A 1 60  ? 13.403  -9.915  12.543  1.00 0.00 ? 60  ARG A CD   2  
ATOM 3200  N NE   . ARG A 1 60  ? 13.049  -11.325 12.157  1.00 0.00 ? 60  ARG A NE   2  
ATOM 3201  C CZ   . ARG A 1 60  ? 12.670  -12.290 13.055  1.00 0.00 ? 60  ARG A CZ   2  
ATOM 3202  N NH1  . ARG A 1 60  ? 12.576  -12.017 14.388  1.00 0.00 ? 60  ARG A NH1  2  
ATOM 3203  N NH2  . ARG A 1 60  ? 12.376  -13.544 12.603  1.00 0.00 ? 60  ARG A NH2  2  
ATOM 3204  H H    . ARG A 1 60  ? 14.871  -7.893  13.680  1.00 0.00 ? 60  ARG A H    2  
ATOM 3205  H HA   . ARG A 1 60  ? 13.406  -5.719  12.841  1.00 0.00 ? 60  ARG A HA   2  
ATOM 3206  H HB2  . ARG A 1 60  ? 13.057  -6.882  10.811  1.00 0.00 ? 60  ARG A HB2  2  
ATOM 3207  H HB3  . ARG A 1 60  ? 14.579  -7.558  11.490  1.00 0.00 ? 60  ARG A HB3  2  
ATOM 3208  H HG2  . ARG A 1 60  ? 11.873  -8.954  11.332  1.00 0.00 ? 60  ARG A HG2  2  
ATOM 3209  H HG3  . ARG A 1 60  ? 13.402  -9.306  10.461  1.00 0.00 ? 60  ARG A HG3  2  
ATOM 3210  H HD2  . ARG A 1 60  ? 14.482  -9.837  12.768  1.00 0.00 ? 60  ARG A HD2  2  
ATOM 3211  H HD3  . ARG A 1 60  ? 12.883  -9.605  13.461  1.00 0.00 ? 60  ARG A HD3  2  
ATOM 3212  H HE   . ARG A 1 60  ? 13.097  -11.572 11.190  1.00 0.00 ? 60  ARG A HE   2  
ATOM 3213  H HH11 . ARG A 1 60  ? 12.788  -11.100 14.727  1.00 0.00 ? 60  ARG A HH11 2  
ATOM 3214  H HH12 . ARG A 1 60  ? 12.292  -12.734 15.025  1.00 0.00 ? 60  ARG A HH12 2  
ATOM 3215  H HH21 . ARG A 1 60  ? 12.440  -13.753 11.627  1.00 0.00 ? 60  ARG A HH21 2  
ATOM 3216  H HH22 . ARG A 1 60  ? 12.096  -14.254 13.250  1.00 0.00 ? 60  ARG A HH22 2  
ATOM 3217  N N    . LYS A 1 61  ? 11.256  -7.856  13.954  1.00 0.00 ? 61  LYS A N    2  
ATOM 3218  C CA   . LYS A 1 61  ? 9.910   -7.980  14.474  1.00 0.00 ? 61  LYS A CA   2  
ATOM 3219  C C    . LYS A 1 61  ? 9.592   -7.147  15.712  1.00 0.00 ? 61  LYS A C    2  
ATOM 3220  O O    . LYS A 1 61  ? 8.439   -6.786  15.956  1.00 0.00 ? 61  LYS A O    2  
ATOM 3221  C CB   . LYS A 1 61  ? 9.423   -9.432  14.363  1.00 0.00 ? 61  LYS A CB   2  
ATOM 3222  C CG   . LYS A 1 61  ? 8.253   -9.930  15.244  1.00 0.00 ? 61  LYS A CG   2  
ATOM 3223  C CD   . LYS A 1 61  ? 8.525   -10.051 16.755  1.00 0.00 ? 61  LYS A CD   2  
ATOM 3224  C CE   . LYS A 1 61  ? 7.526   -10.953 17.492  1.00 0.00 ? 61  LYS A CE   2  
ATOM 3225  N NZ   . LYS A 1 61  ? 6.144   -10.428 17.377  1.00 0.00 ? 61  LYS A NZ   2  
ATOM 3226  H H    . LYS A 1 61  ? 11.858  -8.640  14.082  1.00 0.00 ? 61  LYS A H    2  
ATOM 3227  H HA   . LYS A 1 61  ? 9.282   -7.517  13.745  1.00 0.00 ? 61  LYS A HA   2  
ATOM 3228  H HB2  . LYS A 1 61  ? 9.059   -9.443  13.297  1.00 0.00 ? 61  LYS A HB2  2  
ATOM 3229  H HB3  . LYS A 1 61  ? 10.308  -10.106 14.432  1.00 0.00 ? 61  LYS A HB3  2  
ATOM 3230  H HG2  . LYS A 1 61  ? 7.363   -9.276  15.114  1.00 0.00 ? 61  LYS A HG2  2  
ATOM 3231  H HG3  . LYS A 1 61  ? 7.981   -10.946 14.872  1.00 0.00 ? 61  LYS A HG3  2  
ATOM 3232  H HD2  . LYS A 1 61  ? 9.551   -10.451 16.903  1.00 0.00 ? 61  LYS A HD2  2  
ATOM 3233  H HD3  . LYS A 1 61  ? 8.484   -9.032  17.202  1.00 0.00 ? 61  LYS A HD3  2  
ATOM 3234  H HE2  . LYS A 1 61  ? 7.536   -11.976 17.062  1.00 0.00 ? 61  LYS A HE2  2  
ATOM 3235  H HE3  . LYS A 1 61  ? 7.778   -11.004 18.571  1.00 0.00 ? 61  LYS A HE3  2  
ATOM 3236  H HZ1  . LYS A 1 61  ? 6.104   -9.472  17.786  1.00 0.00 ? 61  LYS A HZ1  2  
ATOM 3237  H HZ2  . LYS A 1 61  ? 5.871   -10.388 16.375  1.00 0.00 ? 61  LYS A HZ2  2  
ATOM 3238  H HZ3  . LYS A 1 61  ? 5.492   -11.055 17.891  1.00 0.00 ? 61  LYS A HZ3  2  
ATOM 3239  N N    . LYS A 1 62  ? 10.637  -6.816  16.516  1.00 0.00 ? 62  LYS A N    2  
ATOM 3240  C CA   . LYS A 1 62  ? 10.601  -6.060  17.761  1.00 0.00 ? 62  LYS A CA   2  
ATOM 3241  C C    . LYS A 1 62  ? 10.069  -4.629  17.695  1.00 0.00 ? 62  LYS A C    2  
ATOM 3242  O O    . LYS A 1 62  ? 9.463   -4.160  18.656  1.00 0.00 ? 62  LYS A O    2  
ATOM 3243  C CB   . LYS A 1 62  ? 11.981  -6.162  18.490  1.00 0.00 ? 62  LYS A CB   2  
ATOM 3244  C CG   . LYS A 1 62  ? 11.950  -5.753  19.973  1.00 0.00 ? 62  LYS A CG   2  
ATOM 3245  C CD   . LYS A 1 62  ? 13.322  -5.818  20.667  1.00 0.00 ? 62  LYS A CD   2  
ATOM 3246  C CE   . LYS A 1 62  ? 14.247  -4.659  20.272  1.00 0.00 ? 62  LYS A CE   2  
ATOM 3247  N NZ   . LYS A 1 62  ? 15.567  -4.787  20.930  1.00 0.00 ? 62  LYS A NZ   2  
ATOM 3248  H H    . LYS A 1 62  ? 11.558  -7.090  16.233  1.00 0.00 ? 62  LYS A H    2  
ATOM 3249  H HA   . LYS A 1 62  ? 9.815   -6.554  18.323  1.00 0.00 ? 62  LYS A HA   2  
ATOM 3250  H HB2  . LYS A 1 62  ? 12.294  -7.231  18.458  1.00 0.00 ? 62  LYS A HB2  2  
ATOM 3251  H HB3  . LYS A 1 62  ? 12.774  -5.595  17.933  1.00 0.00 ? 62  LYS A HB3  2  
ATOM 3252  H HG2  . LYS A 1 62  ? 11.541  -4.724  20.077  1.00 0.00 ? 62  LYS A HG2  2  
ATOM 3253  H HG3  . LYS A 1 62  ? 11.255  -6.453  20.488  1.00 0.00 ? 62  LYS A HG3  2  
ATOM 3254  H HD2  . LYS A 1 62  ? 13.167  -5.779  21.770  1.00 0.00 ? 62  LYS A HD2  2  
ATOM 3255  H HD3  . LYS A 1 62  ? 13.801  -6.792  20.425  1.00 0.00 ? 62  LYS A HD3  2  
ATOM 3256  H HE2  . LYS A 1 62  ? 14.418  -4.637  19.177  1.00 0.00 ? 62  LYS A HE2  2  
ATOM 3257  H HE3  . LYS A 1 62  ? 13.805  -3.689  20.587  1.00 0.00 ? 62  LYS A HE3  2  
ATOM 3258  H HZ1  . LYS A 1 62  ? 15.439  -4.797  21.963  1.00 0.00 ? 62  LYS A HZ1  2  
ATOM 3259  H HZ2  . LYS A 1 62  ? 16.020  -5.672  20.627  1.00 0.00 ? 62  LYS A HZ2  2  
ATOM 3260  H HZ3  . LYS A 1 62  ? 16.168  -3.981  20.662  1.00 0.00 ? 62  LYS A HZ3  2  
ATOM 3261  N N    . MET A 1 63  ? 10.174  -3.926  16.527  1.00 0.00 ? 63  MET A N    2  
ATOM 3262  C CA   . MET A 1 63  ? 9.400   -2.716  16.328  1.00 0.00 ? 63  MET A CA   2  
ATOM 3263  C C    . MET A 1 63  ? 8.345   -2.998  15.276  1.00 0.00 ? 63  MET A C    2  
ATOM 3264  O O    . MET A 1 63  ? 7.522   -2.125  15.039  1.00 0.00 ? 63  MET A O    2  
ATOM 3265  C CB   . MET A 1 63  ? 10.168  -1.390  16.121  1.00 0.00 ? 63  MET A CB   2  
ATOM 3266  C CG   . MET A 1 63  ? 10.844  -0.891  17.415  1.00 0.00 ? 63  MET A CG   2  
ATOM 3267  S SD   . MET A 1 63  ? 11.305  0.875   17.367  1.00 0.00 ? 63  MET A SD   2  
ATOM 3268  C CE   . MET A 1 63  ? 12.430  0.784   15.947  1.00 0.00 ? 63  MET A CE   2  
ATOM 3269  H H    . MET A 1 63  ? 10.649  -4.243  15.703  1.00 0.00 ? 63  MET A H    2  
ATOM 3270  H HA   . MET A 1 63  ? 8.810   -2.477  17.200  1.00 0.00 ? 63  MET A HA   2  
ATOM 3271  H HB2  . MET A 1 63  ? 10.913  -1.522  15.318  1.00 0.00 ? 63  MET A HB2  2  
ATOM 3272  H HB3  . MET A 1 63  ? 9.462   -0.570  15.822  1.00 0.00 ? 63  MET A HB3  2  
ATOM 3273  H HG2  . MET A 1 63  ? 10.074  -1.007  18.238  1.00 0.00 ? 63  MET A HG2  2  
ATOM 3274  H HG3  . MET A 1 63  ? 11.764  -1.523  17.599  1.00 0.00 ? 63  MET A HG3  2  
ATOM 3275  H HE1  . MET A 1 63  ? 13.185  -0.023  16.102  1.00 0.00 ? 63  MET A HE1  2  
ATOM 3276  H HE2  . MET A 1 63  ? 11.873  0.563   15.010  1.00 0.00 ? 63  MET A HE2  2  
ATOM 3277  H HE3  . MET A 1 63  ? 12.974  1.741   15.799  1.00 0.00 ? 63  MET A HE3  2  
ATOM 3278  N N    . LYS A 1 64  ? 8.248   -4.238  14.652  1.00 0.00 ? 64  LYS A N    2  
ATOM 3279  C CA   . LYS A 1 64  ? 7.185   -4.633  13.725  1.00 0.00 ? 64  LYS A CA   2  
ATOM 3280  C C    . LYS A 1 64  ? 5.828   -4.724  14.432  1.00 0.00 ? 64  LYS A C    2  
ATOM 3281  O O    . LYS A 1 64  ? 4.804   -4.168  14.044  1.00 0.00 ? 64  LYS A O    2  
ATOM 3282  C CB   . LYS A 1 64  ? 7.330   -5.965  12.858  1.00 0.00 ? 64  LYS A CB   2  
ATOM 3283  C CG   . LYS A 1 64  ? 6.487   -7.243  13.086  1.00 0.00 ? 64  LYS A CG   2  
ATOM 3284  C CD   . LYS A 1 64  ? 6.646   -8.235  11.920  1.00 0.00 ? 64  LYS A CD   2  
ATOM 3285  C CE   . LYS A 1 64  ? 5.559   -9.319  11.874  1.00 0.00 ? 64  LYS A CE   2  
ATOM 3286  N NZ   . LYS A 1 64  ? 5.559   -10.147 13.101  1.00 0.00 ? 64  LYS A NZ   2  
ATOM 3287  H H    . LYS A 1 64  ? 8.869   -5.002  14.783  1.00 0.00 ? 64  LYS A H    2  
ATOM 3288  H HA   . LYS A 1 64  ? 7.110   -3.780  13.061  1.00 0.00 ? 64  LYS A HA   2  
ATOM 3289  H HB2  . LYS A 1 64  ? 6.610   -5.427  12.236  1.00 0.00 ? 64  LYS A HB2  2  
ATOM 3290  H HB3  . LYS A 1 64  ? 8.236   -6.294  12.196  1.00 0.00 ? 64  LYS A HB3  2  
ATOM 3291  H HG2  . LYS A 1 64  ? 6.765   -7.712  14.049  1.00 0.00 ? 64  LYS A HG2  2  
ATOM 3292  H HG3  . LYS A 1 64  ? 5.401   -6.997  13.120  1.00 0.00 ? 64  LYS A HG3  2  
ATOM 3293  H HD2  . LYS A 1 64  ? 6.587   -7.668  10.964  1.00 0.00 ? 64  LYS A HD2  2  
ATOM 3294  H HD3  . LYS A 1 64  ? 7.654   -8.697  11.955  1.00 0.00 ? 64  LYS A HD3  2  
ATOM 3295  H HE2  . LYS A 1 64  ? 4.555   -8.855  11.782  1.00 0.00 ? 64  LYS A HE2  2  
ATOM 3296  H HE3  . LYS A 1 64  ? 5.728   -9.997  11.010  1.00 0.00 ? 64  LYS A HE3  2  
ATOM 3297  H HZ1  . LYS A 1 64  ? 5.386   -9.540  13.927  1.00 0.00 ? 64  LYS A HZ1  2  
ATOM 3298  H HZ2  . LYS A 1 64  ? 4.809   -10.865 13.036  1.00 0.00 ? 64  LYS A HZ2  2  
ATOM 3299  H HZ3  . LYS A 1 64  ? 6.481   -10.616 13.203  1.00 0.00 ? 64  LYS A HZ3  2  
ATOM 3300  N N    . LYS A 1 65  ? 5.914   -5.429  15.561  1.00 0.00 ? 65  LYS A N    2  
ATOM 3301  C CA   . LYS A 1 65  ? 4.893   -5.632  16.605  1.00 0.00 ? 65  LYS A CA   2  
ATOM 3302  C C    . LYS A 1 65  ? 4.372   -4.316  17.226  1.00 0.00 ? 65  LYS A C    2  
ATOM 3303  O O    . LYS A 1 65  ? 3.198   -4.184  17.548  1.00 0.00 ? 65  LYS A O    2  
ATOM 3304  C CB   . LYS A 1 65  ? 5.309   -6.662  17.692  1.00 0.00 ? 65  LYS A CB   2  
ATOM 3305  C CG   . LYS A 1 65  ? 6.338   -6.189  18.735  1.00 0.00 ? 65  LYS A CG   2  
ATOM 3306  C CD   . LYS A 1 65  ? 6.861   -7.345  19.602  1.00 0.00 ? 65  LYS A CD   2  
ATOM 3307  C CE   . LYS A 1 65  ? 7.832   -6.885  20.696  1.00 0.00 ? 65  LYS A CE   2  
ATOM 3308  N NZ   . LYS A 1 65  ? 8.395   -8.044  21.427  1.00 0.00 ? 65  LYS A NZ   2  
ATOM 3309  H H    . LYS A 1 65  ? 6.824   -5.865  15.546  1.00 0.00 ? 65  LYS A H    2  
ATOM 3310  H HA   . LYS A 1 65  ? 4.047   -6.079  16.098  1.00 0.00 ? 65  LYS A HA   2  
ATOM 3311  H HB2  . LYS A 1 65  ? 4.398   -7.005  18.234  1.00 0.00 ? 65  LYS A HB2  2  
ATOM 3312  H HB3  . LYS A 1 65  ? 5.729   -7.549  17.166  1.00 0.00 ? 65  LYS A HB3  2  
ATOM 3313  H HG2  . LYS A 1 65  ? 7.198   -5.714  18.215  1.00 0.00 ? 65  LYS A HG2  2  
ATOM 3314  H HG3  . LYS A 1 65  ? 5.879   -5.424  19.402  1.00 0.00 ? 65  LYS A HG3  2  
ATOM 3315  H HD2  . LYS A 1 65  ? 5.997   -7.868  20.069  1.00 0.00 ? 65  LYS A HD2  2  
ATOM 3316  H HD3  . LYS A 1 65  ? 7.379   -8.067  18.931  1.00 0.00 ? 65  LYS A HD3  2  
ATOM 3317  H HE2  . LYS A 1 65  ? 8.681   -6.326  20.253  1.00 0.00 ? 65  LYS A HE2  2  
ATOM 3318  H HE3  . LYS A 1 65  ? 7.312   -6.238  21.433  1.00 0.00 ? 65  LYS A HE3  2  
ATOM 3319  H HZ1  . LYS A 1 65  ? 7.626   -8.584  21.870  1.00 0.00 ? 65  LYS A HZ1  2  
ATOM 3320  H HZ2  . LYS A 1 65  ? 8.909   -8.655  20.760  1.00 0.00 ? 65  LYS A HZ2  2  
ATOM 3321  H HZ3  . LYS A 1 65  ? 9.050   -7.706  22.161  1.00 0.00 ? 65  LYS A HZ3  2  
ATOM 3322  N N    . VAL A 1 66  ? 5.261   -3.273  17.284  1.00 0.00 ? 66  VAL A N    2  
ATOM 3323  C CA   . VAL A 1 66  ? 4.977   -1.855  17.601  1.00 0.00 ? 66  VAL A CA   2  
ATOM 3324  C C    . VAL A 1 66  ? 4.339   -1.141  16.407  1.00 0.00 ? 66  VAL A C    2  
ATOM 3325  O O    . VAL A 1 66  ? 3.413   -0.348  16.560  1.00 0.00 ? 66  VAL A O    2  
ATOM 3326  C CB   . VAL A 1 66  ? 6.181   -1.018  18.058  1.00 0.00 ? 66  VAL A CB   2  
ATOM 3327  C CG1  . VAL A 1 66  ? 5.716   0.403   18.495  1.00 0.00 ? 66  VAL A CG1  2  
ATOM 3328  C CG2  . VAL A 1 66  ? 6.899   -1.739  19.222  1.00 0.00 ? 66  VAL A CG2  2  
ATOM 3329  H H    . VAL A 1 66  ? 6.190   -3.482  16.997  1.00 0.00 ? 66  VAL A H    2  
ATOM 3330  H HA   . VAL A 1 66  ? 4.247   -1.835  18.399  1.00 0.00 ? 66  VAL A HA   2  
ATOM 3331  H HB   . VAL A 1 66  ? 6.928   -0.918  17.235  1.00 0.00 ? 66  VAL A HB   2  
ATOM 3332  H HG11 . VAL A 1 66  ? 4.964   0.317   19.309  1.00 0.00 ? 66  VAL A HG11 2  
ATOM 3333  H HG12 . VAL A 1 66  ? 6.579   0.981   18.885  1.00 0.00 ? 66  VAL A HG12 2  
ATOM 3334  H HG13 . VAL A 1 66  ? 5.243   1.007   17.683  1.00 0.00 ? 66  VAL A HG13 2  
ATOM 3335  H HG21 . VAL A 1 66  ? 6.204   -1.876  20.076  1.00 0.00 ? 66  VAL A HG21 2  
ATOM 3336  H HG22 . VAL A 1 66  ? 7.279   -2.734  18.910  1.00 0.00 ? 66  VAL A HG22 2  
ATOM 3337  H HG23 . VAL A 1 66  ? 7.773   -1.141  19.560  1.00 0.00 ? 66  VAL A HG23 2  
ATOM 3338  N N    . TRP A 1 67  ? 4.812   -1.422  15.160  1.00 0.00 ? 67  TRP A N    2  
ATOM 3339  C CA   . TRP A 1 67  ? 4.320   -0.903  13.881  1.00 0.00 ? 67  TRP A CA   2  
ATOM 3340  C C    . TRP A 1 67  ? 2.853   -1.258  13.613  1.00 0.00 ? 67  TRP A C    2  
ATOM 3341  O O    . TRP A 1 67  ? 2.113   -0.421  13.116  1.00 0.00 ? 67  TRP A O    2  
ATOM 3342  C CB   . TRP A 1 67  ? 5.294   -1.199  12.701  1.00 0.00 ? 67  TRP A CB   2  
ATOM 3343  C CG   . TRP A 1 67  ? 4.820   -0.827  11.302  1.00 0.00 ? 67  TRP A CG   2  
ATOM 3344  C CD1  . TRP A 1 67  ? 4.329   -1.703  10.388  1.00 0.00 ? 67  TRP A CD1  2  
ATOM 3345  C CD2  . TRP A 1 67  ? 4.505   0.483   10.806  1.00 0.00 ? 67  TRP A CD2  2  
ATOM 3346  N NE1  . TRP A 1 67  ? 3.764   -1.040  9.335   1.00 0.00 ? 67  TRP A NE1  2  
ATOM 3347  C CE2  . TRP A 1 67  ? 3.896   0.306   9.560   1.00 0.00 ? 67  TRP A CE2  2  
ATOM 3348  C CE3  . TRP A 1 67  ? 4.656   1.721   11.361  1.00 0.00 ? 67  TRP A CE3  2  
ATOM 3349  C CZ2  . TRP A 1 67  ? 3.427   1.363   8.843   1.00 0.00 ? 67  TRP A CZ2  2  
ATOM 3350  C CZ3  . TRP A 1 67  ? 4.068   2.771   10.689  1.00 0.00 ? 67  TRP A CZ3  2  
ATOM 3351  C CH2  . TRP A 1 67  ? 3.453   2.591   9.465   1.00 0.00 ? 67  TRP A CH2  2  
ATOM 3352  H H    . TRP A 1 67  ? 5.594   -2.046  15.055  1.00 0.00 ? 67  TRP A H    2  
ATOM 3353  H HA   . TRP A 1 67  ? 4.332   0.168   13.962  1.00 0.00 ? 67  TRP A HA   2  
ATOM 3354  H HB2  . TRP A 1 67  ? 6.242   -0.634  12.908  1.00 0.00 ? 67  TRP A HB2  2  
ATOM 3355  H HB3  . TRP A 1 67  ? 5.493   -2.300  12.680  1.00 0.00 ? 67  TRP A HB3  2  
ATOM 3356  H HD1  . TRP A 1 67  ? 4.290   -2.756  10.576  1.00 0.00 ? 67  TRP A HD1  2  
ATOM 3357  H HE1  . TRP A 1 67  ? 3.037   -1.392  8.783   1.00 0.00 ? 67  TRP A HE1  2  
ATOM 3358  H HE3  . TRP A 1 67  ? 5.119   1.875   12.324  1.00 0.00 ? 67  TRP A HE3  2  
ATOM 3359  H HZ2  . TRP A 1 67  ? 2.902   1.219   7.907   1.00 0.00 ? 67  TRP A HZ2  2  
ATOM 3360  H HZ3  . TRP A 1 67  ? 4.077   3.759   11.118  1.00 0.00 ? 67  TRP A HZ3  2  
ATOM 3361  H HH2  . TRP A 1 67  ? 2.978   3.428   8.991   1.00 0.00 ? 67  TRP A HH2  2  
ATOM 3362  N N    . ASP A 1 68  ? 2.369   -2.451  14.077  1.00 0.00 ? 68  ASP A N    2  
ATOM 3363  C CA   . ASP A 1 68  ? 0.951   -2.885  14.093  1.00 0.00 ? 68  ASP A CA   2  
ATOM 3364  C C    . ASP A 1 68  ? 0.005   -1.909  14.832  1.00 0.00 ? 68  ASP A C    2  
ATOM 3365  O O    . ASP A 1 68  ? -1.088  -1.600  14.370  1.00 0.00 ? 68  ASP A O    2  
ATOM 3366  C CB   . ASP A 1 68  ? 0.778   -4.298  14.730  1.00 0.00 ? 68  ASP A CB   2  
ATOM 3367  C CG   . ASP A 1 68  ? 1.598   -5.378  14.008  1.00 0.00 ? 68  ASP A CG   2  
ATOM 3368  O OD1  . ASP A 1 68  ? 2.098   -5.125  12.881  1.00 0.00 ? 68  ASP A OD1  2  
ATOM 3369  O OD2  . ASP A 1 68  ? 1.722   -6.490  14.589  1.00 0.00 ? 68  ASP A OD2  2  
ATOM 3370  H H    . ASP A 1 68  ? 3.026   -3.095  14.483  1.00 0.00 ? 68  ASP A H    2  
ATOM 3371  H HA   . ASP A 1 68  ? 0.607   -2.915  13.066  1.00 0.00 ? 68  ASP A HA   2  
ATOM 3372  H HB2  . ASP A 1 68  ? 1.104   -4.259  15.794  1.00 0.00 ? 68  ASP A HB2  2  
ATOM 3373  H HB3  . ASP A 1 68  ? -0.288  -4.616  14.703  1.00 0.00 ? 68  ASP A HB3  2  
ATOM 3374  N N    . ARG A 1 69  ? 0.498   -1.349  15.974  1.00 0.00 ? 69  ARG A N    2  
ATOM 3375  C CA   . ARG A 1 69  ? -0.036  -0.262  16.785  1.00 0.00 ? 69  ARG A CA   2  
ATOM 3376  C C    . ARG A 1 69  ? 0.210   1.119   16.150  1.00 0.00 ? 69  ARG A C    2  
ATOM 3377  O O    . ARG A 1 69  ? -0.728  1.884   15.941  1.00 0.00 ? 69  ARG A O    2  
ATOM 3378  C CB   . ARG A 1 69  ? 0.601   -0.370  18.202  1.00 0.00 ? 69  ARG A CB   2  
ATOM 3379  C CG   . ARG A 1 69  ? -0.126  0.315   19.385  1.00 0.00 ? 69  ARG A CG   2  
ATOM 3380  C CD   . ARG A 1 69  ? -0.113  1.860   19.441  1.00 0.00 ? 69  ARG A CD   2  
ATOM 3381  N NE   . ARG A 1 69  ? 1.281   2.394   19.215  1.00 0.00 ? 69  ARG A NE   2  
ATOM 3382  C CZ   . ARG A 1 69  ? 2.221   2.570   20.197  1.00 0.00 ? 69  ARG A CZ   2  
ATOM 3383  N NH1  . ARG A 1 69  ? 1.946   2.272   21.500  1.00 0.00 ? 69  ARG A NH1  2  
ATOM 3384  N NH2  . ARG A 1 69  ? 3.453   3.052   19.860  1.00 0.00 ? 69  ARG A NH2  2  
ATOM 3385  H H    . ARG A 1 69  ? 1.388   -1.662  16.292  1.00 0.00 ? 69  ARG A H    2  
ATOM 3386  H HA   . ARG A 1 69  ? -1.110  -0.383  16.857  1.00 0.00 ? 69  ARG A HA   2  
ATOM 3387  H HB2  . ARG A 1 69  ? 0.640   -1.465  18.419  1.00 0.00 ? 69  ARG A HB2  2  
ATOM 3388  H HB3  . ARG A 1 69  ? 1.663   -0.047  18.192  1.00 0.00 ? 69  ARG A HB3  2  
ATOM 3389  H HG2  . ARG A 1 69  ? -1.185  -0.028  19.404  1.00 0.00 ? 69  ARG A HG2  2  
ATOM 3390  H HG3  . ARG A 1 69  ? 0.359   -0.053  20.321  1.00 0.00 ? 69  ARG A HG3  2  
ATOM 3391  H HD2  . ARG A 1 69  ? -0.749  2.274   18.624  1.00 0.00 ? 69  ARG A HD2  2  
ATOM 3392  H HD3  . ARG A 1 69  ? -0.510  2.216   20.421  1.00 0.00 ? 69  ARG A HD3  2  
ATOM 3393  H HE   . ARG A 1 69  ? 1.538   2.628   18.278  1.00 0.00 ? 69  ARG A HE   2  
ATOM 3394  H HH11 . ARG A 1 69  ? 1.045   1.920   21.752  1.00 0.00 ? 69  ARG A HH11 2  
ATOM 3395  H HH12 . ARG A 1 69  ? 2.645   2.408   22.202  1.00 0.00 ? 69  ARG A HH12 2  
ATOM 3396  H HH21 . ARG A 1 69  ? 3.660   3.270   18.907  1.00 0.00 ? 69  ARG A HH21 2  
ATOM 3397  H HH22 . ARG A 1 69  ? 4.149   3.185   20.566  1.00 0.00 ? 69  ARG A HH22 2  
ATOM 3398  N N    . ALA A 1 70  ? 1.488   1.475   15.795  1.00 0.00 ? 70  ALA A N    2  
ATOM 3399  C CA   . ALA A 1 70  ? 1.948   2.736   15.180  1.00 0.00 ? 70  ALA A CA   2  
ATOM 3400  C C    . ALA A 1 70  ? 1.226   3.178   13.891  1.00 0.00 ? 70  ALA A C    2  
ATOM 3401  O O    . ALA A 1 70  ? 1.024   4.368   13.645  1.00 0.00 ? 70  ALA A O    2  
ATOM 3402  C CB   . ALA A 1 70  ? 3.459   2.747   14.950  1.00 0.00 ? 70  ALA A CB   2  
ATOM 3403  H H    . ALA A 1 70  ? 2.243   0.820   15.974  1.00 0.00 ? 70  ALA A H    2  
ATOM 3404  H HA   . ALA A 1 70  ? 1.804   3.495   15.941  1.00 0.00 ? 70  ALA A HA   2  
ATOM 3405  H HB1  . ALA A 1 70  ? 3.838   3.786   14.850  1.00 0.00 ? 70  ALA A HB1  2  
ATOM 3406  H HB2  . ALA A 1 70  ? 3.934   2.263   15.829  1.00 0.00 ? 70  ALA A HB2  2  
ATOM 3407  H HB3  . ALA A 1 70  ? 3.745   2.179   14.042  1.00 0.00 ? 70  ALA A HB3  2  
ATOM 3408  N N    . VAL A 1 71  ? 0.784   2.147   13.100  1.00 0.00 ? 71  VAL A N    2  
ATOM 3409  C CA   . VAL A 1 71  ? -0.092  2.110   11.923  1.00 0.00 ? 71  VAL A CA   2  
ATOM 3410  C C    . VAL A 1 71  ? -1.448  2.723   12.177  1.00 0.00 ? 71  VAL A C    2  
ATOM 3411  O O    . VAL A 1 71  ? -1.987  3.356   11.276  1.00 0.00 ? 71  VAL A O    2  
ATOM 3412  C CB   . VAL A 1 71  ? -0.234  0.685   11.378  1.00 0.00 ? 71  VAL A CB   2  
ATOM 3413  C CG1  . VAL A 1 71  ? -1.417  0.406   10.439  1.00 0.00 ? 71  VAL A CG1  2  
ATOM 3414  C CG2  . VAL A 1 71  ? 0.982   0.454   10.502  1.00 0.00 ? 71  VAL A CG2  2  
ATOM 3415  H H    . VAL A 1 71  ? 1.055   1.222   13.370  1.00 0.00 ? 71  VAL A H    2  
ATOM 3416  H HA   . VAL A 1 71  ? 0.362   2.727   11.161  1.00 0.00 ? 71  VAL A HA   2  
ATOM 3417  H HB   . VAL A 1 71  ? -0.256  -0.048  12.217  1.00 0.00 ? 71  VAL A HB   2  
ATOM 3418  H HG11 . VAL A 1 71  ? -1.444  1.180   9.644   1.00 0.00 ? 71  VAL A HG11 2  
ATOM 3419  H HG12 . VAL A 1 71  ? -1.237  -0.580  9.951   1.00 0.00 ? 71  VAL A HG12 2  
ATOM 3420  H HG13 . VAL A 1 71  ? -2.381  0.371   10.983  1.00 0.00 ? 71  VAL A HG13 2  
ATOM 3421  H HG21 . VAL A 1 71  ? 1.915   0.678   11.057  1.00 0.00 ? 71  VAL A HG21 2  
ATOM 3422  H HG22 . VAL A 1 71  ? 1.028   -0.601  10.157  1.00 0.00 ? 71  VAL A HG22 2  
ATOM 3423  H HG23 . VAL A 1 71  ? 0.932   1.106   9.605   1.00 0.00 ? 71  VAL A HG23 2  
ATOM 3424  N N    . ASP A 1 72  ? -2.004  2.617   13.436  1.00 0.00 ? 72  ASP A N    2  
ATOM 3425  C CA   . ASP A 1 72  ? -3.237  3.257   13.928  1.00 0.00 ? 72  ASP A CA   2  
ATOM 3426  C C    . ASP A 1 72  ? -3.167  4.788   13.818  1.00 0.00 ? 72  ASP A C    2  
ATOM 3427  O O    . ASP A 1 72  ? -4.156  5.432   13.501  1.00 0.00 ? 72  ASP A O    2  
ATOM 3428  C CB   . ASP A 1 72  ? -3.620  2.767   15.363  1.00 0.00 ? 72  ASP A CB   2  
ATOM 3429  C CG   . ASP A 1 72  ? -5.048  3.143   15.785  1.00 0.00 ? 72  ASP A CG   2  
ATOM 3430  O OD1  . ASP A 1 72  ? -6.004  2.709   15.090  1.00 0.00 ? 72  ASP A OD1  2  
ATOM 3431  O OD2  . ASP A 1 72  ? -5.193  3.867   16.807  1.00 0.00 ? 72  ASP A OD2  2  
ATOM 3432  H H    . ASP A 1 72  ? -1.518  2.099   14.152  1.00 0.00 ? 72  ASP A H    2  
ATOM 3433  H HA   . ASP A 1 72  ? -4.027  2.945   13.257  1.00 0.00 ? 72  ASP A HA   2  
ATOM 3434  H HB2  . ASP A 1 72  ? -3.555  1.655   15.369  1.00 0.00 ? 72  ASP A HB2  2  
ATOM 3435  H HB3  . ASP A 1 72  ? -2.890  3.139   16.112  1.00 0.00 ? 72  ASP A HB3  2  
ATOM 3436  N N    . PHE A 1 73  ? -1.943  5.380   13.960  1.00 0.00 ? 73  PHE A N    2  
ATOM 3437  C CA   . PHE A 1 73  ? -1.609  6.756   13.603  1.00 0.00 ? 73  PHE A CA   2  
ATOM 3438  C C    . PHE A 1 73  ? -1.429  7.006   12.081  1.00 0.00 ? 73  PHE A C    2  
ATOM 3439  O O    . PHE A 1 73  ? -2.173  7.835   11.557  1.00 0.00 ? 73  PHE A O    2  
ATOM 3440  C CB   . PHE A 1 73  ? -0.329  7.259   14.338  1.00 0.00 ? 73  PHE A CB   2  
ATOM 3441  C CG   . PHE A 1 73  ? -0.458  7.179   15.841  1.00 0.00 ? 73  PHE A CG   2  
ATOM 3442  C CD1  . PHE A 1 73  ? -0.971  8.251   16.544  1.00 0.00 ? 73  PHE A CD1  2  
ATOM 3443  C CD2  . PHE A 1 73  ? -0.026  6.075   16.558  1.00 0.00 ? 73  PHE A CD2  2  
ATOM 3444  C CE1  . PHE A 1 73  ? -1.062  8.229   17.920  1.00 0.00 ? 73  PHE A CE1  2  
ATOM 3445  C CE2  . PHE A 1 73  ? -0.119  6.042   17.937  1.00 0.00 ? 73  PHE A CE2  2  
ATOM 3446  C CZ   . PHE A 1 73  ? -0.635  7.121   18.624  1.00 0.00 ? 73  PHE A CZ   2  
ATOM 3447  H H    . PHE A 1 73  ? -1.180  4.827   14.287  1.00 0.00 ? 73  PHE A H    2  
ATOM 3448  H HA   . PHE A 1 73  ? -2.437  7.388   13.893  1.00 0.00 ? 73  PHE A HA   2  
ATOM 3449  H HB2  . PHE A 1 73  ? 0.563   6.677   14.037  1.00 0.00 ? 73  PHE A HB2  2  
ATOM 3450  H HB3  . PHE A 1 73  ? -0.121  8.322   14.086  1.00 0.00 ? 73  PHE A HB3  2  
ATOM 3451  H HD1  . PHE A 1 73  ? -1.277  9.140   16.012  1.00 0.00 ? 73  PHE A HD1  2  
ATOM 3452  H HD2  . PHE A 1 73  ? 0.391   5.227   16.041  1.00 0.00 ? 73  PHE A HD2  2  
ATOM 3453  H HE1  . PHE A 1 73  ? -1.473  9.084   18.442  1.00 0.00 ? 73  PHE A HE1  2  
ATOM 3454  H HE2  . PHE A 1 73  ? 0.211   5.169   18.486  1.00 0.00 ? 73  PHE A HE2  2  
ATOM 3455  H HZ   . PHE A 1 73  ? -0.703  7.102   19.704  1.00 0.00 ? 73  PHE A HZ   2  
ATOM 3456  N N    . LEU A 1 74  ? -0.490  6.317   11.303  1.00 0.00 ? 74  LEU A N    2  
ATOM 3457  C CA   . LEU A 1 74  ? -0.230  6.537   9.812   1.00 0.00 ? 74  LEU A CA   2  
ATOM 3458  C C    . LEU A 1 74  ? -1.442  6.520   8.895   1.00 0.00 ? 74  LEU A C    2  
ATOM 3459  O O    . LEU A 1 74  ? -1.667  7.378   8.038   1.00 0.00 ? 74  LEU A O    2  
ATOM 3460  C CB   . LEU A 1 74  ? 0.737   5.483   9.120   1.00 0.00 ? 74  LEU A CB   2  
ATOM 3461  C CG   . LEU A 1 74  ? 1.765   6.181   8.190   1.00 0.00 ? 74  LEU A CG   2  
ATOM 3462  C CD1  . LEU A 1 74  ? 3.083   6.452   8.923   1.00 0.00 ? 74  LEU A CD1  2  
ATOM 3463  C CD2  . LEU A 1 74  ? 1.982   5.449   6.845   1.00 0.00 ? 74  LEU A CD2  2  
ATOM 3464  H H    . LEU A 1 74  ? 0.103   5.664   11.809  1.00 0.00 ? 74  LEU A H    2  
ATOM 3465  H HA   . LEU A 1 74  ? 0.168   7.548   9.646   1.00 0.00 ? 74  LEU A HA   2  
ATOM 3466  H HB2  . LEU A 1 74  ? 1.253   4.879   9.911   1.00 0.00 ? 74  LEU A HB2  2  
ATOM 3467  H HB3  . LEU A 1 74  ? 0.217   4.737   8.441   1.00 0.00 ? 74  LEU A HB3  2  
ATOM 3468  H HG   . LEU A 1 74  ? 1.336   7.180   7.910   1.00 0.00 ? 74  LEU A HG   2  
ATOM 3469  H HD11 . LEU A 1 74  ? 2.887   7.027   9.852   1.00 0.00 ? 74  LEU A HD11 2  
ATOM 3470  H HD12 . LEU A 1 74  ? 3.599   5.508   9.193   1.00 0.00 ? 74  LEU A HD12 2  
ATOM 3471  H HD13 . LEU A 1 74  ? 3.758   7.053   8.280   1.00 0.00 ? 74  LEU A HD13 2  
ATOM 3472  H HD21 . LEU A 1 74  ? 1.008   5.340   6.322   1.00 0.00 ? 74  LEU A HD21 2  
ATOM 3473  H HD22 . LEU A 1 74  ? 2.658   6.049   6.198   1.00 0.00 ? 74  LEU A HD22 2  
ATOM 3474  H HD23 . LEU A 1 74  ? 2.421   4.442   6.971   1.00 0.00 ? 74  LEU A HD23 2  
ATOM 3475  N N    . ALA A 1 75  ? -2.233  5.443   9.084   1.00 0.00 ? 75  ALA A N    2  
ATOM 3476  C CA   . ALA A 1 75  ? -3.437  5.038   8.419   1.00 0.00 ? 75  ALA A CA   2  
ATOM 3477  C C    . ALA A 1 75  ? -4.640  5.984   8.571   1.00 0.00 ? 75  ALA A C    2  
ATOM 3478  O O    . ALA A 1 75  ? -5.604  5.859   7.825   1.00 0.00 ? 75  ALA A O    2  
ATOM 3479  C CB   . ALA A 1 75  ? -3.644  3.560   8.783   1.00 0.00 ? 75  ALA A CB   2  
ATOM 3480  H H    . ALA A 1 75  ? -1.986  4.752   9.770   1.00 0.00 ? 75  ALA A H    2  
ATOM 3481  H HA   . ALA A 1 75  ? -3.215  5.038   7.359   1.00 0.00 ? 75  ALA A HA   2  
ATOM 3482  H HB1  . ALA A 1 75  ? -4.353  3.059   8.093   1.00 0.00 ? 75  ALA A HB1  2  
ATOM 3483  H HB2  . ALA A 1 75  ? -2.638  3.061   8.720   1.00 0.00 ? 75  ALA A HB2  2  
ATOM 3484  H HB3  . ALA A 1 75  ? -4.001  3.452   9.828   1.00 0.00 ? 75  ALA A HB3  2  
ATOM 3485  N N    . ALA A 1 76  ? -4.587  7.001   9.494   1.00 0.00 ? 76  ALA A N    2  
ATOM 3486  C CA   . ALA A 1 76  ? -5.544  8.087   9.622   1.00 0.00 ? 76  ALA A CA   2  
ATOM 3487  C C    . ALA A 1 76  ? -5.285  9.223   8.606   1.00 0.00 ? 76  ALA A C    2  
ATOM 3488  O O    . ALA A 1 76  ? -6.077  10.151  8.472   1.00 0.00 ? 76  ALA A O    2  
ATOM 3489  C CB   . ALA A 1 76  ? -5.488  8.632   11.065  1.00 0.00 ? 76  ALA A CB   2  
ATOM 3490  H H    . ALA A 1 76  ? -3.810  7.147   10.113  1.00 0.00 ? 76  ALA A H    2  
ATOM 3491  H HA   . ALA A 1 76  ? -6.544  7.708   9.438   1.00 0.00 ? 76  ALA A HA   2  
ATOM 3492  H HB1  . ALA A 1 76  ? -4.502  9.098   11.290  1.00 0.00 ? 76  ALA A HB1  2  
ATOM 3493  H HB2  . ALA A 1 76  ? -5.644  7.798   11.783  1.00 0.00 ? 76  ALA A HB2  2  
ATOM 3494  H HB3  . ALA A 1 76  ? -6.281  9.386   11.232  1.00 0.00 ? 76  ALA A HB3  2  
ATOM 3495  N N    . ASN A 1 77  ? -4.162  9.147   7.843   1.00 0.00 ? 77  ASN A N    2  
ATOM 3496  C CA   . ASN A 1 77  ? -3.774  10.065  6.785   1.00 0.00 ? 77  ASN A CA   2  
ATOM 3497  C C    . ASN A 1 77  ? -3.643  9.259   5.486   1.00 0.00 ? 77  ASN A C    2  
ATOM 3498  O O    . ASN A 1 77  ? -4.558  8.566   5.054   1.00 0.00 ? 77  ASN A O    2  
ATOM 3499  C CB   . ASN A 1 77  ? -2.461  10.784  7.216   1.00 0.00 ? 77  ASN A CB   2  
ATOM 3500  C CG   . ASN A 1 77  ? -2.007  11.916  6.283   1.00 0.00 ? 77  ASN A CG   2  
ATOM 3501  O OD1  . ASN A 1 77  ? -2.812  12.713  5.801   1.00 0.00 ? 77  ASN A OD1  2  
ATOM 3502  N ND2  . ASN A 1 77  ? -0.679  11.970  6.004   1.00 0.00 ? 77  ASN A ND2  2  
ATOM 3503  H H    . ASN A 1 77  ? -3.525  8.379   7.968   1.00 0.00 ? 77  ASN A H    2  
ATOM 3504  H HA   . ASN A 1 77  ? -4.550  10.804  6.615   1.00 0.00 ? 77  ASN A HA   2  
ATOM 3505  H HB2  . ASN A 1 77  ? -2.674  11.254  8.199   1.00 0.00 ? 77  ASN A HB2  2  
ATOM 3506  H HB3  . ASN A 1 77  ? -1.651  10.043  7.371   1.00 0.00 ? 77  ASN A HB3  2  
ATOM 3507  H HD21 . ASN A 1 77  ? -0.057  11.302  6.441   1.00 0.00 ? 77  ASN A HD21 2  
ATOM 3508  H HD22 . ASN A 1 77  ? -0.364  12.721  5.426   1.00 0.00 ? 77  ASN A HD22 2  
ATOM 3509  N N    . GLU A 1 78  ? -2.473  9.322   4.811   1.00 0.00 ? 78  GLU A N    2  
ATOM 3510  C CA   . GLU A 1 78  ? -2.190  8.642   3.566   1.00 0.00 ? 78  GLU A CA   2  
ATOM 3511  C C    . GLU A 1 78  ? -0.947  7.807   3.771   1.00 0.00 ? 78  GLU A C    2  
ATOM 3512  O O    . GLU A 1 78  ? 0.084   8.308   4.218   1.00 0.00 ? 78  GLU A O    2  
ATOM 3513  C CB   . GLU A 1 78  ? -1.987  9.685   2.433   1.00 0.00 ? 78  GLU A CB   2  
ATOM 3514  C CG   . GLU A 1 78  ? -1.785  9.120   1.010   1.00 0.00 ? 78  GLU A CG   2  
ATOM 3515  C CD   . GLU A 1 78  ? -3.018  8.333   0.567   1.00 0.00 ? 78  GLU A CD   2  
ATOM 3516  O OE1  . GLU A 1 78  ? -4.103  8.962   0.435   1.00 0.00 ? 78  GLU A OE1  2  
ATOM 3517  O OE2  . GLU A 1 78  ? -2.895  7.098   0.350   1.00 0.00 ? 78  GLU A OE2  2  
ATOM 3518  H H    . GLU A 1 78  ? -1.719  9.861   5.179   1.00 0.00 ? 78  GLU A H    2  
ATOM 3519  H HA   . GLU A 1 78  ? -2.993  7.968   3.288   1.00 0.00 ? 78  GLU A HA   2  
ATOM 3520  H HB2  . GLU A 1 78  ? -2.891  10.337  2.413   1.00 0.00 ? 78  GLU A HB2  2  
ATOM 3521  H HB3  . GLU A 1 78  ? -1.128  10.349  2.678   1.00 0.00 ? 78  GLU A HB3  2  
ATOM 3522  H HG2  . GLU A 1 78  ? -1.624  9.961   0.302   1.00 0.00 ? 78  GLU A HG2  2  
ATOM 3523  H HG3  . GLU A 1 78  ? -0.885  8.471   0.974   1.00 0.00 ? 78  GLU A HG3  2  
ATOM 3524  N N    . SER A 1 79  ? -1.029  6.497   3.428   1.00 0.00 ? 79  SER A N    2  
ATOM 3525  C CA   . SER A 1 79  ? 0.044   5.517   3.512   1.00 0.00 ? 79  SER A CA   2  
ATOM 3526  C C    . SER A 1 79  ? 0.604   5.212   2.137   1.00 0.00 ? 79  SER A C    2  
ATOM 3527  O O    . SER A 1 79  ? 1.500   4.383   1.990   1.00 0.00 ? 79  SER A O    2  
ATOM 3528  C CB   . SER A 1 79  ? -0.481  4.182   4.134   1.00 0.00 ? 79  SER A CB   2  
ATOM 3529  O OG   . SER A 1 79  ? -1.682  3.709   3.511   1.00 0.00 ? 79  SER A OG   2  
ATOM 3530  H H    . SER A 1 79  ? -1.881  6.086   3.104   1.00 0.00 ? 79  SER A H    2  
ATOM 3531  H HA   . SER A 1 79  ? 0.862   5.882   4.120   1.00 0.00 ? 79  SER A HA   2  
ATOM 3532  H HB2  . SER A 1 79  ? 0.297   3.387   4.138   1.00 0.00 ? 79  SER A HB2  2  
ATOM 3533  H HB3  . SER A 1 79  ? -0.739  4.391   5.194   1.00 0.00 ? 79  SER A HB3  2  
ATOM 3534  H HG   . SER A 1 79  ? -1.452  3.138   2.754   1.00 0.00 ? 79  SER A HG   2  
ATOM 3535  N N    . ARG A 1 80  ? 0.014   5.826   1.077   1.00 0.00 ? 80  ARG A N    2  
ATOM 3536  C CA   . ARG A 1 80  ? 0.228   5.665   -0.364  1.00 0.00 ? 80  ARG A CA   2  
ATOM 3537  C C    . ARG A 1 80  ? -0.059  4.282   -0.948  1.00 0.00 ? 80  ARG A C    2  
ATOM 3538  O O    . ARG A 1 80  ? -0.730  4.175   -1.971  1.00 0.00 ? 80  ARG A O    2  
ATOM 3539  C CB   . ARG A 1 80  ? 1.541   6.319   -0.870  1.00 0.00 ? 80  ARG A CB   2  
ATOM 3540  C CG   . ARG A 1 80  ? 1.541   6.770   -2.354  1.00 0.00 ? 80  ARG A CG   2  
ATOM 3541  C CD   . ARG A 1 80  ? 0.620   7.960   -2.697  1.00 0.00 ? 80  ARG A CD   2  
ATOM 3542  N NE   . ARG A 1 80  ? -0.774  7.464   -2.985  1.00 0.00 ? 80  ARG A NE   2  
ATOM 3543  C CZ   . ARG A 1 80  ? -1.861  8.290   -3.089  1.00 0.00 ? 80  ARG A CZ   2  
ATOM 3544  N NH1  . ARG A 1 80  ? -1.735  9.640   -2.944  1.00 0.00 ? 80  ARG A NH1  2  
ATOM 3545  N NH2  . ARG A 1 80  ? -3.091  7.748   -3.336  1.00 0.00 ? 80  ARG A NH2  2  
ATOM 3546  H H    . ARG A 1 80  ? -0.679  6.498   1.322   1.00 0.00 ? 80  ARG A H    2  
ATOM 3547  H HA   . ARG A 1 80  ? -0.569  6.243   -0.801  1.00 0.00 ? 80  ARG A HA   2  
ATOM 3548  H HB2  . ARG A 1 80  ? 1.720   7.231   -0.252  1.00 0.00 ? 80  ARG A HB2  2  
ATOM 3549  H HB3  . ARG A 1 80  ? 2.395   5.628   -0.697  1.00 0.00 ? 80  ARG A HB3  2  
ATOM 3550  H HG2  . ARG A 1 80  ? 2.574   7.124   -2.573  1.00 0.00 ? 80  ARG A HG2  2  
ATOM 3551  H HG3  . ARG A 1 80  ? 1.336   5.923   -3.042  1.00 0.00 ? 80  ARG A HG3  2  
ATOM 3552  H HD2  . ARG A 1 80  ? 0.609   8.689   -1.857  1.00 0.00 ? 80  ARG A HD2  2  
ATOM 3553  H HD3  . ARG A 1 80  ? 0.995   8.458   -3.619  1.00 0.00 ? 80  ARG A HD3  2  
ATOM 3554  H HE   . ARG A 1 80  ? -0.911  6.480   -3.094  1.00 0.00 ? 80  ARG A HE   2  
ATOM 3555  H HH11 . ARG A 1 80  ? -0.838  10.040  -2.756  1.00 0.00 ? 80  ARG A HH11 2  
ATOM 3556  H HH12 . ARG A 1 80  ? -2.540  10.229  -3.021  1.00 0.00 ? 80  ARG A HH12 2  
ATOM 3557  H HH21 . ARG A 1 80  ? -3.189  6.759   -3.441  1.00 0.00 ? 80  ARG A HH21 2  
ATOM 3558  H HH22 . ARG A 1 80  ? -3.892  8.342   -3.410  1.00 0.00 ? 80  ARG A HH22 2  
ATOM 3559  N N    . VAL A 1 81  ? 0.426   3.188   -0.291  1.00 0.00 ? 81  VAL A N    2  
ATOM 3560  C CA   . VAL A 1 81  ? 0.173   1.791   -0.622  1.00 0.00 ? 81  VAL A CA   2  
ATOM 3561  C C    . VAL A 1 81  ? -1.089  1.269   0.100   1.00 0.00 ? 81  VAL A C    2  
ATOM 3562  O O    . VAL A 1 81  ? -1.468  1.751   1.177   1.00 0.00 ? 81  VAL A O    2  
ATOM 3563  C CB   . VAL A 1 81  ? 1.429   0.910   -0.560  1.00 0.00 ? 81  VAL A CB   2  
ATOM 3564  C CG1  . VAL A 1 81  ? 2.458   1.515   -1.523  1.00 0.00 ? 81  VAL A CG1  2  
ATOM 3565  C CG2  . VAL A 1 81  ? 2.153   0.807   0.784   1.00 0.00 ? 81  VAL A CG2  2  
ATOM 3566  H H    . VAL A 1 81  ? 0.967   3.345   0.546   1.00 0.00 ? 81  VAL A H    2  
ATOM 3567  H HA   . VAL A 1 81  ? -0.104  1.773   -1.669  1.00 0.00 ? 81  VAL A HA   2  
ATOM 3568  H HB   . VAL A 1 81  ? 1.187   -0.119  -0.911  1.00 0.00 ? 81  VAL A HB   2  
ATOM 3569  H HG11 . VAL A 1 81  ? 1.951   1.984   -2.394  1.00 0.00 ? 81  VAL A HG11 2  
ATOM 3570  H HG12 . VAL A 1 81  ? 3.038   2.329   -1.050  1.00 0.00 ? 81  VAL A HG12 2  
ATOM 3571  H HG13 . VAL A 1 81  ? 3.165   0.724   -1.870  1.00 0.00 ? 81  VAL A HG13 2  
ATOM 3572  H HG21 . VAL A 1 81  ? 2.318   1.820   1.202   1.00 0.00 ? 81  VAL A HG21 2  
ATOM 3573  H HG22 . VAL A 1 81  ? 1.605   0.175   1.509   1.00 0.00 ? 81  VAL A HG22 2  
ATOM 3574  H HG23 . VAL A 1 81  ? 3.155   0.356   0.563   1.00 0.00 ? 81  VAL A HG23 2  
ATOM 3575  N N    . ARG A 1 82  ? -1.815  0.327   -0.568  1.00 0.00 ? 82  ARG A N    2  
ATOM 3576  C CA   . ARG A 1 82  ? -3.160  -0.149  -0.242  1.00 0.00 ? 82  ARG A CA   2  
ATOM 3577  C C    . ARG A 1 82  ? -3.202  -1.654  -0.014  1.00 0.00 ? 82  ARG A C    2  
ATOM 3578  O O    . ARG A 1 82  ? -2.463  -2.378  -0.683  1.00 0.00 ? 82  ARG A O    2  
ATOM 3579  C CB   . ARG A 1 82  ? -4.042  0.207   -1.481  1.00 0.00 ? 82  ARG A CB   2  
ATOM 3580  C CG   . ARG A 1 82  ? -5.515  -0.238  -1.460  1.00 0.00 ? 82  ARG A CG   2  
ATOM 3581  C CD   . ARG A 1 82  ? -6.280  0.179   -2.725  1.00 0.00 ? 82  ARG A CD   2  
ATOM 3582  N NE   . ARG A 1 82  ? -7.706  -0.282  -2.588  1.00 0.00 ? 82  ARG A NE   2  
ATOM 3583  C CZ   . ARG A 1 82  ? -8.561  -0.413  -3.651  1.00 0.00 ? 82  ARG A CZ   2  
ATOM 3584  N NH1  . ARG A 1 82  ? -8.153  -0.121  -4.919  1.00 0.00 ? 82  ARG A NH1  2  
ATOM 3585  N NH2  . ARG A 1 82  ? -9.839  -0.844  -3.435  1.00 0.00 ? 82  ARG A NH2  2  
ATOM 3586  H H    . ARG A 1 82  ? -1.471  -0.043  -1.437  1.00 0.00 ? 82  ARG A H    2  
ATOM 3587  H HA   . ARG A 1 82  ? -3.540  0.340   0.645   1.00 0.00 ? 82  ARG A HA   2  
ATOM 3588  H HB2  . ARG A 1 82  ? -4.030  1.314   -1.593  1.00 0.00 ? 82  ARG A HB2  2  
ATOM 3589  H HB3  . ARG A 1 82  ? -3.576  -0.214  -2.401  1.00 0.00 ? 82  ARG A HB3  2  
ATOM 3590  H HG2  . ARG A 1 82  ? -5.561  -1.348  -1.434  1.00 0.00 ? 82  ARG A HG2  2  
ATOM 3591  H HG3  . ARG A 1 82  ? -6.004  0.167   -0.548  1.00 0.00 ? 82  ARG A HG3  2  
ATOM 3592  H HD2  . ARG A 1 82  ? -6.269  1.282   -2.851  1.00 0.00 ? 82  ARG A HD2  2  
ATOM 3593  H HD3  . ARG A 1 82  ? -5.806  -0.319  -3.603  1.00 0.00 ? 82  ARG A HD3  2  
ATOM 3594  H HE   . ARG A 1 82  ? -8.045  -0.505  -1.674  1.00 0.00 ? 82  ARG A HE   2  
ATOM 3595  H HH11 . ARG A 1 82  ? -7.218  0.194   -5.083  1.00 0.00 ? 82  ARG A HH11 2  
ATOM 3596  H HH12 . ARG A 1 82  ? -8.788  -0.226  -5.685  1.00 0.00 ? 82  ARG A HH12 2  
ATOM 3597  H HH21 . ARG A 1 82  ? -10.144 -1.059  -2.508  1.00 0.00 ? 82  ARG A HH21 2  
ATOM 3598  H HH22 . ARG A 1 82  ? -10.468 -0.943  -4.206  1.00 0.00 ? 82  ARG A HH22 2  
ATOM 3599  N N    . THR A 1 83  ? -4.077  -2.160  0.921   1.00 0.00 ? 83  THR A N    2  
ATOM 3600  C CA   . THR A 1 83  ? -4.303  -3.573  1.246   1.00 0.00 ? 83  THR A CA   2  
ATOM 3601  C C    . THR A 1 83  ? -5.390  -4.154  0.365   1.00 0.00 ? 83  THR A C    2  
ATOM 3602  O O    . THR A 1 83  ? -6.545  -3.739  0.405   1.00 0.00 ? 83  THR A O    2  
ATOM 3603  C CB   . THR A 1 83  ? -4.638  -3.913  2.711   1.00 0.00 ? 83  THR A CB   2  
ATOM 3604  O OG1  . THR A 1 83  ? -4.864  -2.750  3.487   1.00 0.00 ? 83  THR A OG1  2  
ATOM 3605  C CG2  . THR A 1 83  ? -3.459  -4.675  3.339   1.00 0.00 ? 83  THR A CG2  2  
ATOM 3606  H H    . THR A 1 83  ? -4.654  -1.558  1.471   1.00 0.00 ? 83  THR A H    2  
ATOM 3607  H HA   . THR A 1 83  ? -3.395  -4.098  1.036   1.00 0.00 ? 83  THR A HA   2  
ATOM 3608  H HB   . THR A 1 83  ? -5.522  -4.593  2.834   1.00 0.00 ? 83  THR A HB   2  
ATOM 3609  H HG1  . THR A 1 83  ? -4.581  -2.993  4.375   1.00 0.00 ? 83  THR A HG1  2  
ATOM 3610  H HG21 . THR A 1 83  ? -3.229  -5.568  2.716   1.00 0.00 ? 83  THR A HG21 2  
ATOM 3611  H HG22 . THR A 1 83  ? -2.551  -4.037  3.398   1.00 0.00 ? 83  THR A HG22 2  
ATOM 3612  H HG23 . THR A 1 83  ? -3.734  -5.049  4.351   1.00 0.00 ? 83  THR A HG23 2  
ATOM 3613  N N    . GLU A 1 84  ? -5.045  -5.175  -0.442  1.00 0.00 ? 84  GLU A N    2  
ATOM 3614  C CA   . GLU A 1 84  ? -5.977  -5.832  -1.336  1.00 0.00 ? 84  GLU A CA   2  
ATOM 3615  C C    . GLU A 1 84  ? -5.865  -7.315  -1.046  1.00 0.00 ? 84  GLU A C    2  
ATOM 3616  O O    . GLU A 1 84  ? -4.800  -7.795  -0.656  1.00 0.00 ? 84  GLU A O    2  
ATOM 3617  C CB   . GLU A 1 84  ? -5.670  -5.439  -2.811  1.00 0.00 ? 84  GLU A CB   2  
ATOM 3618  C CG   . GLU A 1 84  ? -6.552  -6.128  -3.873  1.00 0.00 ? 84  GLU A CG   2  
ATOM 3619  C CD   . GLU A 1 84  ? -6.167  -5.613  -5.259  1.00 0.00 ? 84  GLU A CD   2  
ATOM 3620  O OE1  . GLU A 1 84  ? -5.020  -5.896  -5.696  1.00 0.00 ? 84  GLU A OE1  2  
ATOM 3621  O OE2  . GLU A 1 84  ? -7.015  -4.936  -5.902  1.00 0.00 ? 84  GLU A OE2  2  
ATOM 3622  H H    . GLU A 1 84  ? -4.102  -5.522  -0.453  1.00 0.00 ? 84  GLU A H    2  
ATOM 3623  H HA   . GLU A 1 84  ? -7.003  -5.552  -1.122  1.00 0.00 ? 84  GLU A HA   2  
ATOM 3624  H HB2  . GLU A 1 84  ? -5.890  -4.323  -2.882  1.00 0.00 ? 84  GLU A HB2  2  
ATOM 3625  H HB3  . GLU A 1 84  ? -4.593  -5.697  -3.036  1.00 0.00 ? 84  GLU A HB3  2  
ATOM 3626  H HG2  . GLU A 1 84  ? -6.347  -7.242  -3.861  1.00 0.00 ? 84  GLU A HG2  2  
ATOM 3627  H HG3  . GLU A 1 84  ? -7.624  -5.836  -3.657  1.00 0.00 ? 84  GLU A HG3  2  
ATOM 3628  N N    . THR A 1 85  ? -6.985  -8.074  -1.202  1.00 0.00 ? 85  THR A N    2  
ATOM 3629  C CA   . THR A 1 85  ? -7.069  -9.516  -0.989  1.00 0.00 ? 85  THR A CA   2  
ATOM 3630  C C    . THR A 1 85  ? -6.979  -10.194 -2.355  1.00 0.00 ? 85  THR A C    2  
ATOM 3631  O O    . THR A 1 85  ? -7.873  -10.054 -3.188  1.00 0.00 ? 85  THR A O    2  
ATOM 3632  C CB   . THR A 1 85  ? -8.340  -9.886  -0.230  1.00 0.00 ? 85  THR A CB   2  
ATOM 3633  O OG1  . THR A 1 85  ? -8.448  -9.073  0.931   1.00 0.00 ? 85  THR A OG1  2  
ATOM 3634  C CG2  . THR A 1 85  ? -8.294  -11.344 0.249   1.00 0.00 ? 85  THR A CG2  2  
ATOM 3635  H H    . THR A 1 85  ? -7.837  -7.652  -1.502  1.00 0.00 ? 85  THR A H    2  
ATOM 3636  H HA   . THR A 1 85  ? -6.249  -9.849  -0.377  1.00 0.00 ? 85  THR A HA   2  
ATOM 3637  H HB   . THR A 1 85  ? -9.253  -9.709  -0.841  1.00 0.00 ? 85  THR A HB   2  
ATOM 3638  H HG1  . THR A 1 85  ? -7.704  -8.463  0.894   1.00 0.00 ? 85  THR A HG1  2  
ATOM 3639  H HG21 . THR A 1 85  ? -7.343  -11.551 0.783   1.00 0.00 ? 85  THR A HG21 2  
ATOM 3640  H HG22 . THR A 1 85  ? -9.140  -11.545 0.943   1.00 0.00 ? 85  THR A HG22 2  
ATOM 3641  H HG23 . THR A 1 85  ? -8.405  -12.023 -0.616  1.00 0.00 ? 85  THR A HG23 2  
ATOM 3642  N N    . ARG A 1 86  ? -5.868  -10.922 -2.642  1.00 0.00 ? 86  ARG A N    2  
ATOM 3643  C CA   . ARG A 1 86  ? -5.613  -11.547 -3.938  1.00 0.00 ? 86  ARG A CA   2  
ATOM 3644  C C    . ARG A 1 86  ? -5.062  -12.916 -3.676  1.00 0.00 ? 86  ARG A C    2  
ATOM 3645  O O    . ARG A 1 86  ? -4.507  -13.172 -2.610  1.00 0.00 ? 86  ARG A O    2  
ATOM 3646  C CB   . ARG A 1 86  ? -4.619  -10.759 -4.844  1.00 0.00 ? 86  ARG A CB   2  
ATOM 3647  C CG   . ARG A 1 86  ? -5.330  -9.658  -5.648  1.00 0.00 ? 86  ARG A CG   2  
ATOM 3648  C CD   . ARG A 1 86  ? -6.105  -10.165 -6.877  1.00 0.00 ? 86  ARG A CD   2  
ATOM 3649  N NE   . ARG A 1 86  ? -6.911  -9.029  -7.456  1.00 0.00 ? 86  ARG A NE   2  
ATOM 3650  C CZ   . ARG A 1 86  ? -6.411  -8.086  -8.315  1.00 0.00 ? 86  ARG A CZ   2  
ATOM 3651  N NH1  . ARG A 1 86  ? -5.120  -8.136  -8.751  1.00 0.00 ? 86  ARG A NH1  2  
ATOM 3652  N NH2  . ARG A 1 86  ? -7.222  -7.071  -8.738  1.00 0.00 ? 86  ARG A NH2  2  
ATOM 3653  H H    . ARG A 1 86  ? -5.135  -11.045 -1.966  1.00 0.00 ? 86  ARG A H    2  
ATOM 3654  H HA   . ARG A 1 86  ? -6.548  -11.682 -4.470  1.00 0.00 ? 86  ARG A HA   2  
ATOM 3655  H HB2  . ARG A 1 86  ? -3.889  -10.231 -4.129  1.00 0.00 ? 86  ARG A HB2  2  
ATOM 3656  H HB3  . ARG A 1 86  ? -4.173  -11.432 -5.666  1.00 0.00 ? 86  ARG A HB3  2  
ATOM 3657  H HG2  . ARG A 1 86  ? -6.069  -9.190  -4.947  1.00 0.00 ? 86  ARG A HG2  2  
ATOM 3658  H HG3  . ARG A 1 86  ? -4.537  -8.949  -6.011  1.00 0.00 ? 86  ARG A HG3  2  
ATOM 3659  H HD2  . ARG A 1 86  ? -5.417  -10.587 -7.643  1.00 0.00 ? 86  ARG A HD2  2  
ATOM 3660  H HD3  . ARG A 1 86  ? -6.828  -10.951 -6.575  1.00 0.00 ? 86  ARG A HD3  2  
ATOM 3661  H HE   . ARG A 1 86  ? -7.865  -8.944  -7.169  1.00 0.00 ? 86  ARG A HE   2  
ATOM 3662  H HH11 . ARG A 1 86  ? -4.518  -8.874  -8.445  1.00 0.00 ? 86  ARG A HH11 2  
ATOM 3663  H HH12 . ARG A 1 86  ? -4.773  -7.433  -9.370  1.00 0.00 ? 86  ARG A HH12 2  
ATOM 3664  H HH21 . ARG A 1 86  ? -8.168  -7.022  -8.419  1.00 0.00 ? 86  ARG A HH21 2  
ATOM 3665  H HH22 . ARG A 1 86  ? -6.869  -6.378  -9.366  1.00 0.00 ? 86  ARG A HH22 2  
ATOM 3666  N N    . ARG A 1 87  ? -5.233  -13.822 -4.673  1.00 0.00 ? 87  ARG A N    2  
ATOM 3667  C CA   . ARG A 1 87  ? -4.878  -15.243 -4.616  1.00 0.00 ? 87  ARG A CA   2  
ATOM 3668  C C    . ARG A 1 87  ? -3.471  -15.575 -5.132  1.00 0.00 ? 87  ARG A C    2  
ATOM 3669  O O    . ARG A 1 87  ? -3.150  -15.321 -6.290  1.00 0.00 ? 87  ARG A O    2  
ATOM 3670  C CB   . ARG A 1 87  ? -5.927  -16.109 -5.364  1.00 0.00 ? 87  ARG A CB   2  
ATOM 3671  C CG   . ARG A 1 87  ? -5.893  -17.606 -4.981  1.00 0.00 ? 87  ARG A CG   2  
ATOM 3672  C CD   . ARG A 1 87  ? -6.881  -18.469 -5.781  1.00 0.00 ? 87  ARG A CD   2  
ATOM 3673  N NE   . ARG A 1 87  ? -8.284  -18.048 -5.440  1.00 0.00 ? 87  ARG A NE   2  
ATOM 3674  C CZ   . ARG A 1 87  ? -9.394  -18.649 -5.969  1.00 0.00 ? 87  ARG A CZ   2  
ATOM 3675  N NH1  . ARG A 1 87  ? -9.277  -19.669 -6.868  1.00 0.00 ? 87  ARG A NH1  2  
ATOM 3676  N NH2  . ARG A 1 87  ? -10.635 -18.222 -5.591  1.00 0.00 ? 87  ARG A NH2  2  
ATOM 3677  H H    . ARG A 1 87  ? -5.656  -13.484 -5.513  1.00 0.00 ? 87  ARG A H    2  
ATOM 3678  H HA   . ARG A 1 87  ? -4.955  -15.556 -3.586  1.00 0.00 ? 87  ARG A HA   2  
ATOM 3679  H HB2  . ARG A 1 87  ? -6.930  -15.720 -5.079  1.00 0.00 ? 87  ARG A HB2  2  
ATOM 3680  H HB3  . ARG A 1 87  ? -5.834  -15.991 -6.467  1.00 0.00 ? 87  ARG A HB3  2  
ATOM 3681  H HG2  . ARG A 1 87  ? -4.868  -18.025 -5.130  1.00 0.00 ? 87  ARG A HG2  2  
ATOM 3682  H HG3  . ARG A 1 87  ? -6.142  -17.693 -3.894  1.00 0.00 ? 87  ARG A HG3  2  
ATOM 3683  H HD2  . ARG A 1 87  ? -6.709  -18.335 -6.872  1.00 0.00 ? 87  ARG A HD2  2  
ATOM 3684  H HD3  . ARG A 1 87  ? -6.752  -19.539 -5.507  1.00 0.00 ? 87  ARG A HD3  2  
ATOM 3685  H HE   . ARG A 1 87  ? -8.409  -17.302 -4.785  1.00 0.00 ? 87  ARG A HE   2  
ATOM 3686  H HH11 . ARG A 1 87  ? -8.370  -19.985 -7.147  1.00 0.00 ? 87  ARG A HH11 2  
ATOM 3687  H HH12 . ARG A 1 87  ? -10.096 -20.099 -7.247  1.00 0.00 ? 87  ARG A HH12 2  
ATOM 3688  H HH21 . ARG A 1 87  ? -10.727 -17.476 -4.931  1.00 0.00 ? 87  ARG A HH21 2  
ATOM 3689  H HH22 . ARG A 1 87  ? -11.451 -18.659 -5.969  1.00 0.00 ? 87  ARG A HH22 2  
ATOM 3690  N N    . ILE A 1 88  ? -2.592  -16.168 -4.283  1.00 0.00 ? 88  ILE A N    2  
ATOM 3691  C CA   . ILE A 1 88  ? -1.212  -16.523 -4.614  1.00 0.00 ? 88  ILE A CA   2  
ATOM 3692  C C    . ILE A 1 88  ? -0.972  -17.933 -4.114  1.00 0.00 ? 88  ILE A C    2  
ATOM 3693  O O    . ILE A 1 88  ? -1.180  -18.224 -2.939  1.00 0.00 ? 88  ILE A O    2  
ATOM 3694  C CB   . ILE A 1 88  ? -0.157  -15.540 -4.067  1.00 0.00 ? 88  ILE A CB   2  
ATOM 3695  C CG1  . ILE A 1 88  ? -0.466  -14.979 -2.647  1.00 0.00 ? 88  ILE A CG1  2  
ATOM 3696  C CG2  . ILE A 1 88  ? 0.007   -14.426 -5.120  1.00 0.00 ? 88  ILE A CG2  2  
ATOM 3697  C CD1  . ILE A 1 88  ? -1.237  -13.645 -2.612  1.00 0.00 ? 88  ILE A CD1  2  
ATOM 3698  H H    . ILE A 1 88  ? -2.876  -16.378 -3.325  1.00 0.00 ? 88  ILE A H    2  
ATOM 3699  H HA   . ILE A 1 88  ? -1.090  -16.572 -5.688  1.00 0.00 ? 88  ILE A HA   2  
ATOM 3700  H HB   . ILE A 1 88  ? 0.841   -16.042 -4.006  1.00 0.00 ? 88  ILE A HB   2  
ATOM 3701  H HG12 . ILE A 1 88  ? -1.042  -15.746 -2.069  1.00 0.00 ? 88  ILE A HG12 2  
ATOM 3702  H HG13 . ILE A 1 88  ? 0.519   -14.795 -2.143  1.00 0.00 ? 88  ILE A HG13 2  
ATOM 3703  H HG21 . ILE A 1 88  ? 0.320   -14.857 -6.093  1.00 0.00 ? 88  ILE A HG21 2  
ATOM 3704  H HG22 . ILE A 1 88  ? -0.966  -13.912 -5.267  1.00 0.00 ? 88  ILE A HG22 2  
ATOM 3705  H HG23 . ILE A 1 88  ? 0.768   -13.686 -4.793  1.00 0.00 ? 88  ILE A HG23 2  
ATOM 3706  H HD11 . ILE A 1 88  ? -2.141  -13.694 -3.251  1.00 0.00 ? 88  ILE A HD11 2  
ATOM 3707  H HD12 . ILE A 1 88  ? -1.563  -13.397 -1.582  1.00 0.00 ? 88  ILE A HD12 2  
ATOM 3708  H HD13 . ILE A 1 88  ? -0.602  -12.811 -2.981  1.00 0.00 ? 88  ILE A HD13 2  
ATOM 3709  N N    . GLY A 1 89  ? -0.589  -18.884 -5.030  1.00 0.00 ? 89  GLY A N    2  
ATOM 3710  C CA   . GLY A 1 89  ? -0.361  -20.338 -4.727  1.00 0.00 ? 89  GLY A CA   2  
ATOM 3711  C C    . GLY A 1 89  ? -1.605  -21.094 -4.303  1.00 0.00 ? 89  GLY A C    2  
ATOM 3712  O O    . GLY A 1 89  ? -1.537  -22.103 -3.611  1.00 0.00 ? 89  GLY A O    2  
ATOM 3713  H H    . GLY A 1 89  ? -0.470  -18.529 -5.961  1.00 0.00 ? 89  GLY A H    2  
ATOM 3714  H HA2  . GLY A 1 89  ? 0.014   -20.901 -5.605  1.00 0.00 ? 89  GLY A HA2  2  
ATOM 3715  H HA3  . GLY A 1 89  ? 0.291   -20.364 -3.841  1.00 0.00 ? 89  GLY A HA3  2  
ATOM 3716  N N    . GLY A 1 90  ? -2.785  -20.550 -4.688  1.00 0.00 ? 90  GLY A N    2  
ATOM 3717  C CA   . GLY A 1 90  ? -4.118  -21.016 -4.267  1.00 0.00 ? 90  GLY A CA   2  
ATOM 3718  C C    . GLY A 1 90  ? -4.629  -20.411 -2.965  1.00 0.00 ? 90  GLY A C    2  
ATOM 3719  O O    . GLY A 1 90  ? -5.640  -20.875 -2.449  1.00 0.00 ? 90  GLY A O    2  
ATOM 3720  H H    . GLY A 1 90  ? -2.688  -19.743 -5.276  1.00 0.00 ? 90  GLY A H    2  
ATOM 3721  H HA2  . GLY A 1 90  ? -4.862  -20.787 -5.023  1.00 0.00 ? 90  GLY A HA2  2  
ATOM 3722  H HA3  . GLY A 1 90  ? -4.078  -22.086 -4.099  1.00 0.00 ? 90  GLY A HA3  2  
ATOM 3723  N N    . ALA A 1 91  ? -3.970  -19.375 -2.368  1.00 0.00 ? 91  ALA A N    2  
ATOM 3724  C CA   . ALA A 1 91  ? -4.369  -18.821 -1.087  1.00 0.00 ? 91  ALA A CA   2  
ATOM 3725  C C    . ALA A 1 91  ? -4.488  -17.302 -1.192  1.00 0.00 ? 91  ALA A C    2  
ATOM 3726  O O    . ALA A 1 91  ? -3.665  -16.640 -1.820  1.00 0.00 ? 91  ALA A O    2  
ATOM 3727  C CB   . ALA A 1 91  ? -3.340  -19.238 -0.018  1.00 0.00 ? 91  ALA A CB   2  
ATOM 3728  H H    . ALA A 1 91  ? -3.134  -18.949 -2.724  1.00 0.00 ? 91  ALA A H    2  
ATOM 3729  H HA   . ALA A 1 91  ? -5.331  -19.212 -0.777  1.00 0.00 ? 91  ALA A HA   2  
ATOM 3730  H HB1  . ALA A 1 91  ? -2.321  -18.895 -0.304  1.00 0.00 ? 91  ALA A HB1  2  
ATOM 3731  H HB2  . ALA A 1 91  ? -3.601  -18.829 0.982   1.00 0.00 ? 91  ALA A HB2  2  
ATOM 3732  H HB3  . ALA A 1 91  ? -3.315  -20.346 0.065   1.00 0.00 ? 91  ALA A HB3  2  
ATOM 3733  N N    . ASP A 1 92  ? -5.550  -16.711 -0.592  1.00 0.00 ? 92  ASP A N    2  
ATOM 3734  C CA   . ASP A 1 92  ? -5.899  -15.299 -0.614  1.00 0.00 ? 92  ASP A CA   2  
ATOM 3735  C C    . ASP A 1 92  ? -5.417  -14.538 0.634   1.00 0.00 ? 92  ASP A C    2  
ATOM 3736  O O    . ASP A 1 92  ? -5.869  -14.795 1.748   1.00 0.00 ? 92  ASP A O    2  
ATOM 3737  C CB   . ASP A 1 92  ? -7.415  -15.105 -0.939  1.00 0.00 ? 92  ASP A CB   2  
ATOM 3738  C CG   . ASP A 1 92  ? -8.389  -15.657 0.116   1.00 0.00 ? 92  ASP A CG   2  
ATOM 3739  O OD1  . ASP A 1 92  ? -8.431  -16.902 0.302   1.00 0.00 ? 92  ASP A OD1  2  
ATOM 3740  O OD2  . ASP A 1 92  ? -9.108  -14.831 0.739   1.00 0.00 ? 92  ASP A OD2  2  
ATOM 3741  H H    . ASP A 1 92  ? -6.205  -17.251 -0.090  1.00 0.00 ? 92  ASP A H    2  
ATOM 3742  H HA   . ASP A 1 92  ? -5.413  -14.865 -1.465  1.00 0.00 ? 92  ASP A HA   2  
ATOM 3743  H HB2  . ASP A 1 92  ? -7.609  -14.021 -1.097  1.00 0.00 ? 92  ASP A HB2  2  
ATOM 3744  H HB3  . ASP A 1 92  ? -7.621  -15.656 -1.895  1.00 0.00 ? 92  ASP A HB3  2  
ATOM 3745  N N    . PHE A 1 93  ? -4.458  -13.587 0.480   1.00 0.00 ? 93  PHE A N    2  
ATOM 3746  C CA   . PHE A 1 93  ? -3.857  -12.833 1.579   1.00 0.00 ? 93  PHE A CA   2  
ATOM 3747  C C    . PHE A 1 93  ? -4.014  -11.349 1.315   1.00 0.00 ? 93  PHE A C    2  
ATOM 3748  O O    . PHE A 1 93  ? -4.325  -10.936 0.196   1.00 0.00 ? 93  PHE A O    2  
ATOM 3749  C CB   . PHE A 1 93  ? -2.323  -13.117 1.722   1.00 0.00 ? 93  PHE A CB   2  
ATOM 3750  C CG   . PHE A 1 93  ? -2.039  -14.595 1.853   1.00 0.00 ? 93  PHE A CG   2  
ATOM 3751  C CD1  . PHE A 1 93  ? -2.592  -15.359 2.868   1.00 0.00 ? 93  PHE A CD1  2  
ATOM 3752  C CD2  . PHE A 1 93  ? -1.211  -15.222 0.938   1.00 0.00 ? 93  PHE A CD2  2  
ATOM 3753  C CE1  . PHE A 1 93  ? -2.348  -16.720 2.935   1.00 0.00 ? 93  PHE A CE1  2  
ATOM 3754  C CE2  . PHE A 1 93  ? -0.974  -16.577 0.990   1.00 0.00 ? 93  PHE A CE2  2  
ATOM 3755  C CZ   . PHE A 1 93  ? -1.542  -17.330 1.995   1.00 0.00 ? 93  PHE A CZ   2  
ATOM 3756  H H    . PHE A 1 93  ? -4.091  -13.363 -0.423  1.00 0.00 ? 93  PHE A H    2  
ATOM 3757  H HA   . PHE A 1 93  ? -4.354  -13.046 2.517   1.00 0.00 ? 93  PHE A HA   2  
ATOM 3758  H HB2  . PHE A 1 93  ? -1.784  -12.757 0.803   1.00 0.00 ? 93  PHE A HB2  2  
ATOM 3759  H HB3  . PHE A 1 93  ? -1.911  -12.629 2.644   1.00 0.00 ? 93  PHE A HB3  2  
ATOM 3760  H HD1  . PHE A 1 93  ? -3.239  -14.898 3.602   1.00 0.00 ? 93  PHE A HD1  2  
ATOM 3761  H HD2  . PHE A 1 93  ? -0.756  -14.641 0.150   1.00 0.00 ? 93  PHE A HD2  2  
ATOM 3762  H HE1  . PHE A 1 93  ? -2.803  -17.308 3.720   1.00 0.00 ? 93  PHE A HE1  2  
ATOM 3763  H HE2  . PHE A 1 93  ? -0.353  -17.053 0.243   1.00 0.00 ? 93  PHE A HE2  2  
ATOM 3764  H HZ   . PHE A 1 93  ? -1.385  -18.400 2.003   1.00 0.00 ? 93  PHE A HZ   2  
ATOM 3765  N N    . LEU A 1 94  ? -3.726  -10.509 2.352   1.00 0.00 ? 94  LEU A N    2  
ATOM 3766  C CA   . LEU A 1 94  ? -3.695  -9.058  2.284   1.00 0.00 ? 94  LEU A CA   2  
ATOM 3767  C C    . LEU A 1 94  ? -2.253  -8.646  1.965   1.00 0.00 ? 94  LEU A C    2  
ATOM 3768  O O    . LEU A 1 94  ? -1.336  -8.817  2.767   1.00 0.00 ? 94  LEU A O    2  
ATOM 3769  C CB   . LEU A 1 94  ? -4.239  -8.396  3.583   1.00 0.00 ? 94  LEU A CB   2  
ATOM 3770  C CG   . LEU A 1 94  ? -5.788  -8.344  3.595   1.00 0.00 ? 94  LEU A CG   2  
ATOM 3771  C CD1  . LEU A 1 94  ? -6.357  -8.696  4.986   1.00 0.00 ? 94  LEU A CD1  2  
ATOM 3772  C CD2  . LEU A 1 94  ? -6.371  -6.979  3.177   1.00 0.00 ? 94  LEU A CD2  2  
ATOM 3773  H H    . LEU A 1 94  ? -3.449  -10.887 3.231   1.00 0.00 ? 94  LEU A H    2  
ATOM 3774  H HA   . LEU A 1 94  ? -4.352  -8.723  1.495   1.00 0.00 ? 94  LEU A HA   2  
ATOM 3775  H HB2  . LEU A 1 94  ? -3.884  -8.998  4.455   1.00 0.00 ? 94  LEU A HB2  2  
ATOM 3776  H HB3  . LEU A 1 94  ? -3.878  -7.348  3.693   1.00 0.00 ? 94  LEU A HB3  2  
ATOM 3777  H HG   . LEU A 1 94  ? -6.091  -9.081  2.814   1.00 0.00 ? 94  LEU A HG   2  
ATOM 3778  H HD11 . LEU A 1 94  ? -5.976  -9.668  5.368   1.00 0.00 ? 94  LEU A HD11 2  
ATOM 3779  H HD12 . LEU A 1 94  ? -6.056  -7.905  5.707   1.00 0.00 ? 94  LEU A HD12 2  
ATOM 3780  H HD13 . LEU A 1 94  ? -7.469  -8.730  4.968   1.00 0.00 ? 94  LEU A HD13 2  
ATOM 3781  H HD21 . LEU A 1 94  ? -5.965  -6.634  2.200   1.00 0.00 ? 94  LEU A HD21 2  
ATOM 3782  H HD22 . LEU A 1 94  ? -7.484  -7.005  3.103   1.00 0.00 ? 94  LEU A HD22 2  
ATOM 3783  H HD23 . LEU A 1 94  ? -6.118  -6.224  3.954   1.00 0.00 ? 94  LEU A HD23 2  
ATOM 3784  N N    . VAL A 1 95  ? -2.042  -8.107  0.745   1.00 0.00 ? 95  VAL A N    2  
ATOM 3785  C CA   . VAL A 1 95  ? -0.774  -7.615  0.202   1.00 0.00 ? 95  VAL A CA   2  
ATOM 3786  C C    . VAL A 1 95  ? -0.836  -6.114  0.383   1.00 0.00 ? 95  VAL A C    2  
ATOM 3787  O O    . VAL A 1 95  ? -1.914  -5.535  0.242   1.00 0.00 ? 95  VAL A O    2  
ATOM 3788  C CB   . VAL A 1 95  ? -0.634  -7.838  -1.332  1.00 0.00 ? 95  VAL A CB   2  
ATOM 3789  C CG1  . VAL A 1 95  ? -0.208  -9.278  -1.642  1.00 0.00 ? 95  VAL A CG1  2  
ATOM 3790  C CG2  . VAL A 1 95  ? -1.931  -7.548  -2.153  1.00 0.00 ? 95  VAL A CG2  2  
ATOM 3791  H H    . VAL A 1 95  ? -2.821  -7.969  0.136   1.00 0.00 ? 95  VAL A H    2  
ATOM 3792  H HA   . VAL A 1 95  ? 0.116   -8.009  0.728   1.00 0.00 ? 95  VAL A HA   2  
ATOM 3793  H HB   . VAL A 1 95  ? 0.223   -7.212  -1.714  1.00 0.00 ? 95  VAL A HB   2  
ATOM 3794  H HG11 . VAL A 1 95  ? 0.764   -9.506  -1.159  1.00 0.00 ? 95  VAL A HG11 2  
ATOM 3795  H HG12 . VAL A 1 95  ? -0.980  -10.005 -1.320  1.00 0.00 ? 95  VAL A HG12 2  
ATOM 3796  H HG13 . VAL A 1 95  ? -0.078  -9.336  -2.749  1.00 0.00 ? 95  VAL A HG13 2  
ATOM 3797  H HG21 . VAL A 1 95  ? -2.379  -6.556  -1.937  1.00 0.00 ? 95  VAL A HG21 2  
ATOM 3798  H HG22 . VAL A 1 95  ? -1.752  -7.591  -3.245  1.00 0.00 ? 95  VAL A HG22 2  
ATOM 3799  H HG23 . VAL A 1 95  ? -2.693  -8.341  -1.987  1.00 0.00 ? 95  VAL A HG23 2  
ATOM 3800  N N    . TRP A 1 96  ? 0.317   -5.422  0.602   1.00 0.00 ? 96  TRP A N    2  
ATOM 3801  C CA   . TRP A 1 96  ? 0.281   -3.943  0.543   1.00 0.00 ? 96  TRP A CA   2  
ATOM 3802  C C    . TRP A 1 96  ? 0.895   -3.693  -0.848  1.00 0.00 ? 96  TRP A C    2  
ATOM 3803  O O    . TRP A 1 96  ? 1.960   -4.230  -1.146  1.00 0.00 ? 96  TRP A O    2  
ATOM 3804  C CB   . TRP A 1 96  ? 1.205   -3.436  1.700   1.00 0.00 ? 96  TRP A CB   2  
ATOM 3805  C CG   . TRP A 1 96  ? 0.632   -2.360  2.602   1.00 0.00 ? 96  TRP A CG   2  
ATOM 3806  C CD1  . TRP A 1 96  ? -0.356  -1.465  2.334   1.00 0.00 ? 96  TRP A CD1  2  
ATOM 3807  C CD2  . TRP A 1 96  ? 1.042   -2.113  3.957   1.00 0.00 ? 96  TRP A CD2  2  
ATOM 3808  N NE1  . TRP A 1 96  ? -0.541  -0.616  3.394   1.00 0.00 ? 96  TRP A NE1  2  
ATOM 3809  C CE2  . TRP A 1 96  ? 0.306   -1.019  4.412   1.00 0.00 ? 96  TRP A CE2  2  
ATOM 3810  C CE3  . TRP A 1 96  ? 1.946   -2.751  4.758   1.00 0.00 ? 96  TRP A CE3  2  
ATOM 3811  C CZ2  . TRP A 1 96  ? 0.488   -0.530  5.675   1.00 0.00 ? 96  TRP A CZ2  2  
ATOM 3812  C CZ3  . TRP A 1 96  ? 2.075   -2.305  6.057   1.00 0.00 ? 96  TRP A CZ3  2  
ATOM 3813  C CH2  . TRP A 1 96  ? 1.382   -1.192  6.501   1.00 0.00 ? 96  TRP A CH2  2  
ATOM 3814  H H    . TRP A 1 96  ? 1.232   -5.891  0.695   1.00 0.00 ? 96  TRP A H    2  
ATOM 3815  H HA   . TRP A 1 96  ? -0.725  -3.448  0.612   1.00 0.00 ? 96  TRP A HA   2  
ATOM 3816  H HB2  . TRP A 1 96  ? 1.390   -4.301  2.373   1.00 0.00 ? 96  TRP A HB2  2  
ATOM 3817  H HB3  . TRP A 1 96  ? 2.207   -3.110  1.345   1.00 0.00 ? 96  TRP A HB3  2  
ATOM 3818  H HD1  . TRP A 1 96  ? -0.920  -1.470  1.427   1.00 0.00 ? 96  TRP A HD1  2  
ATOM 3819  H HE1  . TRP A 1 96  ? -1.109  0.182   3.410   1.00 0.00 ? 96  TRP A HE1  2  
ATOM 3820  H HE3  . TRP A 1 96  ? 2.524   -3.594  4.409   1.00 0.00 ? 96  TRP A HE3  2  
ATOM 3821  H HZ2  . TRP A 1 96  ? -0.058  0.333   6.028   1.00 0.00 ? 96  TRP A HZ2  2  
ATOM 3822  H HZ3  . TRP A 1 96  ? 2.737   -2.829  6.736   1.00 0.00 ? 96  TRP A HZ3  2  
ATOM 3823  H HH2  . TRP A 1 96  ? 1.552   -0.837  7.508   1.00 0.00 ? 96  TRP A HH2  2  
ATOM 3824  N N    . ARG A 1 97  ? 0.288   -2.913  -1.771  1.00 0.00 ? 97  ARG A N    2  
ATOM 3825  C CA   . ARG A 1 97  ? 0.833   -2.771  -3.115  1.00 0.00 ? 97  ARG A CA   2  
ATOM 3826  C C    . ARG A 1 97  ? 0.670   -1.321  -3.495  1.00 0.00 ? 97  ARG A C    2  
ATOM 3827  O O    . ARG A 1 97  ? -0.171  -0.609  -2.937  1.00 0.00 ? 97  ARG A O    2  
ATOM 3828  C CB   . ARG A 1 97  ? 0.165   -3.746  -4.141  1.00 0.00 ? 97  ARG A CB   2  
ATOM 3829  C CG   . ARG A 1 97  ? -1.251  -3.336  -4.601  1.00 0.00 ? 97  ARG A CG   2  
ATOM 3830  C CD   . ARG A 1 97  ? -1.944  -4.337  -5.535  1.00 0.00 ? 97  ARG A CD   2  
ATOM 3831  N NE   . ARG A 1 97  ? -1.168  -4.383  -6.825  1.00 0.00 ? 97  ARG A NE   2  
ATOM 3832  C CZ   . ARG A 1 97  ? -1.717  -4.668  -8.047  1.00 0.00 ? 97  ARG A CZ   2  
ATOM 3833  N NH1  . ARG A 1 97  ? -3.041  -4.969  -8.175  1.00 0.00 ? 97  ARG A NH1  2  
ATOM 3834  N NH2  . ARG A 1 97  ? -0.916  -4.662  -9.153  1.00 0.00 ? 97  ARG A NH2  2  
ATOM 3835  H H    . ARG A 1 97  ? -0.594  -2.453  -1.631  1.00 0.00 ? 97  ARG A H    2  
ATOM 3836  H HA   . ARG A 1 97  ? 1.907   -2.956  -3.120  1.00 0.00 ? 97  ARG A HA   2  
ATOM 3837  H HB2  . ARG A 1 97  ? 0.807   -3.802  -5.049  1.00 0.00 ? 97  ARG A HB2  2  
ATOM 3838  H HB3  . ARG A 1 97  ? 0.143   -4.779  -3.695  1.00 0.00 ? 97  ARG A HB3  2  
ATOM 3839  H HG2  . ARG A 1 97  ? -1.885  -3.190  -3.699  1.00 0.00 ? 97  ARG A HG2  2  
ATOM 3840  H HG3  . ARG A 1 97  ? -1.187  -2.366  -5.155  1.00 0.00 ? 97  ARG A HG3  2  
ATOM 3841  H HD2  . ARG A 1 97  ? -1.960  -5.353  -5.085  1.00 0.00 ? 97  ARG A HD2  2  
ATOM 3842  H HD3  . ARG A 1 97  ? -2.986  -3.993  -5.722  1.00 0.00 ? 97  ARG A HD3  2  
ATOM 3843  H HE   . ARG A 1 97  ? -0.191  -4.177  -6.786  1.00 0.00 ? 97  ARG A HE   2  
ATOM 3844  H HH11 . ARG A 1 97  ? -3.631  -4.980  -7.367  1.00 0.00 ? 97  ARG A HH11 2  
ATOM 3845  H HH12 . ARG A 1 97  ? -3.421  -5.180  -9.075  1.00 0.00 ? 97  ARG A HH12 2  
ATOM 3846  H HH21 . ARG A 1 97  ? 0.056   -4.446  -9.064  1.00 0.00 ? 97  ARG A HH21 2  
ATOM 3847  H HH22 . ARG A 1 97  ? -1.302  -4.871  -10.052 1.00 0.00 ? 97  ARG A HH22 2  
ATOM 3848  N N    . TRP A 1 98  ? 1.497   -0.834  -4.449  1.00 0.00 ? 98  TRP A N    2  
ATOM 3849  C CA   . TRP A 1 98  ? 1.588   0.543   -4.859  1.00 0.00 ? 98  TRP A CA   2  
ATOM 3850  C C    . TRP A 1 98  ? 1.050   0.768   -6.268  1.00 0.00 ? 98  TRP A C    2  
ATOM 3851  O O    . TRP A 1 98  ? 1.143   -0.099  -7.128  1.00 0.00 ? 98  TRP A O    2  
ATOM 3852  C CB   . TRP A 1 98  ? 3.076   0.925   -4.656  1.00 0.00 ? 98  TRP A CB   2  
ATOM 3853  C CG   . TRP A 1 98  ? 3.343   2.409   -4.293  1.00 0.00 ? 98  TRP A CG   2  
ATOM 3854  C CD1  . TRP A 1 98  ? 2.441   3.417   -4.465  1.00 0.00 ? 98  TRP A CD1  2  
ATOM 3855  C CD2  . TRP A 1 98  ? 4.405   2.763   -5.127  1.00 0.00 ? 98  TRP A CD2  2  
ATOM 3856  N NE1  . TRP A 1 98  ? 2.571   3.842   -5.755  1.00 0.00 ? 98  TRP A NE1  2  
ATOM 3857  C CE2  . TRP A 1 98  ? 3.772   3.332   -6.206  1.00 0.00 ? 98  TRP A CE2  2  
ATOM 3858  C CE3  . TRP A 1 98  ? 5.645   2.269   -5.159  1.00 0.00 ? 98  TRP A CE3  2  
ATOM 3859  C CZ2  . TRP A 1 98  ? 4.353   3.304   -7.417  1.00 0.00 ? 98  TRP A CZ2  2  
ATOM 3860  C CZ3  . TRP A 1 98  ? 6.293   2.346   -6.357  1.00 0.00 ? 98  TRP A CZ3  2  
ATOM 3861  C CH2  . TRP A 1 98  ? 5.639   2.812   -7.482  1.00 0.00 ? 98  TRP A CH2  2  
ATOM 3862  H H    . TRP A 1 98  ? 2.165   -1.403  -4.929  1.00 0.00 ? 98  TRP A H    2  
ATOM 3863  H HA   . TRP A 1 98  ? 0.956   1.148   -4.222  1.00 0.00 ? 98  TRP A HA   2  
ATOM 3864  H HB2  . TRP A 1 98  ? 3.419   0.350   -3.729  1.00 0.00 ? 98  TRP A HB2  2  
ATOM 3865  H HB3  . TRP A 1 98  ? 3.624   0.615   -5.628  1.00 0.00 ? 98  TRP A HB3  2  
ATOM 3866  H HD1  . TRP A 1 98  ? 2.196   4.082   -3.645  1.00 0.00 ? 98  TRP A HD1  2  
ATOM 3867  H HE1  . TRP A 1 98  ? 1.943   4.392   -6.275  1.00 0.00 ? 98  TRP A HE1  2  
ATOM 3868  H HE3  . TRP A 1 98  ? 6.006   1.784   -4.253  1.00 0.00 ? 98  TRP A HE3  2  
ATOM 3869  H HZ2  . TRP A 1 98  ? 3.825   3.616   -8.302  1.00 0.00 ? 98  TRP A HZ2  2  
ATOM 3870  H HZ3  . TRP A 1 98  ? 7.303   2.002   -6.413  1.00 0.00 ? 98  TRP A HZ3  2  
ATOM 3871  H HH2  . TRP A 1 98  ? 6.145   2.836   -8.435  1.00 0.00 ? 98  TRP A HH2  2  
ATOM 3872  N N    . ILE A 1 99  ? 0.398   1.942   -6.485  1.00 0.00 ? 99  ILE A N    2  
ATOM 3873  C CA   . ILE A 1 99  ? -0.297  2.391   -7.692  1.00 0.00 ? 99  ILE A CA   2  
ATOM 3874  C C    . ILE A 1 99  ? 0.185   3.761   -8.243  1.00 0.00 ? 99  ILE A C    2  
ATOM 3875  O O    . ILE A 1 99  ? 0.351   4.715   -7.486  1.00 0.00 ? 99  ILE A O    2  
ATOM 3876  C CB   . ILE A 1 99  ? -1.810  2.404   -7.374  1.00 0.00 ? 99  ILE A CB   2  
ATOM 3877  C CG1  . ILE A 1 99  ? -2.186  3.178   -6.062  1.00 0.00 ? 99  ILE A CG1  2  
ATOM 3878  C CG2  . ILE A 1 99  ? -2.250  0.923   -7.314  1.00 0.00 ? 99  ILE A CG2  2  
ATOM 3879  C CD1  . ILE A 1 99  ? -3.573  2.824   -5.493  1.00 0.00 ? 99  ILE A CD1  2  
ATOM 3880  H H    . ILE A 1 99  ? 0.347   2.607   -5.745  1.00 0.00 ? 99  ILE A H    2  
ATOM 3881  H HA   . ILE A 1 99  ? -0.114  1.681   -8.489  1.00 0.00 ? 99  ILE A HA   2  
ATOM 3882  H HB   . ILE A 1 99  ? -2.382  2.861   -8.215  1.00 0.00 ? 99  ILE A HB   2  
ATOM 3883  H HG12 . ILE A 1 99  ? -1.455  2.981   -5.233  1.00 0.00 ? 99  ILE A HG12 2  
ATOM 3884  H HG13 . ILE A 1 99  ? -2.171  4.273   -6.309  1.00 0.00 ? 99  ILE A HG13 2  
ATOM 3885  H HG21 . ILE A 1 99  ? -1.907  0.384   -8.223  1.00 0.00 ? 99  ILE A HG21 2  
ATOM 3886  H HG22 . ILE A 1 99  ? -1.818  0.431   -6.417  1.00 0.00 ? 99  ILE A HG22 2  
ATOM 3887  H HG23 . ILE A 1 99  ? -3.353  0.842   -7.257  1.00 0.00 ? 99  ILE A HG23 2  
ATOM 3888  H HD11 . ILE A 1 99  ? -4.354  2.894   -6.278  1.00 0.00 ? 99  ILE A HD11 2  
ATOM 3889  H HD12 . ILE A 1 99  ? -3.586  1.795   -5.061  1.00 0.00 ? 99  ILE A HD12 2  
ATOM 3890  H HD13 . ILE A 1 99  ? -3.834  3.521   -4.668  1.00 0.00 ? 99  ILE A HD13 2  
ATOM 3891  N N    . GLN A 1 100 ? 0.407   3.915   -9.589  1.00 0.00 ? 100 GLN A N    2  
ATOM 3892  C CA   . GLN A 1 100 ? 0.770   5.187   -10.256 1.00 0.00 ? 100 GLN A CA   2  
ATOM 3893  C C    . GLN A 1 100 ? 0.119   5.238   -11.659 1.00 0.00 ? 100 GLN A C    2  
ATOM 3894  O O    . GLN A 1 100 ? 0.692   4.661   -12.590 1.00 0.00 ? 100 GLN A O    2  
ATOM 3895  C CB   . GLN A 1 100 ? 2.306   5.548   -10.308 1.00 0.00 ? 100 GLN A CB   2  
ATOM 3896  C CG   . GLN A 1 100 ? 2.592   7.053   -10.079 1.00 0.00 ? 100 GLN A CG   2  
ATOM 3897  C CD   . GLN A 1 100 ? 1.721   7.986   -10.903 1.00 0.00 ? 100 GLN A CD   2  
ATOM 3898  O OE1  . GLN A 1 100 ? 0.734   8.537   -10.418 1.00 0.00 ? 100 GLN A OE1  2  
ATOM 3899  N NE2  . GLN A 1 100 ? 2.008   8.145   -12.212 1.00 0.00 ? 100 GLN A NE2  2  
ATOM 3900  H H    . GLN A 1 100 ? 0.330   3.116   -10.183 1.00 0.00 ? 100 GLN A H    2  
ATOM 3901  H HA   . GLN A 1 100 ? 0.366   5.981   -9.642  1.00 0.00 ? 100 GLN A HA   2  
ATOM 3902  H HB2  . GLN A 1 100 ? 2.754   4.976   -9.466  1.00 0.00 ? 100 GLN A HB2  2  
ATOM 3903  H HB3  . GLN A 1 100 ? 2.940   5.249   -11.189 1.00 0.00 ? 100 GLN A HB3  2  
ATOM 3904  H HG2  . GLN A 1 100 ? 2.396   7.299   -9.013  1.00 0.00 ? 100 GLN A HG2  2  
ATOM 3905  H HG3  . GLN A 1 100 ? 3.656   7.265   -10.304 1.00 0.00 ? 100 GLN A HG3  2  
ATOM 3906  H HE21 . GLN A 1 100 ? 2.838   7.739   -12.628 1.00 0.00 ? 100 GLN A HE21 2  
ATOM 3907  H HE22 . GLN A 1 100 ? 1.290   8.561   -12.771 1.00 0.00 ? 100 GLN A HE22 2  
ATOM 3908  N N    . PRO A 1 101 ? -1.044  5.913   -11.937 1.00 0.00 ? 101 PRO A N    2  
ATOM 3909  C CA   . PRO A 1 101 ? -1.770  5.820   -13.214 1.00 0.00 ? 101 PRO A CA   2  
ATOM 3910  C C    . PRO A 1 101 ? -1.080  6.442   -14.428 1.00 0.00 ? 101 PRO A C    2  
ATOM 3911  O O    . PRO A 1 101 ? -0.669  7.599   -14.378 1.00 0.00 ? 101 PRO A O    2  
ATOM 3912  C CB   . PRO A 1 101 ? -3.083  6.583   -12.935 1.00 0.00 ? 101 PRO A CB   2  
ATOM 3913  C CG   . PRO A 1 101 ? -3.296  6.422   -11.435 1.00 0.00 ? 101 PRO A CG   2  
ATOM 3914  C CD   . PRO A 1 101 ? -1.865  6.582   -10.927 1.00 0.00 ? 101 PRO A CD   2  
ATOM 3915  H HA   . PRO A 1 101 ? -1.959  4.777   -13.430 1.00 0.00 ? 101 PRO A HA   2  
ATOM 3916  H HB2  . PRO A 1 101 ? -2.950  7.681   -13.105 1.00 0.00 ? 101 PRO A HB2  2  
ATOM 3917  H HB3  . PRO A 1 101 ? -3.937  6.196   -13.534 1.00 0.00 ? 101 PRO A HB3  2  
ATOM 3918  H HG2  . PRO A 1 101 ? -3.992  7.172   -11.008 1.00 0.00 ? 101 PRO A HG2  2  
ATOM 3919  H HG3  . PRO A 1 101 ? -3.667  5.396   -11.206 1.00 0.00 ? 101 PRO A HG3  2  
ATOM 3920  H HD2  . PRO A 1 101 ? -1.587  7.661   -10.900 1.00 0.00 ? 101 PRO A HD2  2  
ATOM 3921  H HD3  . PRO A 1 101 ? -1.788  6.149   -9.916  1.00 0.00 ? 101 PRO A HD3  2  
ATOM 3922  N N    . SER A 1 102 ? -0.978  5.670   -15.547 1.00 0.00 ? 102 SER A N    2  
ATOM 3923  C CA   . SER A 1 102 ? -0.395  6.066   -16.841 1.00 0.00 ? 102 SER A CA   2  
ATOM 3924  C C    . SER A 1 102 ? 1.107   6.410   -16.805 1.00 0.00 ? 102 SER A C    2  
ATOM 3925  O O    . SER A 1 102 ? 1.588   7.259   -17.557 1.00 0.00 ? 102 SER A O    2  
ATOM 3926  C CB   . SER A 1 102 ? -1.247  7.171   -17.554 1.00 0.00 ? 102 SER A CB   2  
ATOM 3927  O OG   . SER A 1 102 ? -0.885  7.360   -18.927 1.00 0.00 ? 102 SER A OG   2  
ATOM 3928  H H    . SER A 1 102 ? -1.350  4.745   -15.507 1.00 0.00 ? 102 SER A H    2  
ATOM 3929  H HA   . SER A 1 102 ? -0.474  5.191   -17.470 1.00 0.00 ? 102 SER A HA   2  
ATOM 3930  H HB2  . SER A 1 102 ? -2.316  6.862   -17.513 1.00 0.00 ? 102 SER A HB2  2  
ATOM 3931  H HB3  . SER A 1 102 ? -1.175  8.132   -16.996 1.00 0.00 ? 102 SER A HB3  2  
ATOM 3932  H HG   . SER A 1 102 ? 0.045   7.633   -18.883 1.00 0.00 ? 102 SER A HG   2  
ATOM 3933  N N    . ALA A 1 103 ? 1.865   5.760   -15.878 1.00 0.00 ? 103 ALA A N    2  
ATOM 3934  C CA   . ALA A 1 103 ? 3.294   5.910   -15.608 1.00 0.00 ? 103 ALA A CA   2  
ATOM 3935  C C    . ALA A 1 103 ? 3.650   7.196   -14.863 1.00 0.00 ? 103 ALA A C    2  
ATOM 3936  O O    . ALA A 1 103 ? 4.037   7.184   -13.695 1.00 0.00 ? 103 ALA A O    2  
ATOM 3937  C CB   . ALA A 1 103 ? 4.179   5.697   -16.871 1.00 0.00 ? 103 ALA A CB   2  
ATOM 3938  H H    . ALA A 1 103 ? 1.390   5.111   -15.293 1.00 0.00 ? 103 ALA A H    2  
ATOM 3939  H HA   . ALA A 1 103 ? 3.545   5.120   -14.916 1.00 0.00 ? 103 ALA A HA   2  
ATOM 3940  H HB1  . ALA A 1 103 ? 3.935   6.408   -17.687 1.00 0.00 ? 103 ALA A HB1  2  
ATOM 3941  H HB2  . ALA A 1 103 ? 5.263   5.794   -16.649 1.00 0.00 ? 103 ALA A HB2  2  
ATOM 3942  H HB3  . ALA A 1 103 ? 4.007   4.673   -17.267 1.00 0.00 ? 103 ALA A HB3  2  
ATOM 3943  N N    . SER A 1 104 ? 3.502   8.329   -15.589 1.00 0.00 ? 104 SER A N    2  
ATOM 3944  C CA   . SER A 1 104 ? 3.819   9.717   -15.276 1.00 0.00 ? 104 SER A CA   2  
ATOM 3945  C C    . SER A 1 104 ? 2.572   10.598  -15.295 1.00 0.00 ? 104 SER A C    2  
ATOM 3946  O O    . SER A 1 104 ? 2.637   11.827  -15.217 1.00 0.00 ? 104 SER A O    2  
ATOM 3947  C CB   . SER A 1 104 ? 4.811   10.265  -16.349 1.00 0.00 ? 104 SER A CB   2  
ATOM 3948  O OG   . SER A 1 104 ? 5.897   9.355   -16.546 1.00 0.00 ? 104 SER A OG   2  
ATOM 3949  H H    . SER A 1 104 ? 3.177   8.223   -16.528 1.00 0.00 ? 104 SER A H    2  
ATOM 3950  H HA   . SER A 1 104 ? 4.275   9.792   -14.297 1.00 0.00 ? 104 SER A HA   2  
ATOM 3951  H HB2  . SER A 1 104 ? 4.311   10.390  -17.336 1.00 0.00 ? 104 SER A HB2  2  
ATOM 3952  H HB3  . SER A 1 104 ? 5.222   11.252  -16.043 1.00 0.00 ? 104 SER A HB3  2  
ATOM 3953  H HG   . SER A 1 104 ? 6.293   9.214   -15.656 1.00 0.00 ? 104 SER A HG   2  
ATOM 3954  N N    . CYS A 1 105 ? 1.368   9.981   -15.454 1.00 0.00 ? 105 CYS A N    2  
ATOM 3955  C CA   . CYS A 1 105 ? 0.047   10.611  -15.533 1.00 0.00 ? 105 CYS A CA   2  
ATOM 3956  C C    . CYS A 1 105 ? -0.265  11.316  -16.850 1.00 0.00 ? 105 CYS A C    2  
ATOM 3957  O O    . CYS A 1 105 ? -1.215  10.952  -17.539 1.00 0.00 ? 105 CYS A O    2  
ATOM 3958  C CB   . CYS A 1 105 ? -0.340  11.530  -14.328 1.00 0.00 ? 105 CYS A CB   2  
ATOM 3959  S SG   . CYS A 1 105 ? -0.315  10.670  -12.725 1.00 0.00 ? 105 CYS A SG   2  
ATOM 3960  H H    . CYS A 1 105 ? 1.339   8.984   -15.520 1.00 0.00 ? 105 CYS A H    2  
ATOM 3961  H HA   . CYS A 1 105 ? -0.654  9.792   -15.507 1.00 0.00 ? 105 CYS A HA   2  
ATOM 3962  H HB2  . CYS A 1 105 ? 0.351   12.398  -14.286 1.00 0.00 ? 105 CYS A HB2  2  
ATOM 3963  H HB3  . CYS A 1 105 ? -1.365  11.936  -14.480 1.00 0.00 ? 105 CYS A HB3  2  
ATOM 3964  H HG   . CYS A 1 105 ? 0.982   10.830  -12.489 1.00 0.00 ? 105 CYS A HG   2  
ATOM 3965  N N    . ASP A 1 106 ? 0.525   12.366  -17.188 1.00 0.00 ? 106 ASP A N    2  
ATOM 3966  C CA   . ASP A 1 106 ? 0.329   13.209  -18.364 1.00 0.00 ? 106 ASP A CA   2  
ATOM 3967  C C    . ASP A 1 106 ? 1.633   13.811  -18.855 1.00 0.00 ? 106 ASP A C    2  
ATOM 3968  O O    . ASP A 1 106 ? 1.829   13.974  -20.058 1.00 0.00 ? 106 ASP A O    2  
ATOM 3969  C CB   . ASP A 1 106 ? -0.647  14.414  -18.117 1.00 0.00 ? 106 ASP A CB   2  
ATOM 3970  C CG   . ASP A 1 106 ? -2.090  13.948  -17.895 1.00 0.00 ? 106 ASP A CG   2  
ATOM 3971  O OD1  . ASP A 1 106 ? -2.682  13.382  -18.853 1.00 0.00 ? 106 ASP A OD1  2  
ATOM 3972  O OD2  . ASP A 1 106 ? -2.616  14.155  -16.769 1.00 0.00 ? 106 ASP A OD2  2  
ATOM 3973  H H    . ASP A 1 106 ? 1.291   12.554  -16.569 1.00 0.00 ? 106 ASP A H    2  
ATOM 3974  H HA   . ASP A 1 106 ? -0.043  12.609  -19.187 1.00 0.00 ? 106 ASP A HA   2  
ATOM 3975  H HB2  . ASP A 1 106 ? -0.313  14.989  -17.226 1.00 0.00 ? 106 ASP A HB2  2  
ATOM 3976  H HB3  . ASP A 1 106 ? -0.669  15.105  -18.990 1.00 0.00 ? 106 ASP A HB3  2  
ATOM 3977  N N    . LYS A 1 107 ? 2.546   14.237  -17.937 1.00 0.00 ? 107 LYS A N    2  
ATOM 3978  C CA   . LYS A 1 107 ? 3.777   14.958  -18.251 1.00 0.00 ? 107 LYS A CA   2  
ATOM 3979  C C    . LYS A 1 107 ? 4.995   14.049  -18.148 1.00 0.00 ? 107 LYS A C    2  
ATOM 3980  O O    . LYS A 1 107 ? 5.279   13.492  -17.088 1.00 0.00 ? 107 LYS A O    2  
ATOM 3981  C CB   . LYS A 1 107 ? 3.952   16.206  -17.335 1.00 0.00 ? 107 LYS A CB   2  
ATOM 3982  C CG   . LYS A 1 107 ? 2.744   17.168  -17.330 1.00 0.00 ? 107 LYS A CG   2  
ATOM 3983  C CD   . LYS A 1 107 ? 2.353   17.753  -18.703 1.00 0.00 ? 107 LYS A CD   2  
ATOM 3984  C CE   . LYS A 1 107 ? 3.447   18.576  -19.404 1.00 0.00 ? 107 LYS A CE   2  
ATOM 3985  N NZ   . LYS A 1 107 ? 3.861   19.741  -18.587 1.00 0.00 ? 107 LYS A NZ   2  
ATOM 3986  H H    . LYS A 1 107 ? 2.402   14.122  -16.962 1.00 0.00 ? 107 LYS A H    2  
ATOM 3987  H HA   . LYS A 1 107 ? 3.743   15.317  -19.271 1.00 0.00 ? 107 LYS A HA   2  
ATOM 3988  H HB2  . LYS A 1 107 ? 4.109   15.872  -16.283 1.00 0.00 ? 107 LYS A HB2  2  
ATOM 3989  H HB3  . LYS A 1 107 ? 4.855   16.782  -17.641 1.00 0.00 ? 107 LYS A HB3  2  
ATOM 3990  H HG2  . LYS A 1 107 ? 1.861   16.631  -16.916 1.00 0.00 ? 107 LYS A HG2  2  
ATOM 3991  H HG3  . LYS A 1 107 ? 2.969   18.009  -16.635 1.00 0.00 ? 107 LYS A HG3  2  
ATOM 3992  H HD2  . LYS A 1 107 ? 2.047   16.924  -19.379 1.00 0.00 ? 107 LYS A HD2  2  
ATOM 3993  H HD3  . LYS A 1 107 ? 1.459   18.403  -18.565 1.00 0.00 ? 107 LYS A HD3  2  
ATOM 3994  H HE2  . LYS A 1 107 ? 4.348   17.959  -19.596 1.00 0.00 ? 107 LYS A HE2  2  
ATOM 3995  H HE3  . LYS A 1 107 ? 3.065   18.967  -20.371 1.00 0.00 ? 107 LYS A HE3  2  
ATOM 3996  H HZ1  . LYS A 1 107 ? 3.038   20.352  -18.412 1.00 0.00 ? 107 LYS A HZ1  2  
ATOM 3997  H HZ2  . LYS A 1 107 ? 4.244   19.408  -17.679 1.00 0.00 ? 107 LYS A HZ2  2  
ATOM 3998  H HZ3  . LYS A 1 107 ? 4.591   20.280  -19.096 1.00 0.00 ? 107 LYS A HZ3  2  
ATOM 3999  N N    . ILE A 1 108 ? 5.726   13.902  -19.296 1.00 0.00 ? 108 ILE A N    2  
ATOM 4000  C CA   . ILE A 1 108 ? 6.895   13.033  -19.506 1.00 0.00 ? 108 ILE A CA   2  
ATOM 4001  C C    . ILE A 1 108 ? 6.458   11.612  -19.900 1.00 0.00 ? 108 ILE A C    2  
ATOM 4002  O O    . ILE A 1 108 ? 5.513   11.038  -19.374 1.00 0.00 ? 108 ILE A O    2  
ATOM 4003  C CB   . ILE A 1 108 ? 7.998   13.089  -18.411 1.00 0.00 ? 108 ILE A CB   2  
ATOM 4004  C CG1  . ILE A 1 108 ? 8.598   14.526  -18.287 1.00 0.00 ? 108 ILE A CG1  2  
ATOM 4005  C CG2  . ILE A 1 108 ? 9.144   12.059  -18.611 1.00 0.00 ? 108 ILE A CG2  2  
ATOM 4006  C CD1  . ILE A 1 108 ? 9.352   15.029  -19.533 1.00 0.00 ? 108 ILE A CD1  2  
ATOM 4007  H H    . ILE A 1 108 ? 5.435   14.402  -20.107 1.00 0.00 ? 108 ILE A H    2  
ATOM 4008  H HA   . ILE A 1 108 ? 7.356   13.422  -20.399 1.00 0.00 ? 108 ILE A HA   2  
ATOM 4009  H HB   . ILE A 1 108 ? 7.519   12.833  -17.436 1.00 0.00 ? 108 ILE A HB   2  
ATOM 4010  H HG12 . ILE A 1 108 ? 7.770   15.239  -18.063 1.00 0.00 ? 108 ILE A HG12 2  
ATOM 4011  H HG13 . ILE A 1 108 ? 9.293   14.538  -17.409 1.00 0.00 ? 108 ILE A HG13 2  
ATOM 4012  H HG21 . ILE A 1 108 ? 9.583   12.135  -19.627 1.00 0.00 ? 108 ILE A HG21 2  
ATOM 4013  H HG22 . ILE A 1 108 ? 9.953   12.244  -17.871 1.00 0.00 ? 108 ILE A HG22 2  
ATOM 4014  H HG23 . ILE A 1 108 ? 8.785   11.019  -18.454 1.00 0.00 ? 108 ILE A HG23 2  
ATOM 4015  H HD11 . ILE A 1 108 ? 10.169  14.334  -19.822 1.00 0.00 ? 108 ILE A HD11 2  
ATOM 4016  H HD12 . ILE A 1 108 ? 8.662   15.139  -20.396 1.00 0.00 ? 108 ILE A HD12 2  
ATOM 4017  H HD13 . ILE A 1 108 ? 9.801   16.028  -19.341 1.00 0.00 ? 108 ILE A HD13 2  
ATOM 4018  N N    . LEU A 1 109 ? 7.160   11.008  -20.891 1.00 0.00 ? 109 LEU A N    2  
ATOM 4019  C CA   . LEU A 1 109 ? 6.927   9.666   -21.398 1.00 0.00 ? 109 LEU A CA   2  
ATOM 4020  C C    . LEU A 1 109 ? 7.703   8.576   -20.645 1.00 0.00 ? 109 LEU A C    2  
ATOM 4021  O O    . LEU A 1 109 ? 8.304   8.791   -19.591 1.00 0.00 ? 109 LEU A O    2  
ATOM 4022  C CB   . LEU A 1 109 ? 7.184   9.624   -22.937 1.00 0.00 ? 109 LEU A CB   2  
ATOM 4023  C CG   . LEU A 1 109 ? 8.646   9.745   -23.459 1.00 0.00 ? 109 LEU A CG   2  
ATOM 4024  C CD1  . LEU A 1 109 ? 8.674   9.479   -24.975 1.00 0.00 ? 109 LEU A CD1  2  
ATOM 4025  C CD2  . LEU A 1 109 ? 9.317   11.102  -23.169 1.00 0.00 ? 109 LEU A CD2  2  
ATOM 4026  H H    . LEU A 1 109 ? 7.914   11.483  -21.329 1.00 0.00 ? 109 LEU A H    2  
ATOM 4027  H HA   . LEU A 1 109 ? 5.880   9.420   -21.269 1.00 0.00 ? 109 LEU A HA   2  
ATOM 4028  H HB2  . LEU A 1 109 ? 6.751   8.689   -23.351 1.00 0.00 ? 109 LEU A HB2  2  
ATOM 4029  H HB3  . LEU A 1 109 ? 6.598   10.458  -23.383 1.00 0.00 ? 109 LEU A HB3  2  
ATOM 4030  H HG   . LEU A 1 109 ? 9.266   8.951   -22.979 1.00 0.00 ? 109 LEU A HG   2  
ATOM 4031  H HD11 . LEU A 1 109 ? 8.251   8.477   -25.202 1.00 0.00 ? 109 LEU A HD11 2  
ATOM 4032  H HD12 . LEU A 1 109 ? 8.073   10.243  -25.511 1.00 0.00 ? 109 LEU A HD12 2  
ATOM 4033  H HD13 . LEU A 1 109 ? 9.715   9.516   -25.360 1.00 0.00 ? 109 LEU A HD13 2  
ATOM 4034  H HD21 . LEU A 1 109 ? 8.696   11.933  -23.563 1.00 0.00 ? 109 LEU A HD21 2  
ATOM 4035  H HD22 . LEU A 1 109 ? 9.487   11.242  -22.082 1.00 0.00 ? 109 LEU A HD22 2  
ATOM 4036  H HD23 . LEU A 1 109 ? 10.306  11.147  -23.673 1.00 0.00 ? 109 LEU A HD23 2  
ATOM 4037  N N    . VAL A 1 110 ? 7.704   7.340   -21.213 1.00 0.00 ? 110 VAL A N    2  
ATOM 4038  C CA   . VAL A 1 110 ? 8.338   6.133   -20.710 1.00 0.00 ? 110 VAL A CA   2  
ATOM 4039  C C    . VAL A 1 110 ? 9.764   6.083   -21.251 1.00 0.00 ? 110 VAL A C    2  
ATOM 4040  O O    . VAL A 1 110 ? 10.006  5.696   -22.393 1.00 0.00 ? 110 VAL A O    2  
ATOM 4041  C CB   . VAL A 1 110 ? 7.507   4.904   -21.110 1.00 0.00 ? 110 VAL A CB   2  
ATOM 4042  C CG1  . VAL A 1 110 ? 8.115   3.597   -20.549 1.00 0.00 ? 110 VAL A CG1  2  
ATOM 4043  C CG2  . VAL A 1 110 ? 6.054   5.079   -20.598 1.00 0.00 ? 110 VAL A CG2  2  
ATOM 4044  H H    . VAL A 1 110 ? 7.221   7.191   -22.067 1.00 0.00 ? 110 VAL A H    2  
ATOM 4045  H HA   . VAL A 1 110 ? 8.384   6.165   -19.629 1.00 0.00 ? 110 VAL A HA   2  
ATOM 4046  H HB   . VAL A 1 110 ? 7.460   4.828   -22.222 1.00 0.00 ? 110 VAL A HB   2  
ATOM 4047  H HG11 . VAL A 1 110 ? 8.241   3.666   -19.447 1.00 0.00 ? 110 VAL A HG11 2  
ATOM 4048  H HG12 . VAL A 1 110 ? 7.442   2.741   -20.773 1.00 0.00 ? 110 VAL A HG12 2  
ATOM 4049  H HG13 . VAL A 1 110 ? 9.098   3.375   -21.015 1.00 0.00 ? 110 VAL A HG13 2  
ATOM 4050  H HG21 . VAL A 1 110 ? 6.041   5.170   -19.491 1.00 0.00 ? 110 VAL A HG21 2  
ATOM 4051  H HG22 . VAL A 1 110 ? 5.558   5.969   -21.038 1.00 0.00 ? 110 VAL A HG22 2  
ATOM 4052  H HG23 . VAL A 1 110 ? 5.450   4.193   -20.883 1.00 0.00 ? 110 VAL A HG23 2  
ATOM 4053  N N    . ILE A 1 111 ? 10.742  6.531   -20.423 1.00 0.00 ? 111 ILE A N    2  
ATOM 4054  C CA   . ILE A 1 111 ? 12.160  6.616   -20.753 1.00 0.00 ? 111 ILE A CA   2  
ATOM 4055  C C    . ILE A 1 111 ? 12.894  5.515   -19.982 1.00 0.00 ? 111 ILE A C    2  
ATOM 4056  O O    . ILE A 1 111 ? 12.915  5.621   -18.758 1.00 0.00 ? 111 ILE A O    2  
ATOM 4057  C CB   . ILE A 1 111 ? 12.764  7.993   -20.400 1.00 0.00 ? 111 ILE A CB   2  
ATOM 4058  C CG1  . ILE A 1 111 ? 11.959  9.135   -21.085 1.00 0.00 ? 111 ILE A CG1  2  
ATOM 4059  C CG2  . ILE A 1 111 ? 14.259  8.049   -20.825 1.00 0.00 ? 111 ILE A CG2  2  
ATOM 4060  C CD1  . ILE A 1 111 ? 12.479  10.545  -20.758 1.00 0.00 ? 111 ILE A CD1  2  
ATOM 4061  H H    . ILE A 1 111 ? 10.490  6.853   -19.510 1.00 0.00 ? 111 ILE A H    2  
ATOM 4062  H HA   . ILE A 1 111 ? 12.306  6.497   -21.819 1.00 0.00 ? 111 ILE A HA   2  
ATOM 4063  H HB   . ILE A 1 111 ? 12.708  8.159   -19.296 1.00 0.00 ? 111 ILE A HB   2  
ATOM 4064  H HG12 . ILE A 1 111 ? 12.007  8.983   -22.188 1.00 0.00 ? 111 ILE A HG12 2  
ATOM 4065  H HG13 . ILE A 1 111 ? 10.884  9.067   -20.779 1.00 0.00 ? 111 ILE A HG13 2  
ATOM 4066  H HG21 . ILE A 1 111 ? 14.364  7.867   -21.915 1.00 0.00 ? 111 ILE A HG21 2  
ATOM 4067  H HG22 . ILE A 1 111 ? 14.696  9.042   -20.597 1.00 0.00 ? 111 ILE A HG22 2  
ATOM 4068  H HG23 . ILE A 1 111 ? 14.881  7.309   -20.280 1.00 0.00 ? 111 ILE A HG23 2  
ATOM 4069  H HD11 . ILE A 1 111 ? 12.509  10.714  -19.659 1.00 0.00 ? 111 ILE A HD11 2  
ATOM 4070  H HD12 . ILE A 1 111 ? 13.504  10.697  -21.160 1.00 0.00 ? 111 ILE A HD12 2  
ATOM 4071  H HD13 . ILE A 1 111 ? 11.828  11.324  -21.213 1.00 0.00 ? 111 ILE A HD13 2  
ATOM 4072  N N    . PRO A 1 112 ? 13.492  4.454   -20.578 1.00 0.00 ? 112 PRO A N    2  
ATOM 4073  C CA   . PRO A 1 112 ? 14.295  3.457   -19.863 1.00 0.00 ? 112 PRO A CA   2  
ATOM 4074  C C    . PRO A 1 112 ? 15.708  4.008   -19.598 1.00 0.00 ? 112 PRO A C    2  
ATOM 4075  O O    . PRO A 1 112 ? 15.960  4.477   -18.489 1.00 0.00 ? 112 PRO A O    2  
ATOM 4076  C CB   . PRO A 1 112 ? 14.252  2.238   -20.814 1.00 0.00 ? 112 PRO A CB   2  
ATOM 4077  C CG   . PRO A 1 112 ? 14.053  2.801   -22.232 1.00 0.00 ? 112 PRO A CG   2  
ATOM 4078  C CD   . PRO A 1 112 ? 13.373  4.159   -22.007 1.00 0.00 ? 112 PRO A CD   2  
ATOM 4079  H HA   . PRO A 1 112 ? 13.863  3.215   -18.900 1.00 0.00 ? 112 PRO A HA   2  
ATOM 4080  H HB2  . PRO A 1 112 ? 15.127  1.560   -20.734 1.00 0.00 ? 112 PRO A HB2  2  
ATOM 4081  H HB3  . PRO A 1 112 ? 13.345  1.644   -20.555 1.00 0.00 ? 112 PRO A HB3  2  
ATOM 4082  H HG2  . PRO A 1 112 ? 15.029  2.945   -22.741 1.00 0.00 ? 112 PRO A HG2  2  
ATOM 4083  H HG3  . PRO A 1 112 ? 13.426  2.127   -22.851 1.00 0.00 ? 112 PRO A HG3  2  
ATOM 4084  H HD2  . PRO A 1 112 ? 13.865  4.952   -22.615 1.00 0.00 ? 112 PRO A HD2  2  
ATOM 4085  H HD3  . PRO A 1 112 ? 12.297  4.085   -22.291 1.00 0.00 ? 112 PRO A HD3  2  
ATOM 4086  N N    . SER A 1 113 ? 16.597  3.964   -20.620 1.00 0.00 ? 113 SER A N    2  
ATOM 4087  C CA   . SER A 1 113 ? 17.984  4.433   -20.716 1.00 0.00 ? 113 SER A CA   2  
ATOM 4088  C C    . SER A 1 113 ? 18.735  3.387   -21.502 1.00 0.00 ? 113 SER A C    2  
ATOM 4089  O O    . SER A 1 113 ? 19.431  3.686   -22.464 1.00 0.00 ? 113 SER A O    2  
ATOM 4090  C CB   . SER A 1 113 ? 18.789  4.767   -19.420 1.00 0.00 ? 113 SER A CB   2  
ATOM 4091  O OG   . SER A 1 113 ? 18.162  5.823   -18.700 1.00 0.00 ? 113 SER A OG   2  
ATOM 4092  H H    . SER A 1 113 ? 16.252  3.565   -21.465 1.00 0.00 ? 113 SER A H    2  
ATOM 4093  H HA   . SER A 1 113 ? 17.966  5.325   -21.324 1.00 0.00 ? 113 SER A HA   2  
ATOM 4094  H HB2  . SER A 1 113 ? 18.863  3.878   -18.758 1.00 0.00 ? 113 SER A HB2  2  
ATOM 4095  H HB3  . SER A 1 113 ? 19.819  5.104   -19.672 1.00 0.00 ? 113 SER A HB3  2  
ATOM 4096  H HG   . SER A 1 113 ? 17.262  5.479   -18.498 1.00 0.00 ? 113 SER A HG   2  
ATOM 4097  N N    . LYS A 1 114 ? 18.579  2.111   -21.086 1.00 0.00 ? 114 LYS A N    2  
ATOM 4098  C CA   . LYS A 1 114 ? 19.165  0.931   -21.685 1.00 0.00 ? 114 LYS A CA   2  
ATOM 4099  C C    . LYS A 1 114 ? 18.268  -0.183  -21.175 1.00 0.00 ? 114 LYS A C    2  
ATOM 4100  O O    . LYS A 1 114 ? 17.330  0.106   -20.431 1.00 0.00 ? 114 LYS A O    2  
ATOM 4101  C CB   . LYS A 1 114 ? 20.662  0.757   -21.288 1.00 0.00 ? 114 LYS A CB   2  
ATOM 4102  C CG   . LYS A 1 114 ? 21.476  -0.197  -22.184 1.00 0.00 ? 114 LYS A CG   2  
ATOM 4103  C CD   . LYS A 1 114 ? 22.997  -0.082  -21.968 1.00 0.00 ? 114 LYS A CD   2  
ATOM 4104  C CE   . LYS A 1 114 ? 23.491  -0.587  -20.603 1.00 0.00 ? 114 LYS A CE   2  
ATOM 4105  N NZ   . LYS A 1 114 ? 23.249  -2.041  -20.449 1.00 0.00 ? 114 LYS A NZ   2  
ATOM 4106  H H    . LYS A 1 114 ? 17.981  1.899   -20.310 1.00 0.00 ? 114 LYS A H    2  
ATOM 4107  H HA   . LYS A 1 114 ? 19.060  0.986   -22.762 1.00 0.00 ? 114 LYS A HA   2  
ATOM 4108  H HB2  . LYS A 1 114 ? 21.139  1.758   -21.400 1.00 0.00 ? 114 LYS A HB2  2  
ATOM 4109  H HB3  . LYS A 1 114 ? 20.762  0.482   -20.215 1.00 0.00 ? 114 LYS A HB3  2  
ATOM 4110  H HG2  . LYS A 1 114 ? 21.169  -1.251  -22.027 1.00 0.00 ? 114 LYS A HG2  2  
ATOM 4111  H HG3  . LYS A 1 114 ? 21.265  0.064   -23.247 1.00 0.00 ? 114 LYS A HG3  2  
ATOM 4112  H HD2  . LYS A 1 114 ? 23.515  -0.659  -22.768 1.00 0.00 ? 114 LYS A HD2  2  
ATOM 4113  H HD3  . LYS A 1 114 ? 23.296  0.984   -22.081 1.00 0.00 ? 114 LYS A HD3  2  
ATOM 4114  H HE2  . LYS A 1 114 ? 24.586  -0.424  -20.511 1.00 0.00 ? 114 LYS A HE2  2  
ATOM 4115  H HE3  . LYS A 1 114 ? 22.977  -0.066  -19.771 1.00 0.00 ? 114 LYS A HE3  2  
ATOM 4116  H HZ1  . LYS A 1 114 ? 23.753  -2.556  -21.198 1.00 0.00 ? 114 LYS A HZ1  2  
ATOM 4117  H HZ2  . LYS A 1 114 ? 23.593  -2.354  -19.520 1.00 0.00 ? 114 LYS A HZ2  2  
ATOM 4118  H HZ3  . LYS A 1 114 ? 22.229  -2.231  -20.524 1.00 0.00 ? 114 LYS A HZ3  2  
ATOM 4119  N N    . VAL A 1 115 ? 18.512  -1.463  -21.562 1.00 0.00 ? 115 VAL A N    2  
ATOM 4120  C CA   . VAL A 1 115 ? 17.732  -2.637  -21.174 1.00 0.00 ? 115 VAL A CA   2  
ATOM 4121  C C    . VAL A 1 115 ? 18.350  -3.375  -19.985 1.00 0.00 ? 115 VAL A C    2  
ATOM 4122  O O    . VAL A 1 115 ? 17.670  -4.137  -19.299 1.00 0.00 ? 115 VAL A O    2  
ATOM 4123  C CB   . VAL A 1 115 ? 17.483  -3.558  -22.371 1.00 0.00 ? 115 VAL A CB   2  
ATOM 4124  C CG1  . VAL A 1 115 ? 16.408  -2.903  -23.268 1.00 0.00 ? 115 VAL A CG1  2  
ATOM 4125  C CG2  . VAL A 1 115 ? 18.781  -3.810  -23.171 1.00 0.00 ? 115 VAL A CG2  2  
ATOM 4126  H H    . VAL A 1 115 ? 19.255  -1.659  -22.195 1.00 0.00 ? 115 VAL A H    2  
ATOM 4127  H HA   . VAL A 1 115 ? 16.753  -2.326  -20.828 1.00 0.00 ? 115 VAL A HA   2  
ATOM 4128  H HB   . VAL A 1 115 ? 17.067  -4.541  -22.043 1.00 0.00 ? 115 VAL A HB   2  
ATOM 4129  H HG11 . VAL A 1 115 ? 15.467  -2.736  -22.704 1.00 0.00 ? 115 VAL A HG11 2  
ATOM 4130  H HG12 . VAL A 1 115 ? 16.763  -1.927  -23.660 1.00 0.00 ? 115 VAL A HG12 2  
ATOM 4131  H HG13 . VAL A 1 115 ? 16.182  -3.562  -24.134 1.00 0.00 ? 115 VAL A HG13 2  
ATOM 4132  H HG21 . VAL A 1 115 ? 19.561  -4.286  -22.539 1.00 0.00 ? 115 VAL A HG21 2  
ATOM 4133  H HG22 . VAL A 1 115 ? 18.563  -4.497  -24.017 1.00 0.00 ? 115 VAL A HG22 2  
ATOM 4134  H HG23 . VAL A 1 115 ? 19.182  -2.877  -23.615 1.00 0.00 ? 115 VAL A HG23 2  
ATOM 4135  N N    . TRP A 1 116 ? 19.666  -3.134  -19.705 1.00 0.00 ? 116 TRP A N    2  
ATOM 4136  C CA   . TRP A 1 116 ? 20.502  -3.651  -18.611 1.00 0.00 ? 116 TRP A CA   2  
ATOM 4137  C C    . TRP A 1 116 ? 20.573  -5.184  -18.431 1.00 0.00 ? 116 TRP A C    2  
ATOM 4138  O O    . TRP A 1 116 ? 21.512  -5.848  -18.869 1.00 0.00 ? 116 TRP A O    2  
ATOM 4139  C CB   . TRP A 1 116 ? 20.204  -2.938  -17.250 1.00 0.00 ? 116 TRP A CB   2  
ATOM 4140  C CG   . TRP A 1 116 ? 20.135  -1.410  -17.274 1.00 0.00 ? 116 TRP A CG   2  
ATOM 4141  C CD1  . TRP A 1 116 ? 21.147  -0.489  -17.245 1.00 0.00 ? 116 TRP A CD1  2  
ATOM 4142  C CD2  . TRP A 1 116 ? 18.905  -0.658  -17.199 1.00 0.00 ? 116 TRP A CD2  2  
ATOM 4143  N NE1  . TRP A 1 116 ? 20.625  0.787   -17.159 1.00 0.00 ? 116 TRP A NE1  2  
ATOM 4144  C CE2  . TRP A 1 116 ? 19.251  0.692   -17.124 1.00 0.00 ? 116 TRP A CE2  2  
ATOM 4145  C CE3  . TRP A 1 116 ? 17.592  -1.056  -17.169 1.00 0.00 ? 116 TRP A CE3  2  
ATOM 4146  C CZ2  . TRP A 1 116 ? 18.295  1.660   -17.015 1.00 0.00 ? 116 TRP A CZ2  2  
ATOM 4147  C CZ3  . TRP A 1 116 ? 16.625  -0.072  -17.081 1.00 0.00 ? 116 TRP A CZ3  2  
ATOM 4148  C CH2  . TRP A 1 116 ? 16.972  1.266   -17.008 1.00 0.00 ? 116 TRP A CH2  2  
ATOM 4149  H H    . TRP A 1 116 ? 20.139  -2.489  -20.293 1.00 0.00 ? 116 TRP A H    2  
ATOM 4150  H HA   . TRP A 1 116 ? 21.509  -3.373  -18.885 1.00 0.00 ? 116 TRP A HA   2  
ATOM 4151  H HB2  . TRP A 1 116 ? 19.226  -3.275  -16.852 1.00 0.00 ? 116 TRP A HB2  2  
ATOM 4152  H HB3  . TRP A 1 116 ? 20.987  -3.218  -16.509 1.00 0.00 ? 116 TRP A HB3  2  
ATOM 4153  H HD1  . TRP A 1 116 ? 22.201  -0.734  -17.245 1.00 0.00 ? 116 TRP A HD1  2  
ATOM 4154  H HE1  . TRP A 1 116 ? 21.131  1.612   -17.020 1.00 0.00 ? 116 TRP A HE1  2  
ATOM 4155  H HE3  . TRP A 1 116 ? 17.299  -2.093  -17.220 1.00 0.00 ? 116 TRP A HE3  2  
ATOM 4156  H HZ2  . TRP A 1 116 ? 18.549  2.705   -16.919 1.00 0.00 ? 116 TRP A HZ2  2  
ATOM 4157  H HZ3  . TRP A 1 116 ? 15.578  -0.347  -17.069 1.00 0.00 ? 116 TRP A HZ3  2  
ATOM 4158  H HH2  . TRP A 1 116 ? 16.196  2.017   -16.935 1.00 0.00 ? 116 TRP A HH2  2  
ATOM 4159  N N    . GLN A 1 117 ? 19.536  -5.744  -17.758 1.00 0.00 ? 117 GLN A N    2  
ATOM 4160  C CA   . GLN A 1 117 ? 19.340  -7.145  -17.453 1.00 0.00 ? 117 GLN A CA   2  
ATOM 4161  C C    . GLN A 1 117 ? 18.042  -7.666  -18.065 1.00 0.00 ? 117 GLN A C    2  
ATOM 4162  O O    . GLN A 1 117 ? 17.621  -8.780  -17.763 1.00 0.00 ? 117 GLN A O    2  
ATOM 4163  C CB   . GLN A 1 117 ? 19.386  -7.382  -15.907 1.00 0.00 ? 117 GLN A CB   2  
ATOM 4164  C CG   . GLN A 1 117 ? 18.562  -6.418  -15.005 1.00 0.00 ? 117 GLN A CG   2  
ATOM 4165  C CD   . GLN A 1 117 ? 17.039  -6.556  -15.148 1.00 0.00 ? 117 GLN A CD   2  
ATOM 4166  O OE1  . GLN A 1 117 ? 16.438  -7.594  -14.864 1.00 0.00 ? 117 GLN A OE1  2  
ATOM 4167  N NE2  . GLN A 1 117 ? 16.382  -5.457  -15.601 1.00 0.00 ? 117 GLN A NE2  2  
ATOM 4168  H H    . GLN A 1 117 ? 18.813  -5.130  -17.452 1.00 0.00 ? 117 GLN A H    2  
ATOM 4169  H HA   . GLN A 1 117 ? 20.128  -7.741  -17.897 1.00 0.00 ? 117 GLN A HA   2  
ATOM 4170  H HB2  . GLN A 1 117 ? 19.118  -8.433  -15.662 1.00 0.00 ? 117 GLN A HB2  2  
ATOM 4171  H HB3  . GLN A 1 117 ? 20.452  -7.256  -15.601 1.00 0.00 ? 117 GLN A HB3  2  
ATOM 4172  H HG2  . GLN A 1 117 ? 18.801  -6.657  -13.945 1.00 0.00 ? 117 GLN A HG2  2  
ATOM 4173  H HG3  . GLN A 1 117 ? 18.874  -5.369  -15.179 1.00 0.00 ? 117 GLN A HG3  2  
ATOM 4174  H HE21 . GLN A 1 117 ? 16.868  -4.613  -15.805 1.00 0.00 ? 117 GLN A HE21 2  
ATOM 4175  H HE22 . GLN A 1 117 ? 15.400  -5.558  -15.740 1.00 0.00 ? 117 GLN A HE22 2  
ATOM 4176  N N    . GLY A 1 118 ? 17.338  -6.871  -18.925 1.00 0.00 ? 118 GLY A N    2  
ATOM 4177  C CA   . GLY A 1 118 ? 16.002  -7.150  -19.492 1.00 0.00 ? 118 GLY A CA   2  
ATOM 4178  C C    . GLY A 1 118 ? 15.768  -8.350  -20.405 1.00 0.00 ? 118 GLY A C    2  
ATOM 4179  O O    . GLY A 1 118 ? 15.334  -8.218  -21.550 1.00 0.00 ? 118 GLY A O    2  
ATOM 4180  H H    . GLY A 1 118 ? 17.700  -5.954  -19.142 1.00 0.00 ? 118 GLY A H    2  
ATOM 4181  H HA2  . GLY A 1 118 ? 15.318  -7.260  -18.662 1.00 0.00 ? 118 GLY A HA2  2  
ATOM 4182  H HA3  . GLY A 1 118 ? 15.754  -6.283  -20.088 1.00 0.00 ? 118 GLY A HA3  2  
ATOM 4183  N N    . GLN A 1 119 ? 16.024  -9.581  -19.907 1.00 0.00 ? 119 GLN A N    2  
ATOM 4184  C CA   . GLN A 1 119 ? 15.839  -10.809 -20.664 1.00 0.00 ? 119 GLN A CA   2  
ATOM 4185  C C    . GLN A 1 119 ? 14.954  -11.841 -19.979 1.00 0.00 ? 119 GLN A C    2  
ATOM 4186  O O    . GLN A 1 119 ? 14.495  -12.778 -20.630 1.00 0.00 ? 119 GLN A O    2  
ATOM 4187  C CB   . GLN A 1 119 ? 17.194  -11.393 -21.128 1.00 0.00 ? 119 GLN A CB   2  
ATOM 4188  C CG   . GLN A 1 119 ? 17.090  -12.203 -22.437 1.00 0.00 ? 119 GLN A CG   2  
ATOM 4189  C CD   . GLN A 1 119 ? 18.488  -12.592 -22.897 1.00 0.00 ? 119 GLN A CD   2  
ATOM 4190  O OE1  . GLN A 1 119 ? 19.244  -13.218 -22.148 1.00 0.00 ? 119 GLN A OE1  2  
ATOM 4191  N NE2  . GLN A 1 119 ? 18.857  -12.192 -24.143 1.00 0.00 ? 119 GLN A NE2  2  
ATOM 4192  H H    . GLN A 1 119 ? 16.426  -9.622  -18.986 1.00 0.00 ? 119 GLN A H    2  
ATOM 4193  H HA   . GLN A 1 119 ? 15.309  -10.592 -21.583 1.00 0.00 ? 119 GLN A HA   2  
ATOM 4194  H HB2  . GLN A 1 119 ? 17.869  -10.528 -21.332 1.00 0.00 ? 119 GLN A HB2  2  
ATOM 4195  H HB3  . GLN A 1 119 ? 17.679  -11.982 -20.316 1.00 0.00 ? 119 GLN A HB3  2  
ATOM 4196  H HG2  . GLN A 1 119 ? 16.497  -13.129 -22.275 1.00 0.00 ? 119 GLN A HG2  2  
ATOM 4197  H HG3  . GLN A 1 119 ? 16.581  -11.604 -23.221 1.00 0.00 ? 119 GLN A HG3  2  
ATOM 4198  H HE21 . GLN A 1 119 ? 18.207  -11.693 -24.712 1.00 0.00 ? 119 GLN A HE21 2  
ATOM 4199  H HE22 . GLN A 1 119 ? 19.815  -12.340 -24.409 1.00 0.00 ? 119 GLN A HE22 2  
ATOM 4200  N N    . ALA A 1 120 ? 14.621  -11.703 -18.657 1.00 0.00 ? 120 ALA A N    2  
ATOM 4201  C CA   . ALA A 1 120 ? 13.780  -12.626 -17.875 1.00 0.00 ? 120 ALA A CA   2  
ATOM 4202  C C    . ALA A 1 120 ? 12.275  -12.616 -18.224 1.00 0.00 ? 120 ALA A C    2  
ATOM 4203  O O    . ALA A 1 120 ? 11.397  -12.450 -17.378 1.00 0.00 ? 120 ALA A O    2  
ATOM 4204  C CB   . ALA A 1 120 ? 13.983  -12.357 -16.365 1.00 0.00 ? 120 ALA A CB   2  
ATOM 4205  H H    . ALA A 1 120 ? 14.977  -10.932 -18.143 1.00 0.00 ? 120 ALA A H    2  
ATOM 4206  H HA   . ALA A 1 120 ? 14.130  -13.635 -18.069 1.00 0.00 ? 120 ALA A HA   2  
ATOM 4207  H HB1  . ALA A 1 120 ? 13.604  -11.351 -16.084 1.00 0.00 ? 120 ALA A HB1  2  
ATOM 4208  H HB2  . ALA A 1 120 ? 13.458  -13.117 -15.744 1.00 0.00 ? 120 ALA A HB2  2  
ATOM 4209  H HB3  . ALA A 1 120 ? 15.066  -12.393 -16.117 1.00 0.00 ? 120 ALA A HB3  2  
ATOM 4210  N N    . PHE A 1 121 ? 11.996  -12.799 -19.538 1.00 0.00 ? 121 PHE A N    2  
ATOM 4211  C CA   . PHE A 1 121 ? 10.701  -12.778 -20.181 1.00 0.00 ? 121 PHE A CA   2  
ATOM 4212  C C    . PHE A 1 121 ? 10.851  -13.323 -21.604 1.00 0.00 ? 121 PHE A C    2  
ATOM 4213  O O    . PHE A 1 121 ? 10.119  -14.218 -22.016 1.00 0.00 ? 121 PHE A O    2  
ATOM 4214  C CB   . PHE A 1 121 ? 10.086  -11.332 -20.176 1.00 0.00 ? 121 PHE A CB   2  
ATOM 4215  C CG   . PHE A 1 121 ? 8.680   -11.262 -20.731 1.00 0.00 ? 121 PHE A CG   2  
ATOM 4216  C CD1  . PHE A 1 121 ? 7.628   -11.850 -20.053 1.00 0.00 ? 121 PHE A CD1  2  
ATOM 4217  C CD2  . PHE A 1 121 ? 8.434   -10.643 -21.943 1.00 0.00 ? 121 PHE A CD2  2  
ATOM 4218  C CE1  . PHE A 1 121 ? 6.351   -11.823 -20.578 1.00 0.00 ? 121 PHE A CE1  2  
ATOM 4219  C CE2  . PHE A 1 121 ? 7.162   -10.621 -22.476 1.00 0.00 ? 121 PHE A CE2  2  
ATOM 4220  C CZ   . PHE A 1 121 ? 6.118   -11.209 -21.792 1.00 0.00 ? 121 PHE A CZ   2  
ATOM 4221  H H    . PHE A 1 121 ? 12.812  -12.931 -20.123 1.00 0.00 ? 121 PHE A H    2  
ATOM 4222  H HA   . PHE A 1 121 ? 10.045  -13.457 -19.651 1.00 0.00 ? 121 PHE A HA   2  
ATOM 4223  H HB2  . PHE A 1 121 ? 10.025  -10.975 -19.125 1.00 0.00 ? 121 PHE A HB2  2  
ATOM 4224  H HB3  . PHE A 1 121 ? 10.738  -10.624 -20.730 1.00 0.00 ? 121 PHE A HB3  2  
ATOM 4225  H HD1  . PHE A 1 121 ? 7.811   -12.342 -19.107 1.00 0.00 ? 121 PHE A HD1  2  
ATOM 4226  H HD2  . PHE A 1 121 ? 9.251   -10.190 -22.490 1.00 0.00 ? 121 PHE A HD2  2  
ATOM 4227  H HE1  . PHE A 1 121 ? 5.532   -12.287 -20.041 1.00 0.00 ? 121 PHE A HE1  2  
ATOM 4228  H HE2  . PHE A 1 121 ? 6.982   -10.139 -23.428 1.00 0.00 ? 121 PHE A HE2  2  
ATOM 4229  H HZ   . PHE A 1 121 ? 5.120   -11.192 -22.209 1.00 0.00 ? 121 PHE A HZ   2  
ATOM 4230  N N    . HIS A 1 122 ? 11.799  -12.785 -22.423 1.00 0.00 ? 122 HIS A N    2  
ATOM 4231  C CA   . HIS A 1 122 ? 11.954  -13.155 -23.831 1.00 0.00 ? 122 HIS A CA   2  
ATOM 4232  C C    . HIS A 1 122 ? 13.128  -14.093 -24.039 1.00 0.00 ? 122 HIS A C    2  
ATOM 4233  O O    . HIS A 1 122 ? 14.265  -13.776 -23.692 1.00 0.00 ? 122 HIS A O    2  
ATOM 4234  C CB   . HIS A 1 122 ? 12.008  -11.912 -24.775 1.00 0.00 ? 122 HIS A CB   2  
ATOM 4235  C CG   . HIS A 1 122 ? 13.257  -11.058 -24.800 1.00 0.00 ? 122 HIS A CG   2  
ATOM 4236  N ND1  . HIS A 1 122 ? 13.676  -10.212 -23.796 1.00 0.00 ? 122 HIS A ND1  2  
ATOM 4237  C CD2  . HIS A 1 122 ? 14.136  -10.869 -25.824 1.00 0.00 ? 122 HIS A CD2  2  
ATOM 4238  C CE1  . HIS A 1 122 ? 14.775  -9.561  -24.258 1.00 0.00 ? 122 HIS A CE1  2  
ATOM 4239  N NE2  . HIS A 1 122 ? 15.085  -9.922  -25.486 1.00 0.00 ? 122 HIS A NE2  2  
ATOM 4240  H H    . HIS A 1 122 ? 12.437  -12.092 -22.101 1.00 0.00 ? 122 HIS A H    2  
ATOM 4241  H HA   . HIS A 1 122 ? 11.075  -13.698 -24.158 1.00 0.00 ? 122 HIS A HA   2  
ATOM 4242  H HB2  . HIS A 1 122 ? 11.836  -12.255 -25.818 1.00 0.00 ? 122 HIS A HB2  2  
ATOM 4243  H HB3  . HIS A 1 122 ? 11.155  -11.249 -24.510 1.00 0.00 ? 122 HIS A HB3  2  
ATOM 4244  H HD1  . HIS A 1 122 ? 13.233  -10.049 -22.916 1.00 0.00 ? 122 HIS A HD1  2  
ATOM 4245  H HD2  . HIS A 1 122 ? 14.157  -11.324 -26.807 1.00 0.00 ? 122 HIS A HD2  2  
ATOM 4246  H HE1  . HIS A 1 122 ? 15.329  -8.826  -23.669 1.00 0.00 ? 122 HIS A HE1  2  
ATOM 4247  N N    . LEU A 1 123 ? 12.869  -15.319 -24.589 1.00 0.00 ? 123 LEU A N    2  
ATOM 4248  C CA   . LEU A 1 123 ? 13.852  -16.388 -24.833 1.00 0.00 ? 123 LEU A CA   2  
ATOM 4249  C C    . LEU A 1 123 ? 14.294  -17.149 -23.588 1.00 0.00 ? 123 LEU A C    2  
ATOM 4250  O O    . LEU A 1 123 ? 14.221  -18.379 -23.555 1.00 0.00 ? 123 LEU A O    2  
ATOM 4251  C CB   . LEU A 1 123 ? 15.095  -16.005 -25.698 1.00 0.00 ? 123 LEU A CB   2  
ATOM 4252  C CG   . LEU A 1 123 ? 14.807  -15.783 -27.199 1.00 0.00 ? 123 LEU A CG   2  
ATOM 4253  C CD1  . LEU A 1 123 ? 16.078  -15.277 -27.901 1.00 0.00 ? 123 LEU A CD1  2  
ATOM 4254  C CD2  . LEU A 1 123 ? 14.316  -17.062 -27.899 1.00 0.00 ? 123 LEU A CD2  2  
ATOM 4255  H H    . LEU A 1 123 ? 11.933  -15.542 -24.862 1.00 0.00 ? 123 LEU A H    2  
ATOM 4256  H HA   . LEU A 1 123 ? 13.306  -17.134 -25.389 1.00 0.00 ? 123 LEU A HA   2  
ATOM 4257  H HB2  . LEU A 1 123 ? 15.561  -15.087 -25.284 1.00 0.00 ? 123 LEU A HB2  2  
ATOM 4258  H HB3  . LEU A 1 123 ? 15.873  -16.802 -25.655 1.00 0.00 ? 123 LEU A HB3  2  
ATOM 4259  H HG   . LEU A 1 123 ? 14.019  -15.002 -27.299 1.00 0.00 ? 123 LEU A HG   2  
ATOM 4260  H HD11 . LEU A 1 123 ? 16.418  -14.322 -27.444 1.00 0.00 ? 123 LEU A HD11 2  
ATOM 4261  H HD12 . LEU A 1 123 ? 16.897  -16.021 -27.800 1.00 0.00 ? 123 LEU A HD12 2  
ATOM 4262  H HD13 . LEU A 1 123 ? 15.886  -15.109 -28.982 1.00 0.00 ? 123 LEU A HD13 2  
ATOM 4263  H HD21 . LEU A 1 123 ? 15.054  -17.881 -27.759 1.00 0.00 ? 123 LEU A HD21 2  
ATOM 4264  H HD22 . LEU A 1 123 ? 13.338  -17.393 -27.493 1.00 0.00 ? 123 LEU A HD22 2  
ATOM 4265  H HD23 . LEU A 1 123 ? 14.196  -16.882 -28.989 1.00 0.00 ? 123 LEU A HD23 2  
ATOM 4266  N N    . ASP A 1 124 ? 14.727  -16.436 -22.501 1.00 0.00 ? 124 ASP A N    2  
ATOM 4267  C CA   . ASP A 1 124 ? 15.207  -16.969 -21.214 1.00 0.00 ? 124 ASP A CA   2  
ATOM 4268  C C    . ASP A 1 124 ? 14.115  -17.588 -20.319 1.00 0.00 ? 124 ASP A C    2  
ATOM 4269  O O    . ASP A 1 124 ? 13.994  -17.341 -19.123 1.00 0.00 ? 124 ASP A O    2  
ATOM 4270  C CB   . ASP A 1 124 ? 16.028  -15.880 -20.455 1.00 0.00 ? 124 ASP A CB   2  
ATOM 4271  C CG   . ASP A 1 124 ? 16.992  -16.479 -19.424 1.00 0.00 ? 124 ASP A CG   2  
ATOM 4272  O OD1  . ASP A 1 124 ? 17.896  -17.252 -19.839 1.00 0.00 ? 124 ASP A OD1  2  
ATOM 4273  O OD2  . ASP A 1 124 ? 16.831  -16.170 -18.212 1.00 0.00 ? 124 ASP A OD2  2  
ATOM 4274  H H    . ASP A 1 124 ? 14.734  -15.430 -22.568 1.00 0.00 ? 124 ASP A H    2  
ATOM 4275  H HA   . ASP A 1 124 ? 15.892  -17.773 -21.453 1.00 0.00 ? 124 ASP A HA   2  
ATOM 4276  H HB2  . ASP A 1 124 ? 16.644  -15.330 -21.202 1.00 0.00 ? 124 ASP A HB2  2  
ATOM 4277  H HB3  . ASP A 1 124 ? 15.357  -15.139 -19.973 1.00 0.00 ? 124 ASP A HB3  2  
ATOM 4278  N N    . ARG A 1 125 ? 13.293  -18.444 -20.955 1.00 0.00 ? 125 ARG A N    2  
ATOM 4279  C CA   . ARG A 1 125 ? 12.201  -19.221 -20.422 1.00 0.00 ? 125 ARG A CA   2  
ATOM 4280  C C    . ARG A 1 125 ? 12.521  -20.663 -20.774 1.00 0.00 ? 125 ARG A C    2  
ATOM 4281  O O    . ARG A 1 125 ? 12.367  -21.559 -19.953 1.00 0.00 ? 125 ARG A O    2  
ATOM 4282  C CB   . ARG A 1 125 ? 10.819  -18.785 -20.996 1.00 0.00 ? 125 ARG A CB   2  
ATOM 4283  C CG   . ARG A 1 125 ? 10.441  -17.313 -20.711 1.00 0.00 ? 125 ARG A CG   2  
ATOM 4284  C CD   . ARG A 1 125 ? 10.323  -16.929 -19.225 1.00 0.00 ? 125 ARG A CD   2  
ATOM 4285  N NE   . ARG A 1 125 ? 9.252   -17.766 -18.581 1.00 0.00 ? 125 ARG A NE   2  
ATOM 4286  C CZ   . ARG A 1 125 ? 8.875   -17.617 -17.273 1.00 0.00 ? 125 ARG A CZ   2  
ATOM 4287  N NH1  . ARG A 1 125 ? 9.447   -16.661 -16.484 1.00 0.00 ? 125 ARG A NH1  2  
ATOM 4288  N NH2  . ARG A 1 125 ? 7.913   -18.436 -16.754 1.00 0.00 ? 125 ARG A NH2  2  
ATOM 4289  H H    . ARG A 1 125 ? 13.490  -18.561 -21.934 1.00 0.00 ? 125 ARG A H    2  
ATOM 4290  H HA   . ARG A 1 125 ? 12.179  -19.157 -19.340 1.00 0.00 ? 125 ARG A HA   2  
ATOM 4291  H HB2  . ARG A 1 125 ? 10.815  -18.910 -22.103 1.00 0.00 ? 125 ARG A HB2  2  
ATOM 4292  H HB3  . ARG A 1 125 ? 10.019  -19.438 -20.580 1.00 0.00 ? 125 ARG A HB3  2  
ATOM 4293  H HG2  . ARG A 1 125 ? 11.207  -16.647 -21.170 1.00 0.00 ? 125 ARG A HG2  2  
ATOM 4294  H HG3  . ARG A 1 125 ? 9.474   -17.085 -21.212 1.00 0.00 ? 125 ARG A HG3  2  
ATOM 4295  H HD2  . ARG A 1 125 ? 11.285  -17.100 -18.696 1.00 0.00 ? 125 ARG A HD2  2  
ATOM 4296  H HD3  . ARG A 1 125 ? 10.041  -15.856 -19.144 1.00 0.00 ? 125 ARG A HD3  2  
ATOM 4297  H HE   . ARG A 1 125 ? 8.811   -18.477 -19.128 1.00 0.00 ? 125 ARG A HE   2  
ATOM 4298  H HH11 . ARG A 1 125 ? 10.148  -16.057 -16.861 1.00 0.00 ? 125 ARG A HH11 2  
ATOM 4299  H HH12 . ARG A 1 125 ? 9.162   -16.564 -15.530 1.00 0.00 ? 125 ARG A HH12 2  
ATOM 4300  H HH21 . ARG A 1 125 ? 7.494   -19.138 -17.328 1.00 0.00 ? 125 ARG A HH21 2  
ATOM 4301  H HH22 . ARG A 1 125 ? 7.631   -18.334 -15.799 1.00 0.00 ? 125 ARG A HH22 2  
ATOM 4302  N N    . ARG A 1 126 ? 13.000  -20.919 -22.023 1.00 0.00 ? 126 ARG A N    2  
ATOM 4303  C CA   . ARG A 1 126 ? 13.380  -22.251 -22.475 1.00 0.00 ? 126 ARG A CA   2  
ATOM 4304  C C    . ARG A 1 126 ? 14.576  -22.235 -23.423 1.00 0.00 ? 126 ARG A C    2  
ATOM 4305  O O    . ARG A 1 126 ? 14.987  -23.288 -23.902 1.00 0.00 ? 126 ARG A O    2  
ATOM 4306  C CB   . ARG A 1 126 ? 12.167  -23.078 -23.020 1.00 0.00 ? 126 ARG A CB   2  
ATOM 4307  C CG   . ARG A 1 126 ? 11.122  -22.329 -23.882 1.00 0.00 ? 126 ARG A CG   2  
ATOM 4308  C CD   . ARG A 1 126 ? 11.547  -21.920 -25.301 1.00 0.00 ? 126 ARG A CD   2  
ATOM 4309  N NE   . ARG A 1 126 ? 11.877  -23.162 -26.087 1.00 0.00 ? 126 ARG A NE   2  
ATOM 4310  C CZ   . ARG A 1 126 ? 11.825  -23.234 -27.454 1.00 0.00 ? 126 ARG A CZ   2  
ATOM 4311  N NH1  . ARG A 1 126 ? 11.432  -22.161 -28.200 1.00 0.00 ? 126 ARG A NH1  2  
ATOM 4312  N NH2  . ARG A 1 126 ? 12.179  -24.395 -28.079 1.00 0.00 ? 126 ARG A NH2  2  
ATOM 4313  H H    . ARG A 1 126 ? 13.113  -20.188 -22.688 1.00 0.00 ? 126 ARG A H    2  
ATOM 4314  H HA   . ARG A 1 126 ? 13.763  -22.814 -21.630 1.00 0.00 ? 126 ARG A HA   2  
ATOM 4315  H HB2  . ARG A 1 126 ? 12.505  -24.003 -23.538 1.00 0.00 ? 126 ARG A HB2  2  
ATOM 4316  H HB3  . ARG A 1 126 ? 11.611  -23.424 -22.115 1.00 0.00 ? 126 ARG A HB3  2  
ATOM 4317  H HG2  . ARG A 1 126 ? 10.230  -22.992 -23.977 1.00 0.00 ? 126 ARG A HG2  2  
ATOM 4318  H HG3  . ARG A 1 126 ? 10.783  -21.420 -23.339 1.00 0.00 ? 126 ARG A HG3  2  
ATOM 4319  H HD2  . ARG A 1 126 ? 10.701  -21.376 -25.781 1.00 0.00 ? 126 ARG A HD2  2  
ATOM 4320  H HD3  . ARG A 1 126 ? 12.441  -21.260 -25.278 1.00 0.00 ? 126 ARG A HD3  2  
ATOM 4321  H HE   . ARG A 1 126 ? 12.171  -23.973 -25.581 1.00 0.00 ? 126 ARG A HE   2  
ATOM 4322  H HH11 . ARG A 1 126 ? 11.175  -21.307 -27.748 1.00 0.00 ? 126 ARG A HH11 2  
ATOM 4323  H HH12 . ARG A 1 126 ? 11.401  -22.229 -29.197 1.00 0.00 ? 126 ARG A HH12 2  
ATOM 4324  H HH21 . ARG A 1 126 ? 12.472  -25.184 -27.538 1.00 0.00 ? 126 ARG A HH21 2  
ATOM 4325  H HH22 . ARG A 1 126 ? 12.149  -24.455 -29.077 1.00 0.00 ? 126 ARG A HH22 2  
ATOM 4326  N N    . LEU A 1 127 ? 15.200  -21.064 -23.719 1.00 0.00 ? 127 LEU A N    2  
ATOM 4327  C CA   . LEU A 1 127 ? 16.367  -20.967 -24.584 1.00 0.00 ? 127 LEU A CA   2  
ATOM 4328  C C    . LEU A 1 127 ? 17.381  -20.031 -23.949 1.00 0.00 ? 127 LEU A C    2  
ATOM 4329  O O    . LEU A 1 127 ? 17.069  -19.243 -23.059 1.00 0.00 ? 127 LEU A O    2  
ATOM 4330  C CB   . LEU A 1 127 ? 16.000  -20.455 -26.009 1.00 0.00 ? 127 LEU A CB   2  
ATOM 4331  C CG   . LEU A 1 127 ? 15.283  -21.501 -26.891 1.00 0.00 ? 127 LEU A CG   2  
ATOM 4332  C CD1  . LEU A 1 127 ? 14.791  -20.870 -28.203 1.00 0.00 ? 127 LEU A CD1  2  
ATOM 4333  C CD2  . LEU A 1 127 ? 16.170  -22.720 -27.197 1.00 0.00 ? 127 LEU A CD2  2  
ATOM 4334  H H    . LEU A 1 127 ? 14.925  -20.173 -23.354 1.00 0.00 ? 127 LEU A H    2  
ATOM 4335  H HA   . LEU A 1 127 ? 16.873  -21.922 -24.659 1.00 0.00 ? 127 LEU A HA   2  
ATOM 4336  H HB2  . LEU A 1 127 ? 15.334  -19.568 -25.901 1.00 0.00 ? 127 LEU A HB2  2  
ATOM 4337  H HB3  . LEU A 1 127 ? 16.902  -20.135 -26.577 1.00 0.00 ? 127 LEU A HB3  2  
ATOM 4338  H HG   . LEU A 1 127 ? 14.388  -21.863 -26.335 1.00 0.00 ? 127 LEU A HG   2  
ATOM 4339  H HD11 . LEU A 1 127 ? 15.643  -20.433 -28.764 1.00 0.00 ? 127 LEU A HD11 2  
ATOM 4340  H HD12 . LEU A 1 127 ? 14.306  -21.641 -28.838 1.00 0.00 ? 127 LEU A HD12 2  
ATOM 4341  H HD13 . LEU A 1 127 ? 14.050  -20.071 -27.996 1.00 0.00 ? 127 LEU A HD13 2  
ATOM 4342  H HD21 . LEU A 1 127 ? 17.101  -22.401 -27.710 1.00 0.00 ? 127 LEU A HD21 2  
ATOM 4343  H HD22 . LEU A 1 127 ? 16.443  -23.271 -26.273 1.00 0.00 ? 127 LEU A HD22 2  
ATOM 4344  H HD23 . LEU A 1 127 ? 15.625  -23.425 -27.859 1.00 0.00 ? 127 LEU A HD23 2  
ATOM 4345  N N    . GLU A 1 128 ? 18.643  -20.124 -24.445 1.00 0.00 ? 128 GLU A N    2  
ATOM 4346  C CA   . GLU A 1 128 ? 19.838  -19.360 -24.066 1.00 0.00 ? 128 GLU A CA   2  
ATOM 4347  C C    . GLU A 1 128 ? 20.602  -19.950 -22.877 1.00 0.00 ? 128 GLU A C    2  
ATOM 4348  O O    . GLU A 1 128 ? 20.027  -20.420 -21.900 1.00 0.00 ? 128 GLU A O    2  
ATOM 4349  C CB   . GLU A 1 128 ? 19.643  -17.820 -23.929 1.00 0.00 ? 128 GLU A CB   2  
ATOM 4350  C CG   . GLU A 1 128 ? 19.186  -17.174 -25.251 1.00 0.00 ? 128 GLU A CG   2  
ATOM 4351  C CD   . GLU A 1 128 ? 18.913  -15.692 -25.028 1.00 0.00 ? 128 GLU A CD   2  
ATOM 4352  O OE1  . GLU A 1 128 ? 18.014  -15.379 -24.203 1.00 0.00 ? 128 GLU A OE1  2  
ATOM 4353  O OE2  . GLU A 1 128 ? 19.591  -14.855 -25.682 1.00 0.00 ? 128 GLU A OE2  2  
ATOM 4354  H H    . GLU A 1 128 ? 18.804  -20.796 -25.159 1.00 0.00 ? 128 GLU A H    2  
ATOM 4355  H HA   . GLU A 1 128 ? 20.499  -19.483 -24.911 1.00 0.00 ? 128 GLU A HA   2  
ATOM 4356  H HB2  . GLU A 1 128 ? 18.884  -17.621 -23.138 1.00 0.00 ? 128 GLU A HB2  2  
ATOM 4357  H HB3  . GLU A 1 128 ? 20.588  -17.319 -23.616 1.00 0.00 ? 128 GLU A HB3  2  
ATOM 4358  H HG2  . GLU A 1 128 ? 19.974  -17.307 -26.021 1.00 0.00 ? 128 GLU A HG2  2  
ATOM 4359  H HG3  . GLU A 1 128 ? 18.254  -17.656 -25.616 1.00 0.00 ? 128 GLU A HG3  2  
ATOM 4360  N N    . ARG A 1 129 ? 21.959  -19.947 -22.974 1.00 0.00 ? 129 ARG A N    2  
ATOM 4361  C CA   . ARG A 1 129 ? 22.893  -20.522 -22.003 1.00 0.00 ? 129 ARG A CA   2  
ATOM 4362  C C    . ARG A 1 129 ? 23.779  -19.520 -21.239 1.00 0.00 ? 129 ARG A C    2  
ATOM 4363  O O    . ARG A 1 129 ? 23.850  -19.682 -20.021 1.00 0.00 ? 129 ARG A O    2  
ATOM 4364  C CB   . ARG A 1 129 ? 23.766  -21.652 -22.638 1.00 0.00 ? 129 ARG A CB   2  
ATOM 4365  C CG   . ARG A 1 129 ? 22.965  -22.755 -23.365 1.00 0.00 ? 129 ARG A CG   2  
ATOM 4366  C CD   . ARG A 1 129 ? 22.025  -23.556 -22.448 1.00 0.00 ? 129 ARG A CD   2  
ATOM 4367  N NE   . ARG A 1 129 ? 21.242  -24.524 -23.294 1.00 0.00 ? 129 ARG A NE   2  
ATOM 4368  C CZ   . ARG A 1 129 ? 20.116  -25.168 -22.852 1.00 0.00 ? 129 ARG A CZ   2  
ATOM 4369  N NH1  . ARG A 1 129 ? 19.645  -24.969 -21.587 1.00 0.00 ? 129 ARG A NH1  2  
ATOM 4370  N NH2  . ARG A 1 129 ? 19.455  -26.018 -23.691 1.00 0.00 ? 129 ARG A NH2  2  
ATOM 4371  H H    . ARG A 1 129 ? 22.378  -19.568 -23.790 1.00 0.00 ? 129 ARG A H    2  
ATOM 4372  H HA   . ARG A 1 129 ? 22.326  -21.008 -21.217 1.00 0.00 ? 129 ARG A HA   2  
ATOM 4373  H HB2  . ARG A 1 129 ? 24.474  -21.217 -23.377 1.00 0.00 ? 129 ARG A HB2  2  
ATOM 4374  H HB3  . ARG A 1 129 ? 24.370  -22.148 -21.844 1.00 0.00 ? 129 ARG A HB3  2  
ATOM 4375  H HG2  . ARG A 1 129 ? 22.369  -22.294 -24.184 1.00 0.00 ? 129 ARG A HG2  2  
ATOM 4376  H HG3  . ARG A 1 129 ? 23.688  -23.461 -23.833 1.00 0.00 ? 129 ARG A HG3  2  
ATOM 4377  H HD2  . ARG A 1 129 ? 22.610  -24.128 -21.696 1.00 0.00 ? 129 ARG A HD2  2  
ATOM 4378  H HD3  . ARG A 1 129 ? 21.320  -22.869 -21.930 1.00 0.00 ? 129 ARG A HD3  2  
ATOM 4379  H HE   . ARG A 1 129 ? 21.553  -24.694 -24.228 1.00 0.00 ? 129 ARG A HE   2  
ATOM 4380  H HH11 . ARG A 1 129 ? 20.122  -24.345 -20.969 1.00 0.00 ? 129 ARG A HH11 2  
ATOM 4381  H HH12 . ARG A 1 129 ? 18.820  -25.445 -21.280 1.00 0.00 ? 129 ARG A HH12 2  
ATOM 4382  H HH21 . ARG A 1 129 ? 19.793  -26.167 -24.621 1.00 0.00 ? 129 ARG A HH21 2  
ATOM 4383  H HH22 . ARG A 1 129 ? 18.633  -26.493 -23.376 1.00 0.00 ? 129 ARG A HH22 2  
ATOM 4384  N N    . PRO A 1 130 ? 24.509  -18.510 -21.796 1.00 0.00 ? 130 PRO A N    2  
ATOM 4385  C CA   . PRO A 1 130 ? 25.434  -17.659 -21.026 1.00 0.00 ? 130 PRO A CA   2  
ATOM 4386  C C    . PRO A 1 130 ? 24.753  -16.516 -20.255 1.00 0.00 ? 130 PRO A C    2  
ATOM 4387  O O    . PRO A 1 130 ? 25.293  -16.134 -19.221 1.00 0.00 ? 130 PRO A O    2  
ATOM 4388  C CB   . PRO A 1 130 ? 26.401  -17.128 -22.109 1.00 0.00 ? 130 PRO A CB   2  
ATOM 4389  C CG   . PRO A 1 130 ? 25.550  -17.049 -23.379 1.00 0.00 ? 130 PRO A CG   2  
ATOM 4390  C CD   . PRO A 1 130 ? 24.619  -18.257 -23.237 1.00 0.00 ? 130 PRO A CD   2  
ATOM 4391  H HA   . PRO A 1 130 ? 25.978  -18.240 -20.293 1.00 0.00 ? 130 PRO A HA   2  
ATOM 4392  H HB2  . PRO A 1 130 ? 26.888  -16.164 -21.858 1.00 0.00 ? 130 PRO A HB2  2  
ATOM 4393  H HB3  . PRO A 1 130 ? 27.206  -17.883 -22.263 1.00 0.00 ? 130 PRO A HB3  2  
ATOM 4394  H HG2  . PRO A 1 130 ? 24.955  -16.110 -23.382 1.00 0.00 ? 130 PRO A HG2  2  
ATOM 4395  H HG3  . PRO A 1 130 ? 26.163  -17.092 -24.302 1.00 0.00 ? 130 PRO A HG3  2  
ATOM 4396  H HD2  . PRO A 1 130 ? 23.629  -18.030 -23.690 1.00 0.00 ? 130 PRO A HD2  2  
ATOM 4397  H HD3  . PRO A 1 130 ? 25.084  -19.136 -23.737 1.00 0.00 ? 130 PRO A HD3  2  
ATOM 4398  N N    . HIS A 1 131 ? 23.615  -15.970 -20.761 1.00 0.00 ? 131 HIS A N    2  
ATOM 4399  C CA   . HIS A 1 131 ? 22.807  -14.877 -20.221 1.00 0.00 ? 131 HIS A CA   2  
ATOM 4400  C C    . HIS A 1 131 ? 23.361  -13.477 -20.513 1.00 0.00 ? 131 HIS A C    2  
ATOM 4401  O O    . HIS A 1 131 ? 24.041  -12.863 -19.693 1.00 0.00 ? 131 HIS A O    2  
ATOM 4402  C CB   . HIS A 1 131 ? 22.403  -15.053 -18.727 1.00 0.00 ? 131 HIS A CB   2  
ATOM 4403  C CG   . HIS A 1 131 ? 21.159  -14.287 -18.345 1.00 0.00 ? 131 HIS A CG   2  
ATOM 4404  N ND1  . HIS A 1 131 ? 21.121  -12.933 -18.089 1.00 0.00 ? 131 HIS A ND1  2  
ATOM 4405  C CD2  . HIS A 1 131 ? 19.869  -14.714 -18.258 1.00 0.00 ? 131 HIS A CD2  2  
ATOM 4406  C CE1  . HIS A 1 131 ? 19.824  -12.608 -17.856 1.00 0.00 ? 131 HIS A CE1  2  
ATOM 4407  N NE2  . HIS A 1 131 ? 19.027  -13.658 -17.952 1.00 0.00 ? 131 HIS A NE2  2  
ATOM 4408  H H    . HIS A 1 131 ? 23.273  -16.366 -21.608 1.00 0.00 ? 131 HIS A H    2  
ATOM 4409  H HA   . HIS A 1 131 ? 21.877  -14.942 -20.770 1.00 0.00 ? 131 HIS A HA   2  
ATOM 4410  H HB2  . HIS A 1 131 ? 22.182  -16.130 -18.559 1.00 0.00 ? 131 HIS A HB2  2  
ATOM 4411  H HB3  . HIS A 1 131 ? 23.248  -14.791 -18.053 1.00 0.00 ? 131 HIS A HB3  2  
ATOM 4412  H HD1  . HIS A 1 131 ? 21.901  -12.306 -18.124 1.00 0.00 ? 131 HIS A HD1  2  
ATOM 4413  H HD2  . HIS A 1 131 ? 19.468  -15.708 -18.396 1.00 0.00 ? 131 HIS A HD2  2  
ATOM 4414  H HE1  . HIS A 1 131 ? 19.494  -11.593 -17.628 1.00 0.00 ? 131 HIS A HE1  2  
ATOM 4415  N N    . ARG A 1 132 ? 23.043  -12.928 -21.712 1.00 0.00 ? 132 ARG A N    2  
ATOM 4416  C CA   . ARG A 1 132 ? 23.458  -11.610 -22.156 1.00 0.00 ? 132 ARG A CA   2  
ATOM 4417  C C    . ARG A 1 132 ? 22.389  -11.118 -23.118 1.00 0.00 ? 132 ARG A C    2  
ATOM 4418  O O    . ARG A 1 132 ? 21.888  -11.882 -23.944 1.00 0.00 ? 132 ARG A O    2  
ATOM 4419  C CB   . ARG A 1 132 ? 24.859  -11.645 -22.830 1.00 0.00 ? 132 ARG A CB   2  
ATOM 4420  C CG   . ARG A 1 132 ? 25.448  -10.268 -23.197 1.00 0.00 ? 132 ARG A CG   2  
ATOM 4421  C CD   . ARG A 1 132 ? 26.889  -10.363 -23.725 1.00 0.00 ? 132 ARG A CD   2  
ATOM 4422  N NE   . ARG A 1 132 ? 27.408  -8.979  -24.029 1.00 0.00 ? 132 ARG A NE   2  
ATOM 4423  C CZ   . ARG A 1 132 ? 27.208  -8.328  -25.218 1.00 0.00 ? 132 ARG A CZ   2  
ATOM 4424  N NH1  . ARG A 1 132 ? 26.520  -8.916  -26.240 1.00 0.00 ? 132 ARG A NH1  2  
ATOM 4425  N NH2  . ARG A 1 132 ? 27.710  -7.068  -25.383 1.00 0.00 ? 132 ARG A NH2  2  
ATOM 4426  H H    . ARG A 1 132 ? 22.475  -13.415 -22.373 1.00 0.00 ? 132 ARG A H    2  
ATOM 4427  H HA   . ARG A 1 132 ? 23.482  -10.930 -21.314 1.00 0.00 ? 132 ARG A HA   2  
ATOM 4428  H HB2  . ARG A 1 132 ? 25.563  -12.121 -22.109 1.00 0.00 ? 132 ARG A HB2  2  
ATOM 4429  H HB3  . ARG A 1 132 ? 24.838  -12.297 -23.731 1.00 0.00 ? 132 ARG A HB3  2  
ATOM 4430  H HG2  . ARG A 1 132 ? 24.814  -9.783  -23.971 1.00 0.00 ? 132 ARG A HG2  2  
ATOM 4431  H HG3  . ARG A 1 132 ? 25.432  -9.626  -22.288 1.00 0.00 ? 132 ARG A HG3  2  
ATOM 4432  H HD2  . ARG A 1 132 ? 27.547  -10.797 -22.942 1.00 0.00 ? 132 ARG A HD2  2  
ATOM 4433  H HD3  . ARG A 1 132 ? 26.944  -11.007 -24.629 1.00 0.00 ? 132 ARG A HD3  2  
ATOM 4434  H HE   . ARG A 1 132 ? 27.919  -8.506  -23.312 1.00 0.00 ? 132 ARG A HE   2  
ATOM 4435  H HH11 . ARG A 1 132 ? 26.148  -9.837  -26.125 1.00 0.00 ? 132 ARG A HH11 2  
ATOM 4436  H HH12 . ARG A 1 132 ? 26.387  -8.424  -27.100 1.00 0.00 ? 132 ARG A HH12 2  
ATOM 4437  H HH21 . ARG A 1 132 ? 28.214  -6.630  -24.638 1.00 0.00 ? 132 ARG A HH21 2  
ATOM 4438  H HH22 . ARG A 1 132 ? 27.569  -6.583  -26.245 1.00 0.00 ? 132 ARG A HH22 2  
ATOM 4439  N N    . ASP A 1 133 ? 22.001  -9.819  -23.034 1.00 0.00 ? 133 ASP A N    2  
ATOM 4440  C CA   . ASP A 1 133 ? 20.949  -9.198  -23.841 1.00 0.00 ? 133 ASP A CA   2  
ATOM 4441  C C    . ASP A 1 133 ? 21.534  -8.227  -24.863 1.00 0.00 ? 133 ASP A C    2  
ATOM 4442  O O    . ASP A 1 133 ? 22.037  -7.158  -24.512 1.00 0.00 ? 133 ASP A O    2  
ATOM 4443  C CB   . ASP A 1 133 ? 19.904  -8.509  -22.901 1.00 0.00 ? 133 ASP A CB   2  
ATOM 4444  C CG   . ASP A 1 133 ? 18.562  -8.203  -23.583 1.00 0.00 ? 133 ASP A CG   2  
ATOM 4445  O OD1  . ASP A 1 133 ? 17.949  -9.153  -24.135 1.00 0.00 ? 133 ASP A OD1  2  
ATOM 4446  O OD2  . ASP A 1 133 ? 18.133  -7.021  -23.546 1.00 0.00 ? 133 ASP A OD2  2  
ATOM 4447  H H    . ASP A 1 133 ? 22.414  -9.226  -22.348 1.00 0.00 ? 133 ASP A H    2  
ATOM 4448  H HA   . ASP A 1 133 ? 20.426  -9.955  -24.412 1.00 0.00 ? 133 ASP A HA   2  
ATOM 4449  H HB2  . ASP A 1 133 ? 19.688  -9.215  -22.068 1.00 0.00 ? 133 ASP A HB2  2  
ATOM 4450  H HB3  . ASP A 1 133 ? 20.323  -7.589  -22.444 1.00 0.00 ? 133 ASP A HB3  2  
ATOM 4451  N N    . GLY A 1 1   ? -6.631  9.870   35.346  1.00 0.00 ? 1   GLY A N    3  
ATOM 4452  C CA   . GLY A 1 1   ? -5.420  10.643  35.514  1.00 0.00 ? 1   GLY A CA   3  
ATOM 4453  C C    . GLY A 1 1   ? -5.445  11.836  34.613  1.00 0.00 ? 1   GLY A C    3  
ATOM 4454  O O    . GLY A 1 1   ? -4.507  12.630  34.566  1.00 0.00 ? 1   GLY A O    3  
ATOM 4455  H H    . GLY A 1 1   ? -6.571  8.947   34.962  1.00 0.00 ? 1   GLY A H    3  
ATOM 4456  H HA2  . GLY A 1 1   ? -5.391  10.997  36.533  1.00 0.00 ? 1   GLY A HA2  3  
ATOM 4457  H HA3  . GLY A 1 1   ? -4.578  10.028  35.235  1.00 0.00 ? 1   GLY A HA3  3  
ATOM 4458  N N    . SER A 1 2   ? -6.545  11.981  33.843  1.00 0.00 ? 2   SER A N    3  
ATOM 4459  C CA   . SER A 1 2   ? -6.823  13.046  32.886  1.00 0.00 ? 2   SER A CA   3  
ATOM 4460  C C    . SER A 1 2   ? -8.241  12.776  32.378  1.00 0.00 ? 2   SER A C    3  
ATOM 4461  O O    . SER A 1 2   ? -8.695  11.648  32.582  1.00 0.00 ? 2   SER A O    3  
ATOM 4462  C CB   . SER A 1 2   ? -5.813  13.110  31.697  1.00 0.00 ? 2   SER A CB   3  
ATOM 4463  O OG   . SER A 1 2   ? -4.581  13.687  32.124  1.00 0.00 ? 2   SER A OG   3  
ATOM 4464  H H    . SER A 1 2   ? -7.269  11.289  33.922  1.00 0.00 ? 2   SER A H    3  
ATOM 4465  H HA   . SER A 1 2   ? -6.821  13.979  33.431  1.00 0.00 ? 2   SER A HA   3  
ATOM 4466  H HB2  . SER A 1 2   ? -5.622  12.086  31.304  1.00 0.00 ? 2   SER A HB2  3  
ATOM 4467  H HB3  . SER A 1 2   ? -6.194  13.742  30.866  1.00 0.00 ? 2   SER A HB3  3  
ATOM 4468  H HG   . SER A 1 2   ? -4.404  13.331  33.022  1.00 0.00 ? 2   SER A HG   3  
ATOM 4469  N N    . PRO A 1 3   ? -9.008  13.734  31.785  1.00 0.00 ? 3   PRO A N    3  
ATOM 4470  C CA   . PRO A 1 3   ? -10.401 13.545  31.333  1.00 0.00 ? 3   PRO A CA   3  
ATOM 4471  C C    . PRO A 1 3   ? -10.547 12.803  29.983  1.00 0.00 ? 3   PRO A C    3  
ATOM 4472  O O    . PRO A 1 3   ? -9.685  12.014  29.604  1.00 0.00 ? 3   PRO A O    3  
ATOM 4473  C CB   . PRO A 1 3   ? -10.945 15.000  31.240  1.00 0.00 ? 3   PRO A CB   3  
ATOM 4474  C CG   . PRO A 1 3   ? -9.946  15.858  32.025  1.00 0.00 ? 3   PRO A CG   3  
ATOM 4475  C CD   . PRO A 1 3   ? -8.632  15.147  31.730  1.00 0.00 ? 3   PRO A CD   3  
ATOM 4476  H HA   . PRO A 1 3   ? -10.946 12.977  32.075  1.00 0.00 ? 3   PRO A HA   3  
ATOM 4477  H HB2  . PRO A 1 3   ? -10.905 15.406  30.189  1.00 0.00 ? 3   PRO A HB2  3  
ATOM 4478  H HB3  . PRO A 1 3   ? -11.968 15.073  31.695  1.00 0.00 ? 3   PRO A HB3  3  
ATOM 4479  H HG2  . PRO A 1 3   ? -9.949  16.917  31.694  1.00 0.00 ? 3   PRO A HG2  3  
ATOM 4480  H HG3  . PRO A 1 3   ? -10.165 15.806  33.115  1.00 0.00 ? 3   PRO A HG3  3  
ATOM 4481  H HD2  . PRO A 1 3   ? -8.292  15.378  30.695  1.00 0.00 ? 3   PRO A HD2  3  
ATOM 4482  H HD3  . PRO A 1 3   ? -7.853  15.466  32.459  1.00 0.00 ? 3   PRO A HD3  3  
ATOM 4483  N N    . GLU A 1 4   ? -11.642 13.062  29.214  1.00 0.00 ? 4   GLU A N    3  
ATOM 4484  C CA   . GLU A 1 4   ? -11.892 12.486  27.890  1.00 0.00 ? 4   GLU A CA   3  
ATOM 4485  C C    . GLU A 1 4   ? -11.353 13.351  26.755  1.00 0.00 ? 4   GLU A C    3  
ATOM 4486  O O    . GLU A 1 4   ? -11.339 14.579  26.805  1.00 0.00 ? 4   GLU A O    3  
ATOM 4487  C CB   . GLU A 1 4   ? -13.384 12.126  27.626  1.00 0.00 ? 4   GLU A CB   3  
ATOM 4488  C CG   . GLU A 1 4   ? -14.424 13.269  27.679  1.00 0.00 ? 4   GLU A CG   3  
ATOM 4489  C CD   . GLU A 1 4   ? -14.609 13.828  29.090  1.00 0.00 ? 4   GLU A CD   3  
ATOM 4490  O OE1  . GLU A 1 4   ? -15.013 13.045  29.990  1.00 0.00 ? 4   GLU A OE1  3  
ATOM 4491  O OE2  . GLU A 1 4   ? -14.349 15.046  29.285  1.00 0.00 ? 4   GLU A OE2  3  
ATOM 4492  H H    . GLU A 1 4   ? -12.340 13.704  29.520  1.00 0.00 ? 4   GLU A H    3  
ATOM 4493  H HA   . GLU A 1 4   ? -11.362 11.543  27.823  1.00 0.00 ? 4   GLU A HA   3  
ATOM 4494  H HB2  . GLU A 1 4   ? -13.479 11.648  26.624  1.00 0.00 ? 4   GLU A HB2  3  
ATOM 4495  H HB3  . GLU A 1 4   ? -13.656 11.334  28.349  1.00 0.00 ? 4   GLU A HB3  3  
ATOM 4496  H HG2  . GLU A 1 4   ? -14.140 14.083  26.980  1.00 0.00 ? 4   GLU A HG2  3  
ATOM 4497  H HG3  . GLU A 1 4   ? -15.402 12.861  27.342  1.00 0.00 ? 4   GLU A HG3  3  
ATOM 4498  N N    . PHE A 1 5   ? -10.883 12.674  25.680  1.00 0.00 ? 5   PHE A N    3  
ATOM 4499  C CA   . PHE A 1 5   ? -10.257 13.290  24.509  1.00 0.00 ? 5   PHE A CA   3  
ATOM 4500  C C    . PHE A 1 5   ? -10.969 12.853  23.236  1.00 0.00 ? 5   PHE A C    3  
ATOM 4501  O O    . PHE A 1 5   ? -10.352 12.551  22.219  1.00 0.00 ? 5   PHE A O    3  
ATOM 4502  C CB   . PHE A 1 5   ? -8.730  12.976  24.407  1.00 0.00 ? 5   PHE A CB   3  
ATOM 4503  C CG   . PHE A 1 5   ? -7.985  13.584  25.582  1.00 0.00 ? 5   PHE A CG   3  
ATOM 4504  C CD1  . PHE A 1 5   ? -7.580  14.911  25.543  1.00 0.00 ? 5   PHE A CD1  3  
ATOM 4505  C CD2  . PHE A 1 5   ? -7.708  12.853  26.732  1.00 0.00 ? 5   PHE A CD2  3  
ATOM 4506  C CE1  . PHE A 1 5   ? -6.914  15.486  26.607  1.00 0.00 ? 5   PHE A CE1  3  
ATOM 4507  C CE2  . PHE A 1 5   ? -7.051  13.431  27.801  1.00 0.00 ? 5   PHE A CE2  3  
ATOM 4508  C CZ   . PHE A 1 5   ? -6.646  14.747  27.740  1.00 0.00 ? 5   PHE A CZ   3  
ATOM 4509  H H    . PHE A 1 5   ? -10.936 11.679  25.702  1.00 0.00 ? 5   PHE A H    3  
ATOM 4510  H HA   . PHE A 1 5   ? -10.367 14.369  24.540  1.00 0.00 ? 5   PHE A HA   3  
ATOM 4511  H HB2  . PHE A 1 5   ? -8.558  11.878  24.395  1.00 0.00 ? 5   PHE A HB2  3  
ATOM 4512  H HB3  . PHE A 1 5   ? -8.292  13.393  23.472  1.00 0.00 ? 5   PHE A HB3  3  
ATOM 4513  H HD1  . PHE A 1 5   ? -7.787  15.522  24.677  1.00 0.00 ? 5   PHE A HD1  3  
ATOM 4514  H HD2  . PHE A 1 5   ? -8.019  11.821  26.823  1.00 0.00 ? 5   PHE A HD2  3  
ATOM 4515  H HE1  . PHE A 1 5   ? -6.603  16.522  26.550  1.00 0.00 ? 5   PHE A HE1  3  
ATOM 4516  H HE2  . PHE A 1 5   ? -6.857  12.843  28.690  1.00 0.00 ? 5   PHE A HE2  3  
ATOM 4517  H HZ   . PHE A 1 5   ? -6.125  15.201  28.573  1.00 0.00 ? 5   PHE A HZ   3  
ATOM 4518  N N    . ARG A 1 6   ? -12.329 12.872  23.241  1.00 0.00 ? 6   ARG A N    3  
ATOM 4519  C CA   . ARG A 1 6   ? -13.239 12.508  22.145  1.00 0.00 ? 6   ARG A CA   3  
ATOM 4520  C C    . ARG A 1 6   ? -13.480 13.622  21.126  1.00 0.00 ? 6   ARG A C    3  
ATOM 4521  O O    . ARG A 1 6   ? -14.445 13.652  20.365  1.00 0.00 ? 6   ARG A O    3  
ATOM 4522  C CB   . ARG A 1 6   ? -14.584 12.072  22.766  1.00 0.00 ? 6   ARG A CB   3  
ATOM 4523  C CG   . ARG A 1 6   ? -15.341 13.150  23.573  1.00 0.00 ? 6   ARG A CG   3  
ATOM 4524  C CD   . ARG A 1 6   ? -16.530 12.575  24.355  1.00 0.00 ? 6   ARG A CD   3  
ATOM 4525  N NE   . ARG A 1 6   ? -17.189 13.698  25.110  1.00 0.00 ? 6   ARG A NE   3  
ATOM 4526  C CZ   . ARG A 1 6   ? -18.159 13.501  26.058  1.00 0.00 ? 6   ARG A CZ   3  
ATOM 4527  N NH1  . ARG A 1 6   ? -18.591 12.245  26.369  1.00 0.00 ? 6   ARG A NH1  3  
ATOM 4528  N NH2  . ARG A 1 6   ? -18.693 14.579  26.705  1.00 0.00 ? 6   ARG A NH2  3  
ATOM 4529  H H    . ARG A 1 6   ? -12.787 13.142  24.083  1.00 0.00 ? 6   ARG A H    3  
ATOM 4530  H HA   . ARG A 1 6   ? -12.821 11.668  21.604  1.00 0.00 ? 6   ARG A HA   3  
ATOM 4531  H HB2  . ARG A 1 6   ? -15.246 11.685  21.964  1.00 0.00 ? 6   ARG A HB2  3  
ATOM 4532  H HB3  . ARG A 1 6   ? -14.346 11.232  23.452  1.00 0.00 ? 6   ARG A HB3  3  
ATOM 4533  H HG2  . ARG A 1 6   ? -14.651 13.643  24.291  1.00 0.00 ? 6   ARG A HG2  3  
ATOM 4534  H HG3  . ARG A 1 6   ? -15.719 13.932  22.875  1.00 0.00 ? 6   ARG A HG3  3  
ATOM 4535  H HD2  . ARG A 1 6   ? -17.271 12.125  23.659  1.00 0.00 ? 6   ARG A HD2  3  
ATOM 4536  H HD3  . ARG A 1 6   ? -16.167 11.805  25.073  1.00 0.00 ? 6   ARG A HD3  3  
ATOM 4537  H HE   . ARG A 1 6   ? -16.897 14.634  24.914  1.00 0.00 ? 6   ARG A HE   3  
ATOM 4538  H HH11 . ARG A 1 6   ? -18.201 11.452  25.902  1.00 0.00 ? 6   ARG A HH11 3  
ATOM 4539  H HH12 . ARG A 1 6   ? -19.297 12.118  27.067  1.00 0.00 ? 6   ARG A HH12 3  
ATOM 4540  H HH21 . ARG A 1 6   ? -18.377 15.502  26.484  1.00 0.00 ? 6   ARG A HH21 3  
ATOM 4541  H HH22 . ARG A 1 6   ? -19.397 14.445  27.401  1.00 0.00 ? 6   ARG A HH22 3  
ATOM 4542  N N    . TRP A 1 7   ? -12.543 14.578  21.163  1.00 0.00 ? 7   TRP A N    3  
ATOM 4543  C CA   . TRP A 1 7   ? -12.419 15.822  20.434  1.00 0.00 ? 7   TRP A CA   3  
ATOM 4544  C C    . TRP A 1 7   ? -11.620 15.694  19.129  1.00 0.00 ? 7   TRP A C    3  
ATOM 4545  O O    . TRP A 1 7   ? -11.065 14.650  18.802  1.00 0.00 ? 7   TRP A O    3  
ATOM 4546  C CB   . TRP A 1 7   ? -11.862 16.898  21.430  1.00 0.00 ? 7   TRP A CB   3  
ATOM 4547  C CG   . TRP A 1 7   ? -10.411 16.860  21.945  1.00 0.00 ? 7   TRP A CG   3  
ATOM 4548  C CD1  . TRP A 1 7   ? -9.338  16.076  21.613  1.00 0.00 ? 7   TRP A CD1  3  
ATOM 4549  C CD2  . TRP A 1 7   ? -9.918  17.824  22.899  1.00 0.00 ? 7   TRP A CD2  3  
ATOM 4550  N NE1  . TRP A 1 7   ? -8.196  16.545  22.235  1.00 0.00 ? 7   TRP A NE1  3  
ATOM 4551  C CE2  . TRP A 1 7   ? -8.549  17.602  23.048  1.00 0.00 ? 7   TRP A CE2  3  
ATOM 4552  C CE3  . TRP A 1 7   ? -10.551 18.827  23.586  1.00 0.00 ? 7   TRP A CE3  3  
ATOM 4553  C CZ2  . TRP A 1 7   ? -7.793  18.381  23.879  1.00 0.00 ? 7   TRP A CZ2  3  
ATOM 4554  C CZ3  . TRP A 1 7   ? -9.790  19.598  24.441  1.00 0.00 ? 7   TRP A CZ3  3  
ATOM 4555  C CH2  . TRP A 1 7   ? -8.433  19.377  24.586  1.00 0.00 ? 7   TRP A CH2  3  
ATOM 4556  H H    . TRP A 1 7   ? -11.846 14.372  21.837  1.00 0.00 ? 7   TRP A H    3  
ATOM 4557  H HA   . TRP A 1 7   ? -13.417 16.136  20.152  1.00 0.00 ? 7   TRP A HA   3  
ATOM 4558  H HB2  . TRP A 1 7   ? -12.029 17.918  21.031  1.00 0.00 ? 7   TRP A HB2  3  
ATOM 4559  H HB3  . TRP A 1 7   ? -12.506 16.829  22.337  1.00 0.00 ? 7   TRP A HB3  3  
ATOM 4560  H HD1  . TRP A 1 7   ? -9.377  15.222  20.953  1.00 0.00 ? 7   TRP A HD1  3  
ATOM 4561  H HE1  . TRP A 1 7   ? -7.272  16.394  21.943  1.00 0.00 ? 7   TRP A HE1  3  
ATOM 4562  H HE3  . TRP A 1 7   ? -11.613 19.011  23.499  1.00 0.00 ? 7   TRP A HE3  3  
ATOM 4563  H HZ2  . TRP A 1 7   ? -6.730  18.220  24.002  1.00 0.00 ? 7   TRP A HZ2  3  
ATOM 4564  H HZ3  . TRP A 1 7   ? -10.262 20.390  25.012  1.00 0.00 ? 7   TRP A HZ3  3  
ATOM 4565  H HH2  . TRP A 1 7   ? -7.866  19.994  25.273  1.00 0.00 ? 7   TRP A HH2  3  
ATOM 4566  N N    . THR A 1 8   ? -11.508 16.791  18.334  1.00 0.00 ? 8   THR A N    3  
ATOM 4567  C CA   . THR A 1 8   ? -10.825 16.870  17.033  1.00 0.00 ? 8   THR A CA   3  
ATOM 4568  C C    . THR A 1 8   ? -9.305  17.012  17.160  1.00 0.00 ? 8   THR A C    3  
ATOM 4569  O O    . THR A 1 8   ? -8.554  16.791  16.217  1.00 0.00 ? 8   THR A O    3  
ATOM 4570  C CB   . THR A 1 8   ? -11.438 18.009  16.179  1.00 0.00 ? 8   THR A CB   3  
ATOM 4571  O OG1  . THR A 1 8   ? -11.181 17.905  14.782  1.00 0.00 ? 8   THR A OG1  3  
ATOM 4572  C CG2  . THR A 1 8   ? -11.017 19.421  16.640  1.00 0.00 ? 8   THR A CG2  3  
ATOM 4573  H H    . THR A 1 8   ? -11.959 17.635  18.596  1.00 0.00 ? 8   THR A H    3  
ATOM 4574  H HA   . THR A 1 8   ? -11.009 15.947  16.497  1.00 0.00 ? 8   THR A HA   3  
ATOM 4575  H HB   . THR A 1 8   ? -12.546 17.928  16.285  1.00 0.00 ? 8   THR A HB   3  
ATOM 4576  H HG1  . THR A 1 8   ? -10.256 18.143  14.666  1.00 0.00 ? 8   THR A HG1  3  
ATOM 4577  H HG21 . THR A 1 8   ? -11.214 19.567  17.721  1.00 0.00 ? 8   THR A HG21 3  
ATOM 4578  H HG22 . THR A 1 8   ? -9.935  19.599  16.461  1.00 0.00 ? 8   THR A HG22 3  
ATOM 4579  H HG23 . THR A 1 8   ? -11.590 20.187  16.073  1.00 0.00 ? 8   THR A HG23 3  
ATOM 4580  N N    . LYS A 1 9   ? -8.819  17.446  18.352  1.00 0.00 ? 9   LYS A N    3  
ATOM 4581  C CA   . LYS A 1 9   ? -7.431  17.721  18.720  1.00 0.00 ? 9   LYS A CA   3  
ATOM 4582  C C    . LYS A 1 9   ? -6.479  16.561  18.887  1.00 0.00 ? 9   LYS A C    3  
ATOM 4583  O O    . LYS A 1 9   ? -5.282  16.723  18.684  1.00 0.00 ? 9   LYS A O    3  
ATOM 4584  C CB   . LYS A 1 9   ? -7.273  18.833  19.783  1.00 0.00 ? 9   LYS A CB   3  
ATOM 4585  C CG   . LYS A 1 9   ? -8.079  20.100  19.459  1.00 0.00 ? 9   LYS A CG   3  
ATOM 4586  C CD   . LYS A 1 9   ? -8.008  21.124  20.596  1.00 0.00 ? 9   LYS A CD   3  
ATOM 4587  C CE   . LYS A 1 9   ? -8.839  22.383  20.315  1.00 0.00 ? 9   LYS A CE   3  
ATOM 4588  N NZ   . LYS A 1 9   ? -8.758  23.336  21.446  1.00 0.00 ? 9   LYS A NZ   3  
ATOM 4589  H H    . LYS A 1 9   ? -9.472  17.613  19.087  1.00 0.00 ? 9   LYS A H    3  
ATOM 4590  H HA   . LYS A 1 9   ? -7.011  18.107  17.792  1.00 0.00 ? 9   LYS A HA   3  
ATOM 4591  H HB2  . LYS A 1 9   ? -7.621  18.466  20.767  1.00 0.00 ? 9   LYS A HB2  3  
ATOM 4592  H HB3  . LYS A 1 9   ? -6.202  19.122  19.884  1.00 0.00 ? 9   LYS A HB3  3  
ATOM 4593  H HG2  . LYS A 1 9   ? -7.696  20.555  18.518  1.00 0.00 ? 9   LYS A HG2  3  
ATOM 4594  H HG3  . LYS A 1 9   ? -9.148  19.841  19.297  1.00 0.00 ? 9   LYS A HG3  3  
ATOM 4595  H HD2  . LYS A 1 9   ? -8.379  20.646  21.531  1.00 0.00 ? 9   LYS A HD2  3  
ATOM 4596  H HD3  . LYS A 1 9   ? -6.946  21.412  20.758  1.00 0.00 ? 9   LYS A HD3  3  
ATOM 4597  H HE2  . LYS A 1 9   ? -8.465  22.901  19.407  1.00 0.00 ? 9   LYS A HE2  3  
ATOM 4598  H HE3  . LYS A 1 9   ? -9.908  22.117  20.172  1.00 0.00 ? 9   LYS A HE3  3  
ATOM 4599  H HZ1  . LYS A 1 9   ? -9.116  22.880  22.310  1.00 0.00 ? 9   LYS A HZ1  3  
ATOM 4600  H HZ2  . LYS A 1 9   ? -7.768  23.620  21.589  1.00 0.00 ? 9   LYS A HZ2  3  
ATOM 4601  H HZ3  . LYS A 1 9   ? -9.334  24.175  21.233  1.00 0.00 ? 9   LYS A HZ3  3  
ATOM 4602  N N    . GLU A 1 10  ? -6.978  15.346  19.252  1.00 0.00 ? 10  GLU A N    3  
ATOM 4603  C CA   . GLU A 1 10  ? -6.209  14.086  19.380  1.00 0.00 ? 10  GLU A CA   3  
ATOM 4604  C C    . GLU A 1 10  ? -5.397  13.649  18.117  1.00 0.00 ? 10  GLU A C    3  
ATOM 4605  O O    . GLU A 1 10  ? -4.322  13.055  18.184  1.00 0.00 ? 10  GLU A O    3  
ATOM 4606  C CB   . GLU A 1 10  ? -7.130  12.990  19.969  1.00 0.00 ? 10  GLU A CB   3  
ATOM 4607  C CG   . GLU A 1 10  ? -8.137  12.474  18.944  1.00 0.00 ? 10  GLU A CG   3  
ATOM 4608  C CD   . GLU A 1 10  ? -9.015  11.365  19.510  1.00 0.00 ? 10  GLU A CD   3  
ATOM 4609  O OE1  . GLU A 1 10  ? -8.452  10.366  20.033  1.00 0.00 ? 10  GLU A OE1  3  
ATOM 4610  O OE2  . GLU A 1 10  ? -10.266 11.496  19.422  1.00 0.00 ? 10  GLU A OE2  3  
ATOM 4611  H H    . GLU A 1 10  ? -7.960  15.294  19.455  1.00 0.00 ? 10  GLU A H    3  
ATOM 4612  H HA   . GLU A 1 10  ? -5.479  14.191  20.137  1.00 0.00 ? 10  GLU A HA   3  
ATOM 4613  H HB2  . GLU A 1 10  ? -6.501  12.145  20.327  1.00 0.00 ? 10  GLU A HB2  3  
ATOM 4614  H HB3  . GLU A 1 10  ? -7.673  13.399  20.851  1.00 0.00 ? 10  GLU A HB3  3  
ATOM 4615  H HG2  . GLU A 1 10  ? -8.761  13.301  18.546  1.00 0.00 ? 10  GLU A HG2  3  
ATOM 4616  H HG3  . GLU A 1 10  ? -7.487  12.086  18.141  1.00 0.00 ? 10  GLU A HG3  3  
ATOM 4617  N N    . GLU A 1 11  ? -5.909  14.083  16.934  1.00 0.00 ? 11  GLU A N    3  
ATOM 4618  C CA   . GLU A 1 11  ? -5.430  14.064  15.567  1.00 0.00 ? 11  GLU A CA   3  
ATOM 4619  C C    . GLU A 1 11  ? -4.239  14.981  15.328  1.00 0.00 ? 11  GLU A C    3  
ATOM 4620  O O    . GLU A 1 11  ? -3.384  14.636  14.521  1.00 0.00 ? 11  GLU A O    3  
ATOM 4621  C CB   . GLU A 1 11  ? -6.584  14.643  14.692  1.00 0.00 ? 11  GLU A CB   3  
ATOM 4622  C CG   . GLU A 1 11  ? -7.843  13.751  14.673  1.00 0.00 ? 11  GLU A CG   3  
ATOM 4623  C CD   . GLU A 1 11  ? -8.883  14.360  13.731  1.00 0.00 ? 11  GLU A CD   3  
ATOM 4624  O OE1  . GLU A 1 11  ? -8.574  14.505  12.519  1.00 0.00 ? 11  GLU A OE1  3  
ATOM 4625  O OE2  . GLU A 1 11  ? -10.002 14.685  14.211  1.00 0.00 ? 11  GLU A OE2  3  
ATOM 4626  H H    . GLU A 1 11  ? -6.781  14.546  16.987  1.00 0.00 ? 11  GLU A H    3  
ATOM 4627  H HA   . GLU A 1 11  ? -5.107  13.052  15.270  1.00 0.00 ? 11  GLU A HA   3  
ATOM 4628  H HB2  . GLU A 1 11  ? -6.857  15.677  15.067  1.00 0.00 ? 11  GLU A HB2  3  
ATOM 4629  H HB3  . GLU A 1 11  ? -6.255  14.738  13.631  1.00 0.00 ? 11  GLU A HB3  3  
ATOM 4630  H HG2  . GLU A 1 11  ? -7.556  12.741  14.276  1.00 0.00 ? 11  GLU A HG2  3  
ATOM 4631  H HG3  . GLU A 1 11  ? -8.290  13.681  15.700  1.00 0.00 ? 11  GLU A HG3  3  
ATOM 4632  N N    . GLU A 1 12  ? -4.148  16.161  16.033  1.00 0.00 ? 12  GLU A N    3  
ATOM 4633  C CA   . GLU A 1 12  ? -3.106  17.208  15.939  1.00 0.00 ? 12  GLU A CA   3  
ATOM 4634  C C    . GLU A 1 12  ? -1.679  16.689  16.134  1.00 0.00 ? 12  GLU A C    3  
ATOM 4635  O O    . GLU A 1 12  ? -0.759  17.038  15.405  1.00 0.00 ? 12  GLU A O    3  
ATOM 4636  C CB   . GLU A 1 12  ? -3.435  18.398  16.885  1.00 0.00 ? 12  GLU A CB   3  
ATOM 4637  C CG   . GLU A 1 12  ? -2.626  19.682  16.622  1.00 0.00 ? 12  GLU A CG   3  
ATOM 4638  C CD   . GLU A 1 12  ? -3.146  20.797  17.529  1.00 0.00 ? 12  GLU A CD   3  
ATOM 4639  O OE1  . GLU A 1 12  ? -3.044  20.642  18.775  1.00 0.00 ? 12  GLU A OE1  3  
ATOM 4640  O OE2  . GLU A 1 12  ? -3.651  21.817  16.988  1.00 0.00 ? 12  GLU A OE2  3  
ATOM 4641  H H    . GLU A 1 12  ? -4.865  16.373  16.702  1.00 0.00 ? 12  GLU A H    3  
ATOM 4642  H HA   . GLU A 1 12  ? -3.141  17.588  14.926  1.00 0.00 ? 12  GLU A HA   3  
ATOM 4643  H HB2  . GLU A 1 12  ? -4.515  18.639  16.747  1.00 0.00 ? 12  GLU A HB2  3  
ATOM 4644  H HB3  . GLU A 1 12  ? -3.306  18.083  17.944  1.00 0.00 ? 12  GLU A HB3  3  
ATOM 4645  H HG2  . GLU A 1 12  ? -1.549  19.518  16.830  1.00 0.00 ? 12  GLU A HG2  3  
ATOM 4646  H HG3  . GLU A 1 12  ? -2.741  19.979  15.557  1.00 0.00 ? 12  GLU A HG3  3  
ATOM 4647  N N    . GLU A 1 13  ? -1.534  15.716  17.065  1.00 0.00 ? 13  GLU A N    3  
ATOM 4648  C CA   . GLU A 1 13  ? -0.386  14.849  17.320  1.00 0.00 ? 13  GLU A CA   3  
ATOM 4649  C C    . GLU A 1 13  ? 0.009   13.847  16.198  1.00 0.00 ? 13  GLU A C    3  
ATOM 4650  O O    . GLU A 1 13  ? 1.126   13.343  16.166  1.00 0.00 ? 13  GLU A O    3  
ATOM 4651  C CB   . GLU A 1 13  ? -0.762  13.981  18.558  1.00 0.00 ? 13  GLU A CB   3  
ATOM 4652  C CG   . GLU A 1 13  ? -0.910  14.806  19.850  1.00 0.00 ? 13  GLU A CG   3  
ATOM 4653  C CD   . GLU A 1 13  ? -1.370  13.886  20.980  1.00 0.00 ? 13  GLU A CD   3  
ATOM 4654  O OE1  . GLU A 1 13  ? -0.596  12.960  21.345  1.00 0.00 ? 13  GLU A OE1  3  
ATOM 4655  O OE2  . GLU A 1 13  ? -2.503  14.095  21.492  1.00 0.00 ? 13  GLU A OE2  3  
ATOM 4656  H H    . GLU A 1 13  ? -2.326  15.536  17.649  1.00 0.00 ? 13  GLU A H    3  
ATOM 4657  H HA   . GLU A 1 13  ? 0.483   15.459  17.536  1.00 0.00 ? 13  GLU A HA   3  
ATOM 4658  H HB2  . GLU A 1 13  ? -1.742  13.485  18.356  1.00 0.00 ? 13  GLU A HB2  3  
ATOM 4659  H HB3  . GLU A 1 13  ? -0.019  13.167  18.728  1.00 0.00 ? 13  GLU A HB3  3  
ATOM 4660  H HG2  . GLU A 1 13  ? 0.097   15.234  20.124  1.00 0.00 ? 13  GLU A HG2  3  
ATOM 4661  H HG3  . GLU A 1 13  ? -1.703  15.592  19.690  1.00 0.00 ? 13  GLU A HG3  3  
ATOM 4662  N N    . THR A 1 14  ? -0.953  13.441  15.322  1.00 0.00 ? 14  THR A N    3  
ATOM 4663  C CA   . THR A 1 14  ? -0.906  12.377  14.323  1.00 0.00 ? 14  THR A CA   3  
ATOM 4664  C C    . THR A 1 14  ? -0.231  12.533  12.970  1.00 0.00 ? 14  THR A C    3  
ATOM 4665  O O    . THR A 1 14  ? 0.173   11.528  12.392  1.00 0.00 ? 14  THR A O    3  
ATOM 4666  C CB   . THR A 1 14  ? -2.199  11.534  14.320  1.00 0.00 ? 14  THR A CB   3  
ATOM 4667  O OG1  . THR A 1 14  ? -3.318  12.164  13.719  1.00 0.00 ? 14  THR A OG1  3  
ATOM 4668  C CG2  . THR A 1 14  ? -2.545  11.114  15.769  1.00 0.00 ? 14  THR A CG2  3  
ATOM 4669  H H    . THR A 1 14  ? -1.856  13.867  15.312  1.00 0.00 ? 14  THR A H    3  
ATOM 4670  H HA   . THR A 1 14  ? -0.153  11.717  14.737  1.00 0.00 ? 14  THR A HA   3  
ATOM 4671  H HB   . THR A 1 14  ? -2.102  10.604  13.745  1.00 0.00 ? 14  THR A HB   3  
ATOM 4672  H HG1  . THR A 1 14  ? -3.344  13.091  14.031  1.00 0.00 ? 14  THR A HG1  3  
ATOM 4673  H HG21 . THR A 1 14  ? -1.703  10.539  16.211  1.00 0.00 ? 14  THR A HG21 3  
ATOM 4674  H HG22 . THR A 1 14  ? -2.739  11.978  16.440  1.00 0.00 ? 14  THR A HG22 3  
ATOM 4675  H HG23 . THR A 1 14  ? -3.456  10.480  15.775  1.00 0.00 ? 14  THR A HG23 3  
ATOM 4676  N N    . ARG A 1 15  ? -0.129  13.748  12.357  1.00 0.00 ? 15  ARG A N    3  
ATOM 4677  C CA   . ARG A 1 15  ? 0.380   14.030  10.995  1.00 0.00 ? 15  ARG A CA   3  
ATOM 4678  C C    . ARG A 1 15  ? 1.829   13.624  10.600  1.00 0.00 ? 15  ARG A C    3  
ATOM 4679  O O    . ARG A 1 15  ? 2.644   14.444  10.183  1.00 0.00 ? 15  ARG A O    3  
ATOM 4680  C CB   . ARG A 1 15  ? 0.134   15.521  10.597  1.00 0.00 ? 15  ARG A CB   3  
ATOM 4681  C CG   . ARG A 1 15  ? -1.354  15.934  10.515  1.00 0.00 ? 15  ARG A CG   3  
ATOM 4682  C CD   . ARG A 1 15  ? -2.014  16.319  11.851  1.00 0.00 ? 15  ARG A CD   3  
ATOM 4683  N NE   . ARG A 1 15  ? -3.430  16.778  11.612  1.00 0.00 ? 15  ARG A NE   3  
ATOM 4684  C CZ   . ARG A 1 15  ? -4.488  15.932  11.401  1.00 0.00 ? 15  ARG A CZ   3  
ATOM 4685  N NH1  . ARG A 1 15  ? -4.323  14.577  11.396  1.00 0.00 ? 15  ARG A NH1  3  
ATOM 4686  N NH2  . ARG A 1 15  ? -5.732  16.457  11.200  1.00 0.00 ? 15  ARG A NH2  3  
ATOM 4687  H H    . ARG A 1 15  ? -0.465  14.553  12.845  1.00 0.00 ? 15  ARG A H    3  
ATOM 4688  H HA   . ARG A 1 15  ? -0.248  13.455  10.325  1.00 0.00 ? 15  ARG A HA   3  
ATOM 4689  H HB2  . ARG A 1 15  ? 0.667   16.200  11.297  1.00 0.00 ? 15  ARG A HB2  3  
ATOM 4690  H HB3  . ARG A 1 15  ? 0.544   15.711  9.575   1.00 0.00 ? 15  ARG A HB3  3  
ATOM 4691  H HG2  . ARG A 1 15  ? -1.423  16.825  9.845   1.00 0.00 ? 15  ARG A HG2  3  
ATOM 4692  H HG3  . ARG A 1 15  ? -1.916  15.104  10.035  1.00 0.00 ? 15  ARG A HG3  3  
ATOM 4693  H HD2  . ARG A 1 15  ? -2.015  15.476  12.572  1.00 0.00 ? 15  ARG A HD2  3  
ATOM 4694  H HD3  . ARG A 1 15  ? -1.465  17.169  12.309  1.00 0.00 ? 15  ARG A HD3  3  
ATOM 4695  H HE   . ARG A 1 15  ? -3.606  17.763  11.610  1.00 0.00 ? 15  ARG A HE   3  
ATOM 4696  H HH11 . ARG A 1 15  ? -3.416  14.185  11.546  1.00 0.00 ? 15  ARG A HH11 3  
ATOM 4697  H HH12 . ARG A 1 15  ? -5.108  13.978  11.241  1.00 0.00 ? 15  ARG A HH12 3  
ATOM 4698  H HH21 . ARG A 1 15  ? -5.863  17.448  11.204  1.00 0.00 ? 15  ARG A HH21 3  
ATOM 4699  H HH22 . ARG A 1 15  ? -6.513  15.850  11.047  1.00 0.00 ? 15  ARG A HH22 3  
ATOM 4700  N N    . GLN A 1 16  ? 2.136   12.309  10.713  1.00 0.00 ? 16  GLN A N    3  
ATOM 4701  C CA   . GLN A 1 16  ? 3.332   11.555  10.352  1.00 0.00 ? 16  GLN A CA   3  
ATOM 4702  C C    . GLN A 1 16  ? 4.708   11.879  10.894  1.00 0.00 ? 16  GLN A C    3  
ATOM 4703  O O    . GLN A 1 16  ? 5.587   11.028  10.867  1.00 0.00 ? 16  GLN A O    3  
ATOM 4704  C CB   . GLN A 1 16  ? 3.375   11.241  8.820   1.00 0.00 ? 16  GLN A CB   3  
ATOM 4705  C CG   . GLN A 1 16  ? 2.315   10.210  8.375   1.00 0.00 ? 16  GLN A CG   3  
ATOM 4706  C CD   . GLN A 1 16  ? 2.523   8.970   9.239   1.00 0.00 ? 16  GLN A CD   3  
ATOM 4707  O OE1  . GLN A 1 16  ? 3.533   8.271   9.198   1.00 0.00 ? 16  GLN A OE1  3  
ATOM 4708  N NE2  . GLN A 1 16  ? 1.610   8.822   10.231  1.00 0.00 ? 16  GLN A NE2  3  
ATOM 4709  H H    . GLN A 1 16  ? 1.406   11.747  11.125  1.00 0.00 ? 16  GLN A H    3  
ATOM 4710  H HA   . GLN A 1 16  ? 3.180   10.632  10.881  1.00 0.00 ? 16  GLN A HA   3  
ATOM 4711  H HB2  . GLN A 1 16  ? 3.244   12.186  8.248   1.00 0.00 ? 16  GLN A HB2  3  
ATOM 4712  H HB3  . GLN A 1 16  ? 4.357   10.815  8.514   1.00 0.00 ? 16  GLN A HB3  3  
ATOM 4713  H HG2  . GLN A 1 16  ? 1.296   10.625  8.514   1.00 0.00 ? 16  GLN A HG2  3  
ATOM 4714  H HG3  . GLN A 1 16  ? 2.442   9.939   7.307   1.00 0.00 ? 16  GLN A HG3  3  
ATOM 4715  H HE21 . GLN A 1 16  ? 0.708   9.260   10.151  1.00 0.00 ? 16  GLN A HE21 3  
ATOM 4716  H HE22 . GLN A 1 16  ? 1.872   8.306   11.044  1.00 0.00 ? 16  GLN A HE22 3  
ATOM 4717  N N    . MET A 1 17  ? 4.966   13.095  11.400  1.00 0.00 ? 17  MET A N    3  
ATOM 4718  C CA   . MET A 1 17  ? 6.262   13.555  11.854  1.00 0.00 ? 17  MET A CA   3  
ATOM 4719  C C    . MET A 1 17  ? 6.953   12.849  13.031  1.00 0.00 ? 17  MET A C    3  
ATOM 4720  O O    . MET A 1 17  ? 8.171   12.718  12.989  1.00 0.00 ? 17  MET A O    3  
ATOM 4721  C CB   . MET A 1 17  ? 6.225   15.115  12.040  1.00 0.00 ? 17  MET A CB   3  
ATOM 4722  C CG   . MET A 1 17  ? 4.926   15.739  12.613  1.00 0.00 ? 17  MET A CG   3  
ATOM 4723  S SD   . MET A 1 17  ? 4.338   15.093  14.218  1.00 0.00 ? 17  MET A SD   3  
ATOM 4724  C CE   . MET A 1 17  ? 2.552   14.943  13.929  1.00 0.00 ? 17  MET A CE   3  
ATOM 4725  H H    . MET A 1 17  ? 4.240   13.782  11.404  1.00 0.00 ? 17  MET A H    3  
ATOM 4726  H HA   . MET A 1 17  ? 6.953   13.352  11.042  1.00 0.00 ? 17  MET A HA   3  
ATOM 4727  H HB2  . MET A 1 17  ? 7.108   15.487  12.604  1.00 0.00 ? 17  MET A HB2  3  
ATOM 4728  H HB3  . MET A 1 17  ? 6.264   15.582  11.028  1.00 0.00 ? 17  MET A HB3  3  
ATOM 4729  H HG2  . MET A 1 17  ? 5.110   16.834  12.714  1.00 0.00 ? 17  MET A HG2  3  
ATOM 4730  H HG3  . MET A 1 17  ? 4.158   15.648  11.814  1.00 0.00 ? 17  MET A HG3  3  
ATOM 4731  H HE1  . MET A 1 17  ? 2.250   15.331  12.937  1.00 0.00 ? 17  MET A HE1  3  
ATOM 4732  H HE2  . MET A 1 17  ? 2.191   13.885  14.024  1.00 0.00 ? 17  MET A HE2  3  
ATOM 4733  H HE3  . MET A 1 17  ? 1.997   15.535  14.686  1.00 0.00 ? 17  MET A HE3  3  
ATOM 4734  N N    . TYR A 1 18  ? 6.242   12.466  14.131  1.00 0.00 ? 18  TYR A N    3  
ATOM 4735  C CA   . TYR A 1 18  ? 6.854   12.008  15.388  1.00 0.00 ? 18  TYR A CA   3  
ATOM 4736  C C    . TYR A 1 18  ? 7.514   10.681  15.757  1.00 0.00 ? 18  TYR A C    3  
ATOM 4737  O O    . TYR A 1 18  ? 8.669   10.686  16.166  1.00 0.00 ? 18  TYR A O    3  
ATOM 4738  C CB   . TYR A 1 18  ? 6.110   12.618  16.631  1.00 0.00 ? 18  TYR A CB   3  
ATOM 4739  C CG   . TYR A 1 18  ? 4.996   11.763  17.235  1.00 0.00 ? 18  TYR A CG   3  
ATOM 4740  C CD1  . TYR A 1 18  ? 3.783   11.635  16.576  1.00 0.00 ? 18  TYR A CD1  3  
ATOM 4741  C CD2  . TYR A 1 18  ? 5.161   11.068  18.432  1.00 0.00 ? 18  TYR A CD2  3  
ATOM 4742  C CE1  . TYR A 1 18  ? 2.762   10.854  17.089  1.00 0.00 ? 18  TYR A CE1  3  
ATOM 4743  C CE2  . TYR A 1 18  ? 4.139   10.290  18.945  1.00 0.00 ? 18  TYR A CE2  3  
ATOM 4744  C CZ   . TYR A 1 18  ? 2.939   10.185  18.281  1.00 0.00 ? 18  TYR A CZ   3  
ATOM 4745  O OH   . TYR A 1 18  ? 1.910   9.390   18.827  1.00 0.00 ? 18  TYR A OH   3  
ATOM 4746  H H    . TYR A 1 18  ? 5.260   12.596  14.143  1.00 0.00 ? 18  TYR A H    3  
ATOM 4747  H HA   . TYR A 1 18  ? 7.777   12.538  15.356  1.00 0.00 ? 18  TYR A HA   3  
ATOM 4748  H HB2  . TYR A 1 18  ? 6.863   12.881  17.409  1.00 0.00 ? 18  TYR A HB2  3  
ATOM 4749  H HB3  . TYR A 1 18  ? 5.650   13.582  16.324  1.00 0.00 ? 18  TYR A HB3  3  
ATOM 4750  H HD1  . TYR A 1 18  ? 3.621   12.166  15.648  1.00 0.00 ? 18  TYR A HD1  3  
ATOM 4751  H HD2  . TYR A 1 18  ? 6.088   11.101  18.990  1.00 0.00 ? 18  TYR A HD2  3  
ATOM 4752  H HE1  . TYR A 1 18  ? 1.823   10.789  16.552  1.00 0.00 ? 18  TYR A HE1  3  
ATOM 4753  H HE2  . TYR A 1 18  ? 4.290   9.752   19.873  1.00 0.00 ? 18  TYR A HE2  3  
ATOM 4754  H HH   . TYR A 1 18  ? 1.171   9.378   18.209  1.00 0.00 ? 18  TYR A HH   3  
ATOM 4755  N N    . ASP A 1 19  ? 6.809   9.523   15.739  1.00 0.00 ? 19  ASP A N    3  
ATOM 4756  C CA   . ASP A 1 19  ? 7.288   8.312   16.426  1.00 0.00 ? 19  ASP A CA   3  
ATOM 4757  C C    . ASP A 1 19  ? 8.122   7.384   15.554  1.00 0.00 ? 19  ASP A C    3  
ATOM 4758  O O    . ASP A 1 19  ? 8.895   7.811   14.701  1.00 0.00 ? 19  ASP A O    3  
ATOM 4759  C CB   . ASP A 1 19  ? 6.029   7.590   17.029  1.00 0.00 ? 19  ASP A CB   3  
ATOM 4760  C CG   . ASP A 1 19  ? 6.325   6.740   18.275  1.00 0.00 ? 19  ASP A CG   3  
ATOM 4761  O OD1  . ASP A 1 19  ? 6.864   7.305   19.262  1.00 0.00 ? 19  ASP A OD1  3  
ATOM 4762  O OD2  . ASP A 1 19  ? 6.004   5.522   18.251  1.00 0.00 ? 19  ASP A OD2  3  
ATOM 4763  H H    . ASP A 1 19  ? 5.870   9.507   15.406  1.00 0.00 ? 19  ASP A H    3  
ATOM 4764  H HA   . ASP A 1 19  ? 7.923   8.599   17.258  1.00 0.00 ? 19  ASP A HA   3  
ATOM 4765  H HB2  . ASP A 1 19  ? 5.321   8.383   17.356  1.00 0.00 ? 19  ASP A HB2  3  
ATOM 4766  H HB3  . ASP A 1 19  ? 5.490   6.994   16.264  1.00 0.00 ? 19  ASP A HB3  3  
ATOM 4767  N N    . MET A 1 20  ? 7.891   6.047   15.702  1.00 0.00 ? 20  MET A N    3  
ATOM 4768  C CA   . MET A 1 20  ? 8.406   4.887   14.976  1.00 0.00 ? 20  MET A CA   3  
ATOM 4769  C C    . MET A 1 20  ? 8.086   4.927   13.477  1.00 0.00 ? 20  MET A C    3  
ATOM 4770  O O    . MET A 1 20  ? 8.726   4.319   12.627  1.00 0.00 ? 20  MET A O    3  
ATOM 4771  C CB   . MET A 1 20  ? 8.082   3.557   15.703  1.00 0.00 ? 20  MET A CB   3  
ATOM 4772  C CG   . MET A 1 20  ? 6.668   2.993   15.515  1.00 0.00 ? 20  MET A CG   3  
ATOM 4773  S SD   . MET A 1 20  ? 6.617   1.237   15.043  1.00 0.00 ? 20  MET A SD   3  
ATOM 4774  C CE   . MET A 1 20  ? 7.595   1.312   13.513  1.00 0.00 ? 20  MET A CE   3  
ATOM 4775  H H    . MET A 1 20  ? 7.235   5.788   16.405  1.00 0.00 ? 20  MET A H    3  
ATOM 4776  H HA   . MET A 1 20  ? 9.483   4.986   15.002  1.00 0.00 ? 20  MET A HA   3  
ATOM 4777  H HB2  . MET A 1 20  ? 8.825   2.795   15.392  1.00 0.00 ? 20  MET A HB2  3  
ATOM 4778  H HB3  . MET A 1 20  ? 8.227   3.699   16.799  1.00 0.00 ? 20  MET A HB3  3  
ATOM 4779  H HG2  . MET A 1 20  ? 6.112   3.154   16.467  1.00 0.00 ? 20  MET A HG2  3  
ATOM 4780  H HG3  . MET A 1 20  ? 6.157   3.574   14.725  1.00 0.00 ? 20  MET A HG3  3  
ATOM 4781  H HE1  . MET A 1 20  ? 7.176   2.040   12.786  1.00 0.00 ? 20  MET A HE1  3  
ATOM 4782  H HE2  . MET A 1 20  ? 8.651   1.596   13.716  1.00 0.00 ? 20  MET A HE2  3  
ATOM 4783  H HE3  . MET A 1 20  ? 7.604   0.323   13.014  1.00 0.00 ? 20  MET A HE3  3  
ATOM 4784  N N    . VAL A 1 21  ? 7.015   5.693   13.170  1.00 0.00 ? 21  VAL A N    3  
ATOM 4785  C CA   . VAL A 1 21  ? 6.465   6.033   11.830  1.00 0.00 ? 21  VAL A CA   3  
ATOM 4786  C C    . VAL A 1 21  ? 7.456   6.633   10.837  1.00 0.00 ? 21  VAL A C    3  
ATOM 4787  O O    . VAL A 1 21  ? 7.361   6.317   9.650   1.00 0.00 ? 21  VAL A O    3  
ATOM 4788  C CB   . VAL A 1 21  ? 5.175   6.890   11.902  1.00 0.00 ? 21  VAL A CB   3  
ATOM 4789  C CG1  . VAL A 1 21  ? 4.027   6.036   12.508  1.00 0.00 ? 21  VAL A CG1  3  
ATOM 4790  C CG2  . VAL A 1 21  ? 5.353   8.250   12.673  1.00 0.00 ? 21  VAL A CG2  3  
ATOM 4791  H H    . VAL A 1 21  ? 6.664   6.131   14.024  1.00 0.00 ? 21  VAL A H    3  
ATOM 4792  H HA   . VAL A 1 21  ? 6.299   5.091   11.262  1.00 0.00 ? 21  VAL A HA   3  
ATOM 4793  H HB   . VAL A 1 21  ? 4.856   7.109   10.849  1.00 0.00 ? 21  VAL A HB   3  
ATOM 4794  H HG11 . VAL A 1 21  ? 4.061   4.980   12.162  1.00 0.00 ? 21  VAL A HG11 3  
ATOM 4795  H HG12 . VAL A 1 21  ? 4.079   6.035   13.615  1.00 0.00 ? 21  VAL A HG12 3  
ATOM 4796  H HG13 . VAL A 1 21  ? 3.034   6.436   12.201  1.00 0.00 ? 21  VAL A HG13 3  
ATOM 4797  H HG21 . VAL A 1 21  ? 6.160   8.900   12.259  1.00 0.00 ? 21  VAL A HG21 3  
ATOM 4798  H HG22 . VAL A 1 21  ? 4.418   8.849   12.636  1.00 0.00 ? 21  VAL A HG22 3  
ATOM 4799  H HG23 . VAL A 1 21  ? 5.594   8.132   13.745  1.00 0.00 ? 21  VAL A HG23 3  
ATOM 4800  N N    . VAL A 1 22  ? 8.476   7.444   11.280  1.00 0.00 ? 22  VAL A N    3  
ATOM 4801  C CA   . VAL A 1 22  ? 9.557   8.037   10.465  1.00 0.00 ? 22  VAL A CA   3  
ATOM 4802  C C    . VAL A 1 22  ? 10.357  7.026   9.609   1.00 0.00 ? 22  VAL A C    3  
ATOM 4803  O O    . VAL A 1 22  ? 10.738  7.290   8.471   1.00 0.00 ? 22  VAL A O    3  
ATOM 4804  C CB   . VAL A 1 22  ? 10.476  8.908   11.323  1.00 0.00 ? 22  VAL A CB   3  
ATOM 4805  C CG1  . VAL A 1 22  ? 11.615  9.545   10.497  1.00 0.00 ? 22  VAL A CG1  3  
ATOM 4806  C CG2  . VAL A 1 22  ? 9.654   10.019  12.013  1.00 0.00 ? 22  VAL A CG2  3  
ATOM 4807  H H    . VAL A 1 22  ? 8.544   7.664   12.255  1.00 0.00 ? 22  VAL A H    3  
ATOM 4808  H HA   . VAL A 1 22  ? 9.104   8.716   9.767   1.00 0.00 ? 22  VAL A HA   3  
ATOM 4809  H HB   . VAL A 1 22  ? 10.919  8.282   12.121  1.00 0.00 ? 22  VAL A HB   3  
ATOM 4810  H HG11 . VAL A 1 22  ? 11.206  10.017  9.578   1.00 0.00 ? 22  VAL A HG11 3  
ATOM 4811  H HG12 . VAL A 1 22  ? 12.129  10.322  11.100  1.00 0.00 ? 22  VAL A HG12 3  
ATOM 4812  H HG13 . VAL A 1 22  ? 12.365  8.779   10.208  1.00 0.00 ? 22  VAL A HG13 3  
ATOM 4813  H HG21 . VAL A 1 22  ? 9.129   10.644  11.259  1.00 0.00 ? 22  VAL A HG21 3  
ATOM 4814  H HG22 . VAL A 1 22  ? 8.902   9.603   12.714  1.00 0.00 ? 22  VAL A HG22 3  
ATOM 4815  H HG23 . VAL A 1 22  ? 10.326  10.682  12.602  1.00 0.00 ? 22  VAL A HG23 3  
ATOM 4816  N N    . LYS A 1 23  ? 10.559  5.792   10.140  1.00 0.00 ? 23  LYS A N    3  
ATOM 4817  C CA   . LYS A 1 23  ? 11.218  4.636   9.527   1.00 0.00 ? 23  LYS A CA   3  
ATOM 4818  C C    . LYS A 1 23  ? 10.410  3.977   8.390   1.00 0.00 ? 23  LYS A C    3  
ATOM 4819  O O    . LYS A 1 23  ? 10.941  3.671   7.328   1.00 0.00 ? 23  LYS A O    3  
ATOM 4820  C CB   . LYS A 1 23  ? 11.541  3.584   10.625  1.00 0.00 ? 23  LYS A CB   3  
ATOM 4821  C CG   . LYS A 1 23  ? 12.731  3.924   11.553  1.00 0.00 ? 23  LYS A CG   3  
ATOM 4822  C CD   . LYS A 1 23  ? 12.743  5.275   12.301  1.00 0.00 ? 23  LYS A CD   3  
ATOM 4823  C CE   . LYS A 1 23  ? 11.543  5.509   13.226  1.00 0.00 ? 23  LYS A CE   3  
ATOM 4824  N NZ   . LYS A 1 23  ? 11.785  6.657   14.129  1.00 0.00 ? 23  LYS A NZ   3  
ATOM 4825  H H    . LYS A 1 23  ? 10.235  5.647   11.078  1.00 0.00 ? 23  LYS A H    3  
ATOM 4826  H HA   . LYS A 1 23  ? 12.149  4.964   9.086   1.00 0.00 ? 23  LYS A HA   3  
ATOM 4827  H HB2  . LYS A 1 23  ? 10.632  3.409   11.241  1.00 0.00 ? 23  LYS A HB2  3  
ATOM 4828  H HB3  . LYS A 1 23  ? 11.816  2.604   10.165  1.00 0.00 ? 23  LYS A HB3  3  
ATOM 4829  H HG2  . LYS A 1 23  ? 12.791  3.118   12.321  1.00 0.00 ? 23  LYS A HG2  3  
ATOM 4830  H HG3  . LYS A 1 23  ? 13.664  3.874   10.948  1.00 0.00 ? 23  LYS A HG3  3  
ATOM 4831  H HD2  . LYS A 1 23  ? 13.672  5.284   12.917  1.00 0.00 ? 23  LYS A HD2  3  
ATOM 4832  H HD3  . LYS A 1 23  ? 12.824  6.112   11.573  1.00 0.00 ? 23  LYS A HD3  3  
ATOM 4833  H HE2  . LYS A 1 23  ? 10.611  5.730   12.647  1.00 0.00 ? 23  LYS A HE2  3  
ATOM 4834  H HE3  . LYS A 1 23  ? 11.356  4.617   13.857  1.00 0.00 ? 23  LYS A HE3  3  
ATOM 4835  H HZ1  . LYS A 1 23  ? 12.625  6.470   14.712  1.00 0.00 ? 23  LYS A HZ1  3  
ATOM 4836  H HZ2  . LYS A 1 23  ? 11.938  7.515   13.563  1.00 0.00 ? 23  LYS A HZ2  3  
ATOM 4837  H HZ3  . LYS A 1 23  ? 10.957  6.791   14.745  1.00 0.00 ? 23  LYS A HZ3  3  
ATOM 4838  N N    . ILE A 1 24  ? 9.074   3.784   8.581   1.00 0.00 ? 24  ILE A N    3  
ATOM 4839  C CA   . ILE A 1 24  ? 8.085   3.251   7.632   1.00 0.00 ? 24  ILE A CA   3  
ATOM 4840  C C    . ILE A 1 24  ? 7.677   4.269   6.555   1.00 0.00 ? 24  ILE A C    3  
ATOM 4841  O O    . ILE A 1 24  ? 7.534   3.904   5.383   1.00 0.00 ? 24  ILE A O    3  
ATOM 4842  C CB   . ILE A 1 24  ? 6.972   2.448   8.309   1.00 0.00 ? 24  ILE A CB   3  
ATOM 4843  C CG1  . ILE A 1 24  ? 7.494   0.984   8.468   1.00 0.00 ? 24  ILE A CG1  3  
ATOM 4844  C CG2  . ILE A 1 24  ? 5.603   2.544   7.572   1.00 0.00 ? 24  ILE A CG2  3  
ATOM 4845  C CD1  . ILE A 1 24  ? 6.586   0.133   9.353   1.00 0.00 ? 24  ILE A CD1  3  
ATOM 4846  H H    . ILE A 1 24  ? 8.694   4.077   9.451   1.00 0.00 ? 24  ILE A H    3  
ATOM 4847  H HA   . ILE A 1 24  ? 8.596   2.483   7.066   1.00 0.00 ? 24  ILE A HA   3  
ATOM 4848  H HB   . ILE A 1 24  ? 6.822   2.859   9.337   1.00 0.00 ? 24  ILE A HB   3  
ATOM 4849  H HG12 . ILE A 1 24  ? 7.651   0.470   7.482   1.00 0.00 ? 24  ILE A HG12 3  
ATOM 4850  H HG13 . ILE A 1 24  ? 8.498   1.017   8.969   1.00 0.00 ? 24  ILE A HG13 3  
ATOM 4851  H HG21 . ILE A 1 24  ? 5.718   2.255   6.512   1.00 0.00 ? 24  ILE A HG21 3  
ATOM 4852  H HG22 . ILE A 1 24  ? 4.847   1.869   8.019   1.00 0.00 ? 24  ILE A HG22 3  
ATOM 4853  H HG23 . ILE A 1 24  ? 5.171   3.570   7.610   1.00 0.00 ? 24  ILE A HG23 3  
ATOM 4854  H HD11 . ILE A 1 24  ? 5.537   0.097   8.993   1.00 0.00 ? 24  ILE A HD11 3  
ATOM 4855  H HD12 . ILE A 1 24  ? 6.978   -0.902  9.429   1.00 0.00 ? 24  ILE A HD12 3  
ATOM 4856  H HD13 . ILE A 1 24  ? 6.556   0.577   10.367  1.00 0.00 ? 24  ILE A HD13 3  
ATOM 4857  N N    . ILE A 1 25  ? 7.571   5.599   6.882   1.00 0.00 ? 25  ILE A N    3  
ATOM 4858  C CA   . ILE A 1 25  ? 7.399   6.690   5.891   1.00 0.00 ? 25  ILE A CA   3  
ATOM 4859  C C    . ILE A 1 25  ? 8.641   6.854   5.011   1.00 0.00 ? 25  ILE A C    3  
ATOM 4860  O O    . ILE A 1 25  ? 8.505   7.115   3.826   1.00 0.00 ? 25  ILE A O    3  
ATOM 4861  C CB   . ILE A 1 25  ? 6.793   8.019   6.351   1.00 0.00 ? 25  ILE A CB   3  
ATOM 4862  C CG1  . ILE A 1 25  ? 7.646   8.698   7.449   1.00 0.00 ? 25  ILE A CG1  3  
ATOM 4863  C CG2  . ILE A 1 25  ? 5.321   7.746   6.736   1.00 0.00 ? 25  ILE A CG2  3  
ATOM 4864  C CD1  . ILE A 1 25  ? 6.892   9.619   8.416   1.00 0.00 ? 25  ILE A CD1  3  
ATOM 4865  H H    . ILE A 1 25  ? 7.668   5.900   7.841   1.00 0.00 ? 25  ILE A H    3  
ATOM 4866  H HA   . ILE A 1 25  ? 6.648   6.350   5.193   1.00 0.00 ? 25  ILE A HA   3  
ATOM 4867  H HB   . ILE A 1 25  ? 6.730   8.733   5.493   1.00 0.00 ? 25  ILE A HB   3  
ATOM 4868  H HG12 . ILE A 1 25  ? 8.120   7.895   8.042   1.00 0.00 ? 25  ILE A HG12 3  
ATOM 4869  H HG13 . ILE A 1 25  ? 8.476   9.261   6.966   1.00 0.00 ? 25  ILE A HG13 3  
ATOM 4870  H HG21 . ILE A 1 25  ? 4.732   7.298   5.910   1.00 0.00 ? 25  ILE A HG21 3  
ATOM 4871  H HG22 . ILE A 1 25  ? 5.266   7.073   7.619   1.00 0.00 ? 25  ILE A HG22 3  
ATOM 4872  H HG23 . ILE A 1 25  ? 4.820   8.701   7.003   1.00 0.00 ? 25  ILE A HG23 3  
ATOM 4873  H HD11 . ILE A 1 25  ? 6.087   9.061   8.948   1.00 0.00 ? 25  ILE A HD11 3  
ATOM 4874  H HD12 . ILE A 1 25  ? 7.575   10.025  9.201   1.00 0.00 ? 25  ILE A HD12 3  
ATOM 4875  H HD13 . ILE A 1 25  ? 6.431   10.470  7.879   1.00 0.00 ? 25  ILE A HD13 3  
ATOM 4876  N N    . ASP A 1 26  ? 9.882   6.564   5.525   1.00 0.00 ? 26  ASP A N    3  
ATOM 4877  C CA   . ASP A 1 26  ? 11.115  6.442   4.709   1.00 0.00 ? 26  ASP A CA   3  
ATOM 4878  C C    . ASP A 1 26  ? 11.084  5.246   3.724   1.00 0.00 ? 26  ASP A C    3  
ATOM 4879  O O    . ASP A 1 26  ? 11.533  5.373   2.584   1.00 0.00 ? 26  ASP A O    3  
ATOM 4880  C CB   . ASP A 1 26  ? 12.427  6.383   5.550   1.00 0.00 ? 26  ASP A CB   3  
ATOM 4881  C CG   . ASP A 1 26  ? 12.724  7.712   6.260   1.00 0.00 ? 26  ASP A CG   3  
ATOM 4882  O OD1  . ASP A 1 26  ? 12.026  8.725   5.993   1.00 0.00 ? 26  ASP A OD1  3  
ATOM 4883  O OD2  . ASP A 1 26  ? 13.676  7.721   7.086   1.00 0.00 ? 26  ASP A OD2  3  
ATOM 4884  H H    . ASP A 1 26  ? 9.989   6.350   6.496   1.00 0.00 ? 26  ASP A H    3  
ATOM 4885  H HA   . ASP A 1 26  ? 11.183  7.321   4.080   1.00 0.00 ? 26  ASP A HA   3  
ATOM 4886  H HB2  . ASP A 1 26  ? 12.342  5.582   6.315   1.00 0.00 ? 26  ASP A HB2  3  
ATOM 4887  H HB3  . ASP A 1 26  ? 13.308  6.162   4.904   1.00 0.00 ? 26  ASP A HB3  3  
ATOM 4888  N N    . VAL A 1 27  ? 10.461  4.086   4.116   1.00 0.00 ? 27  VAL A N    3  
ATOM 4889  C CA   . VAL A 1 27  ? 10.141  2.885   3.302   1.00 0.00 ? 27  VAL A CA   3  
ATOM 4890  C C    . VAL A 1 27  ? 9.121   3.228   2.193   1.00 0.00 ? 27  VAL A C    3  
ATOM 4891  O O    . VAL A 1 27  ? 9.395   3.041   1.007   1.00 0.00 ? 27  VAL A O    3  
ATOM 4892  C CB   . VAL A 1 27  ? 9.600   1.760   4.224   1.00 0.00 ? 27  VAL A CB   3  
ATOM 4893  C CG1  . VAL A 1 27  ? 8.665   0.705   3.596   1.00 0.00 ? 27  VAL A CG1  3  
ATOM 4894  C CG2  . VAL A 1 27  ? 10.748  1.005   4.927   1.00 0.00 ? 27  VAL A CG2  3  
ATOM 4895  H H    . VAL A 1 27  ? 10.132  4.044   5.059   1.00 0.00 ? 27  VAL A H    3  
ATOM 4896  H HA   . VAL A 1 27  ? 11.037  2.546   2.797   1.00 0.00 ? 27  VAL A HA   3  
ATOM 4897  H HB   . VAL A 1 27  ? 9.005   2.246   5.015   1.00 0.00 ? 27  VAL A HB   3  
ATOM 4898  H HG11 . VAL A 1 27  ? 7.794   1.126   3.054   1.00 0.00 ? 27  VAL A HG11 3  
ATOM 4899  H HG12 . VAL A 1 27  ? 9.254   0.071   2.907   1.00 0.00 ? 27  VAL A HG12 3  
ATOM 4900  H HG13 . VAL A 1 27  ? 8.270   0.089   4.432   1.00 0.00 ? 27  VAL A HG13 3  
ATOM 4901  H HG21 . VAL A 1 27  ? 11.537  1.699   5.276   1.00 0.00 ? 27  VAL A HG21 3  
ATOM 4902  H HG22 . VAL A 1 27  ? 10.355  0.451   5.815   1.00 0.00 ? 27  VAL A HG22 3  
ATOM 4903  H HG23 . VAL A 1 27  ? 11.188  0.276   4.209   1.00 0.00 ? 27  VAL A HG23 3  
ATOM 4904  N N    . LEU A 1 28  ? 7.935   3.818   2.573   1.00 0.00 ? 28  LEU A N    3  
ATOM 4905  C CA   . LEU A 1 28  ? 6.878   4.284   1.645   1.00 0.00 ? 28  LEU A CA   3  
ATOM 4906  C C    . LEU A 1 28  ? 7.271   5.446   0.716   1.00 0.00 ? 28  LEU A C    3  
ATOM 4907  O O    . LEU A 1 28  ? 7.122   5.309   -0.495  1.00 0.00 ? 28  LEU A O    3  
ATOM 4908  C CB   . LEU A 1 28  ? 5.490   4.611   2.296   1.00 0.00 ? 28  LEU A CB   3  
ATOM 4909  C CG   . LEU A 1 28  ? 4.571   3.413   2.658   1.00 0.00 ? 28  LEU A CG   3  
ATOM 4910  C CD1  . LEU A 1 28  ? 4.621   2.251   1.650   1.00 0.00 ? 28  LEU A CD1  3  
ATOM 4911  C CD2  . LEU A 1 28  ? 4.861   2.882   4.061   1.00 0.00 ? 28  LEU A CD2  3  
ATOM 4912  H H    . LEU A 1 28  ? 7.757   3.894   3.566   1.00 0.00 ? 28  LEU A H    3  
ATOM 4913  H HA   . LEU A 1 28  ? 6.718   3.472   0.952   1.00 0.00 ? 28  LEU A HA   3  
ATOM 4914  H HB2  . LEU A 1 28  ? 5.647   5.238   3.201   1.00 0.00 ? 28  LEU A HB2  3  
ATOM 4915  H HB3  . LEU A 1 28  ? 4.864   5.206   1.585   1.00 0.00 ? 28  LEU A HB3  3  
ATOM 4916  H HG   . LEU A 1 28  ? 3.519   3.814   2.652   1.00 0.00 ? 28  LEU A HG   3  
ATOM 4917  H HD11 . LEU A 1 28  ? 4.517   2.626   0.611   1.00 0.00 ? 28  LEU A HD11 3  
ATOM 4918  H HD12 . LEU A 1 28  ? 5.589   1.711   1.730   1.00 0.00 ? 28  LEU A HD12 3  
ATOM 4919  H HD13 . LEU A 1 28  ? 3.803   1.525   1.851   1.00 0.00 ? 28  LEU A HD13 3  
ATOM 4920  H HD21 . LEU A 1 28  ? 4.840   3.699   4.813   1.00 0.00 ? 28  LEU A HD21 3  
ATOM 4921  H HD22 . LEU A 1 28  ? 4.119   2.111   4.352   1.00 0.00 ? 28  LEU A HD22 3  
ATOM 4922  H HD23 . LEU A 1 28  ? 5.873   2.426   4.080   1.00 0.00 ? 28  LEU A HD23 3  
ATOM 4923  N N    . ARG A 1 29  ? 7.838   6.579   1.223   1.00 0.00 ? 29  ARG A N    3  
ATOM 4924  C CA   . ARG A 1 29  ? 8.362   7.749   0.456   1.00 0.00 ? 29  ARG A CA   3  
ATOM 4925  C C    . ARG A 1 29  ? 9.418   7.453   -0.618  1.00 0.00 ? 29  ARG A C    3  
ATOM 4926  O O    . ARG A 1 29  ? 9.571   8.220   -1.563  1.00 0.00 ? 29  ARG A O    3  
ATOM 4927  C CB   . ARG A 1 29  ? 8.848   8.916   1.360   1.00 0.00 ? 29  ARG A CB   3  
ATOM 4928  C CG   . ARG A 1 29  ? 7.716   9.592   2.162   1.00 0.00 ? 29  ARG A CG   3  
ATOM 4929  C CD   . ARG A 1 29  ? 8.252   10.625  3.167   1.00 0.00 ? 29  ARG A CD   3  
ATOM 4930  N NE   . ARG A 1 29  ? 7.084   11.198  3.925   1.00 0.00 ? 29  ARG A NE   3  
ATOM 4931  C CZ   . ARG A 1 29  ? 7.209   11.899  5.096   1.00 0.00 ? 29  ARG A CZ   3  
ATOM 4932  N NH1  . ARG A 1 29  ? 8.433   12.134  5.649   1.00 0.00 ? 29  ARG A NH1  3  
ATOM 4933  N NH2  . ARG A 1 29  ? 6.085   12.360  5.722   1.00 0.00 ? 29  ARG A NH2  3  
ATOM 4934  H H    . ARG A 1 29  ? 7.975   6.653   2.238   1.00 0.00 ? 29  ARG A H    3  
ATOM 4935  H HA   . ARG A 1 29  ? 7.548   8.173   -0.148  1.00 0.00 ? 29  ARG A HA   3  
ATOM 4936  H HB2  . ARG A 1 29  ? 9.614   8.529   2.068   1.00 0.00 ? 29  ARG A HB2  3  
ATOM 4937  H HB3  . ARG A 1 29  ? 9.321   9.726   0.756   1.00 0.00 ? 29  ARG A HB3  3  
ATOM 4938  H HG2  . ARG A 1 29  ? 7.007   10.086  1.461   1.00 0.00 ? 29  ARG A HG2  3  
ATOM 4939  H HG3  . ARG A 1 29  ? 7.156   8.814   2.724   1.00 0.00 ? 29  ARG A HG3  3  
ATOM 4940  H HD2  . ARG A 1 29  ? 8.950   10.124  3.874   1.00 0.00 ? 29  ARG A HD2  3  
ATOM 4941  H HD3  . ARG A 1 29  ? 8.774   11.450  2.638   1.00 0.00 ? 29  ARG A HD3  3  
ATOM 4942  H HE   . ARG A 1 29  ? 6.167   11.046  3.558   1.00 0.00 ? 29  ARG A HE   3  
ATOM 4943  H HH11 . ARG A 1 29  ? 9.259   11.795  5.196   1.00 0.00 ? 29  ARG A HH11 3  
ATOM 4944  H HH12 . ARG A 1 29  ? 8.505   12.643  6.507   1.00 0.00 ? 29  ARG A HH12 3  
ATOM 4945  H HH21 . ARG A 1 29  ? 5.184   12.186  5.323   1.00 0.00 ? 29  ARG A HH21 3  
ATOM 4946  H HH22 . ARG A 1 29  ? 6.163   12.866  6.581   1.00 0.00 ? 29  ARG A HH22 3  
ATOM 4947  N N    . SER A 1 30  ? 10.203  6.353   -0.455  1.00 0.00 ? 30  SER A N    3  
ATOM 4948  C CA   . SER A 1 30  ? 11.320  5.897   -1.305  1.00 0.00 ? 30  SER A CA   3  
ATOM 4949  C C    . SER A 1 30  ? 10.892  5.364   -2.658  1.00 0.00 ? 30  SER A C    3  
ATOM 4950  O O    . SER A 1 30  ? 11.433  5.793   -3.672  1.00 0.00 ? 30  SER A O    3  
ATOM 4951  C CB   . SER A 1 30  ? 12.219  4.821   -0.631  1.00 0.00 ? 30  SER A CB   3  
ATOM 4952  O OG   . SER A 1 30  ? 12.973  5.397   0.432   1.00 0.00 ? 30  SER A OG   3  
ATOM 4953  H H    . SER A 1 30  ? 9.909   5.754   0.284   1.00 0.00 ? 30  SER A H    3  
ATOM 4954  H HA   . SER A 1 30  ? 11.924  6.772   -1.552  1.00 0.00 ? 30  SER A HA   3  
ATOM 4955  H HB2  . SER A 1 30  ? 11.579  3.993   -0.223  1.00 0.00 ? 30  SER A HB2  3  
ATOM 4956  H HB3  . SER A 1 30  ? 12.973  4.421   -1.364  1.00 0.00 ? 30  SER A HB3  3  
ATOM 4957  H HG   . SER A 1 30  ? 12.424  5.399   1.250   1.00 0.00 ? 30  SER A HG   3  
ATOM 4958  N N    . HIS A 1 31  ? 9.855   4.467   -2.735  1.00 0.00 ? 31  HIS A N    3  
ATOM 4959  C CA   . HIS A 1 31  ? 9.212   3.965   -3.958  1.00 0.00 ? 31  HIS A CA   3  
ATOM 4960  C C    . HIS A 1 31  ? 8.575   5.093   -4.792  1.00 0.00 ? 31  HIS A C    3  
ATOM 4961  O O    . HIS A 1 31  ? 8.508   5.088   -6.013  1.00 0.00 ? 31  HIS A O    3  
ATOM 4962  C CB   . HIS A 1 31  ? 8.051   2.958   -3.634  1.00 0.00 ? 31  HIS A CB   3  
ATOM 4963  C CG   . HIS A 1 31  ? 8.077   2.170   -2.346  1.00 0.00 ? 31  HIS A CG   3  
ATOM 4964  N ND1  . HIS A 1 31  ? 8.876   1.082   -2.102  1.00 0.00 ? 31  HIS A ND1  3  
ATOM 4965  C CD2  . HIS A 1 31  ? 7.195   2.208   -1.300  1.00 0.00 ? 31  HIS A CD2  3  
ATOM 4966  C CE1  . HIS A 1 31  ? 8.454   0.530   -0.936  1.00 0.00 ? 31  HIS A CE1  3  
ATOM 4967  N NE2  . HIS A 1 31  ? 7.423   1.163   -0.421  1.00 0.00 ? 31  HIS A NE2  3  
ATOM 4968  H H    . HIS A 1 31  ? 9.457   4.107   -1.894  1.00 0.00 ? 31  HIS A H    3  
ATOM 4969  H HA   . HIS A 1 31  ? 9.960   3.474   -4.566  1.00 0.00 ? 31  HIS A HA   3  
ATOM 4970  H HB2  . HIS A 1 31  ? 7.061   3.460   -3.562  1.00 0.00 ? 31  HIS A HB2  3  
ATOM 4971  H HB3  . HIS A 1 31  ? 7.989   2.234   -4.475  1.00 0.00 ? 31  HIS A HB3  3  
ATOM 4972  H HD1  . HIS A 1 31  ? 9.477   0.580   -2.742  1.00 0.00 ? 31  HIS A HD1  3  
ATOM 4973  H HD2  . HIS A 1 31  ? 6.353   2.864   -1.137  1.00 0.00 ? 31  HIS A HD2  3  
ATOM 4974  H HE1  . HIS A 1 31  ? 8.876   -0.387  -0.542  1.00 0.00 ? 31  HIS A HE1  3  
ATOM 4975  N N    . ASN A 1 32  ? 8.090   6.103   -4.032  1.00 0.00 ? 32  ASN A N    3  
ATOM 4976  C CA   . ASN A 1 32  ? 7.361   7.306   -4.364  1.00 0.00 ? 32  ASN A CA   3  
ATOM 4977  C C    . ASN A 1 32  ? 8.026   8.385   -5.202  1.00 0.00 ? 32  ASN A C    3  
ATOM 4978  O O    . ASN A 1 32  ? 7.369   9.097   -5.961  1.00 0.00 ? 32  ASN A O    3  
ATOM 4979  C CB   . ASN A 1 32  ? 6.467   7.748   -3.186  1.00 0.00 ? 32  ASN A CB   3  
ATOM 4980  C CG   . ASN A 1 32  ? 5.330   6.726   -3.193  1.00 0.00 ? 32  ASN A CG   3  
ATOM 4981  O OD1  . ASN A 1 32  ? 4.429   6.902   -4.015  1.00 0.00 ? 32  ASN A OD1  3  
ATOM 4982  N ND2  . ASN A 1 32  ? 5.372   5.626   -2.410  1.00 0.00 ? 32  ASN A ND2  3  
ATOM 4983  H H    . ASN A 1 32  ? 8.226   6.031   -3.047  1.00 0.00 ? 32  ASN A H    3  
ATOM 4984  H HA   . ASN A 1 32  ? 6.697   6.929   -5.122  1.00 0.00 ? 32  ASN A HA   3  
ATOM 4985  H HB2  . ASN A 1 32  ? 7.012   7.730   -2.224  1.00 0.00 ? 32  ASN A HB2  3  
ATOM 4986  H HB3  . ASN A 1 32  ? 6.014   8.750   -3.347  1.00 0.00 ? 32  ASN A HB3  3  
ATOM 4987  H HD21 . ASN A 1 32  ? 6.120   5.521   -1.696  1.00 0.00 ? 32  ASN A HD21 3  
ATOM 4988  H HD22 . ASN A 1 32  ? 4.581   5.009   -2.556  1.00 0.00 ? 32  ASN A HD22 3  
ATOM 4989  N N    . GLU A 1 33  ? 9.363   8.531   -5.139  1.00 0.00 ? 33  GLU A N    3  
ATOM 4990  C CA   . GLU A 1 33  ? 10.122  9.398   -6.039  1.00 0.00 ? 33  GLU A CA   3  
ATOM 4991  C C    . GLU A 1 33  ? 10.254  8.891   -7.477  1.00 0.00 ? 33  GLU A C    3  
ATOM 4992  O O    . GLU A 1 33  ? 10.036  9.623   -8.430  1.00 0.00 ? 33  GLU A O    3  
ATOM 4993  C CB   . GLU A 1 33  ? 11.486  9.710   -5.393  1.00 0.00 ? 33  GLU A CB   3  
ATOM 4994  C CG   . GLU A 1 33  ? 11.369  10.261  -3.960  1.00 0.00 ? 33  GLU A CG   3  
ATOM 4995  C CD   . GLU A 1 33  ? 10.349  11.395  -3.851  1.00 0.00 ? 33  GLU A CD   3  
ATOM 4996  O OE1  . GLU A 1 33  ? 10.539  12.433  -4.540  1.00 0.00 ? 33  GLU A OE1  3  
ATOM 4997  O OE2  . GLU A 1 33  ? 9.370   11.241  -3.073  1.00 0.00 ? 33  GLU A OE2  3  
ATOM 4998  H H    . GLU A 1 33  ? 9.903   7.971   -4.513  1.00 0.00 ? 33  GLU A H    3  
ATOM 4999  H HA   . GLU A 1 33  ? 9.553   10.300  -6.199  1.00 0.00 ? 33  GLU A HA   3  
ATOM 5000  H HB2  . GLU A 1 33  ? 12.100  8.780   -5.316  1.00 0.00 ? 33  GLU A HB2  3  
ATOM 5001  H HB3  . GLU A 1 33  ? 12.039  10.449  -6.014  1.00 0.00 ? 33  GLU A HB3  3  
ATOM 5002  H HG2  . GLU A 1 33  ? 11.124  9.437   -3.251  1.00 0.00 ? 33  GLU A HG2  3  
ATOM 5003  H HG3  . GLU A 1 33  ? 12.359  10.665  -3.702  1.00 0.00 ? 33  GLU A HG3  3  
ATOM 5004  N N    . ALA A 1 34  ? 10.568  7.590   -7.640  1.00 0.00 ? 34  ALA A N    3  
ATOM 5005  C CA   . ALA A 1 34  ? 10.625  6.797   -8.877  1.00 0.00 ? 34  ALA A CA   3  
ATOM 5006  C C    . ALA A 1 34  ? 9.274   6.445   -9.500  1.00 0.00 ? 34  ALA A C    3  
ATOM 5007  O O    . ALA A 1 34  ? 9.113   6.176   -10.692 1.00 0.00 ? 34  ALA A O    3  
ATOM 5008  C CB   . ALA A 1 34  ? 11.606  5.635   -8.682  1.00 0.00 ? 34  ALA A CB   3  
ATOM 5009  H H    . ALA A 1 34  ? 10.708  7.049   -6.815  1.00 0.00 ? 34  ALA A H    3  
ATOM 5010  H HA   . ALA A 1 34  ? 10.994  7.446   -9.667  1.00 0.00 ? 34  ALA A HA   3  
ATOM 5011  H HB1  . ALA A 1 34  ? 12.609  6.046   -8.431  1.00 0.00 ? 34  ALA A HB1  3  
ATOM 5012  H HB2  . ALA A 1 34  ? 11.295  5.005   -7.822  1.00 0.00 ? 34  ALA A HB2  3  
ATOM 5013  H HB3  . ALA A 1 34  ? 11.722  5.021   -9.599  1.00 0.00 ? 34  ALA A HB3  3  
ATOM 5014  N N    . CYS A 1 35  ? 8.228   6.425   -8.642  1.00 0.00 ? 35  CYS A N    3  
ATOM 5015  C CA   . CYS A 1 35  ? 6.801   6.131   -8.837  1.00 0.00 ? 35  CYS A CA   3  
ATOM 5016  C C    . CYS A 1 35  ? 6.152   6.986   -9.886  1.00 0.00 ? 35  CYS A C    3  
ATOM 5017  O O    . CYS A 1 35  ? 5.314   6.500   -10.642 1.00 0.00 ? 35  CYS A O    3  
ATOM 5018  C CB   . CYS A 1 35  ? 6.114   6.453   -7.468  1.00 0.00 ? 35  CYS A CB   3  
ATOM 5019  S SG   . CYS A 1 35  ? 4.392   6.987   -7.111  1.00 0.00 ? 35  CYS A SG   3  
ATOM 5020  H H    . CYS A 1 35  ? 8.512   6.613   -7.707  1.00 0.00 ? 35  CYS A H    3  
ATOM 5021  H HA   . CYS A 1 35  ? 6.717   5.087   -9.123  1.00 0.00 ? 35  CYS A HA   3  
ATOM 5022  H HB2  . CYS A 1 35  ? 6.357   5.572   -6.822  1.00 0.00 ? 35  CYS A HB2  3  
ATOM 5023  H HB3  . CYS A 1 35  ? 6.635   7.378   -7.158  1.00 0.00 ? 35  CYS A HB3  3  
ATOM 5024  H HG   . CYS A 1 35  ? 4.537   7.186   -5.803  1.00 0.00 ? 35  CYS A HG   3  
ATOM 5025  N N    . GLN A 1 36  ? 6.629   8.265   -10.008 1.00 0.00 ? 36  GLN A N    3  
ATOM 5026  C CA   . GLN A 1 36  ? 6.301   9.269   -11.030 1.00 0.00 ? 36  GLN A CA   3  
ATOM 5027  C C    . GLN A 1 36  ? 6.449   8.835   -12.489 1.00 0.00 ? 36  GLN A C    3  
ATOM 5028  O O    . GLN A 1 36  ? 6.124   9.587   -13.402 1.00 0.00 ? 36  GLN A O    3  
ATOM 5029  C CB   . GLN A 1 36  ? 7.129   10.581  -10.829 1.00 0.00 ? 36  GLN A CB   3  
ATOM 5030  C CG   . GLN A 1 36  ? 8.681   10.508  -10.986 1.00 0.00 ? 36  GLN A CG   3  
ATOM 5031  C CD   . GLN A 1 36  ? 9.353   10.758  -12.352 1.00 0.00 ? 36  GLN A CD   3  
ATOM 5032  O OE1  . GLN A 1 36  ? 10.572  10.954  -12.382 1.00 0.00 ? 36  GLN A OE1  3  
ATOM 5033  N NE2  . GLN A 1 36  ? 8.623   10.703  -13.488 1.00 0.00 ? 36  GLN A NE2  3  
ATOM 5034  H H    . GLN A 1 36  ? 7.337   8.599   -9.354  1.00 0.00 ? 36  GLN A H    3  
ATOM 5035  H HA   . GLN A 1 36  ? 5.256   9.522   -10.893 1.00 0.00 ? 36  GLN A HA   3  
ATOM 5036  H HB2  . GLN A 1 36  ? 6.725   11.407  -11.452 1.00 0.00 ? 36  GLN A HB2  3  
ATOM 5037  H HB3  . GLN A 1 36  ? 6.964   10.866  -9.763  1.00 0.00 ? 36  GLN A HB3  3  
ATOM 5038  H HG2  . GLN A 1 36  ? 9.117   11.277  -10.308 1.00 0.00 ? 36  GLN A HG2  3  
ATOM 5039  H HG3  . GLN A 1 36  ? 9.043   9.522   -10.630 1.00 0.00 ? 36  GLN A HG3  3  
ATOM 5040  H HE21 . GLN A 1 36  ? 7.628   10.537  -13.444 1.00 0.00 ? 36  GLN A HE21 3  
ATOM 5041  H HE22 . GLN A 1 36  ? 9.108   10.437  -14.313 1.00 0.00 ? 36  GLN A HE22 3  
ATOM 5042  N N    . GLU A 1 37  ? 7.100   7.669   -12.697 1.00 0.00 ? 37  GLU A N    3  
ATOM 5043  C CA   . GLU A 1 37  ? 7.559   7.170   -13.984 1.00 0.00 ? 37  GLU A CA   3  
ATOM 5044  C C    . GLU A 1 37  ? 7.037   5.779   -14.246 1.00 0.00 ? 37  GLU A C    3  
ATOM 5045  O O    . GLU A 1 37  ? 6.546   5.442   -15.322 1.00 0.00 ? 37  GLU A O    3  
ATOM 5046  C CB   . GLU A 1 37  ? 9.114   7.091   -13.887 1.00 0.00 ? 37  GLU A CB   3  
ATOM 5047  C CG   . GLU A 1 37  ? 9.887   6.511   -15.089 1.00 0.00 ? 37  GLU A CG   3  
ATOM 5048  C CD   . GLU A 1 37  ? 10.072  7.573   -16.168 1.00 0.00 ? 37  GLU A CD   3  
ATOM 5049  O OE1  . GLU A 1 37  ? 10.742  8.602   -15.881 1.00 0.00 ? 37  GLU A OE1  3  
ATOM 5050  O OE2  . GLU A 1 37  ? 9.546   7.372   -17.296 1.00 0.00 ? 37  GLU A OE2  3  
ATOM 5051  H H    . GLU A 1 37  ? 7.247   7.132   -11.847 1.00 0.00 ? 37  GLU A H    3  
ATOM 5052  H HA   . GLU A 1 37  ? 7.257   7.806   -14.806 1.00 0.00 ? 37  GLU A HA   3  
ATOM 5053  H HB2  . GLU A 1 37  ? 9.501   8.107   -13.653 1.00 0.00 ? 37  GLU A HB2  3  
ATOM 5054  H HB3  . GLU A 1 37  ? 9.398   6.461   -13.014 1.00 0.00 ? 37  GLU A HB3  3  
ATOM 5055  H HG2  . GLU A 1 37  ? 10.866  6.154   -14.704 1.00 0.00 ? 37  GLU A HG2  3  
ATOM 5056  H HG3  . GLU A 1 37  ? 9.387   5.623   -15.521 1.00 0.00 ? 37  GLU A HG3  3  
ATOM 5057  N N    . ASN A 1 38  ? 7.186   4.929   -13.219 1.00 0.00 ? 38  ASN A N    3  
ATOM 5058  C CA   . ASN A 1 38  ? 6.873   3.525   -13.232 1.00 0.00 ? 38  ASN A CA   3  
ATOM 5059  C C    . ASN A 1 38  ? 5.788   3.339   -12.193 1.00 0.00 ? 38  ASN A C    3  
ATOM 5060  O O    . ASN A 1 38  ? 6.037   3.217   -10.991 1.00 0.00 ? 38  ASN A O    3  
ATOM 5061  C CB   . ASN A 1 38  ? 8.122   2.718   -12.846 1.00 0.00 ? 38  ASN A CB   3  
ATOM 5062  C CG   . ASN A 1 38  ? 9.314   2.969   -13.772 1.00 0.00 ? 38  ASN A CG   3  
ATOM 5063  O OD1  . ASN A 1 38  ? 9.220   3.082   -14.992 1.00 0.00 ? 38  ASN A OD1  3  
ATOM 5064  N ND2  . ASN A 1 38  ? 10.499  3.068   -13.113 1.00 0.00 ? 38  ASN A ND2  3  
ATOM 5065  H H    . ASN A 1 38  ? 7.588   5.280   -12.375 1.00 0.00 ? 38  ASN A H    3  
ATOM 5066  H HA   . ASN A 1 38  ? 6.509   3.195   -14.201 1.00 0.00 ? 38  ASN A HA   3  
ATOM 5067  H HB2  . ASN A 1 38  ? 8.402   3.120   -11.857 1.00 0.00 ? 38  ASN A HB2  3  
ATOM 5068  H HB3  . ASN A 1 38  ? 7.931   1.626   -12.792 1.00 0.00 ? 38  ASN A HB3  3  
ATOM 5069  H HD21 . ASN A 1 38  ? 10.520  2.897   -12.130 1.00 0.00 ? 38  ASN A HD21 3  
ATOM 5070  H HD22 . ASN A 1 38  ? 11.318  3.266   -13.641 1.00 0.00 ? 38  ASN A HD22 3  
ATOM 5071  N N    . LYS A 1 39  ? 4.543   3.307   -12.724 1.00 0.00 ? 39  LYS A N    3  
ATOM 5072  C CA   . LYS A 1 39  ? 3.169   3.232   -12.195 1.00 0.00 ? 39  LYS A CA   3  
ATOM 5073  C C    . LYS A 1 39  ? 2.947   2.521   -10.874 1.00 0.00 ? 39  LYS A C    3  
ATOM 5074  O O    . LYS A 1 39  ? 2.128   2.881   -10.043 1.00 0.00 ? 39  LYS A O    3  
ATOM 5075  C CB   . LYS A 1 39  ? 2.210   2.638   -13.283 1.00 0.00 ? 39  LYS A CB   3  
ATOM 5076  C CG   . LYS A 1 39  ? 1.899   1.115   -13.303 1.00 0.00 ? 39  LYS A CG   3  
ATOM 5077  C CD   . LYS A 1 39  ? 3.115   0.193   -13.524 1.00 0.00 ? 39  LYS A CD   3  
ATOM 5078  C CE   . LYS A 1 39  ? 2.969   -0.612  -14.815 1.00 0.00 ? 39  LYS A CE   3  
ATOM 5079  N NZ   . LYS A 1 39  ? 4.165   -1.442  -15.082 1.00 0.00 ? 39  LYS A NZ   3  
ATOM 5080  H H    . LYS A 1 39  ? 4.580   3.425   -13.709 1.00 0.00 ? 39  LYS A H    3  
ATOM 5081  H HA   . LYS A 1 39  ? 2.882   4.252   -12.042 1.00 0.00 ? 39  LYS A HA   3  
ATOM 5082  H HB2  . LYS A 1 39  ? 1.225   3.147   -13.207 1.00 0.00 ? 39  LYS A HB2  3  
ATOM 5083  H HB3  . LYS A 1 39  ? 2.633   2.884   -14.280 1.00 0.00 ? 39  LYS A HB3  3  
ATOM 5084  H HG2  . LYS A 1 39  ? 1.370   0.817   -12.375 1.00 0.00 ? 39  LYS A HG2  3  
ATOM 5085  H HG3  . LYS A 1 39  ? 1.179   0.936   -14.133 1.00 0.00 ? 39  LYS A HG3  3  
ATOM 5086  H HD2  . LYS A 1 39  ? 3.996   0.863   -13.631 1.00 0.00 ? 39  LYS A HD2  3  
ATOM 5087  H HD3  . LYS A 1 39  ? 3.271   -0.482  -12.628 1.00 0.00 ? 39  LYS A HD3  3  
ATOM 5088  H HE2  . LYS A 1 39  ? 2.086   -1.278  -14.757 1.00 0.00 ? 39  LYS A HE2  3  
ATOM 5089  H HE3  . LYS A 1 39  ? 2.839   0.094   -15.663 1.00 0.00 ? 39  LYS A HE3  3  
ATOM 5090  H HZ1  . LYS A 1 39  ? 5.002   -0.830  -15.155 1.00 0.00 ? 39  LYS A HZ1  3  
ATOM 5091  H HZ2  . LYS A 1 39  ? 4.298   -2.120  -14.303 1.00 0.00 ? 39  LYS A HZ2  3  
ATOM 5092  H HZ3  . LYS A 1 39  ? 4.036   -1.960  -15.974 1.00 0.00 ? 39  LYS A HZ3  3  
ATOM 5093  N N    . ASP A 1 40  ? 3.728   1.449   -10.759 1.00 0.00 ? 40  ASP A N    3  
ATOM 5094  C CA   . ASP A 1 40  ? 4.047   0.606   -9.652  1.00 0.00 ? 40  ASP A CA   3  
ATOM 5095  C C    . ASP A 1 40  ? 5.448   -0.016  -9.857  1.00 0.00 ? 40  ASP A C    3  
ATOM 5096  O O    . ASP A 1 40  ? 5.532   -1.169  -10.263 1.00 0.00 ? 40  ASP A O    3  
ATOM 5097  C CB   . ASP A 1 40  ? 2.903   -0.421  -9.326  1.00 0.00 ? 40  ASP A CB   3  
ATOM 5098  C CG   . ASP A 1 40  ? 2.334   -1.318  -10.438 1.00 0.00 ? 40  ASP A CG   3  
ATOM 5099  O OD1  . ASP A 1 40  ? 3.058   -2.210  -10.949 1.00 0.00 ? 40  ASP A OD1  3  
ATOM 5100  O OD2  . ASP A 1 40  ? 1.129   -1.135  -10.765 1.00 0.00 ? 40  ASP A OD2  3  
ATOM 5101  H H    . ASP A 1 40  ? 4.345   1.438   -11.527 1.00 0.00 ? 40  ASP A H    3  
ATOM 5102  H HA   . ASP A 1 40  ? 4.121   1.221   -8.771  1.00 0.00 ? 40  ASP A HA   3  
ATOM 5103  H HB2  . ASP A 1 40  ? 3.212   -1.043  -8.464  1.00 0.00 ? 40  ASP A HB2  3  
ATOM 5104  H HB3  . ASP A 1 40  ? 2.037   0.183   -8.969  1.00 0.00 ? 40  ASP A HB3  3  
ATOM 5105  N N    . LEU A 1 41  ? 6.608   0.634   -9.513  1.00 0.00 ? 41  LEU A N    3  
ATOM 5106  C CA   . LEU A 1 41  ? 7.948   -0.016  -9.493  1.00 0.00 ? 41  LEU A CA   3  
ATOM 5107  C C    . LEU A 1 41  ? 8.203   -1.071  -8.367  1.00 0.00 ? 41  LEU A C    3  
ATOM 5108  O O    . LEU A 1 41  ? 9.068   -1.936  -8.477  1.00 0.00 ? 41  LEU A O    3  
ATOM 5109  C CB   . LEU A 1 41  ? 9.126   0.963   -9.602  1.00 0.00 ? 41  LEU A CB   3  
ATOM 5110  C CG   . LEU A 1 41  ? 9.390   1.821   -8.365  1.00 0.00 ? 41  LEU A CG   3  
ATOM 5111  C CD1  . LEU A 1 41  ? 10.876  1.804   -8.009  1.00 0.00 ? 41  LEU A CD1  3  
ATOM 5112  C CD2  . LEU A 1 41  ? 8.862   3.203   -8.687  1.00 0.00 ? 41  LEU A CD2  3  
ATOM 5113  H H    . LEU A 1 41  ? 6.561   1.626   -9.355  1.00 0.00 ? 41  LEU A H    3  
ATOM 5114  H HA   . LEU A 1 41  ? 8.051   -0.534  -10.423 1.00 0.00 ? 41  LEU A HA   3  
ATOM 5115  H HB2  . LEU A 1 41  ? 10.057  0.391   -9.833  1.00 0.00 ? 41  LEU A HB2  3  
ATOM 5116  H HB3  . LEU A 1 41  ? 8.908   1.645   -10.464 1.00 0.00 ? 41  LEU A HB3  3  
ATOM 5117  H HG   . LEU A 1 41  ? 8.845   1.423   -7.481  1.00 0.00 ? 41  LEU A HG   3  
ATOM 5118  H HD11 . LEU A 1 41  ? 11.473  2.185   -8.862  1.00 0.00 ? 41  LEU A HD11 3  
ATOM 5119  H HD12 . LEU A 1 41  ? 11.083  2.399   -7.097  1.00 0.00 ? 41  LEU A HD12 3  
ATOM 5120  H HD13 . LEU A 1 41  ? 11.185  0.752   -7.822  1.00 0.00 ? 41  LEU A HD13 3  
ATOM 5121  H HD21 . LEU A 1 41  ? 7.799   3.127   -8.987  1.00 0.00 ? 41  LEU A HD21 3  
ATOM 5122  H HD22 . LEU A 1 41  ? 8.922   3.871   -7.809  1.00 0.00 ? 41  LEU A HD22 3  
ATOM 5123  H HD23 . LEU A 1 41  ? 9.426   3.622   -9.545  1.00 0.00 ? 41  LEU A HD23 3  
ATOM 5124  N N    . GLN A 1 42  ? 7.346   -1.003  -7.311  1.00 0.00 ? 42  GLN A N    3  
ATOM 5125  C CA   . GLN A 1 42  ? 7.023   -1.777  -6.120  1.00 0.00 ? 42  GLN A CA   3  
ATOM 5126  C C    . GLN A 1 42  ? 5.749   -2.637  -6.349  1.00 0.00 ? 42  GLN A C    3  
ATOM 5127  O O    . GLN A 1 42  ? 4.954   -2.651  -5.408  1.00 0.00 ? 42  GLN A O    3  
ATOM 5128  C CB   . GLN A 1 42  ? 6.930   -0.914  -4.824  1.00 0.00 ? 42  GLN A CB   3  
ATOM 5129  C CG   . GLN A 1 42  ? 7.175   -1.637  -3.483  1.00 0.00 ? 42  GLN A CG   3  
ATOM 5130  C CD   . GLN A 1 42  ? 8.611   -2.133  -3.362  1.00 0.00 ? 42  GLN A CD   3  
ATOM 5131  O OE1  . GLN A 1 42  ? 9.551   -1.361  -3.165  1.00 0.00 ? 42  GLN A OE1  3  
ATOM 5132  N NE2  . GLN A 1 42  ? 8.769   -3.478  -3.473  1.00 0.00 ? 42  GLN A NE2  3  
ATOM 5133  H H    . GLN A 1 42  ? 6.712   -0.250  -7.322  1.00 0.00 ? 42  GLN A H    3  
ATOM 5134  H HA   . GLN A 1 42  ? 7.842   -2.470  -5.984  1.00 0.00 ? 42  GLN A HA   3  
ATOM 5135  H HB2  . GLN A 1 42  ? 7.668   -0.084  -4.909  1.00 0.00 ? 42  GLN A HB2  3  
ATOM 5136  H HB3  . GLN A 1 42  ? 5.912   -0.460  -4.710  1.00 0.00 ? 42  GLN A HB3  3  
ATOM 5137  H HG2  . GLN A 1 42  ? 6.989   -0.916  -2.659  1.00 0.00 ? 42  GLN A HG2  3  
ATOM 5138  H HG3  . GLN A 1 42  ? 6.459   -2.478  -3.377  1.00 0.00 ? 42  GLN A HG3  3  
ATOM 5139  H HE21 . GLN A 1 42  ? 7.965   -4.064  -3.595  1.00 0.00 ? 42  GLN A HE21 3  
ATOM 5140  H HE22 . GLN A 1 42  ? 9.704   -3.830  -3.443  1.00 0.00 ? 42  GLN A HE22 3  
ATOM 5141  N N    . PRO A 1 43  ? 5.410   -3.286  -7.543  1.00 0.00 ? 43  PRO A N    3  
ATOM 5142  C CA   . PRO A 1 43  ? 4.091   -3.782  -8.042  1.00 0.00 ? 43  PRO A CA   3  
ATOM 5143  C C    . PRO A 1 43  ? 3.194   -4.491  -7.007  1.00 0.00 ? 43  PRO A C    3  
ATOM 5144  O O    . PRO A 1 43  ? 1.975   -4.393  -7.099  1.00 0.00 ? 43  PRO A O    3  
ATOM 5145  C CB   . PRO A 1 43  ? 4.457   -4.743  -9.204  1.00 0.00 ? 43  PRO A CB   3  
ATOM 5146  C CG   . PRO A 1 43  ? 5.926   -5.093  -8.991  1.00 0.00 ? 43  PRO A CG   3  
ATOM 5147  C CD   . PRO A 1 43  ? 6.454   -3.774  -8.448  1.00 0.00 ? 43  PRO A CD   3  
ATOM 5148  H HA   . PRO A 1 43  ? 3.550   -2.951  -8.514  1.00 0.00 ? 43  PRO A HA   3  
ATOM 5149  H HB2  . PRO A 1 43  ? 3.810   -5.638  -9.302  1.00 0.00 ? 43  PRO A HB2  3  
ATOM 5150  H HB3  . PRO A 1 43  ? 4.388   -4.178  -10.157 1.00 0.00 ? 43  PRO A HB3  3  
ATOM 5151  H HG2  . PRO A 1 43  ? 6.031   -5.902  -8.236  1.00 0.00 ? 43  PRO A HG2  3  
ATOM 5152  H HG3  . PRO A 1 43  ? 6.432   -5.399  -9.930  1.00 0.00 ? 43  PRO A HG3  3  
ATOM 5153  H HD2  . PRO A 1 43  ? 7.443   -3.927  -7.957  1.00 0.00 ? 43  PRO A HD2  3  
ATOM 5154  H HD3  . PRO A 1 43  ? 6.559   -3.061  -9.296  1.00 0.00 ? 43  PRO A HD3  3  
ATOM 5155  N N    . TYR A 1 44  ? 3.826   -5.172  -6.018  1.00 0.00 ? 44  TYR A N    3  
ATOM 5156  C CA   . TYR A 1 44  ? 3.315   -5.843  -4.849  1.00 0.00 ? 44  TYR A CA   3  
ATOM 5157  C C    . TYR A 1 44  ? 4.506   -5.909  -3.894  1.00 0.00 ? 44  TYR A C    3  
ATOM 5158  O O    . TYR A 1 44  ? 5.658   -5.723  -4.295  1.00 0.00 ? 44  TYR A O    3  
ATOM 5159  C CB   . TYR A 1 44  ? 2.853   -7.322  -5.112  1.00 0.00 ? 44  TYR A CB   3  
ATOM 5160  C CG   . TYR A 1 44  ? 1.518   -7.454  -5.847  1.00 0.00 ? 44  TYR A CG   3  
ATOM 5161  C CD1  . TYR A 1 44  ? 1.443   -7.552  -7.236  1.00 0.00 ? 44  TYR A CD1  3  
ATOM 5162  C CD2  . TYR A 1 44  ? 0.324   -7.571  -5.138  1.00 0.00 ? 44  TYR A CD2  3  
ATOM 5163  C CE1  . TYR A 1 44  ? 0.240   -7.798  -7.871  1.00 0.00 ? 44  TYR A CE1  3  
ATOM 5164  C CE2  . TYR A 1 44  ? -0.864  -7.894  -5.769  1.00 0.00 ? 44  TYR A CE2  3  
ATOM 5165  C CZ   . TYR A 1 44  ? -0.904  -7.998  -7.141  1.00 0.00 ? 44  TYR A CZ   3  
ATOM 5166  O OH   . TYR A 1 44  ? -2.098  -8.314  -7.818  1.00 0.00 ? 44  TYR A OH   3  
ATOM 5167  H H    . TYR A 1 44  ? 4.820   -5.150  -6.019  1.00 0.00 ? 44  TYR A H    3  
ATOM 5168  H HA   . TYR A 1 44  ? 2.583   -5.204  -4.355  1.00 0.00 ? 44  TYR A HA   3  
ATOM 5169  H HB2  . TYR A 1 44  ? 3.646   -7.846  -5.693  1.00 0.00 ? 44  TYR A HB2  3  
ATOM 5170  H HB3  . TYR A 1 44  ? 2.780   -7.908  -4.167  1.00 0.00 ? 44  TYR A HB3  3  
ATOM 5171  H HD1  . TYR A 1 44  ? 2.314   -7.434  -7.867  1.00 0.00 ? 44  TYR A HD1  3  
ATOM 5172  H HD2  . TYR A 1 44  ? 0.297   -7.425  -4.067  1.00 0.00 ? 44  TYR A HD2  3  
ATOM 5173  H HE1  . TYR A 1 44  ? 0.202   -7.869  -8.950  1.00 0.00 ? 44  TYR A HE1  3  
ATOM 5174  H HE2  . TYR A 1 44  ? -1.758  -8.061  -5.181  1.00 0.00 ? 44  TYR A HE2  3  
ATOM 5175  H HH   . TYR A 1 44  ? -2.686  -8.757  -7.201  1.00 0.00 ? 44  TYR A HH   3  
ATOM 5176  N N    . MET A 1 45  ? 4.186   -6.221  -2.615  1.00 0.00 ? 45  MET A N    3  
ATOM 5177  C CA   . MET A 1 45  ? 5.047   -6.453  -1.460  1.00 0.00 ? 45  MET A CA   3  
ATOM 5178  C C    . MET A 1 45  ? 4.212   -7.280  -0.452  1.00 0.00 ? 45  MET A C    3  
ATOM 5179  O O    . MET A 1 45  ? 2.981   -7.226  -0.543  1.00 0.00 ? 45  MET A O    3  
ATOM 5180  C CB   . MET A 1 45  ? 5.564   -5.137  -0.753  1.00 0.00 ? 45  MET A CB   3  
ATOM 5181  C CG   . MET A 1 45  ? 4.804   -3.820  -1.032  1.00 0.00 ? 45  MET A CG   3  
ATOM 5182  S SD   . MET A 1 45  ? 4.388   -2.845  0.439   1.00 0.00 ? 45  MET A SD   3  
ATOM 5183  C CE   . MET A 1 45  ? 4.852   -1.210  -0.207  1.00 0.00 ? 45  MET A CE   3  
ATOM 5184  H H    . MET A 1 45  ? 3.209   -6.310  -2.418  1.00 0.00 ? 45  MET A H    3  
ATOM 5185  H HA   . MET A 1 45  ? 5.887   -7.055  -1.782  1.00 0.00 ? 45  MET A HA   3  
ATOM 5186  H HB2  . MET A 1 45  ? 5.673   -5.277  0.338   1.00 0.00 ? 45  MET A HB2  3  
ATOM 5187  H HB3  . MET A 1 45  ? 6.615   -4.943  -1.042  1.00 0.00 ? 45  MET A HB3  3  
ATOM 5188  H HG2  . MET A 1 45  ? 5.433   -3.217  -1.718  1.00 0.00 ? 45  MET A HG2  3  
ATOM 5189  H HG3  . MET A 1 45  ? 3.866   -4.014  -1.578  1.00 0.00 ? 45  MET A HG3  3  
ATOM 5190  H HE1  . MET A 1 45  ? 5.915   -1.196  -0.528  1.00 0.00 ? 45  MET A HE1  3  
ATOM 5191  H HE2  . MET A 1 45  ? 4.224   -0.929  -1.078  1.00 0.00 ? 45  MET A HE2  3  
ATOM 5192  H HE3  . MET A 1 45  ? 4.724   -0.425  0.573   1.00 0.00 ? 45  MET A HE3  3  
ATOM 5193  N N    . PRO A 1 46  ? 4.764   -8.090  0.512   1.00 0.00 ? 46  PRO A N    3  
ATOM 5194  C CA   . PRO A 1 46  ? 4.023   -8.651  1.662   1.00 0.00 ? 46  PRO A CA   3  
ATOM 5195  C C    . PRO A 1 46  ? 3.841   -7.559  2.746   1.00 0.00 ? 46  PRO A C    3  
ATOM 5196  O O    . PRO A 1 46  ? 4.441   -6.487  2.639   1.00 0.00 ? 46  PRO A O    3  
ATOM 5197  C CB   . PRO A 1 46  ? 5.021   -9.714  2.186   1.00 0.00 ? 46  PRO A CB   3  
ATOM 5198  C CG   . PRO A 1 46  ? 6.401   -9.071  1.980   1.00 0.00 ? 46  PRO A CG   3  
ATOM 5199  C CD   . PRO A 1 46  ? 6.197   -8.410  0.598   1.00 0.00 ? 46  PRO A CD   3  
ATOM 5200  H HA   . PRO A 1 46  ? 3.050   -9.064  1.388   1.00 0.00 ? 46  PRO A HA   3  
ATOM 5201  H HB2  . PRO A 1 46  ? 4.847   -10.038 3.229   1.00 0.00 ? 46  PRO A HB2  3  
ATOM 5202  H HB3  . PRO A 1 46  ? 4.954   -10.617 1.537   1.00 0.00 ? 46  PRO A HB3  3  
ATOM 5203  H HG2  . PRO A 1 46  ? 6.624   -8.338  2.798   1.00 0.00 ? 46  PRO A HG2  3  
ATOM 5204  H HG3  . PRO A 1 46  ? 7.233   -9.802  1.988   1.00 0.00 ? 46  PRO A HG3  3  
ATOM 5205  H HD2  . PRO A 1 46  ? 6.824   -7.473  0.523   1.00 0.00 ? 46  PRO A HD2  3  
ATOM 5206  H HD3  . PRO A 1 46  ? 6.397   -9.217  -0.182  1.00 0.00 ? 46  PRO A HD3  3  
ATOM 5207  N N    . ILE A 1 47  ? 3.091   -7.796  3.866   1.00 0.00 ? 47  ILE A N    3  
ATOM 5208  C CA   . ILE A 1 47  ? 2.928   -6.826  4.974   1.00 0.00 ? 47  ILE A CA   3  
ATOM 5209  C C    . ILE A 1 47  ? 4.263   -6.542  5.703   1.00 0.00 ? 47  ILE A C    3  
ATOM 5210  O O    . ILE A 1 47  ? 4.650   -5.373  5.802   1.00 0.00 ? 47  ILE A O    3  
ATOM 5211  C CB   . ILE A 1 47  ? 1.688   -7.031  5.858   1.00 0.00 ? 47  ILE A CB   3  
ATOM 5212  C CG1  . ILE A 1 47  ? 0.490   -7.498  4.983   1.00 0.00 ? 47  ILE A CG1  3  
ATOM 5213  C CG2  . ILE A 1 47  ? 1.355   -5.698  6.571   1.00 0.00 ? 47  ILE A CG2  3  
ATOM 5214  C CD1  . ILE A 1 47  ? -0.886  -7.246  5.617   1.00 0.00 ? 47  ILE A CD1  3  
ATOM 5215  H H    . ILE A 1 47  ? 2.636   -8.670  3.981   1.00 0.00 ? 47  ILE A H    3  
ATOM 5216  H HA   . ILE A 1 47  ? 2.702   -5.893  4.488   1.00 0.00 ? 47  ILE A HA   3  
ATOM 5217  H HB   . ILE A 1 47  ? 1.863   -7.804  6.635   1.00 0.00 ? 47  ILE A HB   3  
ATOM 5218  H HG12 . ILE A 1 47  ? 0.501   -6.856  4.026   1.00 0.00 ? 47  ILE A HG12 3  
ATOM 5219  H HG13 . ILE A 1 47  ? 0.574   -8.644  4.865   1.00 0.00 ? 47  ILE A HG13 3  
ATOM 5220  H HG21 . ILE A 1 47  ? 2.234   -5.260  7.079   1.00 0.00 ? 47  ILE A HG21 3  
ATOM 5221  H HG22 . ILE A 1 47  ? 0.969   -4.968  5.831   1.00 0.00 ? 47  ILE A HG22 3  
ATOM 5222  H HG23 . ILE A 1 47  ? 0.566   -5.845  7.341   1.00 0.00 ? 47  ILE A HG23 3  
ATOM 5223  H HD11 . ILE A 1 47  ? -0.992  -7.796  6.577   1.00 0.00 ? 47  ILE A HD11 3  
ATOM 5224  H HD12 . ILE A 1 47  ? -1.068  -6.164  5.789   1.00 0.00 ? 47  ILE A HD12 3  
ATOM 5225  H HD13 . ILE A 1 47  ? -1.672  -7.573  4.911   1.00 0.00 ? 47  ILE A HD13 3  
ATOM 5226  N N    . PRO A 1 48  ? 5.064   -7.530  6.183   1.00 0.00 ? 48  PRO A N    3  
ATOM 5227  C CA   . PRO A 1 48  ? 6.470   -7.434  6.529   1.00 0.00 ? 48  PRO A CA   3  
ATOM 5228  C C    . PRO A 1 48  ? 7.465   -6.812  5.530   1.00 0.00 ? 48  PRO A C    3  
ATOM 5229  O O    . PRO A 1 48  ? 8.562   -6.550  5.962   1.00 0.00 ? 48  PRO A O    3  
ATOM 5230  C CB   . PRO A 1 48  ? 6.823   -8.473  7.614   1.00 0.00 ? 48  PRO A CB   3  
ATOM 5231  C CG   . PRO A 1 48  ? 5.528   -9.310  7.682   1.00 0.00 ? 48  PRO A CG   3  
ATOM 5232  C CD   . PRO A 1 48  ? 4.647   -8.900  6.468   1.00 0.00 ? 48  PRO A CD   3  
ATOM 5233  H HA   . PRO A 1 48  ? 6.454   -6.573  7.171   1.00 0.00 ? 48  PRO A HA   3  
ATOM 5234  H HB2  . PRO A 1 48  ? 7.668   -9.122  7.269   1.00 0.00 ? 48  PRO A HB2  3  
ATOM 5235  H HB3  . PRO A 1 48  ? 7.037   -7.961  8.648   1.00 0.00 ? 48  PRO A HB3  3  
ATOM 5236  H HG2  . PRO A 1 48  ? 5.740   -10.398 7.684   1.00 0.00 ? 48  PRO A HG2  3  
ATOM 5237  H HG3  . PRO A 1 48  ? 4.981   -9.056  8.617   1.00 0.00 ? 48  PRO A HG3  3  
ATOM 5238  H HD2  . PRO A 1 48  ? 4.875   -9.541  5.578   1.00 0.00 ? 48  PRO A HD2  3  
ATOM 5239  H HD3  . PRO A 1 48  ? 3.577   -8.984  6.783   1.00 0.00 ? 48  PRO A HD3  3  
ATOM 5240  N N    . HIS A 1 49  ? 7.305   -6.554  4.189   1.00 0.00 ? 49  HIS A N    3  
ATOM 5241  C CA   . HIS A 1 49  ? 8.304   -5.684  3.457   1.00 0.00 ? 49  HIS A CA   3  
ATOM 5242  C C    . HIS A 1 49  ? 8.443   -4.291  4.119   1.00 0.00 ? 49  HIS A C    3  
ATOM 5243  O O    . HIS A 1 49  ? 9.511   -3.764  4.392   1.00 0.00 ? 49  HIS A O    3  
ATOM 5244  C CB   . HIS A 1 49  ? 7.913   -5.449  1.953   1.00 0.00 ? 49  HIS A CB   3  
ATOM 5245  C CG   . HIS A 1 49  ? 8.493   -4.237  1.210   1.00 0.00 ? 49  HIS A CG   3  
ATOM 5246  N ND1  . HIS A 1 49  ? 8.050   -2.942  1.393   1.00 0.00 ? 49  HIS A ND1  3  
ATOM 5247  C CD2  . HIS A 1 49  ? 9.649   -4.117  0.501   1.00 0.00 ? 49  HIS A CD2  3  
ATOM 5248  C CE1  . HIS A 1 49  ? 8.977   -2.118  0.859   1.00 0.00 ? 49  HIS A CE1  3  
ATOM 5249  N NE2  . HIS A 1 49  ? 9.960   -2.781  0.295   1.00 0.00 ? 49  HIS A NE2  3  
ATOM 5250  H H    . HIS A 1 49  ? 6.445   -6.745  3.714   1.00 0.00 ? 49  HIS A H    3  
ATOM 5251  H HA   . HIS A 1 49  ? 9.283   -6.146  3.502   1.00 0.00 ? 49  HIS A HA   3  
ATOM 5252  H HB2  . HIS A 1 49  ? 8.235   -6.352  1.396   1.00 0.00 ? 49  HIS A HB2  3  
ATOM 5253  H HB3  . HIS A 1 49  ? 6.804   -5.388  1.904   1.00 0.00 ? 49  HIS A HB3  3  
ATOM 5254  H HD1  . HIS A 1 49  ? 7.241   -2.679  1.919   1.00 0.00 ? 49  HIS A HD1  3  
ATOM 5255  H HD2  . HIS A 1 49  ? 10.273  -4.912  0.128   1.00 0.00 ? 49  HIS A HD2  3  
ATOM 5256  H HE1  . HIS A 1 49  ? 8.962   -1.036  1.001   1.00 0.00 ? 49  HIS A HE1  3  
ATOM 5257  N N    . VAL A 1 50  ? 7.252   -3.758  4.464   1.00 0.00 ? 50  VAL A N    3  
ATOM 5258  C CA   . VAL A 1 50  ? 7.021   -2.564  5.257   1.00 0.00 ? 50  VAL A CA   3  
ATOM 5259  C C    . VAL A 1 50  ? 7.261   -2.839  6.753   1.00 0.00 ? 50  VAL A C    3  
ATOM 5260  O O    . VAL A 1 50  ? 8.050   -2.128  7.369   1.00 0.00 ? 50  VAL A O    3  
ATOM 5261  C CB   . VAL A 1 50  ? 5.649   -1.998  4.904   1.00 0.00 ? 50  VAL A CB   3  
ATOM 5262  C CG1  . VAL A 1 50  ? 5.265   -0.759  5.733   1.00 0.00 ? 50  VAL A CG1  3  
ATOM 5263  C CG2  . VAL A 1 50  ? 5.600   -1.679  3.393   1.00 0.00 ? 50  VAL A CG2  3  
ATOM 5264  H H    . VAL A 1 50  ? 6.433   -4.255  4.184   1.00 0.00 ? 50  VAL A H    3  
ATOM 5265  H HA   . VAL A 1 50  ? 7.781   -1.841  5.000   1.00 0.00 ? 50  VAL A HA   3  
ATOM 5266  H HB   . VAL A 1 50  ? 4.901   -2.790  5.088   1.00 0.00 ? 50  VAL A HB   3  
ATOM 5267  H HG11 . VAL A 1 50  ? 6.093   -0.024  5.701   1.00 0.00 ? 50  VAL A HG11 3  
ATOM 5268  H HG12 . VAL A 1 50  ? 4.341   -0.301  5.320   1.00 0.00 ? 50  VAL A HG12 3  
ATOM 5269  H HG13 . VAL A 1 50  ? 5.063   -1.043  6.785   1.00 0.00 ? 50  VAL A HG13 3  
ATOM 5270  H HG21 . VAL A 1 50  ? 5.761   -2.592  2.778   1.00 0.00 ? 50  VAL A HG21 3  
ATOM 5271  H HG22 . VAL A 1 50  ? 4.595   -1.286  3.127   1.00 0.00 ? 50  VAL A HG22 3  
ATOM 5272  H HG23 . VAL A 1 50  ? 6.357   -0.920  3.111   1.00 0.00 ? 50  VAL A HG23 3  
ATOM 5273  N N    . ARG A 1 51  ? 6.658   -3.912  7.367   1.00 0.00 ? 51  ARG A N    3  
ATOM 5274  C CA   . ARG A 1 51  ? 6.911   -4.332  8.759   1.00 0.00 ? 51  ARG A CA   3  
ATOM 5275  C C    . ARG A 1 51  ? 8.268   -4.997  9.126   1.00 0.00 ? 51  ARG A C    3  
ATOM 5276  O O    . ARG A 1 51  ? 8.659   -4.947  10.271  1.00 0.00 ? 51  ARG A O    3  
ATOM 5277  C CB   . ARG A 1 51  ? 5.822   -5.217  9.436   1.00 0.00 ? 51  ARG A CB   3  
ATOM 5278  C CG   . ARG A 1 51  ? 4.356   -4.923  9.127   1.00 0.00 ? 51  ARG A CG   3  
ATOM 5279  C CD   . ARG A 1 51  ? 3.458   -5.806  10.011  1.00 0.00 ? 51  ARG A CD   3  
ATOM 5280  N NE   . ARG A 1 51  ? 2.011   -5.492  9.764   1.00 0.00 ? 51  ARG A NE   3  
ATOM 5281  C CZ   . ARG A 1 51  ? 1.001   -5.959  10.563  1.00 0.00 ? 51  ARG A CZ   3  
ATOM 5282  N NH1  . ARG A 1 51  ? 1.269   -6.744  11.647  1.00 0.00 ? 51  ARG A NH1  3  
ATOM 5283  N NH2  . ARG A 1 51  ? -0.292  -5.631  10.269  1.00 0.00 ? 51  ARG A NH2  3  
ATOM 5284  H H    . ARG A 1 51  ? 5.979   -4.461  6.875   1.00 0.00 ? 51  ARG A H    3  
ATOM 5285  H HA   . ARG A 1 51  ? 6.875   -3.420  9.338   1.00 0.00 ? 51  ARG A HA   3  
ATOM 5286  H HB2  . ARG A 1 51  ? 5.964   -6.295  9.213   1.00 0.00 ? 51  ARG A HB2  3  
ATOM 5287  H HB3  . ARG A 1 51  ? 5.930   -5.106  10.543  1.00 0.00 ? 51  ARG A HB3  3  
ATOM 5288  H HG2  . ARG A 1 51  ? 4.169   -3.848  9.293   1.00 0.00 ? 51  ARG A HG2  3  
ATOM 5289  H HG3  . ARG A 1 51  ? 4.137   -5.126  8.067   1.00 0.00 ? 51  ARG A HG3  3  
ATOM 5290  H HD2  . ARG A 1 51  ? 3.635   -6.879  9.781   1.00 0.00 ? 51  ARG A HD2  3  
ATOM 5291  H HD3  . ARG A 1 51  ? 3.695   -5.605  11.079  1.00 0.00 ? 51  ARG A HD3  3  
ATOM 5292  H HE   . ARG A 1 51  ? 1.776   -4.921  8.978   1.00 0.00 ? 51  ARG A HE   3  
ATOM 5293  H HH11 . ARG A 1 51  ? 2.215   -6.985  11.866  1.00 0.00 ? 51  ARG A HH11 3  
ATOM 5294  H HH12 . ARG A 1 51  ? 0.522   -7.078  12.220  1.00 0.00 ? 51  ARG A HH12 3  
ATOM 5295  H HH21 . ARG A 1 51  ? -0.492  -5.057  9.475   1.00 0.00 ? 51  ARG A HH21 3  
ATOM 5296  H HH22 . ARG A 1 51  ? -1.037  -5.967  10.845  1.00 0.00 ? 51  ARG A HH22 3  
ATOM 5297  N N    . ASP A 1 52  ? 9.054   -5.706  8.278   1.00 0.00 ? 52  ASP A N    3  
ATOM 5298  C CA   . ASP A 1 52  ? 10.395  -6.252  8.600   1.00 0.00 ? 52  ASP A CA   3  
ATOM 5299  C C    . ASP A 1 52  ? 11.543  -5.224  8.565   1.00 0.00 ? 52  ASP A C    3  
ATOM 5300  O O    . ASP A 1 52  ? 12.647  -5.504  9.014   1.00 0.00 ? 52  ASP A O    3  
ATOM 5301  C CB   . ASP A 1 52  ? 10.745  -7.486  7.699   1.00 0.00 ? 52  ASP A CB   3  
ATOM 5302  C CG   . ASP A 1 52  ? 11.736  -8.481  8.320   1.00 0.00 ? 52  ASP A CG   3  
ATOM 5303  O OD1  . ASP A 1 52  ? 11.325  -9.203  9.267   1.00 0.00 ? 52  ASP A OD1  3  
ATOM 5304  O OD2  . ASP A 1 52  ? 12.899  -8.540  7.843   1.00 0.00 ? 52  ASP A OD2  3  
ATOM 5305  H H    . ASP A 1 52  ? 8.780   -5.913  7.301   1.00 0.00 ? 52  ASP A H    3  
ATOM 5306  H HA   . ASP A 1 52  ? 10.364  -6.626  9.618   1.00 0.00 ? 52  ASP A HA   3  
ATOM 5307  H HB2  . ASP A 1 52  ? 9.804   -8.057  7.532   1.00 0.00 ? 52  ASP A HB2  3  
ATOM 5308  H HB3  . ASP A 1 52  ? 11.105  -7.163  6.700   1.00 0.00 ? 52  ASP A HB3  3  
ATOM 5309  N N    . SER A 1 53  ? 11.291  -4.037  7.948   1.00 0.00 ? 53  SER A N    3  
ATOM 5310  C CA   . SER A 1 53  ? 12.181  -2.941  7.568   1.00 0.00 ? 53  SER A CA   3  
ATOM 5311  C C    . SER A 1 53  ? 12.401  -1.838  8.545   1.00 0.00 ? 53  SER A C    3  
ATOM 5312  O O    . SER A 1 53  ? 13.315  -1.040  8.368   1.00 0.00 ? 53  SER A O    3  
ATOM 5313  C CB   . SER A 1 53  ? 11.707  -2.275  6.300   1.00 0.00 ? 53  SER A CB   3  
ATOM 5314  O OG   . SER A 1 53  ? 11.812  -3.209  5.233   1.00 0.00 ? 53  SER A OG   3  
ATOM 5315  H H    . SER A 1 53  ? 10.361  -3.868  7.618   1.00 0.00 ? 53  SER A H    3  
ATOM 5316  H HA   . SER A 1 53  ? 13.147  -3.342  7.337   1.00 0.00 ? 53  SER A HA   3  
ATOM 5317  H HB2  . SER A 1 53  ? 10.672  -2.020  6.588   1.00 0.00 ? 53  SER A HB2  3  
ATOM 5318  H HB3  . SER A 1 53  ? 12.250  -1.355  5.995   1.00 0.00 ? 53  SER A HB3  3  
ATOM 5319  H HG   . SER A 1 53  ? 10.895  -3.443  4.959   1.00 0.00 ? 53  SER A HG   3  
ATOM 5320  N N    . LEU A 1 54  ? 11.549  -1.711  9.602   1.00 0.00 ? 54  LEU A N    3  
ATOM 5321  C CA   . LEU A 1 54  ? 11.489  -0.645  10.596  1.00 0.00 ? 54  LEU A CA   3  
ATOM 5322  C C    . LEU A 1 54  ? 12.735  -0.614  11.483  1.00 0.00 ? 54  LEU A C    3  
ATOM 5323  O O    . LEU A 1 54  ? 13.077  0.408   12.072  1.00 0.00 ? 54  LEU A O    3  
ATOM 5324  C CB   . LEU A 1 54  ? 10.222  -0.818  11.535  1.00 0.00 ? 54  LEU A CB   3  
ATOM 5325  C CG   . LEU A 1 54  ? 9.718   -2.220  12.053  1.00 0.00 ? 54  LEU A CG   3  
ATOM 5326  C CD1  . LEU A 1 54  ? 8.256   -2.452  11.647  1.00 0.00 ? 54  LEU A CD1  3  
ATOM 5327  C CD2  . LEU A 1 54  ? 10.561  -3.498  11.894  1.00 0.00 ? 54  LEU A CD2  3  
ATOM 5328  H H    . LEU A 1 54  ? 10.780  -2.323  9.685   1.00 0.00 ? 54  LEU A H    3  
ATOM 5329  H HA   . LEU A 1 54  ? 11.405  0.306   10.083  1.00 0.00 ? 54  LEU A HA   3  
ATOM 5330  H HB2  . LEU A 1 54  ? 10.410  -0.208  12.480  1.00 0.00 ? 54  LEU A HB2  3  
ATOM 5331  H HB3  . LEU A 1 54  ? 9.369   -0.419  10.885  1.00 0.00 ? 54  LEU A HB3  3  
ATOM 5332  H HG   . LEU A 1 54  ? 9.612   -2.221  13.169  1.00 0.00 ? 54  LEU A HG   3  
ATOM 5333  H HD11 . LEU A 1 54  ? 8.165   -2.405  10.547  1.00 0.00 ? 54  LEU A HD11 3  
ATOM 5334  H HD12 . LEU A 1 54  ? 7.954   -3.471  11.993  1.00 0.00 ? 54  LEU A HD12 3  
ATOM 5335  H HD13 . LEU A 1 54  ? 7.577   -1.707  12.105  1.00 0.00 ? 54  LEU A HD13 3  
ATOM 5336  H HD21 . LEU A 1 54  ? 11.557  -3.410  12.361  1.00 0.00 ? 54  LEU A HD21 3  
ATOM 5337  H HD22 . LEU A 1 54  ? 9.986   -4.299  12.416  1.00 0.00 ? 54  LEU A HD22 3  
ATOM 5338  H HD23 . LEU A 1 54  ? 10.676  -3.922  10.893  1.00 0.00 ? 54  LEU A HD23 3  
ATOM 5339  N N    . ILE A 1 55  ? 13.460  -1.756  11.466  1.00 0.00 ? 55  ILE A N    3  
ATOM 5340  C CA   . ILE A 1 55  ? 14.771  -2.053  12.049  1.00 0.00 ? 55  ILE A CA   3  
ATOM 5341  C C    . ILE A 1 55  ? 15.340  -2.994  10.981  1.00 0.00 ? 55  ILE A C    3  
ATOM 5342  O O    . ILE A 1 55  ? 14.590  -3.557  10.190  1.00 0.00 ? 55  ILE A O    3  
ATOM 5343  C CB   . ILE A 1 55  ? 14.846  -2.734  13.452  1.00 0.00 ? 55  ILE A CB   3  
ATOM 5344  C CG1  . ILE A 1 55  ? 13.617  -2.525  14.367  1.00 0.00 ? 55  ILE A CG1  3  
ATOM 5345  C CG2  . ILE A 1 55  ? 16.104  -2.352  14.268  1.00 0.00 ? 55  ILE A CG2  3  
ATOM 5346  C CD1  . ILE A 1 55  ? 13.320  -1.088  14.695  1.00 0.00 ? 55  ILE A CD1  3  
ATOM 5347  H H    . ILE A 1 55  ? 13.084  -2.438  10.816  1.00 0.00 ? 55  ILE A H    3  
ATOM 5348  H HA   . ILE A 1 55  ? 15.359  -1.144  12.057  1.00 0.00 ? 55  ILE A HA   3  
ATOM 5349  H HB   . ILE A 1 55  ? 14.970  -3.826  13.313  1.00 0.00 ? 55  ILE A HB   3  
ATOM 5350  H HG12 . ILE A 1 55  ? 12.710  -2.980  13.900  1.00 0.00 ? 55  ILE A HG12 3  
ATOM 5351  H HG13 . ILE A 1 55  ? 13.784  -2.985  15.372  1.00 0.00 ? 55  ILE A HG13 3  
ATOM 5352  H HG21 . ILE A 1 55  ? 16.132  -1.264  14.475  1.00 0.00 ? 55  ILE A HG21 3  
ATOM 5353  H HG22 . ILE A 1 55  ? 16.034  -2.897  15.244  1.00 0.00 ? 55  ILE A HG22 3  
ATOM 5354  H HG23 . ILE A 1 55  ? 17.039  -2.662  13.772  1.00 0.00 ? 55  ILE A HG23 3  
ATOM 5355  H HD11 . ILE A 1 55  ? 14.060  -0.396  14.247  1.00 0.00 ? 55  ILE A HD11 3  
ATOM 5356  H HD12 . ILE A 1 55  ? 12.315  -0.866  14.276  1.00 0.00 ? 55  ILE A HD12 3  
ATOM 5357  H HD13 . ILE A 1 55  ? 13.309  -0.970  15.796  1.00 0.00 ? 55  ILE A HD13 3  
ATOM 5358  N N    . GLN A 1 56  ? 16.676  -3.174  10.947  1.00 0.00 ? 56  GLN A N    3  
ATOM 5359  C CA   . GLN A 1 56  ? 17.441  -4.018  10.035  1.00 0.00 ? 56  GLN A CA   3  
ATOM 5360  C C    . GLN A 1 56  ? 17.691  -5.488  10.480  1.00 0.00 ? 56  GLN A C    3  
ATOM 5361  O O    . GLN A 1 56  ? 17.246  -6.380  9.762   1.00 0.00 ? 56  GLN A O    3  
ATOM 5362  C CB   . GLN A 1 56  ? 18.743  -3.259  9.648   1.00 0.00 ? 56  GLN A CB   3  
ATOM 5363  C CG   . GLN A 1 56  ? 18.519  -1.874  8.976   1.00 0.00 ? 56  GLN A CG   3  
ATOM 5364  C CD   . GLN A 1 56  ? 17.849  -1.926  7.597   1.00 0.00 ? 56  GLN A CD   3  
ATOM 5365  O OE1  . GLN A 1 56  ? 18.547  -1.813  6.586   1.00 0.00 ? 56  GLN A OE1  3  
ATOM 5366  N NE2  . GLN A 1 56  ? 16.499  -2.059  7.548   1.00 0.00 ? 56  GLN A NE2  3  
ATOM 5367  H H    . GLN A 1 56  ? 17.235  -2.669  11.592  1.00 0.00 ? 56  GLN A H    3  
ATOM 5368  H HA   . GLN A 1 56  ? 16.891  -4.135  9.118   1.00 0.00 ? 56  GLN A HA   3  
ATOM 5369  H HB2  . GLN A 1 56  ? 19.288  -2.984  10.611  1.00 0.00 ? 56  GLN A HB2  3  
ATOM 5370  H HB3  . GLN A 1 56  ? 19.335  -3.922  8.948   1.00 0.00 ? 56  GLN A HB3  3  
ATOM 5371  H HG2  . GLN A 1 56  ? 17.926  -1.211  9.637   1.00 0.00 ? 56  GLN A HG2  3  
ATOM 5372  H HG3  . GLN A 1 56  ? 19.514  -1.397  8.824   1.00 0.00 ? 56  GLN A HG3  3  
ATOM 5373  H HE21 . GLN A 1 56  ? 15.967  -2.196  8.384   1.00 0.00 ? 56  GLN A HE21 3  
ATOM 5374  H HE22 . GLN A 1 56  ? 16.058  -2.043  6.654   1.00 0.00 ? 56  GLN A HE22 3  
ATOM 5375  N N    . PRO A 1 57  ? 18.384  -5.817  11.598  1.00 0.00 ? 57  PRO A N    3  
ATOM 5376  C CA   . PRO A 1 57  ? 18.750  -7.182  12.040  1.00 0.00 ? 57  PRO A CA   3  
ATOM 5377  C C    . PRO A 1 57  ? 17.606  -7.953  12.724  1.00 0.00 ? 57  PRO A C    3  
ATOM 5378  O O    . PRO A 1 57  ? 16.440  -7.699  12.467  1.00 0.00 ? 57  PRO A O    3  
ATOM 5379  C CB   . PRO A 1 57  ? 19.831  -6.850  13.101  1.00 0.00 ? 57  PRO A CB   3  
ATOM 5380  C CG   . PRO A 1 57  ? 19.254  -5.589  13.740  1.00 0.00 ? 57  PRO A CG   3  
ATOM 5381  C CD   . PRO A 1 57  ? 18.987  -4.812  12.465  1.00 0.00 ? 57  PRO A CD   3  
ATOM 5382  H HA   . PRO A 1 57  ? 19.118  -7.779  11.217  1.00 0.00 ? 57  PRO A HA   3  
ATOM 5383  H HB2  . PRO A 1 57  ? 20.080  -7.633  13.839  1.00 0.00 ? 57  PRO A HB2  3  
ATOM 5384  H HB3  . PRO A 1 57  ? 20.780  -6.592  12.577  1.00 0.00 ? 57  PRO A HB3  3  
ATOM 5385  H HG2  . PRO A 1 57  ? 18.282  -5.836  14.255  1.00 0.00 ? 57  PRO A HG2  3  
ATOM 5386  H HG3  . PRO A 1 57  ? 19.952  -5.094  14.440  1.00 0.00 ? 57  PRO A HG3  3  
ATOM 5387  H HD2  . PRO A 1 57  ? 18.322  -3.920  12.603  1.00 0.00 ? 57  PRO A HD2  3  
ATOM 5388  H HD3  . PRO A 1 57  ? 19.977  -4.543  11.985  1.00 0.00 ? 57  PRO A HD3  3  
ATOM 5389  N N    . HIS A 1 58  ? 17.963  -8.858  13.686  1.00 0.00 ? 58  HIS A N    3  
ATOM 5390  C CA   . HIS A 1 58  ? 17.164  -9.720  14.572  1.00 0.00 ? 58  HIS A CA   3  
ATOM 5391  C C    . HIS A 1 58  ? 16.123  -9.011  15.454  1.00 0.00 ? 58  HIS A C    3  
ATOM 5392  O O    . HIS A 1 58  ? 15.120  -9.600  15.839  1.00 0.00 ? 58  HIS A O    3  
ATOM 5393  C CB   . HIS A 1 58  ? 18.069  -10.639 15.447  1.00 0.00 ? 58  HIS A CB   3  
ATOM 5394  C CG   . HIS A 1 58  ? 18.703  -11.799 14.710  1.00 0.00 ? 58  HIS A CG   3  
ATOM 5395  N ND1  . HIS A 1 58  ? 19.131  -11.795 13.398  1.00 0.00 ? 58  HIS A ND1  3  
ATOM 5396  C CD2  . HIS A 1 58  ? 18.984  -13.048 15.179  1.00 0.00 ? 58  HIS A CD2  3  
ATOM 5397  C CE1  . HIS A 1 58  ? 19.647  -13.026 13.145  1.00 0.00 ? 58  HIS A CE1  3  
ATOM 5398  N NE2  . HIS A 1 58  ? 19.582  -13.818 14.196  1.00 0.00 ? 58  HIS A NE2  3  
ATOM 5399  H H    . HIS A 1 58  ? 18.939  -8.965  13.842  1.00 0.00 ? 58  HIS A H    3  
ATOM 5400  H HA   . HIS A 1 58  ? 16.597  -10.390 13.941  1.00 0.00 ? 58  HIS A HA   3  
ATOM 5401  H HB2  . HIS A 1 58  ? 18.870  -10.031 15.922  1.00 0.00 ? 58  HIS A HB2  3  
ATOM 5402  H HB3  . HIS A 1 58  ? 17.480  -11.118 16.263  1.00 0.00 ? 58  HIS A HB3  3  
ATOM 5403  H HD1  . HIS A 1 58  ? 18.981  -11.068 12.728  1.00 0.00 ? 58  HIS A HD1  3  
ATOM 5404  H HD2  . HIS A 1 58  ? 18.785  -13.462 16.157  1.00 0.00 ? 58  HIS A HD2  3  
ATOM 5405  H HE1  . HIS A 1 58  ? 20.047  -13.318 12.174  1.00 0.00 ? 58  HIS A HE1  3  
ATOM 5406  N N    . ASP A 1 59  ? 16.340  -7.711  15.797  1.00 0.00 ? 59  ASP A N    3  
ATOM 5407  C CA   . ASP A 1 59  ? 15.520  -6.818  16.590  1.00 0.00 ? 59  ASP A CA   3  
ATOM 5408  C C    . ASP A 1 59  ? 14.460  -6.136  15.749  1.00 0.00 ? 59  ASP A C    3  
ATOM 5409  O O    . ASP A 1 59  ? 13.749  -5.270  16.229  1.00 0.00 ? 59  ASP A O    3  
ATOM 5410  C CB   . ASP A 1 59  ? 16.382  -5.726  17.286  1.00 0.00 ? 59  ASP A CB   3  
ATOM 5411  C CG   . ASP A 1 59  ? 17.412  -6.394  18.203  1.00 0.00 ? 59  ASP A CG   3  
ATOM 5412  O OD1  . ASP A 1 59  ? 16.985  -7.067  19.180  1.00 0.00 ? 59  ASP A OD1  3  
ATOM 5413  O OD2  . ASP A 1 59  ? 18.633  -6.239  17.936  1.00 0.00 ? 59  ASP A OD2  3  
ATOM 5414  H H    . ASP A 1 59  ? 17.136  -7.231  15.477  1.00 0.00 ? 59  ASP A H    3  
ATOM 5415  H HA   . ASP A 1 59  ? 14.994  -7.385  17.348  1.00 0.00 ? 59  ASP A HA   3  
ATOM 5416  H HB2  . ASP A 1 59  ? 16.926  -5.123  16.518  1.00 0.00 ? 59  ASP A HB2  3  
ATOM 5417  H HB3  . ASP A 1 59  ? 15.746  -5.061  17.917  1.00 0.00 ? 59  ASP A HB3  3  
ATOM 5418  N N    . ARG A 1 60  ? 14.299  -6.508  14.451  1.00 0.00 ? 60  ARG A N    3  
ATOM 5419  C CA   . ARG A 1 60  ? 13.262  -6.017  13.537  1.00 0.00 ? 60  ARG A CA   3  
ATOM 5420  C C    . ARG A 1 60  ? 11.839  -6.311  13.933  1.00 0.00 ? 60  ARG A C    3  
ATOM 5421  O O    . ARG A 1 60  ? 11.068  -5.367  14.082  1.00 0.00 ? 60  ARG A O    3  
ATOM 5422  C CB   . ARG A 1 60  ? 13.564  -6.327  12.044  1.00 0.00 ? 60  ARG A CB   3  
ATOM 5423  C CG   . ARG A 1 60  ? 13.156  -7.703  11.472  1.00 0.00 ? 60  ARG A CG   3  
ATOM 5424  C CD   . ARG A 1 60  ? 13.810  -8.923  12.143  1.00 0.00 ? 60  ARG A CD   3  
ATOM 5425  N NE   . ARG A 1 60  ? 12.772  -9.996  12.333  1.00 0.00 ? 60  ARG A NE   3  
ATOM 5426  C CZ   . ARG A 1 60  ? 13.046  -11.235 12.845  1.00 0.00 ? 60  ARG A CZ   3  
ATOM 5427  N NH1  . ARG A 1 60  ? 14.320  -11.596 13.171  1.00 0.00 ? 60  ARG A NH1  3  
ATOM 5428  N NH2  . ARG A 1 60  ? 12.023  -12.122 13.031  1.00 0.00 ? 60  ARG A NH2  3  
ATOM 5429  H H    . ARG A 1 60  ? 14.918  -7.194  14.065  1.00 0.00 ? 60  ARG A H    3  
ATOM 5430  H HA   . ARG A 1 60  ? 13.226  -4.940  13.635  1.00 0.00 ? 60  ARG A HA   3  
ATOM 5431  H HB2  . ARG A 1 60  ? 13.059  -5.556  11.419  1.00 0.00 ? 60  ARG A HB2  3  
ATOM 5432  H HB3  . ARG A 1 60  ? 14.655  -6.199  11.871  1.00 0.00 ? 60  ARG A HB3  3  
ATOM 5433  H HG2  . ARG A 1 60  ? 12.048  -7.781  11.488  1.00 0.00 ? 60  ARG A HG2  3  
ATOM 5434  H HG3  . ARG A 1 60  ? 13.454  -7.709  10.397  1.00 0.00 ? 60  ARG A HG3  3  
ATOM 5435  H HD2  . ARG A 1 60  ? 14.624  -9.299  11.485  1.00 0.00 ? 60  ARG A HD2  3  
ATOM 5436  H HD3  . ARG A 1 60  ? 14.252  -8.638  13.130  1.00 0.00 ? 60  ARG A HD3  3  
ATOM 5437  H HE   . ARG A 1 60  ? 11.823  -9.775  12.106  1.00 0.00 ? 60  ARG A HE   3  
ATOM 5438  H HH11 . ARG A 1 60  ? 15.071  -10.949 13.040  1.00 0.00 ? 60  ARG A HH11 3  
ATOM 5439  H HH12 . ARG A 1 60  ? 14.501  -12.505 13.544  1.00 0.00 ? 60  ARG A HH12 3  
ATOM 5440  H HH21 . ARG A 1 60  ? 11.088  -11.862 12.795  1.00 0.00 ? 60  ARG A HH21 3  
ATOM 5441  H HH22 . ARG A 1 60  ? 12.212  -13.029 13.406  1.00 0.00 ? 60  ARG A HH22 3  
ATOM 5442  N N    . LYS A 1 61  ? 11.413  -7.585  14.210  1.00 0.00 ? 61  LYS A N    3  
ATOM 5443  C CA   . LYS A 1 61  ? 10.055  -7.907  14.675  1.00 0.00 ? 61  LYS A CA   3  
ATOM 5444  C C    . LYS A 1 61  ? 9.583   -7.218  15.958  1.00 0.00 ? 61  LYS A C    3  
ATOM 5445  O O    . LYS A 1 61  ? 8.402   -6.933  16.143  1.00 0.00 ? 61  LYS A O    3  
ATOM 5446  C CB   . LYS A 1 61  ? 9.338   -9.181  14.140  1.00 0.00 ? 61  LYS A CB   3  
ATOM 5447  C CG   . LYS A 1 61  ? 7.965   -9.584  14.759  1.00 0.00 ? 61  LYS A CG   3  
ATOM 5448  C CD   . LYS A 1 61  ? 8.041   -10.202 16.165  1.00 0.00 ? 61  LYS A CD   3  
ATOM 5449  C CE   . LYS A 1 61  ? 6.705   -10.781 16.654  1.00 0.00 ? 61  LYS A CE   3  
ATOM 5450  N NZ   . LYS A 1 61  ? 5.665   -9.729  16.763  1.00 0.00 ? 61  LYS A NZ   3  
ATOM 5451  H H    . LYS A 1 61  ? 12.047  -8.349  14.111  1.00 0.00 ? 61  LYS A H    3  
ATOM 5452  H HA   . LYS A 1 61  ? 9.524   -7.307  13.968  1.00 0.00 ? 61  LYS A HA   3  
ATOM 5453  H HB2  . LYS A 1 61  ? 9.091   -8.902  13.069  1.00 0.00 ? 61  LYS A HB2  3  
ATOM 5454  H HB3  . LYS A 1 61  ? 10.060  -10.023 14.134  1.00 0.00 ? 61  LYS A HB3  3  
ATOM 5455  H HG2  . LYS A 1 61  ? 7.266   -8.705  14.824  1.00 0.00 ? 61  LYS A HG2  3  
ATOM 5456  H HG3  . LYS A 1 61  ? 7.484   -10.330 14.086  1.00 0.00 ? 61  LYS A HG3  3  
ATOM 5457  H HD2  . LYS A 1 61  ? 8.812   -11.000 16.168  1.00 0.00 ? 61  LYS A HD2  3  
ATOM 5458  H HD3  . LYS A 1 61  ? 8.361   -9.405  16.872  1.00 0.00 ? 61  LYS A HD3  3  
ATOM 5459  H HE2  . LYS A 1 61  ? 6.333   -11.552 15.947  1.00 0.00 ? 61  LYS A HE2  3  
ATOM 5460  H HE3  . LYS A 1 61  ? 6.828   -11.234 17.660  1.00 0.00 ? 61  LYS A HE3  3  
ATOM 5461  H HZ1  . LYS A 1 61  ? 5.518   -9.291  15.831  1.00 0.00 ? 61  LYS A HZ1  3  
ATOM 5462  H HZ2  . LYS A 1 61  ? 4.775   -10.153 17.093  1.00 0.00 ? 61  LYS A HZ2  3  
ATOM 5463  H HZ3  . LYS A 1 61  ? 5.977   -9.003  17.441  1.00 0.00 ? 61  LYS A HZ3  3  
ATOM 5464  N N    . LYS A 1 62  ? 10.544  -6.819  16.835  1.00 0.00 ? 62  LYS A N    3  
ATOM 5465  C CA   . LYS A 1 62  ? 10.341  -5.950  17.988  1.00 0.00 ? 62  LYS A CA   3  
ATOM 5466  C C    . LYS A 1 62  ? 9.615   -4.602  17.726  1.00 0.00 ? 62  LYS A C    3  
ATOM 5467  O O    . LYS A 1 62  ? 8.833   -4.164  18.570  1.00 0.00 ? 62  LYS A O    3  
ATOM 5468  C CB   . LYS A 1 62  ? 11.706  -5.762  18.721  1.00 0.00 ? 62  LYS A CB   3  
ATOM 5469  C CG   . LYS A 1 62  ? 11.620  -4.883  19.982  1.00 0.00 ? 62  LYS A CG   3  
ATOM 5470  C CD   . LYS A 1 62  ? 12.175  -3.450  19.858  1.00 0.00 ? 62  LYS A CD   3  
ATOM 5471  C CE   . LYS A 1 62  ? 13.680  -3.377  19.556  1.00 0.00 ? 62  LYS A CE   3  
ATOM 5472  N NZ   . LYS A 1 62  ? 14.134  -1.967  19.478  1.00 0.00 ? 62  LYS A NZ   3  
ATOM 5473  H H    . LYS A 1 62  ? 11.498  -7.025  16.639  1.00 0.00 ? 62  LYS A H    3  
ATOM 5474  H HA   . LYS A 1 62  ? 9.652   -6.475  18.638  1.00 0.00 ? 62  LYS A HA   3  
ATOM 5475  H HB2  . LYS A 1 62  ? 12.013  -6.782  19.053  1.00 0.00 ? 62  LYS A HB2  3  
ATOM 5476  H HB3  . LYS A 1 62  ? 12.524  -5.421  18.033  1.00 0.00 ? 62  LYS A HB3  3  
ATOM 5477  H HG2  . LYS A 1 62  ? 10.536  -4.818  20.245  1.00 0.00 ? 62  LYS A HG2  3  
ATOM 5478  H HG3  . LYS A 1 62  ? 12.156  -5.402  20.802  1.00 0.00 ? 62  LYS A HG3  3  
ATOM 5479  H HD2  . LYS A 1 62  ? 11.614  -2.913  19.062  1.00 0.00 ? 62  LYS A HD2  3  
ATOM 5480  H HD3  . LYS A 1 62  ? 11.987  -2.923  20.822  1.00 0.00 ? 62  LYS A HD3  3  
ATOM 5481  H HE2  . LYS A 1 62  ? 14.263  -3.875  20.358  1.00 0.00 ? 62  LYS A HE2  3  
ATOM 5482  H HE3  . LYS A 1 62  ? 13.914  -3.851  18.581  1.00 0.00 ? 62  LYS A HE3  3  
ATOM 5483  H HZ1  . LYS A 1 62  ? 13.944  -1.492  20.382  1.00 0.00 ? 62  LYS A HZ1  3  
ATOM 5484  H HZ2  . LYS A 1 62  ? 15.156  -1.944  19.281  1.00 0.00 ? 62  LYS A HZ2  3  
ATOM 5485  H HZ3  . LYS A 1 62  ? 13.623  -1.481  18.714  1.00 0.00 ? 62  LYS A HZ3  3  
ATOM 5486  N N    . MET A 1 63  ? 9.779   -3.948  16.527  1.00 0.00 ? 63  MET A N    3  
ATOM 5487  C CA   . MET A 1 63  ? 8.981   -2.769  16.199  1.00 0.00 ? 63  MET A CA   3  
ATOM 5488  C C    . MET A 1 63  ? 7.867   -3.059  15.209  1.00 0.00 ? 63  MET A C    3  
ATOM 5489  O O    . MET A 1 63  ? 7.047   -2.187  14.936  1.00 0.00 ? 63  MET A O    3  
ATOM 5490  C CB   . MET A 1 63  ? 9.760   -1.449  15.947  1.00 0.00 ? 63  MET A CB   3  
ATOM 5491  C CG   . MET A 1 63  ? 10.362  -0.856  17.247  1.00 0.00 ? 63  MET A CG   3  
ATOM 5492  S SD   . MET A 1 63  ? 10.275  0.964   17.358  1.00 0.00 ? 63  MET A SD   3  
ATOM 5493  C CE   . MET A 1 63  ? 11.369  1.285   15.953  1.00 0.00 ? 63  MET A CE   3  
ATOM 5494  H H    . MET A 1 63  ? 10.387  -4.281  15.798  1.00 0.00 ? 63  MET A H    3  
ATOM 5495  H HA   . MET A 1 63  ? 8.388   -2.507  17.046  1.00 0.00 ? 63  MET A HA   3  
ATOM 5496  H HB2  . MET A 1 63  ? 10.572  -1.632  15.209  1.00 0.00 ? 63  MET A HB2  3  
ATOM 5497  H HB3  . MET A 1 63  ? 9.067   -0.676  15.528  1.00 0.00 ? 63  MET A HB3  3  
ATOM 5498  H HG2  . MET A 1 63  ? 9.759   -1.234  18.126  1.00 0.00 ? 63  MET A HG2  3  
ATOM 5499  H HG3  . MET A 1 63  ? 11.441  -1.195  17.299  1.00 0.00 ? 63  MET A HG3  3  
ATOM 5500  H HE1  . MET A 1 63  ? 12.325  0.739   16.103  1.00 0.00 ? 63  MET A HE1  3  
ATOM 5501  H HE2  . MET A 1 63  ? 10.919  0.933   14.998  1.00 0.00 ? 63  MET A HE2  3  
ATOM 5502  H HE3  . MET A 1 63  ? 11.598  2.366   15.850  1.00 0.00 ? 63  MET A HE3  3  
ATOM 5503  N N    . LYS A 1 64  ? 7.718   -4.333  14.714  1.00 0.00 ? 64  LYS A N    3  
ATOM 5504  C CA   . LYS A 1 64  ? 6.600   -4.807  13.897  1.00 0.00 ? 64  LYS A CA   3  
ATOM 5505  C C    . LYS A 1 64  ? 5.320   -4.946  14.754  1.00 0.00 ? 64  LYS A C    3  
ATOM 5506  O O    . LYS A 1 64  ? 4.191   -4.716  14.315  1.00 0.00 ? 64  LYS A O    3  
ATOM 5507  C CB   . LYS A 1 64  ? 7.025   -6.114  13.155  1.00 0.00 ? 64  LYS A CB   3  
ATOM 5508  C CG   . LYS A 1 64  ? 5.900   -7.098  12.857  1.00 0.00 ? 64  LYS A CG   3  
ATOM 5509  C CD   . LYS A 1 64  ? 6.264   -8.183  11.836  1.00 0.00 ? 64  LYS A CD   3  
ATOM 5510  C CE   . LYS A 1 64  ? 5.132   -9.193  11.593  1.00 0.00 ? 64  LYS A CE   3  
ATOM 5511  N NZ   . LYS A 1 64  ? 4.784   -9.922  12.836  1.00 0.00 ? 64  LYS A NZ   3  
ATOM 5512  H H    . LYS A 1 64  ? 8.341   -5.084  14.942  1.00 0.00 ? 64  LYS A H    3  
ATOM 5513  H HA   . LYS A 1 64  ? 6.383   -4.035  13.193  1.00 0.00 ? 64  LYS A HA   3  
ATOM 5514  H HB2  . LYS A 1 64  ? 7.610   -5.980  12.171  1.00 0.00 ? 64  LYS A HB2  3  
ATOM 5515  H HB3  . LYS A 1 64  ? 7.606   -6.624  13.967  1.00 0.00 ? 64  LYS A HB3  3  
ATOM 5516  H HG2  . LYS A 1 64  ? 5.691   -7.528  13.863  1.00 0.00 ? 64  LYS A HG2  3  
ATOM 5517  H HG3  . LYS A 1 64  ? 5.016   -6.538  12.495  1.00 0.00 ? 64  LYS A HG3  3  
ATOM 5518  H HD2  . LYS A 1 64  ? 6.519   -7.694  10.870  1.00 0.00 ? 64  LYS A HD2  3  
ATOM 5519  H HD3  . LYS A 1 64  ? 7.168   -8.729  12.176  1.00 0.00 ? 64  LYS A HD3  3  
ATOM 5520  H HE2  . LYS A 1 64  ? 4.217   -8.676  11.236  1.00 0.00 ? 64  LYS A HE2  3  
ATOM 5521  H HE3  . LYS A 1 64  ? 5.446   -9.947  10.839  1.00 0.00 ? 64  LYS A HE3  3  
ATOM 5522  H HZ1  . LYS A 1 64  ? 5.621   -10.431 13.183  1.00 0.00 ? 64  LYS A HZ1  3  
ATOM 5523  H HZ2  . LYS A 1 64  ? 4.468   -9.241  13.556  1.00 0.00 ? 64  LYS A HZ2  3  
ATOM 5524  H HZ3  . LYS A 1 64  ? 4.020   -10.600 12.639  1.00 0.00 ? 64  LYS A HZ3  3  
ATOM 5525  N N    . LYS A 1 65  ? 5.527   -5.271  16.058  1.00 0.00 ? 65  LYS A N    3  
ATOM 5526  C CA   . LYS A 1 65  ? 4.493   -5.329  17.100  1.00 0.00 ? 65  LYS A CA   3  
ATOM 5527  C C    . LYS A 1 65  ? 3.853   -3.945  17.470  1.00 0.00 ? 65  LYS A C    3  
ATOM 5528  O O    . LYS A 1 65  ? 2.632   -3.792  17.505  1.00 0.00 ? 65  LYS A O    3  
ATOM 5529  C CB   . LYS A 1 65  ? 5.040   -6.055  18.356  1.00 0.00 ? 65  LYS A CB   3  
ATOM 5530  C CG   . LYS A 1 65  ? 3.972   -6.487  19.381  1.00 0.00 ? 65  LYS A CG   3  
ATOM 5531  C CD   . LYS A 1 65  ? 4.582   -7.303  20.532  1.00 0.00 ? 65  LYS A CD   3  
ATOM 5532  C CE   . LYS A 1 65  ? 3.570   -7.720  21.608  1.00 0.00 ? 65  LYS A CE   3  
ATOM 5533  N NZ   . LYS A 1 65  ? 2.536   -8.627  21.059  1.00 0.00 ? 65  LYS A NZ   3  
ATOM 5534  H H    . LYS A 1 65  ? 6.475   -5.488  16.304  1.00 0.00 ? 65  LYS A H    3  
ATOM 5535  H HA   . LYS A 1 65  ? 3.725   -5.966  16.670  1.00 0.00 ? 65  LYS A HA   3  
ATOM 5536  H HB2  . LYS A 1 65  ? 5.558   -6.978  18.003  1.00 0.00 ? 65  LYS A HB2  3  
ATOM 5537  H HB3  . LYS A 1 65  ? 5.813   -5.432  18.856  1.00 0.00 ? 65  LYS A HB3  3  
ATOM 5538  H HG2  . LYS A 1 65  ? 3.465   -5.591  19.806  1.00 0.00 ? 65  LYS A HG2  3  
ATOM 5539  H HG3  . LYS A 1 65  ? 3.196   -7.099  18.865  1.00 0.00 ? 65  LYS A HG3  3  
ATOM 5540  H HD2  . LYS A 1 65  ? 5.075   -8.209  20.114  1.00 0.00 ? 65  LYS A HD2  3  
ATOM 5541  H HD3  . LYS A 1 65  ? 5.373   -6.685  21.014  1.00 0.00 ? 65  LYS A HD3  3  
ATOM 5542  H HE2  . LYS A 1 65  ? 4.085   -8.261  22.430  1.00 0.00 ? 65  LYS A HE2  3  
ATOM 5543  H HE3  . LYS A 1 65  ? 3.053   -6.830  22.024  1.00 0.00 ? 65  LYS A HE3  3  
ATOM 5544  H HZ1  . LYS A 1 65  ? 2.991   -9.478  20.673  1.00 0.00 ? 65  LYS A HZ1  3  
ATOM 5545  H HZ2  . LYS A 1 65  ? 1.875   -8.899  21.814  1.00 0.00 ? 65  LYS A HZ2  3  
ATOM 5546  H HZ3  . LYS A 1 65  ? 2.015   -8.139  20.301  1.00 0.00 ? 65  LYS A HZ3  3  
ATOM 5547  N N    . VAL A 1 66  ? 4.694   -2.866  17.666  1.00 0.00 ? 66  VAL A N    3  
ATOM 5548  C CA   . VAL A 1 66  ? 4.336   -1.434  17.850  1.00 0.00 ? 66  VAL A CA   3  
ATOM 5549  C C    . VAL A 1 66  ? 3.760   -0.823  16.575  1.00 0.00 ? 66  VAL A C    3  
ATOM 5550  O O    . VAL A 1 66  ? 2.904   0.062   16.642  1.00 0.00 ? 66  VAL A O    3  
ATOM 5551  C CB   . VAL A 1 66  ? 5.234   -0.511  18.714  1.00 0.00 ? 66  VAL A CB   3  
ATOM 5552  C CG1  . VAL A 1 66  ? 6.725   -0.611  18.374  1.00 0.00 ? 66  VAL A CG1  3  
ATOM 5553  C CG2  . VAL A 1 66  ? 4.783   0.978   18.704  1.00 0.00 ? 66  VAL A CG2  3  
ATOM 5554  H H    . VAL A 1 66  ? 5.675   -3.023  17.623  1.00 0.00 ? 66  VAL A H    3  
ATOM 5555  H HA   . VAL A 1 66  ? 3.454   -1.463  18.478  1.00 0.00 ? 66  VAL A HA   3  
ATOM 5556  H HB   . VAL A 1 66  ? 5.133   -0.876  19.768  1.00 0.00 ? 66  VAL A HB   3  
ATOM 5557  H HG11 . VAL A 1 66  ? 6.890   -0.485  17.284  1.00 0.00 ? 66  VAL A HG11 3  
ATOM 5558  H HG12 . VAL A 1 66  ? 7.288   0.182   18.913  1.00 0.00 ? 66  VAL A HG12 3  
ATOM 5559  H HG13 . VAL A 1 66  ? 7.110   -1.591  18.727  1.00 0.00 ? 66  VAL A HG13 3  
ATOM 5560  H HG21 . VAL A 1 66  ? 3.695   1.077   18.905  1.00 0.00 ? 66  VAL A HG21 3  
ATOM 5561  H HG22 . VAL A 1 66  ? 5.335   1.553   19.479  1.00 0.00 ? 66  VAL A HG22 3  
ATOM 5562  H HG23 . VAL A 1 66  ? 5.000   1.448   17.720  1.00 0.00 ? 66  VAL A HG23 3  
ATOM 5563  N N    . TRP A 1 67  ? 4.174   -1.310  15.359  1.00 0.00 ? 67  TRP A N    3  
ATOM 5564  C CA   . TRP A 1 67  ? 3.613   -0.939  14.047  1.00 0.00 ? 67  TRP A CA   3  
ATOM 5565  C C    . TRP A 1 67  ? 2.065   -1.047  13.935  1.00 0.00 ? 67  TRP A C    3  
ATOM 5566  O O    . TRP A 1 67  ? 1.443   -0.207  13.300  1.00 0.00 ? 67  TRP A O    3  
ATOM 5567  C CB   . TRP A 1 67  ? 4.333   -1.704  12.884  1.00 0.00 ? 67  TRP A CB   3  
ATOM 5568  C CG   . TRP A 1 67  ? 3.763   -1.487  11.489  1.00 0.00 ? 67  TRP A CG   3  
ATOM 5569  C CD1  . TRP A 1 67  ? 2.969   -2.343  10.788  1.00 0.00 ? 67  TRP A CD1  3  
ATOM 5570  C CD2  . TRP A 1 67  ? 3.569   -0.194  10.907  1.00 0.00 ? 67  TRP A CD2  3  
ATOM 5571  N NE1  . TRP A 1 67  ? 2.414   -1.710  9.702   1.00 0.00 ? 67  TRP A NE1  3  
ATOM 5572  C CE2  . TRP A 1 67  ? 2.719   -0.370  9.812   1.00 0.00 ? 67  TRP A CE2  3  
ATOM 5573  C CE3  . TRP A 1 67  ? 3.998   1.041   11.308  1.00 0.00 ? 67  TRP A CE3  3  
ATOM 5574  C CZ2  . TRP A 1 67  ? 2.276   0.698   9.108   1.00 0.00 ? 67  TRP A CZ2  3  
ATOM 5575  C CZ3  . TRP A 1 67  ? 3.455   2.124   10.661  1.00 0.00 ? 67  TRP A CZ3  3  
ATOM 5576  C CH2  . TRP A 1 67  ? 2.598   1.940   9.597   1.00 0.00 ? 67  TRP A CH2  3  
ATOM 5577  H H    . TRP A 1 67  ? 4.892   -2.010  15.310  1.00 0.00 ? 67  TRP A H    3  
ATOM 5578  H HA   . TRP A 1 67  ? 3.833   0.107   13.910  1.00 0.00 ? 67  TRP A HA   3  
ATOM 5579  H HB2  . TRP A 1 67  ? 5.413   -1.393  12.881  1.00 0.00 ? 67  TRP A HB2  3  
ATOM 5580  H HB3  . TRP A 1 67  ? 4.243   -2.797  13.082  1.00 0.00 ? 67  TRP A HB3  3  
ATOM 5581  H HD1  . TRP A 1 67  ? 2.740   -3.340  11.125  1.00 0.00 ? 67  TRP A HD1  3  
ATOM 5582  H HE1  . TRP A 1 67  ? 1.844   -2.119  9.017   1.00 0.00 ? 67  TRP A HE1  3  
ATOM 5583  H HE3  . TRP A 1 67  ? 4.654   1.182   12.155  1.00 0.00 ? 67  TRP A HE3  3  
ATOM 5584  H HZ2  . TRP A 1 67  ? 1.576   0.594   8.294   1.00 0.00 ? 67  TRP A HZ2  3  
ATOM 5585  H HZ3  . TRP A 1 67  ? 3.691   3.124   10.994  1.00 0.00 ? 67  TRP A HZ3  3  
ATOM 5586  H HH2  . TRP A 1 67  ? 2.126   2.792   9.160   1.00 0.00 ? 67  TRP A HH2  3  
ATOM 5587  N N    . ASP A 1 68  ? 1.426   -2.019  14.650  1.00 0.00 ? 68  ASP A N    3  
ATOM 5588  C CA   . ASP A 1 68  ? -0.024  -2.200  14.841  1.00 0.00 ? 68  ASP A CA   3  
ATOM 5589  C C    . ASP A 1 68  ? -0.716  -1.004  15.541  1.00 0.00 ? 68  ASP A C    3  
ATOM 5590  O O    . ASP A 1 68  ? -1.809  -0.587  15.171  1.00 0.00 ? 68  ASP A O    3  
ATOM 5591  C CB   . ASP A 1 68  ? -0.254  -3.519  15.641  1.00 0.00 ? 68  ASP A CB   3  
ATOM 5592  C CG   . ASP A 1 68  ? -1.708  -4.009  15.630  1.00 0.00 ? 68  ASP A CG   3  
ATOM 5593  O OD1  . ASP A 1 68  ? -2.233  -4.277  14.517  1.00 0.00 ? 68  ASP A OD1  3  
ATOM 5594  O OD2  . ASP A 1 68  ? -2.305  -4.121  16.735  1.00 0.00 ? 68  ASP A OD2  3  
ATOM 5595  H H    . ASP A 1 68  ? 1.995   -2.678  15.142  1.00 0.00 ? 68  ASP A H    3  
ATOM 5596  H HA   . ASP A 1 68  ? -0.463  -2.275  13.852  1.00 0.00 ? 68  ASP A HA   3  
ATOM 5597  H HB2  . ASP A 1 68  ? 0.367   -4.315  15.174  1.00 0.00 ? 68  ASP A HB2  3  
ATOM 5598  H HB3  . ASP A 1 68  ? 0.113   -3.387  16.684  1.00 0.00 ? 68  ASP A HB3  3  
ATOM 5599  N N    . ARG A 1 69  ? -0.037  -0.392  16.549  1.00 0.00 ? 69  ARG A N    3  
ATOM 5600  C CA   . ARG A 1 69  ? -0.377  0.890   17.163  1.00 0.00 ? 69  ARG A CA   3  
ATOM 5601  C C    . ARG A 1 69  ? 0.025   2.110   16.306  1.00 0.00 ? 69  ARG A C    3  
ATOM 5602  O O    . ARG A 1 69  ? -0.779  3.010   16.069  1.00 0.00 ? 69  ARG A O    3  
ATOM 5603  C CB   . ARG A 1 69  ? 0.205   0.953   18.600  1.00 0.00 ? 69  ARG A CB   3  
ATOM 5604  C CG   . ARG A 1 69  ? 0.007   2.256   19.417  1.00 0.00 ? 69  ARG A CG   3  
ATOM 5605  C CD   . ARG A 1 69  ? -1.419  2.846   19.444  1.00 0.00 ? 69  ARG A CD   3  
ATOM 5606  N NE   . ARG A 1 69  ? -2.395  1.779   19.866  1.00 0.00 ? 69  ARG A NE   3  
ATOM 5607  C CZ   . ARG A 1 69  ? -3.727  1.804   19.545  1.00 0.00 ? 69  ARG A CZ   3  
ATOM 5608  N NH1  . ARG A 1 69  ? -4.259  2.833   18.825  1.00 0.00 ? 69  ARG A NH1  3  
ATOM 5609  N NH2  . ARG A 1 69  ? -4.533  0.779   19.951  1.00 0.00 ? 69  ARG A NH2  3  
ATOM 5610  H H    . ARG A 1 69  ? 0.838   -0.769  16.849  1.00 0.00 ? 69  ARG A H    3  
ATOM 5611  H HA   . ARG A 1 69  ? -1.457  0.935   17.234  1.00 0.00 ? 69  ARG A HA   3  
ATOM 5612  H HB2  . ARG A 1 69  ? -0.269  0.124   19.173  1.00 0.00 ? 69  ARG A HB2  3  
ATOM 5613  H HB3  . ARG A 1 69  ? 1.293   0.723   18.547  1.00 0.00 ? 69  ARG A HB3  3  
ATOM 5614  H HG2  . ARG A 1 69  ? 0.326   2.044   20.465  1.00 0.00 ? 69  ARG A HG2  3  
ATOM 5615  H HG3  . ARG A 1 69  ? 0.692   3.038   19.017  1.00 0.00 ? 69  ARG A HG3  3  
ATOM 5616  H HD2  . ARG A 1 69  ? -1.466  3.674   20.187  1.00 0.00 ? 69  ARG A HD2  3  
ATOM 5617  H HD3  . ARG A 1 69  ? -1.680  3.237   18.431  1.00 0.00 ? 69  ARG A HD3  3  
ATOM 5618  H HE   . ARG A 1 69  ? -2.046  1.003   20.393  1.00 0.00 ? 69  ARG A HE   3  
ATOM 5619  H HH11 . ARG A 1 69  ? -3.673  3.585   18.521  1.00 0.00 ? 69  ARG A HH11 3  
ATOM 5620  H HH12 . ARG A 1 69  ? -5.233  2.834   18.598  1.00 0.00 ? 69  ARG A HH12 3  
ATOM 5621  H HH21 . ARG A 1 69  ? -4.149  0.020   20.476  1.00 0.00 ? 69  ARG A HH21 3  
ATOM 5622  H HH22 . ARG A 1 69  ? -5.505  0.787   19.718  1.00 0.00 ? 69  ARG A HH22 3  
ATOM 5623  N N    . ALA A 1 70  ? 1.290   2.179   15.794  1.00 0.00 ? 70  ALA A N    3  
ATOM 5624  C CA   . ALA A 1 70  ? 1.841   3.267   14.980  1.00 0.00 ? 70  ALA A CA   3  
ATOM 5625  C C    . ALA A 1 70  ? 1.153   3.574   13.651  1.00 0.00 ? 70  ALA A C    3  
ATOM 5626  O O    . ALA A 1 70  ? 1.086   4.730   13.228  1.00 0.00 ? 70  ALA A O    3  
ATOM 5627  C CB   . ALA A 1 70  ? 3.324   3.032   14.740  1.00 0.00 ? 70  ALA A CB   3  
ATOM 5628  H H    . ALA A 1 70  ? 1.963   1.448   15.982  1.00 0.00 ? 70  ALA A H    3  
ATOM 5629  H HA   . ALA A 1 70  ? 1.757   4.168   15.576  1.00 0.00 ? 70  ALA A HA   3  
ATOM 5630  H HB1  . ALA A 1 70  ? 3.811   3.933   14.314  1.00 0.00 ? 70  ALA A HB1  3  
ATOM 5631  H HB2  . ALA A 1 70  ? 3.783   2.787   15.722  1.00 0.00 ? 70  ALA A HB2  3  
ATOM 5632  H HB3  . ALA A 1 70  ? 3.491   2.173   14.055  1.00 0.00 ? 70  ALA A HB3  3  
ATOM 5633  N N    . VAL A 1 71  ? 0.592   2.511   13.001  1.00 0.00 ? 71  VAL A N    3  
ATOM 5634  C CA   . VAL A 1 71  ? -0.273  2.503   11.807  1.00 0.00 ? 71  VAL A CA   3  
ATOM 5635  C C    . VAL A 1 71  ? -1.558  3.323   11.954  1.00 0.00 ? 71  VAL A C    3  
ATOM 5636  O O    . VAL A 1 71  ? -2.033  3.928   10.999  1.00 0.00 ? 71  VAL A O    3  
ATOM 5637  C CB   . VAL A 1 71  ? -0.486  1.125   11.191  1.00 0.00 ? 71  VAL A CB   3  
ATOM 5638  C CG1  . VAL A 1 71  ? -1.402  0.233   12.022  1.00 0.00 ? 71  VAL A CG1  3  
ATOM 5639  C CG2  . VAL A 1 71  ? -0.980  1.210   9.733   1.00 0.00 ? 71  VAL A CG2  3  
ATOM 5640  H H    . VAL A 1 71  ? 0.764   1.602   13.396  1.00 0.00 ? 71  VAL A H    3  
ATOM 5641  H HA   . VAL A 1 71  ? 0.299   3.031   11.058  1.00 0.00 ? 71  VAL A HA   3  
ATOM 5642  H HB   . VAL A 1 71  ? 0.510   0.629   11.210  1.00 0.00 ? 71  VAL A HB   3  
ATOM 5643  H HG11 . VAL A 1 71  ? -1.075  0.277   13.074  1.00 0.00 ? 71  VAL A HG11 3  
ATOM 5644  H HG12 . VAL A 1 71  ? -2.459  0.550   11.950  1.00 0.00 ? 71  VAL A HG12 3  
ATOM 5645  H HG13 . VAL A 1 71  ? -1.304  -0.810  11.649  1.00 0.00 ? 71  VAL A HG13 3  
ATOM 5646  H HG21 . VAL A 1 71  ? -0.361  1.917   9.146   1.00 0.00 ? 71  VAL A HG21 3  
ATOM 5647  H HG22 . VAL A 1 71  ? -0.935  0.207   9.256   1.00 0.00 ? 71  VAL A HG22 3  
ATOM 5648  H HG23 . VAL A 1 71  ? -2.035  1.555   9.700   1.00 0.00 ? 71  VAL A HG23 3  
ATOM 5649  N N    . ASP A 1 72  ? -2.125  3.419   13.201  1.00 0.00 ? 72  ASP A N    3  
ATOM 5650  C CA   . ASP A 1 72  ? -3.252  4.285   13.629  1.00 0.00 ? 72  ASP A CA   3  
ATOM 5651  C C    . ASP A 1 72  ? -2.999  5.783   13.311  1.00 0.00 ? 72  ASP A C    3  
ATOM 5652  O O    . ASP A 1 72  ? -3.855  6.497   12.797  1.00 0.00 ? 72  ASP A O    3  
ATOM 5653  C CB   . ASP A 1 72  ? -3.590  4.043   15.137  1.00 0.00 ? 72  ASP A CB   3  
ATOM 5654  C CG   . ASP A 1 72  ? -4.946  4.621   15.564  1.00 0.00 ? 72  ASP A CG   3  
ATOM 5655  O OD1  . ASP A 1 72  ? -5.979  4.194   14.984  1.00 0.00 ? 72  ASP A OD1  3  
ATOM 5656  O OD2  . ASP A 1 72  ? -4.958  5.490   16.476  1.00 0.00 ? 72  ASP A OD2  3  
ATOM 5657  H H    . ASP A 1 72  ? -1.679  2.896   13.931  1.00 0.00 ? 72  ASP A H    3  
ATOM 5658  H HA   . ASP A 1 72  ? -4.106  3.984   13.037  1.00 0.00 ? 72  ASP A HA   3  
ATOM 5659  H HB2  . ASP A 1 72  ? -3.623  2.943   15.311  1.00 0.00 ? 72  ASP A HB2  3  
ATOM 5660  H HB3  . ASP A 1 72  ? -2.784  4.442   15.789  1.00 0.00 ? 72  ASP A HB3  3  
ATOM 5661  N N    . PHE A 1 73  ? -1.726  6.243   13.503  1.00 0.00 ? 73  PHE A N    3  
ATOM 5662  C CA   . PHE A 1 73  ? -1.167  7.516   13.007  1.00 0.00 ? 73  PHE A CA   3  
ATOM 5663  C C    . PHE A 1 73  ? -1.055  7.576   11.449  1.00 0.00 ? 73  PHE A C    3  
ATOM 5664  O O    . PHE A 1 73  ? -1.517  8.536   10.828  1.00 0.00 ? 73  PHE A O    3  
ATOM 5665  C CB   . PHE A 1 73  ? 0.225   7.870   13.647  1.00 0.00 ? 73  PHE A CB   3  
ATOM 5666  C CG   . PHE A 1 73  ? 0.354   7.532   15.128  1.00 0.00 ? 73  PHE A CG   3  
ATOM 5667  C CD1  . PHE A 1 73  ? -0.721  7.640   15.996  1.00 0.00 ? 73  PHE A CD1  3  
ATOM 5668  C CD2  . PHE A 1 73  ? 1.569   7.097   15.660  1.00 0.00 ? 73  PHE A CD2  3  
ATOM 5669  C CE1  . PHE A 1 73  ? -0.629  7.215   17.305  1.00 0.00 ? 73  PHE A CE1  3  
ATOM 5670  C CE2  . PHE A 1 73  ? 1.665   6.684   16.975  1.00 0.00 ? 73  PHE A CE2  3  
ATOM 5671  C CZ   . PHE A 1 73  ? 0.554   6.703   17.790  1.00 0.00 ? 73  PHE A CZ   3  
ATOM 5672  H H    . PHE A 1 73  ? -1.098  5.647   14.014  1.00 0.00 ? 73  PHE A H    3  
ATOM 5673  H HA   . PHE A 1 73  ? -1.865  8.298   13.280  1.00 0.00 ? 73  PHE A HA   3  
ATOM 5674  H HB2  . PHE A 1 73  ? 1.016   7.299   13.115  1.00 0.00 ? 73  PHE A HB2  3  
ATOM 5675  H HB3  . PHE A 1 73  ? 0.441   8.955   13.535  1.00 0.00 ? 73  PHE A HB3  3  
ATOM 5676  H HD1  . PHE A 1 73  ? -1.673  8.017   15.643  1.00 0.00 ? 73  PHE A HD1  3  
ATOM 5677  H HD2  . PHE A 1 73  ? 2.456   7.034   15.044  1.00 0.00 ? 73  PHE A HD2  3  
ATOM 5678  H HE1  . PHE A 1 73  ? -1.497  7.272   17.949  1.00 0.00 ? 73  PHE A HE1  3  
ATOM 5679  H HE2  . PHE A 1 73  ? 2.610   6.332   17.371  1.00 0.00 ? 73  PHE A HE2  3  
ATOM 5680  H HZ   . PHE A 1 73  ? 0.618   6.342   18.808  1.00 0.00 ? 73  PHE A HZ   3  
ATOM 5681  N N    . LEU A 1 74  ? -0.450  6.541   10.753  1.00 0.00 ? 74  LEU A N    3  
ATOM 5682  C CA   . LEU A 1 74  ? -0.351  6.365   9.249   1.00 0.00 ? 74  LEU A CA   3  
ATOM 5683  C C    . LEU A 1 74  ? -1.697  6.494   8.489   1.00 0.00 ? 74  LEU A C    3  
ATOM 5684  O O    . LEU A 1 74  ? -1.779  7.048   7.391   1.00 0.00 ? 74  LEU A O    3  
ATOM 5685  C CB   . LEU A 1 74  ? 0.285   4.985   8.882   1.00 0.00 ? 74  LEU A CB   3  
ATOM 5686  C CG   . LEU A 1 74  ? 1.055   4.823   7.534   1.00 0.00 ? 74  LEU A CG   3  
ATOM 5687  C CD1  . LEU A 1 74  ? 0.418   5.339   6.229   1.00 0.00 ? 74  LEU A CD1  3  
ATOM 5688  C CD2  . LEU A 1 74  ? 2.500   5.346   7.675   1.00 0.00 ? 74  LEU A CD2  3  
ATOM 5689  H H    . LEU A 1 74  ? -0.047  5.822   11.338  1.00 0.00 ? 74  LEU A H    3  
ATOM 5690  H HA   . LEU A 1 74  ? 0.287   7.147   8.817   1.00 0.00 ? 74  LEU A HA   3  
ATOM 5691  H HB2  . LEU A 1 74  ? 1.107   4.775   9.625   1.00 0.00 ? 74  LEU A HB2  3  
ATOM 5692  H HB3  . LEU A 1 74  ? -0.517  4.190   8.944   1.00 0.00 ? 74  LEU A HB3  3  
ATOM 5693  H HG   . LEU A 1 74  ? 1.106   3.712   7.402   1.00 0.00 ? 74  LEU A HG   3  
ATOM 5694  H HD11 . LEU A 1 74  ? -0.608  4.930   6.107   1.00 0.00 ? 74  LEU A HD11 3  
ATOM 5695  H HD12 . LEU A 1 74  ? 0.371   6.447   6.198   1.00 0.00 ? 74  LEU A HD12 3  
ATOM 5696  H HD13 . LEU A 1 74  ? 1.016   5.009   5.352   1.00 0.00 ? 74  LEU A HD13 3  
ATOM 5697  H HD21 . LEU A 1 74  ? 3.014   4.865   8.535   1.00 0.00 ? 74  LEU A HD21 3  
ATOM 5698  H HD22 . LEU A 1 74  ? 3.083   5.128   6.756   1.00 0.00 ? 74  LEU A HD22 3  
ATOM 5699  H HD23 . LEU A 1 74  ? 2.508   6.446   7.836   1.00 0.00 ? 74  LEU A HD23 3  
ATOM 5700  N N    . ALA A 1 75  ? -2.824  6.043   9.110   1.00 0.00 ? 75  ALA A N    3  
ATOM 5701  C CA   . ALA A 1 75  ? -4.203  6.201   8.691   1.00 0.00 ? 75  ALA A CA   3  
ATOM 5702  C C    . ALA A 1 75  ? -4.735  7.646   8.510   1.00 0.00 ? 75  ALA A C    3  
ATOM 5703  O O    . ALA A 1 75  ? -5.799  7.836   7.924   1.00 0.00 ? 75  ALA A O    3  
ATOM 5704  C CB   . ALA A 1 75  ? -5.066  5.318   9.598   1.00 0.00 ? 75  ALA A CB   3  
ATOM 5705  H H    . ALA A 1 75  ? -2.773  5.548   9.981   1.00 0.00 ? 75  ALA A H    3  
ATOM 5706  H HA   . ALA A 1 75  ? -4.269  5.763   7.703   1.00 0.00 ? 75  ALA A HA   3  
ATOM 5707  H HB1  . ALA A 1 75  ? -6.112  5.247   9.232   1.00 0.00 ? 75  ALA A HB1  3  
ATOM 5708  H HB2  . ALA A 1 75  ? -4.606  4.299   9.587   1.00 0.00 ? 75  ALA A HB2  3  
ATOM 5709  H HB3  . ALA A 1 75  ? -5.048  5.690   10.642  1.00 0.00 ? 75  ALA A HB3  3  
ATOM 5710  N N    . ALA A 1 76  ? -3.985  8.703   8.969   1.00 0.00 ? 76  ALA A N    3  
ATOM 5711  C CA   . ALA A 1 76  ? -4.269  10.109  8.703   1.00 0.00 ? 76  ALA A CA   3  
ATOM 5712  C C    . ALA A 1 76  ? -3.871  10.571  7.273   1.00 0.00 ? 76  ALA A C    3  
ATOM 5713  O O    . ALA A 1 76  ? -4.700  11.104  6.550   1.00 0.00 ? 76  ALA A O    3  
ATOM 5714  C CB   . ALA A 1 76  ? -3.607  10.986  9.789   1.00 0.00 ? 76  ALA A CB   3  
ATOM 5715  H H    . ALA A 1 76  ? -3.134  8.555   9.480   1.00 0.00 ? 76  ALA A H    3  
ATOM 5716  H HA   . ALA A 1 76  ? -5.338  10.264  8.776   1.00 0.00 ? 76  ALA A HA   3  
ATOM 5717  H HB1  . ALA A 1 76  ? -3.991  10.681  10.788  1.00 0.00 ? 76  ALA A HB1  3  
ATOM 5718  H HB2  . ALA A 1 76  ? -3.845  12.063  9.650   1.00 0.00 ? 76  ALA A HB2  3  
ATOM 5719  H HB3  . ALA A 1 76  ? -2.505  10.853  9.800   1.00 0.00 ? 76  ALA A HB3  3  
ATOM 5720  N N    . ASN A 1 77  ? -2.610  10.366  6.790   1.00 0.00 ? 77  ASN A N    3  
ATOM 5721  C CA   . ASN A 1 77  ? -2.227  10.731  5.411   1.00 0.00 ? 77  ASN A CA   3  
ATOM 5722  C C    . ASN A 1 77  ? -1.093  9.838   4.913   1.00 0.00 ? 77  ASN A C    3  
ATOM 5723  O O    . ASN A 1 77  ? -0.340  9.308   5.728   1.00 0.00 ? 77  ASN A O    3  
ATOM 5724  C CB   . ASN A 1 77  ? -1.958  12.265  5.144   1.00 0.00 ? 77  ASN A CB   3  
ATOM 5725  C CG   . ASN A 1 77  ? -0.674  12.880  5.736   1.00 0.00 ? 77  ASN A CG   3  
ATOM 5726  O OD1  . ASN A 1 77  ? 0.149   13.456  5.022   1.00 0.00 ? 77  ASN A OD1  3  
ATOM 5727  N ND2  . ASN A 1 77  ? -0.534  12.798  7.076   1.00 0.00 ? 77  ASN A ND2  3  
ATOM 5728  H H    . ASN A 1 77  ? -1.923  9.903   7.353   1.00 0.00 ? 77  ASN A H    3  
ATOM 5729  H HA   . ASN A 1 77  ? -3.061  10.466  4.768   1.00 0.00 ? 77  ASN A HA   3  
ATOM 5730  H HB2  . ASN A 1 77  ? -1.914  12.444  4.047   1.00 0.00 ? 77  ASN A HB2  3  
ATOM 5731  H HB3  . ASN A 1 77  ? -2.820  12.849  5.530   1.00 0.00 ? 77  ASN A HB3  3  
ATOM 5732  H HD21 . ASN A 1 77  ? -1.278  12.405  7.609   1.00 0.00 ? 77  ASN A HD21 3  
ATOM 5733  H HD22 . ASN A 1 77  ? 0.238   13.286  7.478   1.00 0.00 ? 77  ASN A HD22 3  
ATOM 5734  N N    . GLU A 1 78  ? -0.963  9.674   3.557   1.00 0.00 ? 78  GLU A N    3  
ATOM 5735  C CA   . GLU A 1 78  ? 0.044   8.857   2.868   1.00 0.00 ? 78  GLU A CA   3  
ATOM 5736  C C    . GLU A 1 78  ? -0.356  7.379   2.708   1.00 0.00 ? 78  GLU A C    3  
ATOM 5737  O O    . GLU A 1 78  ? 0.479   6.476   2.650   1.00 0.00 ? 78  GLU A O    3  
ATOM 5738  C CB   . GLU A 1 78  ? 1.500   9.041   3.405   1.00 0.00 ? 78  GLU A CB   3  
ATOM 5739  C CG   . GLU A 1 78  ? 2.624   8.734   2.396   1.00 0.00 ? 78  GLU A CG   3  
ATOM 5740  C CD   . GLU A 1 78  ? 3.974   8.883   3.094   1.00 0.00 ? 78  GLU A CD   3  
ATOM 5741  O OE1  . GLU A 1 78  ? 4.256   10.000  3.601   1.00 0.00 ? 78  GLU A OE1  3  
ATOM 5742  O OE2  . GLU A 1 78  ? 4.738   7.881   3.135   1.00 0.00 ? 78  GLU A OE2  3  
ATOM 5743  H H    . GLU A 1 78  ? -1.589  10.168  2.959   1.00 0.00 ? 78  GLU A H    3  
ATOM 5744  H HA   . GLU A 1 78  ? 0.064   9.247   1.860   1.00 0.00 ? 78  GLU A HA   3  
ATOM 5745  H HB2  . GLU A 1 78  ? 1.608   10.110  3.703   1.00 0.00 ? 78  GLU A HB2  3  
ATOM 5746  H HB3  . GLU A 1 78  ? 1.636   8.436   4.330   1.00 0.00 ? 78  GLU A HB3  3  
ATOM 5747  H HG2  . GLU A 1 78  ? 2.531   7.701   1.999   1.00 0.00 ? 78  GLU A HG2  3  
ATOM 5748  H HG3  . GLU A 1 78  ? 2.566   9.443   1.543   1.00 0.00 ? 78  GLU A HG3  3  
ATOM 5749  N N    . SER A 1 79  ? -1.687  7.102   2.561   1.00 0.00 ? 79  SER A N    3  
ATOM 5750  C CA   . SER A 1 79  ? -2.303  5.783   2.327   1.00 0.00 ? 79  SER A CA   3  
ATOM 5751  C C    . SER A 1 79  ? -2.459  5.529   0.842   1.00 0.00 ? 79  SER A C    3  
ATOM 5752  O O    . SER A 1 79  ? -3.533  5.219   0.334   1.00 0.00 ? 79  SER A O    3  
ATOM 5753  C CB   . SER A 1 79  ? -3.710  5.606   2.964   1.00 0.00 ? 79  SER A CB   3  
ATOM 5754  O OG   . SER A 1 79  ? -3.602  5.414   4.364   1.00 0.00 ? 79  SER A OG   3  
ATOM 5755  H H    . SER A 1 79  ? -2.331  7.858   2.600   1.00 0.00 ? 79  SER A H    3  
ATOM 5756  H HA   . SER A 1 79  ? -1.661  5.004   2.719   1.00 0.00 ? 79  SER A HA   3  
ATOM 5757  H HB2  . SER A 1 79  ? -4.365  6.478   2.747   1.00 0.00 ? 79  SER A HB2  3  
ATOM 5758  H HB3  . SER A 1 79  ? -4.221  4.686   2.598   1.00 0.00 ? 79  SER A HB3  3  
ATOM 5759  H HG   . SER A 1 79  ? -3.353  6.245   4.780   1.00 0.00 ? 79  SER A HG   3  
ATOM 5760  N N    . ARG A 1 80  ? -1.338  5.661   0.105   1.00 0.00 ? 80  ARG A N    3  
ATOM 5761  C CA   . ARG A 1 80  ? -1.213  5.474   -1.337  1.00 0.00 ? 80  ARG A CA   3  
ATOM 5762  C C    . ARG A 1 80  ? -0.715  4.080   -1.704  1.00 0.00 ? 80  ARG A C    3  
ATOM 5763  O O    . ARG A 1 80  ? -0.514  3.770   -2.875  1.00 0.00 ? 80  ARG A O    3  
ATOM 5764  C CB   . ARG A 1 80  ? -0.316  6.588   -1.964  1.00 0.00 ? 80  ARG A CB   3  
ATOM 5765  C CG   . ARG A 1 80  ? 1.146   6.633   -1.466  1.00 0.00 ? 80  ARG A CG   3  
ATOM 5766  C CD   . ARG A 1 80  ? 1.846   7.962   -1.804  1.00 0.00 ? 80  ARG A CD   3  
ATOM 5767  N NE   . ARG A 1 80  ? 1.751   8.202   -3.288  1.00 0.00 ? 80  ARG A NE   3  
ATOM 5768  C CZ   . ARG A 1 80  ? 2.213   9.339   -3.898  1.00 0.00 ? 80  ARG A CZ   3  
ATOM 5769  N NH1  . ARG A 1 80  ? 2.801   10.333  -3.170  1.00 0.00 ? 80  ARG A NH1  3  
ATOM 5770  N NH2  . ARG A 1 80  ? 2.095   9.470   -5.251  1.00 0.00 ? 80  ARG A NH2  3  
ATOM 5771  H H    . ARG A 1 80  ? -0.502  5.925   0.588   1.00 0.00 ? 80  ARG A H    3  
ATOM 5772  H HA   . ARG A 1 80  ? -2.209  5.522   -1.780  1.00 0.00 ? 80  ARG A HA   3  
ATOM 5773  H HB2  . ARG A 1 80  ? -0.301  6.506   -3.077  1.00 0.00 ? 80  ARG A HB2  3  
ATOM 5774  H HB3  . ARG A 1 80  ? -0.769  7.578   -1.715  1.00 0.00 ? 80  ARG A HB3  3  
ATOM 5775  H HG2  . ARG A 1 80  ? 1.179   6.509   -0.362  1.00 0.00 ? 80  ARG A HG2  3  
ATOM 5776  H HG3  . ARG A 1 80  ? 1.718   5.793   -1.922  1.00 0.00 ? 80  ARG A HG3  3  
ATOM 5777  H HD2  . ARG A 1 80  ? 1.342   8.796   -1.268  1.00 0.00 ? 80  ARG A HD2  3  
ATOM 5778  H HD3  . ARG A 1 80  ? 2.917   7.916   -1.507  1.00 0.00 ? 80  ARG A HD3  3  
ATOM 5779  H HE   . ARG A 1 80  ? 1.329   7.495   -3.855  1.00 0.00 ? 80  ARG A HE   3  
ATOM 5780  H HH11 . ARG A 1 80  ? 2.892   10.238  -2.179  1.00 0.00 ? 80  ARG A HH11 3  
ATOM 5781  H HH12 . ARG A 1 80  ? 3.138   11.155  -3.628  1.00 0.00 ? 80  ARG A HH12 3  
ATOM 5782  H HH21 . ARG A 1 80  ? 1.668   8.742   -5.788  1.00 0.00 ? 80  ARG A HH21 3  
ATOM 5783  H HH22 . ARG A 1 80  ? 2.433   10.294  -5.705  1.00 0.00 ? 80  ARG A HH22 3  
ATOM 5784  N N    . VAL A 1 81  ? -0.536  3.189   -0.691  1.00 0.00 ? 81  VAL A N    3  
ATOM 5785  C CA   . VAL A 1 81  ? -0.243  1.763   -0.836  1.00 0.00 ? 81  VAL A CA   3  
ATOM 5786  C C    . VAL A 1 81  ? -1.506  1.093   -0.329  1.00 0.00 ? 81  VAL A C    3  
ATOM 5787  O O    . VAL A 1 81  ? -1.935  1.350   0.796   1.00 0.00 ? 81  VAL A O    3  
ATOM 5788  C CB   . VAL A 1 81  ? 1.064   1.278   -0.188  1.00 0.00 ? 81  VAL A CB   3  
ATOM 5789  C CG1  . VAL A 1 81  ? 1.359   -0.224  -0.404  1.00 0.00 ? 81  VAL A CG1  3  
ATOM 5790  C CG2  . VAL A 1 81  ? 2.212   2.000   -0.902  1.00 0.00 ? 81  VAL A CG2  3  
ATOM 5791  H H    . VAL A 1 81  ? -0.701  3.480   0.247   1.00 0.00 ? 81  VAL A H    3  
ATOM 5792  H HA   . VAL A 1 81  ? -0.182  1.542   -1.875  1.00 0.00 ? 81  VAL A HA   3  
ATOM 5793  H HB   . VAL A 1 81  ? 1.072   1.506   0.900   1.00 0.00 ? 81  VAL A HB   3  
ATOM 5794  H HG11 . VAL A 1 81  ? 0.456   -0.848  -0.526  1.00 0.00 ? 81  VAL A HG11 3  
ATOM 5795  H HG12 . VAL A 1 81  ? 1.963   -0.369  -1.339  1.00 0.00 ? 81  VAL A HG12 3  
ATOM 5796  H HG13 . VAL A 1 81  ? 1.973   -0.638  0.418   1.00 0.00 ? 81  VAL A HG13 3  
ATOM 5797  H HG21 . VAL A 1 81  ? 1.934   2.188   -1.961  1.00 0.00 ? 81  VAL A HG21 3  
ATOM 5798  H HG22 . VAL A 1 81  ? 2.468   2.973   -0.452  1.00 0.00 ? 81  VAL A HG22 3  
ATOM 5799  H HG23 . VAL A 1 81  ? 3.100   1.309   -0.941  1.00 0.00 ? 81  VAL A HG23 3  
ATOM 5800  N N    . ARG A 1 82  ? -2.182  0.262   -1.171  1.00 0.00 ? 82  ARG A N    3  
ATOM 5801  C CA   . ARG A 1 82  ? -3.490  -0.320  -0.918  1.00 0.00 ? 82  ARG A CA   3  
ATOM 5802  C C    . ARG A 1 82  ? -3.434  -1.743  -0.407  1.00 0.00 ? 82  ARG A C    3  
ATOM 5803  O O    . ARG A 1 82  ? -2.484  -2.481  -0.679  1.00 0.00 ? 82  ARG A O    3  
ATOM 5804  C CB   . ARG A 1 82  ? -4.369  -0.279  -2.204  1.00 0.00 ? 82  ARG A CB   3  
ATOM 5805  C CG   . ARG A 1 82  ? -3.905  -1.179  -3.371  1.00 0.00 ? 82  ARG A CG   3  
ATOM 5806  C CD   . ARG A 1 82  ? -5.028  -1.522  -4.362  1.00 0.00 ? 82  ARG A CD   3  
ATOM 5807  N NE   . ARG A 1 82  ? -5.991  -2.458  -3.680  1.00 0.00 ? 82  ARG A NE   3  
ATOM 5808  C CZ   . ARG A 1 82  ? -7.009  -3.096  -4.336  1.00 0.00 ? 82  ARG A CZ   3  
ATOM 5809  N NH1  . ARG A 1 82  ? -7.178  -2.949  -5.682  1.00 0.00 ? 82  ARG A NH1  3  
ATOM 5810  N NH2  . ARG A 1 82  ? -7.863  -3.895  -3.630  1.00 0.00 ? 82  ARG A NH2  3  
ATOM 5811  H H    . ARG A 1 82  ? -1.815  0.003   -2.069  1.00 0.00 ? 82  ARG A H    3  
ATOM 5812  H HA   . ARG A 1 82  ? -3.986  0.270   -0.158  1.00 0.00 ? 82  ARG A HA   3  
ATOM 5813  H HB2  . ARG A 1 82  ? -5.419  -0.541  -1.964  1.00 0.00 ? 82  ARG A HB2  3  
ATOM 5814  H HB3  . ARG A 1 82  ? -4.399  0.771   -2.570  1.00 0.00 ? 82  ARG A HB3  3  
ATOM 5815  H HG2  . ARG A 1 82  ? -3.074  -0.647  -3.871  1.00 0.00 ? 82  ARG A HG2  3  
ATOM 5816  H HG3  . ARG A 1 82  ? -3.484  -2.151  -3.031  1.00 0.00 ? 82  ARG A HG3  3  
ATOM 5817  H HD2  . ARG A 1 82  ? -5.578  -0.606  -4.662  1.00 0.00 ? 82  ARG A HD2  3  
ATOM 5818  H HD3  . ARG A 1 82  ? -4.598  -2.033  -5.250  1.00 0.00 ? 82  ARG A HD3  3  
ATOM 5819  H HE   . ARG A 1 82  ? -5.895  -2.600  -2.695  1.00 0.00 ? 82  ARG A HE   3  
ATOM 5820  H HH11 . ARG A 1 82  ? -6.551  -2.370  -6.203  1.00 0.00 ? 82  ARG A HH11 3  
ATOM 5821  H HH12 . ARG A 1 82  ? -7.924  -3.425  -6.148  1.00 0.00 ? 82  ARG A HH12 3  
ATOM 5822  H HH21 . ARG A 1 82  ? -7.738  -4.010  -2.645  1.00 0.00 ? 82  ARG A HH21 3  
ATOM 5823  H HH22 . ARG A 1 82  ? -8.608  -4.369  -4.099  1.00 0.00 ? 82  ARG A HH22 3  
ATOM 5824  N N    . THR A 1 83  ? -4.498  -2.159  0.327   1.00 0.00 ? 83  THR A N    3  
ATOM 5825  C CA   . THR A 1 83  ? -4.679  -3.488  0.932   1.00 0.00 ? 83  THR A CA   3  
ATOM 5826  C C    . THR A 1 83  ? -5.576  -4.353  0.054   1.00 0.00 ? 83  THR A C    3  
ATOM 5827  O O    . THR A 1 83  ? -6.689  -3.963  -0.303  1.00 0.00 ? 83  THR A O    3  
ATOM 5828  C CB   . THR A 1 83  ? -5.246  -3.511  2.375   1.00 0.00 ? 83  THR A CB   3  
ATOM 5829  O OG1  . THR A 1 83  ? -5.050  -2.274  3.054   1.00 0.00 ? 83  THR A OG1  3  
ATOM 5830  C CG2  . THR A 1 83  ? -4.532  -4.613  3.180   1.00 0.00 ? 83  THR A CG2  3  
ATOM 5831  H H    . THR A 1 83  ? -5.233  -1.505  0.471   1.00 0.00 ? 83  THR A H    3  
ATOM 5832  H HA   . THR A 1 83  ? -3.706  -3.967  0.974   1.00 0.00 ? 83  THR A HA   3  
ATOM 5833  H HB   . THR A 1 83  ? -6.335  -3.747  2.417   1.00 0.00 ? 83  THR A HB   3  
ATOM 5834  H HG1  . THR A 1 83  ? -5.307  -2.423  3.971   1.00 0.00 ? 83  THR A HG1  3  
ATOM 5835  H HG21 . THR A 1 83  ? -3.432  -4.460  3.168   1.00 0.00 ? 83  THR A HG21 3  
ATOM 5836  H HG22 . THR A 1 83  ? -4.876  -4.625  4.236   1.00 0.00 ? 83  THR A HG22 3  
ATOM 5837  H HG23 . THR A 1 83  ? -4.752  -5.606  2.737   1.00 0.00 ? 83  THR A HG23 3  
ATOM 5838  N N    . GLU A 1 84  ? -5.104  -5.575  -0.298  1.00 0.00 ? 84  GLU A N    3  
ATOM 5839  C CA   . GLU A 1 84  ? -5.816  -6.490  -1.175  1.00 0.00 ? 84  GLU A CA   3  
ATOM 5840  C C    . GLU A 1 84  ? -5.723  -7.952  -0.730  1.00 0.00 ? 84  GLU A C    3  
ATOM 5841  O O    . GLU A 1 84  ? -4.637  -8.450  -0.421  1.00 0.00 ? 84  GLU A O    3  
ATOM 5842  C CB   . GLU A 1 84  ? -5.171  -6.352  -2.592  1.00 0.00 ? 84  GLU A CB   3  
ATOM 5843  C CG   . GLU A 1 84  ? -5.914  -7.072  -3.739  1.00 0.00 ? 84  GLU A CG   3  
ATOM 5844  C CD   . GLU A 1 84  ? -5.192  -6.847  -5.070  1.00 0.00 ? 84  GLU A CD   3  
ATOM 5845  O OE1  . GLU A 1 84  ? -4.023  -6.377  -5.056  1.00 0.00 ? 84  GLU A OE1  3  
ATOM 5846  O OE2  . GLU A 1 84  ? -5.805  -7.159  -6.126  1.00 0.00 ? 84  GLU A OE2  3  
ATOM 5847  H H    . GLU A 1 84  ? -4.186  -5.871  -0.011  1.00 0.00 ? 84  GLU A H    3  
ATOM 5848  H HA   . GLU A 1 84  ? -6.868  -6.235  -1.237  1.00 0.00 ? 84  GLU A HA   3  
ATOM 5849  H HB2  . GLU A 1 84  ? -5.213  -5.244  -2.848  1.00 0.00 ? 84  GLU A HB2  3  
ATOM 5850  H HB3  . GLU A 1 84  ? -4.111  -6.758  -2.537  1.00 0.00 ? 84  GLU A HB3  3  
ATOM 5851  H HG2  . GLU A 1 84  ? -5.906  -8.188  -3.550  1.00 0.00 ? 84  GLU A HG2  3  
ATOM 5852  H HG3  . GLU A 1 84  ? -6.945  -6.606  -3.819  1.00 0.00 ? 84  GLU A HG3  3  
ATOM 5853  N N    . THR A 1 85  ? -6.862  -8.711  -0.815  1.00 0.00 ? 85  THR A N    3  
ATOM 5854  C CA   . THR A 1 85  ? -6.971  -10.169 -0.718  1.00 0.00 ? 85  THR A CA   3  
ATOM 5855  C C    . THR A 1 85  ? -6.642  -10.689 -2.120  1.00 0.00 ? 85  THR A C    3  
ATOM 5856  O O    . THR A 1 85  ? -7.385  -10.470 -3.079  1.00 0.00 ? 85  THR A O    3  
ATOM 5857  C CB   . THR A 1 85  ? -8.398  -10.602 -0.343  1.00 0.00 ? 85  THR A CB   3  
ATOM 5858  O OG1  . THR A 1 85  ? -9.340  -9.575  -0.646  1.00 0.00 ? 85  THR A OG1  3  
ATOM 5859  C CG2  . THR A 1 85  ? -8.461  -10.839 1.170   1.00 0.00 ? 85  THR A CG2  3  
ATOM 5860  H H    . THR A 1 85  ? -7.758  -8.336  -1.056  1.00 0.00 ? 85  THR A H    3  
ATOM 5861  H HA   . THR A 1 85  ? -6.257  -10.562 -0.008  1.00 0.00 ? 85  THR A HA   3  
ATOM 5862  H HB   . THR A 1 85  ? -8.715  -11.554 -0.838  1.00 0.00 ? 85  THR A HB   3  
ATOM 5863  H HG1  . THR A 1 85  ? -10.187 -9.844  -0.273  1.00 0.00 ? 85  THR A HG1  3  
ATOM 5864  H HG21 . THR A 1 85  ? -7.713  -11.608 1.461   1.00 0.00 ? 85  THR A HG21 3  
ATOM 5865  H HG22 . THR A 1 85  ? -8.252  -9.892  1.709   1.00 0.00 ? 85  THR A HG22 3  
ATOM 5866  H HG23 . THR A 1 85  ? -9.466  -11.205 1.469   1.00 0.00 ? 85  THR A HG23 3  
ATOM 5867  N N    . ARG A 1 86  ? -5.480  -11.361 -2.288  1.00 0.00 ? 86  ARG A N    3  
ATOM 5868  C CA   . ARG A 1 86  ? -4.998  -11.730 -3.616  1.00 0.00 ? 86  ARG A CA   3  
ATOM 5869  C C    . ARG A 1 86  ? -4.593  -13.184 -3.591  1.00 0.00 ? 86  ARG A C    3  
ATOM 5870  O O    . ARG A 1 86  ? -4.016  -13.639 -2.603  1.00 0.00 ? 86  ARG A O    3  
ATOM 5871  C CB   . ARG A 1 86  ? -3.839  -10.790 -4.055  1.00 0.00 ? 86  ARG A CB   3  
ATOM 5872  C CG   . ARG A 1 86  ? -3.341  -10.966 -5.507  1.00 0.00 ? 86  ARG A CG   3  
ATOM 5873  C CD   . ARG A 1 86  ? -4.426  -10.742 -6.576  1.00 0.00 ? 86  ARG A CD   3  
ATOM 5874  N NE   . ARG A 1 86  ? -3.825  -10.982 -7.938  1.00 0.00 ? 86  ARG A NE   3  
ATOM 5875  C CZ   . ARG A 1 86  ? -3.944  -12.152 -8.641  1.00 0.00 ? 86  ARG A CZ   3  
ATOM 5876  N NH1  . ARG A 1 86  ? -4.679  -13.197 -8.162  1.00 0.00 ? 86  ARG A NH1  3  
ATOM 5877  N NH2  . ARG A 1 86  ? -3.315  -12.271 -9.847  1.00 0.00 ? 86  ARG A NH2  3  
ATOM 5878  H H    . ARG A 1 86  ? -4.864  -11.562 -1.520  1.00 0.00 ? 86  ARG A H    3  
ATOM 5879  H HA   . ARG A 1 86  ? -5.792  -11.624 -4.344  1.00 0.00 ? 86  ARG A HA   3  
ATOM 5880  H HB2  . ARG A 1 86  ? -4.301  -9.737  -4.043  1.00 0.00 ? 86  ARG A HB2  3  
ATOM 5881  H HB3  . ARG A 1 86  ? -2.945  -10.977 -3.358  1.00 0.00 ? 86  ARG A HB3  3  
ATOM 5882  H HG2  . ARG A 1 86  ? -2.554  -10.183 -5.667  1.00 0.00 ? 86  ARG A HG2  3  
ATOM 5883  H HG3  . ARG A 1 86  ? -2.909  -11.996 -5.622  1.00 0.00 ? 86  ARG A HG3  3  
ATOM 5884  H HD2  . ARG A 1 86  ? -5.306  -11.401 -6.415  1.00 0.00 ? 86  ARG A HD2  3  
ATOM 5885  H HD3  . ARG A 1 86  ? -4.766  -9.685  -6.544  1.00 0.00 ? 86  ARG A HD3  3  
ATOM 5886  H HE   . ARG A 1 86  ? -3.278  -10.247 -8.338  1.00 0.00 ? 86  ARG A HE   3  
ATOM 5887  H HH11 . ARG A 1 86  ? -5.140  -13.118 -7.278  1.00 0.00 ? 86  ARG A HH11 3  
ATOM 5888  H HH12 . ARG A 1 86  ? -4.750  -14.041 -8.691  1.00 0.00 ? 86  ARG A HH12 3  
ATOM 5889  H HH21 . ARG A 1 86  ? -2.775  -11.510 -10.206 1.00 0.00 ? 86  ARG A HH21 3  
ATOM 5890  H HH22 . ARG A 1 86  ? -3.393  -13.119 -10.371 1.00 0.00 ? 86  ARG A HH22 3  
ATOM 5891  N N    . ARG A 1 87  ? -4.910  -13.949 -4.678  1.00 0.00 ? 87  ARG A N    3  
ATOM 5892  C CA   . ARG A 1 87  ? -4.705  -15.390 -4.798  1.00 0.00 ? 87  ARG A CA   3  
ATOM 5893  C C    . ARG A 1 87  ? -3.364  -15.772 -5.421  1.00 0.00 ? 87  ARG A C    3  
ATOM 5894  O O    . ARG A 1 87  ? -3.095  -15.444 -6.574  1.00 0.00 ? 87  ARG A O    3  
ATOM 5895  C CB   . ARG A 1 87  ? -5.861  -16.059 -5.584  1.00 0.00 ? 87  ARG A CB   3  
ATOM 5896  C CG   . ARG A 1 87  ? -5.938  -17.588 -5.381  1.00 0.00 ? 87  ARG A CG   3  
ATOM 5897  C CD   . ARG A 1 87  ? -7.205  -18.244 -5.963  1.00 0.00 ? 87  ARG A CD   3  
ATOM 5898  N NE   . ARG A 1 87  ? -8.436  -17.691 -5.285  1.00 0.00 ? 87  ARG A NE   3  
ATOM 5899  C CZ   . ARG A 1 87  ? -8.871  -18.073 -4.042  1.00 0.00 ? 87  ARG A CZ   3  
ATOM 5900  N NH1  . ARG A 1 87  ? -8.227  -19.043 -3.332  1.00 0.00 ? 87  ARG A NH1  3  
ATOM 5901  N NH2  . ARG A 1 87  ? -9.966  -17.462 -3.501  1.00 0.00 ? 87  ARG A NH2  3  
ATOM 5902  H H    . ARG A 1 87  ? -5.327  -13.509 -5.468  1.00 0.00 ? 87  ARG A H    3  
ATOM 5903  H HA   . ARG A 1 87  ? -4.770  -15.813 -3.810  1.00 0.00 ? 87  ARG A HA   3  
ATOM 5904  H HB2  . ARG A 1 87  ? -6.804  -15.623 -5.182  1.00 0.00 ? 87  ARG A HB2  3  
ATOM 5905  H HB3  . ARG A 1 87  ? -5.825  -15.812 -6.668  1.00 0.00 ? 87  ARG A HB3  3  
ATOM 5906  H HG2  . ARG A 1 87  ? -5.040  -18.087 -5.823  1.00 0.00 ? 87  ARG A HG2  3  
ATOM 5907  H HG3  . ARG A 1 87  ? -5.928  -17.783 -4.282  1.00 0.00 ? 87  ARG A HG3  3  
ATOM 5908  H HD2  . ARG A 1 87  ? -7.285  -18.012 -7.046  1.00 0.00 ? 87  ARG A HD2  3  
ATOM 5909  H HD3  . ARG A 1 87  ? -7.172  -19.348 -5.837  1.00 0.00 ? 87  ARG A HD3  3  
ATOM 5910  H HE   . ARG A 1 87  ? -8.948  -16.977 -5.763  1.00 0.00 ? 87  ARG A HE   3  
ATOM 5911  H HH11 . ARG A 1 87  ? -7.419  -19.491 -3.718  1.00 0.00 ? 87  ARG A HH11 3  
ATOM 5912  H HH12 . ARG A 1 87  ? -8.558  -19.302 -2.424  1.00 0.00 ? 87  ARG A HH12 3  
ATOM 5913  H HH21 . ARG A 1 87  ? -10.442 -16.746 -4.012  1.00 0.00 ? 87  ARG A HH21 3  
ATOM 5914  H HH22 . ARG A 1 87  ? -10.287 -17.727 -2.592  1.00 0.00 ? 87  ARG A HH22 3  
ATOM 5915  N N    . ILE A 1 88  ? -2.482  -16.477 -4.669  1.00 0.00 ? 88  ILE A N    3  
ATOM 5916  C CA   . ILE A 1 88  ? -1.155  -16.887 -5.135  1.00 0.00 ? 88  ILE A CA   3  
ATOM 5917  C C    . ILE A 1 88  ? -0.940  -18.336 -4.743  1.00 0.00 ? 88  ILE A C    3  
ATOM 5918  O O    . ILE A 1 88  ? -1.089  -18.702 -3.581  1.00 0.00 ? 88  ILE A O    3  
ATOM 5919  C CB   . ILE A 1 88  ? -0.003  -15.982 -4.659  1.00 0.00 ? 88  ILE A CB   3  
ATOM 5920  C CG1  . ILE A 1 88  ? -0.119  -15.498 -3.185  1.00 0.00 ? 88  ILE A CG1  3  
ATOM 5921  C CG2  . ILE A 1 88  ? 0.092   -14.811 -5.660  1.00 0.00 ? 88  ILE A CG2  3  
ATOM 5922  C CD1  . ILE A 1 88  ? -0.731  -14.095 -3.002  1.00 0.00 ? 88  ILE A CD1  3  
ATOM 5923  H H    . ILE A 1 88  ? -2.725  -16.739 -3.713  1.00 0.00 ? 88  ILE A H    3  
ATOM 5924  H HA   . ILE A 1 88  ? -1.129  -16.887 -6.217  1.00 0.00 ? 88  ILE A HA   3  
ATOM 5925  H HB   . ILE A 1 88  ? 0.967   -16.533 -4.746  1.00 0.00 ? 88  ILE A HB   3  
ATOM 5926  H HG12 . ILE A 1 88  ? -0.724  -16.241 -2.606  1.00 0.00 ? 88  ILE A HG12 3  
ATOM 5927  H HG13 . ILE A 1 88  ? 0.921   -15.458 -2.766  1.00 0.00 ? 88  ILE A HG13 3  
ATOM 5928  H HG21 . ILE A 1 88  ? 0.272   -15.198 -6.684  1.00 0.00 ? 88  ILE A HG21 3  
ATOM 5929  H HG22 . ILE A 1 88  ? -0.861  -14.241 -5.673  1.00 0.00 ? 88  ILE A HG22 3  
ATOM 5930  H HG23 . ILE A 1 88  ? 0.921   -14.124 -5.387  1.00 0.00 ? 88  ILE A HG23 3  
ATOM 5931  H HD11 . ILE A 1 88  ? -1.723  -14.034 -3.492  1.00 0.00 ? 88  ILE A HD11 3  
ATOM 5932  H HD12 . ILE A 1 88  ? -0.868  -13.862 -1.927  1.00 0.00 ? 88  ILE A HD12 3  
ATOM 5933  H HD13 . ILE A 1 88  ? -0.074  -13.309 -3.433  1.00 0.00 ? 88  ILE A HD13 3  
ATOM 5934  N N    . GLY A 1 89  ? -0.655  -19.232 -5.747  1.00 0.00 ? 89  GLY A N    3  
ATOM 5935  C CA   . GLY A 1 89  ? -0.503  -20.712 -5.561  1.00 0.00 ? 89  GLY A CA   3  
ATOM 5936  C C    . GLY A 1 89  ? -1.807  -21.419 -5.246  1.00 0.00 ? 89  GLY A C    3  
ATOM 5937  O O    . GLY A 1 89  ? -1.829  -22.495 -4.661  1.00 0.00 ? 89  GLY A O    3  
ATOM 5938  H H    . GLY A 1 89  ? -0.573  -18.818 -6.659  1.00 0.00 ? 89  GLY A H    3  
ATOM 5939  H HA2  . GLY A 1 89  ? -0.125  -21.219 -6.471  1.00 0.00 ? 89  GLY A HA2  3  
ATOM 5940  H HA3  . GLY A 1 89  ? 0.112   -20.852 -4.659  1.00 0.00 ? 89  GLY A HA3  3  
ATOM 5941  N N    . GLY A 1 90  ? -2.937  -20.756 -5.600  1.00 0.00 ? 90  GLY A N    3  
ATOM 5942  C CA   . GLY A 1 90  ? -4.315  -21.166 -5.267  1.00 0.00 ? 90  GLY A CA   3  
ATOM 5943  C C    . GLY A 1 90  ? -4.801  -20.733 -3.889  1.00 0.00 ? 90  GLY A C    3  
ATOM 5944  O O    . GLY A 1 90  ? -5.793  -21.270 -3.407  1.00 0.00 ? 90  GLY A O    3  
ATOM 5945  H H    . GLY A 1 90  ? -2.760  -19.908 -6.105  1.00 0.00 ? 90  GLY A H    3  
ATOM 5946  H HA2  . GLY A 1 90  ? -5.024  -20.759 -5.982  1.00 0.00 ? 90  GLY A HA2  3  
ATOM 5947  H HA3  . GLY A 1 90  ? -4.363  -22.247 -5.270  1.00 0.00 ? 90  GLY A HA3  3  
ATOM 5948  N N    . ALA A 1 91  ? -4.140  -19.764 -3.195  1.00 0.00 ? 91  ALA A N    3  
ATOM 5949  C CA   . ALA A 1 91  ? -4.510  -19.362 -1.848  1.00 0.00 ? 91  ALA A CA   3  
ATOM 5950  C C    . ALA A 1 91  ? -4.482  -17.836 -1.719  1.00 0.00 ? 91  ALA A C    3  
ATOM 5951  O O    . ALA A 1 91  ? -3.563  -17.178 -2.206  1.00 0.00 ? 91  ALA A O    3  
ATOM 5952  C CB   . ALA A 1 91  ? -3.537  -20.016 -0.843  1.00 0.00 ? 91  ALA A CB   3  
ATOM 5953  H H    . ALA A 1 91  ? -3.322  -19.299 -3.534  1.00 0.00 ? 91  ALA A H    3  
ATOM 5954  H HA   . ALA A 1 91  ? -5.510  -19.706 -1.610  1.00 0.00 ? 91  ALA A HA   3  
ATOM 5955  H HB1  . ALA A 1 91  ? -2.486  -19.751 -1.094  1.00 0.00 ? 91  ALA A HB1  3  
ATOM 5956  H HB2  . ALA A 1 91  ? -3.753  -19.714 0.203   1.00 0.00 ? 91  ALA A HB2  3  
ATOM 5957  H HB3  . ALA A 1 91  ? -3.629  -21.123 -0.906  1.00 0.00 ? 91  ALA A HB3  3  
ATOM 5958  N N    . ASP A 1 92  ? -5.512  -17.233 -1.062  1.00 0.00 ? 92  ASP A N    3  
ATOM 5959  C CA   . ASP A 1 92  ? -5.716  -15.804 -0.809  1.00 0.00 ? 92  ASP A CA   3  
ATOM 5960  C C    . ASP A 1 92  ? -5.144  -15.340 0.541   1.00 0.00 ? 92  ASP A C    3  
ATOM 5961  O O    . ASP A 1 92  ? -5.567  -15.799 1.602   1.00 0.00 ? 92  ASP A O    3  
ATOM 5962  C CB   . ASP A 1 92  ? -7.206  -15.340 -0.971  1.00 0.00 ? 92  ASP A CB   3  
ATOM 5963  C CG   . ASP A 1 92  ? -8.217  -16.115 -0.108  1.00 0.00 ? 92  ASP A CG   3  
ATOM 5964  O OD1  . ASP A 1 92  ? -8.420  -17.332 -0.362  1.00 0.00 ? 92  ASP A OD1  3  
ATOM 5965  O OD2  . ASP A 1 92  ? -8.809  -15.485 0.809   1.00 0.00 ? 92  ASP A OD2  3  
ATOM 5966  H H    . ASP A 1 92  ? -6.234  -17.789 -0.692  1.00 0.00 ? 92  ASP A H    3  
ATOM 5967  H HA   . ASP A 1 92  ? -5.201  -15.274 -1.586  1.00 0.00 ? 92  ASP A HA   3  
ATOM 5968  H HB2  . ASP A 1 92  ? -7.288  -14.248 -0.729  1.00 0.00 ? 92  ASP A HB2  3  
ATOM 5969  H HB3  . ASP A 1 92  ? -7.498  -15.495 -2.039  1.00 0.00 ? 92  ASP A HB3  3  
ATOM 5970  N N    . PHE A 1 93  ? -4.154  -14.412 0.535   1.00 0.00 ? 93  PHE A N    3  
ATOM 5971  C CA   . PHE A 1 93  ? -3.507  -13.880 1.730   1.00 0.00 ? 93  PHE A CA   3  
ATOM 5972  C C    . PHE A 1 93  ? -3.687  -12.378 1.664   1.00 0.00 ? 93  PHE A C    3  
ATOM 5973  O O    . PHE A 1 93  ? -4.271  -11.863 0.704   1.00 0.00 ? 93  PHE A O    3  
ATOM 5974  C CB   . PHE A 1 93  ? -1.982  -14.224 1.815   1.00 0.00 ? 93  PHE A CB   3  
ATOM 5975  C CG   . PHE A 1 93  ? -1.754  -15.707 1.644   1.00 0.00 ? 93  PHE A CG   3  
ATOM 5976  C CD1  . PHE A 1 93  ? -2.029  -16.612 2.655   1.00 0.00 ? 93  PHE A CD1  3  
ATOM 5977  C CD2  . PHE A 1 93  ? -1.267  -16.191 0.443   1.00 0.00 ? 93  PHE A CD2  3  
ATOM 5978  C CE1  . PHE A 1 93  ? -1.828  -17.968 2.461   1.00 0.00 ? 93  PHE A CE1  3  
ATOM 5979  C CE2  . PHE A 1 93  ? -1.077  -17.539 0.235   1.00 0.00 ? 93  PHE A CE2  3  
ATOM 5980  C CZ   . PHE A 1 93  ? -1.355  -18.432 1.249   1.00 0.00 ? 93  PHE A CZ   3  
ATOM 5981  H H    . PHE A 1 93  ? -3.825  -14.015 -0.324  1.00 0.00 ? 93  PHE A H    3  
ATOM 5982  H HA   . PHE A 1 93  ? -4.004  -14.223 2.631   1.00 0.00 ? 93  PHE A HA   3  
ATOM 5983  H HB2  . PHE A 1 93  ? -1.423  -13.707 0.990   1.00 0.00 ? 93  PHE A HB2  3  
ATOM 5984  H HB3  . PHE A 1 93  ? -1.572  -13.946 2.820   1.00 0.00 ? 93  PHE A HB3  3  
ATOM 5985  H HD1  . PHE A 1 93  ? -2.414  -16.256 3.600   1.00 0.00 ? 93  PHE A HD1  3  
ATOM 5986  H HD2  . PHE A 1 93  ? -1.055  -15.498 -0.355  1.00 0.00 ? 93  PHE A HD2  3  
ATOM 5987  H HE1  . PHE A 1 93  ? -2.053  -18.668 3.253   1.00 0.00 ? 93  PHE A HE1  3  
ATOM 5988  H HE2  . PHE A 1 93  ? -0.735  -17.896 -0.728  1.00 0.00 ? 93  PHE A HE2  3  
ATOM 5989  H HZ   . PHE A 1 93  ? -1.227  -19.492 1.068   1.00 0.00 ? 93  PHE A HZ   3  
ATOM 5990  N N    . LEU A 1 94  ? -3.161  -11.620 2.669   1.00 0.00 ? 94  LEU A N    3  
ATOM 5991  C CA   . LEU A 1 94  ? -3.250  -10.170 2.664   1.00 0.00 ? 94  LEU A CA   3  
ATOM 5992  C C    . LEU A 1 94  ? -1.888  -9.619  2.235   1.00 0.00 ? 94  LEU A C    3  
ATOM 5993  O O    . LEU A 1 94  ? -0.887  -9.718  2.947   1.00 0.00 ? 94  LEU A O    3  
ATOM 5994  C CB   . LEU A 1 94  ? -3.772  -9.616  4.017   1.00 0.00 ? 94  LEU A CB   3  
ATOM 5995  C CG   . LEU A 1 94  ? -4.887  -8.549  3.859   1.00 0.00 ? 94  LEU A CG   3  
ATOM 5996  C CD1  . LEU A 1 94  ? -6.210  -9.273  3.539   1.00 0.00 ? 94  LEU A CD1  3  
ATOM 5997  C CD2  . LEU A 1 94  ? -5.092  -7.747  5.162   1.00 0.00 ? 94  LEU A CD2  3  
ATOM 5998  H H    . LEU A 1 94  ? -2.656  -12.001 3.442   1.00 0.00 ? 94  LEU A H    3  
ATOM 5999  H HA   . LEU A 1 94  ? -3.994  -9.842  1.947   1.00 0.00 ? 94  LEU A HA   3  
ATOM 6000  H HB2  . LEU A 1 94  ? -4.248  -10.475 4.560   1.00 0.00 ? 94  LEU A HB2  3  
ATOM 6001  H HB3  . LEU A 1 94  ? -2.948  -9.228  4.655   1.00 0.00 ? 94  LEU A HB3  3  
ATOM 6002  H HG   . LEU A 1 94  ? -4.605  -7.851  3.013   1.00 0.00 ? 94  LEU A HG   3  
ATOM 6003  H HD11 . LEU A 1 94  ? -6.113  -9.905  2.631   1.00 0.00 ? 94  LEU A HD11 3  
ATOM 6004  H HD12 . LEU A 1 94  ? -6.477  -9.944  4.385   1.00 0.00 ? 94  LEU A HD12 3  
ATOM 6005  H HD13 . LEU A 1 94  ? -7.051  -8.558  3.405   1.00 0.00 ? 94  LEU A HD13 3  
ATOM 6006  H HD21 . LEU A 1 94  ? -5.291  -8.443  6.005   1.00 0.00 ? 94  LEU A HD21 3  
ATOM 6007  H HD22 . LEU A 1 94  ? -4.199  -7.141  5.425   1.00 0.00 ? 94  LEU A HD22 3  
ATOM 6008  H HD23 . LEU A 1 94  ? -5.972  -7.070  5.078   1.00 0.00 ? 94  LEU A HD23 3  
ATOM 6009  N N    . VAL A 1 95  ? -1.852  -9.021  1.015   1.00 0.00 ? 95  VAL A N    3  
ATOM 6010  C CA   . VAL A 1 95  ? -0.680  -8.408  0.399   1.00 0.00 ? 95  VAL A CA   3  
ATOM 6011  C C    . VAL A 1 95  ? -0.958  -6.905  0.353   1.00 0.00 ? 95  VAL A C    3  
ATOM 6012  O O    . VAL A 1 95  ? -2.114  -6.461  0.321   1.00 0.00 ? 95  VAL A O    3  
ATOM 6013  C CB   . VAL A 1 95  ? -0.351  -8.956  -1.009  1.00 0.00 ? 95  VAL A CB   3  
ATOM 6014  C CG1  . VAL A 1 95  ? -0.113  -10.485 -0.932  1.00 0.00 ? 95  VAL A CG1  3  
ATOM 6015  C CG2  . VAL A 1 95  ? -1.471  -8.658  -2.045  1.00 0.00 ? 95  VAL A CG2  3  
ATOM 6016  H H    . VAL A 1 95  ? -2.684  -8.919  0.460   1.00 0.00 ? 95  VAL A H    3  
ATOM 6017  H HA   . VAL A 1 95  ? 0.219   -8.572  1.005   1.00 0.00 ? 95  VAL A HA   3  
ATOM 6018  H HB   . VAL A 1 95  ? 0.625   -8.503  -1.336  1.00 0.00 ? 95  VAL A HB   3  
ATOM 6019  H HG11 . VAL A 1 95  ? 0.700   -10.722 -0.213  1.00 0.00 ? 95  VAL A HG11 3  
ATOM 6020  H HG12 . VAL A 1 95  ? -1.036  -11.005 -0.598  1.00 0.00 ? 95  VAL A HG12 3  
ATOM 6021  H HG13 . VAL A 1 95  ? 0.169   -10.886 -1.930  1.00 0.00 ? 95  VAL A HG13 3  
ATOM 6022  H HG21 . VAL A 1 95  ? -2.444  -9.063  -1.691  1.00 0.00 ? 95  VAL A HG21 3  
ATOM 6023  H HG22 . VAL A 1 95  ? -1.619  -7.575  -2.250  1.00 0.00 ? 95  VAL A HG22 3  
ATOM 6024  H HG23 . VAL A 1 95  ? -1.256  -9.170  -3.009  1.00 0.00 ? 95  VAL A HG23 3  
ATOM 6025  N N    . TRP A 1 96  ? 0.124   -6.097  0.329   1.00 0.00 ? 96  TRP A N    3  
ATOM 6026  C CA   . TRP A 1 96  ? 0.024   -4.620  0.274   1.00 0.00 ? 96  TRP A CA   3  
ATOM 6027  C C    . TRP A 1 96  ? 0.707   -4.192  -1.042  1.00 0.00 ? 96  TRP A C    3  
ATOM 6028  O O    . TRP A 1 96  ? 1.715   -4.783  -1.430  1.00 0.00 ? 96  TRP A O    3  
ATOM 6029  C CB   . TRP A 1 96  ? 0.826   -4.160  1.528   1.00 0.00 ? 96  TRP A CB   3  
ATOM 6030  C CG   . TRP A 1 96  ? 0.538   -2.826  2.189   1.00 0.00 ? 96  TRP A CG   3  
ATOM 6031  C CD1  . TRP A 1 96  ? -0.356  -1.852  1.877   1.00 0.00 ? 96  TRP A CD1  3  
ATOM 6032  C CD2  . TRP A 1 96  ? 1.129   -2.441  3.440   1.00 0.00 ? 96  TRP A CD2  3  
ATOM 6033  N NE1  . TRP A 1 96  ? -0.302  -0.838  2.799   1.00 0.00 ? 96  TRP A NE1  3  
ATOM 6034  C CE2  . TRP A 1 96  ? 0.582   -1.210  3.795   1.00 0.00 ? 96  TRP A CE2  3  
ATOM 6035  C CE3  . TRP A 1 96  ? 2.030   -3.081  4.238   1.00 0.00 ? 96  TRP A CE3  3  
ATOM 6036  C CZ2  . TRP A 1 96  ? 0.946   -0.597  4.964   1.00 0.00 ? 96  TRP A CZ2  3  
ATOM 6037  C CZ3  . TRP A 1 96  ? 2.280   -2.537  5.476   1.00 0.00 ? 96  TRP A CZ3  3  
ATOM 6038  C CH2  . TRP A 1 96  ? 1.778   -1.300  5.817   1.00 0.00 ? 96  TRP A CH2  3  
ATOM 6039  H H    . TRP A 1 96  ? 1.052   -6.537  0.354   1.00 0.00 ? 96  TRP A H    3  
ATOM 6040  H HA   . TRP A 1 96  ? -1.008  -4.175  0.323   1.00 0.00 ? 96  TRP A HA   3  
ATOM 6041  H HB2  . TRP A 1 96  ? 0.593   -4.895  2.333   1.00 0.00 ? 96  TRP A HB2  3  
ATOM 6042  H HB3  . TRP A 1 96  ? 1.919   -4.251  1.355   1.00 0.00 ? 96  TRP A HB3  3  
ATOM 6043  H HD1  . TRP A 1 96  ? -1.004  -1.885  1.028   1.00 0.00 ? 96  TRP A HD1  3  
ATOM 6044  H HE1  . TRP A 1 96  ? -0.731  0.036   2.692   1.00 0.00 ? 96  TRP A HE1  3  
ATOM 6045  H HE3  . TRP A 1 96  ? 2.486   -4.010  3.941   1.00 0.00 ? 96  TRP A HE3  3  
ATOM 6046  H HZ2  . TRP A 1 96  ? 0.555   0.369   5.245   1.00 0.00 ? 96  TRP A HZ2  3  
ATOM 6047  H HZ3  . TRP A 1 96  ? 2.876   -3.079  6.201   1.00 0.00 ? 96  TRP A HZ3  3  
ATOM 6048  H HH2  . TRP A 1 96  ? 2.081   -0.897  6.770   1.00 0.00 ? 96  TRP A HH2  3  
ATOM 6049  N N    . ARG A 1 97  ? 0.232   -3.165  -1.805  1.00 0.00 ? 97  ARG A N    3  
ATOM 6050  C CA   . ARG A 1 97  ? 0.952   -2.779  -3.018  1.00 0.00 ? 97  ARG A CA   3  
ATOM 6051  C C    . ARG A 1 97  ? 0.790   -1.339  -3.380  1.00 0.00 ? 97  ARG A C    3  
ATOM 6052  O O    . ARG A 1 97  ? -0.211  -0.714  -3.041  1.00 0.00 ? 97  ARG A O    3  
ATOM 6053  C CB   . ARG A 1 97  ? 0.515   -3.576  -4.274  1.00 0.00 ? 97  ARG A CB   3  
ATOM 6054  C CG   . ARG A 1 97  ? -0.942  -3.346  -4.752  1.00 0.00 ? 97  ARG A CG   3  
ATOM 6055  C CD   . ARG A 1 97  ? -1.324  -4.181  -5.979  1.00 0.00 ? 97  ARG A CD   3  
ATOM 6056  N NE   . ARG A 1 97  ? -2.708  -3.772  -6.407  1.00 0.00 ? 97  ARG A NE   3  
ATOM 6057  C CZ   . ARG A 1 97  ? -3.281  -4.174  -7.584  1.00 0.00 ? 97  ARG A CZ   3  
ATOM 6058  N NH1  . ARG A 1 97  ? -2.611  -4.990  -8.448  1.00 0.00 ? 97  ARG A NH1  3  
ATOM 6059  N NH2  . ARG A 1 97  ? -4.543  -3.753  -7.891  1.00 0.00 ? 97  ARG A NH2  3  
ATOM 6060  H H    . ARG A 1 97  ? -0.611  -2.656  -1.585  1.00 0.00 ? 97  ARG A H    3  
ATOM 6061  H HA   . ARG A 1 97  ? 2.027   -2.803  -2.791  1.00 0.00 ? 97  ARG A HA   3  
ATOM 6062  H HB2  . ARG A 1 97  ? 1.214   -3.246  -5.066  1.00 0.00 ? 97  ARG A HB2  3  
ATOM 6063  H HB3  . ARG A 1 97  ? 0.683   -4.665  -4.123  1.00 0.00 ? 97  ARG A HB3  3  
ATOM 6064  H HG2  . ARG A 1 97  ? -1.636  -3.572  -3.912  1.00 0.00 ? 97  ARG A HG2  3  
ATOM 6065  H HG3  . ARG A 1 97  ? -1.078  -2.277  -5.041  1.00 0.00 ? 97  ARG A HG3  3  
ATOM 6066  H HD2  . ARG A 1 97  ? -0.608  -3.984  -6.807  1.00 0.00 ? 97  ARG A HD2  3  
ATOM 6067  H HD3  . ARG A 1 97  ? -1.329  -5.261  -5.726  1.00 0.00 ? 97  ARG A HD3  3  
ATOM 6068  H HE   . ARG A 1 97  ? -3.232  -3.175  -5.801  1.00 0.00 ? 97  ARG A HE   3  
ATOM 6069  H HH11 . ARG A 1 97  ? -1.688  -5.306  -8.224  1.00 0.00 ? 97  ARG A HH11 3  
ATOM 6070  H HH12 . ARG A 1 97  ? -3.044  -5.277  -9.302  1.00 0.00 ? 97  ARG A HH12 3  
ATOM 6071  H HH21 . ARG A 1 97  ? -5.038  -3.158  -7.258  1.00 0.00 ? 97  ARG A HH21 3  
ATOM 6072  H HH22 . ARG A 1 97  ? -4.971  -4.042  -8.747  1.00 0.00 ? 97  ARG A HH22 3  
ATOM 6073  N N    . TRP A 1 98  ? 1.824   -0.756  -4.055  1.00 0.00 ? 98  TRP A N    3  
ATOM 6074  C CA   . TRP A 1 98  ? 1.928   0.652   -4.335  1.00 0.00 ? 98  TRP A CA   3  
ATOM 6075  C C    . TRP A 1 98  ? 1.612   0.960   -5.774  1.00 0.00 ? 98  TRP A C    3  
ATOM 6076  O O    . TRP A 1 98  ? 2.273   0.446   -6.660  1.00 0.00 ? 98  TRP A O    3  
ATOM 6077  C CB   . TRP A 1 98  ? 3.341   1.123   -3.879  1.00 0.00 ? 98  TRP A CB   3  
ATOM 6078  C CG   . TRP A 1 98  ? 3.605   2.634   -4.058  1.00 0.00 ? 98  TRP A CG   3  
ATOM 6079  C CD1  . TRP A 1 98  ? 2.717   3.678   -4.057  1.00 0.00 ? 98  TRP A CD1  3  
ATOM 6080  C CD2  . TRP A 1 98  ? 4.439   2.844   -5.177  1.00 0.00 ? 98  TRP A CD2  3  
ATOM 6081  N NE1  . TRP A 1 98  ? 2.784   4.335   -5.264  1.00 0.00 ? 98  TRP A NE1  3  
ATOM 6082  C CE2  . TRP A 1 98  ? 3.790   3.739   -5.991  1.00 0.00 ? 98  TRP A CE2  3  
ATOM 6083  C CE3  . TRP A 1 98  ? 5.527   2.161   -5.567  1.00 0.00 ? 98  TRP A CE3  3  
ATOM 6084  C CZ2  . TRP A 1 98  ? 4.176   3.861   -7.280  1.00 0.00 ? 98  TRP A CZ2  3  
ATOM 6085  C CZ3  . TRP A 1 98  ? 5.999   2.367   -6.827  1.00 0.00 ? 98  TRP A CZ3  3  
ATOM 6086  C CH2  . TRP A 1 98  ? 5.303   3.185   -7.687  1.00 0.00 ? 98  TRP A CH2  3  
ATOM 6087  H H    . TRP A 1 98  ? 2.634   -1.239  -4.392  1.00 0.00 ? 98  TRP A H    3  
ATOM 6088  H HA   . TRP A 1 98  ? 1.203   1.184   -3.778  1.00 0.00 ? 98  TRP A HA   3  
ATOM 6089  H HB2  . TRP A 1 98  ? 3.424   0.872   -2.774  1.00 0.00 ? 98  TRP A HB2  3  
ATOM 6090  H HB3  . TRP A 1 98  ? 4.058   0.520   -4.549  1.00 0.00 ? 98  TRP A HB3  3  
ATOM 6091  H HD1  . TRP A 1 98  ? 2.099   3.954   -3.223  1.00 0.00 ? 98  TRP A HD1  3  
ATOM 6092  H HE1  . TRP A 1 98  ? 2.229   5.079   -5.579  1.00 0.00 ? 98  TRP A HE1  3  
ATOM 6093  H HE3  . TRP A 1 98  ? 5.957   1.494   -4.839  1.00 0.00 ? 98  TRP A HE3  3  
ATOM 6094  H HZ2  . TRP A 1 98  ? 3.628   4.466   -7.972  1.00 0.00 ? 98  TRP A HZ2  3  
ATOM 6095  H HZ3  . TRP A 1 98  ? 6.897   1.865   -7.138  1.00 0.00 ? 98  TRP A HZ3  3  
ATOM 6096  H HH2  . TRP A 1 98  ? 5.631   3.305   -8.704  1.00 0.00 ? 98  TRP A HH2  3  
ATOM 6097  N N    . ILE A 1 99  ? 0.585   1.811   -5.995  1.00 0.00 ? 99  ILE A N    3  
ATOM 6098  C CA   . ILE A 1 99  ? 0.058   2.266   -7.254  1.00 0.00 ? 99  ILE A CA   3  
ATOM 6099  C C    . ILE A 1 99  ? 0.195   3.786   -7.268  1.00 0.00 ? 99  ILE A C    3  
ATOM 6100  O O    . ILE A 1 99  ? -0.275  4.467   -6.357  1.00 0.00 ? 99  ILE A O    3  
ATOM 6101  C CB   . ILE A 1 99  ? -1.397  1.783   -7.400  1.00 0.00 ? 99  ILE A CB   3  
ATOM 6102  C CG1  . ILE A 1 99  ? -2.319  2.176   -6.202  1.00 0.00 ? 99  ILE A CG1  3  
ATOM 6103  C CG2  . ILE A 1 99  ? -1.302  0.246   -7.518  1.00 0.00 ? 99  ILE A CG2  3  
ATOM 6104  C CD1  . ILE A 1 99  ? -3.717  1.537   -6.221  1.00 0.00 ? 99  ILE A CD1  3  
ATOM 6105  H H    . ILE A 1 99  ? 0.075   2.223   -5.247  1.00 0.00 ? 99  ILE A H    3  
ATOM 6106  H HA   . ILE A 1 99  ? 0.646   1.876   -8.078  1.00 0.00 ? 99  ILE A HA   3  
ATOM 6107  H HB   . ILE A 1 99  ? -1.840  2.178   -8.344  1.00 0.00 ? 99  ILE A HB   3  
ATOM 6108  H HG12 . ILE A 1 99  ? -1.835  1.841   -5.249  1.00 0.00 ? 99  ILE A HG12 3  
ATOM 6109  H HG13 . ILE A 1 99  ? -2.453  3.288   -6.186  1.00 0.00 ? 99  ILE A HG13 3  
ATOM 6110  H HG21 . ILE A 1 99  ? -0.534  -0.045  -8.264  1.00 0.00 ? 99  ILE A HG21 3  
ATOM 6111  H HG22 . ILE A 1 99  ? -1.011  -0.187  -6.536  1.00 0.00 ? 99  ILE A HG22 3  
ATOM 6112  H HG23 . ILE A 1 99  ? -2.275  -0.190  -7.821  1.00 0.00 ? 99  ILE A HG23 3  
ATOM 6113  H HD11 . ILE A 1 99  ? -4.266  1.819   -7.145  1.00 0.00 ? 99  ILE A HD11 3  
ATOM 6114  H HD12 . ILE A 1 99  ? -3.641  0.431   -6.169  1.00 0.00 ? 99  ILE A HD12 3  
ATOM 6115  H HD13 . ILE A 1 99  ? -4.301  1.863   -5.330  1.00 0.00 ? 99  ILE A HD13 3  
ATOM 6116  N N    . GLN A 1 100 ? 0.874   4.353   -8.304  1.00 0.00 ? 100 GLN A N    3  
ATOM 6117  C CA   . GLN A 1 100 ? 1.104   5.767   -8.587  1.00 0.00 ? 100 GLN A CA   3  
ATOM 6118  C C    . GLN A 1 100 ? -0.214  6.360   -9.102  1.00 0.00 ? 100 GLN A C    3  
ATOM 6119  O O    . GLN A 1 100 ? -0.594  5.925   -10.196 1.00 0.00 ? 100 GLN A O    3  
ATOM 6120  C CB   . GLN A 1 100 ? 2.164   6.019   -9.724  1.00 0.00 ? 100 GLN A CB   3  
ATOM 6121  C CG   . GLN A 1 100 ? 2.528   7.513   -9.775  1.00 0.00 ? 100 GLN A CG   3  
ATOM 6122  C CD   . GLN A 1 100 ? 2.466   8.040   -11.191 1.00 0.00 ? 100 GLN A CD   3  
ATOM 6123  O OE1  . GLN A 1 100 ? 1.630   8.880   -11.513 1.00 0.00 ? 100 GLN A OE1  3  
ATOM 6124  N NE2  . GLN A 1 100 ? 3.336   7.495   -12.077 1.00 0.00 ? 100 GLN A NE2  3  
ATOM 6125  H H    . GLN A 1 100 ? 1.281   3.748   -9.009  1.00 0.00 ? 100 GLN A H    3  
ATOM 6126  H HA   . GLN A 1 100 ? 1.434   6.256   -7.682  1.00 0.00 ? 100 GLN A HA   3  
ATOM 6127  H HB2  . GLN A 1 100 ? 3.166   5.505   -9.643  1.00 0.00 ? 100 GLN A HB2  3  
ATOM 6128  H HB3  . GLN A 1 100 ? 1.768   5.646   -10.696 1.00 0.00 ? 100 GLN A HB3  3  
ATOM 6129  H HG2  . GLN A 1 100 ? 1.879   8.086   -9.089  1.00 0.00 ? 100 GLN A HG2  3  
ATOM 6130  H HG3  . GLN A 1 100 ? 3.555   7.634   -9.403  1.00 0.00 ? 100 GLN A HG3  3  
ATOM 6131  H HE21 . GLN A 1 100 ? 4.140   6.999   -11.704 1.00 0.00 ? 100 GLN A HE21 3  
ATOM 6132  H HE22 . GLN A 1 100 ? 3.144   7.605   -13.052 1.00 0.00 ? 100 GLN A HE22 3  
ATOM 6133  N N    . PRO A 1 101 ? -0.956  7.305   -8.451  1.00 0.00 ? 101 PRO A N    3  
ATOM 6134  C CA   . PRO A 1 101 ? -2.322  7.684   -8.838  1.00 0.00 ? 101 PRO A CA   3  
ATOM 6135  C C    . PRO A 1 101 ? -2.517  8.236   -10.245 1.00 0.00 ? 101 PRO A C    3  
ATOM 6136  O O    . PRO A 1 101 ? -1.808  9.145   -10.665 1.00 0.00 ? 101 PRO A O    3  
ATOM 6137  C CB   . PRO A 1 101 ? -2.702  8.767   -7.816  1.00 0.00 ? 101 PRO A CB   3  
ATOM 6138  C CG   . PRO A 1 101 ? -1.967  8.322   -6.554  1.00 0.00 ? 101 PRO A CG   3  
ATOM 6139  C CD   . PRO A 1 101 ? -0.633  7.807   -7.115  1.00 0.00 ? 101 PRO A CD   3  
ATOM 6140  H HA   . PRO A 1 101 ? -2.944  6.806   -8.731  1.00 0.00 ? 101 PRO A HA   3  
ATOM 6141  H HB2  . PRO A 1 101 ? -2.283  9.763   -8.110  1.00 0.00 ? 101 PRO A HB2  3  
ATOM 6142  H HB3  . PRO A 1 101 ? -3.807  8.852   -7.717  1.00 0.00 ? 101 PRO A HB3  3  
ATOM 6143  H HG2  . PRO A 1 101 ? -1.829  9.141   -5.818  1.00 0.00 ? 101 PRO A HG2  3  
ATOM 6144  H HG3  . PRO A 1 101 ? -2.513  7.480   -6.071  1.00 0.00 ? 101 PRO A HG3  3  
ATOM 6145  H HD2  . PRO A 1 101 ? 0.085   8.650   -7.219  1.00 0.00 ? 101 PRO A HD2  3  
ATOM 6146  H HD3  . PRO A 1 101 ? -0.217  7.024   -6.438  1.00 0.00 ? 101 PRO A HD3  3  
ATOM 6147  N N    . SER A 1 102 ? -3.497  7.665   -10.979 1.00 0.00 ? 102 SER A N    3  
ATOM 6148  C CA   . SER A 1 102 ? -3.880  8.013   -12.342 1.00 0.00 ? 102 SER A CA   3  
ATOM 6149  C C    . SER A 1 102 ? -2.924  7.546   -13.455 1.00 0.00 ? 102 SER A C    3  
ATOM 6150  O O    . SER A 1 102 ? -3.211  7.800   -14.626 1.00 0.00 ? 102 SER A O    3  
ATOM 6151  C CB   . SER A 1 102 ? -4.306  9.511   -12.490 1.00 0.00 ? 102 SER A CB   3  
ATOM 6152  O OG   . SER A 1 102 ? -5.086  9.745   -13.669 1.00 0.00 ? 102 SER A OG   3  
ATOM 6153  H H    . SER A 1 102 ? -4.020  6.932   -10.555 1.00 0.00 ? 102 SER A H    3  
ATOM 6154  H HA   . SER A 1 102 ? -4.786  7.449   -12.513 1.00 0.00 ? 102 SER A HA   3  
ATOM 6155  H HB2  . SER A 1 102 ? -4.909  9.777   -11.588 1.00 0.00 ? 102 SER A HB2  3  
ATOM 6156  H HB3  . SER A 1 102 ? -3.409  10.171  -12.485 1.00 0.00 ? 102 SER A HB3  3  
ATOM 6157  H HG   . SER A 1 102 ? -4.567  9.322   -14.373 1.00 0.00 ? 102 SER A HG   3  
ATOM 6158  N N    . ALA A 1 103 ? -1.773  6.871   -13.125 1.00 0.00 ? 103 ALA A N    3  
ATOM 6159  C CA   . ALA A 1 103 ? -0.768  6.264   -14.001 1.00 0.00 ? 103 ALA A CA   3  
ATOM 6160  C C    . ALA A 1 103 ? 0.135   7.190   -14.821 1.00 0.00 ? 103 ALA A C    3  
ATOM 6161  O O    . ALA A 1 103 ? 1.338   6.953   -14.948 1.00 0.00 ? 103 ALA A O    3  
ATOM 6162  C CB   . ALA A 1 103 ? -1.392  5.178   -14.914 1.00 0.00 ? 103 ALA A CB   3  
ATOM 6163  H H    . ALA A 1 103 ? -1.566  6.734   -12.155 1.00 0.00 ? 103 ALA A H    3  
ATOM 6164  H HA   . ALA A 1 103 ? -0.093  5.751   -13.328 1.00 0.00 ? 103 ALA A HA   3  
ATOM 6165  H HB1  . ALA A 1 103 ? -2.102  5.617   -15.648 1.00 0.00 ? 103 ALA A HB1  3  
ATOM 6166  H HB2  . ALA A 1 103 ? -1.954  4.451   -14.292 1.00 0.00 ? 103 ALA A HB2  3  
ATOM 6167  H HB3  . ALA A 1 103 ? -0.610  4.616   -15.462 1.00 0.00 ? 103 ALA A HB3  3  
ATOM 6168  N N    . SER A 1 104 ? -0.494  8.232   -15.425 1.00 0.00 ? 104 SER A N    3  
ATOM 6169  C CA   . SER A 1 104 ? 0.058   9.264   -16.302 1.00 0.00 ? 104 SER A CA   3  
ATOM 6170  C C    . SER A 1 104 ? -0.119  8.906   -17.787 1.00 0.00 ? 104 SER A C    3  
ATOM 6171  O O    . SER A 1 104 ? 0.369   9.633   -18.655 1.00 0.00 ? 104 SER A O    3  
ATOM 6172  C CB   . SER A 1 104 ? 1.502   9.759   -15.962 1.00 0.00 ? 104 SER A CB   3  
ATOM 6173  O OG   . SER A 1 104 ? 1.836   10.963  -16.657 1.00 0.00 ? 104 SER A OG   3  
ATOM 6174  H H    . SER A 1 104 ? -1.481  8.298   -15.235 1.00 0.00 ? 104 SER A H    3  
ATOM 6175  H HA   . SER A 1 104 ? -0.551  10.146  -16.126 1.00 0.00 ? 104 SER A HA   3  
ATOM 6176  H HB2  . SER A 1 104 ? 1.545   9.983   -14.871 1.00 0.00 ? 104 SER A HB2  3  
ATOM 6177  H HB3  . SER A 1 104 ? 2.262   8.971   -16.168 1.00 0.00 ? 104 SER A HB3  3  
ATOM 6178  H HG   . SER A 1 104 ? 1.627   10.798  -17.593 1.00 0.00 ? 104 SER A HG   3  
ATOM 6179  N N    . CYS A 1 105 ? -0.823  7.774   -18.108 1.00 0.00 ? 105 CYS A N    3  
ATOM 6180  C CA   . CYS A 1 105 ? -1.185  7.275   -19.447 1.00 0.00 ? 105 CYS A CA   3  
ATOM 6181  C C    . CYS A 1 105 ? -0.060  6.626   -20.265 1.00 0.00 ? 105 CYS A C    3  
ATOM 6182  O O    . CYS A 1 105 ? -0.194  5.516   -20.779 1.00 0.00 ? 105 CYS A O    3  
ATOM 6183  C CB   . CYS A 1 105 ? -1.968  8.333   -20.300 1.00 0.00 ? 105 CYS A CB   3  
ATOM 6184  S SG   . CYS A 1 105 ? -2.948  7.665   -21.703 1.00 0.00 ? 105 CYS A SG   3  
ATOM 6185  H H    . CYS A 1 105 ? -1.166  7.216   -17.353 1.00 0.00 ? 105 CYS A H    3  
ATOM 6186  H HA   . CYS A 1 105 ? -1.885  6.474   -19.257 1.00 0.00 ? 105 CYS A HA   3  
ATOM 6187  H HB2  . CYS A 1 105 ? -2.667  8.851   -19.606 1.00 0.00 ? 105 CYS A HB2  3  
ATOM 6188  H HB3  . CYS A 1 105 ? -1.264  9.115   -20.662 1.00 0.00 ? 105 CYS A HB3  3  
ATOM 6189  H HG   . CYS A 1 105 ? -1.968  6.934   -22.224 1.00 0.00 ? 105 CYS A HG   3  
ATOM 6190  N N    . ASP A 1 106 ? 1.081   7.345   -20.425 1.00 0.00 ? 106 ASP A N    3  
ATOM 6191  C CA   . ASP A 1 106 ? 2.262   6.953   -21.195 1.00 0.00 ? 106 ASP A CA   3  
ATOM 6192  C C    . ASP A 1 106 ? 3.210   6.066   -20.384 1.00 0.00 ? 106 ASP A C    3  
ATOM 6193  O O    . ASP A 1 106 ? 4.029   6.546   -19.607 1.00 0.00 ? 106 ASP A O    3  
ATOM 6194  C CB   . ASP A 1 106 ? 2.991   8.225   -21.742 1.00 0.00 ? 106 ASP A CB   3  
ATOM 6195  C CG   . ASP A 1 106 ? 4.013   7.914   -22.845 1.00 0.00 ? 106 ASP A CG   3  
ATOM 6196  O OD1  . ASP A 1 106 ? 3.598   7.363   -23.899 1.00 0.00 ? 106 ASP A OD1  3  
ATOM 6197  O OD2  . ASP A 1 106 ? 5.217   8.226   -22.642 1.00 0.00 ? 106 ASP A OD2  3  
ATOM 6198  H H    . ASP A 1 106 ? 1.118   8.245   -19.982 1.00 0.00 ? 106 ASP A H    3  
ATOM 6199  H HA   . ASP A 1 106 ? 1.929   6.378   -22.050 1.00 0.00 ? 106 ASP A HA   3  
ATOM 6200  H HB2  . ASP A 1 106 ? 2.220   8.894   -22.185 1.00 0.00 ? 106 ASP A HB2  3  
ATOM 6201  H HB3  . ASP A 1 106 ? 3.474   8.788   -20.916 1.00 0.00 ? 106 ASP A HB3  3  
ATOM 6202  N N    . LYS A 1 107 ? 3.092   4.731   -20.564 1.00 0.00 ? 107 LYS A N    3  
ATOM 6203  C CA   . LYS A 1 107 ? 3.877   3.706   -19.900 1.00 0.00 ? 107 LYS A CA   3  
ATOM 6204  C C    . LYS A 1 107 ? 3.780   2.453   -20.766 1.00 0.00 ? 107 LYS A C    3  
ATOM 6205  O O    . LYS A 1 107 ? 3.317   2.514   -21.904 1.00 0.00 ? 107 LYS A O    3  
ATOM 6206  C CB   . LYS A 1 107 ? 3.374   3.437   -18.444 1.00 0.00 ? 107 LYS A CB   3  
ATOM 6207  C CG   . LYS A 1 107 ? 1.921   2.935   -18.338 1.00 0.00 ? 107 LYS A CG   3  
ATOM 6208  C CD   . LYS A 1 107 ? 1.439   2.762   -16.895 1.00 0.00 ? 107 LYS A CD   3  
ATOM 6209  C CE   . LYS A 1 107 ? 0.070   2.071   -16.796 1.00 0.00 ? 107 LYS A CE   3  
ATOM 6210  N NZ   . LYS A 1 107 ? -0.977  2.832   -17.520 1.00 0.00 ? 107 LYS A NZ   3  
ATOM 6211  H H    . LYS A 1 107 ? 2.421   4.358   -21.202 1.00 0.00 ? 107 LYS A H    3  
ATOM 6212  H HA   . LYS A 1 107 ? 4.917   4.008   -19.873 1.00 0.00 ? 107 LYS A HA   3  
ATOM 6213  H HB2  . LYS A 1 107 ? 4.048   2.719   -17.930 1.00 0.00 ? 107 LYS A HB2  3  
ATOM 6214  H HB3  . LYS A 1 107 ? 3.448   4.400   -17.887 1.00 0.00 ? 107 LYS A HB3  3  
ATOM 6215  H HG2  . LYS A 1 107 ? 1.247   3.647   -18.865 1.00 0.00 ? 107 LYS A HG2  3  
ATOM 6216  H HG3  . LYS A 1 107 ? 1.831   1.943   -18.837 1.00 0.00 ? 107 LYS A HG3  3  
ATOM 6217  H HD2  . LYS A 1 107 ? 2.182   2.136   -16.352 1.00 0.00 ? 107 LYS A HD2  3  
ATOM 6218  H HD3  . LYS A 1 107 ? 1.404   3.753   -16.391 1.00 0.00 ? 107 LYS A HD3  3  
ATOM 6219  H HE2  . LYS A 1 107 ? 0.117   1.056   -17.243 1.00 0.00 ? 107 LYS A HE2  3  
ATOM 6220  H HE3  . LYS A 1 107 ? -0.246  1.990   -15.735 1.00 0.00 ? 107 LYS A HE3  3  
ATOM 6221  H HZ1  . LYS A 1 107 ? -0.710  2.919   -18.522 1.00 0.00 ? 107 LYS A HZ1  3  
ATOM 6222  H HZ2  . LYS A 1 107 ? -1.885  2.331   -17.444 1.00 0.00 ? 107 LYS A HZ2  3  
ATOM 6223  H HZ3  . LYS A 1 107 ? -1.068  3.780   -17.102 1.00 0.00 ? 107 LYS A HZ3  3  
ATOM 6224  N N    . ILE A 1 108 ? 4.178   1.282   -20.209 1.00 0.00 ? 108 ILE A N    3  
ATOM 6225  C CA   . ILE A 1 108 ? 4.111   -0.050  -20.799 1.00 0.00 ? 108 ILE A CA   3  
ATOM 6226  C C    . ILE A 1 108 ? 3.705   -0.979  -19.647 1.00 0.00 ? 108 ILE A C    3  
ATOM 6227  O O    . ILE A 1 108 ? 3.546   -0.530  -18.514 1.00 0.00 ? 108 ILE A O    3  
ATOM 6228  C CB   . ILE A 1 108 ? 5.435   -0.432  -21.503 1.00 0.00 ? 108 ILE A CB   3  
ATOM 6229  C CG1  . ILE A 1 108 ? 5.317   -1.663  -22.450 1.00 0.00 ? 108 ILE A CG1  3  
ATOM 6230  C CG2  . ILE A 1 108 ? 6.602   -0.577  -20.496 1.00 0.00 ? 108 ILE A CG2  3  
ATOM 6231  C CD1  . ILE A 1 108 ? 6.507   -1.846  -23.411 1.00 0.00 ? 108 ILE A CD1  3  
ATOM 6232  H H    . ILE A 1 108 ? 4.511   1.267   -19.269 1.00 0.00 ? 108 ILE A H    3  
ATOM 6233  H HA   . ILE A 1 108 ? 3.307   -0.076  -21.525 1.00 0.00 ? 108 ILE A HA   3  
ATOM 6234  H HB   . ILE A 1 108 ? 5.675   0.449   -22.149 1.00 0.00 ? 108 ILE A HB   3  
ATOM 6235  H HG12 . ILE A 1 108 ? 5.254   -2.588  -21.831 1.00 0.00 ? 108 ILE A HG12 3  
ATOM 6236  H HG13 . ILE A 1 108 ? 4.373   -1.560  -23.041 1.00 0.00 ? 108 ILE A HG13 3  
ATOM 6237  H HG21 . ILE A 1 108 ? 6.658   0.304   -19.825 1.00 0.00 ? 108 ILE A HG21 3  
ATOM 6238  H HG22 . ILE A 1 108 ? 6.495   -1.491  -19.877 1.00 0.00 ? 108 ILE A HG22 3  
ATOM 6239  H HG23 . ILE A 1 108 ? 7.568   -0.643  -21.038 1.00 0.00 ? 108 ILE A HG23 3  
ATOM 6240  H HD11 . ILE A 1 108 ? 7.458   -1.972  -22.851 1.00 0.00 ? 108 ILE A HD11 3  
ATOM 6241  H HD12 . ILE A 1 108 ? 6.371   -2.758  -24.034 1.00 0.00 ? 108 ILE A HD12 3  
ATOM 6242  H HD13 . ILE A 1 108 ? 6.622   -0.979  -24.098 1.00 0.00 ? 108 ILE A HD13 3  
ATOM 6243  N N    . LEU A 1 109 ? 3.541   -2.303  -19.899 1.00 0.00 ? 109 LEU A N    3  
ATOM 6244  C CA   . LEU A 1 109 ? 3.210   -3.355  -18.946 1.00 0.00 ? 109 LEU A CA   3  
ATOM 6245  C C    . LEU A 1 109 ? 4.480   -4.099  -18.486 1.00 0.00 ? 109 LEU A C    3  
ATOM 6246  O O    . LEU A 1 109 ? 5.593   -3.640  -18.729 1.00 0.00 ? 109 LEU A O    3  
ATOM 6247  C CB   . LEU A 1 109 ? 2.065   -4.271  -19.492 1.00 0.00 ? 109 LEU A CB   3  
ATOM 6248  C CG   . LEU A 1 109 ? 2.109   -4.807  -20.956 1.00 0.00 ? 109 LEU A CG   3  
ATOM 6249  C CD1  . LEU A 1 109 ? 1.790   -3.753  -22.036 1.00 0.00 ? 109 LEU A CD1  3  
ATOM 6250  C CD2  . LEU A 1 109 ? 3.362   -5.620  -21.321 1.00 0.00 ? 109 LEU A CD2  3  
ATOM 6251  H H    . LEU A 1 109 ? 3.683   -2.657  -20.815 1.00 0.00 ? 109 LEU A H    3  
ATOM 6252  H HA   . LEU A 1 109 ? 2.815   -2.900  -18.045 1.00 0.00 ? 109 LEU A HA   3  
ATOM 6253  H HB2  . LEU A 1 109 ? 1.910   -5.135  -18.813 1.00 0.00 ? 109 LEU A HB2  3  
ATOM 6254  H HB3  . LEU A 1 109 ? 1.130   -3.665  -19.424 1.00 0.00 ? 109 LEU A HB3  3  
ATOM 6255  H HG   . LEU A 1 109 ? 1.256   -5.532  -21.010 1.00 0.00 ? 109 LEU A HG   3  
ATOM 6256  H HD11 . LEU A 1 109 ? 0.896   -3.160  -21.749 1.00 0.00 ? 109 LEU A HD11 3  
ATOM 6257  H HD12 . LEU A 1 109 ? 2.637   -3.063  -22.208 1.00 0.00 ? 109 LEU A HD12 3  
ATOM 6258  H HD13 . LEU A 1 109 ? 1.576   -4.257  -23.003 1.00 0.00 ? 109 LEU A HD13 3  
ATOM 6259  H HD21 . LEU A 1 109 ? 3.490   -6.458  -20.604 1.00 0.00 ? 109 LEU A HD21 3  
ATOM 6260  H HD22 . LEU A 1 109 ? 3.256   -6.048  -22.340 1.00 0.00 ? 109 LEU A HD22 3  
ATOM 6261  H HD23 . LEU A 1 109 ? 4.271   -4.983  -21.317 1.00 0.00 ? 109 LEU A HD23 3  
ATOM 6262  N N    . VAL A 1 110 ? 4.376   -5.265  -17.785 1.00 0.00 ? 110 VAL A N    3  
ATOM 6263  C CA   . VAL A 1 110 ? 5.518   -5.979  -17.184 1.00 0.00 ? 110 VAL A CA   3  
ATOM 6264  C C    . VAL A 1 110 ? 6.381   -6.842  -18.121 1.00 0.00 ? 110 VAL A C    3  
ATOM 6265  O O    . VAL A 1 110 ? 7.325   -7.515  -17.715 1.00 0.00 ? 110 VAL A O    3  
ATOM 6266  C CB   . VAL A 1 110 ? 5.068   -6.678  -15.888 1.00 0.00 ? 110 VAL A CB   3  
ATOM 6267  C CG1  . VAL A 1 110 ? 4.278   -7.981  -16.148 1.00 0.00 ? 110 VAL A CG1  3  
ATOM 6268  C CG2  . VAL A 1 110 ? 6.243   -6.891  -14.906 1.00 0.00 ? 110 VAL A CG2  3  
ATOM 6269  H H    . VAL A 1 110 ? 3.483   -5.649  -17.571 1.00 0.00 ? 110 VAL A H    3  
ATOM 6270  H HA   . VAL A 1 110 ? 6.216   -5.222  -16.865 1.00 0.00 ? 110 VAL A HA   3  
ATOM 6271  H HB   . VAL A 1 110 ? 4.371   -5.970  -15.373 1.00 0.00 ? 110 VAL A HB   3  
ATOM 6272  H HG11 . VAL A 1 110 ? 3.435   -7.806  -16.847 1.00 0.00 ? 110 VAL A HG11 3  
ATOM 6273  H HG12 . VAL A 1 110 ? 4.939   -8.764  -16.574 1.00 0.00 ? 110 VAL A HG12 3  
ATOM 6274  H HG13 . VAL A 1 110 ? 3.866   -8.369  -15.190 1.00 0.00 ? 110 VAL A HG13 3  
ATOM 6275  H HG21 . VAL A 1 110 ? 6.774   -5.933  -14.727 1.00 0.00 ? 110 VAL A HG21 3  
ATOM 6276  H HG22 . VAL A 1 110 ? 5.863   -7.268  -13.933 1.00 0.00 ? 110 VAL A HG22 3  
ATOM 6277  H HG23 . VAL A 1 110 ? 6.967   -7.632  -15.303 1.00 0.00 ? 110 VAL A HG23 3  
ATOM 6278  N N    . ILE A 1 111 ? 6.102   -6.811  -19.442 1.00 0.00 ? 111 ILE A N    3  
ATOM 6279  C CA   . ILE A 1 111 ? 6.831   -7.515  -20.488 1.00 0.00 ? 111 ILE A CA   3  
ATOM 6280  C C    . ILE A 1 111 ? 7.421   -6.456  -21.435 1.00 0.00 ? 111 ILE A C    3  
ATOM 6281  O O    . ILE A 1 111 ? 6.712   -6.013  -22.341 1.00 0.00 ? 111 ILE A O    3  
ATOM 6282  C CB   . ILE A 1 111 ? 5.900   -8.495  -21.218 1.00 0.00 ? 111 ILE A CB   3  
ATOM 6283  C CG1  . ILE A 1 111 ? 5.355   -9.547  -20.210 1.00 0.00 ? 111 ILE A CG1  3  
ATOM 6284  C CG2  . ILE A 1 111 ? 6.624   -9.191  -22.399 1.00 0.00 ? 111 ILE A CG2  3  
ATOM 6285  C CD1  . ILE A 1 111 ? 4.423   -10.609 -20.818 1.00 0.00 ? 111 ILE A CD1  3  
ATOM 6286  H H    . ILE A 1 111 ? 5.350   -6.239  -19.755 1.00 0.00 ? 111 ILE A H    3  
ATOM 6287  H HA   . ILE A 1 111 ? 7.632   -8.115  -20.076 1.00 0.00 ? 111 ILE A HA   3  
ATOM 6288  H HB   . ILE A 1 111 ? 5.035   -7.908  -21.603 1.00 0.00 ? 111 ILE A HB   3  
ATOM 6289  H HG12 . ILE A 1 111 ? 6.226   -10.070 -19.750 1.00 0.00 ? 111 ILE A HG12 3  
ATOM 6290  H HG13 . ILE A 1 111 ? 4.809   -9.020  -19.389 1.00 0.00 ? 111 ILE A HG13 3  
ATOM 6291  H HG21 . ILE A 1 111 ? 7.507   -9.755  -22.031 1.00 0.00 ? 111 ILE A HG21 3  
ATOM 6292  H HG22 . ILE A 1 111 ? 5.944   -9.905  -22.906 1.00 0.00 ? 111 ILE A HG22 3  
ATOM 6293  H HG23 . ILE A 1 111 ? 6.954   -8.475  -23.179 1.00 0.00 ? 111 ILE A HG23 3  
ATOM 6294  H HD11 . ILE A 1 111 ? 3.542   -10.150 -21.318 1.00 0.00 ? 111 ILE A HD11 3  
ATOM 6295  H HD12 . ILE A 1 111 ? 4.964   -11.226 -21.567 1.00 0.00 ? 111 ILE A HD12 3  
ATOM 6296  H HD13 . ILE A 1 111 ? 4.049   -11.301 -20.031 1.00 0.00 ? 111 ILE A HD13 3  
ATOM 6297  N N    . PRO A 1 112 ? 8.673   -5.960  -21.284 1.00 0.00 ? 112 PRO A N    3  
ATOM 6298  C CA   . PRO A 1 112 ? 9.280   -4.955  -22.171 1.00 0.00 ? 112 PRO A CA   3  
ATOM 6299  C C    . PRO A 1 112 ? 9.796   -5.559  -23.492 1.00 0.00 ? 112 PRO A C    3  
ATOM 6300  O O    . PRO A 1 112 ? 9.911   -4.836  -24.482 1.00 0.00 ? 112 PRO A O    3  
ATOM 6301  C CB   . PRO A 1 112 ? 10.421  -4.376  -21.306 1.00 0.00 ? 112 PRO A CB   3  
ATOM 6302  C CG   . PRO A 1 112 ? 10.837  -5.527  -20.385 1.00 0.00 ? 112 PRO A CG   3  
ATOM 6303  C CD   . PRO A 1 112 ? 9.527   -6.277  -20.136 1.00 0.00 ? 112 PRO A CD   3  
ATOM 6304  H HA   . PRO A 1 112 ? 8.565   -4.183  -22.430 1.00 0.00 ? 112 PRO A HA   3  
ATOM 6305  H HB2  . PRO A 1 112 ? 11.270  -3.964  -21.890 1.00 0.00 ? 112 PRO A HB2  3  
ATOM 6306  H HB3  . PRO A 1 112 ? 10.002  -3.558  -20.677 1.00 0.00 ? 112 PRO A HB3  3  
ATOM 6307  H HG2  . PRO A 1 112 ? 11.544  -6.198  -20.918 1.00 0.00 ? 112 PRO A HG2  3  
ATOM 6308  H HG3  . PRO A 1 112 ? 11.306  -5.171  -19.445 1.00 0.00 ? 112 PRO A HG3  3  
ATOM 6309  H HD2  . PRO A 1 112 ? 9.712   -7.370  -20.040 1.00 0.00 ? 112 PRO A HD2  3  
ATOM 6310  H HD3  . PRO A 1 112 ? 9.055   -5.888  -19.203 1.00 0.00 ? 112 PRO A HD3  3  
ATOM 6311  N N    . SER A 1 113 ? 10.140  -6.878  -23.528 1.00 0.00 ? 113 SER A N    3  
ATOM 6312  C CA   . SER A 1 113 ? 10.589  -7.683  -24.676 1.00 0.00 ? 113 SER A CA   3  
ATOM 6313  C C    . SER A 1 113 ? 11.975  -7.341  -25.248 1.00 0.00 ? 113 SER A C    3  
ATOM 6314  O O    . SER A 1 113 ? 12.871  -8.177  -25.329 1.00 0.00 ? 113 SER A O    3  
ATOM 6315  C CB   . SER A 1 113 ? 9.494   -7.779  -25.790 1.00 0.00 ? 113 SER A CB   3  
ATOM 6316  O OG   . SER A 1 113 ? 9.472   -9.049  -26.446 1.00 0.00 ? 113 SER A OG   3  
ATOM 6317  H H    . SER A 1 113 ? 10.015  -7.379  -22.677 1.00 0.00 ? 113 SER A H    3  
ATOM 6318  H HA   . SER A 1 113 ? 10.689  -8.681  -24.272 1.00 0.00 ? 113 SER A HA   3  
ATOM 6319  H HB2  . SER A 1 113 ? 8.505   -7.666  -25.291 1.00 0.00 ? 113 SER A HB2  3  
ATOM 6320  H HB3  . SER A 1 113 ? 9.575   -6.951  -26.530 1.00 0.00 ? 113 SER A HB3  3  
ATOM 6321  H HG   . SER A 1 113 ? 10.279  -9.122  -26.965 1.00 0.00 ? 113 SER A HG   3  
ATOM 6322  N N    . LYS A 1 114 ? 12.168  -6.062  -25.647 1.00 0.00 ? 114 LYS A N    3  
ATOM 6323  C CA   . LYS A 1 114 ? 13.393  -5.499  -26.188 1.00 0.00 ? 114 LYS A CA   3  
ATOM 6324  C C    . LYS A 1 114 ? 14.064  -4.622  -25.134 1.00 0.00 ? 114 LYS A C    3  
ATOM 6325  O O    . LYS A 1 114 ? 14.005  -3.396  -25.186 1.00 0.00 ? 114 LYS A O    3  
ATOM 6326  C CB   . LYS A 1 114 ? 13.113  -4.668  -27.474 1.00 0.00 ? 114 LYS A CB   3  
ATOM 6327  C CG   . LYS A 1 114 ? 12.532  -5.498  -28.633 1.00 0.00 ? 114 LYS A CG   3  
ATOM 6328  C CD   . LYS A 1 114 ? 12.084  -4.645  -29.836 1.00 0.00 ? 114 LYS A CD   3  
ATOM 6329  C CE   . LYS A 1 114 ? 13.232  -3.923  -30.555 1.00 0.00 ? 114 LYS A CE   3  
ATOM 6330  N NZ   . LYS A 1 114 ? 12.738  -3.171  -31.732 1.00 0.00 ? 114 LYS A NZ   3  
ATOM 6331  H H    . LYS A 1 114 ? 11.399  -5.422  -25.532 1.00 0.00 ? 114 LYS A H    3  
ATOM 6332  H HA   . LYS A 1 114 ? 14.092  -6.285  -26.446 1.00 0.00 ? 114 LYS A HA   3  
ATOM 6333  H HB2  . LYS A 1 114 ? 12.387  -3.857  -27.233 1.00 0.00 ? 114 LYS A HB2  3  
ATOM 6334  H HB3  . LYS A 1 114 ? 14.052  -4.188  -27.832 1.00 0.00 ? 114 LYS A HB3  3  
ATOM 6335  H HG2  . LYS A 1 114 ? 13.283  -6.240  -28.983 1.00 0.00 ? 114 LYS A HG2  3  
ATOM 6336  H HG3  . LYS A 1 114 ? 11.643  -6.061  -28.270 1.00 0.00 ? 114 LYS A HG3  3  
ATOM 6337  H HD2  . LYS A 1 114 ? 11.586  -5.323  -30.568 1.00 0.00 ? 114 LYS A HD2  3  
ATOM 6338  H HD3  . LYS A 1 114 ? 11.329  -3.903  -29.494 1.00 0.00 ? 114 LYS A HD3  3  
ATOM 6339  H HE2  . LYS A 1 114 ? 13.737  -3.198  -29.884 1.00 0.00 ? 114 LYS A HE2  3  
ATOM 6340  H HE3  . LYS A 1 114 ? 13.973  -4.663  -30.922 1.00 0.00 ? 114 LYS A HE3  3  
ATOM 6341  H HZ1  . LYS A 1 114 ? 12.263  -3.827  -32.387 1.00 0.00 ? 114 LYS A HZ1  3  
ATOM 6342  H HZ2  . LYS A 1 114 ? 12.064  -2.443  -31.421 1.00 0.00 ? 114 LYS A HZ2  3  
ATOM 6343  H HZ3  . LYS A 1 114 ? 13.539  -2.719  -32.216 1.00 0.00 ? 114 LYS A HZ3  3  
ATOM 6344  N N    . VAL A 1 115 ? 14.769  -5.242  -24.146 1.00 0.00 ? 115 VAL A N    3  
ATOM 6345  C CA   . VAL A 1 115 ? 15.479  -4.577  -23.042 1.00 0.00 ? 115 VAL A CA   3  
ATOM 6346  C C    . VAL A 1 115 ? 16.832  -3.972  -23.432 1.00 0.00 ? 115 VAL A C    3  
ATOM 6347  O O    . VAL A 1 115 ? 17.483  -3.288  -22.647 1.00 0.00 ? 115 VAL A O    3  
ATOM 6348  C CB   . VAL A 1 115 ? 15.609  -5.470  -21.802 1.00 0.00 ? 115 VAL A CB   3  
ATOM 6349  C CG1  . VAL A 1 115 ? 14.194  -5.761  -21.264 1.00 0.00 ? 115 VAL A CG1  3  
ATOM 6350  C CG2  . VAL A 1 115 ? 16.360  -6.787  -22.093 1.00 0.00 ? 115 VAL A CG2  3  
ATOM 6351  H H    . VAL A 1 115 ? 14.792  -6.240  -24.122 1.00 0.00 ? 115 VAL A H    3  
ATOM 6352  H HA   . VAL A 1 115 ? 14.882  -3.730  -22.726 1.00 0.00 ? 115 VAL A HA   3  
ATOM 6353  H HB   . VAL A 1 115 ? 16.160  -4.927  -20.996 1.00 0.00 ? 115 VAL A HB   3  
ATOM 6354  H HG11 . VAL A 1 115 ? 13.675  -4.810  -21.023 1.00 0.00 ? 115 VAL A HG11 3  
ATOM 6355  H HG12 . VAL A 1 115 ? 13.587  -6.323  -22.005 1.00 0.00 ? 115 VAL A HG12 3  
ATOM 6356  H HG13 . VAL A 1 115 ? 14.263  -6.367  -20.335 1.00 0.00 ? 115 VAL A HG13 3  
ATOM 6357  H HG21 . VAL A 1 115 ? 15.841  -7.390  -22.864 1.00 0.00 ? 115 VAL A HG21 3  
ATOM 6358  H HG22 . VAL A 1 115 ? 17.396  -6.587  -22.433 1.00 0.00 ? 115 VAL A HG22 3  
ATOM 6359  H HG23 . VAL A 1 115 ? 16.422  -7.397  -21.164 1.00 0.00 ? 115 VAL A HG23 3  
ATOM 6360  N N    . TRP A 1 116 ? 17.258  -4.200  -24.698 1.00 0.00 ? 116 TRP A N    3  
ATOM 6361  C CA   . TRP A 1 116 ? 18.449  -3.672  -25.337 1.00 0.00 ? 116 TRP A CA   3  
ATOM 6362  C C    . TRP A 1 116 ? 17.971  -3.232  -26.720 1.00 0.00 ? 116 TRP A C    3  
ATOM 6363  O O    . TRP A 1 116 ? 17.226  -3.985  -27.349 1.00 0.00 ? 116 TRP A O    3  
ATOM 6364  C CB   . TRP A 1 116 ? 19.580  -4.740  -25.493 1.00 0.00 ? 116 TRP A CB   3  
ATOM 6365  C CG   . TRP A 1 116 ? 19.842  -5.609  -24.272 1.00 0.00 ? 116 TRP A CG   3  
ATOM 6366  C CD1  . TRP A 1 116 ? 19.583  -6.943  -24.141 1.00 0.00 ? 116 TRP A CD1  3  
ATOM 6367  C CD2  . TRP A 1 116 ? 20.418  -5.181  -23.021 1.00 0.00 ? 116 TRP A CD2  3  
ATOM 6368  N NE1  . TRP A 1 116 ? 19.954  -7.374  -22.890 1.00 0.00 ? 116 TRP A NE1  3  
ATOM 6369  C CE2  . TRP A 1 116 ? 20.470  -6.302  -22.193 1.00 0.00 ? 116 TRP A CE2  3  
ATOM 6370  C CE3  . TRP A 1 116 ? 20.870  -3.960  -22.592 1.00 0.00 ? 116 TRP A CE3  3  
ATOM 6371  C CZ2  . TRP A 1 116 ? 20.974  -6.222  -20.926 1.00 0.00 ? 116 TRP A CZ2  3  
ATOM 6372  C CZ3  . TRP A 1 116 ? 21.379  -3.880  -21.309 1.00 0.00 ? 116 TRP A CZ3  3  
ATOM 6373  C CH2  . TRP A 1 116 ? 21.427  -4.993  -20.491 1.00 0.00 ? 116 TRP A CH2  3  
ATOM 6374  H H    . TRP A 1 116 ? 16.684  -4.733  -25.316 1.00 0.00 ? 116 TRP A H    3  
ATOM 6375  H HA   . TRP A 1 116 ? 18.816  -2.807  -24.795 1.00 0.00 ? 116 TRP A HA   3  
ATOM 6376  H HB2  . TRP A 1 116 ? 19.325  -5.459  -26.305 1.00 0.00 ? 116 TRP A HB2  3  
ATOM 6377  H HB3  . TRP A 1 116 ? 20.532  -4.232  -25.762 1.00 0.00 ? 116 TRP A HB3  3  
ATOM 6378  H HD1  . TRP A 1 116 ? 19.145  -7.558  -24.916 1.00 0.00 ? 116 TRP A HD1  3  
ATOM 6379  H HE1  . TRP A 1 116 ? 19.955  -8.295  -22.562 1.00 0.00 ? 116 TRP A HE1  3  
ATOM 6380  H HE3  . TRP A 1 116 ? 20.832  -3.078  -23.213 1.00 0.00 ? 116 TRP A HE3  3  
ATOM 6381  H HZ2  . TRP A 1 116 ? 21.019  -7.083  -20.275 1.00 0.00 ? 116 TRP A HZ2  3  
ATOM 6382  H HZ3  . TRP A 1 116 ? 21.743  -2.930  -20.936 1.00 0.00 ? 116 TRP A HZ3  3  
ATOM 6383  H HH2  . TRP A 1 116 ? 21.827  -4.899  -19.490 1.00 0.00 ? 116 TRP A HH2  3  
ATOM 6384  N N    . GLN A 1 117 ? 18.401  -2.038  -27.230 1.00 0.00 ? 117 GLN A N    3  
ATOM 6385  C CA   . GLN A 1 117 ? 18.007  -1.459  -28.521 1.00 0.00 ? 117 GLN A CA   3  
ATOM 6386  C C    . GLN A 1 117 ? 19.105  -1.650  -29.578 1.00 0.00 ? 117 GLN A C    3  
ATOM 6387  O O    . GLN A 1 117 ? 19.221  -0.916  -30.555 1.00 0.00 ? 117 GLN A O    3  
ATOM 6388  C CB   . GLN A 1 117 ? 17.635  0.045   -28.319 1.00 0.00 ? 117 GLN A CB   3  
ATOM 6389  C CG   . GLN A 1 117 ? 16.855  0.730   -29.479 1.00 0.00 ? 117 GLN A CG   3  
ATOM 6390  C CD   . GLN A 1 117 ? 16.573  2.210   -29.188 1.00 0.00 ? 117 GLN A CD   3  
ATOM 6391  O OE1  . GLN A 1 117 ? 15.426  2.658   -29.170 1.00 0.00 ? 117 GLN A OE1  3  
ATOM 6392  N NE2  . GLN A 1 117 ? 17.656  2.995   -28.950 1.00 0.00 ? 117 GLN A NE2  3  
ATOM 6393  H H    . GLN A 1 117 ? 19.016  -1.465  -26.694 1.00 0.00 ? 117 GLN A H    3  
ATOM 6394  H HA   . GLN A 1 117 ? 17.120  -1.959  -28.895 1.00 0.00 ? 117 GLN A HA   3  
ATOM 6395  H HB2  . GLN A 1 117 ? 16.981  0.095   -27.415 1.00 0.00 ? 117 GLN A HB2  3  
ATOM 6396  H HB3  . GLN A 1 117 ? 18.556  0.619   -28.083 1.00 0.00 ? 117 GLN A HB3  3  
ATOM 6397  H HG2  . GLN A 1 117 ? 17.407  0.672   -30.440 1.00 0.00 ? 117 GLN A HG2  3  
ATOM 6398  H HG3  . GLN A 1 117 ? 15.876  0.224   -29.615 1.00 0.00 ? 117 GLN A HG3  3  
ATOM 6399  H HE21 . GLN A 1 117 ? 18.563  2.625   -29.128 1.00 0.00 ? 117 GLN A HE21 3  
ATOM 6400  H HE22 . GLN A 1 117 ? 17.494  3.944   -28.693 1.00 0.00 ? 117 GLN A HE22 3  
ATOM 6401  N N    . GLY A 1 118 ? 19.956  -2.702  -29.403 1.00 0.00 ? 118 GLY A N    3  
ATOM 6402  C CA   . GLY A 1 118 ? 21.087  -3.077  -30.271 1.00 0.00 ? 118 GLY A CA   3  
ATOM 6403  C C    . GLY A 1 118 ? 20.697  -3.785  -31.548 1.00 0.00 ? 118 GLY A C    3  
ATOM 6404  O O    . GLY A 1 118 ? 21.418  -3.781  -32.540 1.00 0.00 ? 118 GLY A O    3  
ATOM 6405  H H    . GLY A 1 118 ? 19.803  -3.260  -28.592 1.00 0.00 ? 118 GLY A H    3  
ATOM 6406  H HA2  . GLY A 1 118 ? 21.621  -2.181  -30.557 1.00 0.00 ? 118 GLY A HA2  3  
ATOM 6407  H HA3  . GLY A 1 118 ? 21.711  -3.759  -29.713 1.00 0.00 ? 118 GLY A HA3  3  
ATOM 6408  N N    . GLN A 1 119 ? 19.475  -4.371  -31.531 1.00 0.00 ? 119 GLN A N    3  
ATOM 6409  C CA   . GLN A 1 119 ? 18.794  -5.078  -32.600 1.00 0.00 ? 119 GLN A CA   3  
ATOM 6410  C C    . GLN A 1 119 ? 18.005  -4.160  -33.543 1.00 0.00 ? 119 GLN A C    3  
ATOM 6411  O O    . GLN A 1 119 ? 17.439  -4.619  -34.534 1.00 0.00 ? 119 GLN A O    3  
ATOM 6412  C CB   . GLN A 1 119 ? 17.851  -6.152  -31.972 1.00 0.00 ? 119 GLN A CB   3  
ATOM 6413  C CG   . GLN A 1 119 ? 16.797  -5.590  -30.985 1.00 0.00 ? 119 GLN A CG   3  
ATOM 6414  C CD   . GLN A 1 119 ? 15.935  -6.707  -30.388 1.00 0.00 ? 119 GLN A CD   3  
ATOM 6415  O OE1  . GLN A 1 119 ? 15.130  -7.344  -31.067 1.00 0.00 ? 119 GLN A OE1  3  
ATOM 6416  N NE2  . GLN A 1 119 ? 16.065  -6.937  -29.054 1.00 0.00 ? 119 GLN A NE2  3  
ATOM 6417  H H    . GLN A 1 119 ? 18.954  -4.331  -30.687 1.00 0.00 ? 119 GLN A H    3  
ATOM 6418  H HA   . GLN A 1 119 ? 19.527  -5.589  -33.211 1.00 0.00 ? 119 GLN A HA   3  
ATOM 6419  H HB2  . GLN A 1 119 ? 17.335  -6.718  -32.781 1.00 0.00 ? 119 GLN A HB2  3  
ATOM 6420  H HB3  . GLN A 1 119 ? 18.490  -6.882  -31.426 1.00 0.00 ? 119 GLN A HB3  3  
ATOM 6421  H HG2  . GLN A 1 119 ? 17.275  -5.020  -30.165 1.00 0.00 ? 119 GLN A HG2  3  
ATOM 6422  H HG3  . GLN A 1 119 ? 16.105  -4.906  -31.519 1.00 0.00 ? 119 GLN A HG3  3  
ATOM 6423  H HE21 . GLN A 1 119 ? 16.668  -6.349  -28.517 1.00 0.00 ? 119 GLN A HE21 3  
ATOM 6424  H HE22 . GLN A 1 119 ? 15.528  -7.683  -28.665 1.00 0.00 ? 119 GLN A HE22 3  
ATOM 6425  N N    . ALA A 1 120 ? 17.942  -2.828  -33.271 1.00 0.00 ? 120 ALA A N    3  
ATOM 6426  C CA   . ALA A 1 120 ? 17.207  -1.898  -34.118 1.00 0.00 ? 120 ALA A CA   3  
ATOM 6427  C C    . ALA A 1 120 ? 17.911  -0.554  -34.279 1.00 0.00 ? 120 ALA A C    3  
ATOM 6428  O O    . ALA A 1 120 ? 17.444  0.477   -33.802 1.00 0.00 ? 120 ALA A O    3  
ATOM 6429  C CB   . ALA A 1 120 ? 15.751  -1.707  -33.628 1.00 0.00 ? 120 ALA A CB   3  
ATOM 6430  H H    . ALA A 1 120 ? 18.402  -2.434  -32.476 1.00 0.00 ? 120 ALA A H    3  
ATOM 6431  H HA   . ALA A 1 120 ? 17.139  -2.287  -35.129 1.00 0.00 ? 120 ALA A HA   3  
ATOM 6432  H HB1  . ALA A 1 120 ? 15.228  -2.686  -33.620 1.00 0.00 ? 120 ALA A HB1  3  
ATOM 6433  H HB2  . ALA A 1 120 ? 15.182  -1.022  -34.292 1.00 0.00 ? 120 ALA A HB2  3  
ATOM 6434  H HB3  . ALA A 1 120 ? 15.729  -1.298  -32.596 1.00 0.00 ? 120 ALA A HB3  3  
ATOM 6435  N N    . PHE A 1 121 ? 19.041  -0.520  -35.042 1.00 0.00 ? 121 PHE A N    3  
ATOM 6436  C CA   . PHE A 1 121 ? 19.780  0.698   -35.409 1.00 0.00 ? 121 PHE A CA   3  
ATOM 6437  C C    . PHE A 1 121 ? 19.396  1.181   -36.817 1.00 0.00 ? 121 PHE A C    3  
ATOM 6438  O O    . PHE A 1 121 ? 20.167  1.852   -37.506 1.00 0.00 ? 121 PHE A O    3  
ATOM 6439  C CB   . PHE A 1 121 ? 21.328  0.507   -35.343 1.00 0.00 ? 121 PHE A CB   3  
ATOM 6440  C CG   . PHE A 1 121 ? 21.827  0.332   -33.931 1.00 0.00 ? 121 PHE A CG   3  
ATOM 6441  C CD1  . PHE A 1 121 ? 21.521  1.255   -32.943 1.00 0.00 ? 121 PHE A CD1  3  
ATOM 6442  C CD2  . PHE A 1 121 ? 22.686  -0.707  -33.617 1.00 0.00 ? 121 PHE A CD2  3  
ATOM 6443  C CE1  . PHE A 1 121 ? 22.042  1.128   -31.671 1.00 0.00 ? 121 PHE A CE1  3  
ATOM 6444  C CE2  . PHE A 1 121 ? 23.228  -0.824  -32.353 1.00 0.00 ? 121 PHE A CE2  3  
ATOM 6445  C CZ   . PHE A 1 121 ? 22.900  0.091   -31.374 1.00 0.00 ? 121 PHE A CZ   3  
ATOM 6446  H H    . PHE A 1 121 ? 19.412  -1.368  -35.412 1.00 0.00 ? 121 PHE A H    3  
ATOM 6447  H HA   . PHE A 1 121 ? 19.506  1.508   -34.743 1.00 0.00 ? 121 PHE A HA   3  
ATOM 6448  H HB2  . PHE A 1 121 ? 21.636  -0.374  -35.946 1.00 0.00 ? 121 PHE A HB2  3  
ATOM 6449  H HB3  . PHE A 1 121 ? 21.865  1.402   -35.733 1.00 0.00 ? 121 PHE A HB3  3  
ATOM 6450  H HD1  . PHE A 1 121 ? 20.885  2.102   -33.164 1.00 0.00 ? 121 PHE A HD1  3  
ATOM 6451  H HD2  . PHE A 1 121 ? 22.954  -1.430  -34.376 1.00 0.00 ? 121 PHE A HD2  3  
ATOM 6452  H HE1  . PHE A 1 121 ? 21.786  1.855   -30.912 1.00 0.00 ? 121 PHE A HE1  3  
ATOM 6453  H HE2  . PHE A 1 121 ? 23.903  -1.640  -32.129 1.00 0.00 ? 121 PHE A HE2  3  
ATOM 6454  H HZ   . PHE A 1 121 ? 23.326  0.002   -30.384 1.00 0.00 ? 121 PHE A HZ   3  
ATOM 6455  N N    . HIS A 1 122 ? 18.159  0.838   -37.249 1.00 0.00 ? 122 HIS A N    3  
ATOM 6456  C CA   . HIS A 1 122 ? 17.515  1.170   -38.503 1.00 0.00 ? 122 HIS A CA   3  
ATOM 6457  C C    . HIS A 1 122 ? 16.067  0.769   -38.305 1.00 0.00 ? 122 HIS A C    3  
ATOM 6458  O O    . HIS A 1 122 ? 15.760  0.050   -37.352 1.00 0.00 ? 122 HIS A O    3  
ATOM 6459  C CB   . HIS A 1 122 ? 18.144  0.465   -39.743 1.00 0.00 ? 122 HIS A CB   3  
ATOM 6460  C CG   . HIS A 1 122 ? 18.819  1.449   -40.653 1.00 0.00 ? 122 HIS A CG   3  
ATOM 6461  N ND1  . HIS A 1 122 ? 19.846  2.266   -40.238 1.00 0.00 ? 122 HIS A ND1  3  
ATOM 6462  C CD2  . HIS A 1 122 ? 18.562  1.801   -41.943 1.00 0.00 ? 122 HIS A CD2  3  
ATOM 6463  C CE1  . HIS A 1 122 ? 20.163  3.065   -41.283 1.00 0.00 ? 122 HIS A CE1  3  
ATOM 6464  N NE2  . HIS A 1 122 ? 19.410  2.819   -42.338 1.00 0.00 ? 122 HIS A NE2  3  
ATOM 6465  H H    . HIS A 1 122 ? 17.570  0.298   -36.643 1.00 0.00 ? 122 HIS A H    3  
ATOM 6466  H HA   . HIS A 1 122 ? 17.528  2.246   -38.626 1.00 0.00 ? 122 HIS A HA   3  
ATOM 6467  H HB2  . HIS A 1 122 ? 18.901  -0.272  -39.398 1.00 0.00 ? 122 HIS A HB2  3  
ATOM 6468  H HB3  . HIS A 1 122 ? 17.409  -0.095  -40.358 1.00 0.00 ? 122 HIS A HB3  3  
ATOM 6469  H HD1  . HIS A 1 122 ? 20.231  2.272   -39.300 1.00 0.00 ? 122 HIS A HD1  3  
ATOM 6470  H HD2  . HIS A 1 122 ? 17.836  1.402   -42.639 1.00 0.00 ? 122 HIS A HD2  3  
ATOM 6471  H HE1  . HIS A 1 122 ? 20.938  3.830   -41.242 1.00 0.00 ? 122 HIS A HE1  3  
ATOM 6472  N N    . LEU A 1 123 ? 15.168  1.236   -39.206 1.00 0.00 ? 123 LEU A N    3  
ATOM 6473  C CA   . LEU A 1 123 ? 13.741  0.947   -39.224 1.00 0.00 ? 123 LEU A CA   3  
ATOM 6474  C C    . LEU A 1 123 ? 13.226  1.540   -40.532 1.00 0.00 ? 123 LEU A C    3  
ATOM 6475  O O    . LEU A 1 123 ? 14.019  1.802   -41.437 1.00 0.00 ? 123 LEU A O    3  
ATOM 6476  C CB   . LEU A 1 123 ? 12.959  1.463   -37.969 1.00 0.00 ? 123 LEU A CB   3  
ATOM 6477  C CG   . LEU A 1 123 ? 12.061  0.390   -37.306 1.00 0.00 ? 123 LEU A CG   3  
ATOM 6478  C CD1  . LEU A 1 123 ? 11.608  0.857   -35.914 1.00 0.00 ? 123 LEU A CD1  3  
ATOM 6479  C CD2  . LEU A 1 123 ? 10.841  -0.015  -38.151 1.00 0.00 ? 123 LEU A CD2  3  
ATOM 6480  H H    . LEU A 1 123 ? 15.450  1.811   -39.976 1.00 0.00 ? 123 LEU A H    3  
ATOM 6481  H HA   . LEU A 1 123 ? 13.636  -0.126  -39.297 1.00 0.00 ? 123 LEU A HA   3  
ATOM 6482  H HB2  . LEU A 1 123 ? 13.712  1.746   -37.200 1.00 0.00 ? 123 LEU A HB2  3  
ATOM 6483  H HB3  . LEU A 1 123 ? 12.374  2.387   -38.151 1.00 0.00 ? 123 LEU A HB3  3  
ATOM 6484  H HG   . LEU A 1 123 ? 12.687  -0.525  -37.163 1.00 0.00 ? 123 LEU A HG   3  
ATOM 6485  H HD11 . LEU A 1 123 ? 11.044  1.810   -35.983 1.00 0.00 ? 123 LEU A HD11 3  
ATOM 6486  H HD12 . LEU A 1 123 ? 10.948  0.094   -35.448 1.00 0.00 ? 123 LEU A HD12 3  
ATOM 6487  H HD13 . LEU A 1 123 ? 12.485  1.012   -35.250 1.00 0.00 ? 123 LEU A HD13 3  
ATOM 6488  H HD21 . LEU A 1 123 ? 11.148  -0.451  -39.124 1.00 0.00 ? 123 LEU A HD21 3  
ATOM 6489  H HD22 . LEU A 1 123 ? 10.251  -0.785  -37.608 1.00 0.00 ? 123 LEU A HD22 3  
ATOM 6490  H HD23 . LEU A 1 123 ? 10.180  0.859   -38.325 1.00 0.00 ? 123 LEU A HD23 3  
ATOM 6491  N N    . ASP A 1 124 ? 11.889  1.768   -40.655 1.00 0.00 ? 124 ASP A N    3  
ATOM 6492  C CA   . ASP A 1 124 ? 11.156  2.383   -41.776 1.00 0.00 ? 124 ASP A CA   3  
ATOM 6493  C C    . ASP A 1 124 ? 10.983  1.537   -43.037 1.00 0.00 ? 124 ASP A C    3  
ATOM 6494  O O    . ASP A 1 124 ? 9.870   1.329   -43.514 1.00 0.00 ? 124 ASP A O    3  
ATOM 6495  C CB   . ASP A 1 124 ? 11.647  3.812   -42.176 1.00 0.00 ? 124 ASP A CB   3  
ATOM 6496  C CG   . ASP A 1 124 ? 11.657  4.733   -40.952 1.00 0.00 ? 124 ASP A CG   3  
ATOM 6497  O OD1  . ASP A 1 124 ? 10.561  4.964   -40.375 1.00 0.00 ? 124 ASP A OD1  3  
ATOM 6498  O OD2  . ASP A 1 124 ? 12.761  5.215   -40.580 1.00 0.00 ? 124 ASP A OD2  3  
ATOM 6499  H H    . ASP A 1 124 ? 11.321  1.530   -39.871 1.00 0.00 ? 124 ASP A H    3  
ATOM 6500  H HA   . ASP A 1 124 ? 10.146  2.510   -41.408 1.00 0.00 ? 124 ASP A HA   3  
ATOM 6501  H HB2  . ASP A 1 124 ? 12.671  3.765   -42.605 1.00 0.00 ? 124 ASP A HB2  3  
ATOM 6502  H HB3  . ASP A 1 124 ? 10.972  4.264   -42.936 1.00 0.00 ? 124 ASP A HB3  3  
ATOM 6503  N N    . ARG A 1 125 ? 12.109  1.051   -43.619 1.00 0.00 ? 125 ARG A N    3  
ATOM 6504  C CA   . ARG A 1 125 ? 12.158  0.276   -44.855 1.00 0.00 ? 125 ARG A CA   3  
ATOM 6505  C C    . ARG A 1 125 ? 12.387  -1.213  -44.599 1.00 0.00 ? 125 ARG A C    3  
ATOM 6506  O O    . ARG A 1 125 ? 13.382  -1.619  -44.001 1.00 0.00 ? 125 ARG A O    3  
ATOM 6507  C CB   . ARG A 1 125 ? 13.287  0.809   -45.781 1.00 0.00 ? 125 ARG A CB   3  
ATOM 6508  C CG   . ARG A 1 125 ? 13.134  2.300   -46.146 1.00 0.00 ? 125 ARG A CG   3  
ATOM 6509  C CD   . ARG A 1 125 ? 14.321  2.855   -46.949 1.00 0.00 ? 125 ARG A CD   3  
ATOM 6510  N NE   . ARG A 1 125 ? 15.522  2.913   -46.041 1.00 0.00 ? 125 ARG A NE   3  
ATOM 6511  C CZ   . ARG A 1 125 ? 16.789  3.186   -46.481 1.00 0.00 ? 125 ARG A CZ   3  
ATOM 6512  N NH1  . ARG A 1 125 ? 17.044  3.380   -47.808 1.00 0.00 ? 125 ARG A NH1  3  
ATOM 6513  N NH2  . ARG A 1 125 ? 17.810  3.266   -45.578 1.00 0.00 ? 125 ARG A NH2  3  
ATOM 6514  H H    . ARG A 1 125 ? 12.994  1.243   -43.185 1.00 0.00 ? 125 ARG A H    3  
ATOM 6515  H HA   . ARG A 1 125 ? 11.224  0.373   -45.396 1.00 0.00 ? 125 ARG A HA   3  
ATOM 6516  H HB2  . ARG A 1 125 ? 14.272  0.677   -45.275 1.00 0.00 ? 125 ARG A HB2  3  
ATOM 6517  H HB3  . ARG A 1 125 ? 13.317  0.236   -46.736 1.00 0.00 ? 125 ARG A HB3  3  
ATOM 6518  H HG2  . ARG A 1 125 ? 12.207  2.428   -46.749 1.00 0.00 ? 125 ARG A HG2  3  
ATOM 6519  H HG3  . ARG A 1 125 ? 13.021  2.913   -45.224 1.00 0.00 ? 125 ARG A HG3  3  
ATOM 6520  H HD2  . ARG A 1 125 ? 14.532  2.198   -47.822 1.00 0.00 ? 125 ARG A HD2  3  
ATOM 6521  H HD3  . ARG A 1 125 ? 14.094  3.886   -47.298 1.00 0.00 ? 125 ARG A HD3  3  
ATOM 6522  H HE   . ARG A 1 125 ? 15.376  2.779   -45.061 1.00 0.00 ? 125 ARG A HE   3  
ATOM 6523  H HH11 . ARG A 1 125 ? 16.301  3.319   -48.473 1.00 0.00 ? 125 ARG A HH11 3  
ATOM 6524  H HH12 . ARG A 1 125 ? 17.975  3.578   -48.116 1.00 0.00 ? 125 ARG A HH12 3  
ATOM 6525  H HH21 . ARG A 1 125 ? 17.627  3.133   -44.604 1.00 0.00 ? 125 ARG A HH21 3  
ATOM 6526  H HH22 . ARG A 1 125 ? 18.738  3.470   -45.891 1.00 0.00 ? 125 ARG A HH22 3  
ATOM 6527  N N    . ARG A 1 126 ? 11.483  -2.097  -45.109 1.00 0.00 ? 126 ARG A N    3  
ATOM 6528  C CA   . ARG A 1 126 ? 11.545  -3.559  -44.981 1.00 0.00 ? 126 ARG A CA   3  
ATOM 6529  C C    . ARG A 1 126 ? 12.354  -4.262  -46.086 1.00 0.00 ? 126 ARG A C    3  
ATOM 6530  O O    . ARG A 1 126 ? 12.101  -5.408  -46.456 1.00 0.00 ? 126 ARG A O    3  
ATOM 6531  C CB   . ARG A 1 126 ? 10.109  -4.158  -44.883 1.00 0.00 ? 126 ARG A CB   3  
ATOM 6532  C CG   . ARG A 1 126 ? 9.181   -3.879  -46.085 1.00 0.00 ? 126 ARG A CG   3  
ATOM 6533  C CD   . ARG A 1 126 ? 7.833   -4.615  -45.997 1.00 0.00 ? 126 ARG A CD   3  
ATOM 6534  N NE   . ARG A 1 126 ? 8.083   -6.098  -46.080 1.00 0.00 ? 126 ARG A NE   3  
ATOM 6535  C CZ   . ARG A 1 126 ? 7.091   -7.037  -45.975 1.00 0.00 ? 126 ARG A CZ   3  
ATOM 6536  N NH1  . ARG A 1 126 ? 5.791   -6.667  -45.792 1.00 0.00 ? 126 ARG A NH1  3  
ATOM 6537  N NH2  . ARG A 1 126 ? 7.413   -8.362  -46.055 1.00 0.00 ? 126 ARG A NH2  3  
ATOM 6538  H H    . ARG A 1 126 ? 10.686  -1.764  -45.605 1.00 0.00 ? 126 ARG A H    3  
ATOM 6539  H HA   . ARG A 1 126 ? 12.035  -3.808  -44.047 1.00 0.00 ? 126 ARG A HA   3  
ATOM 6540  H HB2  . ARG A 1 126 ? 10.182  -5.256  -44.719 1.00 0.00 ? 126 ARG A HB2  3  
ATOM 6541  H HB3  . ARG A 1 126 ? 9.621   -3.737  -43.975 1.00 0.00 ? 126 ARG A HB3  3  
ATOM 6542  H HG2  . ARG A 1 126 ? 8.966   -2.788  -46.140 1.00 0.00 ? 126 ARG A HG2  3  
ATOM 6543  H HG3  . ARG A 1 126 ? 9.681   -4.176  -47.035 1.00 0.00 ? 126 ARG A HG3  3  
ATOM 6544  H HD2  . ARG A 1 126 ? 7.331   -4.375  -45.034 1.00 0.00 ? 126 ARG A HD2  3  
ATOM 6545  H HD3  . ARG A 1 126 ? 7.182   -4.314  -46.847 1.00 0.00 ? 126 ARG A HD3  3  
ATOM 6546  H HE   . ARG A 1 126 ? 9.024   -6.411  -46.211 1.00 0.00 ? 126 ARG A HE   3  
ATOM 6547  H HH11 . ARG A 1 126 ? 5.551   -5.698  -45.732 1.00 0.00 ? 126 ARG A HH11 3  
ATOM 6548  H HH12 . ARG A 1 126 ? 5.079   -7.364  -45.717 1.00 0.00 ? 126 ARG A HH12 3  
ATOM 6549  H HH21 . ARG A 1 126 ? 8.365   -8.637  -46.189 1.00 0.00 ? 126 ARG A HH21 3  
ATOM 6550  H HH22 . ARG A 1 126 ? 6.696   -9.056  -45.979 1.00 0.00 ? 126 ARG A HH22 3  
ATOM 6551  N N    . LEU A 1 127 ? 13.379  -3.566  -46.635 1.00 0.00 ? 127 LEU A N    3  
ATOM 6552  C CA   . LEU A 1 127 ? 14.255  -4.028  -47.691 1.00 0.00 ? 127 LEU A CA   3  
ATOM 6553  C C    . LEU A 1 127 ? 15.676  -3.643  -47.310 1.00 0.00 ? 127 LEU A C    3  
ATOM 6554  O O    . LEU A 1 127 ? 16.248  -2.665  -47.786 1.00 0.00 ? 127 LEU A O    3  
ATOM 6555  C CB   . LEU A 1 127 ? 13.820  -3.479  -49.086 1.00 0.00 ? 127 LEU A CB   3  
ATOM 6556  C CG   . LEU A 1 127 ? 14.024  -4.440  -50.287 1.00 0.00 ? 127 LEU A CG   3  
ATOM 6557  C CD1  . LEU A 1 127 ? 15.481  -4.892  -50.496 1.00 0.00 ? 127 LEU A CD1  3  
ATOM 6558  C CD2  . LEU A 1 127 ? 13.079  -5.652  -50.203 1.00 0.00 ? 127 LEU A CD2  3  
ATOM 6559  H H    . LEU A 1 127 ? 13.559  -2.649  -46.289 1.00 0.00 ? 127 LEU A H    3  
ATOM 6560  H HA   . LEU A 1 127 ? 14.229  -5.108  -47.732 1.00 0.00 ? 127 LEU A HA   3  
ATOM 6561  H HB2  . LEU A 1 127 ? 12.726  -3.284  -49.029 1.00 0.00 ? 127 LEU A HB2  3  
ATOM 6562  H HB3  . LEU A 1 127 ? 14.296  -2.501  -49.309 1.00 0.00 ? 127 LEU A HB3  3  
ATOM 6563  H HG   . LEU A 1 127 ? 13.726  -3.867  -51.200 1.00 0.00 ? 127 LEU A HG   3  
ATOM 6564  H HD11 . LEU A 1 127 ? 16.150  -4.010  -50.589 1.00 0.00 ? 127 LEU A HD11 3  
ATOM 6565  H HD12 . LEU A 1 127 ? 15.826  -5.515  -49.649 1.00 0.00 ? 127 LEU A HD12 3  
ATOM 6566  H HD13 . LEU A 1 127 ? 15.567  -5.502  -51.421 1.00 0.00 ? 127 LEU A HD13 3  
ATOM 6567  H HD21 . LEU A 1 127 ? 12.024  -5.316  -50.109 1.00 0.00 ? 127 LEU A HD21 3  
ATOM 6568  H HD22 . LEU A 1 127 ? 13.167  -6.271  -51.121 1.00 0.00 ? 127 LEU A HD22 3  
ATOM 6569  H HD23 . LEU A 1 127 ? 13.325  -6.287  -49.329 1.00 0.00 ? 127 LEU A HD23 3  
ATOM 6570  N N    . GLU A 1 128 ? 16.284  -4.453  -46.407 1.00 0.00 ? 128 GLU A N    3  
ATOM 6571  C CA   . GLU A 1 128 ? 17.655  -4.313  -45.927 1.00 0.00 ? 128 GLU A CA   3  
ATOM 6572  C C    . GLU A 1 128 ? 18.340  -5.636  -46.230 1.00 0.00 ? 128 GLU A C    3  
ATOM 6573  O O    . GLU A 1 128 ? 19.061  -6.199  -45.412 1.00 0.00 ? 128 GLU A O    3  
ATOM 6574  C CB   . GLU A 1 128 ? 17.713  -3.968  -44.410 1.00 0.00 ? 128 GLU A CB   3  
ATOM 6575  C CG   . GLU A 1 128 ? 17.065  -2.608  -44.081 1.00 0.00 ? 128 GLU A CG   3  
ATOM 6576  C CD   . GLU A 1 128 ? 17.191  -2.306  -42.588 1.00 0.00 ? 128 GLU A CD   3  
ATOM 6577  O OE1  . GLU A 1 128 ? 18.349  -2.203  -42.099 1.00 0.00 ? 128 GLU A OE1  3  
ATOM 6578  O OE2  . GLU A 1 128 ? 16.133  -2.166  -41.918 1.00 0.00 ? 128 GLU A OE2  3  
ATOM 6579  H H    . GLU A 1 128 ? 15.781  -5.228  -46.033 1.00 0.00 ? 128 GLU A H    3  
ATOM 6580  H HA   . GLU A 1 128 ? 18.187  -3.546  -46.478 1.00 0.00 ? 128 GLU A HA   3  
ATOM 6581  H HB2  . GLU A 1 128 ? 17.198  -4.761  -43.823 1.00 0.00 ? 128 GLU A HB2  3  
ATOM 6582  H HB3  . GLU A 1 128 ? 18.779  -3.932  -44.081 1.00 0.00 ? 128 GLU A HB3  3  
ATOM 6583  H HG2  . GLU A 1 128 ? 17.570  -1.805  -44.659 1.00 0.00 ? 128 GLU A HG2  3  
ATOM 6584  H HG3  . GLU A 1 128 ? 15.991  -2.625  -44.364 1.00 0.00 ? 128 GLU A HG3  3  
ATOM 6585  N N    . ARG A 1 129 ? 18.050  -6.156  -47.451 1.00 0.00 ? 129 ARG A N    3  
ATOM 6586  C CA   . ARG A 1 129 ? 18.445  -7.430  -48.050 1.00 0.00 ? 129 ARG A CA   3  
ATOM 6587  C C    . ARG A 1 129 ? 17.789  -8.677  -47.407 1.00 0.00 ? 129 ARG A C    3  
ATOM 6588  O O    . ARG A 1 129 ? 18.502  -9.596  -47.003 1.00 0.00 ? 129 ARG A O    3  
ATOM 6589  C CB   . ARG A 1 129 ? 19.997  -7.542  -48.171 1.00 0.00 ? 129 ARG A CB   3  
ATOM 6590  C CG   . ARG A 1 129 ? 20.543  -8.543  -49.210 1.00 0.00 ? 129 ARG A CG   3  
ATOM 6591  C CD   . ARG A 1 129 ? 20.217  -8.176  -50.666 1.00 0.00 ? 129 ARG A CD   3  
ATOM 6592  N NE   . ARG A 1 129 ? 20.818  -9.226  -51.563 1.00 0.00 ? 129 ARG A NE   3  
ATOM 6593  C CZ   . ARG A 1 129 ? 20.746  -9.172  -52.930 1.00 0.00 ? 129 ARG A CZ   3  
ATOM 6594  N NH1  . ARG A 1 129 ? 20.121  -8.135  -53.558 1.00 0.00 ? 129 ARG A NH1  3  
ATOM 6595  N NH2  . ARG A 1 129 ? 21.301  -10.176 -53.671 1.00 0.00 ? 129 ARG A NH2  3  
ATOM 6596  H H    . ARG A 1 129 ? 17.455  -5.597  -48.022 1.00 0.00 ? 129 ARG A H    3  
ATOM 6597  H HA   . ARG A 1 129 ? 18.065  -7.390  -49.060 1.00 0.00 ? 129 ARG A HA   3  
ATOM 6598  H HB2  . ARG A 1 129 ? 20.383  -6.537  -48.459 1.00 0.00 ? 129 ARG A HB2  3  
ATOM 6599  H HB3  . ARG A 1 129 ? 20.430  -7.772  -47.172 1.00 0.00 ? 129 ARG A HB3  3  
ATOM 6600  H HG2  . ARG A 1 129 ? 21.653  -8.571  -49.099 1.00 0.00 ? 129 ARG A HG2  3  
ATOM 6601  H HG3  . ARG A 1 129 ? 20.162  -9.562  -48.981 1.00 0.00 ? 129 ARG A HG3  3  
ATOM 6602  H HD2  . ARG A 1 129 ? 19.118  -8.154  -50.824 1.00 0.00 ? 129 ARG A HD2  3  
ATOM 6603  H HD3  . ARG A 1 129 ? 20.656  -7.185  -50.914 1.00 0.00 ? 129 ARG A HD3  3  
ATOM 6604  H HE   . ARG A 1 129 ? 21.282  -10.003 -51.139 1.00 0.00 ? 129 ARG A HE   3  
ATOM 6605  H HH11 . ARG A 1 129 ? 19.708  -7.400  -53.020 1.00 0.00 ? 129 ARG A HH11 3  
ATOM 6606  H HH12 . ARG A 1 129 ? 20.071  -8.113  -54.557 1.00 0.00 ? 129 ARG A HH12 3  
ATOM 6607  H HH21 . ARG A 1 129 ? 21.756  -10.940 -53.215 1.00 0.00 ? 129 ARG A HH21 3  
ATOM 6608  H HH22 . ARG A 1 129 ? 21.249  -10.147 -54.669 1.00 0.00 ? 129 ARG A HH22 3  
ATOM 6609  N N    . PRO A 1 130 ? 16.438  -8.829  -47.301 1.00 0.00 ? 130 PRO A N    3  
ATOM 6610  C CA   . PRO A 1 130 ? 15.787  -9.974  -46.652 1.00 0.00 ? 130 PRO A CA   3  
ATOM 6611  C C    . PRO A 1 130 ? 15.599  -11.112 -47.664 1.00 0.00 ? 130 PRO A C    3  
ATOM 6612  O O    . PRO A 1 130 ? 14.470  -11.513 -47.942 1.00 0.00 ? 130 PRO A O    3  
ATOM 6613  C CB   . PRO A 1 130 ? 14.442  -9.352  -46.222 1.00 0.00 ? 130 PRO A CB   3  
ATOM 6614  C CG   . PRO A 1 130 ? 14.083  -8.403  -47.373 1.00 0.00 ? 130 PRO A CG   3  
ATOM 6615  C CD   . PRO A 1 130 ? 15.452  -7.880  -47.822 1.00 0.00 ? 130 PRO A CD   3  
ATOM 6616  H HA   . PRO A 1 130 ? 16.351  -10.352 -45.809 1.00 0.00 ? 130 PRO A HA   3  
ATOM 6617  H HB2  . PRO A 1 130 ? 13.646  -10.098 -46.017 1.00 0.00 ? 130 PRO A HB2  3  
ATOM 6618  H HB3  . PRO A 1 130 ? 14.599  -8.746  -45.301 1.00 0.00 ? 130 PRO A HB3  3  
ATOM 6619  H HG2  . PRO A 1 130 ? 13.612  -8.976  -48.200 1.00 0.00 ? 130 PRO A HG2  3  
ATOM 6620  H HG3  . PRO A 1 130 ? 13.396  -7.595  -47.053 1.00 0.00 ? 130 PRO A HG3  3  
ATOM 6621  H HD2  . PRO A 1 130 ? 15.514  -7.820  -48.932 1.00 0.00 ? 130 PRO A HD2  3  
ATOM 6622  H HD3  . PRO A 1 130 ? 15.604  -6.881  -47.366 1.00 0.00 ? 130 PRO A HD3  3  
ATOM 6623  N N    . HIS A 1 131 ? 16.694  -11.627 -48.271 1.00 0.00 ? 131 HIS A N    3  
ATOM 6624  C CA   . HIS A 1 131 ? 16.650  -12.628 -49.330 1.00 0.00 ? 131 HIS A CA   3  
ATOM 6625  C C    . HIS A 1 131 ? 17.555  -13.793 -48.965 1.00 0.00 ? 131 HIS A C    3  
ATOM 6626  O O    . HIS A 1 131 ? 18.739  -13.797 -49.287 1.00 0.00 ? 131 HIS A O    3  
ATOM 6627  C CB   . HIS A 1 131 ? 17.052  -12.027 -50.717 1.00 0.00 ? 131 HIS A CB   3  
ATOM 6628  C CG   . HIS A 1 131 ? 16.381  -10.717 -51.081 1.00 0.00 ? 131 HIS A CG   3  
ATOM 6629  N ND1  . HIS A 1 131 ? 15.079  -10.364 -50.784 1.00 0.00 ? 131 HIS A ND1  3  
ATOM 6630  C CD2  . HIS A 1 131 ? 16.906  -9.644  -51.731 1.00 0.00 ? 131 HIS A CD2  3  
ATOM 6631  C CE1  . HIS A 1 131 ? 14.891  -9.104  -51.247 1.00 0.00 ? 131 HIS A CE1  3  
ATOM 6632  N NE2  . HIS A 1 131 ? 15.975  -8.623  -51.819 1.00 0.00 ? 131 HIS A NE2  3  
ATOM 6633  H H    . HIS A 1 131 ? 17.593  -11.256 -48.023 1.00 0.00 ? 131 HIS A H    3  
ATOM 6634  H HA   . HIS A 1 131 ? 15.652  -13.036 -49.435 1.00 0.00 ? 131 HIS A HA   3  
ATOM 6635  H HB2  . HIS A 1 131 ? 18.146  -11.826 -50.747 1.00 0.00 ? 131 HIS A HB2  3  
ATOM 6636  H HB3  . HIS A 1 131 ? 16.820  -12.760 -51.520 1.00 0.00 ? 131 HIS A HB3  3  
ATOM 6637  H HD1  . HIS A 1 131 ? 14.459  -10.880 -50.185 1.00 0.00 ? 131 HIS A HD1  3  
ATOM 6638  H HD2  . HIS A 1 131 ? 17.889  -9.519  -52.164 1.00 0.00 ? 131 HIS A HD2  3  
ATOM 6639  H HE1  . HIS A 1 131 ? 13.961  -8.549  -51.126 1.00 0.00 ? 131 HIS A HE1  3  
ATOM 6640  N N    . ARG A 1 132 ? 17.005  -14.817 -48.269 1.00 0.00 ? 132 ARG A N    3  
ATOM 6641  C CA   . ARG A 1 132 ? 17.736  -15.988 -47.824 1.00 0.00 ? 132 ARG A CA   3  
ATOM 6642  C C    . ARG A 1 132 ? 16.765  -17.155 -47.862 1.00 0.00 ? 132 ARG A C    3  
ATOM 6643  O O    . ARG A 1 132 ? 15.575  -16.978 -47.608 1.00 0.00 ? 132 ARG A O    3  
ATOM 6644  C CB   . ARG A 1 132 ? 18.309  -15.764 -46.394 1.00 0.00 ? 132 ARG A CB   3  
ATOM 6645  C CG   . ARG A 1 132 ? 19.211  -16.893 -45.861 1.00 0.00 ? 132 ARG A CG   3  
ATOM 6646  C CD   . ARG A 1 132 ? 19.817  -16.566 -44.488 1.00 0.00 ? 132 ARG A CD   3  
ATOM 6647  N NE   . ARG A 1 132 ? 20.646  -17.742 -44.046 1.00 0.00 ? 132 ARG A NE   3  
ATOM 6648  C CZ   . ARG A 1 132 ? 21.284  -17.798 -42.835 1.00 0.00 ? 132 ARG A CZ   3  
ATOM 6649  N NH1  . ARG A 1 132 ? 21.208  -16.759 -41.955 1.00 0.00 ? 132 ARG A NH1  3  
ATOM 6650  N NH2  . ARG A 1 132 ? 22.004  -18.911 -42.508 1.00 0.00 ? 132 ARG A NH2  3  
ATOM 6651  H H    . ARG A 1 132 ? 16.040  -14.814 -48.010 1.00 0.00 ? 132 ARG A H    3  
ATOM 6652  H HA   . ARG A 1 132 ? 18.544  -16.214 -48.510 1.00 0.00 ? 132 ARG A HA   3  
ATOM 6653  H HB2  . ARG A 1 132 ? 18.922  -14.834 -46.424 1.00 0.00 ? 132 ARG A HB2  3  
ATOM 6654  H HB3  . ARG A 1 132 ? 17.481  -15.580 -45.674 1.00 0.00 ? 132 ARG A HB3  3  
ATOM 6655  H HG2  . ARG A 1 132 ? 18.623  -17.832 -45.769 1.00 0.00 ? 132 ARG A HG2  3  
ATOM 6656  H HG3  . ARG A 1 132 ? 20.035  -17.069 -46.588 1.00 0.00 ? 132 ARG A HG3  3  
ATOM 6657  H HD2  . ARG A 1 132 ? 20.468  -15.666 -44.558 1.00 0.00 ? 132 ARG A HD2  3  
ATOM 6658  H HD3  . ARG A 1 132 ? 19.006  -16.391 -43.747 1.00 0.00 ? 132 ARG A HD3  3  
ATOM 6659  H HE   . ARG A 1 132 ? 20.725  -18.524 -44.665 1.00 0.00 ? 132 ARG A HE   3  
ATOM 6660  H HH11 . ARG A 1 132 ? 20.682  -15.942 -42.192 1.00 0.00 ? 132 ARG A HH11 3  
ATOM 6661  H HH12 . ARG A 1 132 ? 21.680  -16.814 -41.074 1.00 0.00 ? 132 ARG A HH12 3  
ATOM 6662  H HH21 . ARG A 1 132 ? 22.060  -19.677 -43.147 1.00 0.00 ? 132 ARG A HH21 3  
ATOM 6663  H HH22 . ARG A 1 132 ? 22.471  -18.962 -41.624 1.00 0.00 ? 132 ARG A HH22 3  
ATOM 6664  N N    . ASP A 1 133 ? 17.252  -18.378 -48.190 1.00 0.00 ? 133 ASP A N    3  
ATOM 6665  C CA   . ASP A 1 133 ? 16.464  -19.603 -48.272 1.00 0.00 ? 133 ASP A CA   3  
ATOM 6666  C C    . ASP A 1 133 ? 17.237  -20.688 -47.552 1.00 0.00 ? 133 ASP A C    3  
ATOM 6667  O O    . ASP A 1 133 ? 18.467  -20.649 -47.518 1.00 0.00 ? 133 ASP A O    3  
ATOM 6668  C CB   . ASP A 1 133 ? 16.198  -20.056 -49.740 1.00 0.00 ? 133 ASP A CB   3  
ATOM 6669  C CG   . ASP A 1 133 ? 15.322  -19.028 -50.463 1.00 0.00 ? 133 ASP A CG   3  
ATOM 6670  O OD1  . ASP A 1 133 ? 14.152  -18.842 -50.033 1.00 0.00 ? 133 ASP A OD1  3  
ATOM 6671  O OD2  . ASP A 1 133 ? 15.812  -18.419 -51.451 1.00 0.00 ? 133 ASP A OD2  3  
ATOM 6672  H H    . ASP A 1 133 ? 18.223  -18.502 -48.383 1.00 0.00 ? 133 ASP A H    3  
ATOM 6673  H HA   . ASP A 1 133 ? 15.520  -19.492 -47.749 1.00 0.00 ? 133 ASP A HA   3  
ATOM 6674  H HB2  . ASP A 1 133 ? 17.159  -20.162 -50.289 1.00 0.00 ? 133 ASP A HB2  3  
ATOM 6675  H HB3  . ASP A 1 133 ? 15.667  -21.034 -49.765 1.00 0.00 ? 133 ASP A HB3  3  
ATOM 6676  N N    . GLY A 1 1   ? -14.045 17.061  0.052   1.00 0.00 ? 1   GLY A N    4  
ATOM 6677  C CA   . GLY A 1 1   ? -15.292 17.621  0.521   1.00 0.00 ? 1   GLY A CA   4  
ATOM 6678  C C    . GLY A 1 1   ? -15.219 17.862  1.993   1.00 0.00 ? 1   GLY A C    4  
ATOM 6679  O O    . GLY A 1 1   ? -16.181 18.304  2.614   1.00 0.00 ? 1   GLY A O    4  
ATOM 6680  H H    . GLY A 1 1   ? -14.072 16.382  -0.680  1.00 0.00 ? 1   GLY A H    4  
ATOM 6681  H HA2  . GLY A 1 1   ? -15.440 18.572  0.033   1.00 0.00 ? 1   GLY A HA2  4  
ATOM 6682  H HA3  . GLY A 1 1   ? -16.077 16.903  0.339   1.00 0.00 ? 1   GLY A HA3  4  
ATOM 6683  N N    . SER A 1 2   ? -14.043 17.570  2.588   1.00 0.00 ? 2   SER A N    4  
ATOM 6684  C CA   . SER A 1 2   ? -13.734 17.723  4.000   1.00 0.00 ? 2   SER A CA   4  
ATOM 6685  C C    . SER A 1 2   ? -12.219 17.863  4.109   1.00 0.00 ? 2   SER A C    4  
ATOM 6686  O O    . SER A 1 2   ? -11.525 17.210  3.327   1.00 0.00 ? 2   SER A O    4  
ATOM 6687  C CB   . SER A 1 2   ? -14.192 16.485  4.843   1.00 0.00 ? 2   SER A CB   4  
ATOM 6688  O OG   . SER A 1 2   ? -13.937 16.612  6.250   1.00 0.00 ? 2   SER A OG   4  
ATOM 6689  H H    . SER A 1 2   ? -13.308 17.218  2.006   1.00 0.00 ? 2   SER A H    4  
ATOM 6690  H HA   . SER A 1 2   ? -14.230 18.610  4.370   1.00 0.00 ? 2   SER A HA   4  
ATOM 6691  H HB2  . SER A 1 2   ? -15.293 16.379  4.714   1.00 0.00 ? 2   SER A HB2  4  
ATOM 6692  H HB3  . SER A 1 2   ? -13.729 15.549  4.455   1.00 0.00 ? 2   SER A HB3  4  
ATOM 6693  H HG   . SER A 1 2   ? -12.985 16.514  6.401   1.00 0.00 ? 2   SER A HG   4  
ATOM 6694  N N    . PRO A 1 3   ? -11.627 18.670  5.025   1.00 0.00 ? 3   PRO A N    4  
ATOM 6695  C CA   . PRO A 1 3   ? -10.187 18.705  5.290   1.00 0.00 ? 3   PRO A CA   4  
ATOM 6696  C C    . PRO A 1 3   ? -9.737  17.533  6.197   1.00 0.00 ? 3   PRO A C    4  
ATOM 6697  O O    . PRO A 1 3   ? -10.563 16.765  6.692   1.00 0.00 ? 3   PRO A O    4  
ATOM 6698  C CB   . PRO A 1 3   ? -9.971  20.085  5.978   1.00 0.00 ? 3   PRO A CB   4  
ATOM 6699  C CG   . PRO A 1 3   ? -11.345 20.777  5.959   1.00 0.00 ? 3   PRO A CG   4  
ATOM 6700  C CD   . PRO A 1 3   ? -12.323 19.610  5.894   1.00 0.00 ? 3   PRO A CD   4  
ATOM 6701  H HA   . PRO A 1 3   ? -9.635  18.643  4.359   1.00 0.00 ? 3   PRO A HA   4  
ATOM 6702  H HB2  . PRO A 1 3   ? -9.670  19.991  7.059   1.00 0.00 ? 3   PRO A HB2  4  
ATOM 6703  H HB3  . PRO A 1 3   ? -9.239  20.696  5.383   1.00 0.00 ? 3   PRO A HB3  4  
ATOM 6704  H HG2  . PRO A 1 3   ? -11.503 21.432  6.840   1.00 0.00 ? 3   PRO A HG2  4  
ATOM 6705  H HG3  . PRO A 1 3   ? -11.440 21.382  5.028   1.00 0.00 ? 3   PRO A HG3  4  
ATOM 6706  H HD2  . PRO A 1 3   ? -12.431 19.132  6.895   1.00 0.00 ? 3   PRO A HD2  4  
ATOM 6707  H HD3  . PRO A 1 3   ? -13.311 19.956  5.522   1.00 0.00 ? 3   PRO A HD3  4  
ATOM 6708  N N    . GLU A 1 4   ? -8.407  17.412  6.420   1.00 0.00 ? 4   GLU A N    4  
ATOM 6709  C CA   . GLU A 1 4   ? -7.754  16.369  7.212   1.00 0.00 ? 4   GLU A CA   4  
ATOM 6710  C C    . GLU A 1 4   ? -7.554  16.715  8.686   1.00 0.00 ? 4   GLU A C    4  
ATOM 6711  O O    . GLU A 1 4   ? -7.365  15.830  9.514   1.00 0.00 ? 4   GLU A O    4  
ATOM 6712  C CB   . GLU A 1 4   ? -6.363  16.058  6.596   1.00 0.00 ? 4   GLU A CB   4  
ATOM 6713  C CG   . GLU A 1 4   ? -6.424  15.293  5.260   1.00 0.00 ? 4   GLU A CG   4  
ATOM 6714  C CD   . GLU A 1 4   ? -6.935  13.870  5.490   1.00 0.00 ? 4   GLU A CD   4  
ATOM 6715  O OE1  . GLU A 1 4   ? -6.239  13.099  6.205   1.00 0.00 ? 4   GLU A OE1  4  
ATOM 6716  O OE2  . GLU A 1 4   ? -8.024  13.534  4.953   1.00 0.00 ? 4   GLU A OE2  4  
ATOM 6717  H H    . GLU A 1 4   ? -7.816  18.068  5.963   1.00 0.00 ? 4   GLU A H    4  
ATOM 6718  H HA   . GLU A 1 4   ? -8.351  15.466  7.199   1.00 0.00 ? 4   GLU A HA   4  
ATOM 6719  H HB2  . GLU A 1 4   ? -5.823  17.013  6.411   1.00 0.00 ? 4   GLU A HB2  4  
ATOM 6720  H HB3  . GLU A 1 4   ? -5.738  15.479  7.306   1.00 0.00 ? 4   GLU A HB3  4  
ATOM 6721  H HG2  . GLU A 1 4   ? -7.087  15.826  4.546   1.00 0.00 ? 4   GLU A HG2  4  
ATOM 6722  H HG3  . GLU A 1 4   ? -5.406  15.238  4.818   1.00 0.00 ? 4   GLU A HG3  4  
ATOM 6723  N N    . PHE A 1 5   ? -7.533  18.030  9.014   1.00 0.00 ? 5   PHE A N    4  
ATOM 6724  C CA   . PHE A 1 5   ? -7.352  18.688  10.318  1.00 0.00 ? 5   PHE A CA   4  
ATOM 6725  C C    . PHE A 1 5   ? -6.021  18.458  11.061  1.00 0.00 ? 5   PHE A C    4  
ATOM 6726  O O    . PHE A 1 5   ? -5.876  18.741  12.248  1.00 0.00 ? 5   PHE A O    4  
ATOM 6727  C CB   . PHE A 1 5   ? -8.640  18.692  11.228  1.00 0.00 ? 5   PHE A CB   4  
ATOM 6728  C CG   . PHE A 1 5   ? -8.824  17.537  12.210  1.00 0.00 ? 5   PHE A CG   4  
ATOM 6729  C CD1  . PHE A 1 5   ? -9.369  16.324  11.816  1.00 0.00 ? 5   PHE A CD1  4  
ATOM 6730  C CD2  . PHE A 1 5   ? -8.469  17.682  13.548  1.00 0.00 ? 5   PHE A CD2  4  
ATOM 6731  C CE1  . PHE A 1 5   ? -9.533  15.288  12.713  1.00 0.00 ? 5   PHE A CE1  4  
ATOM 6732  C CE2  . PHE A 1 5   ? -8.641  16.653  14.448  1.00 0.00 ? 5   PHE A CE2  4  
ATOM 6733  C CZ   . PHE A 1 5   ? -9.168  15.449  14.031  1.00 0.00 ? 5   PHE A CZ   4  
ATOM 6734  H H    . PHE A 1 5   ? -7.686  18.629  8.237   1.00 0.00 ? 5   PHE A H    4  
ATOM 6735  H HA   . PHE A 1 5   ? -7.275  19.727  10.034  1.00 0.00 ? 5   PHE A HA   4  
ATOM 6736  H HB2  . PHE A 1 5   ? -8.653  19.639  11.809  1.00 0.00 ? 5   PHE A HB2  4  
ATOM 6737  H HB3  . PHE A 1 5   ? -9.535  18.729  10.570  1.00 0.00 ? 5   PHE A HB3  4  
ATOM 6738  H HD1  . PHE A 1 5   ? -9.656  16.162  10.786  1.00 0.00 ? 5   PHE A HD1  4  
ATOM 6739  H HD2  . PHE A 1 5   ? -8.034  18.608  13.901  1.00 0.00 ? 5   PHE A HD2  4  
ATOM 6740  H HE1  . PHE A 1 5   ? -9.939  14.342  12.378  1.00 0.00 ? 5   PHE A HE1  4  
ATOM 6741  H HE2  . PHE A 1 5   ? -8.351  16.787  15.482  1.00 0.00 ? 5   PHE A HE2  4  
ATOM 6742  H HZ   . PHE A 1 5   ? -9.290  14.636  14.735  1.00 0.00 ? 5   PHE A HZ   4  
ATOM 6743  N N    . ARG A 1 6   ? -4.989  17.959  10.341  1.00 0.00 ? 6   ARG A N    4  
ATOM 6744  C CA   . ARG A 1 6   ? -3.631  17.576  10.722  1.00 0.00 ? 6   ARG A CA   4  
ATOM 6745  C C    . ARG A 1 6   ? -2.655  18.663  11.187  1.00 0.00 ? 6   ARG A C    4  
ATOM 6746  O O    . ARG A 1 6   ? -1.499  18.758  10.781  1.00 0.00 ? 6   ARG A O    4  
ATOM 6747  C CB   . ARG A 1 6   ? -3.054  16.817  9.526   1.00 0.00 ? 6   ARG A CB   4  
ATOM 6748  C CG   . ARG A 1 6   ? -3.088  17.615  8.208   1.00 0.00 ? 6   ARG A CG   4  
ATOM 6749  C CD   . ARG A 1 6   ? -2.197  16.976  7.147   1.00 0.00 ? 6   ARG A CD   4  
ATOM 6750  N NE   . ARG A 1 6   ? -2.768  15.631  6.783   1.00 0.00 ? 6   ARG A NE   4  
ATOM 6751  C CZ   . ARG A 1 6   ? -2.256  14.837  5.791   1.00 0.00 ? 6   ARG A CZ   4  
ATOM 6752  N NH1  . ARG A 1 6   ? -1.169  15.232  5.068   1.00 0.00 ? 6   ARG A NH1  4  
ATOM 6753  N NH2  . ARG A 1 6   ? -2.848  13.636  5.526   1.00 0.00 ? 6   ARG A NH2  4  
ATOM 6754  H H    . ARG A 1 6   ? -5.185  17.759  9.389   1.00 0.00 ? 6   ARG A H    4  
ATOM 6755  H HA   . ARG A 1 6   ? -3.708  16.876  11.539  1.00 0.00 ? 6   ARG A HA   4  
ATOM 6756  H HB2  . ARG A 1 6   ? -2.018  16.493  9.761   1.00 0.00 ? 6   ARG A HB2  4  
ATOM 6757  H HB3  . ARG A 1 6   ? -3.671  15.902  9.401   1.00 0.00 ? 6   ARG A HB3  4  
ATOM 6758  H HG2  . ARG A 1 6   ? -4.123  17.711  7.821   1.00 0.00 ? 6   ARG A HG2  4  
ATOM 6759  H HG3  . ARG A 1 6   ? -2.691  18.643  8.380   1.00 0.00 ? 6   ARG A HG3  4  
ATOM 6760  H HD2  . ARG A 1 6   ? -2.161  17.635  6.255   1.00 0.00 ? 6   ARG A HD2  4  
ATOM 6761  H HD3  . ARG A 1 6   ? -1.186  16.853  7.596   1.00 0.00 ? 6   ARG A HD3  4  
ATOM 6762  H HE   . ARG A 1 6   ? -3.565  15.305  7.289   1.00 0.00 ? 6   ARG A HE   4  
ATOM 6763  H HH11 . ARG A 1 6   ? -0.738  16.114  5.256   1.00 0.00 ? 6   ARG A HH11 4  
ATOM 6764  H HH12 . ARG A 1 6   ? -0.810  14.643  4.345   1.00 0.00 ? 6   ARG A HH12 4  
ATOM 6765  H HH21 . ARG A 1 6   ? -3.643  13.342  6.055   1.00 0.00 ? 6   ARG A HH21 4  
ATOM 6766  H HH22 . ARG A 1 6   ? -2.484  13.048  4.803   1.00 0.00 ? 6   ARG A HH22 4  
ATOM 6767  N N    . TRP A 1 7   ? -3.208  19.476  12.083  1.00 0.00 ? 7   TRP A N    4  
ATOM 6768  C CA   . TRP A 1 7   ? -2.728  20.618  12.801  1.00 0.00 ? 7   TRP A CA   4  
ATOM 6769  C C    . TRP A 1 7   ? -2.047  20.235  14.118  1.00 0.00 ? 7   TRP A C    4  
ATOM 6770  O O    . TRP A 1 7   ? -1.661  19.092  14.356  1.00 0.00 ? 7   TRP A O    4  
ATOM 6771  C CB   . TRP A 1 7   ? -3.986  21.547  12.958  1.00 0.00 ? 7   TRP A CB   4  
ATOM 6772  C CG   . TRP A 1 7   ? -4.938  21.369  14.159  1.00 0.00 ? 7   TRP A CG   4  
ATOM 6773  C CD1  . TRP A 1 7   ? -5.277  20.263  14.889  1.00 0.00 ? 7   TRP A CD1  4  
ATOM 6774  C CD2  . TRP A 1 7   ? -5.557  22.481  14.814  1.00 0.00 ? 7   TRP A CD2  4  
ATOM 6775  N NE1  . TRP A 1 7   ? -6.002  20.632  15.999  1.00 0.00 ? 7   TRP A NE1  4  
ATOM 6776  C CE2  . TRP A 1 7   ? -6.195  21.999  15.953  1.00 0.00 ? 7   TRP A CE2  4  
ATOM 6777  C CE3  . TRP A 1 7   ? -5.579  23.798  14.482  1.00 0.00 ? 7   TRP A CE3  4  
ATOM 6778  C CZ2  . TRP A 1 7   ? -6.863  22.845  16.792  1.00 0.00 ? 7   TRP A CZ2  4  
ATOM 6779  C CZ3  . TRP A 1 7   ? -6.245  24.663  15.327  1.00 0.00 ? 7   TRP A CZ3  4  
ATOM 6780  C CH2  . TRP A 1 7   ? -6.874  24.191  16.469  1.00 0.00 ? 7   TRP A CH2  4  
ATOM 6781  H H    . TRP A 1 7   ? -4.169  19.234  12.228  1.00 0.00 ? 7   TRP A H    4  
ATOM 6782  H HA   . TRP A 1 7   ? -1.978  21.131  12.216  1.00 0.00 ? 7   TRP A HA   4  
ATOM 6783  H HB2  . TRP A 1 7   ? -3.668  22.610  12.879  1.00 0.00 ? 7   TRP A HB2  4  
ATOM 6784  H HB3  . TRP A 1 7   ? -4.619  21.381  12.055  1.00 0.00 ? 7   TRP A HB3  4  
ATOM 6785  H HD1  . TRP A 1 7   ? -4.995  19.255  14.628  1.00 0.00 ? 7   TRP A HD1  4  
ATOM 6786  H HE1  . TRP A 1 7   ? -6.431  20.017  16.624  1.00 0.00 ? 7   TRP A HE1  4  
ATOM 6787  H HE3  . TRP A 1 7   ? -5.104  24.107  13.561  1.00 0.00 ? 7   TRP A HE3  4  
ATOM 6788  H HZ2  . TRP A 1 7   ? -7.360  22.489  17.682  1.00 0.00 ? 7   TRP A HZ2  4  
ATOM 6789  H HZ3  . TRP A 1 7   ? -6.286  25.720  15.096  1.00 0.00 ? 7   TRP A HZ3  4  
ATOM 6790  H HH2  . TRP A 1 7   ? -7.395  24.889  17.112  1.00 0.00 ? 7   TRP A HH2  4  
ATOM 6791  N N    . THR A 1 8   ? -1.943  21.236  15.017  1.00 0.00 ? 8   THR A N    4  
ATOM 6792  C CA   . THR A 1 8   ? -1.367  21.271  16.345  1.00 0.00 ? 8   THR A CA   4  
ATOM 6793  C C    . THR A 1 8   ? -1.890  20.317  17.404  1.00 0.00 ? 8   THR A C    4  
ATOM 6794  O O    . THR A 1 8   ? -1.120  19.574  17.998  1.00 0.00 ? 8   THR A O    4  
ATOM 6795  C CB   . THR A 1 8   ? -1.548  22.690  16.869  1.00 0.00 ? 8   THR A CB   4  
ATOM 6796  O OG1  . THR A 1 8   ? -1.075  23.616  15.905  1.00 0.00 ? 8   THR A OG1  4  
ATOM 6797  C CG2  . THR A 1 8   ? -0.776  22.914  18.170  1.00 0.00 ? 8   THR A CG2  4  
ATOM 6798  H H    . THR A 1 8   ? -2.251  22.153  14.785  1.00 0.00 ? 8   THR A H    4  
ATOM 6799  H HA   . THR A 1 8   ? -0.309  21.084  16.250  1.00 0.00 ? 8   THR A HA   4  
ATOM 6800  H HB   . THR A 1 8   ? -2.626  22.917  17.023  1.00 0.00 ? 8   THR A HB   4  
ATOM 6801  H HG1  . THR A 1 8   ? -0.408  24.153  16.347  1.00 0.00 ? 8   THR A HG1  4  
ATOM 6802  H HG21 . THR A 1 8   ? 0.254   22.520  18.046  1.00 0.00 ? 8   THR A HG21 4  
ATOM 6803  H HG22 . THR A 1 8   ? -0.752  23.987  18.446  1.00 0.00 ? 8   THR A HG22 4  
ATOM 6804  H HG23 . THR A 1 8   ? -1.273  22.347  18.990  1.00 0.00 ? 8   THR A HG23 4  
ATOM 6805  N N    . LYS A 1 9   ? -3.212  20.331  17.744  1.00 0.00 ? 9   LYS A N    4  
ATOM 6806  C CA   . LYS A 1 9   ? -3.800  19.503  18.809  1.00 0.00 ? 9   LYS A CA   4  
ATOM 6807  C C    . LYS A 1 9   ? -3.917  18.021  18.536  1.00 0.00 ? 9   LYS A C    4  
ATOM 6808  O O    . LYS A 1 9   ? -3.809  17.206  19.446  1.00 0.00 ? 9   LYS A O    4  
ATOM 6809  C CB   . LYS A 1 9   ? -5.042  20.109  19.518  1.00 0.00 ? 9   LYS A CB   4  
ATOM 6810  C CG   . LYS A 1 9   ? -4.863  21.585  19.911  1.00 0.00 ? 9   LYS A CG   4  
ATOM 6811  C CD   . LYS A 1 9   ? -6.045  22.118  20.735  1.00 0.00 ? 9   LYS A CD   4  
ATOM 6812  C CE   . LYS A 1 9   ? -5.907  23.597  21.125  1.00 0.00 ? 9   LYS A CE   4  
ATOM 6813  N NZ   . LYS A 1 9   ? -5.883  24.473  19.930  1.00 0.00 ? 9   LYS A NZ   4  
ATOM 6814  H H    . LYS A 1 9   ? -3.852  20.938  17.279  1.00 0.00 ? 9   LYS A H    4  
ATOM 6815  H HA   . LYS A 1 9   ? -3.034  19.476  19.574  1.00 0.00 ? 9   LYS A HA   4  
ATOM 6816  H HB2  . LYS A 1 9   ? -5.950  20.012  18.895  1.00 0.00 ? 9   LYS A HB2  4  
ATOM 6817  H HB3  . LYS A 1 9   ? -5.235  19.539  20.458  1.00 0.00 ? 9   LYS A HB3  4  
ATOM 6818  H HG2  . LYS A 1 9   ? -3.930  21.687  20.511  1.00 0.00 ? 9   LYS A HG2  4  
ATOM 6819  H HG3  . LYS A 1 9   ? -4.747  22.202  18.993  1.00 0.00 ? 9   LYS A HG3  4  
ATOM 6820  H HD2  . LYS A 1 9   ? -6.987  21.978  20.160  1.00 0.00 ? 9   LYS A HD2  4  
ATOM 6821  H HD3  . LYS A 1 9   ? -6.131  21.517  21.669  1.00 0.00 ? 9   LYS A HD3  4  
ATOM 6822  H HE2  . LYS A 1 9   ? -6.770  23.910  21.751  1.00 0.00 ? 9   LYS A HE2  4  
ATOM 6823  H HE3  . LYS A 1 9   ? -4.966  23.765  21.688  1.00 0.00 ? 9   LYS A HE3  4  
ATOM 6824  H HZ1  . LYS A 1 9   ? -6.759  24.343  19.387  1.00 0.00 ? 9   LYS A HZ1  4  
ATOM 6825  H HZ2  . LYS A 1 9   ? -5.802  25.466  20.229  1.00 0.00 ? 9   LYS A HZ2  4  
ATOM 6826  H HZ3  . LYS A 1 9   ? -5.066  24.223  19.336  1.00 0.00 ? 9   LYS A HZ3  4  
ATOM 6827  N N    . GLU A 1 10  ? -4.067  17.627  17.243  1.00 0.00 ? 10  GLU A N    4  
ATOM 6828  C CA   . GLU A 1 10  ? -4.097  16.257  16.702  1.00 0.00 ? 10  GLU A CA   4  
ATOM 6829  C C    . GLU A 1 10  ? -2.853  15.393  17.009  1.00 0.00 ? 10  GLU A C    4  
ATOM 6830  O O    . GLU A 1 10  ? -2.850  14.165  16.944  1.00 0.00 ? 10  GLU A O    4  
ATOM 6831  C CB   . GLU A 1 10  ? -4.378  16.277  15.180  1.00 0.00 ? 10  GLU A CB   4  
ATOM 6832  C CG   . GLU A 1 10  ? -5.079  14.999  14.687  1.00 0.00 ? 10  GLU A CG   4  
ATOM 6833  C CD   . GLU A 1 10  ? -5.083  14.938  13.162  1.00 0.00 ? 10  GLU A CD   4  
ATOM 6834  O OE1  . GLU A 1 10  ? -4.008  14.613  12.589  1.00 0.00 ? 10  GLU A OE1  4  
ATOM 6835  O OE2  . GLU A 1 10  ? -6.152  15.199  12.551  1.00 0.00 ? 10  GLU A OE2  4  
ATOM 6836  H H    . GLU A 1 10  ? -4.139  18.369  16.572  1.00 0.00 ? 10  GLU A H    4  
ATOM 6837  H HA   . GLU A 1 10  ? -4.935  15.760  17.176  1.00 0.00 ? 10  GLU A HA   4  
ATOM 6838  H HB2  . GLU A 1 10  ? -5.084  17.111  14.970  1.00 0.00 ? 10  GLU A HB2  4  
ATOM 6839  H HB3  . GLU A 1 10  ? -3.450  16.486  14.602  1.00 0.00 ? 10  GLU A HB3  4  
ATOM 6840  H HG2  . GLU A 1 10  ? -4.588  14.084  15.077  1.00 0.00 ? 10  GLU A HG2  4  
ATOM 6841  H HG3  . GLU A 1 10  ? -6.116  15.040  15.084  1.00 0.00 ? 10  GLU A HG3  4  
ATOM 6842  N N    . GLU A 1 11  ? -1.754  16.056  17.452  1.00 0.00 ? 11  GLU A N    4  
ATOM 6843  C CA   . GLU A 1 11  ? -0.518  15.525  18.004  1.00 0.00 ? 11  GLU A CA   4  
ATOM 6844  C C    . GLU A 1 11  ? -0.720  14.788  19.337  1.00 0.00 ? 11  GLU A C    4  
ATOM 6845  O O    . GLU A 1 11  ? 0.006   13.846  19.616  1.00 0.00 ? 11  GLU A O    4  
ATOM 6846  C CB   . GLU A 1 11  ? 0.448   16.721  18.238  1.00 0.00 ? 11  GLU A CB   4  
ATOM 6847  C CG   . GLU A 1 11  ? 0.926   17.333  16.905  1.00 0.00 ? 11  GLU A CG   4  
ATOM 6848  C CD   . GLU A 1 11  ? 1.876   18.511  17.134  1.00 0.00 ? 11  GLU A CD   4  
ATOM 6849  O OE1  . GLU A 1 11  ? 2.172   18.844  18.312  1.00 0.00 ? 11  GLU A OE1  4  
ATOM 6850  O OE2  . GLU A 1 11  ? 2.318   19.102  16.110  1.00 0.00 ? 11  GLU A OE2  4  
ATOM 6851  H H    . GLU A 1 11  ? -1.777  17.053  17.475  1.00 0.00 ? 11  GLU A H    4  
ATOM 6852  H HA   . GLU A 1 11  ? -0.113  14.773  17.301  1.00 0.00 ? 11  GLU A HA   4  
ATOM 6853  H HB2  . GLU A 1 11  ? -0.076  17.512  18.852  1.00 0.00 ? 11  GLU A HB2  4  
ATOM 6854  H HB3  . GLU A 1 11  ? 1.358   16.391  18.791  1.00 0.00 ? 11  GLU A HB3  4  
ATOM 6855  H HG2  . GLU A 1 11  ? 1.480   16.542  16.331  1.00 0.00 ? 11  GLU A HG2  4  
ATOM 6856  H HG3  . GLU A 1 11  ? 0.036   17.713  16.336  1.00 0.00 ? 11  GLU A HG3  4  
ATOM 6857  N N    . GLU A 1 12  ? -1.744  15.142  20.186  1.00 0.00 ? 12  GLU A N    4  
ATOM 6858  C CA   . GLU A 1 12  ? -2.068  14.417  21.433  1.00 0.00 ? 12  GLU A CA   4  
ATOM 6859  C C    . GLU A 1 12  ? -2.739  13.057  21.166  1.00 0.00 ? 12  GLU A C    4  
ATOM 6860  O O    . GLU A 1 12  ? -2.492  12.069  21.846  1.00 0.00 ? 12  GLU A O    4  
ATOM 6861  C CB   . GLU A 1 12  ? -2.875  15.287  22.442  1.00 0.00 ? 12  GLU A CB   4  
ATOM 6862  C CG   . GLU A 1 12  ? -4.388  15.442  22.178  1.00 0.00 ? 12  GLU A CG   4  
ATOM 6863  C CD   . GLU A 1 12  ? -4.960  16.567  23.040  1.00 0.00 ? 12  GLU A CD   4  
ATOM 6864  O OE1  . GLU A 1 12  ? -4.568  17.743  22.815  1.00 0.00 ? 12  GLU A OE1  4  
ATOM 6865  O OE2  . GLU A 1 12  ? -5.799  16.266  23.930  1.00 0.00 ? 12  GLU A OE2  4  
ATOM 6866  H H    . GLU A 1 12  ? -2.351  15.912  19.959  1.00 0.00 ? 12  GLU A H    4  
ATOM 6867  H HA   . GLU A 1 12  ? -1.131  14.186  21.926  1.00 0.00 ? 12  GLU A HA   4  
ATOM 6868  H HB2  . GLU A 1 12  ? -2.755  14.854  23.461  1.00 0.00 ? 12  GLU A HB2  4  
ATOM 6869  H HB3  . GLU A 1 12  ? -2.397  16.292  22.456  1.00 0.00 ? 12  GLU A HB3  4  
ATOM 6870  H HG2  . GLU A 1 12  ? -4.578  15.671  21.111  1.00 0.00 ? 12  GLU A HG2  4  
ATOM 6871  H HG3  . GLU A 1 12  ? -4.909  14.490  22.420  1.00 0.00 ? 12  GLU A HG3  4  
ATOM 6872  N N    . GLU A 1 13  ? -3.568  13.021  20.088  1.00 0.00 ? 13  GLU A N    4  
ATOM 6873  C CA   . GLU A 1 13  ? -4.241  11.863  19.496  1.00 0.00 ? 13  GLU A CA   4  
ATOM 6874  C C    . GLU A 1 13  ? -3.331  10.901  18.709  1.00 0.00 ? 13  GLU A C    4  
ATOM 6875  O O    . GLU A 1 13  ? -3.431  9.694   18.897  1.00 0.00 ? 13  GLU A O    4  
ATOM 6876  C CB   . GLU A 1 13  ? -5.345  12.348  18.504  1.00 0.00 ? 13  GLU A CB   4  
ATOM 6877  C CG   . GLU A 1 13  ? -6.477  13.160  19.166  1.00 0.00 ? 13  GLU A CG   4  
ATOM 6878  C CD   . GLU A 1 13  ? -7.197  12.303  20.206  1.00 0.00 ? 13  GLU A CD   4  
ATOM 6879  O OE1  . GLU A 1 13  ? -7.783  11.259  19.813  1.00 0.00 ? 13  GLU A OE1  4  
ATOM 6880  O OE2  . GLU A 1 13  ? -7.175  12.685  21.407  1.00 0.00 ? 13  GLU A OE2  4  
ATOM 6881  H H    . GLU A 1 13  ? -3.761  13.913  19.684  1.00 0.00 ? 13  GLU A H    4  
ATOM 6882  H HA   . GLU A 1 13  ? -4.693  11.279  20.286  1.00 0.00 ? 13  GLU A HA   4  
ATOM 6883  H HB2  . GLU A 1 13  ? -4.880  13.026  17.750  1.00 0.00 ? 13  GLU A HB2  4  
ATOM 6884  H HB3  . GLU A 1 13  ? -5.784  11.492  17.932  1.00 0.00 ? 13  GLU A HB3  4  
ATOM 6885  H HG2  . GLU A 1 13  ? -6.025  14.056  19.680  1.00 0.00 ? 13  GLU A HG2  4  
ATOM 6886  H HG3  . GLU A 1 13  ? -7.222  13.438  18.365  1.00 0.00 ? 13  GLU A HG3  4  
ATOM 6887  N N    . THR A 1 14  ? -2.443  11.425  17.813  1.00 0.00 ? 14  THR A N    4  
ATOM 6888  C CA   . THR A 1 14  ? -1.469  10.748  16.960  1.00 0.00 ? 14  THR A CA   4  
ATOM 6889  C C    . THR A 1 14  ? -0.188  10.313  17.664  1.00 0.00 ? 14  THR A C    4  
ATOM 6890  O O    . THR A 1 14  ? 0.363   9.258   17.355  1.00 0.00 ? 14  THR A O    4  
ATOM 6891  C CB   . THR A 1 14  ? -1.190  11.579  15.720  1.00 0.00 ? 14  THR A CB   4  
ATOM 6892  O OG1  . THR A 1 14  ? -0.779  12.895  16.003  1.00 0.00 ? 14  THR A OG1  4  
ATOM 6893  C CG2  . THR A 1 14  ? -2.462  11.614  14.854  1.00 0.00 ? 14  THR A CG2  4  
ATOM 6894  H H    . THR A 1 14  ? -2.397  12.403  17.634  1.00 0.00 ? 14  THR A H    4  
ATOM 6895  H HA   . THR A 1 14  ? -1.895  9.838   16.559  1.00 0.00 ? 14  THR A HA   4  
ATOM 6896  H HB   . THR A 1 14  ? -0.358  11.172  15.145  1.00 0.00 ? 14  THR A HB   4  
ATOM 6897  H HG1  . THR A 1 14  ? -1.582  13.376  16.281  1.00 0.00 ? 14  THR A HG1  4  
ATOM 6898  H HG21 . THR A 1 14  ? -3.341  11.990  15.431  1.00 0.00 ? 14  THR A HG21 4  
ATOM 6899  H HG22 . THR A 1 14  ? -2.304  12.265  13.968  1.00 0.00 ? 14  THR A HG22 4  
ATOM 6900  H HG23 . THR A 1 14  ? -2.702  10.589  14.495  1.00 0.00 ? 14  THR A HG23 4  
ATOM 6901  N N    . ARG A 1 15  ? 0.293   11.143  18.629  1.00 0.00 ? 15  ARG A N    4  
ATOM 6902  C CA   . ARG A 1 15  ? 1.429   11.088  19.553  1.00 0.00 ? 15  ARG A CA   4  
ATOM 6903  C C    . ARG A 1 15  ? 2.638   10.197  19.290  1.00 0.00 ? 15  ARG A C    4  
ATOM 6904  O O    . ARG A 1 15  ? 3.767   10.655  19.112  1.00 0.00 ? 15  ARG A O    4  
ATOM 6905  C CB   . ARG A 1 15  ? 0.890   10.872  21.004  1.00 0.00 ? 15  ARG A CB   4  
ATOM 6906  C CG   . ARG A 1 15  ? 1.831   11.210  22.187  1.00 0.00 ? 15  ARG A CG   4  
ATOM 6907  C CD   . ARG A 1 15  ? 2.071   12.715  22.428  1.00 0.00 ? 15  ARG A CD   4  
ATOM 6908  N NE   . ARG A 1 15  ? 3.041   13.253  21.409  1.00 0.00 ? 15  ARG A NE   4  
ATOM 6909  C CZ   . ARG A 1 15  ? 3.113   14.572  21.042  1.00 0.00 ? 15  ARG A CZ   4  
ATOM 6910  N NH1  . ARG A 1 15  ? 2.325   15.511  21.638  1.00 0.00 ? 15  ARG A NH1  4  
ATOM 6911  N NH2  . ARG A 1 15  ? 3.980   14.943  20.055  1.00 0.00 ? 15  ARG A NH2  4  
ATOM 6912  H H    . ARG A 1 15  ? -0.215  11.994  18.791  1.00 0.00 ? 15  ARG A H    4  
ATOM 6913  H HA   . ARG A 1 15  ? 1.830   12.086  19.505  1.00 0.00 ? 15  ARG A HA   4  
ATOM 6914  H HB2  . ARG A 1 15  ? -0.013  11.514  21.123  1.00 0.00 ? 15  ARG A HB2  4  
ATOM 6915  H HB3  . ARG A 1 15  ? 0.535   9.824   21.108  1.00 0.00 ? 15  ARG A HB3  4  
ATOM 6916  H HG2  . ARG A 1 15  ? 1.341   10.820  23.110  1.00 0.00 ? 15  ARG A HG2  4  
ATOM 6917  H HG3  . ARG A 1 15  ? 2.799   10.674  22.092  1.00 0.00 ? 15  ARG A HG3  4  
ATOM 6918  H HD2  . ARG A 1 15  ? 1.100   13.258  22.378  1.00 0.00 ? 15  ARG A HD2  4  
ATOM 6919  H HD3  . ARG A 1 15  ? 2.526   12.863  23.433  1.00 0.00 ? 15  ARG A HD3  4  
ATOM 6920  H HE   . ARG A 1 15  ? 3.636   12.600  20.941  1.00 0.00 ? 15  ARG A HE   4  
ATOM 6921  H HH11 . ARG A 1 15  ? 1.683   15.241  22.356  1.00 0.00 ? 15  ARG A HH11 4  
ATOM 6922  H HH12 . ARG A 1 15  ? 2.387   16.468  21.354  1.00 0.00 ? 15  ARG A HH12 4  
ATOM 6923  H HH21 . ARG A 1 15  ? 4.555   14.257  19.611  1.00 0.00 ? 15  ARG A HH21 4  
ATOM 6924  H HH22 . ARG A 1 15  ? 4.036   15.901  19.775  1.00 0.00 ? 15  ARG A HH22 4  
ATOM 6925  N N    . GLN A 1 16  ? 2.427   8.851   19.264  1.00 0.00 ? 16  GLN A N    4  
ATOM 6926  C CA   . GLN A 1 16  ? 3.460   7.826   19.128  1.00 0.00 ? 16  GLN A CA   4  
ATOM 6927  C C    . GLN A 1 16  ? 3.881   7.532   17.708  1.00 0.00 ? 16  GLN A C    4  
ATOM 6928  O O    . GLN A 1 16  ? 4.772   6.724   17.447  1.00 0.00 ? 16  GLN A O    4  
ATOM 6929  C CB   . GLN A 1 16  ? 3.082   6.535   19.904  1.00 0.00 ? 16  GLN A CB   4  
ATOM 6930  C CG   . GLN A 1 16  ? 2.849   6.773   21.422  1.00 0.00 ? 16  GLN A CG   4  
ATOM 6931  C CD   . GLN A 1 16  ? 4.106   7.299   22.133  1.00 0.00 ? 16  GLN A CD   4  
ATOM 6932  O OE1  . GLN A 1 16  ? 4.578   8.408   21.880  1.00 0.00 ? 16  GLN A OE1  4  
ATOM 6933  N NE2  . GLN A 1 16  ? 4.661   6.492   23.068  1.00 0.00 ? 16  GLN A NE2  4  
ATOM 6934  H H    . GLN A 1 16  ? 1.495   8.501   19.361  1.00 0.00 ? 16  GLN A H    4  
ATOM 6935  H HA   . GLN A 1 16  ? 4.371   8.201   19.576  1.00 0.00 ? 16  GLN A HA   4  
ATOM 6936  H HB2  . GLN A 1 16  ? 2.146   6.113   19.473  1.00 0.00 ? 16  GLN A HB2  4  
ATOM 6937  H HB3  . GLN A 1 16  ? 3.875   5.760   19.795  1.00 0.00 ? 16  GLN A HB3  4  
ATOM 6938  H HG2  . GLN A 1 16  ? 2.048   7.527   21.569  1.00 0.00 ? 16  GLN A HG2  4  
ATOM 6939  H HG3  . GLN A 1 16  ? 2.515   5.826   21.897  1.00 0.00 ? 16  GLN A HG3  4  
ATOM 6940  H HE21 . GLN A 1 16  ? 4.254   5.608   23.272  1.00 0.00 ? 16  GLN A HE21 4  
ATOM 6941  H HE22 . GLN A 1 16  ? 5.463   6.838   23.549  1.00 0.00 ? 16  GLN A HE22 4  
ATOM 6942  N N    . MET A 1 17  ? 3.290   8.260   16.723  1.00 0.00 ? 17  MET A N    4  
ATOM 6943  C CA   . MET A 1 17  ? 3.662   8.237   15.314  1.00 0.00 ? 17  MET A CA   4  
ATOM 6944  C C    . MET A 1 17  ? 5.014   8.903   15.063  1.00 0.00 ? 17  MET A C    4  
ATOM 6945  O O    . MET A 1 17  ? 5.819   8.433   14.266  1.00 0.00 ? 17  MET A O    4  
ATOM 6946  C CB   . MET A 1 17  ? 2.559   8.825   14.396  1.00 0.00 ? 17  MET A CB   4  
ATOM 6947  C CG   . MET A 1 17  ? 2.313   10.351  14.454  1.00 0.00 ? 17  MET A CG   4  
ATOM 6948  S SD   . MET A 1 17  ? 1.520   11.049  12.974  1.00 0.00 ? 17  MET A SD   4  
ATOM 6949  C CE   . MET A 1 17  ? 0.205   9.813   12.858  1.00 0.00 ? 17  MET A CE   4  
ATOM 6950  H H    . MET A 1 17  ? 2.555   8.892   16.975  1.00 0.00 ? 17  MET A H    4  
ATOM 6951  H HA   . MET A 1 17  ? 3.788   7.197   15.033  1.00 0.00 ? 17  MET A HA   4  
ATOM 6952  H HB2  . MET A 1 17  ? 2.796   8.559   13.344  1.00 0.00 ? 17  MET A HB2  4  
ATOM 6953  H HB3  . MET A 1 17  ? 1.605   8.308   14.657  1.00 0.00 ? 17  MET A HB3  4  
ATOM 6954  H HG2  . MET A 1 17  ? 1.721   10.576  15.366  1.00 0.00 ? 17  MET A HG2  4  
ATOM 6955  H HG3  . MET A 1 17  ? 3.262   10.906  14.564  1.00 0.00 ? 17  MET A HG3  4  
ATOM 6956  H HE1  . MET A 1 17  ? -0.300  9.654   13.841  1.00 0.00 ? 17  MET A HE1  4  
ATOM 6957  H HE2  . MET A 1 17  ? -0.573  10.129  12.132  1.00 0.00 ? 17  MET A HE2  4  
ATOM 6958  H HE3  . MET A 1 17  ? 0.599   8.837   12.507  1.00 0.00 ? 17  MET A HE3  4  
ATOM 6959  N N    . TYR A 1 18  ? 5.315   9.993   15.829  1.00 0.00 ? 18  TYR A N    4  
ATOM 6960  C CA   . TYR A 1 18  ? 6.531   10.807  15.818  1.00 0.00 ? 18  TYR A CA   4  
ATOM 6961  C C    . TYR A 1 18  ? 7.821   10.074  16.212  1.00 0.00 ? 18  TYR A C    4  
ATOM 6962  O O    . TYR A 1 18  ? 8.918   10.524  15.899  1.00 0.00 ? 18  TYR A O    4  
ATOM 6963  C CB   . TYR A 1 18  ? 6.317   12.158  16.571  1.00 0.00 ? 18  TYR A CB   4  
ATOM 6964  C CG   . TYR A 1 18  ? 5.247   12.957  15.833  1.00 0.00 ? 18  TYR A CG   4  
ATOM 6965  C CD1  . TYR A 1 18  ? 5.558   13.499  14.593  1.00 0.00 ? 18  TYR A CD1  4  
ATOM 6966  C CD2  . TYR A 1 18  ? 3.945   13.121  16.301  1.00 0.00 ? 18  TYR A CD2  4  
ATOM 6967  C CE1  . TYR A 1 18  ? 4.605   14.147  13.830  1.00 0.00 ? 18  TYR A CE1  4  
ATOM 6968  C CE2  . TYR A 1 18  ? 2.990   13.771  15.534  1.00 0.00 ? 18  TYR A CE2  4  
ATOM 6969  C CZ   . TYR A 1 18  ? 3.317   14.277  14.294  1.00 0.00 ? 18  TYR A CZ   4  
ATOM 6970  O OH   . TYR A 1 18  ? 2.333   14.915  13.509  1.00 0.00 ? 18  TYR A OH   4  
ATOM 6971  H H    . TYR A 1 18  ? 4.635   10.317  16.487  1.00 0.00 ? 18  TYR A H    4  
ATOM 6972  H HA   . TYR A 1 18  ? 6.706   11.058  14.780  1.00 0.00 ? 18  TYR A HA   4  
ATOM 6973  H HB2  . TYR A 1 18  ? 6.023   11.975  17.628  1.00 0.00 ? 18  TYR A HB2  4  
ATOM 6974  H HB3  . TYR A 1 18  ? 7.246   12.768  16.572  1.00 0.00 ? 18  TYR A HB3  4  
ATOM 6975  H HD1  . TYR A 1 18  ? 6.559   13.398  14.191  1.00 0.00 ? 18  TYR A HD1  4  
ATOM 6976  H HD2  . TYR A 1 18  ? 3.642   12.721  17.259  1.00 0.00 ? 18  TYR A HD2  4  
ATOM 6977  H HE1  . TYR A 1 18  ? 4.881   14.543  12.861  1.00 0.00 ? 18  TYR A HE1  4  
ATOM 6978  H HE2  . TYR A 1 18  ? 1.970   13.877  15.886  1.00 0.00 ? 18  TYR A HE2  4  
ATOM 6979  H HH   . TYR A 1 18  ? 2.724   15.155  12.665  1.00 0.00 ? 18  TYR A HH   4  
ATOM 6980  N N    . ASP A 1 19  ? 7.686   8.891   16.870  1.00 0.00 ? 19  ASP A N    4  
ATOM 6981  C CA   . ASP A 1 19  ? 8.751   7.958   17.226  1.00 0.00 ? 19  ASP A CA   4  
ATOM 6982  C C    . ASP A 1 19  ? 9.057   6.979   16.082  1.00 0.00 ? 19  ASP A C    4  
ATOM 6983  O O    . ASP A 1 19  ? 10.020  7.171   15.347  1.00 0.00 ? 19  ASP A O    4  
ATOM 6984  C CB   . ASP A 1 19  ? 8.417   7.161   18.520  1.00 0.00 ? 19  ASP A CB   4  
ATOM 6985  C CG   . ASP A 1 19  ? 8.226   8.135   19.686  1.00 0.00 ? 19  ASP A CG   4  
ATOM 6986  O OD1  . ASP A 1 19  ? 9.213   8.830   20.046  1.00 0.00 ? 19  ASP A OD1  4  
ATOM 6987  O OD2  . ASP A 1 19  ? 7.091   8.195   20.229  1.00 0.00 ? 19  ASP A OD2  4  
ATOM 6988  H H    . ASP A 1 19  ? 6.762   8.591   17.091  1.00 0.00 ? 19  ASP A H    4  
ATOM 6989  H HA   . ASP A 1 19  ? 9.666   8.512   17.404  1.00 0.00 ? 19  ASP A HA   4  
ATOM 6990  H HB2  . ASP A 1 19  ? 7.479   6.578   18.388  1.00 0.00 ? 19  ASP A HB2  4  
ATOM 6991  H HB3  . ASP A 1 19  ? 9.240   6.461   18.783  1.00 0.00 ? 19  ASP A HB3  4  
ATOM 6992  N N    . MET A 1 20  ? 8.260   5.878   15.920  1.00 0.00 ? 20  MET A N    4  
ATOM 6993  C CA   . MET A 1 20  ? 8.392   4.803   14.928  1.00 0.00 ? 20  MET A CA   4  
ATOM 6994  C C    . MET A 1 20  ? 7.949   5.044   13.509  1.00 0.00 ? 20  MET A C    4  
ATOM 6995  O O    . MET A 1 20  ? 8.538   4.483   12.592  1.00 0.00 ? 20  MET A O    4  
ATOM 6996  C CB   . MET A 1 20  ? 7.885   3.407   15.464  1.00 0.00 ? 20  MET A CB   4  
ATOM 6997  C CG   . MET A 1 20  ? 6.561   2.763   14.936  1.00 0.00 ? 20  MET A CG   4  
ATOM 6998  S SD   . MET A 1 20  ? 6.468   2.056   13.224  1.00 0.00 ? 20  MET A SD   4  
ATOM 6999  C CE   . MET A 1 20  ? 8.147   1.517   12.744  1.00 0.00 ? 20  MET A CE   4  
ATOM 7000  H H    . MET A 1 20  ? 7.499   5.758   16.548  1.00 0.00 ? 20  MET A H    4  
ATOM 7001  H HA   . MET A 1 20  ? 9.458   4.696   14.738  1.00 0.00 ? 20  MET A HA   4  
ATOM 7002  H HB2  . MET A 1 20  ? 8.685   2.657   15.285  1.00 0.00 ? 20  MET A HB2  4  
ATOM 7003  H HB3  . MET A 1 20  ? 7.765   3.491   16.569  1.00 0.00 ? 20  MET A HB3  4  
ATOM 7004  H HG2  . MET A 1 20  ? 6.323   1.935   15.644  1.00 0.00 ? 20  MET A HG2  4  
ATOM 7005  H HG3  . MET A 1 20  ? 5.746   3.508   15.065  1.00 0.00 ? 20  MET A HG3  4  
ATOM 7006  H HE1  . MET A 1 20  ? 8.944   2.152   13.186  1.00 0.00 ? 20  MET A HE1  4  
ATOM 7007  H HE2  . MET A 1 20  ? 8.331   0.481   13.092  1.00 0.00 ? 20  MET A HE2  4  
ATOM 7008  H HE3  . MET A 1 20  ? 8.288   1.573   11.626  1.00 0.00 ? 20  MET A HE3  4  
ATOM 7009  N N    . VAL A 1 21  ? 6.889   5.847   13.216  1.00 0.00 ? 21  VAL A N    4  
ATOM 7010  C CA   . VAL A 1 21  ? 6.368   5.963   11.812  1.00 0.00 ? 21  VAL A CA   4  
ATOM 7011  C C    . VAL A 1 21  ? 7.260   6.655   10.811  1.00 0.00 ? 21  VAL A C    4  
ATOM 7012  O O    . VAL A 1 21  ? 7.212   6.319   9.633   1.00 0.00 ? 21  VAL A O    4  
ATOM 7013  C CB   . VAL A 1 21  ? 4.856   5.994   11.546  1.00 0.00 ? 21  VAL A CB   4  
ATOM 7014  C CG1  . VAL A 1 21  ? 4.122   5.106   12.584  1.00 0.00 ? 21  VAL A CG1  4  
ATOM 7015  C CG2  . VAL A 1 21  ? 4.306   7.431   11.468  1.00 0.00 ? 21  VAL A CG2  4  
ATOM 7016  H H    . VAL A 1 21  ? 6.445   6.404   13.961  1.00 0.00 ? 21  VAL A H    4  
ATOM 7017  H HA   . VAL A 1 21  ? 6.527   4.960   11.348  1.00 0.00 ? 21  VAL A HA   4  
ATOM 7018  H HB   . VAL A 1 21  ? 4.693   5.493   10.553  1.00 0.00 ? 21  VAL A HB   4  
ATOM 7019  H HG11 . VAL A 1 21  ? 4.581   4.097   12.650  1.00 0.00 ? 21  VAL A HG11 4  
ATOM 7020  H HG12 . VAL A 1 21  ? 4.168   5.560   13.594  1.00 0.00 ? 21  VAL A HG12 4  
ATOM 7021  H HG13 . VAL A 1 21  ? 3.047   4.940   12.335  1.00 0.00 ? 21  VAL A HG13 4  
ATOM 7022  H HG21 . VAL A 1 21  ? 4.683   8.041   12.307  1.00 0.00 ? 21  VAL A HG21 4  
ATOM 7023  H HG22 . VAL A 1 21  ? 4.595   7.959   10.534  1.00 0.00 ? 21  VAL A HG22 4  
ATOM 7024  H HG23 . VAL A 1 21  ? 3.195   7.424   11.552  1.00 0.00 ? 21  VAL A HG23 4  
ATOM 7025  N N    . VAL A 1 22  ? 8.107   7.639   11.235  1.00 0.00 ? 22  VAL A N    4  
ATOM 7026  C CA   . VAL A 1 22  ? 9.051   8.409   10.414  1.00 0.00 ? 22  VAL A CA   4  
ATOM 7027  C C    . VAL A 1 22  ? 10.011  7.573   9.531   1.00 0.00 ? 22  VAL A C    4  
ATOM 7028  O O    . VAL A 1 22  ? 10.225  7.913   8.370   1.00 0.00 ? 22  VAL A O    4  
ATOM 7029  C CB   . VAL A 1 22  ? 9.734   9.518   11.228  1.00 0.00 ? 22  VAL A CB   4  
ATOM 7030  C CG1  . VAL A 1 22  ? 10.859  9.038   12.171  1.00 0.00 ? 22  VAL A CG1  4  
ATOM 7031  C CG2  . VAL A 1 22  ? 10.226  10.643  10.294  1.00 0.00 ? 22  VAL A CG2  4  
ATOM 7032  H H    . VAL A 1 22  ? 8.114   7.870   12.202  1.00 0.00 ? 22  VAL A H    4  
ATOM 7033  H HA   . VAL A 1 22  ? 8.434   8.951   9.719   1.00 0.00 ? 22  VAL A HA   4  
ATOM 7034  H HB   . VAL A 1 22  ? 8.944   9.948   11.888  1.00 0.00 ? 22  VAL A HB   4  
ATOM 7035  H HG11 . VAL A 1 22  ? 10.481  8.270   12.877  1.00 0.00 ? 22  VAL A HG11 4  
ATOM 7036  H HG12 . VAL A 1 22  ? 11.716  8.636   11.593  1.00 0.00 ? 22  VAL A HG12 4  
ATOM 7037  H HG13 . VAL A 1 22  ? 11.228  9.896   12.774  1.00 0.00 ? 22  VAL A HG13 4  
ATOM 7038  H HG21 . VAL A 1 22  ? 9.419   10.967  9.603   1.00 0.00 ? 22  VAL A HG21 4  
ATOM 7039  H HG22 . VAL A 1 22  ? 10.558  11.520  10.889  1.00 0.00 ? 22  VAL A HG22 4  
ATOM 7040  H HG23 . VAL A 1 22  ? 11.087  10.291  9.684   1.00 0.00 ? 22  VAL A HG23 4  
ATOM 7041  N N    . LYS A 1 23  ? 10.503  6.378   9.994   1.00 0.00 ? 23  LYS A N    4  
ATOM 7042  C CA   . LYS A 1 23  ? 11.220  5.421   9.124   1.00 0.00 ? 23  LYS A CA   4  
ATOM 7043  C C    . LYS A 1 23  ? 10.326  4.648   8.126   1.00 0.00 ? 23  LYS A C    4  
ATOM 7044  O O    . LYS A 1 23  ? 10.728  4.318   7.013   1.00 0.00 ? 23  LYS A O    4  
ATOM 7045  C CB   . LYS A 1 23  ? 12.071  4.425   9.944   1.00 0.00 ? 23  LYS A CB   4  
ATOM 7046  C CG   . LYS A 1 23  ? 11.272  3.622   10.984  1.00 0.00 ? 23  LYS A CG   4  
ATOM 7047  C CD   . LYS A 1 23  ? 11.806  3.778   12.411  1.00 0.00 ? 23  LYS A CD   4  
ATOM 7048  C CE   . LYS A 1 23  ? 11.698  5.213   12.942  1.00 0.00 ? 23  LYS A CE   4  
ATOM 7049  N NZ   . LYS A 1 23  ? 12.148  5.283   14.350  1.00 0.00 ? 23  LYS A NZ   4  
ATOM 7050  H H    . LYS A 1 23  ? 10.315  6.072   10.941  1.00 0.00 ? 23  LYS A H    4  
ATOM 7051  H HA   . LYS A 1 23  ? 11.913  5.985   8.512   1.00 0.00 ? 23  LYS A HA   4  
ATOM 7052  H HB2  . LYS A 1 23  ? 12.614  3.718   9.275   1.00 0.00 ? 23  LYS A HB2  4  
ATOM 7053  H HB3  . LYS A 1 23  ? 12.861  5.009   10.465  1.00 0.00 ? 23  LYS A HB3  4  
ATOM 7054  H HG2  . LYS A 1 23  ? 10.204  3.924   10.978  1.00 0.00 ? 23  LYS A HG2  4  
ATOM 7055  H HG3  . LYS A 1 23  ? 11.296  2.549   10.692  1.00 0.00 ? 23  LYS A HG3  4  
ATOM 7056  H HD2  . LYS A 1 23  ? 11.214  3.106   13.071  1.00 0.00 ? 23  LYS A HD2  4  
ATOM 7057  H HD3  . LYS A 1 23  ? 12.868  3.450   12.444  1.00 0.00 ? 23  LYS A HD3  4  
ATOM 7058  H HE2  . LYS A 1 23  ? 12.335  5.903   12.356  1.00 0.00 ? 23  LYS A HE2  4  
ATOM 7059  H HE3  . LYS A 1 23  ? 10.641  5.563   12.882  1.00 0.00 ? 23  LYS A HE3  4  
ATOM 7060  H HZ1  . LYS A 1 23  ? 11.559  4.653   14.932  1.00 0.00 ? 23  LYS A HZ1  4  
ATOM 7061  H HZ2  . LYS A 1 23  ? 13.142  4.983   14.411  1.00 0.00 ? 23  LYS A HZ2  4  
ATOM 7062  H HZ3  . LYS A 1 23  ? 12.057  6.260   14.694  1.00 0.00 ? 23  LYS A HZ3  4  
ATOM 7063  N N    . ILE A 1 24  ? 9.048   4.375   8.519   1.00 0.00 ? 24  ILE A N    4  
ATOM 7064  C CA   . ILE A 1 24  ? 8.003   3.696   7.745   1.00 0.00 ? 24  ILE A CA   4  
ATOM 7065  C C    . ILE A 1 24  ? 7.370   4.581   6.667   1.00 0.00 ? 24  ILE A C    4  
ATOM 7066  O O    . ILE A 1 24  ? 7.172   4.148   5.531   1.00 0.00 ? 24  ILE A O    4  
ATOM 7067  C CB   . ILE A 1 24  ? 7.027   2.870   8.586   1.00 0.00 ? 24  ILE A CB   4  
ATOM 7068  C CG1  . ILE A 1 24  ? 7.619   1.409   8.709   1.00 0.00 ? 24  ILE A CG1  4  
ATOM 7069  C CG2  . ILE A 1 24  ? 5.556   2.928   8.028   1.00 0.00 ? 24  ILE A CG2  4  
ATOM 7070  C CD1  . ILE A 1 24  ? 6.657   0.392   9.332   1.00 0.00 ? 24  ILE A CD1  4  
ATOM 7071  H H    . ILE A 1 24  ? 8.767   4.705   9.414   1.00 0.00 ? 24  ILE A H    4  
ATOM 7072  H HA   . ILE A 1 24  ? 8.512   2.928   7.205   1.00 0.00 ? 24  ILE A HA   4  
ATOM 7073  H HB   . ILE A 1 24  ? 6.965   3.362   9.592   1.00 0.00 ? 24  ILE A HB   4  
ATOM 7074  H HG12 . ILE A 1 24  ? 7.932   0.997   7.759   1.00 0.00 ? 24  ILE A HG12 4  
ATOM 7075  H HG13 . ILE A 1 24  ? 8.684   1.270   8.962   1.00 0.00 ? 24  ILE A HG13 4  
ATOM 7076  H HG21 . ILE A 1 24  ? 5.496   2.559   6.982   1.00 0.00 ? 24  ILE A HG21 4  
ATOM 7077  H HG22 . ILE A 1 24  ? 4.857   2.317   8.623   1.00 0.00 ? 24  ILE A HG22 4  
ATOM 7078  H HG23 . ILE A 1 24  ? 5.123   3.954   8.067   1.00 0.00 ? 24  ILE A HG23 4  
ATOM 7079  H HD11 . ILE A 1 24  ? 6.169   0.761   10.256  1.00 0.00 ? 24  ILE A HD11 4  
ATOM 7080  H HD12 . ILE A 1 24  ? 5.857   0.153   8.603   1.00 0.00 ? 24  ILE A HD12 4  
ATOM 7081  H HD13 . ILE A 1 24  ? 7.168   -0.571  9.531   1.00 0.00 ? 24  ILE A HD13 4  
ATOM 7082  N N    . ILE A 1 25  ? 7.094   5.887   6.964   1.00 0.00 ? 25  ILE A N    4  
ATOM 7083  C CA   . ILE A 1 25  ? 6.624   6.910   6.003   1.00 0.00 ? 25  ILE A CA   4  
ATOM 7084  C C    . ILE A 1 25  ? 7.715   7.262   4.989   1.00 0.00 ? 25  ILE A C    4  
ATOM 7085  O O    . ILE A 1 25  ? 7.439   7.516   3.816   1.00 0.00 ? 25  ILE A O    4  
ATOM 7086  C CB   . ILE A 1 25  ? 5.946   8.136   6.610   1.00 0.00 ? 25  ILE A CB   4  
ATOM 7087  C CG1  . ILE A 1 25  ? 6.935   9.045   7.377   1.00 0.00 ? 25  ILE A CG1  4  
ATOM 7088  C CG2  . ILE A 1 25  ? 4.778   7.607   7.470   1.00 0.00 ? 25  ILE A CG2  4  
ATOM 7089  C CD1  . ILE A 1 25  ? 6.282   10.089  8.285   1.00 0.00 ? 25  ILE A CD1  4  
ATOM 7090  H H    . ILE A 1 25  ? 7.239   6.202   7.916   1.00 0.00 ? 25  ILE A H    4  
ATOM 7091  H HA   . ILE A 1 25  ? 5.847   6.440   5.413   1.00 0.00 ? 25  ILE A HA   4  
ATOM 7092  H HB   . ILE A 1 25  ? 5.495   8.752   5.794   1.00 0.00 ? 25  ILE A HB   4  
ATOM 7093  H HG12 . ILE A 1 25  ? 7.590   8.389   7.985   1.00 0.00 ? 25  ILE A HG12 4  
ATOM 7094  H HG13 . ILE A 1 25  ? 7.588   9.569   6.642   1.00 0.00 ? 25  ILE A HG13 4  
ATOM 7095  H HG21 . ILE A 1 25  ? 4.148   6.899   6.887   1.00 0.00 ? 25  ILE A HG21 4  
ATOM 7096  H HG22 . ILE A 1 25  ? 5.145   7.060   8.361   1.00 0.00 ? 25  ILE A HG22 4  
ATOM 7097  H HG23 . ILE A 1 25  ? 4.131   8.443   7.815   1.00 0.00 ? 25  ILE A HG23 4  
ATOM 7098  H HD11 . ILE A 1 25  ? 5.558   10.702  7.710   1.00 0.00 ? 25  ILE A HD11 4  
ATOM 7099  H HD12 . ILE A 1 25  ? 5.745   9.603   9.128   1.00 0.00 ? 25  ILE A HD12 4  
ATOM 7100  H HD13 . ILE A 1 25  ? 7.051   10.769  8.710   1.00 0.00 ? 25  ILE A HD13 4  
ATOM 7101  N N    . ASP A 1 26  ? 9.010   7.160   5.440   1.00 0.00 ? 26  ASP A N    4  
ATOM 7102  C CA   . ASP A 1 26  ? 10.226  7.218   4.613   1.00 0.00 ? 26  ASP A CA   4  
ATOM 7103  C C    . ASP A 1 26  ? 10.391  5.988   3.708   1.00 0.00 ? 26  ASP A C    4  
ATOM 7104  O O    . ASP A 1 26  ? 10.841  6.158   2.579   1.00 0.00 ? 26  ASP A O    4  
ATOM 7105  C CB   . ASP A 1 26  ? 11.550  7.472   5.395   1.00 0.00 ? 26  ASP A CB   4  
ATOM 7106  C CG   . ASP A 1 26  ? 11.629  8.898   5.962   1.00 0.00 ? 26  ASP A CG   4  
ATOM 7107  O OD1  . ASP A 1 26  ? 10.707  9.718   5.712   1.00 0.00 ? 26  ASP A OD1  4  
ATOM 7108  O OD2  . ASP A 1 26  ? 12.638  9.179   6.665   1.00 0.00 ? 26  ASP A OD2  4  
ATOM 7109  H H    . ASP A 1 26  ? 9.164   6.953   6.409   1.00 0.00 ? 26  ASP A H    4  
ATOM 7110  H HA   . ASP A 1 26  ? 10.112  8.043   3.920   1.00 0.00 ? 26  ASP A HA   4  
ATOM 7111  H HB2  . ASP A 1 26  ? 11.632  6.748   6.234   1.00 0.00 ? 26  ASP A HB2  4  
ATOM 7112  H HB3  . ASP A 1 26  ? 12.438  7.348   4.734   1.00 0.00 ? 26  ASP A HB3  4  
ATOM 7113  N N    . VAL A 1 27  ? 9.956   4.730   4.107   1.00 0.00 ? 27  VAL A N    4  
ATOM 7114  C CA   . VAL A 1 27  ? 9.884   3.545   3.188   1.00 0.00 ? 27  VAL A CA   4  
ATOM 7115  C C    . VAL A 1 27  ? 8.883   3.735   2.043   1.00 0.00 ? 27  VAL A C    4  
ATOM 7116  O O    . VAL A 1 27  ? 9.203   3.436   0.891   1.00 0.00 ? 27  VAL A O    4  
ATOM 7117  C CB   . VAL A 1 27  ? 9.764   2.067   3.694   1.00 0.00 ? 27  VAL A CB   4  
ATOM 7118  C CG1  . VAL A 1 27  ? 11.051  1.624   4.391   1.00 0.00 ? 27  VAL A CG1  4  
ATOM 7119  C CG2  . VAL A 1 27  ? 8.535   1.610   4.529   1.00 0.00 ? 27  VAL A CG2  4  
ATOM 7120  H H    . VAL A 1 27  ? 9.621   4.595   5.040   1.00 0.00 ? 27  VAL A H    4  
ATOM 7121  H HA   . VAL A 1 27  ? 10.840  3.533   2.679   1.00 0.00 ? 27  VAL A HA   4  
ATOM 7122  H HB   . VAL A 1 27  ? 9.726   1.423   2.769   1.00 0.00 ? 27  VAL A HB   4  
ATOM 7123  H HG11 . VAL A 1 27  ? 11.793  2.442   4.477   1.00 0.00 ? 27  VAL A HG11 4  
ATOM 7124  H HG12 . VAL A 1 27  ? 10.784  1.263   5.419   1.00 0.00 ? 27  VAL A HG12 4  
ATOM 7125  H HG13 . VAL A 1 27  ? 11.484  0.759   3.807   1.00 0.00 ? 27  VAL A HG13 4  
ATOM 7126  H HG21 . VAL A 1 27  ? 7.635   2.217   4.313   1.00 0.00 ? 27  VAL A HG21 4  
ATOM 7127  H HG22 . VAL A 1 27  ? 8.278   0.556   4.266   1.00 0.00 ? 27  VAL A HG22 4  
ATOM 7128  H HG23 . VAL A 1 27  ? 8.753   1.598   5.629   1.00 0.00 ? 27  VAL A HG23 4  
ATOM 7129  N N    . LEU A 1 28  ? 7.678   4.317   2.317   1.00 0.00 ? 28  LEU A N    4  
ATOM 7130  C CA   . LEU A 1 28  ? 6.637   4.681   1.317   1.00 0.00 ? 28  LEU A CA   4  
ATOM 7131  C C    . LEU A 1 28  ? 7.028   5.699   0.240   1.00 0.00 ? 28  LEU A C    4  
ATOM 7132  O O    . LEU A 1 28  ? 6.891   5.436   -0.954  1.00 0.00 ? 28  LEU A O    4  
ATOM 7133  C CB   . LEU A 1 28  ? 5.282   5.093   2.001   1.00 0.00 ? 28  LEU A CB   4  
ATOM 7134  C CG   . LEU A 1 28  ? 4.286   3.931   2.234   1.00 0.00 ? 28  LEU A CG   4  
ATOM 7135  C CD1  . LEU A 1 28  ? 4.928   2.579   2.547   1.00 0.00 ? 28  LEU A CD1  4  
ATOM 7136  C CD2  . LEU A 1 28  ? 3.264   4.214   3.348   1.00 0.00 ? 28  LEU A CD2  4  
ATOM 7137  H H    . LEU A 1 28  ? 7.493   4.472   3.296   1.00 0.00 ? 28  LEU A H    4  
ATOM 7138  H HA   . LEU A 1 28  ? 6.556   3.814   0.675   1.00 0.00 ? 28  LEU A HA   4  
ATOM 7139  H HB2  . LEU A 1 28  ? 5.515   5.597   2.964   1.00 0.00 ? 28  LEU A HB2  4  
ATOM 7140  H HB3  . LEU A 1 28  ? 4.719   5.845   1.397   1.00 0.00 ? 28  LEU A HB3  4  
ATOM 7141  H HG   . LEU A 1 28  ? 3.716   3.830   1.280   1.00 0.00 ? 28  LEU A HG   4  
ATOM 7142  H HD11 . LEU A 1 28  ? 5.539   2.673   3.472   1.00 0.00 ? 28  LEU A HD11 4  
ATOM 7143  H HD12 . LEU A 1 28  ? 4.128   1.830   2.720   1.00 0.00 ? 28  LEU A HD12 4  
ATOM 7144  H HD13 . LEU A 1 28  ? 5.572   2.206   1.726   1.00 0.00 ? 28  LEU A HD13 4  
ATOM 7145  H HD21 . LEU A 1 28  ? 2.732   5.176   3.197   1.00 0.00 ? 28  LEU A HD21 4  
ATOM 7146  H HD22 . LEU A 1 28  ? 2.508   3.393   3.364   1.00 0.00 ? 28  LEU A HD22 4  
ATOM 7147  H HD23 . LEU A 1 28  ? 3.765   4.224   4.342   1.00 0.00 ? 28  LEU A HD23 4  
ATOM 7148  N N    . ARG A 1 29  ? 7.640   6.837   0.639   1.00 0.00 ? 29  ARG A N    4  
ATOM 7149  C CA   . ARG A 1 29  ? 8.298   7.864   -0.208  1.00 0.00 ? 29  ARG A CA   4  
ATOM 7150  C C    . ARG A 1 29  ? 9.357   7.369   -1.233  1.00 0.00 ? 29  ARG A C    4  
ATOM 7151  O O    . ARG A 1 29  ? 9.692   8.043   -2.201  1.00 0.00 ? 29  ARG A O    4  
ATOM 7152  C CB   . ARG A 1 29  ? 8.883   8.946   0.746   1.00 0.00 ? 29  ARG A CB   4  
ATOM 7153  C CG   . ARG A 1 29  ? 9.227   10.320  0.132   1.00 0.00 ? 29  ARG A CG   4  
ATOM 7154  C CD   . ARG A 1 29  ? 8.084   11.001  -0.649  1.00 0.00 ? 29  ARG A CD   4  
ATOM 7155  N NE   . ARG A 1 29  ? 6.883   11.157  0.255   1.00 0.00 ? 29  ARG A NE   4  
ATOM 7156  C CZ   . ARG A 1 29  ? 5.618   10.712  -0.035  1.00 0.00 ? 29  ARG A CZ   4  
ATOM 7157  N NH1  . ARG A 1 29  ? 5.332   10.104  -1.222  1.00 0.00 ? 29  ARG A NH1  4  
ATOM 7158  N NH2  . ARG A 1 29  ? 4.627   10.874  0.891   1.00 0.00 ? 29  ARG A NH2  4  
ATOM 7159  H H    . ARG A 1 29  ? 7.738   6.998   1.642   1.00 0.00 ? 29  ARG A H    4  
ATOM 7160  H HA   . ARG A 1 29  ? 7.549   8.339   -0.859  1.00 0.00 ? 29  ARG A HA   4  
ATOM 7161  H HB2  . ARG A 1 29  ? 8.115   9.133   1.530   1.00 0.00 ? 29  ARG A HB2  4  
ATOM 7162  H HB3  . ARG A 1 29  ? 9.770   8.538   1.284   1.00 0.00 ? 29  ARG A HB3  4  
ATOM 7163  H HG2  . ARG A 1 29  ? 9.542   11.001  0.956   1.00 0.00 ? 29  ARG A HG2  4  
ATOM 7164  H HG3  . ARG A 1 29  ? 10.100  10.208  -0.547  1.00 0.00 ? 29  ARG A HG3  4  
ATOM 7165  H HD2  . ARG A 1 29  ? 8.400   12.018  -0.963  1.00 0.00 ? 29  ARG A HD2  4  
ATOM 7166  H HD3  . ARG A 1 29  ? 7.841   10.411  -1.560  1.00 0.00 ? 29  ARG A HD3  4  
ATOM 7167  H HE   . ARG A 1 29  ? 7.030   11.595  1.143   1.00 0.00 ? 29  ARG A HE   4  
ATOM 7168  H HH11 . ARG A 1 29  ? 6.054   9.975   -1.902  1.00 0.00 ? 29  ARG A HH11 4  
ATOM 7169  H HH12 . ARG A 1 29  ? 4.405   9.781   -1.408  1.00 0.00 ? 29  ARG A HH12 4  
ATOM 7170  H HH21 . ARG A 1 29  ? 4.828   11.315  1.766   1.00 0.00 ? 29  ARG A HH21 4  
ATOM 7171  H HH22 . ARG A 1 29  ? 3.701   10.552  0.693   1.00 0.00 ? 29  ARG A HH22 4  
ATOM 7172  N N    . SER A 1 30  ? 9.992   6.207   -0.926  1.00 0.00 ? 30  SER A N    4  
ATOM 7173  C CA   . SER A 1 30  ? 11.188  5.597   -1.521  1.00 0.00 ? 30  SER A CA   4  
ATOM 7174  C C    . SER A 1 30  ? 10.988  4.927   -2.864  1.00 0.00 ? 30  SER A C    4  
ATOM 7175  O O    . SER A 1 30  ? 11.633  5.259   -3.852  1.00 0.00 ? 30  SER A O    4  
ATOM 7176  C CB   . SER A 1 30  ? 11.898  4.668   -0.467  1.00 0.00 ? 30  SER A CB   4  
ATOM 7177  O OG   . SER A 1 30  ? 11.482  3.295   -0.416  1.00 0.00 ? 30  SER A OG   4  
ATOM 7178  H H    . SER A 1 30  ? 9.508   5.680   -0.229  1.00 0.00 ? 30  SER A H    4  
ATOM 7179  H HA   . SER A 1 30  ? 11.855  6.430   -1.731  1.00 0.00 ? 30  SER A HA   4  
ATOM 7180  H HB2  . SER A 1 30  ? 13.001  4.694   -0.653  1.00 0.00 ? 30  SER A HB2  4  
ATOM 7181  H HB3  . SER A 1 30  ? 11.625  5.095   0.533   1.00 0.00 ? 30  SER A HB3  4  
ATOM 7182  H HG   . SER A 1 30  ? 10.640  3.267   0.090   1.00 0.00 ? 30  SER A HG   4  
ATOM 7183  N N    . HIS A 1 31  ? 9.990   4.006   -2.956  1.00 0.00 ? 31  HIS A N    4  
ATOM 7184  C CA   . HIS A 1 31  ? 9.497   3.425   -4.202  1.00 0.00 ? 31  HIS A CA   4  
ATOM 7185  C C    . HIS A 1 31  ? 8.590   4.414   -4.929  1.00 0.00 ? 31  HIS A C    4  
ATOM 7186  O O    . HIS A 1 31  ? 8.575   4.443   -6.147  1.00 0.00 ? 31  HIS A O    4  
ATOM 7187  C CB   . HIS A 1 31  ? 8.874   2.026   -4.051  1.00 0.00 ? 31  HIS A CB   4  
ATOM 7188  C CG   . HIS A 1 31  ? 7.917   1.969   -2.917  1.00 0.00 ? 31  HIS A CG   4  
ATOM 7189  N ND1  . HIS A 1 31  ? 8.316   1.702   -1.627  1.00 0.00 ? 31  HIS A ND1  4  
ATOM 7190  C CD2  . HIS A 1 31  ? 6.590   2.235   -2.861  1.00 0.00 ? 31  HIS A CD2  4  
ATOM 7191  C CE1  . HIS A 1 31  ? 7.215   1.811   -0.855  1.00 0.00 ? 31  HIS A CE1  4  
ATOM 7192  N NE2  . HIS A 1 31  ? 6.152   2.129   -1.559  1.00 0.00 ? 31  HIS A NE2  4  
ATOM 7193  H H    . HIS A 1 31  ? 9.498   3.700   -2.132  1.00 0.00 ? 31  HIS A H    4  
ATOM 7194  H HA   . HIS A 1 31  ? 10.341  3.289   -4.871  1.00 0.00 ? 31  HIS A HA   4  
ATOM 7195  H HB2  . HIS A 1 31  ? 8.384   1.676   -4.985  1.00 0.00 ? 31  HIS A HB2  4  
ATOM 7196  H HB3  . HIS A 1 31  ? 9.689   1.303   -3.823  1.00 0.00 ? 31  HIS A HB3  4  
ATOM 7197  H HD1  . HIS A 1 31  ? 9.223   1.359   -1.360  1.00 0.00 ? 31  HIS A HD1  4  
ATOM 7198  H HD2  . HIS A 1 31  ? 5.902   2.530   -3.644  1.00 0.00 ? 31  HIS A HD2  4  
ATOM 7199  H HE1  . HIS A 1 31  ? 7.228   1.624   0.214   1.00 0.00 ? 31  HIS A HE1  4  
ATOM 7200  N N    . ASN A 1 32  ? 7.838   5.296   -4.191  1.00 0.00 ? 32  ASN A N    4  
ATOM 7201  C CA   . ASN A 1 32  ? 7.017   6.385   -4.719  1.00 0.00 ? 32  ASN A CA   4  
ATOM 7202  C C    . ASN A 1 32  ? 7.775   7.492   -5.466  1.00 0.00 ? 32  ASN A C    4  
ATOM 7203  O O    . ASN A 1 32  ? 7.261   8.027   -6.439  1.00 0.00 ? 32  ASN A O    4  
ATOM 7204  C CB   . ASN A 1 32  ? 6.134   7.037   -3.617  1.00 0.00 ? 32  ASN A CB   4  
ATOM 7205  C CG   . ASN A 1 32  ? 4.841   6.246   -3.448  1.00 0.00 ? 32  ASN A CG   4  
ATOM 7206  O OD1  . ASN A 1 32  ? 3.855   6.621   -4.086  1.00 0.00 ? 32  ASN A OD1  4  
ATOM 7207  N ND2  . ASN A 1 32  ? 4.810   5.171   -2.631  1.00 0.00 ? 32  ASN A ND2  4  
ATOM 7208  H H    . ASN A 1 32  ? 7.844   5.289   -3.195  1.00 0.00 ? 32  ASN A H    4  
ATOM 7209  H HA   . ASN A 1 32  ? 6.390   5.932   -5.479  1.00 0.00 ? 32  ASN A HA   4  
ATOM 7210  H HB2  . ASN A 1 32  ? 6.683   7.128   -2.664  1.00 0.00 ? 32  ASN A HB2  4  
ATOM 7211  H HB3  . ASN A 1 32  ? 5.789   8.062   -3.896  1.00 0.00 ? 32  ASN A HB3  4  
ATOM 7212  H HD21 . ASN A 1 32  ? 5.658   5.000   -2.067  1.00 0.00 ? 32  ASN A HD21 4  
ATOM 7213  H HD22 . ASN A 1 32  ? 3.904   4.715   -2.576  1.00 0.00 ? 32  ASN A HD22 4  
ATOM 7214  N N    . GLU A 1 33  ? 9.037   7.867   -5.102  1.00 0.00 ? 33  GLU A N    4  
ATOM 7215  C CA   . GLU A 1 33  ? 9.862   8.816   -5.870  1.00 0.00 ? 33  GLU A CA   4  
ATOM 7216  C C    . GLU A 1 33  ? 10.403  8.269   -7.188  1.00 0.00 ? 33  GLU A C    4  
ATOM 7217  O O    . GLU A 1 33  ? 10.482  8.989   -8.171  1.00 0.00 ? 33  GLU A O    4  
ATOM 7218  C CB   . GLU A 1 33  ? 10.952  9.504   -5.000  1.00 0.00 ? 33  GLU A CB   4  
ATOM 7219  C CG   . GLU A 1 33  ? 12.185  8.648   -4.680  1.00 0.00 ? 33  GLU A CG   4  
ATOM 7220  C CD   . GLU A 1 33  ? 13.144  9.417   -3.775  1.00 0.00 ? 33  GLU A CD   4  
ATOM 7221  O OE1  . GLU A 1 33  ? 12.754  9.708   -2.611  1.00 0.00 ? 33  GLU A OE1  4  
ATOM 7222  O OE2  . GLU A 1 33  ? 14.278  9.720   -4.230  1.00 0.00 ? 33  GLU A OE2  4  
ATOM 7223  H H    . GLU A 1 33  ? 9.469   7.480   -4.283  1.00 0.00 ? 33  GLU A H    4  
ATOM 7224  H HA   . GLU A 1 33  ? 9.203   9.586   -6.246  1.00 0.00 ? 33  GLU A HA   4  
ATOM 7225  H HB2  . GLU A 1 33  ? 11.281  10.438  -5.510  1.00 0.00 ? 33  GLU A HB2  4  
ATOM 7226  H HB3  . GLU A 1 33  ? 10.494  9.774   -4.024  1.00 0.00 ? 33  GLU A HB3  4  
ATOM 7227  H HG2  . GLU A 1 33  ? 11.879  7.708   -4.179  1.00 0.00 ? 33  GLU A HG2  4  
ATOM 7228  H HG3  . GLU A 1 33  ? 12.680  8.406   -5.637  1.00 0.00 ? 33  GLU A HG3  4  
ATOM 7229  N N    . ALA A 1 34  ? 10.738  6.952   -7.226  1.00 0.00 ? 34  ALA A N    4  
ATOM 7230  C CA   . ALA A 1 34  ? 11.039  6.128   -8.404  1.00 0.00 ? 34  ALA A CA   4  
ATOM 7231  C C    . ALA A 1 34  ? 9.849   5.735   -9.254  1.00 0.00 ? 34  ALA A C    4  
ATOM 7232  O O    . ALA A 1 34  ? 9.977   5.457   -10.450 1.00 0.00 ? 34  ALA A O    4  
ATOM 7233  C CB   . ALA A 1 34  ? 12.013  4.986   -8.083  1.00 0.00 ? 34  ALA A CB   4  
ATOM 7234  H H    . ALA A 1 34  ? 10.647  6.427   -6.380  1.00 0.00 ? 34  ALA A H    4  
ATOM 7235  H HA   . ALA A 1 34  ? 11.522  6.766   -9.140  1.00 0.00 ? 34  ALA A HA   4  
ATOM 7236  H HB1  . ALA A 1 34  ? 12.969  5.418   -7.712  1.00 0.00 ? 34  ALA A HB1  4  
ATOM 7237  H HB2  . ALA A 1 34  ? 11.606  4.354   -7.269  1.00 0.00 ? 34  ALA A HB2  4  
ATOM 7238  H HB3  . ALA A 1 34  ? 12.254  4.366   -8.971  1.00 0.00 ? 34  ALA A HB3  4  
ATOM 7239  N N    . CYS A 1 35  ? 8.619   5.681   -8.653  1.00 0.00 ? 35  CYS A N    4  
ATOM 7240  C CA   . CYS A 1 35  ? 7.345   5.310   -9.276  1.00 0.00 ? 35  CYS A CA   4  
ATOM 7241  C C    . CYS A 1 35  ? 6.968   6.130   -10.486 1.00 0.00 ? 35  CYS A C    4  
ATOM 7242  O O    . CYS A 1 35  ? 6.423   5.566   -11.420 1.00 0.00 ? 35  CYS A O    4  
ATOM 7243  C CB   . CYS A 1 35  ? 6.126   5.161   -8.286  1.00 0.00 ? 35  CYS A CB   4  
ATOM 7244  S SG   . CYS A 1 35  ? 5.028   6.569   -7.807  1.00 0.00 ? 35  CYS A SG   4  
ATOM 7245  H H    . CYS A 1 35  ? 8.561   5.868   -7.669  1.00 0.00 ? 35  CYS A H    4  
ATOM 7246  H HA   . CYS A 1 35  ? 7.530   4.316   -9.659  1.00 0.00 ? 35  CYS A HA   4  
ATOM 7247  H HB2  . CYS A 1 35  ? 5.453   4.367   -8.722  1.00 0.00 ? 35  CYS A HB2  4  
ATOM 7248  H HB3  . CYS A 1 35  ? 6.594   4.808   -7.335  1.00 0.00 ? 35  CYS A HB3  4  
ATOM 7249  H HG   . CYS A 1 35  ? 5.967   7.391   -7.351  1.00 0.00 ? 35  CYS A HG   4  
ATOM 7250  N N    . GLN A 1 36  ? 7.369   7.442   -10.528 1.00 0.00 ? 36  GLN A N    4  
ATOM 7251  C CA   . GLN A 1 36  ? 7.292   8.445   -11.609 1.00 0.00 ? 36  GLN A CA   4  
ATOM 7252  C C    . GLN A 1 36  ? 7.875   8.045   -12.975 1.00 0.00 ? 36  GLN A C    4  
ATOM 7253  O O    . GLN A 1 36  ? 7.835   8.802   -13.938 1.00 0.00 ? 36  GLN A O    4  
ATOM 7254  C CB   . GLN A 1 36  ? 7.767   9.858   -11.159 1.00 0.00 ? 36  GLN A CB   4  
ATOM 7255  C CG   . GLN A 1 36  ? 9.258   10.015  -10.792 1.00 0.00 ? 36  GLN A CG   4  
ATOM 7256  C CD   . GLN A 1 36  ? 10.188  10.308  -11.975 1.00 0.00 ? 36  GLN A CD   4  
ATOM 7257  O OE1  . GLN A 1 36  ? 10.117  11.337  -12.652 1.00 0.00 ? 36  GLN A OE1  4  
ATOM 7258  N NE2  . GLN A 1 36  ? 11.140  9.369   -12.210 1.00 0.00 ? 36  GLN A NE2  4  
ATOM 7259  H H    . GLN A 1 36  ? 7.830   7.803   -9.706  1.00 0.00 ? 36  GLN A H    4  
ATOM 7260  H HA   . GLN A 1 36  ? 6.237   8.571   -11.803 1.00 0.00 ? 36  GLN A HA   4  
ATOM 7261  H HB2  . GLN A 1 36  ? 7.481   10.620  -11.919 1.00 0.00 ? 36  GLN A HB2  4  
ATOM 7262  H HB3  . GLN A 1 36  ? 7.194   10.093  -10.232 1.00 0.00 ? 36  GLN A HB3  4  
ATOM 7263  H HG2  . GLN A 1 36  ? 9.364   10.870  -10.087 1.00 0.00 ? 36  GLN A HG2  4  
ATOM 7264  H HG3  . GLN A 1 36  ? 9.593   9.095   -10.279 1.00 0.00 ? 36  GLN A HG3  4  
ATOM 7265  H HE21 . GLN A 1 36  ? 11.145  8.535   -11.661 1.00 0.00 ? 36  GLN A HE21 4  
ATOM 7266  H HE22 . GLN A 1 36  ? 11.692  9.474   -13.031 1.00 0.00 ? 36  GLN A HE22 4  
ATOM 7267  N N    . GLU A 1 37  ? 8.581   6.896   -12.990 1.00 0.00 ? 37  GLU A N    4  
ATOM 7268  C CA   . GLU A 1 37  ? 9.376   6.355   -14.085 1.00 0.00 ? 37  GLU A CA   4  
ATOM 7269  C C    . GLU A 1 37  ? 8.991   4.924   -14.375 1.00 0.00 ? 37  GLU A C    4  
ATOM 7270  O O    . GLU A 1 37  ? 8.795   4.555   -15.532 1.00 0.00 ? 37  GLU A O    4  
ATOM 7271  C CB   . GLU A 1 37  ? 10.883  6.425   -13.686 1.00 0.00 ? 37  GLU A CB   4  
ATOM 7272  C CG   . GLU A 1 37  ? 11.917  5.537   -14.418 1.00 0.00 ? 37  GLU A CG   4  
ATOM 7273  C CD   . GLU A 1 37  ? 12.077  5.951   -15.881 1.00 0.00 ? 37  GLU A CD   4  
ATOM 7274  O OE1  . GLU A 1 37  ? 12.506  7.109   -16.127 1.00 0.00 ? 37  GLU A OE1  4  
ATOM 7275  O OE2  . GLU A 1 37  ? 11.775  5.111   -16.772 1.00 0.00 ? 37  GLU A OE2  4  
ATOM 7276  H H    . GLU A 1 37  ? 8.402   6.348   -12.154 1.00 0.00 ? 37  GLU A H    4  
ATOM 7277  H HA   . GLU A 1 37  ? 9.213   6.908   -15.003 1.00 0.00 ? 37  GLU A HA   4  
ATOM 7278  H HB2  . GLU A 1 37  ? 11.201  7.479   -13.821 1.00 0.00 ? 37  GLU A HB2  4  
ATOM 7279  H HB3  . GLU A 1 37  ? 10.973  6.189   -12.601 1.00 0.00 ? 37  GLU A HB3  4  
ATOM 7280  H HG2  . GLU A 1 37  ? 12.887  5.629   -13.890 1.00 0.00 ? 37  GLU A HG2  4  
ATOM 7281  H HG3  . GLU A 1 37  ? 11.647  4.470   -14.340 1.00 0.00 ? 37  GLU A HG3  4  
ATOM 7282  N N    . ASN A 1 38  ? 8.891   4.093   -13.318 1.00 0.00 ? 38  ASN A N    4  
ATOM 7283  C CA   . ASN A 1 38  ? 8.566   2.675   -13.379 1.00 0.00 ? 38  ASN A CA   4  
ATOM 7284  C C    . ASN A 1 38  ? 7.313   2.540   -12.524 1.00 0.00 ? 38  ASN A C    4  
ATOM 7285  O O    . ASN A 1 38  ? 7.379   2.563   -11.293 1.00 0.00 ? 38  ASN A O    4  
ATOM 7286  C CB   . ASN A 1 38  ? 9.689   1.812   -12.766 1.00 0.00 ? 38  ASN A CB   4  
ATOM 7287  C CG   . ASN A 1 38  ? 10.962  1.629   -13.600 1.00 0.00 ? 38  ASN A CG   4  
ATOM 7288  O OD1  . ASN A 1 38  ? 11.128  2.140   -14.706 1.00 0.00 ? 38  ASN A OD1  4  
ATOM 7289  N ND2  . ASN A 1 38  ? 11.917  0.875   -12.990 1.00 0.00 ? 38  ASN A ND2  4  
ATOM 7290  H H    . ASN A 1 38  ? 9.062   4.479   -12.407 1.00 0.00 ? 38  ASN A H    4  
ATOM 7291  H HA   . ASN A 1 38  ? 8.350   2.343   -14.389 1.00 0.00 ? 38  ASN A HA   4  
ATOM 7292  H HB2  . ASN A 1 38  ? 9.966   2.379   -11.861 1.00 0.00 ? 38  ASN A HB2  4  
ATOM 7293  H HB3  . ASN A 1 38  ? 9.327   0.793   -12.507 1.00 0.00 ? 38  ASN A HB3  4  
ATOM 7294  H HD21 . ASN A 1 38  ? 11.727  0.508   -12.084 1.00 0.00 ? 38  ASN A HD21 4  
ATOM 7295  H HD22 . ASN A 1 38  ? 12.792  0.728   -13.445 1.00 0.00 ? 38  ASN A HD22 4  
ATOM 7296  N N    . LYS A 1 39  ? 6.176   2.408   -13.246 1.00 0.00 ? 39  LYS A N    4  
ATOM 7297  C CA   . LYS A 1 39  ? 4.731   2.449   -13.001 1.00 0.00 ? 39  LYS A CA   4  
ATOM 7298  C C    . LYS A 1 39  ? 4.238   2.045   -11.634 1.00 0.00 ? 39  LYS A C    4  
ATOM 7299  O O    . LYS A 1 39  ? 3.424   2.686   -10.983 1.00 0.00 ? 39  LYS A O    4  
ATOM 7300  C CB   . LYS A 1 39  ? 4.016   1.661   -14.158 1.00 0.00 ? 39  LYS A CB   4  
ATOM 7301  C CG   . LYS A 1 39  ? 4.507   0.220   -14.501 1.00 0.00 ? 39  LYS A CG   4  
ATOM 7302  C CD   . LYS A 1 39  ? 3.902   -0.874  -13.600 1.00 0.00 ? 39  LYS A CD   4  
ATOM 7303  C CE   . LYS A 1 39  ? 2.894   -1.785  -14.306 1.00 0.00 ? 39  LYS A CE   4  
ATOM 7304  N NZ   . LYS A 1 39  ? 2.258   -2.711  -13.340 1.00 0.00 ? 39  LYS A NZ   4  
ATOM 7305  H H    . LYS A 1 39  ? 6.363   2.345   -14.209 1.00 0.00 ? 39  LYS A H    4  
ATOM 7306  H HA   . LYS A 1 39  ? 4.417   3.472   -13.100 1.00 0.00 ? 39  LYS A HA   4  
ATOM 7307  H HB2  . LYS A 1 39  ? 2.914   1.640   -14.007 1.00 0.00 ? 39  LYS A HB2  4  
ATOM 7308  H HB3  . LYS A 1 39  ? 4.185   2.259   -15.084 1.00 0.00 ? 39  LYS A HB3  4  
ATOM 7309  H HG2  . LYS A 1 39  ? 4.175   0.008   -15.545 1.00 0.00 ? 39  LYS A HG2  4  
ATOM 7310  H HG3  . LYS A 1 39  ? 5.613   0.160   -14.505 1.00 0.00 ? 39  LYS A HG3  4  
ATOM 7311  H HD2  . LYS A 1 39  ? 4.659   -1.491  -13.056 1.00 0.00 ? 39  LYS A HD2  4  
ATOM 7312  H HD3  . LYS A 1 39  ? 3.377   -0.284  -12.823 1.00 0.00 ? 39  LYS A HD3  4  
ATOM 7313  H HE2  . LYS A 1 39  ? 2.088   -1.184  -14.776 1.00 0.00 ? 39  LYS A HE2  4  
ATOM 7314  H HE3  . LYS A 1 39  ? 3.398   -2.396  -15.082 1.00 0.00 ? 39  LYS A HE3  4  
ATOM 7315  H HZ1  . LYS A 1 39  ? 1.765   -2.163  -12.606 1.00 0.00 ? 39  LYS A HZ1  4  
ATOM 7316  H HZ2  . LYS A 1 39  ? 1.574   -3.316  -13.837 1.00 0.00 ? 39  LYS A HZ2  4  
ATOM 7317  H HZ3  . LYS A 1 39  ? 2.989   -3.305  -12.898 1.00 0.00 ? 39  LYS A HZ3  4  
ATOM 7318  N N    . ASP A 1 40  ? 4.758   0.906   -11.226 1.00 0.00 ? 40  ASP A N    4  
ATOM 7319  C CA   . ASP A 1 40  ? 4.706   0.313   -9.928  1.00 0.00 ? 40  ASP A CA   4  
ATOM 7320  C C    . ASP A 1 40  ? 5.957   -0.543  -9.920  1.00 0.00 ? 40  ASP A C    4  
ATOM 7321  O O    . ASP A 1 40  ? 5.866   -1.723  -10.236 1.00 0.00 ? 40  ASP A O    4  
ATOM 7322  C CB   . ASP A 1 40  ? 3.278   -0.306  -9.749  1.00 0.00 ? 40  ASP A CB   4  
ATOM 7323  C CG   . ASP A 1 40  ? 3.054   -1.593  -8.951  1.00 0.00 ? 40  ASP A CG   4  
ATOM 7324  O OD1  . ASP A 1 40  ? 3.470   -1.657  -7.767  1.00 0.00 ? 40  ASP A OD1  4  
ATOM 7325  O OD2  . ASP A 1 40  ? 2.412   -2.515  -9.523  1.00 0.00 ? 40  ASP A OD2  4  
ATOM 7326  H H    . ASP A 1 40  ? 5.442   0.632   -11.887 1.00 0.00 ? 40  ASP A H    4  
ATOM 7327  H HA   . ASP A 1 40  ? 4.839   1.073   -9.168  1.00 0.00 ? 40  ASP A HA   4  
ATOM 7328  H HB2  . ASP A 1 40  ? 2.714   0.500   -9.242  1.00 0.00 ? 40  ASP A HB2  4  
ATOM 7329  H HB3  . ASP A 1 40  ? 2.773   -0.410  -10.732 1.00 0.00 ? 40  ASP A HB3  4  
ATOM 7330  N N    . LEU A 1 41  ? 7.168   -0.008  -9.577  1.00 0.00 ? 41  LEU A N    4  
ATOM 7331  C CA   . LEU A 1 41  ? 8.465   -0.736  -9.608  1.00 0.00 ? 41  LEU A CA   4  
ATOM 7332  C C    . LEU A 1 41  ? 8.692   -1.924  -8.669  1.00 0.00 ? 41  LEU A C    4  
ATOM 7333  O O    . LEU A 1 41  ? 9.481   -2.817  -8.960  1.00 0.00 ? 41  LEU A O    4  
ATOM 7334  C CB   . LEU A 1 41  ? 9.718   0.148   -9.594  1.00 0.00 ? 41  LEU A CB   4  
ATOM 7335  C CG   . LEU A 1 41  ? 10.053  0.876   -8.291  1.00 0.00 ? 41  LEU A CG   4  
ATOM 7336  C CD1  . LEU A 1 41  ? 11.563  1.108   -8.306  1.00 0.00 ? 41  LEU A CD1  4  
ATOM 7337  C CD2  . LEU A 1 41  ? 9.263   2.178   -8.218  1.00 0.00 ? 41  LEU A CD2  4  
ATOM 7338  H H    . LEU A 1 41  ? 7.217   0.984   -9.462  1.00 0.00 ? 41  LEU A H    4  
ATOM 7339  H HA   . LEU A 1 41  ? 8.539   -1.134  -10.599 1.00 0.00 ? 41  LEU A HA   4  
ATOM 7340  H HB2  . LEU A 1 41  ? 10.598  -0.495  -9.886  1.00 0.00 ? 41  LEU A HB2  4  
ATOM 7341  H HB3  . LEU A 1 41  ? 9.574   0.940   -10.365 1.00 0.00 ? 41  LEU A HB3  4  
ATOM 7342  H HG   . LEU A 1 41  ? 9.819   0.255   -7.396  1.00 0.00 ? 41  LEU A HG   4  
ATOM 7343  H HD11 . LEU A 1 41  ? 11.855  1.612   -9.253  1.00 0.00 ? 41  LEU A HD11 4  
ATOM 7344  H HD12 . LEU A 1 41  ? 11.894  1.690   -7.425  1.00 0.00 ? 41  LEU A HD12 4  
ATOM 7345  H HD13 . LEU A 1 41  ? 12.071  0.120   -8.277  1.00 0.00 ? 41  LEU A HD13 4  
ATOM 7346  H HD21 . LEU A 1 41  ? 9.371   2.736   -9.174  1.00 0.00 ? 41  LEU A HD21 4  
ATOM 7347  H HD22 . LEU A 1 41  ? 8.187   1.992   -8.057  1.00 0.00 ? 41  LEU A HD22 4  
ATOM 7348  H HD23 . LEU A 1 41  ? 9.622   2.804   -7.381  1.00 0.00 ? 41  LEU A HD23 4  
ATOM 7349  N N    . GLN A 1 42  ? 7.925   -1.925  -7.563  1.00 0.00 ? 42  GLN A N    4  
ATOM 7350  C CA   . GLN A 1 42  ? 7.697   -2.866  -6.482  1.00 0.00 ? 42  GLN A CA   4  
ATOM 7351  C C    . GLN A 1 42  ? 6.523   -3.833  -6.756  1.00 0.00 ? 42  GLN A C    4  
ATOM 7352  O O    . GLN A 1 42  ? 5.899   -4.028  -5.724  1.00 0.00 ? 42  GLN A O    4  
ATOM 7353  C CB   . GLN A 1 42  ? 7.696   -2.230  -5.032  1.00 0.00 ? 42  GLN A CB   4  
ATOM 7354  C CG   . GLN A 1 42  ? 9.085   -2.374  -4.373  1.00 0.00 ? 42  GLN A CG   4  
ATOM 7355  C CD   . GLN A 1 42  ? 9.339   -1.455  -3.173  1.00 0.00 ? 42  GLN A CD   4  
ATOM 7356  O OE1  . GLN A 1 42  ? 10.430  -0.937  -2.932  1.00 0.00 ? 42  GLN A OE1  4  
ATOM 7357  N NE2  . GLN A 1 42  ? 8.282   -1.222  -2.365  1.00 0.00 ? 42  GLN A NE2  4  
ATOM 7358  H H    . GLN A 1 42  ? 7.361   -1.113  -7.480  1.00 0.00 ? 42  GLN A H    4  
ATOM 7359  H HA   . GLN A 1 42  ? 8.553   -3.530  -6.476  1.00 0.00 ? 42  GLN A HA   4  
ATOM 7360  H HB2  . GLN A 1 42  ? 7.293   -1.191  -4.990  1.00 0.00 ? 42  GLN A HB2  4  
ATOM 7361  H HB3  . GLN A 1 42  ? 7.039   -2.785  -4.329  1.00 0.00 ? 42  GLN A HB3  4  
ATOM 7362  H HG2  . GLN A 1 42  ? 9.131   -3.432  -4.016  1.00 0.00 ? 42  GLN A HG2  4  
ATOM 7363  H HG3  . GLN A 1 42  ? 9.888   -2.197  -5.115  1.00 0.00 ? 42  GLN A HG3  4  
ATOM 7364  H HE21 . GLN A 1 42  ? 7.368   -1.253  -2.766  1.00 0.00 ? 42  GLN A HE21 4  
ATOM 7365  H HE22 . GLN A 1 42  ? 8.463   -0.660  -1.564  1.00 0.00 ? 42  GLN A HE22 4  
ATOM 7366  N N    . PRO A 1 43  ? 6.046   -4.472  -7.901  1.00 0.00 ? 43  PRO A N    4  
ATOM 7367  C CA   . PRO A 1 43  ? 4.638   -4.750  -8.271  1.00 0.00 ? 43  PRO A CA   4  
ATOM 7368  C C    . PRO A 1 43  ? 3.586   -5.201  -7.233  1.00 0.00 ? 43  PRO A C    4  
ATOM 7369  O O    . PRO A 1 43  ? 2.406   -4.947  -7.451  1.00 0.00 ? 43  PRO A O    4  
ATOM 7370  C CB   . PRO A 1 43  ? 4.779   -5.863  -9.326  1.00 0.00 ? 43  PRO A CB   4  
ATOM 7371  C CG   . PRO A 1 43  ? 6.087   -5.563  -10.063 1.00 0.00 ? 43  PRO A CG   4  
ATOM 7372  C CD   . PRO A 1 43  ? 6.866   -4.651  -9.101  1.00 0.00 ? 43  PRO A CD   4  
ATOM 7373  H HA   . PRO A 1 43  ? 4.274   -3.855  -8.777  1.00 0.00 ? 43  PRO A HA   4  
ATOM 7374  H HB2  . PRO A 1 43  ? 4.883   -6.871  -8.859  1.00 0.00 ? 43  PRO A HB2  4  
ATOM 7375  H HB3  . PRO A 1 43  ? 3.915   -5.878  -10.023 1.00 0.00 ? 43  PRO A HB3  4  
ATOM 7376  H HG2  . PRO A 1 43  ? 6.644   -6.499  -10.282 1.00 0.00 ? 43  PRO A HG2  4  
ATOM 7377  H HG3  . PRO A 1 43  ? 5.864   -5.050  -11.024 1.00 0.00 ? 43  PRO A HG3  4  
ATOM 7378  H HD2  . PRO A 1 43  ? 7.852   -5.104  -8.850  1.00 0.00 ? 43  PRO A HD2  4  
ATOM 7379  H HD3  . PRO A 1 43  ? 7.010   -3.678  -9.612  1.00 0.00 ? 43  PRO A HD3  4  
ATOM 7380  N N    . TYR A 1 44  ? 4.000   -5.828  -6.111  1.00 0.00 ? 44  TYR A N    4  
ATOM 7381  C CA   . TYR A 1 44  ? 3.211   -6.216  -4.967  1.00 0.00 ? 44  TYR A CA   4  
ATOM 7382  C C    . TYR A 1 44  ? 4.270   -6.445  -3.874  1.00 0.00 ? 44  TYR A C    4  
ATOM 7383  O O    . TYR A 1 44  ? 5.286   -7.081  -4.158  1.00 0.00 ? 44  TYR A O    4  
ATOM 7384  C CB   . TYR A 1 44  ? 2.531   -7.626  -5.169  1.00 0.00 ? 44  TYR A CB   4  
ATOM 7385  C CG   . TYR A 1 44  ? 1.278   -7.664  -6.051  1.00 0.00 ? 44  TYR A CG   4  
ATOM 7386  C CD1  . TYR A 1 44  ? 0.014   -7.540  -5.485  1.00 0.00 ? 44  TYR A CD1  4  
ATOM 7387  C CD2  . TYR A 1 44  ? 1.328   -7.929  -7.419  1.00 0.00 ? 44  TYR A CD2  4  
ATOM 7388  C CE1  . TYR A 1 44  ? -1.139  -7.768  -6.215  1.00 0.00 ? 44  TYR A CE1  4  
ATOM 7389  C CE2  . TYR A 1 44  ? 0.173   -8.094  -8.163  1.00 0.00 ? 44  TYR A CE2  4  
ATOM 7390  C CZ   . TYR A 1 44  ? -1.063  -8.044  -7.561  1.00 0.00 ? 44  TYR A CZ   4  
ATOM 7391  O OH   . TYR A 1 44  ? -2.225  -8.267  -8.333  1.00 0.00 ? 44  TYR A OH   4  
ATOM 7392  H H    . TYR A 1 44  ? 4.988   -5.926  -5.969  1.00 0.00 ? 44  TYR A H    4  
ATOM 7393  H HA   . TYR A 1 44  ? 2.552   -5.384  -4.686  1.00 0.00 ? 44  TYR A HA   4  
ATOM 7394  H HB2  . TYR A 1 44  ? 3.287   -8.322  -5.602  1.00 0.00 ? 44  TYR A HB2  4  
ATOM 7395  H HB3  . TYR A 1 44  ? 2.273   -8.100  -4.194  1.00 0.00 ? 44  TYR A HB3  4  
ATOM 7396  H HD1  . TYR A 1 44  ? -0.102  -7.262  -4.450  1.00 0.00 ? 44  TYR A HD1  4  
ATOM 7397  H HD2  . TYR A 1 44  ? 2.266   -8.012  -7.951  1.00 0.00 ? 44  TYR A HD2  4  
ATOM 7398  H HE1  . TYR A 1 44  ? -2.100  -7.696  -5.722  1.00 0.00 ? 44  TYR A HE1  4  
ATOM 7399  H HE2  . TYR A 1 44  ? 0.239   -8.293  -9.225  1.00 0.00 ? 44  TYR A HE2  4  
ATOM 7400  H HH   . TYR A 1 44  ? -2.953  -8.477  -7.743  1.00 0.00 ? 44  TYR A HH   4  
ATOM 7401  N N    . MET A 1 45  ? 4.047   -6.001  -2.606  1.00 0.00 ? 45  MET A N    4  
ATOM 7402  C CA   . MET A 1 45  ? 4.897   -6.318  -1.433  1.00 0.00 ? 45  MET A CA   4  
ATOM 7403  C C    . MET A 1 45  ? 4.046   -6.858  -0.247  1.00 0.00 ? 45  MET A C    4  
ATOM 7404  O O    . MET A 1 45  ? 2.952   -6.329  -0.049  1.00 0.00 ? 45  MET A O    4  
ATOM 7405  C CB   . MET A 1 45  ? 5.831   -5.155  -0.932  1.00 0.00 ? 45  MET A CB   4  
ATOM 7406  C CG   . MET A 1 45  ? 6.191   -4.041  -1.947  1.00 0.00 ? 45  MET A CG   4  
ATOM 7407  S SD   . MET A 1 45  ? 4.994   -2.665  -1.992  1.00 0.00 ? 45  MET A SD   4  
ATOM 7408  C CE   . MET A 1 45  ? 5.573   -1.783  -0.506  1.00 0.00 ? 45  MET A CE   4  
ATOM 7409  H H    . MET A 1 45  ? 3.229   -5.435  -2.449  1.00 0.00 ? 45  MET A H    4  
ATOM 7410  H HA   . MET A 1 45  ? 5.558   -7.123  -1.728  1.00 0.00 ? 45  MET A HA   4  
ATOM 7411  H HB2  . MET A 1 45  ? 5.476   -4.678  0.010   1.00 0.00 ? 45  MET A HB2  4  
ATOM 7412  H HB3  . MET A 1 45  ? 6.795   -5.633  -0.658  1.00 0.00 ? 45  MET A HB3  4  
ATOM 7413  H HG2  . MET A 1 45  ? 7.196   -3.635  -1.674  1.00 0.00 ? 45  MET A HG2  4  
ATOM 7414  H HG3  . MET A 1 45  ? 6.318   -4.483  -2.961  1.00 0.00 ? 45  MET A HG3  4  
ATOM 7415  H HE1  . MET A 1 45  ? 5.932   -2.484  0.281   1.00 0.00 ? 45  MET A HE1  4  
ATOM 7416  H HE2  . MET A 1 45  ? 6.411   -1.089  -0.723  1.00 0.00 ? 45  MET A HE2  4  
ATOM 7417  H HE3  . MET A 1 45  ? 4.756   -1.162  -0.081  1.00 0.00 ? 45  MET A HE3  4  
ATOM 7418  N N    . PRO A 1 46  ? 4.417   -7.861  0.609   1.00 0.00 ? 46  PRO A N    4  
ATOM 7419  C CA   . PRO A 1 46  ? 3.596   -8.381  1.734   1.00 0.00 ? 46  PRO A CA   4  
ATOM 7420  C C    . PRO A 1 46  ? 3.513   -7.403  2.922   1.00 0.00 ? 46  PRO A C    4  
ATOM 7421  O O    . PRO A 1 46  ? 4.229   -6.397  2.921   1.00 0.00 ? 46  PRO A O    4  
ATOM 7422  C CB   . PRO A 1 46  ? 4.400   -9.636  2.158   1.00 0.00 ? 46  PRO A CB   4  
ATOM 7423  C CG   . PRO A 1 46  ? 5.861   -9.273  1.862   1.00 0.00 ? 46  PRO A CG   4  
ATOM 7424  C CD   . PRO A 1 46  ? 5.705   -8.557  0.514   1.00 0.00 ? 46  PRO A CD   4  
ATOM 7425  H HA   . PRO A 1 46  ? 2.581   -8.625  1.425   1.00 0.00 ? 46  PRO A HA   4  
ATOM 7426  H HB2  . PRO A 1 46  ? 4.246   -9.965  3.205   1.00 0.00 ? 46  PRO A HB2  4  
ATOM 7427  H HB3  . PRO A 1 46  ? 4.106   -10.482 1.495   1.00 0.00 ? 46  PRO A HB3  4  
ATOM 7428  H HG2  . PRO A 1 46  ? 6.284   -8.602  2.654   1.00 0.00 ? 46  PRO A HG2  4  
ATOM 7429  H HG3  . PRO A 1 46  ? 6.526   -10.156 1.801   1.00 0.00 ? 46  PRO A HG3  4  
ATOM 7430  H HD2  . PRO A 1 46  ? 6.559   -7.823  0.369   1.00 0.00 ? 46  PRO A HD2  4  
ATOM 7431  H HD3  . PRO A 1 46  ? 5.595   -9.362  -0.287  1.00 0.00 ? 46  PRO A HD3  4  
ATOM 7432  N N    . ILE A 1 47  ? 2.707   -7.700  4.009   1.00 0.00 ? 47  ILE A N    4  
ATOM 7433  C CA   . ILE A 1 47  ? 2.569   -6.875  5.240   1.00 0.00 ? 47  ILE A CA   4  
ATOM 7434  C C    . ILE A 1 47  ? 3.933   -6.737  5.938   1.00 0.00 ? 47  ILE A C    4  
ATOM 7435  O O    . ILE A 1 47  ? 4.384   -5.602  6.091   1.00 0.00 ? 47  ILE A O    4  
ATOM 7436  C CB   . ILE A 1 47  ? 1.425   -7.289  6.201   1.00 0.00 ? 47  ILE A CB   4  
ATOM 7437  C CG1  . ILE A 1 47  ? 0.033   -7.357  5.529   1.00 0.00 ? 47  ILE A CG1  4  
ATOM 7438  C CG2  . ILE A 1 47  ? 1.367   -6.381  7.460   1.00 0.00 ? 47  ILE A CG2  4  
ATOM 7439  C CD1  . ILE A 1 47  ? -0.429  -6.050  4.867   1.00 0.00 ? 47  ILE A CD1  4  
ATOM 7440  H H    . ILE A 1 47  ? 2.165   -8.530  3.982   1.00 0.00 ? 47  ILE A H    4  
ATOM 7441  H HA   . ILE A 1 47  ? 2.323   -5.883  4.904   1.00 0.00 ? 47  ILE A HA   4  
ATOM 7442  H HB   . ILE A 1 47  ? 1.584   -8.328  6.550   1.00 0.00 ? 47  ILE A HB   4  
ATOM 7443  H HG12 . ILE A 1 47  ? 0.089   -8.179  4.721   1.00 0.00 ? 47  ILE A HG12 4  
ATOM 7444  H HG13 . ILE A 1 47  ? -0.712  -7.539  6.392   1.00 0.00 ? 47  ILE A HG13 4  
ATOM 7445  H HG21 . ILE A 1 47  ? 1.307   -5.313  7.167   1.00 0.00 ? 47  ILE A HG21 4  
ATOM 7446  H HG22 . ILE A 1 47  ? 0.474   -6.617  8.077   1.00 0.00 ? 47  ILE A HG22 4  
ATOM 7447  H HG23 . ILE A 1 47  ? 2.253   -6.520  8.113   1.00 0.00 ? 47  ILE A HG23 4  
ATOM 7448  H HD11 . ILE A 1 47  ? -0.291  -5.181  5.543   1.00 0.00 ? 47  ILE A HD11 4  
ATOM 7449  H HD12 . ILE A 1 47  ? 0.122   -5.865  3.922   1.00 0.00 ? 47  ILE A HD12 4  
ATOM 7450  H HD13 . ILE A 1 47  ? -1.515  -6.126  4.630   1.00 0.00 ? 47  ILE A HD13 4  
ATOM 7451  N N    . PRO A 1 48  ? 4.716   -7.789  6.292   1.00 0.00 ? 48  PRO A N    4  
ATOM 7452  C CA   . PRO A 1 48  ? 6.141   -7.757  6.485   1.00 0.00 ? 48  PRO A CA   4  
ATOM 7453  C C    . PRO A 1 48  ? 7.097   -7.160  5.442   1.00 0.00 ? 48  PRO A C    4  
ATOM 7454  O O    . PRO A 1 48  ? 8.214   -6.997  5.865   1.00 0.00 ? 48  PRO A O    4  
ATOM 7455  C CB   . PRO A 1 48  ? 6.551   -8.749  7.597   1.00 0.00 ? 48  PRO A CB   4  
ATOM 7456  C CG   . PRO A 1 48  ? 5.357   -9.733  7.557   1.00 0.00 ? 48  PRO A CG   4  
ATOM 7457  C CD   . PRO A 1 48  ? 4.275   -9.144  6.594   1.00 0.00 ? 48  PRO A CD   4  
ATOM 7458  H HA   . PRO A 1 48  ? 6.181   -6.884  7.082   1.00 0.00 ? 48  PRO A HA   4  
ATOM 7459  H HB2  . PRO A 1 48  ? 7.478   -9.307  7.300   1.00 0.00 ? 48  PRO A HB2  4  
ATOM 7460  H HB3  . PRO A 1 48  ? 6.691   -8.210  8.641   1.00 0.00 ? 48  PRO A HB3  4  
ATOM 7461  H HG2  . PRO A 1 48  ? 5.680   -10.728 7.184   1.00 0.00 ? 48  PRO A HG2  4  
ATOM 7462  H HG3  . PRO A 1 48  ? 4.935   -9.854  8.575   1.00 0.00 ? 48  PRO A HG3  4  
ATOM 7463  H HD2  . PRO A 1 48  ? 4.183   -9.723  5.644   1.00 0.00 ? 48  PRO A HD2  4  
ATOM 7464  H HD3  . PRO A 1 48  ? 3.334   -9.154  7.196   1.00 0.00 ? 48  PRO A HD3  4  
ATOM 7465  N N    . HIS A 1 49  ? 6.894   -6.852  4.107   1.00 0.00 ? 49  HIS A N    4  
ATOM 7466  C CA   . HIS A 1 49  ? 7.945   -6.060  3.368   1.00 0.00 ? 49  HIS A CA   4  
ATOM 7467  C C    . HIS A 1 49  ? 7.881   -4.606  3.815   1.00 0.00 ? 49  HIS A C    4  
ATOM 7468  O O    . HIS A 1 49  ? 8.910   -4.072  4.228   1.00 0.00 ? 49  HIS A O    4  
ATOM 7469  C CB   . HIS A 1 49  ? 8.148   -6.135  1.813   1.00 0.00 ? 49  HIS A CB   4  
ATOM 7470  C CG   . HIS A 1 49  ? 9.314   -5.278  1.210   1.00 0.00 ? 49  HIS A CG   4  
ATOM 7471  N ND1  . HIS A 1 49  ? 10.240  -4.554  1.955   1.00 0.00 ? 49  HIS A ND1  4  
ATOM 7472  C CD2  . HIS A 1 49  ? 9.495   -4.831  -0.068  1.00 0.00 ? 49  HIS A CD2  4  
ATOM 7473  C CE1  . HIS A 1 49  ? 10.844  -3.662  1.142   1.00 0.00 ? 49  HIS A CE1  4  
ATOM 7474  N NE2  . HIS A 1 49  ? 10.441  -3.814  -0.100  1.00 0.00 ? 49  HIS A NE2  4  
ATOM 7475  H H    . HIS A 1 49  ? 5.996   -6.940  3.668   1.00 0.00 ? 49  HIS A H    4  
ATOM 7476  H HA   . HIS A 1 49  ? 8.913   -6.401  3.684   1.00 0.00 ? 49  HIS A HA   4  
ATOM 7477  H HB2  . HIS A 1 49  ? 8.367   -7.193  1.551   1.00 0.00 ? 49  HIS A HB2  4  
ATOM 7478  H HB3  . HIS A 1 49  ? 7.180   -5.857  1.336   1.00 0.00 ? 49  HIS A HB3  4  
ATOM 7479  H HD1  . HIS A 1 49  ? 10.237  -4.486  2.965   1.00 0.00 ? 49  HIS A HD1  4  
ATOM 7480  H HD2  . HIS A 1 49  ? 8.984   -5.108  -0.980  1.00 0.00 ? 49  HIS A HD2  4  
ATOM 7481  H HE1  . HIS A 1 49  ? 11.370  -2.778  1.560   1.00 0.00 ? 49  HIS A HE1  4  
ATOM 7482  N N    . VAL A 1 50  ? 6.680   -3.952  3.889   1.00 0.00 ? 50  VAL A N    4  
ATOM 7483  C CA   . VAL A 1 50  ? 6.545   -2.616  4.519   1.00 0.00 ? 50  VAL A CA   4  
ATOM 7484  C C    . VAL A 1 50  ? 6.968   -2.622  5.999   1.00 0.00 ? 50  VAL A C    4  
ATOM 7485  O O    . VAL A 1 50  ? 7.597   -1.682  6.488   1.00 0.00 ? 50  VAL A O    4  
ATOM 7486  C CB   . VAL A 1 50  ? 5.182   -1.960  4.340   1.00 0.00 ? 50  VAL A CB   4  
ATOM 7487  C CG1  . VAL A 1 50  ? 5.256   -0.493  4.803   1.00 0.00 ? 50  VAL A CG1  4  
ATOM 7488  C CG2  . VAL A 1 50  ? 4.795   -1.981  2.851   1.00 0.00 ? 50  VAL A CG2  4  
ATOM 7489  H H    . VAL A 1 50  ? 5.832   -4.384  3.565   1.00 0.00 ? 50  VAL A H    4  
ATOM 7490  H HA   . VAL A 1 50  ? 7.274   -1.966  4.040   1.00 0.00 ? 50  VAL A HA   4  
ATOM 7491  H HB   . VAL A 1 50  ? 4.404   -2.498  4.923   1.00 0.00 ? 50  VAL A HB   4  
ATOM 7492  H HG11 . VAL A 1 50  ? 6.094   0.007   4.268   1.00 0.00 ? 50  VAL A HG11 4  
ATOM 7493  H HG12 . VAL A 1 50  ? 4.297   0.020   4.597   1.00 0.00 ? 50  VAL A HG12 4  
ATOM 7494  H HG13 . VAL A 1 50  ? 5.467   -0.382  5.885   1.00 0.00 ? 50  VAL A HG13 4  
ATOM 7495  H HG21 . VAL A 1 50  ? 5.597   -1.487  2.264   1.00 0.00 ? 50  VAL A HG21 4  
ATOM 7496  H HG22 . VAL A 1 50  ? 4.656   -3.016  2.471   1.00 0.00 ? 50  VAL A HG22 4  
ATOM 7497  H HG23 . VAL A 1 50  ? 3.851   -1.410  2.696   1.00 0.00 ? 50  VAL A HG23 4  
ATOM 7498  N N    . ARG A 1 51  ? 6.714   -3.778  6.685   1.00 0.00 ? 51  ARG A N    4  
ATOM 7499  C CA   . ARG A 1 51  ? 7.230   -4.096  8.006   1.00 0.00 ? 51  ARG A CA   4  
ATOM 7500  C C    . ARG A 1 51  ? 8.718   -4.381  8.104   1.00 0.00 ? 51  ARG A C    4  
ATOM 7501  O O    . ARG A 1 51  ? 9.348   -3.679  8.855   1.00 0.00 ? 51  ARG A O    4  
ATOM 7502  C CB   . ARG A 1 51  ? 6.417   -5.197  8.721   1.00 0.00 ? 51  ARG A CB   4  
ATOM 7503  C CG   . ARG A 1 51  ? 6.053   -4.980  10.176  1.00 0.00 ? 51  ARG A CG   4  
ATOM 7504  C CD   . ARG A 1 51  ? 4.896   -4.031  10.496  1.00 0.00 ? 51  ARG A CD   4  
ATOM 7505  N NE   . ARG A 1 51  ? 4.916   -2.789  9.642   1.00 0.00 ? 51  ARG A NE   4  
ATOM 7506  C CZ   . ARG A 1 51  ? 4.156   -2.675  8.508   1.00 0.00 ? 51  ARG A CZ   4  
ATOM 7507  N NH1  . ARG A 1 51  ? 3.359   -3.710  8.124   1.00 0.00 ? 51  ARG A NH1  4  
ATOM 7508  N NH2  . ARG A 1 51  ? 4.168   -1.527  7.782   1.00 0.00 ? 51  ARG A NH2  4  
ATOM 7509  H H    . ARG A 1 51  ? 6.145   -4.501  6.283   1.00 0.00 ? 51  ARG A H    4  
ATOM 7510  H HA   . ARG A 1 51  ? 7.114   -3.199  8.590   1.00 0.00 ? 51  ARG A HA   4  
ATOM 7511  H HB2  . ARG A 1 51  ? 5.454   -5.333  8.187   1.00 0.00 ? 51  ARG A HB2  4  
ATOM 7512  H HB3  . ARG A 1 51  ? 6.959   -6.169  8.700   1.00 0.00 ? 51  ARG A HB3  4  
ATOM 7513  H HG2  . ARG A 1 51  ? 5.735   -5.972  10.572  1.00 0.00 ? 51  ARG A HG2  4  
ATOM 7514  H HG3  . ARG A 1 51  ? 6.972   -4.697  10.704  1.00 0.00 ? 51  ARG A HG3  4  
ATOM 7515  H HD2  . ARG A 1 51  ? 3.929   -4.573  10.399  1.00 0.00 ? 51  ARG A HD2  4  
ATOM 7516  H HD3  . ARG A 1 51  ? 4.983   -3.706  11.551  1.00 0.00 ? 51  ARG A HD3  4  
ATOM 7517  H HE   . ARG A 1 51  ? 5.491   -2.020  9.920   1.00 0.00 ? 51  ARG A HE   4  
ATOM 7518  H HH11 . ARG A 1 51  ? 3.341   -4.553  8.661   1.00 0.00 ? 51  ARG A HH11 4  
ATOM 7519  H HH12 . ARG A 1 51  ? 2.794   -3.626  7.303   1.00 0.00 ? 51  ARG A HH12 4  
ATOM 7520  H HH21 . ARG A 1 51  ? 4.743   -0.760  8.070   1.00 0.00 ? 51  ARG A HH21 4  
ATOM 7521  H HH22 . ARG A 1 51  ? 3.601   -1.449  6.962   1.00 0.00 ? 51  ARG A HH22 4  
ATOM 7522  N N    . ASP A 1 52  ? 9.389   -5.319  7.369   1.00 0.00 ? 52  ASP A N    4  
ATOM 7523  C CA   . ASP A 1 52  ? 10.820  -5.742  7.431   1.00 0.00 ? 52  ASP A CA   4  
ATOM 7524  C C    . ASP A 1 52  ? 11.862  -4.630  7.281   1.00 0.00 ? 52  ASP A C    4  
ATOM 7525  O O    . ASP A 1 52  ? 13.062  -4.841  7.399   1.00 0.00 ? 52  ASP A O    4  
ATOM 7526  C CB   . ASP A 1 52  ? 11.133  -6.900  6.411   1.00 0.00 ? 52  ASP A CB   4  
ATOM 7527  C CG   . ASP A 1 52  ? 12.463  -7.654  6.602   1.00 0.00 ? 52  ASP A CG   4  
ATOM 7528  O OD1  . ASP A 1 52  ? 12.610  -8.337  7.648   1.00 0.00 ? 52  ASP A OD1  4  
ATOM 7529  O OD2  . ASP A 1 52  ? 13.333  -7.560  5.695   1.00 0.00 ? 52  ASP A OD2  4  
ATOM 7530  H H    . ASP A 1 52  ? 8.866   -5.893  6.681   1.00 0.00 ? 52  ASP A H    4  
ATOM 7531  H HA   . ASP A 1 52  ? 10.966  -6.153  8.420   1.00 0.00 ? 52  ASP A HA   4  
ATOM 7532  H HB2  . ASP A 1 52  ? 10.344  -7.674  6.532   1.00 0.00 ? 52  ASP A HB2  4  
ATOM 7533  H HB3  . ASP A 1 52  ? 11.065  -6.516  5.372   1.00 0.00 ? 52  ASP A HB3  4  
ATOM 7534  N N    . SER A 1 53  ? 11.361  -3.448  6.858   1.00 0.00 ? 53  SER A N    4  
ATOM 7535  C CA   . SER A 1 53  ? 11.976  -2.221  6.515   1.00 0.00 ? 53  SER A CA   4  
ATOM 7536  C C    . SER A 1 53  ? 12.082  -1.243  7.665   1.00 0.00 ? 53  SER A C    4  
ATOM 7537  O O    . SER A 1 53  ? 12.832  -0.276  7.569   1.00 0.00 ? 53  SER A O    4  
ATOM 7538  C CB   . SER A 1 53  ? 11.084  -1.583  5.468   1.00 0.00 ? 53  SER A CB   4  
ATOM 7539  O OG   . SER A 1 53  ? 10.842  -2.419  4.330   1.00 0.00 ? 53  SER A OG   4  
ATOM 7540  H H    . SER A 1 53  ? 10.366  -3.285  6.841   1.00 0.00 ? 53  SER A H    4  
ATOM 7541  H HA   . SER A 1 53  ? 12.929  -2.370  6.064   1.00 0.00 ? 53  SER A HA   4  
ATOM 7542  H HB2  . SER A 1 53  ? 10.164  -1.361  6.036   1.00 0.00 ? 53  SER A HB2  4  
ATOM 7543  H HB3  . SER A 1 53  ? 11.562  -0.669  5.095   1.00 0.00 ? 53  SER A HB3  4  
ATOM 7544  H HG   . SER A 1 53  ? 10.076  -3.011  4.519   1.00 0.00 ? 53  SER A HG   4  
ATOM 7545  N N    . LEU A 1 54  ? 11.289  -1.433  8.782   1.00 0.00 ? 54  LEU A N    4  
ATOM 7546  C CA   . LEU A 1 54  ? 11.122  -0.503  9.908   1.00 0.00 ? 54  LEU A CA   4  
ATOM 7547  C C    . LEU A 1 54  ? 12.418  -0.374  10.716  1.00 0.00 ? 54  LEU A C    4  
ATOM 7548  O O    . LEU A 1 54  ? 12.699  0.649   11.333  1.00 0.00 ? 54  LEU A O    4  
ATOM 7549  C CB   . LEU A 1 54  ? 9.993   -0.892  10.952  1.00 0.00 ? 54  LEU A CB   4  
ATOM 7550  C CG   . LEU A 1 54  ? 9.777   -2.305  11.576  1.00 0.00 ? 54  LEU A CG   4  
ATOM 7551  C CD1  . LEU A 1 54  ? 8.293   -2.629  11.403  1.00 0.00 ? 54  LEU A CD1  4  
ATOM 7552  C CD2  . LEU A 1 54  ? 10.689  -3.503  11.290  1.00 0.00 ? 54  LEU A CD2  4  
ATOM 7553  H H    . LEU A 1 54  ? 10.653  -2.201  8.836   1.00 0.00 ? 54  LEU A H    4  
ATOM 7554  H HA   . LEU A 1 54  ? 10.793  0.449   9.457   1.00 0.00 ? 54  LEU A HA   4  
ATOM 7555  H HB2  . LEU A 1 54  ? 10.084  -0.177  11.833  1.00 0.00 ? 54  LEU A HB2  4  
ATOM 7556  H HB3  . LEU A 1 54  ? 9.016   -0.788  10.388  1.00 0.00 ? 54  LEU A HB3  4  
ATOM 7557  H HG   . LEU A 1 54  ? 9.818   -2.283  12.689  1.00 0.00 ? 54  LEU A HG   4  
ATOM 7558  H HD11 . LEU A 1 54  ? 7.968   -2.563  10.352  1.00 0.00 ? 54  LEU A HD11 4  
ATOM 7559  H HD12 . LEU A 1 54  ? 8.139   -3.656  11.780  1.00 0.00 ? 54  LEU A HD12 4  
ATOM 7560  H HD13 . LEU A 1 54  ? 7.667   -1.925  11.993  1.00 0.00 ? 54  LEU A HD13 4  
ATOM 7561  H HD21 . LEU A 1 54  ? 11.037  -3.666  10.267  1.00 0.00 ? 54  LEU A HD21 4  
ATOM 7562  H HD22 . LEU A 1 54  ? 11.608  -3.409  11.893  1.00 0.00 ? 54  LEU A HD22 4  
ATOM 7563  H HD23 . LEU A 1 54  ? 10.112  -4.423  11.606  1.00 0.00 ? 54  LEU A HD23 4  
ATOM 7564  N N    . ILE A 1 55  ? 13.224  -1.462  10.638  1.00 0.00 ? 55  ILE A N    4  
ATOM 7565  C CA   . ILE A 1 55  ? 14.583  -1.700  11.128  1.00 0.00 ? 55  ILE A CA   4  
ATOM 7566  C C    . ILE A 1 55  ? 15.011  -2.691  10.048  1.00 0.00 ? 55  ILE A C    4  
ATOM 7567  O O    . ILE A 1 55  ? 14.136  -3.311  9.457   1.00 0.00 ? 55  ILE A O    4  
ATOM 7568  C CB   . ILE A 1 55  ? 14.846  -2.362  12.519  1.00 0.00 ? 55  ILE A CB   4  
ATOM 7569  C CG1  . ILE A 1 55  ? 13.766  -2.296  13.620  1.00 0.00 ? 55  ILE A CG1  4  
ATOM 7570  C CG2  . ILE A 1 55  ? 16.170  -1.868  13.142  1.00 0.00 ? 55  ILE A CG2  4  
ATOM 7571  C CD1  . ILE A 1 55  ? 13.173  -0.958  13.925  1.00 0.00 ? 55  ILE A CD1  4  
ATOM 7572  H H    . ILE A 1 55  ? 12.864  -2.179  10.013  1.00 0.00 ? 55  ILE A H    4  
ATOM 7573  H HA   . ILE A 1 55  ? 15.158  -0.790  11.023  1.00 0.00 ? 55  ILE A HA   4  
ATOM 7574  H HB   . ILE A 1 55  ? 15.025  -3.449  12.377  1.00 0.00 ? 55  ILE A HB   4  
ATOM 7575  H HG12 . ILE A 1 55  ? 12.922  -2.994  13.397  1.00 0.00 ? 55  ILE A HG12 4  
ATOM 7576  H HG13 . ILE A 1 55  ? 14.243  -2.591  14.592  1.00 0.00 ? 55  ILE A HG13 4  
ATOM 7577  H HG21 . ILE A 1 55  ? 17.025  -1.972  12.449  1.00 0.00 ? 55  ILE A HG21 4  
ATOM 7578  H HG22 . ILE A 1 55  ? 16.079  -0.812  13.468  1.00 0.00 ? 55  ILE A HG22 4  
ATOM 7579  H HG23 . ILE A 1 55  ? 16.354  -2.505  14.045  1.00 0.00 ? 55  ILE A HG23 4  
ATOM 7580  H HD11 . ILE A 1 55  ? 13.865  -0.121  13.703  1.00 0.00 ? 55  ILE A HD11 4  
ATOM 7581  H HD12 . ILE A 1 55  ? 12.244  -0.852  13.332  1.00 0.00 ? 55  ILE A HD12 4  
ATOM 7582  H HD13 . ILE A 1 55  ? 12.900  -0.948  14.997  1.00 0.00 ? 55  ILE A HD13 4  
ATOM 7583  N N    . GLN A 1 56  ? 16.328  -2.870  9.788   1.00 0.00 ? 56  GLN A N    4  
ATOM 7584  C CA   . GLN A 1 56  ? 16.885  -3.788  8.798   1.00 0.00 ? 56  GLN A CA   4  
ATOM 7585  C C    . GLN A 1 56  ? 17.222  -5.226  9.261   1.00 0.00 ? 56  GLN A C    4  
ATOM 7586  O O    . GLN A 1 56  ? 16.834  -6.135  8.532   1.00 0.00 ? 56  GLN A O    4  
ATOM 7587  C CB   . GLN A 1 56  ? 18.134  -3.179  8.080   1.00 0.00 ? 56  GLN A CB   4  
ATOM 7588  C CG   . GLN A 1 56  ? 17.848  -1.878  7.284   1.00 0.00 ? 56  GLN A CG   4  
ATOM 7589  C CD   . GLN A 1 56  ? 17.694  -0.639  8.171   1.00 0.00 ? 56  GLN A CD   4  
ATOM 7590  O OE1  . GLN A 1 56  ? 18.658  -0.142  8.751   1.00 0.00 ? 56  GLN A OE1  4  
ATOM 7591  N NE2  . GLN A 1 56  ? 16.449  -0.117  8.301   1.00 0.00 ? 56  GLN A NE2  4  
ATOM 7592  H H    . GLN A 1 56  ? 16.999  -2.327  10.280  1.00 0.00 ? 56  GLN A H    4  
ATOM 7593  H HA   . GLN A 1 56  ? 16.150  -3.924  8.010   1.00 0.00 ? 56  GLN A HA   4  
ATOM 7594  H HB2  . GLN A 1 56  ? 18.929  -2.932  8.856   1.00 0.00 ? 56  GLN A HB2  4  
ATOM 7595  H HB3  . GLN A 1 56  ? 18.458  -3.921  7.272   1.00 0.00 ? 56  GLN A HB3  4  
ATOM 7596  H HG2  . GLN A 1 56  ? 18.721  -1.681  6.624   1.00 0.00 ? 56  GLN A HG2  4  
ATOM 7597  H HG3  . GLN A 1 56  ? 16.956  -2.012  6.641   1.00 0.00 ? 56  GLN A HG3  4  
ATOM 7598  H HE21 . GLN A 1 56  ? 15.642  -0.602  7.964   1.00 0.00 ? 56  GLN A HE21 4  
ATOM 7599  H HE22 . GLN A 1 56  ? 16.364  0.740   8.799   1.00 0.00 ? 56  GLN A HE22 4  
ATOM 7600  N N    . PRO A 1 57  ? 17.926  -5.540  10.384  1.00 0.00 ? 57  PRO A N    4  
ATOM 7601  C CA   . PRO A 1 57  ? 18.514  -6.871  10.632  1.00 0.00 ? 57  PRO A CA   4  
ATOM 7602  C C    . PRO A 1 57  ? 17.572  -7.793  11.418  1.00 0.00 ? 57  PRO A C    4  
ATOM 7603  O O    . PRO A 1 57  ? 16.424  -7.950  11.031  1.00 0.00 ? 57  PRO A O    4  
ATOM 7604  C CB   . PRO A 1 57  ? 19.757  -6.475  11.462  1.00 0.00 ? 57  PRO A CB   4  
ATOM 7605  C CG   . PRO A 1 57  ? 19.210  -5.370  12.370  1.00 0.00 ? 57  PRO A CG   4  
ATOM 7606  C CD   . PRO A 1 57  ? 18.398  -4.551  11.358  1.00 0.00 ? 57  PRO A CD   4  
ATOM 7607  H HA   . PRO A 1 57  ? 18.783  -7.376  9.712   1.00 0.00 ? 57  PRO A HA   4  
ATOM 7608  H HB2  . PRO A 1 57  ? 20.266  -7.297  11.996  1.00 0.00 ? 57  PRO A HB2  4  
ATOM 7609  H HB3  . PRO A 1 57  ? 20.510  -6.027  10.772  1.00 0.00 ? 57  PRO A HB3  4  
ATOM 7610  H HG2  . PRO A 1 57  ? 18.531  -5.838  13.127  1.00 0.00 ? 57  PRO A HG2  4  
ATOM 7611  H HG3  . PRO A 1 57  ? 20.009  -4.800  12.884  1.00 0.00 ? 57  PRO A HG3  4  
ATOM 7612  H HD2  . PRO A 1 57  ? 17.509  -4.042  11.839  1.00 0.00 ? 57  PRO A HD2  4  
ATOM 7613  H HD3  . PRO A 1 57  ? 19.104  -3.841  10.833  1.00 0.00 ? 57  PRO A HD3  4  
ATOM 7614  N N    . HIS A 1 58  ? 18.058  -8.385  12.557  1.00 0.00 ? 58  HIS A N    4  
ATOM 7615  C CA   . HIS A 1 58  ? 17.370  -9.252  13.520  1.00 0.00 ? 58  HIS A CA   4  
ATOM 7616  C C    . HIS A 1 58  ? 16.415  -8.483  14.438  1.00 0.00 ? 58  HIS A C    4  
ATOM 7617  O O    . HIS A 1 58  ? 15.422  -9.020  14.910  1.00 0.00 ? 58  HIS A O    4  
ATOM 7618  C CB   . HIS A 1 58  ? 18.377  -10.068 14.396  1.00 0.00 ? 58  HIS A CB   4  
ATOM 7619  C CG   . HIS A 1 58  ? 17.728  -10.975 15.424  1.00 0.00 ? 58  HIS A CG   4  
ATOM 7620  N ND1  . HIS A 1 58  ? 17.426  -12.308 15.233  1.00 0.00 ? 58  HIS A ND1  4  
ATOM 7621  C CD2  . HIS A 1 58  ? 17.176  -10.642 16.627  1.00 0.00 ? 58  HIS A CD2  4  
ATOM 7622  C CE1  . HIS A 1 58  ? 16.716  -12.709 16.319  1.00 0.00 ? 58  HIS A CE1  4  
ATOM 7623  N NE2  . HIS A 1 58  ? 16.532  -11.729 17.182  1.00 0.00 ? 58  HIS A NE2  4  
ATOM 7624  H H    . HIS A 1 58  ? 19.011  -8.203  12.784  1.00 0.00 ? 58  HIS A H    4  
ATOM 7625  H HA   . HIS A 1 58  ? 16.761  -9.958  12.968  1.00 0.00 ? 58  HIS A HA   4  
ATOM 7626  H HB2  . HIS A 1 58  ? 19.010  -10.689 13.725  1.00 0.00 ? 58  HIS A HB2  4  
ATOM 7627  H HB3  . HIS A 1 58  ? 19.052  -9.370  14.939  1.00 0.00 ? 58  HIS A HB3  4  
ATOM 7628  H HD1  . HIS A 1 58  ? 17.699  -12.881 14.460  1.00 0.00 ? 58  HIS A HD1  4  
ATOM 7629  H HD2  . HIS A 1 58  ? 17.143  -9.686  17.134  1.00 0.00 ? 58  HIS A HD2  4  
ATOM 7630  H HE1  . HIS A 1 58  ? 16.337  -13.723 16.445  1.00 0.00 ? 58  HIS A HE1  4  
ATOM 7631  N N    . ASP A 1 59  ? 16.688  -7.176  14.698  1.00 0.00 ? 59  ASP A N    4  
ATOM 7632  C CA   . ASP A 1 59  ? 15.958  -6.207  15.500  1.00 0.00 ? 59  ASP A CA   4  
ATOM 7633  C C    . ASP A 1 59  ? 14.758  -5.662  14.770  1.00 0.00 ? 59  ASP A C    4  
ATOM 7634  O O    . ASP A 1 59  ? 14.036  -4.847  15.316  1.00 0.00 ? 59  ASP A O    4  
ATOM 7635  C CB   . ASP A 1 59  ? 16.895  -5.020  15.870  1.00 0.00 ? 59  ASP A CB   4  
ATOM 7636  C CG   . ASP A 1 59  ? 18.046  -5.536  16.738  1.00 0.00 ? 59  ASP A CG   4  
ATOM 7637  O OD1  . ASP A 1 59  ? 17.765  -6.026  17.864  1.00 0.00 ? 59  ASP A OD1  4  
ATOM 7638  O OD2  . ASP A 1 59  ? 19.219  -5.445  16.284  1.00 0.00 ? 59  ASP A OD2  4  
ATOM 7639  H H    . ASP A 1 59  ? 17.478  -6.743  14.308  1.00 0.00 ? 59  ASP A H    4  
ATOM 7640  H HA   . ASP A 1 59  ? 15.565  -6.646  16.414  1.00 0.00 ? 59  ASP A HA   4  
ATOM 7641  H HB2  . ASP A 1 59  ? 17.323  -4.574  14.939  1.00 0.00 ? 59  ASP A HB2  4  
ATOM 7642  H HB3  . ASP A 1 59  ? 16.355  -4.235  16.451  1.00 0.00 ? 59  ASP A HB3  4  
ATOM 7643  N N    . ARG A 1 60  ? 14.474  -6.114  13.514  1.00 0.00 ? 60  ARG A N    4  
ATOM 7644  C CA   . ARG A 1 60  ? 13.321  -5.794  12.672  1.00 0.00 ? 60  ARG A CA   4  
ATOM 7645  C C    . ARG A 1 60  ? 11.971  -6.005  13.319  1.00 0.00 ? 60  ARG A C    4  
ATOM 7646  O O    . ARG A 1 60  ? 11.222  -5.061  13.542  1.00 0.00 ? 60  ARG A O    4  
ATOM 7647  C CB   . ARG A 1 60  ? 13.464  -6.458  11.269  1.00 0.00 ? 60  ARG A CB   4  
ATOM 7648  C CG   . ARG A 1 60  ? 13.019  -7.920  11.015  1.00 0.00 ? 60  ARG A CG   4  
ATOM 7649  C CD   . ARG A 1 60  ? 13.603  -8.962  11.978  1.00 0.00 ? 60  ARG A CD   4  
ATOM 7650  N NE   . ARG A 1 60  ? 13.210  -10.355 11.566  1.00 0.00 ? 60  ARG A NE   4  
ATOM 7651  C CZ   . ARG A 1 60  ? 13.937  -11.125 10.697  1.00 0.00 ? 60  ARG A CZ   4  
ATOM 7652  N NH1  . ARG A 1 60  ? 15.088  -10.660 10.131  1.00 0.00 ? 60  ARG A NH1  4  
ATOM 7653  N NH2  . ARG A 1 60  ? 13.499  -12.382 10.393  1.00 0.00 ? 60  ARG A NH2  4  
ATOM 7654  H H    . ARG A 1 60  ? 15.109  -6.770  13.117  1.00 0.00 ? 60  ARG A H    4  
ATOM 7655  H HA   . ARG A 1 60  ? 13.313  -4.723  12.518  1.00 0.00 ? 60  ARG A HA   4  
ATOM 7656  H HB2  . ARG A 1 60  ? 12.960  -5.821  10.513  1.00 0.00 ? 60  ARG A HB2  4  
ATOM 7657  H HB3  . ARG A 1 60  ? 14.551  -6.457  11.047  1.00 0.00 ? 60  ARG A HB3  4  
ATOM 7658  H HG2  . ARG A 1 60  ? 11.909  -7.973  11.029  1.00 0.00 ? 60  ARG A HG2  4  
ATOM 7659  H HG3  . ARG A 1 60  ? 13.355  -8.175  9.985   1.00 0.00 ? 60  ARG A HG3  4  
ATOM 7660  H HD2  . ARG A 1 60  ? 14.685  -8.871  12.132  1.00 0.00 ? 60  ARG A HD2  4  
ATOM 7661  H HD3  . ARG A 1 60  ? 13.200  -8.785  12.977  1.00 0.00 ? 60  ARG A HD3  4  
ATOM 7662  H HE   . ARG A 1 60  ? 12.374  -10.740 11.955  1.00 0.00 ? 60  ARG A HE   4  
ATOM 7663  H HH11 . ARG A 1 60  ? 15.414  -9.740  10.348  1.00 0.00 ? 60  ARG A HH11 4  
ATOM 7664  H HH12 . ARG A 1 60  ? 15.603  -11.237 9.497   1.00 0.00 ? 60  ARG A HH12 4  
ATOM 7665  H HH21 . ARG A 1 60  ? 12.656  -12.731 10.804  1.00 0.00 ? 60  ARG A HH21 4  
ATOM 7666  H HH22 . ARG A 1 60  ? 14.021  -12.954 9.760   1.00 0.00 ? 60  ARG A HH22 4  
ATOM 7667  N N    . LYS A 1 61  ? 11.622  -7.237  13.765  1.00 0.00 ? 61  LYS A N    4  
ATOM 7668  C CA   . LYS A 1 61  ? 10.379  -7.584  14.428  1.00 0.00 ? 61  LYS A CA   4  
ATOM 7669  C C    . LYS A 1 61  ? 10.038  -6.831  15.714  1.00 0.00 ? 61  LYS A C    4  
ATOM 7670  O O    . LYS A 1 61  ? 8.874   -6.593  16.041  1.00 0.00 ? 61  LYS A O    4  
ATOM 7671  C CB   . LYS A 1 61  ? 9.796   -8.985  14.127  1.00 0.00 ? 61  LYS A CB   4  
ATOM 7672  C CG   . LYS A 1 61  ? 8.560   -9.450  14.950  1.00 0.00 ? 61  LYS A CG   4  
ATOM 7673  C CD   . LYS A 1 61  ? 8.892   -9.913  16.378  1.00 0.00 ? 61  LYS A CD   4  
ATOM 7674  C CE   . LYS A 1 61  ? 7.836   -10.854 16.962  1.00 0.00 ? 61  LYS A CE   4  
ATOM 7675  N NZ   . LYS A 1 61  ? 8.132   -11.180 18.377  1.00 0.00 ? 61  LYS A NZ   4  
ATOM 7676  H H    . LYS A 1 61  ? 12.255  -7.991  13.617  1.00 0.00 ? 61  LYS A H    4  
ATOM 7677  H HA   . LYS A 1 61  ? 9.736   -7.101  13.737  1.00 0.00 ? 61  LYS A HA   4  
ATOM 7678  H HB2  . LYS A 1 61  ? 9.420   -8.878  13.066  1.00 0.00 ? 61  LYS A HB2  4  
ATOM 7679  H HB3  . LYS A 1 61  ? 10.637  -9.719  14.117  1.00 0.00 ? 61  LYS A HB3  4  
ATOM 7680  H HG2  . LYS A 1 61  ? 7.768   -8.651  15.023  1.00 0.00 ? 61  LYS A HG2  4  
ATOM 7681  H HG3  . LYS A 1 61  ? 8.101   -10.310 14.413  1.00 0.00 ? 61  LYS A HG3  4  
ATOM 7682  H HD2  . LYS A 1 61  ? 9.883   -10.417 16.379  1.00 0.00 ? 61  LYS A HD2  4  
ATOM 7683  H HD3  . LYS A 1 61  ? 8.967   -8.997  17.010  1.00 0.00 ? 61  LYS A HD3  4  
ATOM 7684  H HE2  . LYS A 1 61  ? 6.839   -10.371 16.932  1.00 0.00 ? 61  LYS A HE2  4  
ATOM 7685  H HE3  . LYS A 1 61  ? 7.801   -11.807 16.394  1.00 0.00 ? 61  LYS A HE3  4  
ATOM 7686  H HZ1  . LYS A 1 61  ? 8.154   -10.303 18.936  1.00 0.00 ? 61  LYS A HZ1  4  
ATOM 7687  H HZ2  . LYS A 1 61  ? 7.393   -11.810 18.749  1.00 0.00 ? 61  LYS A HZ2  4  
ATOM 7688  H HZ3  . LYS A 1 61  ? 9.056   -11.654 18.438  1.00 0.00 ? 61  LYS A HZ3  4  
ATOM 7689  N N    . LYS A 1 62  ? 11.087  -6.329  16.421  1.00 0.00 ? 62  LYS A N    4  
ATOM 7690  C CA   . LYS A 1 62  ? 11.005  -5.402  17.553  1.00 0.00 ? 62  LYS A CA   4  
ATOM 7691  C C    . LYS A 1 62  ? 10.223  -4.080  17.302  1.00 0.00 ? 62  LYS A C    4  
ATOM 7692  O O    . LYS A 1 62  ? 9.625   -3.528  18.224  1.00 0.00 ? 62  LYS A O    4  
ATOM 7693  C CB   . LYS A 1 62  ? 12.447  -5.189  18.133  1.00 0.00 ? 62  LYS A CB   4  
ATOM 7694  C CG   . LYS A 1 62  ? 12.560  -4.119  19.232  1.00 0.00 ? 62  LYS A CG   4  
ATOM 7695  C CD   . LYS A 1 62  ? 13.919  -4.069  19.950  1.00 0.00 ? 62  LYS A CD   4  
ATOM 7696  C CE   . LYS A 1 62  ? 15.034  -3.542  19.036  1.00 0.00 ? 62  LYS A CE   4  
ATOM 7697  N NZ   . LYS A 1 62  ? 16.329  -3.465  19.751  1.00 0.00 ? 62  LYS A NZ   4  
ATOM 7698  H H    . LYS A 1 62  ? 12.012  -6.519  16.091  1.00 0.00 ? 62  LYS A H    4  
ATOM 7699  H HA   . LYS A 1 62  ? 10.374  -5.895  18.284  1.00 0.00 ? 62  LYS A HA   4  
ATOM 7700  H HB2  . LYS A 1 62  ? 12.777  -6.164  18.557  1.00 0.00 ? 62  LYS A HB2  4  
ATOM 7701  H HB3  . LYS A 1 62  ? 13.178  -4.938  17.320  1.00 0.00 ? 62  LYS A HB3  4  
ATOM 7702  H HG2  . LYS A 1 62  ? 12.395  -3.123  18.763  1.00 0.00 ? 62  LYS A HG2  4  
ATOM 7703  H HG3  . LYS A 1 62  ? 11.754  -4.303  19.973  1.00 0.00 ? 62  LYS A HG3  4  
ATOM 7704  H HD2  . LYS A 1 62  ? 13.832  -3.393  20.831  1.00 0.00 ? 62  LYS A HD2  4  
ATOM 7705  H HD3  . LYS A 1 62  ? 14.173  -5.086  20.317  1.00 0.00 ? 62  LYS A HD3  4  
ATOM 7706  H HE2  . LYS A 1 62  ? 15.168  -4.221  18.172  1.00 0.00 ? 62  LYS A HE2  4  
ATOM 7707  H HE3  . LYS A 1 62  ? 14.781  -2.524  18.666  1.00 0.00 ? 62  LYS A HE3  4  
ATOM 7708  H HZ1  . LYS A 1 62  ? 16.587  -4.411  20.098  1.00 0.00 ? 62  LYS A HZ1  4  
ATOM 7709  H HZ2  . LYS A 1 62  ? 17.063  -3.122  19.098  1.00 0.00 ? 62  LYS A HZ2  4  
ATOM 7710  H HZ3  . LYS A 1 62  ? 16.244  -2.811  20.554  1.00 0.00 ? 62  LYS A HZ3  4  
ATOM 7711  N N    . MET A 1 63  ? 10.134  -3.589  16.026  1.00 0.00 ? 63  MET A N    4  
ATOM 7712  C CA   . MET A 1 63  ? 9.235   -2.484  15.668  1.00 0.00 ? 63  MET A CA   4  
ATOM 7713  C C    . MET A 1 63  ? 8.052   -2.868  14.796  1.00 0.00 ? 63  MET A C    4  
ATOM 7714  O O    . MET A 1 63  ? 7.202   -2.029  14.501  1.00 0.00 ? 63  MET A O    4  
ATOM 7715  C CB   . MET A 1 63  ? 9.871   -1.087  15.448  1.00 0.00 ? 63  MET A CB   4  
ATOM 7716  C CG   . MET A 1 63  ? 10.503  -0.522  16.751  1.00 0.00 ? 63  MET A CG   4  
ATOM 7717  S SD   . MET A 1 63  ? 10.643  1.296   16.829  1.00 0.00 ? 63  MET A SD   4  
ATOM 7718  C CE   . MET A 1 63  ? 11.742  1.548   15.414  1.00 0.00 ? 63  MET A CE   4  
ATOM 7719  H H    . MET A 1 63  ? 10.634  -4.027  15.273  1.00 0.00 ? 63  MET A H    4  
ATOM 7720  H HA   . MET A 1 63  ? 8.650   -2.242  16.501  1.00 0.00 ? 63  MET A HA   4  
ATOM 7721  H HB2  . MET A 1 63  ? 10.629  -1.155  14.643  1.00 0.00 ? 63  MET A HB2  4  
ATOM 7722  H HB3  . MET A 1 63  ? 9.081   -0.360  15.135  1.00 0.00 ? 63  MET A HB3  4  
ATOM 7723  H HG2  . MET A 1 63  ? 9.804   -0.785  17.602  1.00 0.00 ? 63  MET A HG2  4  
ATOM 7724  H HG3  . MET A 1 63  ? 11.521  -1.003  16.891  1.00 0.00 ? 63  MET A HG3  4  
ATOM 7725  H HE1  . MET A 1 63  ? 12.685  0.975   15.558  1.00 0.00 ? 63  MET A HE1  4  
ATOM 7726  H HE2  . MET A 1 63  ? 11.265  1.200   14.466  1.00 0.00 ? 63  MET A HE2  4  
ATOM 7727  H HE3  . MET A 1 63  ? 12.007  2.620   15.300  1.00 0.00 ? 63  MET A HE3  4  
ATOM 7728  N N    . LYS A 1 64  ? 7.901   -4.181  14.424  1.00 0.00 ? 64  LYS A N    4  
ATOM 7729  C CA   . LYS A 1 64  ? 6.766   -4.803  13.737  1.00 0.00 ? 64  LYS A CA   4  
ATOM 7730  C C    . LYS A 1 64  ? 5.588   -4.923  14.725  1.00 0.00 ? 64  LYS A C    4  
ATOM 7731  O O    . LYS A 1 64  ? 4.428   -4.659  14.403  1.00 0.00 ? 64  LYS A O    4  
ATOM 7732  C CB   . LYS A 1 64  ? 7.219   -6.167  13.100  1.00 0.00 ? 64  LYS A CB   4  
ATOM 7733  C CG   . LYS A 1 64  ? 6.118   -7.215  12.978  1.00 0.00 ? 64  LYS A CG   4  
ATOM 7734  C CD   . LYS A 1 64  ? 6.450   -8.423  12.092  1.00 0.00 ? 64  LYS A CD   4  
ATOM 7735  C CE   . LYS A 1 64  ? 5.307   -9.446  12.004  1.00 0.00 ? 64  LYS A CE   4  
ATOM 7736  N NZ   . LYS A 1 64  ? 5.014   -10.037 13.331  1.00 0.00 ? 64  LYS A NZ   4  
ATOM 7737  H H    . LYS A 1 64  ? 8.546   -4.876  14.732  1.00 0.00 ? 64  LYS A H    4  
ATOM 7738  H HA   . LYS A 1 64  ? 6.415   -4.140  12.963  1.00 0.00 ? 64  LYS A HA   4  
ATOM 7739  H HB2  . LYS A 1 64  ? 7.726   -6.121  12.055  1.00 0.00 ? 64  LYS A HB2  4  
ATOM 7740  H HB3  . LYS A 1 64  ? 7.841   -6.579  13.935  1.00 0.00 ? 64  LYS A HB3  4  
ATOM 7741  H HG2  . LYS A 1 64  ? 5.934   -7.515  14.034  1.00 0.00 ? 64  LYS A HG2  4  
ATOM 7742  H HG3  . LYS A 1 64  ? 5.246   -6.685  12.547  1.00 0.00 ? 64  LYS A HG3  4  
ATOM 7743  H HD2  . LYS A 1 64  ? 6.666   -8.060  11.062  1.00 0.00 ? 64  LYS A HD2  4  
ATOM 7744  H HD3  . LYS A 1 64  ? 7.363   -8.930  12.461  1.00 0.00 ? 64  LYS A HD3  4  
ATOM 7745  H HE2  . LYS A 1 64  ? 4.379   -8.960  11.638  1.00 0.00 ? 64  LYS A HE2  4  
ATOM 7746  H HE3  . LYS A 1 64  ? 5.583   -10.274 11.320  1.00 0.00 ? 64  LYS A HE3  4  
ATOM 7747  H HZ1  . LYS A 1 64  ? 4.743   -9.284  13.995  1.00 0.00 ? 64  LYS A HZ1  4  
ATOM 7748  H HZ2  . LYS A 1 64  ? 4.232   -10.718 13.241  1.00 0.00 ? 64  LYS A HZ2  4  
ATOM 7749  H HZ3  . LYS A 1 64  ? 5.860   -10.526 13.687  1.00 0.00 ? 64  LYS A HZ3  4  
ATOM 7750  N N    . LYS A 1 65  ? 5.909   -5.302  16.000  1.00 0.00 ? 65  LYS A N    4  
ATOM 7751  C CA   . LYS A 1 65  ? 4.946   -5.411  17.104  1.00 0.00 ? 65  LYS A CA   4  
ATOM 7752  C C    . LYS A 1 65  ? 4.374   -4.068  17.649  1.00 0.00 ? 65  LYS A C    4  
ATOM 7753  O O    . LYS A 1 65  ? 3.223   -4.009  18.070  1.00 0.00 ? 65  LYS A O    4  
ATOM 7754  C CB   . LYS A 1 65  ? 5.502   -6.301  18.249  1.00 0.00 ? 65  LYS A CB   4  
ATOM 7755  C CG   . LYS A 1 65  ? 5.522   -7.806  17.904  1.00 0.00 ? 65  LYS A CG   4  
ATOM 7756  C CD   . LYS A 1 65  ? 4.115   -8.434  17.810  1.00 0.00 ? 65  LYS A CD   4  
ATOM 7757  C CE   . LYS A 1 65  ? 4.136   -9.936  17.495  1.00 0.00 ? 65  LYS A CE   4  
ATOM 7758  N NZ   . LYS A 1 65  ? 2.761   -10.484 17.420  1.00 0.00 ? 65  LYS A NZ   4  
ATOM 7759  H H    . LYS A 1 65  ? 6.865   -5.554  16.201  1.00 0.00 ? 65  LYS A H    4  
ATOM 7760  H HA   . LYS A 1 65  ? 4.092   -5.941  16.688  1.00 0.00 ? 65  LYS A HA   4  
ATOM 7761  H HB2  . LYS A 1 65  ? 6.536   -5.964  18.487  1.00 0.00 ? 65  LYS A HB2  4  
ATOM 7762  H HB3  . LYS A 1 65  ? 4.889   -6.198  19.175  1.00 0.00 ? 65  LYS A HB3  4  
ATOM 7763  H HG2  . LYS A 1 65  ? 6.063   -7.962  16.945  1.00 0.00 ? 65  LYS A HG2  4  
ATOM 7764  H HG3  . LYS A 1 65  ? 6.082   -8.347  18.700  1.00 0.00 ? 65  LYS A HG3  4  
ATOM 7765  H HD2  . LYS A 1 65  ? 3.587   -8.273  18.777  1.00 0.00 ? 65  LYS A HD2  4  
ATOM 7766  H HD3  . LYS A 1 65  ? 3.525   -7.929  17.016  1.00 0.00 ? 65  LYS A HD3  4  
ATOM 7767  H HE2  . LYS A 1 65  ? 4.622   -10.116 16.514  1.00 0.00 ? 65  LYS A HE2  4  
ATOM 7768  H HE3  . LYS A 1 65  ? 4.681   -10.495 18.285  1.00 0.00 ? 65  LYS A HE3  4  
ATOM 7769  H HZ1  . LYS A 1 65  ? 2.232   -9.988  16.675  1.00 0.00 ? 65  LYS A HZ1  4  
ATOM 7770  H HZ2  . LYS A 1 65  ? 2.804   -11.499 17.196  1.00 0.00 ? 65  LYS A HZ2  4  
ATOM 7771  H HZ3  . LYS A 1 65  ? 2.283   -10.351 18.333  1.00 0.00 ? 65  LYS A HZ3  4  
ATOM 7772  N N    . VAL A 1 66  ? 5.131   -2.921  17.592  1.00 0.00 ? 66  VAL A N    4  
ATOM 7773  C CA   . VAL A 1 66  ? 4.659   -1.546  17.894  1.00 0.00 ? 66  VAL A CA   4  
ATOM 7774  C C    . VAL A 1 66  ? 3.808   -1.000  16.759  1.00 0.00 ? 66  VAL A C    4  
ATOM 7775  O O    . VAL A 1 66  ? 2.869   -0.250  17.016  1.00 0.00 ? 66  VAL A O    4  
ATOM 7776  C CB   . VAL A 1 66  ? 5.601   -0.501  18.538  1.00 0.00 ? 66  VAL A CB   4  
ATOM 7777  C CG1  . VAL A 1 66  ? 6.844   -0.168  17.703  1.00 0.00 ? 66  VAL A CG1  4  
ATOM 7778  C CG2  . VAL A 1 66  ? 4.846   0.812   18.899  1.00 0.00 ? 66  VAL A CG2  4  
ATOM 7779  H H    . VAL A 1 66  ? 6.062   -2.978  17.255  1.00 0.00 ? 66  VAL A H    4  
ATOM 7780  H HA   . VAL A 1 66  ? 3.928   -1.664  18.687  1.00 0.00 ? 66  VAL A HA   4  
ATOM 7781  H HB   . VAL A 1 66  ? 5.968   -0.941  19.501  1.00 0.00 ? 66  VAL A HB   4  
ATOM 7782  H HG11 . VAL A 1 66  ? 6.626   -0.118  16.616  1.00 0.00 ? 66  VAL A HG11 4  
ATOM 7783  H HG12 . VAL A 1 66  ? 7.263   0.811   18.025  1.00 0.00 ? 66  VAL A HG12 4  
ATOM 7784  H HG13 . VAL A 1 66  ? 7.614   -0.929  17.914  1.00 0.00 ? 66  VAL A HG13 4  
ATOM 7785  H HG21 . VAL A 1 66  ? 3.927   0.588   19.481  1.00 0.00 ? 66  VAL A HG21 4  
ATOM 7786  H HG22 . VAL A 1 66  ? 5.498   1.471   19.511  1.00 0.00 ? 66  VAL A HG22 4  
ATOM 7787  H HG23 . VAL A 1 66  ? 4.558   1.385   17.989  1.00 0.00 ? 66  VAL A HG23 4  
ATOM 7788  N N    . TRP A 1 67  ? 4.052   -1.397  15.464  1.00 0.00 ? 67  TRP A N    4  
ATOM 7789  C CA   . TRP A 1 67  ? 3.225   -1.026  14.291  1.00 0.00 ? 67  TRP A CA   4  
ATOM 7790  C C    . TRP A 1 67  ? 1.711   -1.282  14.436  1.00 0.00 ? 67  TRP A C    4  
ATOM 7791  O O    . TRP A 1 67  ? 0.891   -0.500  13.970  1.00 0.00 ? 67  TRP A O    4  
ATOM 7792  C CB   . TRP A 1 67  ? 3.756   -1.724  13.005  1.00 0.00 ? 67  TRP A CB   4  
ATOM 7793  C CG   . TRP A 1 67  ? 2.877   -1.691  11.757  1.00 0.00 ? 67  TRP A CG   4  
ATOM 7794  C CD1  . TRP A 1 67  ? 2.023   -2.653  11.294  1.00 0.00 ? 67  TRP A CD1  4  
ATOM 7795  C CD2  . TRP A 1 67  ? 2.722   -0.554  10.906  1.00 0.00 ? 67  TRP A CD2  4  
ATOM 7796  N NE1  . TRP A 1 67  ? 1.443   -2.241  10.121  1.00 0.00 ? 67  TRP A NE1  4  
ATOM 7797  C CE2  . TRP A 1 67  ? 1.847   -0.930  9.885   1.00 0.00 ? 67  TRP A CE2  4  
ATOM 7798  C CE3  . TRP A 1 67  ? 3.254   0.697   10.980  1.00 0.00 ? 67  TRP A CE3  4  
ATOM 7799  C CZ2  . TRP A 1 67  ? 1.539   -0.056  8.880   1.00 0.00 ? 67  TRP A CZ2  4  
ATOM 7800  C CZ3  . TRP A 1 67  ? 2.894   1.590   9.996   1.00 0.00 ? 67  TRP A CZ3  4  
ATOM 7801  C CH2  . TRP A 1 67  ? 2.093   1.205   8.934   1.00 0.00 ? 67  TRP A CH2  4  
ATOM 7802  H H    . TRP A 1 67  ? 4.823   -2.018  15.267  1.00 0.00 ? 67  TRP A H    4  
ATOM 7803  H HA   . TRP A 1 67  ? 3.320   0.037   14.147  1.00 0.00 ? 67  TRP A HA   4  
ATOM 7804  H HB2  . TRP A 1 67  ? 4.740   -1.248  12.746  1.00 0.00 ? 67  TRP A HB2  4  
ATOM 7805  H HB3  . TRP A 1 67  ? 3.896   -2.808  13.231  1.00 0.00 ? 67  TRP A HB3  4  
ATOM 7806  H HD1  . TRP A 1 67  ? 1.879   -3.616  11.764  1.00 0.00 ? 67  TRP A HD1  4  
ATOM 7807  H HE1  . TRP A 1 67  ? 1.243   -2.873  9.398   1.00 0.00 ? 67  TRP A HE1  4  
ATOM 7808  H HE3  . TRP A 1 67  ? 3.920   0.996   11.777  1.00 0.00 ? 67  TRP A HE3  4  
ATOM 7809  H HZ2  . TRP A 1 67  ? 0.851   -0.306  8.090   1.00 0.00 ? 67  TRP A HZ2  4  
ATOM 7810  H HZ3  . TRP A 1 67  ? 3.279   2.599   10.046  1.00 0.00 ? 67  TRP A HZ3  4  
ATOM 7811  H HH2  . TRP A 1 67  ? 1.897   1.897   8.124   1.00 0.00 ? 67  TRP A HH2  4  
ATOM 7812  N N    . ASP A 1 68  ? 1.346   -2.349  15.197  1.00 0.00 ? 68  ASP A N    4  
ATOM 7813  C CA   . ASP A 1 68  ? 0.013   -2.788  15.626  1.00 0.00 ? 68  ASP A CA   4  
ATOM 7814  C C    . ASP A 1 68  ? -0.764  -1.665  16.353  1.00 0.00 ? 68  ASP A C    4  
ATOM 7815  O O    . ASP A 1 68  ? -1.929  -1.386  16.086  1.00 0.00 ? 68  ASP A O    4  
ATOM 7816  C CB   . ASP A 1 68  ? 0.220   -4.001  16.582  1.00 0.00 ? 68  ASP A CB   4  
ATOM 7817  C CG   . ASP A 1 68  ? 0.953   -5.181  15.913  1.00 0.00 ? 68  ASP A CG   4  
ATOM 7818  O OD1  . ASP A 1 68  ? 1.093   -5.200  14.662  1.00 0.00 ? 68  ASP A OD1  4  
ATOM 7819  O OD2  . ASP A 1 68  ? 1.364   -6.099  16.672  1.00 0.00 ? 68  ASP A OD2  4  
ATOM 7820  H H    . ASP A 1 68  ? 2.087   -2.927  15.536  1.00 0.00 ? 68  ASP A H    4  
ATOM 7821  H HA   . ASP A 1 68  ? -0.555  -3.071  14.748  1.00 0.00 ? 68  ASP A HA   4  
ATOM 7822  H HB2  . ASP A 1 68  ? 0.805   -3.651  17.460  1.00 0.00 ? 68  ASP A HB2  4  
ATOM 7823  H HB3  . ASP A 1 68  ? -0.720  -4.416  16.965  1.00 0.00 ? 68  ASP A HB3  4  
ATOM 7824  N N    . ARG A 1 69  ? -0.035  -0.936  17.240  1.00 0.00 ? 69  ARG A N    4  
ATOM 7825  C CA   . ARG A 1 69  ? -0.377  0.341   17.852  1.00 0.00 ? 69  ARG A CA   4  
ATOM 7826  C C    . ARG A 1 69  ? -0.178  1.565   16.937  1.00 0.00 ? 69  ARG A C    4  
ATOM 7827  O O    . ARG A 1 69  ? -1.067  2.405   16.840  1.00 0.00 ? 69  ARG A O    4  
ATOM 7828  C CB   . ARG A 1 69  ? 0.389   0.462   19.198  1.00 0.00 ? 69  ARG A CB   4  
ATOM 7829  C CG   . ARG A 1 69  ? 0.066   1.673   20.102  1.00 0.00 ? 69  ARG A CG   4  
ATOM 7830  C CD   . ARG A 1 69  ? -1.437  1.860   20.368  1.00 0.00 ? 69  ARG A CD   4  
ATOM 7831  N NE   . ARG A 1 69  ? -1.614  2.850   21.485  1.00 0.00 ? 69  ARG A NE   4  
ATOM 7832  C CZ   . ARG A 1 69  ? -2.819  3.081   22.094  1.00 0.00 ? 69  ARG A CZ   4  
ATOM 7833  N NH1  . ARG A 1 69  ? -3.945  2.421   21.694  1.00 0.00 ? 69  ARG A NH1  4  
ATOM 7834  N NH2  . ARG A 1 69  ? -2.895  3.988   23.111  1.00 0.00 ? 69  ARG A NH2  4  
ATOM 7835  H H    . ARG A 1 69  ? 0.909   -1.209  17.423  1.00 0.00 ? 69  ARG A H    4  
ATOM 7836  H HA   . ARG A 1 69  ? -1.447  0.339   18.041  1.00 0.00 ? 69  ARG A HA   4  
ATOM 7837  H HB2  . ARG A 1 69  ? 0.142   -0.453  19.787  1.00 0.00 ? 69  ARG A HB2  4  
ATOM 7838  H HB3  . ARG A 1 69  ? 1.483   0.431   18.997  1.00 0.00 ? 69  ARG A HB3  4  
ATOM 7839  H HG2  . ARG A 1 69  ? 0.593   1.497   21.071  1.00 0.00 ? 69  ARG A HG2  4  
ATOM 7840  H HG3  . ARG A 1 69  ? 0.483   2.603   19.657  1.00 0.00 ? 69  ARG A HG3  4  
ATOM 7841  H HD2  . ARG A 1 69  ? -1.943  2.257   19.455  1.00 0.00 ? 69  ARG A HD2  4  
ATOM 7842  H HD3  . ARG A 1 69  ? -1.885  0.885   20.668  1.00 0.00 ? 69  ARG A HD3  4  
ATOM 7843  H HE   . ARG A 1 69  ? -0.812  3.357   21.803  1.00 0.00 ? 69  ARG A HE   4  
ATOM 7844  H HH11 . ARG A 1 69  ? -3.895  1.756   20.949  1.00 0.00 ? 69  ARG A HH11 4  
ATOM 7845  H HH12 . ARG A 1 69  ? -4.817  2.598   22.148  1.00 0.00 ? 69  ARG A HH12 4  
ATOM 7846  H HH21 . ARG A 1 69  ? -2.073  4.476   23.407  1.00 0.00 ? 69  ARG A HH21 4  
ATOM 7847  H HH22 . ARG A 1 69  ? -3.769  4.164   23.561  1.00 0.00 ? 69  ARG A HH22 4  
ATOM 7848  N N    . ALA A 1 70  ? 0.983   1.731   16.223  1.00 0.00 ? 70  ALA A N    4  
ATOM 7849  C CA   . ALA A 1 70  ? 1.319   2.887   15.371  1.00 0.00 ? 70  ALA A CA   4  
ATOM 7850  C C    . ALA A 1 70  ? 0.406   3.173   14.156  1.00 0.00 ? 70  ALA A C    4  
ATOM 7851  O O    . ALA A 1 70  ? 0.135   4.336   13.836  1.00 0.00 ? 70  ALA A O    4  
ATOM 7852  C CB   . ALA A 1 70  ? 2.805   2.862   14.980  1.00 0.00 ? 70  ALA A CB   4  
ATOM 7853  H H    . ALA A 1 70  ? 1.718   1.048   16.294  1.00 0.00 ? 70  ALA A H    4  
ATOM 7854  H HA   . ALA A 1 70  ? 1.231   3.750   16.017  1.00 0.00 ? 70  ALA A HA   4  
ATOM 7855  H HB1  . ALA A 1 70  ? 3.146   3.865   14.653  1.00 0.00 ? 70  ALA A HB1  4  
ATOM 7856  H HB2  . ALA A 1 70  ? 3.406   2.582   15.872  1.00 0.00 ? 70  ALA A HB2  4  
ATOM 7857  H HB3  . ALA A 1 70  ? 3.015   2.127   14.176  1.00 0.00 ? 70  ALA A HB3  4  
ATOM 7858  N N    . VAL A 1 71  ? -0.159  2.081   13.539  1.00 0.00 ? 71  VAL A N    4  
ATOM 7859  C CA   . VAL A 1 71  ? -1.215  2.019   12.492  1.00 0.00 ? 71  VAL A CA   4  
ATOM 7860  C C    . VAL A 1 71  ? -2.461  2.808   12.835  1.00 0.00 ? 71  VAL A C    4  
ATOM 7861  O O    . VAL A 1 71  ? -2.975  3.509   11.976  1.00 0.00 ? 71  VAL A O    4  
ATOM 7862  C CB   . VAL A 1 71  ? -1.691  0.597   12.136  1.00 0.00 ? 71  VAL A CB   4  
ATOM 7863  C CG1  . VAL A 1 71  ? -2.932  0.499   11.204  1.00 0.00 ? 71  VAL A CG1  4  
ATOM 7864  C CG2  . VAL A 1 71  ? -0.572  -0.039  11.337  1.00 0.00 ? 71  VAL A CG2  4  
ATOM 7865  H H    . VAL A 1 71  ? 0.191   1.190   13.850  1.00 0.00 ? 71  VAL A H    4  
ATOM 7866  H HA   . VAL A 1 71  ? -0.805  2.453   11.587  1.00 0.00 ? 71  VAL A HA   4  
ATOM 7867  H HB   . VAL A 1 71  ? -1.877  0.007   13.064  1.00 0.00 ? 71  VAL A HB   4  
ATOM 7868  H HG11 . VAL A 1 71  ? -2.783  1.111   10.286  1.00 0.00 ? 71  VAL A HG11 4  
ATOM 7869  H HG12 . VAL A 1 71  ? -3.060  -0.556  10.875  1.00 0.00 ? 71  VAL A HG12 4  
ATOM 7870  H HG13 . VAL A 1 71  ? -3.873  0.806   11.702  1.00 0.00 ? 71  VAL A HG13 4  
ATOM 7871  H HG21 . VAL A 1 71  ? 0.413   0.085   11.821  1.00 0.00 ? 71  VAL A HG21 4  
ATOM 7872  H HG22 . VAL A 1 71  ? -0.762  -1.125  11.198  1.00 0.00 ? 71  VAL A HG22 4  
ATOM 7873  H HG23 . VAL A 1 71  ? -0.518  0.439   10.338  1.00 0.00 ? 71  VAL A HG23 4  
ATOM 7874  N N    . ASP A 1 72  ? -2.947  2.762   14.118  1.00 0.00 ? 72  ASP A N    4  
ATOM 7875  C CA   . ASP A 1 72  ? -4.096  3.482   14.695  1.00 0.00 ? 72  ASP A CA   4  
ATOM 7876  C C    . ASP A 1 72  ? -3.985  5.008   14.517  1.00 0.00 ? 72  ASP A C    4  
ATOM 7877  O O    . ASP A 1 72  ? -4.928  5.678   14.114  1.00 0.00 ? 72  ASP A O    4  
ATOM 7878  C CB   . ASP A 1 72  ? -4.304  2.989   16.171  1.00 0.00 ? 72  ASP A CB   4  
ATOM 7879  C CG   . ASP A 1 72  ? -5.490  3.625   16.908  1.00 0.00 ? 72  ASP A CG   4  
ATOM 7880  O OD1  . ASP A 1 72  ? -6.640  3.483   16.413  1.00 0.00 ? 72  ASP A OD1  4  
ATOM 7881  O OD2  . ASP A 1 72  ? -5.257  4.253   17.976  1.00 0.00 ? 72  ASP A OD2  4  
ATOM 7882  H H    . ASP A 1 72  ? -2.468  2.188   14.782  1.00 0.00 ? 72  ASP A H    4  
ATOM 7883  H HA   . ASP A 1 72  ? -4.968  3.190   14.125  1.00 0.00 ? 72  ASP A HA   4  
ATOM 7884  H HB2  . ASP A 1 72  ? -4.502  1.893   16.119  1.00 0.00 ? 72  ASP A HB2  4  
ATOM 7885  H HB3  . ASP A 1 72  ? -3.371  3.098   16.769  1.00 0.00 ? 72  ASP A HB3  4  
ATOM 7886  N N    . PHE A 1 73  ? -2.762  5.541   14.741  1.00 0.00 ? 73  PHE A N    4  
ATOM 7887  C CA   . PHE A 1 73  ? -2.257  6.883   14.461  1.00 0.00 ? 73  PHE A CA   4  
ATOM 7888  C C    . PHE A 1 73  ? -1.909  7.174   12.992  1.00 0.00 ? 73  PHE A C    4  
ATOM 7889  O O    . PHE A 1 73  ? -2.483  8.112   12.438  1.00 0.00 ? 73  PHE A O    4  
ATOM 7890  C CB   . PHE A 1 73  ? -1.053  7.154   15.403  1.00 0.00 ? 73  PHE A CB   4  
ATOM 7891  C CG   . PHE A 1 73  ? -1.373  6.732   16.833  1.00 0.00 ? 73  PHE A CG   4  
ATOM 7892  C CD1  . PHE A 1 73  ? -2.576  7.095   17.424  1.00 0.00 ? 73  PHE A CD1  4  
ATOM 7893  C CD2  . PHE A 1 73  ? -0.499  5.946   17.576  1.00 0.00 ? 73  PHE A CD2  4  
ATOM 7894  C CE1  . PHE A 1 73  ? -2.928  6.642   18.676  1.00 0.00 ? 73  PHE A CE1  4  
ATOM 7895  C CE2  . PHE A 1 73  ? -0.852  5.494   18.834  1.00 0.00 ? 73  PHE A CE2  4  
ATOM 7896  C CZ   . PHE A 1 73  ? -2.071  5.832   19.381  1.00 0.00 ? 73  PHE A CZ   4  
ATOM 7897  H H    . PHE A 1 73  ? -2.093  4.918   15.142  1.00 0.00 ? 73  PHE A H    4  
ATOM 7898  H HA   . PHE A 1 73  ? -3.020  7.635   14.645  1.00 0.00 ? 73  PHE A HA   4  
ATOM 7899  H HB2  . PHE A 1 73  ? -0.163  6.593   15.042  1.00 0.00 ? 73  PHE A HB2  4  
ATOM 7900  H HB3  . PHE A 1 73  ? -0.801  8.233   15.423  1.00 0.00 ? 73  PHE A HB3  4  
ATOM 7901  H HD1  . PHE A 1 73  ? -3.285  7.725   16.903  1.00 0.00 ? 73  PHE A HD1  4  
ATOM 7902  H HD2  . PHE A 1 73  ? 0.466   5.653   17.178  1.00 0.00 ? 73  PHE A HD2  4  
ATOM 7903  H HE1  . PHE A 1 73  ? -3.882  6.926   19.101  1.00 0.00 ? 73  PHE A HE1  4  
ATOM 7904  H HE2  . PHE A 1 73  ? -0.170  4.868   19.395  1.00 0.00 ? 73  PHE A HE2  4  
ATOM 7905  H HZ   . PHE A 1 73  ? -2.367  5.470   20.356  1.00 0.00 ? 73  PHE A HZ   4  
ATOM 7906  N N    . LEU A 1 74  ? -0.986  6.407   12.304  1.00 0.00 ? 74  LEU A N    4  
ATOM 7907  C CA   . LEU A 1 74  ? -0.622  6.620   10.864  1.00 0.00 ? 74  LEU A CA   4  
ATOM 7908  C C    . LEU A 1 74  ? -1.765  6.471   9.848   1.00 0.00 ? 74  LEU A C    4  
ATOM 7909  O O    . LEU A 1 74  ? -1.873  7.279   8.920   1.00 0.00 ? 74  LEU A O    4  
ATOM 7910  C CB   . LEU A 1 74  ? 0.552   5.710   10.380  1.00 0.00 ? 74  LEU A CB   4  
ATOM 7911  C CG   . LEU A 1 74  ? 1.090   5.984   8.951   1.00 0.00 ? 74  LEU A CG   4  
ATOM 7912  C CD1  . LEU A 1 74  ? 1.570   7.417   8.706   1.00 0.00 ? 74  LEU A CD1  4  
ATOM 7913  C CD2  . LEU A 1 74  ? 2.254   5.052   8.648   1.00 0.00 ? 74  LEU A CD2  4  
ATOM 7914  H H    . LEU A 1 74  ? -0.505  5.645   12.792  1.00 0.00 ? 74  LEU A H    4  
ATOM 7915  H HA   . LEU A 1 74  ? -0.303  7.662   10.722  1.00 0.00 ? 74  LEU A HA   4  
ATOM 7916  H HB2  . LEU A 1 74  ? 1.442   5.868   11.045  1.00 0.00 ? 74  LEU A HB2  4  
ATOM 7917  H HB3  . LEU A 1 74  ? 0.209   4.631   10.398  1.00 0.00 ? 74  LEU A HB3  4  
ATOM 7918  H HG   . LEU A 1 74  ? 0.283   5.746   8.228   1.00 0.00 ? 74  LEU A HG   4  
ATOM 7919  H HD11 . LEU A 1 74  ? 2.379   7.665   9.421   1.00 0.00 ? 74  LEU A HD11 4  
ATOM 7920  H HD12 . LEU A 1 74  ? 1.999   7.487   7.683   1.00 0.00 ? 74  LEU A HD12 4  
ATOM 7921  H HD13 . LEU A 1 74  ? 0.740   8.147   8.797   1.00 0.00 ? 74  LEU A HD13 4  
ATOM 7922  H HD21 . LEU A 1 74  ? 2.012   4.043   9.016   1.00 0.00 ? 74  LEU A HD21 4  
ATOM 7923  H HD22 . LEU A 1 74  ? 2.463   5.027   7.558   1.00 0.00 ? 74  LEU A HD22 4  
ATOM 7924  H HD23 . LEU A 1 74  ? 3.161   5.412   9.171   1.00 0.00 ? 74  LEU A HD23 4  
ATOM 7925  N N    . ALA A 1 75  ? -2.694  5.473   10.012  1.00 0.00 ? 75  ALA A N    4  
ATOM 7926  C CA   . ALA A 1 75  ? -3.850  5.267   9.140   1.00 0.00 ? 75  ALA A CA   4  
ATOM 7927  C C    . ALA A 1 75  ? -4.877  6.412   9.042   1.00 0.00 ? 75  ALA A C    4  
ATOM 7928  O O    . ALA A 1 75  ? -5.690  6.432   8.124   1.00 0.00 ? 75  ALA A O    4  
ATOM 7929  C CB   . ALA A 1 75  ? -4.530  3.929   9.484   1.00 0.00 ? 75  ALA A CB   4  
ATOM 7930  H H    . ALA A 1 75  ? -2.657  4.772   10.747  1.00 0.00 ? 75  ALA A H    4  
ATOM 7931  H HA   . ALA A 1 75  ? -3.459  5.148   8.137   1.00 0.00 ? 75  ALA A HA   4  
ATOM 7932  H HB1  . ALA A 1 75  ? -5.281  3.637   8.720   1.00 0.00 ? 75  ALA A HB1  4  
ATOM 7933  H HB2  . ALA A 1 75  ? -3.744  3.141   9.532   1.00 0.00 ? 75  ALA A HB2  4  
ATOM 7934  H HB3  . ALA A 1 75  ? -5.023  3.981   10.479  1.00 0.00 ? 75  ALA A HB3  4  
ATOM 7935  N N    . ALA A 1 76  ? -4.807  7.438   9.953   1.00 0.00 ? 76  ALA A N    4  
ATOM 7936  C CA   . ALA A 1 76  ? -5.577  8.668   9.925   1.00 0.00 ? 76  ALA A CA   4  
ATOM 7937  C C    . ALA A 1 76  ? -5.009  9.728   8.949   1.00 0.00 ? 76  ALA A C    4  
ATOM 7938  O O    . ALA A 1 76  ? -5.657  10.733  8.664   1.00 0.00 ? 76  ALA A O    4  
ATOM 7939  C CB   . ALA A 1 76  ? -5.652  9.221   11.368  1.00 0.00 ? 76  ALA A CB   4  
ATOM 7940  H H    . ALA A 1 76  ? -4.157  7.429   10.721  1.00 0.00 ? 76  ALA A H    4  
ATOM 7941  H HA   . ALA A 1 76  ? -6.586  8.446   9.598   1.00 0.00 ? 76  ALA A HA   4  
ATOM 7942  H HB1  . ALA A 1 76  ? -6.036  8.431   12.051  1.00 0.00 ? 76  ALA A HB1  4  
ATOM 7943  H HB2  . ALA A 1 76  ? -4.651  9.539   11.736  1.00 0.00 ? 76  ALA A HB2  4  
ATOM 7944  H HB3  . ALA A 1 76  ? -6.345  10.087  11.428  1.00 0.00 ? 76  ALA A HB3  4  
ATOM 7945  N N    . ASN A 1 77  ? -3.777  9.514   8.397   1.00 0.00 ? 77  ASN A N    4  
ATOM 7946  C CA   . ASN A 1 77  ? -3.109  10.402  7.449   1.00 0.00 ? 77  ASN A CA   4  
ATOM 7947  C C    . ASN A 1 77  ? -2.911  9.742   6.080   1.00 0.00 ? 77  ASN A C    4  
ATOM 7948  O O    . ASN A 1 77  ? -2.120  10.224  5.271   1.00 0.00 ? 77  ASN A O    4  
ATOM 7949  C CB   . ASN A 1 77  ? -1.748  10.906  8.016   1.00 0.00 ? 77  ASN A CB   4  
ATOM 7950  C CG   . ASN A 1 77  ? -1.943  11.790  9.255   1.00 0.00 ? 77  ASN A CG   4  
ATOM 7951  O OD1  . ASN A 1 77  ? -1.420  11.483  10.328  1.00 0.00 ? 77  ASN A OD1  4  
ATOM 7952  N ND2  . ASN A 1 77  ? -2.672  12.921  9.105   1.00 0.00 ? 77  ASN A ND2  4  
ATOM 7953  H H    . ASN A 1 77  ? -3.253  8.698   8.664   1.00 0.00 ? 77  ASN A H    4  
ATOM 7954  H HA   . ASN A 1 77  ? -3.730  11.263  7.237   1.00 0.00 ? 77  ASN A HA   4  
ATOM 7955  H HB2  . ASN A 1 77  ? -1.122  10.041  8.324   1.00 0.00 ? 77  ASN A HB2  4  
ATOM 7956  H HB3  . ASN A 1 77  ? -1.184  11.501  7.268   1.00 0.00 ? 77  ASN A HB3  4  
ATOM 7957  H HD21 . ASN A 1 77  ? -3.065  13.156  8.222   1.00 0.00 ? 77  ASN A HD21 4  
ATOM 7958  H HD22 . ASN A 1 77  ? -2.757  13.527  9.896   1.00 0.00 ? 77  ASN A HD22 4  
ATOM 7959  N N    . GLU A 1 78  ? -3.660  8.640   5.790   1.00 0.00 ? 78  GLU A N    4  
ATOM 7960  C CA   . GLU A 1 78  ? -3.702  7.880   4.530   1.00 0.00 ? 78  GLU A CA   4  
ATOM 7961  C C    . GLU A 1 78  ? -2.491  6.963   4.214   1.00 0.00 ? 78  GLU A C    4  
ATOM 7962  O O    . GLU A 1 78  ? -1.952  6.293   5.091   1.00 0.00 ? 78  GLU A O    4  
ATOM 7963  C CB   . GLU A 1 78  ? -4.149  8.773   3.327   1.00 0.00 ? 78  GLU A CB   4  
ATOM 7964  C CG   . GLU A 1 78  ? -4.969  8.042   2.241   1.00 0.00 ? 78  GLU A CG   4  
ATOM 7965  C CD   . GLU A 1 78  ? -5.343  9.024   1.132   1.00 0.00 ? 78  GLU A CD   4  
ATOM 7966  O OE1  . GLU A 1 78  ? -6.087  9.998   1.428   1.00 0.00 ? 78  GLU A OE1  4  
ATOM 7967  O OE2  . GLU A 1 78  ? -4.894  8.811   -0.026  1.00 0.00 ? 78  GLU A OE2  4  
ATOM 7968  H H    . GLU A 1 78  ? -4.277  8.309   6.501   1.00 0.00 ? 78  GLU A H    4  
ATOM 7969  H HA   . GLU A 1 78  ? -4.520  7.190   4.683   1.00 0.00 ? 78  GLU A HA   4  
ATOM 7970  H HB2  . GLU A 1 78  ? -4.818  9.560   3.747   1.00 0.00 ? 78  GLU A HB2  4  
ATOM 7971  H HB3  . GLU A 1 78  ? -3.281  9.310   2.886   1.00 0.00 ? 78  GLU A HB3  4  
ATOM 7972  H HG2  . GLU A 1 78  ? -4.385  7.205   1.806   1.00 0.00 ? 78  GLU A HG2  4  
ATOM 7973  H HG3  . GLU A 1 78  ? -5.894  7.623   2.691   1.00 0.00 ? 78  GLU A HG3  4  
ATOM 7974  N N    . SER A 1 79  ? -2.050  6.900   2.934   1.00 0.00 ? 79  SER A N    4  
ATOM 7975  C CA   . SER A 1 79  ? -0.929  6.116   2.426   1.00 0.00 ? 79  SER A CA   4  
ATOM 7976  C C    . SER A 1 79  ? -0.815  6.498   0.956   1.00 0.00 ? 79  SER A C    4  
ATOM 7977  O O    . SER A 1 79  ? -1.566  7.341   0.467   1.00 0.00 ? 79  SER A O    4  
ATOM 7978  C CB   . SER A 1 79  ? -1.063  4.549   2.572   1.00 0.00 ? 79  SER A CB   4  
ATOM 7979  O OG   . SER A 1 79  ? 0.111   3.819   2.164   1.00 0.00 ? 79  SER A OG   4  
ATOM 7980  H H    . SER A 1 79  ? -2.501  7.460   2.238   1.00 0.00 ? 79  SER A H    4  
ATOM 7981  H HA   . SER A 1 79  ? -0.028  6.448   2.922   1.00 0.00 ? 79  SER A HA   4  
ATOM 7982  H HB2  . SER A 1 79  ? -1.244  4.315   3.644   1.00 0.00 ? 79  SER A HB2  4  
ATOM 7983  H HB3  . SER A 1 79  ? -1.949  4.184   2.004   1.00 0.00 ? 79  SER A HB3  4  
ATOM 7984  H HG   . SER A 1 79  ? -0.200  3.056   1.623   1.00 0.00 ? 79  SER A HG   4  
ATOM 7985  N N    . ARG A 1 80  ? 0.125   5.816   0.263   1.00 0.00 ? 80  ARG A N    4  
ATOM 7986  C CA   . ARG A 1 80  ? 0.440   5.857   -1.151  1.00 0.00 ? 80  ARG A CA   4  
ATOM 7987  C C    . ARG A 1 80  ? 0.273   4.442   -1.689  1.00 0.00 ? 80  ARG A C    4  
ATOM 7988  O O    . ARG A 1 80  ? -0.446  4.249   -2.668  1.00 0.00 ? 80  ARG A O    4  
ATOM 7989  C CB   . ARG A 1 80  ? 1.860   6.419   -1.402  1.00 0.00 ? 80  ARG A CB   4  
ATOM 7990  C CG   . ARG A 1 80  ? 2.091   7.862   -0.901  1.00 0.00 ? 80  ARG A CG   4  
ATOM 7991  C CD   . ARG A 1 80  ? 1.216   8.917   -1.599  1.00 0.00 ? 80  ARG A CD   4  
ATOM 7992  N NE   . ARG A 1 80  ? 1.566   10.288  -1.075  1.00 0.00 ? 80  ARG A NE   4  
ATOM 7993  C CZ   . ARG A 1 80  ? 1.001   10.855  0.038   1.00 0.00 ? 80  ARG A CZ   4  
ATOM 7994  N NH1  . ARG A 1 80  ? 0.061   10.193  0.772   1.00 0.00 ? 80  ARG A NH1  4  
ATOM 7995  N NH2  . ARG A 1 80  ? 1.392   12.106  0.419   1.00 0.00 ? 80  ARG A NH2  4  
ATOM 7996  H H    . ARG A 1 80  ? 0.632   5.147   0.810   1.00 0.00 ? 80  ARG A H    4  
ATOM 7997  H HA   . ARG A 1 80  ? -0.290  6.442   -1.704  1.00 0.00 ? 80  ARG A HA   4  
ATOM 7998  H HB2  . ARG A 1 80  ? 2.615   5.772   -0.901  1.00 0.00 ? 80  ARG A HB2  4  
ATOM 7999  H HB3  . ARG A 1 80  ? 2.060   6.419   -2.497  1.00 0.00 ? 80  ARG A HB3  4  
ATOM 8000  H HG2  . ARG A 1 80  ? 1.920   7.899   0.198   1.00 0.00 ? 80  ARG A HG2  4  
ATOM 8001  H HG3  . ARG A 1 80  ? 3.162   8.111   -1.084  1.00 0.00 ? 80  ARG A HG3  4  
ATOM 8002  H HD2  . ARG A 1 80  ? 1.432   8.916   -2.689  1.00 0.00 ? 80  ARG A HD2  4  
ATOM 8003  H HD3  . ARG A 1 80  ? 0.134   8.713   -1.453  1.00 0.00 ? 80  ARG A HD3  4  
ATOM 8004  H HE   . ARG A 1 80  ? 2.254   10.814  -1.574  1.00 0.00 ? 80  ARG A HE   4  
ATOM 8005  H HH11 . ARG A 1 80  ? -0.228  9.274   0.501   1.00 0.00 ? 80  ARG A HH11 4  
ATOM 8006  H HH12 . ARG A 1 80  ? -0.336  10.625  1.581   1.00 0.00 ? 80  ARG A HH12 4  
ATOM 8007  H HH21 . ARG A 1 80  ? 2.084   12.597  -0.110  1.00 0.00 ? 80  ARG A HH21 4  
ATOM 8008  H HH22 . ARG A 1 80  ? 0.989   12.530  1.231   1.00 0.00 ? 80  ARG A HH22 4  
ATOM 8009  N N    . VAL A 1 81  ? 0.891   3.392   -1.033  1.00 0.00 ? 81  VAL A N    4  
ATOM 8010  C CA   . VAL A 1 81  ? 0.685   1.968   -1.362  1.00 0.00 ? 81  VAL A CA   4  
ATOM 8011  C C    . VAL A 1 81  ? -0.591  1.485   -0.641  1.00 0.00 ? 81  VAL A C    4  
ATOM 8012  O O    . VAL A 1 81  ? -0.890  1.934   0.471   1.00 0.00 ? 81  VAL A O    4  
ATOM 8013  C CB   . VAL A 1 81  ? 1.923   1.055   -1.148  1.00 0.00 ? 81  VAL A CB   4  
ATOM 8014  C CG1  . VAL A 1 81  ? 3.115   1.360   -2.119  1.00 0.00 ? 81  VAL A CG1  4  
ATOM 8015  C CG2  . VAL A 1 81  ? 2.378   1.096   0.328   1.00 0.00 ? 81  VAL A CG2  4  
ATOM 8016  H H    . VAL A 1 81  ? 1.471   3.538   -0.237  1.00 0.00 ? 81  VAL A H    4  
ATOM 8017  H HA   . VAL A 1 81  ? 0.417   1.907   -2.396  1.00 0.00 ? 81  VAL A HA   4  
ATOM 8018  H HB   . VAL A 1 81  ? 1.633   -0.003  -1.367  1.00 0.00 ? 81  VAL A HB   4  
ATOM 8019  H HG11 . VAL A 1 81  ? 3.244   2.424   -2.445  1.00 0.00 ? 81  VAL A HG11 4  
ATOM 8020  H HG12 . VAL A 1 81  ? 4.057   0.986   -1.678  1.00 0.00 ? 81  VAL A HG12 4  
ATOM 8021  H HG13 . VAL A 1 81  ? 3.067   0.767   -3.054  1.00 0.00 ? 81  VAL A HG13 4  
ATOM 8022  H HG21 . VAL A 1 81  ? 1.543   0.873   1.023   1.00 0.00 ? 81  VAL A HG21 4  
ATOM 8023  H HG22 . VAL A 1 81  ? 3.170   0.334   0.493   1.00 0.00 ? 81  VAL A HG22 4  
ATOM 8024  H HG23 . VAL A 1 81  ? 2.791   2.094   0.567   1.00 0.00 ? 81  VAL A HG23 4  
ATOM 8025  N N    . ARG A 1 82  ? -1.430  0.630   -1.296  1.00 0.00 ? 82  ARG A N    4  
ATOM 8026  C CA   . ARG A 1 82  ? -2.781  0.263   -0.863  1.00 0.00 ? 82  ARG A CA   4  
ATOM 8027  C C    . ARG A 1 82  ? -2.919  -1.231  -0.613  1.00 0.00 ? 82  ARG A C    4  
ATOM 8028  O O    . ARG A 1 82  ? -2.363  -2.028  -1.368  1.00 0.00 ? 82  ARG A O    4  
ATOM 8029  C CB   . ARG A 1 82  ? -3.752  0.660   -2.016  1.00 0.00 ? 82  ARG A CB   4  
ATOM 8030  C CG   . ARG A 1 82  ? -5.259  0.408   -1.787  1.00 0.00 ? 82  ARG A CG   4  
ATOM 8031  C CD   . ARG A 1 82  ? -6.057  0.444   -3.102  1.00 0.00 ? 82  ARG A CD   4  
ATOM 8032  N NE   . ARG A 1 82  ? -7.492  0.072   -2.828  1.00 0.00 ? 82  ARG A NE   4  
ATOM 8033  C CZ   . ARG A 1 82  ? -7.964  -1.216  -2.839  1.00 0.00 ? 82  ARG A CZ   4  
ATOM 8034  N NH1  . ARG A 1 82  ? -7.143  -2.266  -3.132  1.00 0.00 ? 82  ARG A NH1  4  
ATOM 8035  N NH2  . ARG A 1 82  ? -9.278  -1.451  -2.552  1.00 0.00 ? 82  ARG A NH2  4  
ATOM 8036  H H    . ARG A 1 82  ? -1.209  0.261   -2.207  1.00 0.00 ? 82  ARG A H    4  
ATOM 8037  H HA   . ARG A 1 82  ? -3.062  0.787   0.041   1.00 0.00 ? 82  ARG A HA   4  
ATOM 8038  H HB2  . ARG A 1 82  ? -3.619  1.745   -2.226  1.00 0.00 ? 82  ARG A HB2  4  
ATOM 8039  H HB3  . ARG A 1 82  ? -3.438  0.121   -2.941  1.00 0.00 ? 82  ARG A HB3  4  
ATOM 8040  H HG2  . ARG A 1 82  ? -5.429  -0.595  -1.338  1.00 0.00 ? 82  ARG A HG2  4  
ATOM 8041  H HG3  . ARG A 1 82  ? -5.652  1.164   -1.074  1.00 0.00 ? 82  ARG A HG3  4  
ATOM 8042  H HD2  . ARG A 1 82  ? -6.046  1.470   -3.529  1.00 0.00 ? 82  ARG A HD2  4  
ATOM 8043  H HD3  . ARG A 1 82  ? -5.611  -0.261  -3.843  1.00 0.00 ? 82  ARG A HD3  4  
ATOM 8044  H HE   . ARG A 1 82  ? -8.132  0.808   -2.606  1.00 0.00 ? 82  ARG A HE   4  
ATOM 8045  H HH11 . ARG A 1 82  ? -6.180  -2.103  -3.342  1.00 0.00 ? 82  ARG A HH11 4  
ATOM 8046  H HH12 . ARG A 1 82  ? -7.505  -3.199  -3.137  1.00 0.00 ? 82  ARG A HH12 4  
ATOM 8047  H HH21 . ARG A 1 82  ? -9.885  -0.686  -2.336  1.00 0.00 ? 82  ARG A HH21 4  
ATOM 8048  H HH22 . ARG A 1 82  ? -9.631  -2.386  -2.561  1.00 0.00 ? 82  ARG A HH22 4  
ATOM 8049  N N    . THR A 1 83  ? -3.687  -1.632  0.454   1.00 0.00 ? 83  THR A N    4  
ATOM 8050  C CA   . THR A 1 83  ? -3.986  -3.010  0.859   1.00 0.00 ? 83  THR A CA   4  
ATOM 8051  C C    . THR A 1 83  ? -5.119  -3.633  0.055   1.00 0.00 ? 83  THR A C    4  
ATOM 8052  O O    . THR A 1 83  ? -6.281  -3.234  0.145   1.00 0.00 ? 83  THR A O    4  
ATOM 8053  C CB   . THR A 1 83  ? -4.287  -3.200  2.352   1.00 0.00 ? 83  THR A CB   4  
ATOM 8054  O OG1  . THR A 1 83  ? -4.315  -1.962  3.049   1.00 0.00 ? 83  THR A OG1  4  
ATOM 8055  C CG2  . THR A 1 83  ? -3.161  -4.037  2.966   1.00 0.00 ? 83  THR A CG2  4  
ATOM 8056  H H    . THR A 1 83  ? -4.113  -0.975  1.075   1.00 0.00 ? 83  THR A H    4  
ATOM 8057  H HA   . THR A 1 83  ? -3.093  -3.584  0.678   1.00 0.00 ? 83  THR A HA   4  
ATOM 8058  H HB   . THR A 1 83  ? -5.234  -3.761  2.569   1.00 0.00 ? 83  THR A HB   4  
ATOM 8059  H HG1  . THR A 1 83  ? -4.383  -2.211  3.976   1.00 0.00 ? 83  THR A HG1  4  
ATOM 8060  H HG21 . THR A 1 83  ? -3.115  -5.015  2.439   1.00 0.00 ? 83  THR A HG21 4  
ATOM 8061  H HG22 . THR A 1 83  ? -2.180  -3.524  2.849   1.00 0.00 ? 83  THR A HG22 4  
ATOM 8062  H HG23 . THR A 1 83  ? -3.356  -4.221  4.043   1.00 0.00 ? 83  THR A HG23 4  
ATOM 8063  N N    . GLU A 1 84  ? -4.780  -4.670  -0.738  1.00 0.00 ? 84  GLU A N    4  
ATOM 8064  C CA   . GLU A 1 84  ? -5.695  -5.411  -1.572  1.00 0.00 ? 84  GLU A CA   4  
ATOM 8065  C C    . GLU A 1 84  ? -5.761  -6.826  -1.030  1.00 0.00 ? 84  GLU A C    4  
ATOM 8066  O O    . GLU A 1 84  ? -4.760  -7.344  -0.536  1.00 0.00 ? 84  GLU A O    4  
ATOM 8067  C CB   . GLU A 1 84  ? -5.138  -5.374  -3.025  1.00 0.00 ? 84  GLU A CB   4  
ATOM 8068  C CG   . GLU A 1 84  ? -5.989  -6.127  -4.066  1.00 0.00 ? 84  GLU A CG   4  
ATOM 8069  C CD   . GLU A 1 84  ? -5.450  -5.828  -5.463  1.00 0.00 ? 84  GLU A CD   4  
ATOM 8070  O OE1  . GLU A 1 84  ? -5.562  -4.649  -5.896  1.00 0.00 ? 84  GLU A OE1  4  
ATOM 8071  O OE2  . GLU A 1 84  ? -4.925  -6.769  -6.117  1.00 0.00 ? 84  GLU A OE2  4  
ATOM 8072  H H    . GLU A 1 84  ? -3.830  -4.999  -0.780  1.00 0.00 ? 84  GLU A H    4  
ATOM 8073  H HA   . GLU A 1 84  ? -6.694  -4.991  -1.551  1.00 0.00 ? 84  GLU A HA   4  
ATOM 8074  H HB2  . GLU A 1 84  ? -5.138  -4.272  -3.316  1.00 0.00 ? 84  GLU A HB2  4  
ATOM 8075  H HB3  . GLU A 1 84  ? -4.100  -5.838  -3.023  1.00 0.00 ? 84  GLU A HB3  4  
ATOM 8076  H HG2  . GLU A 1 84  ? -5.881  -7.240  -3.878  1.00 0.00 ? 84  GLU A HG2  4  
ATOM 8077  H HG3  . GLU A 1 84  ? -7.048  -5.732  -4.007  1.00 0.00 ? 84  GLU A HG3  4  
ATOM 8078  N N    . THR A 1 85  ? -6.935  -7.512  -1.118  1.00 0.00 ? 85  THR A N    4  
ATOM 8079  C CA   . THR A 1 85  ? -7.073  -8.922  -0.763  1.00 0.00 ? 85  THR A CA   4  
ATOM 8080  C C    . THR A 1 85  ? -6.880  -9.691  -2.073  1.00 0.00 ? 85  THR A C    4  
ATOM 8081  O O    . THR A 1 85  ? -7.685  -9.607  -3.001  1.00 0.00 ? 85  THR A O    4  
ATOM 8082  C CB   . THR A 1 85  ? -8.408  -9.209  -0.089  1.00 0.00 ? 85  THR A CB   4  
ATOM 8083  O OG1  . THR A 1 85  ? -8.646  -8.261  0.945   1.00 0.00 ? 85  THR A OG1  4  
ATOM 8084  C CG2  . THR A 1 85  ? -8.405  -10.609 0.548   1.00 0.00 ? 85  THR A CG2  4  
ATOM 8085  H H    . THR A 1 85  ? -7.757  -7.082  -1.477  1.00 0.00 ? 85  THR A H    4  
ATOM 8086  H HA   . THR A 1 85  ? -6.307  -9.212  -0.066  1.00 0.00 ? 85  THR A HA   4  
ATOM 8087  H HB   . THR A 1 85  ? -9.255  -9.101  -0.796  1.00 0.00 ? 85  THR A HB   4  
ATOM 8088  H HG1  . THR A 1 85  ? -7.795  -8.087  1.354   1.00 0.00 ? 85  THR A HG1  4  
ATOM 8089  H HG21 . THR A 1 85  ? -7.549  -10.719 1.249   1.00 0.00 ? 85  THR A HG21 4  
ATOM 8090  H HG22 . THR A 1 85  ? -9.346  -10.774 1.114   1.00 0.00 ? 85  THR A HG22 4  
ATOM 8091  H HG23 . THR A 1 85  ? -8.341  -11.391 -0.233  1.00 0.00 ? 85  THR A HG23 4  
ATOM 8092  N N    . ARG A 1 86  ? -5.749  -10.421 -2.207  1.00 0.00 ? 86  ARG A N    4  
ATOM 8093  C CA   . ARG A 1 86  ? -5.341  -11.028 -3.457  1.00 0.00 ? 86  ARG A CA   4  
ATOM 8094  C C    . ARG A 1 86  ? -4.854  -12.419 -3.148  1.00 0.00 ? 86  ARG A C    4  
ATOM 8095  O O    . ARG A 1 86  ? -4.246  -12.627 -2.102  1.00 0.00 ? 86  ARG A O    4  
ATOM 8096  C CB   . ARG A 1 86  ? -4.203  -10.147 -4.049  1.00 0.00 ? 86  ARG A CB   4  
ATOM 8097  C CG   . ARG A 1 86  ? -3.588  -10.618 -5.379  1.00 0.00 ? 86  ARG A CG   4  
ATOM 8098  C CD   . ARG A 1 86  ? -4.588  -10.623 -6.544  1.00 0.00 ? 86  ARG A CD   4  
ATOM 8099  N NE   . ARG A 1 86  ? -3.866  -11.083 -7.781  1.00 0.00 ? 86  ARG A NE   4  
ATOM 8100  C CZ   . ARG A 1 86  ? -4.495  -11.277 -8.982  1.00 0.00 ? 86  ARG A CZ   4  
ATOM 8101  N NH1  . ARG A 1 86  ? -5.837  -11.065 -9.112  1.00 0.00 ? 86  ARG A NH1  4  
ATOM 8102  N NH2  . ARG A 1 86  ? -3.767  -11.686 -10.062 1.00 0.00 ? 86  ARG A NH2  4  
ATOM 8103  H H    . ARG A 1 86  ? -5.053  -10.498 -1.487  1.00 0.00 ? 86  ARG A H    4  
ATOM 8104  H HA   . ARG A 1 86  ? -6.165  -11.104 -4.157  1.00 0.00 ? 86  ARG A HA   4  
ATOM 8105  H HB2  . ARG A 1 86  ? -4.702  -9.139  -4.298  1.00 0.00 ? 86  ARG A HB2  4  
ATOM 8106  H HB3  . ARG A 1 86  ? -3.347  -10.128 -3.280  1.00 0.00 ? 86  ARG A HB3  4  
ATOM 8107  H HG2  . ARG A 1 86  ? -2.781  -9.868  -5.602  1.00 0.00 ? 86  ARG A HG2  4  
ATOM 8108  H HG3  . ARG A 1 86  ? -3.169  -11.659 -5.264  1.00 0.00 ? 86  ARG A HG3  4  
ATOM 8109  H HD2  . ARG A 1 86  ? -5.424  -11.326 -6.333  1.00 0.00 ? 86  ARG A HD2  4  
ATOM 8110  H HD3  . ARG A 1 86  ? -4.986  -9.599  -6.715  1.00 0.00 ? 86  ARG A HD3  4  
ATOM 8111  H HE   . ARG A 1 86  ? -2.882  -11.247 -7.723  1.00 0.00 ? 86  ARG A HE   4  
ATOM 8112  H HH11 . ARG A 1 86  ? -6.374  -10.765 -8.323  1.00 0.00 ? 86  ARG A HH11 4  
ATOM 8113  H HH12 . ARG A 1 86  ? -6.281  -11.209 -9.996  1.00 0.00 ? 86  ARG A HH12 4  
ATOM 8114  H HH21 . ARG A 1 86  ? -2.783  -11.841 -9.970  1.00 0.00 ? 86  ARG A HH21 4  
ATOM 8115  H HH22 . ARG A 1 86  ? -4.218  -11.830 -10.942 1.00 0.00 ? 86  ARG A HH22 4  
ATOM 8116  N N    . ARG A 1 87  ? -5.109  -13.409 -4.050  1.00 0.00 ? 87  ARG A N    4  
ATOM 8117  C CA   . ARG A 1 87  ? -4.728  -14.813 -3.910  1.00 0.00 ? 87  ARG A CA   4  
ATOM 8118  C C    . ARG A 1 87  ? -3.302  -15.103 -4.396  1.00 0.00 ? 87  ARG A C    4  
ATOM 8119  O O    . ARG A 1 87  ? -2.976  -14.831 -5.546  1.00 0.00 ? 87  ARG A O    4  
ATOM 8120  C CB   . ARG A 1 87  ? -5.728  -15.729 -4.666  1.00 0.00 ? 87  ARG A CB   4  
ATOM 8121  C CG   . ARG A 1 87  ? -5.682  -17.208 -4.227  1.00 0.00 ? 87  ARG A CG   4  
ATOM 8122  C CD   . ARG A 1 87  ? -6.485  -18.155 -5.127  1.00 0.00 ? 87  ARG A CD   4  
ATOM 8123  N NE   . ARG A 1 87  ? -5.770  -18.261 -6.449  1.00 0.00 ? 87  ARG A NE   4  
ATOM 8124  C CZ   . ARG A 1 87  ? -5.949  -19.299 -7.325  1.00 0.00 ? 87  ARG A CZ   4  
ATOM 8125  N NH1  . ARG A 1 87  ? -6.822  -20.309 -7.047  1.00 0.00 ? 87  ARG A NH1  4  
ATOM 8126  N NH2  . ARG A 1 87  ? -5.238  -19.320 -8.491  1.00 0.00 ? 87  ARG A NH2  4  
ATOM 8127  H H    . ARG A 1 87  ? -5.586  -13.186 -4.894  1.00 0.00 ? 87  ARG A H    4  
ATOM 8128  H HA   . ARG A 1 87  ? -4.803  -15.081 -2.868  1.00 0.00 ? 87  ARG A HA   4  
ATOM 8129  H HB2  . ARG A 1 87  ? -6.755  -15.361 -4.444  1.00 0.00 ? 87  ARG A HB2  4  
ATOM 8130  H HB3  . ARG A 1 87  ? -5.589  -15.642 -5.769  1.00 0.00 ? 87  ARG A HB3  4  
ATOM 8131  H HG2  . ARG A 1 87  ? -4.628  -17.572 -4.183  1.00 0.00 ? 87  ARG A HG2  4  
ATOM 8132  H HG3  . ARG A 1 87  ? -6.110  -17.263 -3.196  1.00 0.00 ? 87  ARG A HG3  4  
ATOM 8133  H HD2  . ARG A 1 87  ? -6.537  -19.157 -4.643  1.00 0.00 ? 87  ARG A HD2  4  
ATOM 8134  H HD3  . ARG A 1 87  ? -7.511  -17.765 -5.299  1.00 0.00 ? 87  ARG A HD3  4  
ATOM 8135  H HE   . ARG A 1 87  ? -5.123  -17.539 -6.692  1.00 0.00 ? 87  ARG A HE   4  
ATOM 8136  H HH11 . ARG A 1 87  ? -7.342  -20.298 -6.194  1.00 0.00 ? 87  ARG A HH11 4  
ATOM 8137  H HH12 . ARG A 1 87  ? -6.939  -21.062 -7.696  1.00 0.00 ? 87  ARG A HH12 4  
ATOM 8138  H HH21 . ARG A 1 87  ? -4.595  -18.583 -8.698  1.00 0.00 ? 87  ARG A HH21 4  
ATOM 8139  H HH22 . ARG A 1 87  ? -5.358  -20.075 -9.134  1.00 0.00 ? 87  ARG A HH22 4  
ATOM 8140  N N    . ILE A 1 88  ? -2.414  -15.665 -3.536  1.00 0.00 ? 88  ILE A N    4  
ATOM 8141  C CA   . ILE A 1 88  ? -1.025  -15.994 -3.858  1.00 0.00 ? 88  ILE A CA   4  
ATOM 8142  C C    . ILE A 1 88  ? -0.747  -17.383 -3.323  1.00 0.00 ? 88  ILE A C    4  
ATOM 8143  O O    . ILE A 1 88  ? -0.943  -17.649 -2.141  1.00 0.00 ? 88  ILE A O    4  
ATOM 8144  C CB   . ILE A 1 88  ? 0.020   -14.977 -3.360  1.00 0.00 ? 88  ILE A CB   4  
ATOM 8145  C CG1  . ILE A 1 88  ? -0.240  -14.401 -1.934  1.00 0.00 ? 88  ILE A CG1  4  
ATOM 8146  C CG2  . ILE A 1 88  ? 0.107   -13.881 -4.441  1.00 0.00 ? 88  ILE A CG2  4  
ATOM 8147  C CD1  . ILE A 1 88  ? -1.054  -13.099 -1.896  1.00 0.00 ? 88  ILE A CD1  4  
ATOM 8148  H H    . ILE A 1 88  ? -2.698  -15.878 -2.582  1.00 0.00 ? 88  ILE A H    4  
ATOM 8149  H HA   . ILE A 1 88  ? -0.909  -16.076 -4.932  1.00 0.00 ? 88  ILE A HA   4  
ATOM 8150  H HB   . ILE A 1 88  ? 1.033   -15.452 -3.334  1.00 0.00 ? 88  ILE A HB   4  
ATOM 8151  H HG12 . ILE A 1 88  ? -0.763  -15.175 -1.318  1.00 0.00 ? 88  ILE A HG12 4  
ATOM 8152  H HG13 . ILE A 1 88  ? 0.758   -14.167 -1.478  1.00 0.00 ? 88  ILE A HG13 4  
ATOM 8153  H HG21 . ILE A 1 88  ? 0.383   -14.334 -5.416  1.00 0.00 ? 88  ILE A HG21 4  
ATOM 8154  H HG22 . ILE A 1 88  ? -0.889  -13.400 -4.554  1.00 0.00 ? 88  ILE A HG22 4  
ATOM 8155  H HG23 . ILE A 1 88  ? 0.864   -13.117 -4.168  1.00 0.00 ? 88  ILE A HG23 4  
ATOM 8156  H HD11 . ILE A 1 88  ? -1.957  -13.187 -2.532  1.00 0.00 ? 88  ILE A HD11 4  
ATOM 8157  H HD12 . ILE A 1 88  ? -1.387  -12.856 -0.870  1.00 0.00 ? 88  ILE A HD12 4  
ATOM 8158  H HD13 . ILE A 1 88  ? -0.448  -12.246 -2.268  1.00 0.00 ? 88  ILE A HD13 4  
ATOM 8159  N N    . GLY A 1 89  ? -0.340  -18.344 -4.214  1.00 0.00 ? 89  GLY A N    4  
ATOM 8160  C CA   . GLY A 1 89  ? -0.065  -19.780 -3.869  1.00 0.00 ? 89  GLY A CA   4  
ATOM 8161  C C    . GLY A 1 89  ? -1.280  -20.563 -3.412  1.00 0.00 ? 89  GLY A C    4  
ATOM 8162  O O    . GLY A 1 89  ? -1.174  -21.551 -2.697  1.00 0.00 ? 89  GLY A O    4  
ATOM 8163  H H    . GLY A 1 89  ? -0.235  -18.012 -5.155  1.00 0.00 ? 89  GLY A H    4  
ATOM 8164  H HA2  . GLY A 1 89  ? 0.316   -20.357 -4.734  1.00 0.00 ? 89  GLY A HA2  4  
ATOM 8165  H HA3  . GLY A 1 89  ? 0.597   -19.759 -2.990  1.00 0.00 ? 89  GLY A HA3  4  
ATOM 8166  N N    . GLY A 1 90  ? -2.480  -20.068 -3.798  1.00 0.00 ? 90  GLY A N    4  
ATOM 8167  C CA   . GLY A 1 90  ? -3.788  -20.586 -3.369  1.00 0.00 ? 90  GLY A CA   4  
ATOM 8168  C C    . GLY A 1 90  ? -4.367  -19.929 -2.128  1.00 0.00 ? 90  GLY A C    4  
ATOM 8169  O O    . GLY A 1 90  ? -5.415  -20.369 -1.667  1.00 0.00 ? 90  GLY A O    4  
ATOM 8170  H H    . GLY A 1 90  ? -2.423  -19.263 -4.392  1.00 0.00 ? 90  GLY A H    4  
ATOM 8171  H HA2  . GLY A 1 90  ? -4.524  -20.453 -4.156  1.00 0.00 ? 90  GLY A HA2  4  
ATOM 8172  H HA3  . GLY A 1 90  ? -3.692  -21.637 -3.129  1.00 0.00 ? 90  GLY A HA3  4  
ATOM 8173  N N    . ALA A 1 91  ? -3.739  -18.876 -1.524  1.00 0.00 ? 91  ALA A N    4  
ATOM 8174  C CA   . ALA A 1 91  ? -4.243  -18.276 -0.300  1.00 0.00 ? 91  ALA A CA   4  
ATOM 8175  C C    . ALA A 1 91  ? -4.356  -16.766 -0.475  1.00 0.00 ? 91  ALA A C    4  
ATOM 8176  O O    . ALA A 1 91  ? -3.471  -16.131 -1.043  1.00 0.00 ? 91  ALA A O    4  
ATOM 8177  C CB   . ALA A 1 91  ? -3.294  -18.635 0.858   1.00 0.00 ? 91  ALA A CB   4  
ATOM 8178  H H    . ALA A 1 91  ? -2.870  -18.462 -1.825  1.00 0.00 ? 91  ALA A H    4  
ATOM 8179  H HA   . ALA A 1 91  ? -5.226  -18.655 -0.045  1.00 0.00 ? 91  ALA A HA   4  
ATOM 8180  H HB1  . ALA A 1 91  ? -2.261  -18.285 0.639   1.00 0.00 ? 91  ALA A HB1  4  
ATOM 8181  H HB2  . ALA A 1 91  ? -3.643  -18.195 1.816   1.00 0.00 ? 91  ALA A HB2  4  
ATOM 8182  H HB3  . ALA A 1 91  ? -3.260  -19.740 0.984   1.00 0.00 ? 91  ALA A HB3  4  
ATOM 8183  N N    . ASP A 1 92  ? -5.471  -16.146 -0.003  1.00 0.00 ? 92  ASP A N    4  
ATOM 8184  C CA   . ASP A 1 92  ? -5.776  -14.722 -0.099  1.00 0.00 ? 92  ASP A CA   4  
ATOM 8185  C C    . ASP A 1 92  ? -5.409  -13.953 1.176   1.00 0.00 ? 92  ASP A C    4  
ATOM 8186  O O    . ASP A 1 92  ? -5.886  -14.266 2.265   1.00 0.00 ? 92  ASP A O    4  
ATOM 8187  C CB   . ASP A 1 92  ? -7.244  -14.455 -0.569  1.00 0.00 ? 92  ASP A CB   4  
ATOM 8188  C CG   . ASP A 1 92  ? -8.332  -15.012 0.365   1.00 0.00 ? 92  ASP A CG   4  
ATOM 8189  O OD1  . ASP A 1 92  ? -8.448  -16.262 0.474   1.00 0.00 ? 92  ASP A OD1  4  
ATOM 8190  O OD2  . ASP A 1 92  ? -9.066  -14.185 0.968   1.00 0.00 ? 92  ASP A OD2  4  
ATOM 8191  H H    . ASP A 1 92  ? -6.181  -16.662 0.453   1.00 0.00 ? 92  ASP A H    4  
ATOM 8192  H HA   . ASP A 1 92  ? -5.178  -14.321 -0.895  1.00 0.00 ? 92  ASP A HA   4  
ATOM 8193  H HB2  . ASP A 1 92  ? -7.392  -13.356 -0.690  1.00 0.00 ? 92  ASP A HB2  4  
ATOM 8194  H HB3  . ASP A 1 92  ? -7.373  -14.957 -1.563  1.00 0.00 ? 92  ASP A HB3  4  
ATOM 8195  N N    . PHE A 1 93  ? -4.532  -12.925 1.078   1.00 0.00 ? 93  PHE A N    4  
ATOM 8196  C CA   . PHE A 1 93  ? -4.059  -12.137 2.203   1.00 0.00 ? 93  PHE A CA   4  
ATOM 8197  C C    . PHE A 1 93  ? -4.235  -10.690 1.815   1.00 0.00 ? 93  PHE A C    4  
ATOM 8198  O O    . PHE A 1 93  ? -4.493  -10.376 0.652   1.00 0.00 ? 93  PHE A O    4  
ATOM 8199  C CB   . PHE A 1 93  ? -2.533  -12.360 2.498   1.00 0.00 ? 93  PHE A CB   4  
ATOM 8200  C CG   . PHE A 1 93  ? -2.230  -13.828 2.711   1.00 0.00 ? 93  PHE A CG   4  
ATOM 8201  C CD1  . PHE A 1 93  ? -2.810  -14.543 3.745   1.00 0.00 ? 93  PHE A CD1  4  
ATOM 8202  C CD2  . PHE A 1 93  ? -1.382  -14.499 1.844   1.00 0.00 ? 93  PHE A CD2  4  
ATOM 8203  C CE1  . PHE A 1 93  ? -2.583  -15.903 3.877   1.00 0.00 ? 93  PHE A CE1  4  
ATOM 8204  C CE2  . PHE A 1 93  ? -1.156  -15.853 1.966   1.00 0.00 ? 93  PHE A CE2  4  
ATOM 8205  C CZ   . PHE A 1 93  ? -1.760  -16.560 2.982   1.00 0.00 ? 93  PHE A CZ   4  
ATOM 8206  H H    . PHE A 1 93  ? -4.144  -12.649 0.198   1.00 0.00 ? 93  PHE A H    4  
ATOM 8207  H HA   . PHE A 1 93  ? -4.651  -12.314 3.093   1.00 0.00 ? 93  PHE A HA   4  
ATOM 8208  H HB2  . PHE A 1 93  ? -1.921  -12.035 1.615   1.00 0.00 ? 93  PHE A HB2  4  
ATOM 8209  H HB3  . PHE A 1 93  ? -2.212  -11.813 3.426   1.00 0.00 ? 93  PHE A HB3  4  
ATOM 8210  H HD1  . PHE A 1 93  ? -3.479  -14.047 4.434   1.00 0.00 ? 93  PHE A HD1  4  
ATOM 8211  H HD2  . PHE A 1 93  ? -0.909  -13.970 1.033   1.00 0.00 ? 93  PHE A HD2  4  
ATOM 8212  H HE1  . PHE A 1 93  ? -3.068  -16.453 4.671   1.00 0.00 ? 93  PHE A HE1  4  
ATOM 8213  H HE2  . PHE A 1 93  ? -0.519  -16.366 1.256   1.00 0.00 ? 93  PHE A HE2  4  
ATOM 8214  H HZ   . PHE A 1 93  ? -1.614  -17.630 3.033   1.00 0.00 ? 93  PHE A HZ   4  
ATOM 8215  N N    . LEU A 1 94  ? -3.994  -9.771  2.790   1.00 0.00 ? 94  LEU A N    4  
ATOM 8216  C CA   . LEU A 1 94  ? -3.922  -8.329  2.609   1.00 0.00 ? 94  LEU A CA   4  
ATOM 8217  C C    . LEU A 1 94  ? -2.469  -8.041  2.250   1.00 0.00 ? 94  LEU A C    4  
ATOM 8218  O O    . LEU A 1 94  ? -1.555  -8.264  3.034   1.00 0.00 ? 94  LEU A O    4  
ATOM 8219  C CB   . LEU A 1 94  ? -4.422  -7.574  3.864   1.00 0.00 ? 94  LEU A CB   4  
ATOM 8220  C CG   . LEU A 1 94  ? -5.942  -7.303  3.768   1.00 0.00 ? 94  LEU A CG   4  
ATOM 8221  C CD1  . LEU A 1 94  ? -6.559  -7.274  5.174   1.00 0.00 ? 94  LEU A CD1  4  
ATOM 8222  C CD2  . LEU A 1 94  ? -6.346  -6.006  3.038   1.00 0.00 ? 94  LEU A CD2  4  
ATOM 8223  H H    . LEU A 1 94  ? -3.745  -10.083 3.704   1.00 0.00 ? 94  LEU A H    4  
ATOM 8224  H HA   . LEU A 1 94  ? -4.558  -8.027  1.789   1.00 0.00 ? 94  LEU A HA   4  
ATOM 8225  H HB2  . LEU A 1 94  ? -4.232  -8.234  4.748   1.00 0.00 ? 94  LEU A HB2  4  
ATOM 8226  H HB3  . LEU A 1 94  ? -3.907  -6.606  4.035   1.00 0.00 ? 94  LEU A HB3  4  
ATOM 8227  H HG   . LEU A 1 94  ? -6.315  -8.143  3.143   1.00 0.00 ? 94  LEU A HG   4  
ATOM 8228  H HD11 . LEU A 1 94  ? -6.383  -8.222  5.726   1.00 0.00 ? 94  LEU A HD11 4  
ATOM 8229  H HD12 . LEU A 1 94  ? -6.077  -6.452  5.750   1.00 0.00 ? 94  LEU A HD12 4  
ATOM 8230  H HD13 . LEU A 1 94  ? -7.654  -7.074  5.129   1.00 0.00 ? 94  LEU A HD13 4  
ATOM 8231  H HD21 . LEU A 1 94  ? -5.821  -5.888  2.064   1.00 0.00 ? 94  LEU A HD21 4  
ATOM 8232  H HD22 . LEU A 1 94  ? -7.445  -5.967  2.833   1.00 0.00 ? 94  LEU A HD22 4  
ATOM 8233  H HD23 . LEU A 1 94  ? -6.105  -5.141  3.691   1.00 0.00 ? 94  LEU A HD23 4  
ATOM 8234  N N    . VAL A 1 95  ? -2.236  -7.623  0.994   1.00 0.00 ? 95  VAL A N    4  
ATOM 8235  C CA   . VAL A 1 95  ? -0.920  -7.424  0.415   1.00 0.00 ? 95  VAL A CA   4  
ATOM 8236  C C    . VAL A 1 95  ? -0.887  -5.944  0.074   1.00 0.00 ? 95  VAL A C    4  
ATOM 8237  O O    . VAL A 1 95  ? -1.929  -5.391  -0.290  1.00 0.00 ? 95  VAL A O    4  
ATOM 8238  C CB   . VAL A 1 95  ? -0.795  -8.403  -0.773  1.00 0.00 ? 95  VAL A CB   4  
ATOM 8239  C CG1  . VAL A 1 95  ? -1.717  -8.054  -1.977  1.00 0.00 ? 95  VAL A CG1  4  
ATOM 8240  C CG2  . VAL A 1 95  ? 0.661   -8.577  -1.244  1.00 0.00 ? 95  VAL A CG2  4  
ATOM 8241  H H    . VAL A 1 95  ? -2.994  -7.461  0.350   1.00 0.00 ? 95  VAL A H    4  
ATOM 8242  H HA   . VAL A 1 95  ? -0.111  -7.639  1.116   1.00 0.00 ? 95  VAL A HA   4  
ATOM 8243  H HB   . VAL A 1 95  ? -1.079  -9.408  -0.350  1.00 0.00 ? 95  VAL A HB   4  
ATOM 8244  H HG11 . VAL A 1 95  ? -1.497  -7.039  -2.369  1.00 0.00 ? 95  VAL A HG11 4  
ATOM 8245  H HG12 . VAL A 1 95  ? -1.548  -8.762  -2.818  1.00 0.00 ? 95  VAL A HG12 4  
ATOM 8246  H HG13 . VAL A 1 95  ? -2.799  -8.077  -1.732  1.00 0.00 ? 95  VAL A HG13 4  
ATOM 8247  H HG21 . VAL A 1 95  ? 1.301   -8.927  -0.410  1.00 0.00 ? 95  VAL A HG21 4  
ATOM 8248  H HG22 . VAL A 1 95  ? 0.685   -9.355  -2.038  1.00 0.00 ? 95  VAL A HG22 4  
ATOM 8249  H HG23 . VAL A 1 95  ? 1.064   -7.628  -1.653  1.00 0.00 ? 95  VAL A HG23 4  
ATOM 8250  N N    . TRP A 1 96  ? 0.279   -5.241  0.143   1.00 0.00 ? 96  TRP A N    4  
ATOM 8251  C CA   . TRP A 1 96  ? 0.257   -3.786  -0.204  1.00 0.00 ? 96  TRP A CA   4  
ATOM 8252  C C    . TRP A 1 96  ? 0.802   -3.671  -1.648  1.00 0.00 ? 96  TRP A C    4  
ATOM 8253  O O    . TRP A 1 96  ? 1.830   -4.258  -1.996  1.00 0.00 ? 96  TRP A O    4  
ATOM 8254  C CB   . TRP A 1 96  ? 1.201   -2.984  0.759   1.00 0.00 ? 96  TRP A CB   4  
ATOM 8255  C CG   . TRP A 1 96  ? 0.540   -2.267  1.946   1.00 0.00 ? 96  TRP A CG   4  
ATOM 8256  C CD1  . TRP A 1 96  ? -0.347  -1.225  1.952   1.00 0.00 ? 96  TRP A CD1  4  
ATOM 8257  C CD2  . TRP A 1 96  ? 0.896   -2.477  3.319   1.00 0.00 ? 96  TRP A CD2  4  
ATOM 8258  N NE1  . TRP A 1 96  ? -0.573  -0.777  3.240   1.00 0.00 ? 96  TRP A NE1  4  
ATOM 8259  C CE2  . TRP A 1 96  ? 0.186   -1.543  4.086   1.00 0.00 ? 96  TRP A CE2  4  
ATOM 8260  C CE3  . TRP A 1 96  ? 1.764   -3.353  3.891   1.00 0.00 ? 96  TRP A CE3  4  
ATOM 8261  C CZ2  . TRP A 1 96  ? 0.321   -1.489  5.438   1.00 0.00 ? 96  TRP A CZ2  4  
ATOM 8262  C CZ3  . TRP A 1 96  ? 1.919   -3.270  5.251   1.00 0.00 ? 96  TRP A CZ3  4  
ATOM 8263  C CH2  . TRP A 1 96  ? 1.213   -2.366  6.015   1.00 0.00 ? 96  TRP A CH2  4  
ATOM 8264  H H    . TRP A 1 96  ? 1.163   -5.704  0.425   1.00 0.00 ? 96  TRP A H    4  
ATOM 8265  H HA   . TRP A 1 96  ? -0.733  -3.267  -0.140  1.00 0.00 ? 96  TRP A HA   4  
ATOM 8266  H HB2  . TRP A 1 96  ? 1.996   -3.673  1.119   1.00 0.00 ? 96  TRP A HB2  4  
ATOM 8267  H HB3  . TRP A 1 96  ? 1.714   -2.153  0.228   1.00 0.00 ? 96  TRP A HB3  4  
ATOM 8268  H HD1  . TRP A 1 96  ? -0.775  -0.806  1.063   1.00 0.00 ? 96  TRP A HD1  4  
ATOM 8269  H HE1  . TRP A 1 96  ? -1.225  -0.099  3.521   1.00 0.00 ? 96  TRP A HE1  4  
ATOM 8270  H HE3  . TRP A 1 96  ? 2.346   -4.064  3.323   1.00 0.00 ? 96  TRP A HE3  4  
ATOM 8271  H HZ2  . TRP A 1 96  ? -0.217  -0.769  6.040   1.00 0.00 ? 96  TRP A HZ2  4  
ATOM 8272  H HZ3  . TRP A 1 96  ? 2.641   -3.915  5.724   1.00 0.00 ? 96  TRP A HZ3  4  
ATOM 8273  H HH2  . TRP A 1 96  ? 1.392   -2.333  7.079   1.00 0.00 ? 96  TRP A HH2  4  
ATOM 8274  N N    . ARG A 1 97  ? 0.127   -2.915  -2.566  1.00 0.00 ? 97  ARG A N    4  
ATOM 8275  C CA   . ARG A 1 97  ? 0.595   -2.741  -3.935  1.00 0.00 ? 97  ARG A CA   4  
ATOM 8276  C C    . ARG A 1 97  ? 0.180   -1.329  -4.312  1.00 0.00 ? 97  ARG A C    4  
ATOM 8277  O O    . ARG A 1 97  ? -0.742  -0.759  -3.727  1.00 0.00 ? 97  ARG A O    4  
ATOM 8278  C CB   . ARG A 1 97  ? 0.056   -3.814  -4.934  1.00 0.00 ? 97  ARG A CB   4  
ATOM 8279  C CG   . ARG A 1 97  ? -1.222  -3.438  -5.714  1.00 0.00 ? 97  ARG A CG   4  
ATOM 8280  C CD   . ARG A 1 97  ? -1.771  -4.552  -6.612  1.00 0.00 ? 97  ARG A CD   4  
ATOM 8281  N NE   . ARG A 1 97  ? -2.915  -4.022  -7.434  1.00 0.00 ? 97  ARG A NE   4  
ATOM 8282  C CZ   . ARG A 1 97  ? -2.766  -3.318  -8.601  1.00 0.00 ? 97  ARG A CZ   4  
ATOM 8283  N NH1  . ARG A 1 97  ? -1.531  -3.074  -9.129  1.00 0.00 ? 97  ARG A NH1  4  
ATOM 8284  N NH2  . ARG A 1 97  ? -3.877  -2.847  -9.242  1.00 0.00 ? 97  ARG A NH2  4  
ATOM 8285  H H    . ARG A 1 97  ? -0.731  -2.406  -2.390  1.00 0.00 ? 97  ARG A H    4  
ATOM 8286  H HA   . ARG A 1 97  ? 1.685   -2.795  -3.954  1.00 0.00 ? 97  ARG A HA   4  
ATOM 8287  H HB2  . ARG A 1 97  ? 0.864   -4.033  -5.676  1.00 0.00 ? 97  ARG A HB2  4  
ATOM 8288  H HB3  . ARG A 1 97  ? -0.119  -4.756  -4.372  1.00 0.00 ? 97  ARG A HB3  4  
ATOM 8289  H HG2  . ARG A 1 97  ? -2.007  -3.125  -4.993  1.00 0.00 ? 97  ARG A HG2  4  
ATOM 8290  H HG3  . ARG A 1 97  ? -0.966  -2.578  -6.379  1.00 0.00 ? 97  ARG A HG3  4  
ATOM 8291  H HD2  . ARG A 1 97  ? -0.980  -4.968  -7.275  1.00 0.00 ? 97  ARG A HD2  4  
ATOM 8292  H HD3  . ARG A 1 97  ? -2.179  -5.363  -5.974  1.00 0.00 ? 97  ARG A HD3  4  
ATOM 8293  H HE   . ARG A 1 97  ? -3.843  -4.173  -7.092  1.00 0.00 ? 97  ARG A HE   4  
ATOM 8294  H HH11 . ARG A 1 97  ? -0.713  -3.412  -8.663  1.00 0.00 ? 97  ARG A HH11 4  
ATOM 8295  H HH12 . ARG A 1 97  ? -1.445  -2.553  -9.978  1.00 0.00 ? 97  ARG A HH12 4  
ATOM 8296  H HH21 . ARG A 1 97  ? -4.784  -3.017  -8.858  1.00 0.00 ? 97  ARG A HH21 4  
ATOM 8297  H HH22 . ARG A 1 97  ? -3.782  -2.325  -10.089 1.00 0.00 ? 97  ARG A HH22 4  
ATOM 8298  N N    . TRP A 1 98  ? 0.889   -0.694  -5.272  1.00 0.00 ? 98  TRP A N    4  
ATOM 8299  C CA   . TRP A 1 98  ? 0.699   0.690   -5.732  1.00 0.00 ? 98  TRP A CA   4  
ATOM 8300  C C    . TRP A 1 98  ? 0.437   1.063   -7.154  1.00 0.00 ? 98  TRP A C    4  
ATOM 8301  O O    . TRP A 1 98  ? 0.836   0.390   -8.090  1.00 0.00 ? 98  TRP A O    4  
ATOM 8302  C CB   . TRP A 1 98  ? 1.247   1.823   -4.845  1.00 0.00 ? 98  TRP A CB   4  
ATOM 8303  C CG   . TRP A 1 98  ? 2.553   2.436   -5.228  1.00 0.00 ? 98  TRP A CG   4  
ATOM 8304  C CD1  . TRP A 1 98  ? 2.819   3.753   -5.395  1.00 0.00 ? 98  TRP A CD1  4  
ATOM 8305  C CD2  . TRP A 1 98  ? 3.734   1.718   -5.576  1.00 0.00 ? 98  TRP A CD2  4  
ATOM 8306  N NE1  . TRP A 1 98  ? 4.046   3.911   -5.972  1.00 0.00 ? 98  TRP A NE1  4  
ATOM 8307  C CE2  . TRP A 1 98  ? 4.638   2.655   -6.057  1.00 0.00 ? 98  TRP A CE2  4  
ATOM 8308  C CE3  . TRP A 1 98  ? 4.026   0.390   -5.520  1.00 0.00 ? 98  TRP A CE3  4  
ATOM 8309  C CZ2  . TRP A 1 98  ? 5.869   2.250   -6.481  1.00 0.00 ? 98  TRP A CZ2  4  
ATOM 8310  C CZ3  . TRP A 1 98  ? 5.237   -0.011  -6.007  1.00 0.00 ? 98  TRP A CZ3  4  
ATOM 8311  C CH2  . TRP A 1 98  ? 6.160   0.904   -6.455  1.00 0.00 ? 98  TRP A CH2  4  
ATOM 8312  H H    . TRP A 1 98  ? 1.621   -1.206  -5.733  1.00 0.00 ? 98  TRP A H    4  
ATOM 8313  H HA   . TRP A 1 98  ? -0.340  0.819   -5.448  1.00 0.00 ? 98  TRP A HA   4  
ATOM 8314  H HB2  . TRP A 1 98  ? 0.515   2.712   -4.813  1.00 0.00 ? 98  TRP A HB2  4  
ATOM 8315  H HB3  . TRP A 1 98  ? 1.419   1.270   -3.877  1.00 0.00 ? 98  TRP A HB3  4  
ATOM 8316  H HD1  . TRP A 1 98  ? 2.146   4.534   -5.074  1.00 0.00 ? 98  TRP A HD1  4  
ATOM 8317  H HE1  . TRP A 1 98  ? 4.161   4.679   -6.566  1.00 0.00 ? 98  TRP A HE1  4  
ATOM 8318  H HE3  . TRP A 1 98  ? 3.358   -0.351  -5.115  1.00 0.00 ? 98  TRP A HE3  4  
ATOM 8319  H HZ2  . TRP A 1 98  ? 6.630   2.924   -6.814  1.00 0.00 ? 98  TRP A HZ2  4  
ATOM 8320  H HZ3  . TRP A 1 98  ? 5.445   -1.069  -6.035  1.00 0.00 ? 98  TRP A HZ3  4  
ATOM 8321  H HH2  . TRP A 1 98  ? 7.133   0.567   -6.781  1.00 0.00 ? 98  TRP A HH2  4  
ATOM 8322  N N    . ILE A 1 99  ? -0.322  2.150   -7.331  1.00 0.00 ? 99  ILE A N    4  
ATOM 8323  C CA   . ILE A 1 99  ? -0.635  2.761   -8.600  1.00 0.00 ? 99  ILE A CA   4  
ATOM 8324  C C    . ILE A 1 99  ? 0.211   4.026   -8.844  1.00 0.00 ? 99  ILE A C    4  
ATOM 8325  O O    . ILE A 1 99  ? 0.123   4.955   -8.045  1.00 0.00 ? 99  ILE A O    4  
ATOM 8326  C CB   . ILE A 1 99  ? -2.133  3.103   -8.521  1.00 0.00 ? 99  ILE A CB   4  
ATOM 8327  C CG1  . ILE A 1 99  ? -2.569  3.969   -7.276  1.00 0.00 ? 99  ILE A CG1  4  
ATOM 8328  C CG2  . ILE A 1 99  ? -2.843  1.735   -8.529  1.00 0.00 ? 99  ILE A CG2  4  
ATOM 8329  C CD1  . ILE A 1 99  ? -3.485  3.287   -6.245  1.00 0.00 ? 99  ILE A CD1  4  
ATOM 8330  H H    . ILE A 1 99  ? -0.668  2.665   -6.551  1.00 0.00 ? 99  ILE A H    4  
ATOM 8331  H HA   . ILE A 1 99  ? -0.429  2.074   -9.422  1.00 0.00 ? 99  ILE A HA   4  
ATOM 8332  H HB   . ILE A 1 99  ? -2.445  3.648   -9.440  1.00 0.00 ? 99  ILE A HB   4  
ATOM 8333  H HG12 . ILE A 1 99  ? -1.678  4.351   -6.703  1.00 0.00 ? 99  ILE A HG12 4  
ATOM 8334  H HG13 . ILE A 1 99  ? -3.137  4.845   -7.689  1.00 0.00 ? 99  ILE A HG13 4  
ATOM 8335  H HG21 . ILE A 1 99  ? -2.517  1.145   -9.408  1.00 0.00 ? 99  ILE A HG21 4  
ATOM 8336  H HG22 . ILE A 1 99  ? -2.557  1.174   -7.611  1.00 0.00 ? 99  ILE A HG22 4  
ATOM 8337  H HG23 . ILE A 1 99  ? -3.943  1.864   -8.557  1.00 0.00 ? 99  ILE A HG23 4  
ATOM 8338  H HD11 . ILE A 1 99  ? -3.012  2.383   -5.809  1.00 0.00 ? 99  ILE A HD11 4  
ATOM 8339  H HD12 . ILE A 1 99  ? -3.700  3.990   -5.409  1.00 0.00 ? 99  ILE A HD12 4  
ATOM 8340  H HD13 . ILE A 1 99  ? -4.458  3.002   -6.703  1.00 0.00 ? 99  ILE A HD13 4  
ATOM 8341  N N    . GLN A 1 100 ? 1.036   4.149   -9.942  1.00 0.00 ? 100 GLN A N    4  
ATOM 8342  C CA   . GLN A 1 100 ? 1.653   5.448   -10.305 1.00 0.00 ? 100 GLN A CA   4  
ATOM 8343  C C    . GLN A 1 100 ? 0.775   6.071   -11.395 1.00 0.00 ? 100 GLN A C    4  
ATOM 8344  O O    . GLN A 1 100 ? 0.820   5.565   -12.515 1.00 0.00 ? 100 GLN A O    4  
ATOM 8345  C CB   . GLN A 1 100 ? 3.175   5.528   -10.708 1.00 0.00 ? 100 GLN A CB   4  
ATOM 8346  C CG   . GLN A 1 100 ? 3.632   6.992   -10.913 1.00 0.00 ? 100 GLN A CG   4  
ATOM 8347  C CD   . GLN A 1 100 ? 3.853   7.362   -12.395 1.00 0.00 ? 100 GLN A CD   4  
ATOM 8348  O OE1  . GLN A 1 100 ? 4.511   6.638   -13.148 1.00 0.00 ? 100 GLN A OE1  4  
ATOM 8349  N NE2  . GLN A 1 100 ? 3.349   8.532   -12.856 1.00 0.00 ? 100 GLN A NE2  4  
ATOM 8350  H H    . GLN A 1 100 ? 1.201   3.410   -10.597 1.00 0.00 ? 100 GLN A H    4  
ATOM 8351  H HA   . GLN A 1 100 ? 1.656   6.087   -9.427  1.00 0.00 ? 100 GLN A HA   4  
ATOM 8352  H HB2  . GLN A 1 100 ? 3.703   5.056   -9.845  1.00 0.00 ? 100 GLN A HB2  4  
ATOM 8353  H HB3  . GLN A 1 100 ? 3.645   4.985   -11.571 1.00 0.00 ? 100 GLN A HB3  4  
ATOM 8354  H HG2  . GLN A 1 100 ? 2.960   7.681   -10.384 1.00 0.00 ? 100 GLN A HG2  4  
ATOM 8355  H HG3  . GLN A 1 100 ? 4.601   7.034   -10.389 1.00 0.00 ? 100 GLN A HG3  4  
ATOM 8356  H HE21 . GLN A 1 100 ? 2.625   9.025   -12.367 1.00 0.00 ? 100 GLN A HE21 4  
ATOM 8357  H HE22 . GLN A 1 100 ? 3.557   8.773   -13.803 1.00 0.00 ? 100 GLN A HE22 4  
ATOM 8358  N N    . PRO A 1 101 ? -0.080  7.111   -11.172 1.00 0.00 ? 101 PRO A N    4  
ATOM 8359  C CA   . PRO A 1 101 ? -0.937  7.714   -12.203 1.00 0.00 ? 101 PRO A CA   4  
ATOM 8360  C C    . PRO A 1 101 ? -0.170  8.617   -13.166 1.00 0.00 ? 101 PRO A C    4  
ATOM 8361  O O    . PRO A 1 101 ? 0.600   9.447   -12.684 1.00 0.00 ? 101 PRO A O    4  
ATOM 8362  C CB   . PRO A 1 101 ? -1.939  8.594   -11.405 1.00 0.00 ? 101 PRO A CB   4  
ATOM 8363  C CG   . PRO A 1 101 ? -1.874  8.058   -9.978  1.00 0.00 ? 101 PRO A CG   4  
ATOM 8364  C CD   . PRO A 1 101 ? -0.396  7.678   -9.860  1.00 0.00 ? 101 PRO A CD   4  
ATOM 8365  H HA   . PRO A 1 101 ? -1.441  6.935   -12.758 1.00 0.00 ? 101 PRO A HA   4  
ATOM 8366  H HB2  . PRO A 1 101 ? -1.617  9.665   -11.325 1.00 0.00 ? 101 PRO A HB2  4  
ATOM 8367  H HB3  . PRO A 1 101 ? -2.951  8.562   -11.860 1.00 0.00 ? 101 PRO A HB3  4  
ATOM 8368  H HG2  . PRO A 1 101 ? -2.184  8.811   -9.223  1.00 0.00 ? 101 PRO A HG2  4  
ATOM 8369  H HG3  . PRO A 1 101 ? -2.511  7.153   -9.876  1.00 0.00 ? 101 PRO A HG3  4  
ATOM 8370  H HD2  . PRO A 1 101 ? 0.235   8.582   -9.713  1.00 0.00 ? 101 PRO A HD2  4  
ATOM 8371  H HD3  . PRO A 1 101 ? -0.267  6.990   -9.001  1.00 0.00 ? 101 PRO A HD3  4  
ATOM 8372  N N    . SER A 1 102 ? -0.419  8.508   -14.499 1.00 0.00 ? 102 SER A N    4  
ATOM 8373  C CA   . SER A 1 102 ? 0.121   9.382   -15.545 1.00 0.00 ? 102 SER A CA   4  
ATOM 8374  C C    . SER A 1 102 ? 1.572   9.098   -15.939 1.00 0.00 ? 102 SER A C    4  
ATOM 8375  O O    . SER A 1 102 ? 2.375   10.022  -16.063 1.00 0.00 ? 102 SER A O    4  
ATOM 8376  C CB   . SER A 1 102 ? -0.146  10.904  -15.249 1.00 0.00 ? 102 SER A CB   4  
ATOM 8377  O OG   . SER A 1 102 ? 0.244   11.764  -16.319 1.00 0.00 ? 102 SER A OG   4  
ATOM 8378  H H    . SER A 1 102 ? -1.073  7.828   -14.815 1.00 0.00 ? 102 SER A H    4  
ATOM 8379  H HA   . SER A 1 102 ? -0.454  9.160   -16.432 1.00 0.00 ? 102 SER A HA   4  
ATOM 8380  H HB2  . SER A 1 102 ? -1.235  11.031  -15.048 1.00 0.00 ? 102 SER A HB2  4  
ATOM 8381  H HB3  . SER A 1 102 ? 0.395   11.219  -14.332 1.00 0.00 ? 102 SER A HB3  4  
ATOM 8382  H HG   . SER A 1 102 ? 1.181   11.533  -16.450 1.00 0.00 ? 102 SER A HG   4  
ATOM 8383  N N    . ALA A 1 103 ? 1.923   7.801   -16.145 1.00 0.00 ? 103 ALA A N    4  
ATOM 8384  C CA   . ALA A 1 103 ? 3.242   7.296   -16.515 1.00 0.00 ? 103 ALA A CA   4  
ATOM 8385  C C    . ALA A 1 103 ? 3.720   7.557   -17.953 1.00 0.00 ? 103 ALA A C    4  
ATOM 8386  O O    . ALA A 1 103 ? 4.840   8.026   -18.137 1.00 0.00 ? 103 ALA A O    4  
ATOM 8387  C CB   . ALA A 1 103 ? 3.312   5.785   -16.198 1.00 0.00 ? 103 ALA A CB   4  
ATOM 8388  H H    . ALA A 1 103 ? 1.252   7.087   -15.975 1.00 0.00 ? 103 ALA A H    4  
ATOM 8389  H HA   . ALA A 1 103 ? 3.969   7.784   -15.875 1.00 0.00 ? 103 ALA A HA   4  
ATOM 8390  H HB1  . ALA A 1 103 ? 3.001   5.624   -15.143 1.00 0.00 ? 103 ALA A HB1  4  
ATOM 8391  H HB2  . ALA A 1 103 ? 4.348   5.391   -16.292 1.00 0.00 ? 103 ALA A HB2  4  
ATOM 8392  H HB3  . ALA A 1 103 ? 2.633   5.195   -16.850 1.00 0.00 ? 103 ALA A HB3  4  
ATOM 8393  N N    . SER A 1 104 ? 2.888   7.252   -18.995 1.00 0.00 ? 104 SER A N    4  
ATOM 8394  C CA   . SER A 1 104 ? 3.126   7.405   -20.440 1.00 0.00 ? 104 SER A CA   4  
ATOM 8395  C C    . SER A 1 104 ? 3.722   6.159   -21.097 1.00 0.00 ? 104 SER A C    4  
ATOM 8396  O O    . SER A 1 104 ? 3.065   5.127   -21.199 1.00 0.00 ? 104 SER A O    4  
ATOM 8397  C CB   . SER A 1 104 ? 3.808   8.737   -20.929 1.00 0.00 ? 104 SER A CB   4  
ATOM 8398  O OG   . SER A 1 104 ? 5.177   8.860   -20.530 1.00 0.00 ? 104 SER A OG   4  
ATOM 8399  H H    . SER A 1 104 ? 1.999   6.859   -18.787 1.00 0.00 ? 104 SER A H    4  
ATOM 8400  H HA   . SER A 1 104 ? 2.129   7.459   -20.855 1.00 0.00 ? 104 SER A HA   4  
ATOM 8401  H HB2  . SER A 1 104 ? 3.748   8.823   -22.037 1.00 0.00 ? 104 SER A HB2  4  
ATOM 8402  H HB3  . SER A 1 104 ? 3.241   9.593   -20.501 1.00 0.00 ? 104 SER A HB3  4  
ATOM 8403  H HG   . SER A 1 104 ? 5.176   8.645   -19.562 1.00 0.00 ? 104 SER A HG   4  
ATOM 8404  N N    . CYS A 1 105 ? 4.990   6.252   -21.563 1.00 0.00 ? 105 CYS A N    4  
ATOM 8405  C CA   . CYS A 1 105 ? 5.754   5.195   -22.220 1.00 0.00 ? 105 CYS A CA   4  
ATOM 8406  C C    . CYS A 1 105 ? 6.871   4.739   -21.288 1.00 0.00 ? 105 CYS A C    4  
ATOM 8407  O O    . CYS A 1 105 ? 6.610   3.998   -20.348 1.00 0.00 ? 105 CYS A O    4  
ATOM 8408  C CB   . CYS A 1 105 ? 6.283   5.647   -23.614 1.00 0.00 ? 105 CYS A CB   4  
ATOM 8409  S SG   . CYS A 1 105 ? 4.922   6.038   -24.766 1.00 0.00 ? 105 CYS A SG   4  
ATOM 8410  H H    . CYS A 1 105 ? 5.453   7.137   -21.430 1.00 0.00 ? 105 CYS A H    4  
ATOM 8411  H HA   . CYS A 1 105 ? 5.130   4.322   -22.371 1.00 0.00 ? 105 CYS A HA   4  
ATOM 8412  H HB2  . CYS A 1 105 ? 6.917   6.553   -23.502 1.00 0.00 ? 105 CYS A HB2  4  
ATOM 8413  H HB3  . CYS A 1 105 ? 6.907   4.843   -24.062 1.00 0.00 ? 105 CYS A HB3  4  
ATOM 8414  H HG   . CYS A 1 105 ? 4.371   4.830   -24.759 1.00 0.00 ? 105 CYS A HG   4  
ATOM 8415  N N    . ASP A 1 106 ? 8.134   5.180   -21.511 1.00 0.00 ? 106 ASP A N    4  
ATOM 8416  C CA   . ASP A 1 106 ? 9.305   4.899   -20.691 1.00 0.00 ? 106 ASP A CA   4  
ATOM 8417  C C    . ASP A 1 106 ? 10.390  5.822   -21.213 1.00 0.00 ? 106 ASP A C    4  
ATOM 8418  O O    . ASP A 1 106 ? 10.409  6.154   -22.399 1.00 0.00 ? 106 ASP A O    4  
ATOM 8419  C CB   . ASP A 1 106 ? 9.872   3.436   -20.767 1.00 0.00 ? 106 ASP A CB   4  
ATOM 8420  C CG   . ASP A 1 106 ? 9.115   2.473   -19.846 1.00 0.00 ? 106 ASP A CG   4  
ATOM 8421  O OD1  . ASP A 1 106 ? 9.126   2.710   -18.608 1.00 0.00 ? 106 ASP A OD1  4  
ATOM 8422  O OD2  . ASP A 1 106 ? 8.530   1.487   -20.367 1.00 0.00 ? 106 ASP A OD2  4  
ATOM 8423  H H    . ASP A 1 106 ? 8.348   5.778   -22.283 1.00 0.00 ? 106 ASP A H    4  
ATOM 8424  H HA   . ASP A 1 106 ? 9.101   5.188   -19.667 1.00 0.00 ? 106 ASP A HA   4  
ATOM 8425  H HB2  . ASP A 1 106 ? 9.821   3.070   -21.815 1.00 0.00 ? 106 ASP A HB2  4  
ATOM 8426  H HB3  . ASP A 1 106 ? 10.936  3.386   -20.438 1.00 0.00 ? 106 ASP A HB3  4  
ATOM 8427  N N    . LYS A 1 107 ? 11.327  6.219   -20.308 1.00 0.00 ? 107 LYS A N    4  
ATOM 8428  C CA   . LYS A 1 107 ? 12.521  7.016   -20.573 1.00 0.00 ? 107 LYS A CA   4  
ATOM 8429  C C    . LYS A 1 107 ? 13.748  6.270   -20.040 1.00 0.00 ? 107 LYS A C    4  
ATOM 8430  O O    . LYS A 1 107 ? 14.651  6.876   -19.467 1.00 0.00 ? 107 LYS A O    4  
ATOM 8431  C CB   . LYS A 1 107 ? 12.456  8.433   -19.930 1.00 0.00 ? 107 LYS A CB   4  
ATOM 8432  C CG   . LYS A 1 107 ? 11.330  9.318   -20.490 1.00 0.00 ? 107 LYS A CG   4  
ATOM 8433  C CD   . LYS A 1 107 ? 11.348  10.759  -19.949 1.00 0.00 ? 107 LYS A CD   4  
ATOM 8434  C CE   . LYS A 1 107 ? 11.138  10.883  -18.429 1.00 0.00 ? 107 LYS A CE   4  
ATOM 8435  N NZ   . LYS A 1 107 ? 9.839   10.306  -18.010 1.00 0.00 ? 107 LYS A NZ   4  
ATOM 8436  H H    . LYS A 1 107 ? 11.207  5.947   -19.356 1.00 0.00 ? 107 LYS A H    4  
ATOM 8437  H HA   . LYS A 1 107 ? 12.668  7.138   -21.640 1.00 0.00 ? 107 LYS A HA   4  
ATOM 8438  H HB2  . LYS A 1 107 ? 12.333  8.345   -18.827 1.00 0.00 ? 107 LYS A HB2  4  
ATOM 8439  H HB3  . LYS A 1 107 ? 13.411  8.974   -20.122 1.00 0.00 ? 107 LYS A HB3  4  
ATOM 8440  H HG2  . LYS A 1 107 ? 11.412  9.350   -21.600 1.00 0.00 ? 107 LYS A HG2  4  
ATOM 8441  H HG3  . LYS A 1 107 ? 10.348  8.854   -20.249 1.00 0.00 ? 107 LYS A HG3  4  
ATOM 8442  H HD2  . LYS A 1 107 ? 12.320  11.232  -20.213 1.00 0.00 ? 107 LYS A HD2  4  
ATOM 8443  H HD3  . LYS A 1 107 ? 10.548  11.338  -20.464 1.00 0.00 ? 107 LYS A HD3  4  
ATOM 8444  H HE2  . LYS A 1 107 ? 11.938  10.356  -17.870 1.00 0.00 ? 107 LYS A HE2  4  
ATOM 8445  H HE3  . LYS A 1 107 ? 11.140  11.954  -18.133 1.00 0.00 ? 107 LYS A HE3  4  
ATOM 8446  H HZ1  . LYS A 1 107 ? 9.811   9.298   -18.268 1.00 0.00 ? 107 LYS A HZ1  4  
ATOM 8447  H HZ2  . LYS A 1 107 ? 9.729   10.405  -16.981 1.00 0.00 ? 107 LYS A HZ2  4  
ATOM 8448  H HZ3  . LYS A 1 107 ? 9.066   10.808  -18.492 1.00 0.00 ? 107 LYS A HZ3  4  
ATOM 8449  N N    . ILE A 1 108 ? 13.799  4.917   -20.229 1.00 0.00 ? 108 ILE A N    4  
ATOM 8450  C CA   . ILE A 1 108 ? 14.848  3.972   -19.793 1.00 0.00 ? 108 ILE A CA   4  
ATOM 8451  C C    . ILE A 1 108 ? 14.621  3.522   -18.343 1.00 0.00 ? 108 ILE A C    4  
ATOM 8452  O O    . ILE A 1 108 ? 14.984  4.198   -17.380 1.00 0.00 ? 108 ILE A O    4  
ATOM 8453  C CB   . ILE A 1 108 ? 16.318  4.378   -20.063 1.00 0.00 ? 108 ILE A CB   4  
ATOM 8454  C CG1  . ILE A 1 108 ? 16.532  4.701   -21.572 1.00 0.00 ? 108 ILE A CG1  4  
ATOM 8455  C CG2  . ILE A 1 108 ? 17.301  3.253   -19.629 1.00 0.00 ? 108 ILE A CG2  4  
ATOM 8456  C CD1  . ILE A 1 108 ? 17.888  5.353   -21.895 1.00 0.00 ? 108 ILE A CD1  4  
ATOM 8457  H H    . ILE A 1 108 ? 13.026  4.492   -20.690 1.00 0.00 ? 108 ILE A H    4  
ATOM 8458  H HA   . ILE A 1 108 ? 14.689  3.094   -20.400 1.00 0.00 ? 108 ILE A HA   4  
ATOM 8459  H HB   . ILE A 1 108 ? 16.537  5.294   -19.465 1.00 0.00 ? 108 ILE A HB   4  
ATOM 8460  H HG12 . ILE A 1 108 ? 16.447  3.750   -22.147 1.00 0.00 ? 108 ILE A HG12 4  
ATOM 8461  H HG13 . ILE A 1 108 ? 15.720  5.383   -21.921 1.00 0.00 ? 108 ILE A HG13 4  
ATOM 8462  H HG21 . ILE A 1 108 ? 17.077  2.314   -20.178 1.00 0.00 ? 108 ILE A HG21 4  
ATOM 8463  H HG22 . ILE A 1 108 ? 18.348  3.538   -19.858 1.00 0.00 ? 108 ILE A HG22 4  
ATOM 8464  H HG23 . ILE A 1 108 ? 17.261  3.048   -18.541 1.00 0.00 ? 108 ILE A HG23 4  
ATOM 8465  H HD11 . ILE A 1 108 ? 18.036  6.291   -21.320 1.00 0.00 ? 108 ILE A HD11 4  
ATOM 8466  H HD12 . ILE A 1 108 ? 18.730  4.669   -21.656 1.00 0.00 ? 108 ILE A HD12 4  
ATOM 8467  H HD13 . ILE A 1 108 ? 17.959  5.604   -22.976 1.00 0.00 ? 108 ILE A HD13 4  
ATOM 8468  N N    . LEU A 1 109 ? 14.005  2.323   -18.156 1.00 0.00 ? 109 LEU A N    4  
ATOM 8469  C CA   . LEU A 1 109 ? 13.586  1.670   -16.912 1.00 0.00 ? 109 LEU A CA   4  
ATOM 8470  C C    . LEU A 1 109 ? 14.617  1.342   -15.805 1.00 0.00 ? 109 LEU A C    4  
ATOM 8471  O O    . LEU A 1 109 ? 14.583  0.285   -15.174 1.00 0.00 ? 109 LEU A O    4  
ATOM 8472  C CB   . LEU A 1 109 ? 12.627  0.474   -17.241 1.00 0.00 ? 109 LEU A CB   4  
ATOM 8473  C CG   . LEU A 1 109 ? 13.064  -0.640  -18.244 1.00 0.00 ? 109 LEU A CG   4  
ATOM 8474  C CD1  . LEU A 1 109 ? 13.141  -0.199  -19.720 1.00 0.00 ? 109 LEU A CD1  4  
ATOM 8475  C CD2  . LEU A 1 109 ? 14.329  -1.418  -17.846 1.00 0.00 ? 109 LEU A CD2  4  
ATOM 8476  H H    . LEU A 1 109 ? 13.723  1.792   -18.949 1.00 0.00 ? 109 LEU A H    4  
ATOM 8477  H HA   . LEU A 1 109 ? 12.946  2.396   -16.424 1.00 0.00 ? 109 LEU A HA   4  
ATOM 8478  H HB2  . LEU A 1 109 ? 12.317  -0.024  -16.295 1.00 0.00 ? 109 LEU A HB2  4  
ATOM 8479  H HB3  . LEU A 1 109 ? 11.700  0.925   -17.666 1.00 0.00 ? 109 LEU A HB3  4  
ATOM 8480  H HG   . LEU A 1 109 ? 12.225  -1.382  -18.205 1.00 0.00 ? 109 LEU A HG   4  
ATOM 8481  H HD11 . LEU A 1 109 ? 12.284  0.458   -19.974 1.00 0.00 ? 109 LEU A HD11 4  
ATOM 8482  H HD12 . LEU A 1 109 ? 14.096  0.324   -19.929 1.00 0.00 ? 109 LEU A HD12 4  
ATOM 8483  H HD13 . LEU A 1 109 ? 13.102  -1.095  -20.377 1.00 0.00 ? 109 LEU A HD13 4  
ATOM 8484  H HD21 . LEU A 1 109 ? 14.252  -1.769  -16.795 1.00 0.00 ? 109 LEU A HD21 4  
ATOM 8485  H HD22 . LEU A 1 109 ? 14.462  -2.303  -18.504 1.00 0.00 ? 109 LEU A HD22 4  
ATOM 8486  H HD23 . LEU A 1 109 ? 15.228  -0.774  -17.937 1.00 0.00 ? 109 LEU A HD23 4  
ATOM 8487  N N    . VAL A 1 110 ? 15.522  2.315   -15.516 1.00 0.00 ? 110 VAL A N    4  
ATOM 8488  C CA   . VAL A 1 110 ? 16.558  2.358   -14.483 1.00 0.00 ? 110 VAL A CA   4  
ATOM 8489  C C    . VAL A 1 110 ? 17.737  1.404   -14.705 1.00 0.00 ? 110 VAL A C    4  
ATOM 8490  O O    . VAL A 1 110 ? 17.846  0.325   -14.123 1.00 0.00 ? 110 VAL A O    4  
ATOM 8491  C CB   . VAL A 1 110 ? 16.039  2.383   -13.035 1.00 0.00 ? 110 VAL A CB   4  
ATOM 8492  C CG1  . VAL A 1 110 ? 17.174  2.743   -12.045 1.00 0.00 ? 110 VAL A CG1  4  
ATOM 8493  C CG2  . VAL A 1 110 ? 14.925  3.450   -12.909 1.00 0.00 ? 110 VAL A CG2  4  
ATOM 8494  H H    . VAL A 1 110 ? 15.445  3.150   -16.083 1.00 0.00 ? 110 VAL A H    4  
ATOM 8495  H HA   . VAL A 1 110 ? 16.988  3.342   -14.600 1.00 0.00 ? 110 VAL A HA   4  
ATOM 8496  H HB   . VAL A 1 110 ? 15.610  1.392   -12.764 1.00 0.00 ? 110 VAL A HB   4  
ATOM 8497  H HG11 . VAL A 1 110 ? 17.671  3.687   -12.352 1.00 0.00 ? 110 VAL A HG11 4  
ATOM 8498  H HG12 . VAL A 1 110 ? 16.747  2.889   -11.030 1.00 0.00 ? 110 VAL A HG12 4  
ATOM 8499  H HG13 . VAL A 1 110 ? 17.938  1.941   -11.982 1.00 0.00 ? 110 VAL A HG13 4  
ATOM 8500  H HG21 . VAL A 1 110 ? 15.290  4.436   -13.265 1.00 0.00 ? 110 VAL A HG21 4  
ATOM 8501  H HG22 . VAL A 1 110 ? 14.032  3.175   -13.508 1.00 0.00 ? 110 VAL A HG22 4  
ATOM 8502  H HG23 . VAL A 1 110 ? 14.601  3.556   -11.852 1.00 0.00 ? 110 VAL A HG23 4  
ATOM 8503  N N    . ILE A 1 111 ? 18.681  1.845   -15.570 1.00 0.00 ? 111 ILE A N    4  
ATOM 8504  C CA   . ILE A 1 111 ? 19.941  1.203   -15.911 1.00 0.00 ? 111 ILE A CA   4  
ATOM 8505  C C    . ILE A 1 111 ? 20.984  2.084   -15.219 1.00 0.00 ? 111 ILE A C    4  
ATOM 8506  O O    . ILE A 1 111 ? 20.835  3.305   -15.349 1.00 0.00 ? 111 ILE A O    4  
ATOM 8507  C CB   . ILE A 1 111 ? 20.131  1.144   -17.438 1.00 0.00 ? 111 ILE A CB   4  
ATOM 8508  C CG1  . ILE A 1 111 ? 19.051  0.191   -18.026 1.00 0.00 ? 111 ILE A CG1  4  
ATOM 8509  C CG2  . ILE A 1 111 ? 21.554  0.669   -17.829 1.00 0.00 ? 111 ILE A CG2  4  
ATOM 8510  C CD1  . ILE A 1 111 ? 19.133  -0.036  -19.547 1.00 0.00 ? 111 ILE A CD1  4  
ATOM 8511  H H    . ILE A 1 111 ? 18.553  2.730   -16.009 1.00 0.00 ? 111 ILE A H    4  
ATOM 8512  H HA   . ILE A 1 111 ? 19.960  0.194   -15.523 1.00 0.00 ? 111 ILE A HA   4  
ATOM 8513  H HB   . ILE A 1 111 ? 19.964  2.165   -17.860 1.00 0.00 ? 111 ILE A HB   4  
ATOM 8514  H HG12 . ILE A 1 111 ? 19.160  -0.799  -17.522 1.00 0.00 ? 111 ILE A HG12 4  
ATOM 8515  H HG13 . ILE A 1 111 ? 18.040  0.592   -17.767 1.00 0.00 ? 111 ILE A HG13 4  
ATOM 8516  H HG21 . ILE A 1 111 ? 21.745  -0.349  -17.425 1.00 0.00 ? 111 ILE A HG21 4  
ATOM 8517  H HG22 . ILE A 1 111 ? 21.659  0.626   -18.934 1.00 0.00 ? 111 ILE A HG22 4  
ATOM 8518  H HG23 . ILE A 1 111 ? 22.346  1.357   -17.472 1.00 0.00 ? 111 ILE A HG23 4  
ATOM 8519  H HD11 . ILE A 1 111 ? 19.125  0.926   -20.102 1.00 0.00 ? 111 ILE A HD11 4  
ATOM 8520  H HD12 . ILE A 1 111 ? 20.065  -0.583  -19.811 1.00 0.00 ? 111 ILE A HD12 4  
ATOM 8521  H HD13 . ILE A 1 111 ? 18.280  -0.652  -19.901 1.00 0.00 ? 111 ILE A HD13 4  
ATOM 8522  N N    . PRO A 1 112 ? 22.061  1.584   -14.531 1.00 0.00 ? 112 PRO A N    4  
ATOM 8523  C CA   . PRO A 1 112 ? 22.976  2.352   -13.660 1.00 0.00 ? 112 PRO A CA   4  
ATOM 8524  C C    . PRO A 1 112 ? 23.600  3.639   -14.210 1.00 0.00 ? 112 PRO A C    4  
ATOM 8525  O O    . PRO A 1 112 ? 23.785  4.561   -13.423 1.00 0.00 ? 112 PRO A O    4  
ATOM 8526  C CB   . PRO A 1 112 ? 24.037  1.315   -13.240 1.00 0.00 ? 112 PRO A CB   4  
ATOM 8527  C CG   . PRO A 1 112 ? 23.256  0.002   -13.181 1.00 0.00 ? 112 PRO A CG   4  
ATOM 8528  C CD   . PRO A 1 112 ? 22.279  0.142   -14.353 1.00 0.00 ? 112 PRO A CD   4  
ATOM 8529  H HA   . PRO A 1 112 ? 22.401  2.667   -12.800 1.00 0.00 ? 112 PRO A HA   4  
ATOM 8530  H HB2  . PRO A 1 112 ? 24.837  1.209   -14.006 1.00 0.00 ? 112 PRO A HB2  4  
ATOM 8531  H HB3  . PRO A 1 112 ? 24.497  1.568   -12.262 1.00 0.00 ? 112 PRO A HB3  4  
ATOM 8532  H HG2  . PRO A 1 112 ? 23.911  -0.889  -13.269 1.00 0.00 ? 112 PRO A HG2  4  
ATOM 8533  H HG3  . PRO A 1 112 ? 22.688  -0.053  -12.225 1.00 0.00 ? 112 PRO A HG3  4  
ATOM 8534  H HD2  . PRO A 1 112 ? 22.745  -0.271  -15.276 1.00 0.00 ? 112 PRO A HD2  4  
ATOM 8535  H HD3  . PRO A 1 112 ? 21.342  -0.413  -14.112 1.00 0.00 ? 112 PRO A HD3  4  
ATOM 8536  N N    . SER A 1 113 ? 23.867  3.722   -15.547 1.00 0.00 ? 113 SER A N    4  
ATOM 8537  C CA   . SER A 1 113 ? 24.335  4.892   -16.295 1.00 0.00 ? 113 SER A CA   4  
ATOM 8538  C C    . SER A 1 113 ? 25.782  5.296   -16.019 1.00 0.00 ? 113 SER A C    4  
ATOM 8539  O O    . SER A 1 113 ? 26.059  6.331   -15.419 1.00 0.00 ? 113 SER A O    4  
ATOM 8540  C CB   . SER A 1 113 ? 23.362  6.111   -16.202 1.00 0.00 ? 113 SER A CB   4  
ATOM 8541  O OG   . SER A 1 113 ? 22.060  5.772   -16.701 1.00 0.00 ? 113 SER A OG   4  
ATOM 8542  H H    . SER A 1 113 ? 23.653  2.930   -16.108 1.00 0.00 ? 113 SER A H    4  
ATOM 8543  H HA   . SER A 1 113 ? 24.320  4.593   -17.334 1.00 0.00 ? 113 SER A HA   4  
ATOM 8544  H HB2  . SER A 1 113 ? 23.273  6.460   -15.149 1.00 0.00 ? 113 SER A HB2  4  
ATOM 8545  H HB3  . SER A 1 113 ? 23.746  6.961   -16.809 1.00 0.00 ? 113 SER A HB3  4  
ATOM 8546  H HG   . SER A 1 113 ? 21.702  5.042   -16.155 1.00 0.00 ? 113 SER A HG   4  
ATOM 8547  N N    . LYS A 1 114 ? 26.758  4.459   -16.469 1.00 0.00 ? 114 LYS A N    4  
ATOM 8548  C CA   . LYS A 1 114 ? 28.202  4.612   -16.274 1.00 0.00 ? 114 LYS A CA   4  
ATOM 8549  C C    . LYS A 1 114 ? 28.835  5.593   -17.264 1.00 0.00 ? 114 LYS A C    4  
ATOM 8550  O O    . LYS A 1 114 ? 29.265  5.230   -18.355 1.00 0.00 ? 114 LYS A O    4  
ATOM 8551  C CB   . LYS A 1 114 ? 28.899  3.225   -16.354 1.00 0.00 ? 114 LYS A CB   4  
ATOM 8552  C CG   . LYS A 1 114 ? 28.412  2.243   -15.273 1.00 0.00 ? 114 LYS A CG   4  
ATOM 8553  C CD   . LYS A 1 114 ? 29.103  0.874   -15.370 1.00 0.00 ? 114 LYS A CD   4  
ATOM 8554  C CE   . LYS A 1 114 ? 28.648  -0.098  -14.275 1.00 0.00 ? 114 LYS A CE   4  
ATOM 8555  N NZ   . LYS A 1 114 ? 29.345  -1.399  -14.401 1.00 0.00 ? 114 LYS A NZ   4  
ATOM 8556  H H    . LYS A 1 114 ? 26.508  3.636   -16.967 1.00 0.00 ? 114 LYS A H    4  
ATOM 8557  H HA   . LYS A 1 114 ? 28.381  4.998   -15.277 1.00 0.00 ? 114 LYS A HA   4  
ATOM 8558  H HB2  . LYS A 1 114 ? 28.717  2.772   -17.354 1.00 0.00 ? 114 LYS A HB2  4  
ATOM 8559  H HB3  . LYS A 1 114 ? 30.001  3.342   -16.229 1.00 0.00 ? 114 LYS A HB3  4  
ATOM 8560  H HG2  . LYS A 1 114 ? 28.618  2.675   -14.267 1.00 0.00 ? 114 LYS A HG2  4  
ATOM 8561  H HG3  . LYS A 1 114 ? 27.313  2.098   -15.358 1.00 0.00 ? 114 LYS A HG3  4  
ATOM 8562  H HD2  . LYS A 1 114 ? 28.883  0.433   -16.368 1.00 0.00 ? 114 LYS A HD2  4  
ATOM 8563  H HD3  . LYS A 1 114 ? 30.205  1.023   -15.295 1.00 0.00 ? 114 LYS A HD3  4  
ATOM 8564  H HE2  . LYS A 1 114 ? 28.879  0.312   -13.269 1.00 0.00 ? 114 LYS A HE2  4  
ATOM 8565  H HE3  . LYS A 1 114 ? 27.556  -0.290  -14.353 1.00 0.00 ? 114 LYS A HE3  4  
ATOM 8566  H HZ1  . LYS A 1 114 ? 30.371  -1.250  -14.314 1.00 0.00 ? 114 LYS A HZ1  4  
ATOM 8567  H HZ2  . LYS A 1 114 ? 29.024  -2.040  -13.648 1.00 0.00 ? 114 LYS A HZ2  4  
ATOM 8568  H HZ3  . LYS A 1 114 ? 29.132  -1.817  -15.329 1.00 0.00 ? 114 LYS A HZ3  4  
ATOM 8569  N N    . VAL A 1 115 ? 28.856  6.892   -16.880 1.00 0.00 ? 115 VAL A N    4  
ATOM 8570  C CA   . VAL A 1 115 ? 29.315  8.021   -17.673 1.00 0.00 ? 115 VAL A CA   4  
ATOM 8571  C C    . VAL A 1 115 ? 29.503  9.145   -16.666 1.00 0.00 ? 115 VAL A C    4  
ATOM 8572  O O    . VAL A 1 115 ? 29.095  9.009   -15.516 1.00 0.00 ? 115 VAL A O    4  
ATOM 8573  C CB   . VAL A 1 115 ? 28.293  8.389   -18.780 1.00 0.00 ? 115 VAL A CB   4  
ATOM 8574  C CG1  . VAL A 1 115 ? 26.892  8.747   -18.218 1.00 0.00 ? 115 VAL A CG1  4  
ATOM 8575  C CG2  . VAL A 1 115 ? 28.805  9.479   -19.750 1.00 0.00 ? 115 VAL A CG2  4  
ATOM 8576  H H    . VAL A 1 115 ? 28.493  7.172   -15.987 1.00 0.00 ? 115 VAL A H    4  
ATOM 8577  H HA   . VAL A 1 115 ? 30.281  7.790   -18.104 1.00 0.00 ? 115 VAL A HA   4  
ATOM 8578  H HB   . VAL A 1 115 ? 28.161  7.464   -19.393 1.00 0.00 ? 115 VAL A HB   4  
ATOM 8579  H HG11 . VAL A 1 115 ? 26.515  7.943   -17.552 1.00 0.00 ? 115 VAL A HG11 4  
ATOM 8580  H HG12 . VAL A 1 115 ? 26.911  9.698   -17.651 1.00 0.00 ? 115 VAL A HG12 4  
ATOM 8581  H HG13 . VAL A 1 115 ? 26.173  8.862   -19.056 1.00 0.00 ? 115 VAL A HG13 4  
ATOM 8582  H HG21 . VAL A 1 115 ? 29.841  9.257   -20.084 1.00 0.00 ? 115 VAL A HG21 4  
ATOM 8583  H HG22 . VAL A 1 115 ? 28.155  9.509   -20.651 1.00 0.00 ? 115 VAL A HG22 4  
ATOM 8584  H HG23 . VAL A 1 115 ? 28.772  10.488  -19.290 1.00 0.00 ? 115 VAL A HG23 4  
ATOM 8585  N N    . TRP A 1 116 ? 30.090  10.298  -17.066 1.00 0.00 ? 116 TRP A N    4  
ATOM 8586  C CA   . TRP A 1 116 ? 30.215  11.497  -16.255 1.00 0.00 ? 116 TRP A CA   4  
ATOM 8587  C C    . TRP A 1 116 ? 29.351  12.560  -16.924 1.00 0.00 ? 116 TRP A C    4  
ATOM 8588  O O    . TRP A 1 116 ? 29.701  13.060  -17.993 1.00 0.00 ? 116 TRP A O    4  
ATOM 8589  C CB   . TRP A 1 116 ? 31.710  11.919  -16.145 1.00 0.00 ? 116 TRP A CB   4  
ATOM 8590  C CG   . TRP A 1 116 ? 32.049  13.150  -15.304 1.00 0.00 ? 116 TRP A CG   4  
ATOM 8591  C CD1  . TRP A 1 116 ? 32.592  14.327  -15.733 1.00 0.00 ? 116 TRP A CD1  4  
ATOM 8592  C CD2  . TRP A 1 116 ? 31.894  13.273  -13.874 1.00 0.00 ? 116 TRP A CD2  4  
ATOM 8593  N NE1  . TRP A 1 116 ? 32.815  15.165  -14.666 1.00 0.00 ? 116 TRP A NE1  4  
ATOM 8594  C CE2  . TRP A 1 116 ? 32.388  14.528  -13.515 1.00 0.00 ? 116 TRP A CE2  4  
ATOM 8595  C CE3  . TRP A 1 116 ? 31.397  12.407  -12.932 1.00 0.00 ? 116 TRP A CE3  4  
ATOM 8596  C CZ2  . TRP A 1 116 ? 32.396  14.937  -12.210 1.00 0.00 ? 116 TRP A CZ2  4  
ATOM 8597  C CZ3  . TRP A 1 116 ? 31.391  12.830  -11.616 1.00 0.00 ? 116 TRP A CZ3  4  
ATOM 8598  C CH2  . TRP A 1 116 ? 31.881  14.075  -11.260 1.00 0.00 ? 116 TRP A CH2  4  
ATOM 8599  H H    . TRP A 1 116 ? 30.419  10.390  -18.003 1.00 0.00 ? 116 TRP A H    4  
ATOM 8600  H HA   . TRP A 1 116 ? 29.826  11.339  -15.257 1.00 0.00 ? 116 TRP A HA   4  
ATOM 8601  H HB2  . TRP A 1 116 ? 32.258  11.064  -15.689 1.00 0.00 ? 116 TRP A HB2  4  
ATOM 8602  H HB3  . TRP A 1 116 ? 32.130  12.064  -17.165 1.00 0.00 ? 116 TRP A HB3  4  
ATOM 8603  H HD1  . TRP A 1 116 ? 32.807  14.555  -16.768 1.00 0.00 ? 116 TRP A HD1  4  
ATOM 8604  H HE1  . TRP A 1 116 ? 33.248  16.039  -14.701 1.00 0.00 ? 116 TRP A HE1  4  
ATOM 8605  H HE3  . TRP A 1 116 ? 31.027  11.425  -13.191 1.00 0.00 ? 116 TRP A HE3  4  
ATOM 8606  H HZ2  . TRP A 1 116 ? 32.803  15.895  -11.918 1.00 0.00 ? 116 TRP A HZ2  4  
ATOM 8607  H HZ3  . TRP A 1 116 ? 31.013  12.172  -10.841 1.00 0.00 ? 116 TRP A HZ3  4  
ATOM 8608  H HH2  . TRP A 1 116 ? 31.867  14.369  -10.218 1.00 0.00 ? 116 TRP A HH2  4  
ATOM 8609  N N    . GLN A 1 117 ? 28.188  12.913  -16.298 1.00 0.00 ? 117 GLN A N    4  
ATOM 8610  C CA   . GLN A 1 117 ? 27.230  13.904  -16.795 1.00 0.00 ? 117 GLN A CA   4  
ATOM 8611  C C    . GLN A 1 117 ? 27.552  15.309  -16.274 1.00 0.00 ? 117 GLN A C    4  
ATOM 8612  O O    . GLN A 1 117 ? 27.122  16.310  -16.836 1.00 0.00 ? 117 GLN A O    4  
ATOM 8613  C CB   . GLN A 1 117 ? 25.751  13.574  -16.399 1.00 0.00 ? 117 GLN A CB   4  
ATOM 8614  C CG   . GLN A 1 117 ? 25.121  12.275  -16.981 1.00 0.00 ? 117 GLN A CG   4  
ATOM 8615  C CD   . GLN A 1 117 ? 23.600  12.255  -16.710 1.00 0.00 ? 117 GLN A CD   4  
ATOM 8616  O OE1  . GLN A 1 117 ? 23.043  13.260  -16.255 1.00 0.00 ? 117 GLN A OE1  4  
ATOM 8617  N NE2  . GLN A 1 117 ? 22.917  11.109  -16.968 1.00 0.00 ? 117 GLN A NE2  4  
ATOM 8618  H H    . GLN A 1 117 ? 27.926  12.463  -15.449 1.00 0.00 ? 117 GLN A H    4  
ATOM 8619  H HA   . GLN A 1 117 ? 27.280  13.958  -17.877 1.00 0.00 ? 117 GLN A HA   4  
ATOM 8620  H HB2  . GLN A 1 117 ? 25.654  13.528  -15.290 1.00 0.00 ? 117 GLN A HB2  4  
ATOM 8621  H HB3  . GLN A 1 117 ? 25.109  14.416  -16.754 1.00 0.00 ? 117 GLN A HB3  4  
ATOM 8622  H HG2  . GLN A 1 117 ? 25.268  12.247  -18.080 1.00 0.00 ? 117 GLN A HG2  4  
ATOM 8623  H HG3  . GLN A 1 117 ? 25.584  11.377  -16.529 1.00 0.00 ? 117 GLN A HG3  4  
ATOM 8624  H HE21 . GLN A 1 117 ? 23.412  10.265  -17.159 1.00 0.00 ? 117 GLN A HE21 4  
ATOM 8625  H HE22 . GLN A 1 117 ? 21.914  11.131  -16.839 1.00 0.00 ? 117 GLN A HE22 4  
ATOM 8626  N N    . GLY A 1 118 ? 28.290  15.382  -15.138 1.00 0.00 ? 118 GLY A N    4  
ATOM 8627  C CA   . GLY A 1 118 ? 28.645  16.603  -14.415 1.00 0.00 ? 118 GLY A CA   4  
ATOM 8628  C C    . GLY A 1 118 ? 27.985  16.694  -13.058 1.00 0.00 ? 118 GLY A C    4  
ATOM 8629  O O    . GLY A 1 118 ? 28.628  17.002  -12.062 1.00 0.00 ? 118 GLY A O    4  
ATOM 8630  H H    . GLY A 1 118 ? 28.608  14.522  -14.749 1.00 0.00 ? 118 GLY A H    4  
ATOM 8631  H HA2  . GLY A 1 118 ? 29.711  16.561  -14.238 1.00 0.00 ? 118 GLY A HA2  4  
ATOM 8632  H HA3  . GLY A 1 118 ? 28.349  17.484  -14.974 1.00 0.00 ? 118 GLY A HA3  4  
ATOM 8633  N N    . GLN A 1 119 ? 26.655  16.420  -12.976 1.00 0.00 ? 119 GLN A N    4  
ATOM 8634  C CA   . GLN A 1 119 ? 25.805  16.518  -11.784 1.00 0.00 ? 119 GLN A CA   4  
ATOM 8635  C C    . GLN A 1 119 ? 25.917  15.371  -10.764 1.00 0.00 ? 119 GLN A C    4  
ATOM 8636  O O    . GLN A 1 119 ? 25.416  15.462  -9.643  1.00 0.00 ? 119 GLN A O    4  
ATOM 8637  C CB   . GLN A 1 119 ? 24.319  16.736  -12.202 1.00 0.00 ? 119 GLN A CB   4  
ATOM 8638  C CG   . GLN A 1 119 ? 23.752  15.643  -13.135 1.00 0.00 ? 119 GLN A CG   4  
ATOM 8639  C CD   . GLN A 1 119 ? 22.258  15.843  -13.405 1.00 0.00 ? 119 GLN A CD   4  
ATOM 8640  O OE1  . GLN A 1 119 ? 21.524  16.581  -12.738 1.00 0.00 ? 119 GLN A OE1  4  
ATOM 8641  N NE2  . GLN A 1 119 ? 21.772  15.079  -14.422 1.00 0.00 ? 119 GLN A NE2  4  
ATOM 8642  H H    . GLN A 1 119 ? 26.180  16.185  -13.818 1.00 0.00 ? 119 GLN A H    4  
ATOM 8643  H HA   . GLN A 1 119 ? 26.096  17.409  -11.243 1.00 0.00 ? 119 GLN A HA   4  
ATOM 8644  H HB2  . GLN A 1 119 ? 23.674  16.827  -11.297 1.00 0.00 ? 119 GLN A HB2  4  
ATOM 8645  H HB3  . GLN A 1 119 ? 24.251  17.710  -12.739 1.00 0.00 ? 119 GLN A HB3  4  
ATOM 8646  H HG2  . GLN A 1 119 ? 24.294  15.641  -14.104 1.00 0.00 ? 119 GLN A HG2  4  
ATOM 8647  H HG3  . GLN A 1 119 ? 23.861  14.641  -12.664 1.00 0.00 ? 119 GLN A HG3  4  
ATOM 8648  H HE21 . GLN A 1 119 ? 22.380  14.500  -14.989 1.00 0.00 ? 119 GLN A HE21 4  
ATOM 8649  H HE22 . GLN A 1 119 ? 20.783  15.040  -14.557 1.00 0.00 ? 119 GLN A HE22 4  
ATOM 8650  N N    . ALA A 1 120 ? 26.616  14.254  -11.116 1.00 0.00 ? 120 ALA A N    4  
ATOM 8651  C CA   . ALA A 1 120 ? 26.847  13.069  -10.286 1.00 0.00 ? 120 ALA A CA   4  
ATOM 8652  C C    . ALA A 1 120 ? 27.885  13.204  -9.152  1.00 0.00 ? 120 ALA A C    4  
ATOM 8653  O O    . ALA A 1 120 ? 28.808  12.403  -8.998  1.00 0.00 ? 120 ALA A O    4  
ATOM 8654  C CB   . ALA A 1 120 ? 27.210  11.866  -11.180 1.00 0.00 ? 120 ALA A CB   4  
ATOM 8655  H H    . ALA A 1 120 ? 27.021  14.205  -12.023 1.00 0.00 ? 120 ALA A H    4  
ATOM 8656  H HA   . ALA A 1 120 ? 25.909  12.817  -9.807  1.00 0.00 ? 120 ALA A HA   4  
ATOM 8657  H HB1  . ALA A 1 120 ? 26.453  11.755  -11.987 1.00 0.00 ? 120 ALA A HB1  4  
ATOM 8658  H HB2  . ALA A 1 120 ? 27.234  10.914  -10.604 1.00 0.00 ? 120 ALA A HB2  4  
ATOM 8659  H HB3  . ALA A 1 120 ? 28.202  12.004  -11.662 1.00 0.00 ? 120 ALA A HB3  4  
ATOM 8660  N N    . PHE A 1 121 ? 27.695  14.233  -8.289  1.00 0.00 ? 121 PHE A N    4  
ATOM 8661  C CA   . PHE A 1 121 ? 28.462  14.501  -7.076  1.00 0.00 ? 121 PHE A CA   4  
ATOM 8662  C C    . PHE A 1 121 ? 27.638  14.010  -5.893  1.00 0.00 ? 121 PHE A C    4  
ATOM 8663  O O    . PHE A 1 121 ? 28.060  13.149  -5.127  1.00 0.00 ? 121 PHE A O    4  
ATOM 8664  C CB   . PHE A 1 121 ? 28.811  16.011  -6.911  1.00 0.00 ? 121 PHE A CB   4  
ATOM 8665  C CG   . PHE A 1 121 ? 29.979  16.390  -7.789  1.00 0.00 ? 121 PHE A CG   4  
ATOM 8666  C CD1  . PHE A 1 121 ? 31.262  16.005  -7.435  1.00 0.00 ? 121 PHE A CD1  4  
ATOM 8667  C CD2  . PHE A 1 121 ? 29.815  17.164  -8.926  1.00 0.00 ? 121 PHE A CD2  4  
ATOM 8668  C CE1  . PHE A 1 121 ? 32.353  16.391  -8.188  1.00 0.00 ? 121 PHE A CE1  4  
ATOM 8669  C CE2  . PHE A 1 121 ? 30.906  17.558  -9.680  1.00 0.00 ? 121 PHE A CE2  4  
ATOM 8670  C CZ   . PHE A 1 121 ? 32.179  17.178  -9.309  1.00 0.00 ? 121 PHE A CZ   4  
ATOM 8671  H H    . PHE A 1 121 ? 26.932  14.851  -8.500  1.00 0.00 ? 121 PHE A H    4  
ATOM 8672  H HA   . PHE A 1 121 ? 29.375  13.916  -7.059  1.00 0.00 ? 121 PHE A HA   4  
ATOM 8673  H HB2  . PHE A 1 121 ? 27.940  16.650  -7.171  1.00 0.00 ? 121 PHE A HB2  4  
ATOM 8674  H HB3  . PHE A 1 121 ? 29.121  16.251  -5.869  1.00 0.00 ? 121 PHE A HB3  4  
ATOM 8675  H HD1  . PHE A 1 121 ? 31.414  15.406  -6.546  1.00 0.00 ? 121 PHE A HD1  4  
ATOM 8676  H HD2  . PHE A 1 121 ? 28.825  17.474  -9.229  1.00 0.00 ? 121 PHE A HD2  4  
ATOM 8677  H HE1  . PHE A 1 121 ? 33.349  16.084  -7.896  1.00 0.00 ? 121 PHE A HE1  4  
ATOM 8678  H HE2  . PHE A 1 121 ? 30.760  18.166  -10.564 1.00 0.00 ? 121 PHE A HE2  4  
ATOM 8679  H HZ   . PHE A 1 121 ? 33.033  17.491  -9.895  1.00 0.00 ? 121 PHE A HZ   4  
ATOM 8680  N N    . HIS A 1 122 ? 26.401  14.550  -5.740  1.00 0.00 ? 122 HIS A N    4  
ATOM 8681  C CA   . HIS A 1 122 ? 25.443  14.183  -4.702  1.00 0.00 ? 122 HIS A CA   4  
ATOM 8682  C C    . HIS A 1 122 ? 24.141  13.724  -5.352  1.00 0.00 ? 122 HIS A C    4  
ATOM 8683  O O    . HIS A 1 122 ? 23.075  13.732  -4.737  1.00 0.00 ? 122 HIS A O    4  
ATOM 8684  C CB   . HIS A 1 122 ? 25.171  15.371  -3.732  1.00 0.00 ? 122 HIS A CB   4  
ATOM 8685  C CG   . HIS A 1 122 ? 26.421  16.059  -3.238  1.00 0.00 ? 122 HIS A CG   4  
ATOM 8686  N ND1  . HIS A 1 122 ? 27.499  15.426  -2.652  1.00 0.00 ? 122 HIS A ND1  4  
ATOM 8687  C CD2  . HIS A 1 122 ? 26.752  17.379  -3.282  1.00 0.00 ? 122 HIS A CD2  4  
ATOM 8688  C CE1  . HIS A 1 122 ? 28.417  16.386  -2.375  1.00 0.00 ? 122 HIS A CE1  4  
ATOM 8689  N NE2  . HIS A 1 122 ? 28.008  17.584  -2.738  1.00 0.00 ? 122 HIS A NE2  4  
ATOM 8690  H H    . HIS A 1 122 ? 26.106  15.264  -6.367  1.00 0.00 ? 122 HIS A H    4  
ATOM 8691  H HA   . HIS A 1 122 ? 25.808  13.346  -4.119  1.00 0.00 ? 122 HIS A HA   4  
ATOM 8692  H HB2  . HIS A 1 122 ? 24.566  16.158  -4.235  1.00 0.00 ? 122 HIS A HB2  4  
ATOM 8693  H HB3  . HIS A 1 122 ? 24.595  15.014  -2.851  1.00 0.00 ? 122 HIS A HB3  4  
ATOM 8694  H HD1  . HIS A 1 122 ? 27.628  14.439  -2.549  1.00 0.00 ? 122 HIS A HD1  4  
ATOM 8695  H HD2  . HIS A 1 122 ? 26.188  18.219  -3.670  1.00 0.00 ? 122 HIS A HD2  4  
ATOM 8696  H HE1  . HIS A 1 122 ? 29.388  16.176  -1.924  1.00 0.00 ? 122 HIS A HE1  4  
ATOM 8697  N N    . LEU A 1 123 ? 24.204  13.357  -6.664  1.00 0.00 ? 123 LEU A N    4  
ATOM 8698  C CA   . LEU A 1 123 ? 23.125  12.912  -7.557  1.00 0.00 ? 123 LEU A CA   4  
ATOM 8699  C C    . LEU A 1 123 ? 22.152  14.012  -7.983  1.00 0.00 ? 123 LEU A C    4  
ATOM 8700  O O    . LEU A 1 123 ? 21.964  14.264  -9.167  1.00 0.00 ? 123 LEU A O    4  
ATOM 8701  C CB   . LEU A 1 123 ? 22.393  11.627  -7.036  1.00 0.00 ? 123 LEU A CB   4  
ATOM 8702  C CG   . LEU A 1 123 ? 21.462  10.822  -7.999  1.00 0.00 ? 123 LEU A CG   4  
ATOM 8703  C CD1  . LEU A 1 123 ? 20.011  11.342  -8.077  1.00 0.00 ? 123 LEU A CD1  4  
ATOM 8704  C CD2  . LEU A 1 123 ? 22.040  10.601  -9.409  1.00 0.00 ? 123 LEU A CD2  4  
ATOM 8705  H H    . LEU A 1 123 ? 25.104  13.399  -7.089  1.00 0.00 ? 123 LEU A H    4  
ATOM 8706  H HA   . LEU A 1 123 ? 23.628  12.628  -8.469  1.00 0.00 ? 123 LEU A HA   4  
ATOM 8707  H HB2  . LEU A 1 123 ? 23.202  10.924  -6.727  1.00 0.00 ? 123 LEU A HB2  4  
ATOM 8708  H HB3  . LEU A 1 123 ? 21.821  11.862  -6.112  1.00 0.00 ? 123 LEU A HB3  4  
ATOM 8709  H HG   . LEU A 1 123 ? 21.385  9.808   -7.530  1.00 0.00 ? 123 LEU A HG   4  
ATOM 8710  H HD11 . LEU A 1 123 ? 19.615  11.534  -7.056  1.00 0.00 ? 123 LEU A HD11 4  
ATOM 8711  H HD12 . LEU A 1 123 ? 19.956  12.279  -8.668  1.00 0.00 ? 123 LEU A HD12 4  
ATOM 8712  H HD13 . LEU A 1 123 ? 19.361  10.589  -8.572  1.00 0.00 ? 123 LEU A HD13 4  
ATOM 8713  H HD21 . LEU A 1 123 ? 23.038  10.120  -9.350  1.00 0.00 ? 123 LEU A HD21 4  
ATOM 8714  H HD22 . LEU A 1 123 ? 21.370  9.946   -10.007 1.00 0.00 ? 123 LEU A HD22 4  
ATOM 8715  H HD23 . LEU A 1 123 ? 22.135  11.568  -9.949  1.00 0.00 ? 123 LEU A HD23 4  
ATOM 8716  N N    . ASP A 1 124 ? 21.476  14.643  -6.986  1.00 0.00 ? 124 ASP A N    4  
ATOM 8717  C CA   . ASP A 1 124 ? 20.407  15.644  -7.043  1.00 0.00 ? 124 ASP A CA   4  
ATOM 8718  C C    . ASP A 1 124 ? 19.077  14.908  -7.059  1.00 0.00 ? 124 ASP A C    4  
ATOM 8719  O O    . ASP A 1 124 ? 18.710  14.281  -6.069  1.00 0.00 ? 124 ASP A O    4  
ATOM 8720  C CB   . ASP A 1 124 ? 20.501  16.755  -8.139  1.00 0.00 ? 124 ASP A CB   4  
ATOM 8721  C CG   . ASP A 1 124 ? 21.808  17.540  -7.975  1.00 0.00 ? 124 ASP A CG   4  
ATOM 8722  O OD1  . ASP A 1 124 ? 21.996  18.156  -6.892  1.00 0.00 ? 124 ASP A OD1  4  
ATOM 8723  O OD2  . ASP A 1 124 ? 22.630  17.532  -8.929  1.00 0.00 ? 124 ASP A OD2  4  
ATOM 8724  H H    . ASP A 1 124 ? 21.704  14.345  -6.059  1.00 0.00 ? 124 ASP A H    4  
ATOM 8725  H HA   . ASP A 1 124 ? 20.430  16.146  -6.087  1.00 0.00 ? 124 ASP A HA   4  
ATOM 8726  H HB2  . ASP A 1 124 ? 20.463  16.315  -9.157  1.00 0.00 ? 124 ASP A HB2  4  
ATOM 8727  H HB3  . ASP A 1 124 ? 19.656  17.471  -8.035  1.00 0.00 ? 124 ASP A HB3  4  
ATOM 8728  N N    . ARG A 1 125 ? 18.348  14.929  -8.197  1.00 0.00 ? 125 ARG A N    4  
ATOM 8729  C CA   . ARG A 1 125 ? 17.115  14.178  -8.379  1.00 0.00 ? 125 ARG A CA   4  
ATOM 8730  C C    . ARG A 1 125 ? 16.816  14.198  -9.869  1.00 0.00 ? 125 ARG A C    4  
ATOM 8731  O O    . ARG A 1 125 ? 16.383  15.213  -10.407 1.00 0.00 ? 125 ARG A O    4  
ATOM 8732  C CB   . ARG A 1 125 ? 15.912  14.739  -7.562  1.00 0.00 ? 125 ARG A CB   4  
ATOM 8733  C CG   . ARG A 1 125 ? 14.638  13.863  -7.515  1.00 0.00 ? 125 ARG A CG   4  
ATOM 8734  C CD   . ARG A 1 125 ? 14.679  12.671  -6.537  1.00 0.00 ? 125 ARG A CD   4  
ATOM 8735  N NE   . ARG A 1 125 ? 15.454  11.511  -7.111  1.00 0.00 ? 125 ARG A NE   4  
ATOM 8736  C CZ   . ARG A 1 125 ? 14.891  10.488  -7.827  1.00 0.00 ? 125 ARG A CZ   4  
ATOM 8737  N NH1  . ARG A 1 125 ? 13.571  10.506  -8.173  1.00 0.00 ? 125 ARG A NH1  4  
ATOM 8738  N NH2  . ARG A 1 125 ? 15.666  9.426   -8.195  1.00 0.00 ? 125 ARG A NH2  4  
ATOM 8739  H H    . ARG A 1 125 ? 18.655  15.444  -8.997  1.00 0.00 ? 125 ARG A H    4  
ATOM 8740  H HA   . ARG A 1 125 ? 17.306  13.151  -8.095  1.00 0.00 ? 125 ARG A HA   4  
ATOM 8741  H HB2  . ARG A 1 125 ? 16.242  14.887  -6.508  1.00 0.00 ? 125 ARG A HB2  4  
ATOM 8742  H HB3  . ARG A 1 125 ? 15.638  15.747  -7.950  1.00 0.00 ? 125 ARG A HB3  4  
ATOM 8743  H HG2  . ARG A 1 125 ? 13.820  14.529  -7.154  1.00 0.00 ? 125 ARG A HG2  4  
ATOM 8744  H HG3  . ARG A 1 125 ? 14.348  13.527  -8.530  1.00 0.00 ? 125 ARG A HG3  4  
ATOM 8745  H HD2  . ARG A 1 125 ? 15.176  12.975  -5.591  1.00 0.00 ? 125 ARG A HD2  4  
ATOM 8746  H HD3  . ARG A 1 125 ? 13.642  12.347  -6.290  1.00 0.00 ? 125 ARG A HD3  4  
ATOM 8747  H HE   . ARG A 1 125 ? 16.430  11.455  -6.898  1.00 0.00 ? 125 ARG A HE   4  
ATOM 8748  H HH11 . ARG A 1 125 ? 12.995  11.280  -7.906  1.00 0.00 ? 125 ARG A HH11 4  
ATOM 8749  H HH12 . ARG A 1 125 ? 13.181  9.748   -8.694  1.00 0.00 ? 125 ARG A HH12 4  
ATOM 8750  H HH21 . ARG A 1 125 ? 16.634  9.405   -7.950  1.00 0.00 ? 125 ARG A HH21 4  
ATOM 8751  H HH22 . ARG A 1 125 ? 15.266  8.675   -8.722  1.00 0.00 ? 125 ARG A HH22 4  
ATOM 8752  N N    . ARG A 1 126 ? 17.042  13.066  -10.590 1.00 0.00 ? 126 ARG A N    4  
ATOM 8753  C CA   . ARG A 1 126 ? 16.903  12.809  -12.026 1.00 0.00 ? 126 ARG A CA   4  
ATOM 8754  C C    . ARG A 1 126 ? 15.514  12.943  -12.702 1.00 0.00 ? 126 ARG A C    4  
ATOM 8755  O O    . ARG A 1 126 ? 15.136  12.157  -13.568 1.00 0.00 ? 126 ARG A O    4  
ATOM 8756  C CB   . ARG A 1 126 ? 17.460  11.376  -12.277 1.00 0.00 ? 126 ARG A CB   4  
ATOM 8757  C CG   . ARG A 1 126 ? 16.685  10.247  -11.565 1.00 0.00 ? 126 ARG A CG   4  
ATOM 8758  C CD   . ARG A 1 126 ? 17.175  8.833   -11.918 1.00 0.00 ? 126 ARG A CD   4  
ATOM 8759  N NE   . ARG A 1 126 ? 16.279  7.821   -11.240 1.00 0.00 ? 126 ARG A NE   4  
ATOM 8760  C CZ   . ARG A 1 126 ? 15.085  7.386   -11.754 1.00 0.00 ? 126 ARG A CZ   4  
ATOM 8761  N NH1  . ARG A 1 126 ? 14.663  7.777   -12.991 1.00 0.00 ? 126 ARG A NH1  4  
ATOM 8762  N NH2  . ARG A 1 126 ? 14.300  6.552   -11.009 1.00 0.00 ? 126 ARG A NH2  4  
ATOM 8763  H H    . ARG A 1 126 ? 17.387  12.264  -10.117 1.00 0.00 ? 126 ARG A H    4  
ATOM 8764  H HA   . ARG A 1 126 ? 17.558  13.504  -12.536 1.00 0.00 ? 126 ARG A HA   4  
ATOM 8765  H HB2  . ARG A 1 126 ? 17.478  11.164  -13.365 1.00 0.00 ? 126 ARG A HB2  4  
ATOM 8766  H HB3  . ARG A 1 126 ? 18.517  11.343  -11.924 1.00 0.00 ? 126 ARG A HB3  4  
ATOM 8767  H HG2  . ARG A 1 126 ? 16.745  10.385  -10.465 1.00 0.00 ? 126 ARG A HG2  4  
ATOM 8768  H HG3  . ARG A 1 126 ? 15.612  10.316  -11.859 1.00 0.00 ? 126 ARG A HG3  4  
ATOM 8769  H HD2  . ARG A 1 126 ? 17.178  8.671   -13.018 1.00 0.00 ? 126 ARG A HD2  4  
ATOM 8770  H HD3  . ARG A 1 126 ? 18.206  8.682   -11.532 1.00 0.00 ? 126 ARG A HD3  4  
ATOM 8771  H HE   . ARG A 1 126 ? 16.545  7.503   -10.329 1.00 0.00 ? 126 ARG A HE   4  
ATOM 8772  H HH11 . ARG A 1 126 ? 15.231  8.388   -13.542 1.00 0.00 ? 126 ARG A HH11 4  
ATOM 8773  H HH12 . ARG A 1 126 ? 13.789  7.448   -13.350 1.00 0.00 ? 126 ARG A HH12 4  
ATOM 8774  H HH21 . ARG A 1 126 ? 14.599  6.266   -10.099 1.00 0.00 ? 126 ARG A HH21 4  
ATOM 8775  H HH22 . ARG A 1 126 ? 13.426  6.231   -11.374 1.00 0.00 ? 126 ARG A HH22 4  
ATOM 8776  N N    . LEU A 1 127 ? 14.711  13.971  -12.333 1.00 0.00 ? 127 LEU A N    4  
ATOM 8777  C CA   . LEU A 1 127 ? 13.352  14.219  -12.851 1.00 0.00 ? 127 LEU A CA   4  
ATOM 8778  C C    . LEU A 1 127 ? 13.306  15.456  -13.744 1.00 0.00 ? 127 LEU A C    4  
ATOM 8779  O O    . LEU A 1 127 ? 12.281  16.102  -13.956 1.00 0.00 ? 127 LEU A O    4  
ATOM 8780  C CB   . LEU A 1 127 ? 12.268  14.193  -11.732 1.00 0.00 ? 127 LEU A CB   4  
ATOM 8781  C CG   . LEU A 1 127 ? 12.483  15.053  -10.461 1.00 0.00 ? 127 LEU A CG   4  
ATOM 8782  C CD1  . LEU A 1 127 ? 12.216  16.554  -10.661 1.00 0.00 ? 127 LEU A CD1  4  
ATOM 8783  C CD2  . LEU A 1 127 ? 11.568  14.529  -9.339  1.00 0.00 ? 127 LEU A CD2  4  
ATOM 8784  H H    . LEU A 1 127 ? 15.078  14.597  -11.632 1.00 0.00 ? 127 LEU A H    4  
ATOM 8785  H HA   . LEU A 1 127 ? 13.057  13.412  -13.512 1.00 0.00 ? 127 LEU A HA   4  
ATOM 8786  H HB2  . LEU A 1 127 ? 11.265  14.413  -12.156 1.00 0.00 ? 127 LEU A HB2  4  
ATOM 8787  H HB3  . LEU A 1 127 ? 12.230  13.134  -11.387 1.00 0.00 ? 127 LEU A HB3  4  
ATOM 8788  H HG   . LEU A 1 127 ? 13.535  14.931  -10.119 1.00 0.00 ? 127 LEU A HG   4  
ATOM 8789  H HD11 . LEU A 1 127 ? 11.190  16.708  -11.058 1.00 0.00 ? 127 LEU A HD11 4  
ATOM 8790  H HD12 . LEU A 1 127 ? 12.300  17.089  -9.691  1.00 0.00 ? 127 LEU A HD12 4  
ATOM 8791  H HD13 . LEU A 1 127 ? 12.942  17.005  -11.367 1.00 0.00 ? 127 LEU A HD13 4  
ATOM 8792  H HD21 . LEU A 1 127 ? 11.787  13.462  -9.123  1.00 0.00 ? 127 LEU A HD21 4  
ATOM 8793  H HD22 . LEU A 1 127 ? 11.721  15.119  -8.411  1.00 0.00 ? 127 LEU A HD22 4  
ATOM 8794  H HD23 . LEU A 1 127 ? 10.504  14.622  -9.643  1.00 0.00 ? 127 LEU A HD23 4  
ATOM 8795  N N    . GLU A 1 128 ? 14.495  15.783  -14.291 1.00 0.00 ? 128 GLU A N    4  
ATOM 8796  C CA   . GLU A 1 128 ? 14.803  16.891  -15.181 1.00 0.00 ? 128 GLU A CA   4  
ATOM 8797  C C    . GLU A 1 128 ? 15.622  16.308  -16.320 1.00 0.00 ? 128 GLU A C    4  
ATOM 8798  O O    . GLU A 1 128 ? 15.175  16.234  -17.462 1.00 0.00 ? 128 GLU A O    4  
ATOM 8799  C CB   . GLU A 1 128 ? 15.598  18.027  -14.466 1.00 0.00 ? 128 GLU A CB   4  
ATOM 8800  C CG   . GLU A 1 128 ? 14.823  18.768  -13.354 1.00 0.00 ? 128 GLU A CG   4  
ATOM 8801  C CD   . GLU A 1 128 ? 13.592  19.473  -13.923 1.00 0.00 ? 128 GLU A CD   4  
ATOM 8802  O OE1  . GLU A 1 128 ? 13.765  20.336  -14.824 1.00 0.00 ? 128 GLU A OE1  4  
ATOM 8803  O OE2  . GLU A 1 128 ? 12.462  19.164  -13.457 1.00 0.00 ? 128 GLU A OE2  4  
ATOM 8804  H H    . GLU A 1 128 ? 15.250  15.184  -14.044 1.00 0.00 ? 128 GLU A H    4  
ATOM 8805  H HA   . GLU A 1 128 ? 13.895  17.286  -15.623 1.00 0.00 ? 128 GLU A HA   4  
ATOM 8806  H HB2  . GLU A 1 128 ? 16.507  17.609  -13.980 1.00 0.00 ? 128 GLU A HB2  4  
ATOM 8807  H HB3  . GLU A 1 128 ? 15.932  18.789  -15.208 1.00 0.00 ? 128 GLU A HB3  4  
ATOM 8808  H HG2  . GLU A 1 128 ? 14.522  18.050  -12.564 1.00 0.00 ? 128 GLU A HG2  4  
ATOM 8809  H HG3  . GLU A 1 128 ? 15.490  19.528  -12.892 1.00 0.00 ? 128 GLU A HG3  4  
ATOM 8810  N N    . ARG A 1 129 ? 16.856  15.846  -15.995 1.00 0.00 ? 129 ARG A N    4  
ATOM 8811  C CA   . ARG A 1 129 ? 17.766  15.187  -16.915 1.00 0.00 ? 129 ARG A CA   4  
ATOM 8812  C C    . ARG A 1 129 ? 18.084  13.801  -16.349 1.00 0.00 ? 129 ARG A C    4  
ATOM 8813  O O    . ARG A 1 129 ? 18.933  13.707  -15.459 1.00 0.00 ? 129 ARG A O    4  
ATOM 8814  C CB   . ARG A 1 129 ? 19.071  16.006  -17.132 1.00 0.00 ? 129 ARG A CB   4  
ATOM 8815  C CG   . ARG A 1 129 ? 20.073  15.350  -18.109 1.00 0.00 ? 129 ARG A CG   4  
ATOM 8816  C CD   . ARG A 1 129 ? 21.362  16.161  -18.301 1.00 0.00 ? 129 ARG A CD   4  
ATOM 8817  N NE   . ARG A 1 129 ? 22.273  15.358  -19.193 1.00 0.00 ? 129 ARG A NE   4  
ATOM 8818  C CZ   . ARG A 1 129 ? 23.627  15.552  -19.269 1.00 0.00 ? 129 ARG A CZ   4  
ATOM 8819  N NH1  . ARG A 1 129 ? 24.235  16.538  -18.548 1.00 0.00 ? 129 ARG A NH1  4  
ATOM 8820  N NH2  . ARG A 1 129 ? 24.378  14.741  -20.070 1.00 0.00 ? 129 ARG A NH2  4  
ATOM 8821  H H    . ARG A 1 129 ? 17.196  15.932  -15.062 1.00 0.00 ? 129 ARG A H    4  
ATOM 8822  H HA   . ARG A 1 129 ? 17.327  15.086  -17.901 1.00 0.00 ? 129 ARG A HA   4  
ATOM 8823  H HB2  . ARG A 1 129 ? 18.791  17.003  -17.539 1.00 0.00 ? 129 ARG A HB2  4  
ATOM 8824  H HB3  . ARG A 1 129 ? 19.576  16.191  -16.158 1.00 0.00 ? 129 ARG A HB3  4  
ATOM 8825  H HG2  . ARG A 1 129 ? 20.374  14.353  -17.715 1.00 0.00 ? 129 ARG A HG2  4  
ATOM 8826  H HG3  . ARG A 1 129 ? 19.580  15.204  -19.094 1.00 0.00 ? 129 ARG A HG3  4  
ATOM 8827  H HD2  . ARG A 1 129 ? 21.149  17.136  -18.789 1.00 0.00 ? 129 ARG A HD2  4  
ATOM 8828  H HD3  . ARG A 1 129 ? 21.845  16.326  -17.312 1.00 0.00 ? 129 ARG A HD3  4  
ATOM 8829  H HE   . ARG A 1 129 ? 21.868  14.625  -19.741 1.00 0.00 ? 129 ARG A HE   4  
ATOM 8830  H HH11 . ARG A 1 129 ? 23.690  17.131  -17.954 1.00 0.00 ? 129 ARG A HH11 4  
ATOM 8831  H HH12 . ARG A 1 129 ? 25.226  16.660  -18.607 1.00 0.00 ? 129 ARG A HH12 4  
ATOM 8832  H HH21 . ARG A 1 129 ? 23.939  14.013  -20.597 1.00 0.00 ? 129 ARG A HH21 4  
ATOM 8833  H HH22 . ARG A 1 129 ? 25.368  14.872  -20.124 1.00 0.00 ? 129 ARG A HH22 4  
ATOM 8834  N N    . PRO A 1 130 ? 17.418  12.696  -16.775 1.00 0.00 ? 130 PRO A N    4  
ATOM 8835  C CA   . PRO A 1 130 ? 17.727  11.329  -16.356 1.00 0.00 ? 130 PRO A CA   4  
ATOM 8836  C C    . PRO A 1 130 ? 18.885  10.763  -17.182 1.00 0.00 ? 130 PRO A C    4  
ATOM 8837  O O    . PRO A 1 130 ? 20.027  10.810  -16.723 1.00 0.00 ? 130 PRO A O    4  
ATOM 8838  C CB   . PRO A 1 130 ? 16.384  10.598  -16.559 1.00 0.00 ? 130 PRO A CB   4  
ATOM 8839  C CG   . PRO A 1 130 ? 15.672  11.328  -17.707 1.00 0.00 ? 130 PRO A CG   4  
ATOM 8840  C CD   . PRO A 1 130 ? 16.248  12.750  -17.657 1.00 0.00 ? 130 PRO A CD   4  
ATOM 8841  H HA   . PRO A 1 130 ? 18.044  11.293  -15.324 1.00 0.00 ? 130 PRO A HA   4  
ATOM 8842  H HB2  . PRO A 1 130 ? 16.470  9.505   -16.720 1.00 0.00 ? 130 PRO A HB2  4  
ATOM 8843  H HB3  . PRO A 1 130 ? 15.776  10.748  -15.637 1.00 0.00 ? 130 PRO A HB3  4  
ATOM 8844  H HG2  . PRO A 1 130 ? 15.918  10.855  -18.682 1.00 0.00 ? 130 PRO A HG2  4  
ATOM 8845  H HG3  . PRO A 1 130 ? 14.569  11.308  -17.573 1.00 0.00 ? 130 PRO A HG3  4  
ATOM 8846  H HD2  . PRO A 1 130 ? 16.544  13.084  -18.674 1.00 0.00 ? 130 PRO A HD2  4  
ATOM 8847  H HD3  . PRO A 1 130 ? 15.478  13.439  -17.238 1.00 0.00 ? 130 PRO A HD3  4  
ATOM 8848  N N    . HIS A 1 131 ? 18.629  10.235  -18.402 1.00 0.00 ? 131 HIS A N    4  
ATOM 8849  C CA   . HIS A 1 131 ? 19.642  9.701   -19.293 1.00 0.00 ? 131 HIS A CA   4  
ATOM 8850  C C    . HIS A 1 131 ? 19.604  10.502  -20.587 1.00 0.00 ? 131 HIS A C    4  
ATOM 8851  O O    . HIS A 1 131 ? 18.835  10.195  -21.498 1.00 0.00 ? 131 HIS A O    4  
ATOM 8852  C CB   . HIS A 1 131 ? 19.414  8.190   -19.556 1.00 0.00 ? 131 HIS A CB   4  
ATOM 8853  C CG   . HIS A 1 131 ? 20.595  7.550   -20.230 1.00 0.00 ? 131 HIS A CG   4  
ATOM 8854  N ND1  . HIS A 1 131 ? 21.624  6.924   -19.558 1.00 0.00 ? 131 HIS A ND1  4  
ATOM 8855  C CD2  . HIS A 1 131 ? 20.969  7.585   -21.538 1.00 0.00 ? 131 HIS A CD2  4  
ATOM 8856  C CE1  . HIS A 1 131 ? 22.563  6.610   -20.484 1.00 0.00 ? 131 HIS A CE1  4  
ATOM 8857  N NE2  . HIS A 1 131 ? 22.209  6.996   -21.692 1.00 0.00 ? 131 HIS A NE2  4  
ATOM 8858  H H    . HIS A 1 131 ? 17.698  10.183  -18.759 1.00 0.00 ? 131 HIS A H    4  
ATOM 8859  H HA   . HIS A 1 131 ? 20.636  9.811   -18.873 1.00 0.00 ? 131 HIS A HA   4  
ATOM 8860  H HB2  . HIS A 1 131 ? 19.255  7.685   -18.577 1.00 0.00 ? 131 HIS A HB2  4  
ATOM 8861  H HB3  . HIS A 1 131 ? 18.495  8.027   -20.159 1.00 0.00 ? 131 HIS A HB3  4  
ATOM 8862  H HD1  . HIS A 1 131 ? 21.627  6.675   -18.578 1.00 0.00 ? 131 HIS A HD1  4  
ATOM 8863  H HD2  . HIS A 1 131 ? 20.466  8.023   -22.392 1.00 0.00 ? 131 HIS A HD2  4  
ATOM 8864  H HE1  . HIS A 1 131 ? 23.487  6.082   -20.250 1.00 0.00 ? 131 HIS A HE1  4  
ATOM 8865  N N    . ARG A 1 132 ? 20.420  11.585  -20.678 1.00 0.00 ? 132 ARG A N    4  
ATOM 8866  C CA   . ARG A 1 132 ? 20.591  12.481  -21.830 1.00 0.00 ? 132 ARG A CA   4  
ATOM 8867  C C    . ARG A 1 132 ? 19.460  13.483  -22.112 1.00 0.00 ? 132 ARG A C    4  
ATOM 8868  O O    . ARG A 1 132 ? 19.721  14.607  -22.537 1.00 0.00 ? 132 ARG A O    4  
ATOM 8869  C CB   . ARG A 1 132 ? 21.042  11.708  -23.105 1.00 0.00 ? 132 ARG A CB   4  
ATOM 8870  C CG   . ARG A 1 132 ? 21.651  12.573  -24.226 1.00 0.00 ? 132 ARG A CG   4  
ATOM 8871  C CD   . ARG A 1 132 ? 22.173  11.733  -25.401 1.00 0.00 ? 132 ARG A CD   4  
ATOM 8872  N NE   . ARG A 1 132 ? 22.731  12.666  -26.442 1.00 0.00 ? 132 ARG A NE   4  
ATOM 8873  C CZ   . ARG A 1 132 ? 23.268  12.231  -27.626 1.00 0.00 ? 132 ARG A CZ   4  
ATOM 8874  N NH1  . ARG A 1 132 ? 23.332  10.900  -27.919 1.00 0.00 ? 132 ARG A NH1  4  
ATOM 8875  N NH2  . ARG A 1 132 ? 23.743  13.145  -28.524 1.00 0.00 ? 132 ARG A NH2  4  
ATOM 8876  H H    . ARG A 1 132 ? 21.001  11.793  -19.897 1.00 0.00 ? 132 ARG A H    4  
ATOM 8877  H HA   . ARG A 1 132 ? 21.432  13.106  -21.564 1.00 0.00 ? 132 ARG A HA   4  
ATOM 8878  H HB2  . ARG A 1 132 ? 21.820  10.975  -22.791 1.00 0.00 ? 132 ARG A HB2  4  
ATOM 8879  H HB3  . ARG A 1 132 ? 20.190  11.122  -23.516 1.00 0.00 ? 132 ARG A HB3  4  
ATOM 8880  H HG2  . ARG A 1 132 ? 20.881  13.280  -24.605 1.00 0.00 ? 132 ARG A HG2  4  
ATOM 8881  H HG3  . ARG A 1 132 ? 22.488  13.171  -23.801 1.00 0.00 ? 132 ARG A HG3  4  
ATOM 8882  H HD2  . ARG A 1 132 ? 22.978  11.048  -25.054 1.00 0.00 ? 132 ARG A HD2  4  
ATOM 8883  H HD3  . ARG A 1 132 ? 21.341  11.145  -25.847 1.00 0.00 ? 132 ARG A HD3  4  
ATOM 8884  H HE   . ARG A 1 132 ? 22.703  13.649  -26.262 1.00 0.00 ? 132 ARG A HE   4  
ATOM 8885  H HH11 . ARG A 1 132 ? 22.988  10.228  -27.265 1.00 0.00 ? 132 ARG A HH11 4  
ATOM 8886  H HH12 . ARG A 1 132 ? 23.727  10.599  -28.787 1.00 0.00 ? 132 ARG A HH12 4  
ATOM 8887  H HH21 . ARG A 1 132 ? 23.697  14.121  -28.313 1.00 0.00 ? 132 ARG A HH21 4  
ATOM 8888  H HH22 . ARG A 1 132 ? 24.135  12.836  -29.391 1.00 0.00 ? 132 ARG A HH22 4  
ATOM 8889  N N    . ASP A 1 133 ? 18.176  13.073  -21.908 1.00 0.00 ? 133 ASP A N    4  
ATOM 8890  C CA   . ASP A 1 133 ? 16.931  13.829  -22.065 1.00 0.00 ? 133 ASP A CA   4  
ATOM 8891  C C    . ASP A 1 133 ? 16.583  14.199  -23.507 1.00 0.00 ? 133 ASP A C    4  
ATOM 8892  O O    . ASP A 1 133 ? 15.996  13.402  -24.239 1.00 0.00 ? 133 ASP A O    4  
ATOM 8893  C CB   . ASP A 1 133 ? 16.848  15.056  -21.095 1.00 0.00 ? 133 ASP A CB   4  
ATOM 8894  C CG   . ASP A 1 133 ? 15.408  15.500  -20.798 1.00 0.00 ? 133 ASP A CG   4  
ATOM 8895  O OD1  . ASP A 1 133 ? 14.626  14.663  -20.272 1.00 0.00 ? 133 ASP A OD1  4  
ATOM 8896  O OD2  . ASP A 1 133 ? 15.080  16.682  -21.086 1.00 0.00 ? 133 ASP A OD2  4  
ATOM 8897  H H    . ASP A 1 133 ? 18.070  12.122  -21.605 1.00 0.00 ? 133 ASP A H    4  
ATOM 8898  H HA   . ASP A 1 133 ? 16.164  13.130  -21.761 1.00 0.00 ? 133 ASP A HA   4  
ATOM 8899  H HB2  . ASP A 1 133 ? 17.303  14.754  -20.126 1.00 0.00 ? 133 ASP A HB2  4  
ATOM 8900  H HB3  . ASP A 1 133 ? 17.441  15.909  -21.484 1.00 0.00 ? 133 ASP A HB3  4  
ATOM 8901  N N    . GLY A 1 1   ? -14.607 29.908  26.778  1.00 0.00 ? 1   GLY A N    5  
ATOM 8902  C CA   . GLY A 1 1   ? -15.356 30.585  25.741  1.00 0.00 ? 1   GLY A CA   5  
ATOM 8903  C C    . GLY A 1 1   ? -15.876 29.584  24.759  1.00 0.00 ? 1   GLY A C    5  
ATOM 8904  O O    . GLY A 1 1   ? -16.536 29.916  23.774  1.00 0.00 ? 1   GLY A O    5  
ATOM 8905  H H    . GLY A 1 1   ? -14.365 30.424  27.601  1.00 0.00 ? 1   GLY A H    5  
ATOM 8906  H HA2  . GLY A 1 1   ? -16.203 31.074  26.196  1.00 0.00 ? 1   GLY A HA2  5  
ATOM 8907  H HA3  . GLY A 1 1   ? -14.687 31.249  25.217  1.00 0.00 ? 1   GLY A HA3  5  
ATOM 8908  N N    . SER A 1 2   ? -15.568 28.298  25.003  1.00 0.00 ? 2   SER A N    5  
ATOM 8909  C CA   . SER A 1 2   ? -15.955 27.139  24.213  1.00 0.00 ? 2   SER A CA   5  
ATOM 8910  C C    . SER A 1 2   ? -15.510 25.936  25.035  1.00 0.00 ? 2   SER A C    5  
ATOM 8911  O O    . SER A 1 2   ? -14.583 26.104  25.830  1.00 0.00 ? 2   SER A O    5  
ATOM 8912  C CB   . SER A 1 2   ? -15.319 27.102  22.790  1.00 0.00 ? 2   SER A CB   5  
ATOM 8913  O OG   . SER A 1 2   ? -15.953 28.053  21.939  1.00 0.00 ? 2   SER A OG   5  
ATOM 8914  H H    . SER A 1 2   ? -15.006 28.108  25.814  1.00 0.00 ? 2   SER A H    5  
ATOM 8915  H HA   . SER A 1 2   ? -17.035 27.130  24.144  1.00 0.00 ? 2   SER A HA   5  
ATOM 8916  H HB2  . SER A 1 2   ? -14.234 27.340  22.849  1.00 0.00 ? 2   SER A HB2  5  
ATOM 8917  H HB3  . SER A 1 2   ? -15.440 26.107  22.309  1.00 0.00 ? 2   SER A HB3  5  
ATOM 8918  H HG   . SER A 1 2   ? -16.192 28.824  22.500  1.00 0.00 ? 2   SER A HG   5  
ATOM 8919  N N    . PRO A 1 3   ? -16.094 24.717  24.940  1.00 0.00 ? 3   PRO A N    5  
ATOM 8920  C CA   . PRO A 1 3   ? -15.743 23.567  25.773  1.00 0.00 ? 3   PRO A CA   5  
ATOM 8921  C C    . PRO A 1 3   ? -14.458 22.849  25.334  1.00 0.00 ? 3   PRO A C    5  
ATOM 8922  O O    . PRO A 1 3   ? -13.996 22.990  24.198  1.00 0.00 ? 3   PRO A O    5  
ATOM 8923  C CB   . PRO A 1 3   ? -16.976 22.628  25.659  1.00 0.00 ? 3   PRO A CB   5  
ATOM 8924  C CG   . PRO A 1 3   ? -18.067 23.484  25.007  1.00 0.00 ? 3   PRO A CG   5  
ATOM 8925  C CD   . PRO A 1 3   ? -17.237 24.389  24.104  1.00 0.00 ? 3   PRO A CD   5  
ATOM 8926  H HA   . PRO A 1 3   ? -15.614 23.891  26.798  1.00 0.00 ? 3   PRO A HA   5  
ATOM 8927  H HB2  . PRO A 1 3   ? -16.793 21.770  24.952  1.00 0.00 ? 3   PRO A HB2  5  
ATOM 8928  H HB3  . PRO A 1 3   ? -17.300 22.283  26.676  1.00 0.00 ? 3   PRO A HB3  5  
ATOM 8929  H HG2  . PRO A 1 3   ? -18.808 22.875  24.450  1.00 0.00 ? 3   PRO A HG2  5  
ATOM 8930  H HG3  . PRO A 1 3   ? -18.589 24.093  25.779  1.00 0.00 ? 3   PRO A HG3  5  
ATOM 8931  H HD2  . PRO A 1 3   ? -16.831 23.775  23.270  1.00 0.00 ? 3   PRO A HD2  5  
ATOM 8932  H HD3  . PRO A 1 3   ? -17.820 25.253  23.719  1.00 0.00 ? 3   PRO A HD3  5  
ATOM 8933  N N    . GLU A 1 4   ? -13.887 22.051  26.265  1.00 0.00 ? 4   GLU A N    5  
ATOM 8934  C CA   . GLU A 1 4   ? -12.694 21.190  26.151  1.00 0.00 ? 4   GLU A CA   5  
ATOM 8935  C C    . GLU A 1 4   ? -11.350 21.879  25.906  1.00 0.00 ? 4   GLU A C    5  
ATOM 8936  O O    . GLU A 1 4   ? -10.388 21.619  26.622  1.00 0.00 ? 4   GLU A O    5  
ATOM 8937  C CB   . GLU A 1 4   ? -12.884 20.037  25.112  1.00 0.00 ? 4   GLU A CB   5  
ATOM 8938  C CG   . GLU A 1 4   ? -14.100 19.127  25.391  1.00 0.00 ? 4   GLU A CG   5  
ATOM 8939  C CD   . GLU A 1 4   ? -13.954 18.432  26.745  1.00 0.00 ? 4   GLU A CD   5  
ATOM 8940  O OE1  . GLU A 1 4   ? -12.979 17.651  26.908  1.00 0.00 ? 4   GLU A OE1  5  
ATOM 8941  O OE2  . GLU A 1 4   ? -14.817 18.672  27.632  1.00 0.00 ? 4   GLU A OE2  5  
ATOM 8942  H H    . GLU A 1 4   ? -14.392 22.041  27.120  1.00 0.00 ? 4   GLU A H    5  
ATOM 8943  H HA   . GLU A 1 4   ? -12.544 20.701  27.107  1.00 0.00 ? 4   GLU A HA   5  
ATOM 8944  H HB2  . GLU A 1 4   ? -13.020 20.470  24.096  1.00 0.00 ? 4   GLU A HB2  5  
ATOM 8945  H HB3  . GLU A 1 4   ? -11.980 19.389  25.076  1.00 0.00 ? 4   GLU A HB3  5  
ATOM 8946  H HG2  . GLU A 1 4   ? -15.034 19.726  25.373  1.00 0.00 ? 4   GLU A HG2  5  
ATOM 8947  H HG3  . GLU A 1 4   ? -14.169 18.355  24.595  1.00 0.00 ? 4   GLU A HG3  5  
ATOM 8948  N N    . PHE A 1 5   ? -11.290 22.724  24.835  1.00 0.00 ? 5   PHE A N    5  
ATOM 8949  C CA   . PHE A 1 5   ? -10.142 23.438  24.271  1.00 0.00 ? 5   PHE A CA   5  
ATOM 8950  C C    . PHE A 1 5   ? -9.322  22.458  23.413  1.00 0.00 ? 5   PHE A C    5  
ATOM 8951  O O    . PHE A 1 5   ? -8.208  22.071  23.739  1.00 0.00 ? 5   PHE A O    5  
ATOM 8952  C CB   . PHE A 1 5   ? -9.313  24.235  25.334  1.00 0.00 ? 5   PHE A CB   5  
ATOM 8953  C CG   . PHE A 1 5   ? -8.279  25.172  24.733  1.00 0.00 ? 5   PHE A CG   5  
ATOM 8954  C CD1  . PHE A 1 5   ? -8.664  26.272  23.979  1.00 0.00 ? 5   PHE A CD1  5  
ATOM 8955  C CD2  . PHE A 1 5   ? -6.924  24.947  24.925  1.00 0.00 ? 5   PHE A CD2  5  
ATOM 8956  C CE1  . PHE A 1 5   ? -7.720  27.117  23.426  1.00 0.00 ? 5   PHE A CE1  5  
ATOM 8957  C CE2  . PHE A 1 5   ? -5.983  25.798  24.385  1.00 0.00 ? 5   PHE A CE2  5  
ATOM 8958  C CZ   . PHE A 1 5   ? -6.376  26.878  23.626  1.00 0.00 ? 5   PHE A CZ   5  
ATOM 8959  H H    . PHE A 1 5   ? -12.166 22.867  24.354  1.00 0.00 ? 5   PHE A H    5  
ATOM 8960  H HA   . PHE A 1 5   ? -10.577 24.157  23.590  1.00 0.00 ? 5   PHE A HA   5  
ATOM 8961  H HB2  . PHE A 1 5   ? -10.011 24.858  25.936  1.00 0.00 ? 5   PHE A HB2  5  
ATOM 8962  H HB3  . PHE A 1 5   ? -8.820  23.531  26.041  1.00 0.00 ? 5   PHE A HB3  5  
ATOM 8963  H HD1  . PHE A 1 5   ? -9.710  26.491  23.818  1.00 0.00 ? 5   PHE A HD1  5  
ATOM 8964  H HD2  . PHE A 1 5   ? -6.576  24.093  25.492  1.00 0.00 ? 5   PHE A HD2  5  
ATOM 8965  H HE1  . PHE A 1 5   ? -8.034  27.982  22.854  1.00 0.00 ? 5   PHE A HE1  5  
ATOM 8966  H HE2  . PHE A 1 5   ? -4.931  25.611  24.558  1.00 0.00 ? 5   PHE A HE2  5  
ATOM 8967  H HZ   . PHE A 1 5   ? -5.634  27.542  23.202  1.00 0.00 ? 5   PHE A HZ   5  
ATOM 8968  N N    . ARG A 1 6   ? -9.909  21.988  22.285  1.00 0.00 ? 6   ARG A N    5  
ATOM 8969  C CA   . ARG A 1 6   ? -9.440  20.916  21.415  1.00 0.00 ? 6   ARG A CA   5  
ATOM 8970  C C    . ARG A 1 6   ? -8.565  21.343  20.242  1.00 0.00 ? 6   ARG A C    5  
ATOM 8971  O O    . ARG A 1 6   ? -8.515  20.702  19.199  1.00 0.00 ? 6   ARG A O    5  
ATOM 8972  C CB   . ARG A 1 6   ? -10.721 20.197  20.920  1.00 0.00 ? 6   ARG A CB   5  
ATOM 8973  C CG   . ARG A 1 6   ? -10.576 18.801  20.281  1.00 0.00 ? 6   ARG A CG   5  
ATOM 8974  C CD   . ARG A 1 6   ? -9.932  17.749  21.193  1.00 0.00 ? 6   ARG A CD   5  
ATOM 8975  N NE   . ARG A 1 6   ? -10.064 16.417  20.513  1.00 0.00 ? 6   ARG A NE   5  
ATOM 8976  C CZ   . ARG A 1 6   ? -9.407  15.289  20.922  1.00 0.00 ? 6   ARG A CZ   5  
ATOM 8977  N NH1  . ARG A 1 6   ? -8.484  15.332  21.925  1.00 0.00 ? 6   ARG A NH1  5  
ATOM 8978  N NH2  . ARG A 1 6   ? -9.692  14.101  20.313  1.00 0.00 ? 6   ARG A NH2  5  
ATOM 8979  H H    . ARG A 1 6   ? -10.814 22.320  22.043  1.00 0.00 ? 6   ARG A H    5  
ATOM 8980  H HA   . ARG A 1 6   ? -8.860  20.217  22.004  1.00 0.00 ? 6   ARG A HA   5  
ATOM 8981  H HB2  . ARG A 1 6   ? -11.371 20.078  21.815  1.00 0.00 ? 6   ARG A HB2  5  
ATOM 8982  H HB3  . ARG A 1 6   ? -11.263 20.863  20.214  1.00 0.00 ? 6   ARG A HB3  5  
ATOM 8983  H HG2  . ARG A 1 6   ? -11.598 18.461  20.001  1.00 0.00 ? 6   ARG A HG2  5  
ATOM 8984  H HG3  . ARG A 1 6   ? -9.988  18.885  19.342  1.00 0.00 ? 6   ARG A HG3  5  
ATOM 8985  H HD2  . ARG A 1 6   ? -8.859  17.986  21.351  1.00 0.00 ? 6   ARG A HD2  5  
ATOM 8986  H HD3  . ARG A 1 6   ? -10.463 17.703  22.168  1.00 0.00 ? 6   ARG A HD3  5  
ATOM 8987  H HE   . ARG A 1 6   ? -10.725 16.336  19.767  1.00 0.00 ? 6   ARG A HE   5  
ATOM 8988  H HH11 . ARG A 1 6   ? -8.274  16.202  22.374  1.00 0.00 ? 6   ARG A HH11 5  
ATOM 8989  H HH12 . ARG A 1 6   ? -8.013  14.496  22.209  1.00 0.00 ? 6   ARG A HH12 5  
ATOM 8990  H HH21 . ARG A 1 6   ? -10.370 14.068  19.578  1.00 0.00 ? 6   ARG A HH21 5  
ATOM 8991  H HH22 . ARG A 1 6   ? -9.221  13.267  20.598  1.00 0.00 ? 6   ARG A HH22 5  
ATOM 8992  N N    . TRP A 1 7   ? -7.812  22.452  20.413  1.00 0.00 ? 7   TRP A N    5  
ATOM 8993  C CA   . TRP A 1 7   ? -6.870  23.119  19.516  1.00 0.00 ? 7   TRP A CA   5  
ATOM 8994  C C    . TRP A 1 7   ? -5.822  22.244  18.785  1.00 0.00 ? 7   TRP A C    5  
ATOM 8995  O O    . TRP A 1 7   ? -6.005  21.857  17.636  1.00 0.00 ? 7   TRP A O    5  
ATOM 8996  C CB   . TRP A 1 7   ? -6.216  24.286  20.326  1.00 0.00 ? 7   TRP A CB   5  
ATOM 8997  C CG   . TRP A 1 7   ? -5.322  23.931  21.528  1.00 0.00 ? 7   TRP A CG   5  
ATOM 8998  C CD1  . TRP A 1 7   ? -5.365  22.883  22.406  1.00 0.00 ? 7   TRP A CD1  5  
ATOM 8999  C CD2  . TRP A 1 7   ? -4.099  24.624  21.800  1.00 0.00 ? 7   TRP A CD2  5  
ATOM 9000  N NE1  . TRP A 1 7   ? -4.209  22.837  23.146  1.00 0.00 ? 7   TRP A NE1  5  
ATOM 9001  C CE2  . TRP A 1 7   ? -3.431  23.921  22.800  1.00 0.00 ? 7   TRP A CE2  5  
ATOM 9002  C CE3  . TRP A 1 7   ? -3.576  25.747  21.240  1.00 0.00 ? 7   TRP A CE3  5  
ATOM 9003  C CZ2  . TRP A 1 7   ? -2.214  24.337  23.255  1.00 0.00 ? 7   TRP A CZ2  5  
ATOM 9004  C CZ3  . TRP A 1 7   ? -2.336  26.163  21.681  1.00 0.00 ? 7   TRP A CZ3  5  
ATOM 9005  C CH2  . TRP A 1 7   ? -1.664  25.464  22.671  1.00 0.00 ? 7   TRP A CH2  5  
ATOM 9006  H H    . TRP A 1 7   ? -7.918  22.908  21.289  1.00 0.00 ? 7   TRP A H    5  
ATOM 9007  H HA   . TRP A 1 7   ? -7.467  23.562  18.730  1.00 0.00 ? 7   TRP A HA   5  
ATOM 9008  H HB2  . TRP A 1 7   ? -5.644  24.930  19.623  1.00 0.00 ? 7   TRP A HB2  5  
ATOM 9009  H HB3  . TRP A 1 7   ? -7.037  24.919  20.727  1.00 0.00 ? 7   TRP A HB3  5  
ATOM 9010  H HD1  . TRP A 1 7   ? -6.163  22.165  22.475  1.00 0.00 ? 7   TRP A HD1  5  
ATOM 9011  H HE1  . TRP A 1 7   ? -3.972  22.117  23.767  1.00 0.00 ? 7   TRP A HE1  5  
ATOM 9012  H HE3  . TRP A 1 7   ? -4.140  26.276  20.487  1.00 0.00 ? 7   TRP A HE3  5  
ATOM 9013  H HZ2  . TRP A 1 7   ? -1.685  23.804  24.032  1.00 0.00 ? 7   TRP A HZ2  5  
ATOM 9014  H HZ3  . TRP A 1 7   ? -1.880  27.047  21.252  1.00 0.00 ? 7   TRP A HZ3  5  
ATOM 9015  H HH2  . TRP A 1 7   ? -0.694  25.812  22.999  1.00 0.00 ? 7   TRP A HH2  5  
ATOM 9016  N N    . THR A 1 8   ? -4.709  21.895  19.479  1.00 0.00 ? 8   THR A N    5  
ATOM 9017  C CA   . THR A 1 8   ? -3.615  21.039  19.039  1.00 0.00 ? 8   THR A CA   5  
ATOM 9018  C C    . THR A 1 8   ? -3.807  19.651  19.616  1.00 0.00 ? 8   THR A C    5  
ATOM 9019  O O    . THR A 1 8   ? -3.111  18.726  19.217  1.00 0.00 ? 8   THR A O    5  
ATOM 9020  C CB   . THR A 1 8   ? -2.194  21.589  19.290  1.00 0.00 ? 8   THR A CB   5  
ATOM 9021  O OG1  . THR A 1 8   ? -1.218  20.976  18.450  1.00 0.00 ? 8   THR A OG1  5  
ATOM 9022  C CG2  . THR A 1 8   ? -1.715  21.414  20.742  1.00 0.00 ? 8   THR A CG2  5  
ATOM 9023  H H    . THR A 1 8   ? -4.604  22.260  20.401  1.00 0.00 ? 8   THR A H    5  
ATOM 9024  H HA   . THR A 1 8   ? -3.689  20.922  17.963  1.00 0.00 ? 8   THR A HA   5  
ATOM 9025  H HB   . THR A 1 8   ? -2.203  22.676  19.042  1.00 0.00 ? 8   THR A HB   5  
ATOM 9026  H HG1  . THR A 1 8   ? -1.399  20.029  18.518  1.00 0.00 ? 8   THR A HG1  5  
ATOM 9027  H HG21 . THR A 1 8   ? -2.462  21.823  21.450  1.00 0.00 ? 8   THR A HG21 5  
ATOM 9028  H HG22 . THR A 1 8   ? -1.529  20.347  20.988  1.00 0.00 ? 8   THR A HG22 5  
ATOM 9029  H HG23 . THR A 1 8   ? -0.760  21.963  20.885  1.00 0.00 ? 8   THR A HG23 5  
ATOM 9030  N N    . LYS A 1 9   ? -4.727  19.447  20.609  1.00 0.00 ? 9   LYS A N    5  
ATOM 9031  C CA   . LYS A 1 9   ? -4.983  18.211  21.372  1.00 0.00 ? 9   LYS A CA   5  
ATOM 9032  C C    . LYS A 1 9   ? -5.166  16.905  20.614  1.00 0.00 ? 9   LYS A C    5  
ATOM 9033  O O    . LYS A 1 9   ? -4.804  15.841  21.111  1.00 0.00 ? 9   LYS A O    5  
ATOM 9034  C CB   . LYS A 1 9   ? -6.058  18.360  22.474  1.00 0.00 ? 9   LYS A CB   5  
ATOM 9035  C CG   . LYS A 1 9   ? -5.606  19.302  23.592  1.00 0.00 ? 9   LYS A CG   5  
ATOM 9036  C CD   . LYS A 1 9   ? -6.635  19.407  24.722  1.00 0.00 ? 9   LYS A CD   5  
ATOM 9037  C CE   . LYS A 1 9   ? -6.207  20.397  25.815  1.00 0.00 ? 9   LYS A CE   5  
ATOM 9038  N NZ   . LYS A 1 9   ? -7.250  20.516  26.861  1.00 0.00 ? 9   LYS A NZ   5  
ATOM 9039  H H    . LYS A 1 9   ? -5.274  20.226  20.897  1.00 0.00 ? 9   LYS A H    5  
ATOM 9040  H HA   . LYS A 1 9   ? -4.016  18.047  21.851  1.00 0.00 ? 9   LYS A HA   5  
ATOM 9041  H HB2  . LYS A 1 9   ? -6.997  18.743  22.022  1.00 0.00 ? 9   LYS A HB2  5  
ATOM 9042  H HB3  . LYS A 1 9   ? -6.288  17.381  22.960  1.00 0.00 ? 9   LYS A HB3  5  
ATOM 9043  H HG2  . LYS A 1 9   ? -4.644  18.945  24.017  1.00 0.00 ? 9   LYS A HG2  5  
ATOM 9044  H HG3  . LYS A 1 9   ? -5.420  20.303  23.158  1.00 0.00 ? 9   LYS A HG3  5  
ATOM 9045  H HD2  . LYS A 1 9   ? -7.610  19.735  24.295  1.00 0.00 ? 9   LYS A HD2  5  
ATOM 9046  H HD3  . LYS A 1 9   ? -6.778  18.400  25.171  1.00 0.00 ? 9   LYS A HD3  5  
ATOM 9047  H HE2  . LYS A 1 9   ? -5.271  20.056  26.304  1.00 0.00 ? 9   LYS A HE2  5  
ATOM 9048  H HE3  . LYS A 1 9   ? -6.049  21.407  25.382  1.00 0.00 ? 9   LYS A HE3  5  
ATOM 9049  H HZ1  . LYS A 1 9   ? -8.135  20.854  26.431  1.00 0.00 ? 9   LYS A HZ1  5  
ATOM 9050  H HZ2  . LYS A 1 9   ? -7.409  19.586  27.297  1.00 0.00 ? 9   LYS A HZ2  5  
ATOM 9051  H HZ3  . LYS A 1 9   ? -6.937  21.190  27.587  1.00 0.00 ? 9   LYS A HZ3  5  
ATOM 9052  N N    . GLU A 1 10  ? -5.647  16.961  19.336  1.00 0.00 ? 10  GLU A N    5  
ATOM 9053  C CA   . GLU A 1 10  ? -5.680  15.867  18.344  1.00 0.00 ? 10  GLU A CA   5  
ATOM 9054  C C    . GLU A 1 10  ? -4.300  15.206  18.042  1.00 0.00 ? 10  GLU A C    5  
ATOM 9055  O O    . GLU A 1 10  ? -4.216  14.083  17.544  1.00 0.00 ? 10  GLU A O    5  
ATOM 9056  C CB   . GLU A 1 10  ? -6.362  16.323  17.031  1.00 0.00 ? 10  GLU A CB   5  
ATOM 9057  C CG   . GLU A 1 10  ? -7.797  16.840  17.263  1.00 0.00 ? 10  GLU A CG   5  
ATOM 9058  C CD   . GLU A 1 10  ? -8.419  17.275  15.937  1.00 0.00 ? 10  GLU A CD   5  
ATOM 9059  O OE1  . GLU A 1 10  ? -8.573  16.405  15.039  1.00 0.00 ? 10  GLU A OE1  5  
ATOM 9060  O OE2  . GLU A 1 10  ? -8.752  18.484  15.808  1.00 0.00 ? 10  GLU A OE2  5  
ATOM 9061  H H    . GLU A 1 10  ? -5.944  17.863  19.009  1.00 0.00 ? 10  GLU A H    5  
ATOM 9062  H HA   . GLU A 1 10  ? -6.298  15.082  18.762  1.00 0.00 ? 10  GLU A HA   5  
ATOM 9063  H HB2  . GLU A 1 10  ? -5.757  17.135  16.567  1.00 0.00 ? 10  GLU A HB2  5  
ATOM 9064  H HB3  . GLU A 1 10  ? -6.412  15.474  16.310  1.00 0.00 ? 10  GLU A HB3  5  
ATOM 9065  H HG2  . GLU A 1 10  ? -8.416  16.031  17.710  1.00 0.00 ? 10  GLU A HG2  5  
ATOM 9066  H HG3  . GLU A 1 10  ? -7.791  17.702  17.963  1.00 0.00 ? 10  GLU A HG3  5  
ATOM 9067  N N    . GLU A 1 11  ? -3.183  15.878  18.462  1.00 0.00 ? 11  GLU A N    5  
ATOM 9068  C CA   . GLU A 1 11  ? -1.791  15.435  18.575  1.00 0.00 ? 11  GLU A CA   5  
ATOM 9069  C C    . GLU A 1 11  ? -1.604  14.361  19.651  1.00 0.00 ? 11  GLU A C    5  
ATOM 9070  O O    . GLU A 1 11  ? -0.716  13.533  19.524  1.00 0.00 ? 11  GLU A O    5  
ATOM 9071  C CB   . GLU A 1 11  ? -0.833  16.615  18.844  1.00 0.00 ? 11  GLU A CB   5  
ATOM 9072  C CG   . GLU A 1 11  ? -0.345  17.255  17.521  1.00 0.00 ? 11  GLU A CG   5  
ATOM 9073  C CD   . GLU A 1 11  ? -1.449  17.617  16.518  1.00 0.00 ? 11  GLU A CD   5  
ATOM 9074  O OE1  . GLU A 1 11  ? -1.978  18.756  16.588  1.00 0.00 ? 11  GLU A OE1  5  
ATOM 9075  O OE2  . GLU A 1 11  ? -1.754  16.763  15.643  1.00 0.00 ? 11  GLU A OE2  5  
ATOM 9076  H H    . GLU A 1 11  ? -3.299  16.796  18.833  1.00 0.00 ? 11  GLU A H    5  
ATOM 9077  H HA   . GLU A 1 11  ? -1.455  15.004  17.631  1.00 0.00 ? 11  GLU A HA   5  
ATOM 9078  H HB2  . GLU A 1 11  ? -1.283  17.336  19.575  1.00 0.00 ? 11  GLU A HB2  5  
ATOM 9079  H HB3  . GLU A 1 11  ? 0.120   16.272  19.317  1.00 0.00 ? 11  GLU A HB3  5  
ATOM 9080  H HG2  . GLU A 1 11  ? 0.207   18.177  17.799  1.00 0.00 ? 11  GLU A HG2  5  
ATOM 9081  H HG3  . GLU A 1 11  ? 0.330   16.506  17.021  1.00 0.00 ? 11  GLU A HG3  5  
ATOM 9082  N N    . GLU A 1 12  ? -2.445  14.331  20.733  1.00 0.00 ? 12  GLU A N    5  
ATOM 9083  C CA   . GLU A 1 12  ? -2.428  13.335  21.815  1.00 0.00 ? 12  GLU A CA   5  
ATOM 9084  C C    . GLU A 1 12  ? -2.959  11.970  21.355  1.00 0.00 ? 12  GLU A C    5  
ATOM 9085  O O    . GLU A 1 12  ? -2.357  10.934  21.608  1.00 0.00 ? 12  GLU A O    5  
ATOM 9086  C CB   . GLU A 1 12  ? -3.187  13.864  23.058  1.00 0.00 ? 12  GLU A CB   5  
ATOM 9087  C CG   . GLU A 1 12  ? -3.000  13.022  24.336  1.00 0.00 ? 12  GLU A CG   5  
ATOM 9088  C CD   . GLU A 1 12  ? -3.715  13.703  25.504  1.00 0.00 ? 12  GLU A CD   5  
ATOM 9089  O OE1  . GLU A 1 12  ? -3.313  14.841  25.866  1.00 0.00 ? 12  GLU A OE1  5  
ATOM 9090  O OE2  . GLU A 1 12  ? -4.672  13.091  26.050  1.00 0.00 ? 12  GLU A OE2  5  
ATOM 9091  H H    . GLU A 1 12  ? -3.177  15.022  20.815  1.00 0.00 ? 12  GLU A H    5  
ATOM 9092  H HA   . GLU A 1 12  ? -1.397  13.178  22.110  1.00 0.00 ? 12  GLU A HA   5  
ATOM 9093  H HB2  . GLU A 1 12  ? -2.803  14.889  23.262  1.00 0.00 ? 12  GLU A HB2  5  
ATOM 9094  H HB3  . GLU A 1 12  ? -4.271  13.961  22.831  1.00 0.00 ? 12  GLU A HB3  5  
ATOM 9095  H HG2  . GLU A 1 12  ? -3.416  12.003  24.190  1.00 0.00 ? 12  GLU A HG2  5  
ATOM 9096  H HG3  . GLU A 1 12  ? -1.917  12.932  24.572  1.00 0.00 ? 12  GLU A HG3  5  
ATOM 9097  N N    . GLU A 1 13  ? -4.079  11.977  20.580  1.00 0.00 ? 13  GLU A N    5  
ATOM 9098  C CA   . GLU A 1 13  ? -4.696  10.847  19.865  1.00 0.00 ? 13  GLU A CA   5  
ATOM 9099  C C    . GLU A 1 13  ? -3.823  10.166  18.784  1.00 0.00 ? 13  GLU A C    5  
ATOM 9100  O O    . GLU A 1 13  ? -3.848  8.948   18.613  1.00 0.00 ? 13  GLU A O    5  
ATOM 9101  C CB   . GLU A 1 13  ? -6.030  11.299  19.209  1.00 0.00 ? 13  GLU A CB   5  
ATOM 9102  C CG   . GLU A 1 13  ? -6.977  12.076  20.146  1.00 0.00 ? 13  GLU A CG   5  
ATOM 9103  C CD   . GLU A 1 13  ? -7.290  11.269  21.405  1.00 0.00 ? 13  GLU A CD   5  
ATOM 9104  O OE1  . GLU A 1 13  ? -7.887  10.167  21.272  1.00 0.00 ? 13  GLU A OE1  5  
ATOM 9105  O OE2  . GLU A 1 13  ? -6.944  11.749  22.519  1.00 0.00 ? 13  GLU A OE2  5  
ATOM 9106  H H    . GLU A 1 13  ? -4.544  12.856  20.477  1.00 0.00 ? 13  GLU A H    5  
ATOM 9107  H HA   . GLU A 1 13  ? -4.917  10.074  20.583  1.00 0.00 ? 13  GLU A HA   5  
ATOM 9108  H HB2  . GLU A 1 13  ? -5.820  11.977  18.348  1.00 0.00 ? 13  GLU A HB2  5  
ATOM 9109  H HB3  . GLU A 1 13  ? -6.577  10.408  18.820  1.00 0.00 ? 13  GLU A HB3  5  
ATOM 9110  H HG2  . GLU A 1 13  ? -6.480  13.043  20.446  1.00 0.00 ? 13  GLU A HG2  5  
ATOM 9111  H HG3  . GLU A 1 13  ? -7.944  12.232  19.585  1.00 0.00 ? 13  GLU A HG3  5  
ATOM 9112  N N    . THR A 1 14  ? -3.037  10.983  18.033  1.00 0.00 ? 14  THR A N    5  
ATOM 9113  C CA   . THR A 1 14  ? -2.037  10.660  17.025  1.00 0.00 ? 14  THR A CA   5  
ATOM 9114  C C    . THR A 1 14  ? -0.674  10.223  17.571  1.00 0.00 ? 14  THR A C    5  
ATOM 9115  O O    . THR A 1 14  ? 0.042   9.481   16.908  1.00 0.00 ? 14  THR A O    5  
ATOM 9116  C CB   . THR A 1 14  ? -1.971  11.728  15.951  1.00 0.00 ? 14  THR A CB   5  
ATOM 9117  O OG1  . THR A 1 14  ? -1.939  13.044  16.478  1.00 0.00 ? 14  THR A OG1  5  
ATOM 9118  C CG2  . THR A 1 14  ? -3.249  11.619  15.114  1.00 0.00 ? 14  THR A CG2  5  
ATOM 9119  H H    . THR A 1 14  ? -3.039  11.968  18.154  1.00 0.00 ? 14  THR A H    5  
ATOM 9120  H HA   . THR A 1 14  ? -2.371  9.785   16.482  1.00 0.00 ? 14  THR A HA   5  
ATOM 9121  H HB   . THR A 1 14  ? -1.102  11.589  15.288  1.00 0.00 ? 14  THR A HB   5  
ATOM 9122  H HG1  . THR A 1 14  ? -2.873  13.302  16.599  1.00 0.00 ? 14  THR A HG1  5  
ATOM 9123  H HG21 . THR A 1 14  ? -4.146  11.742  15.761  1.00 0.00 ? 14  THR A HG21 5  
ATOM 9124  H HG22 . THR A 1 14  ? -3.247  12.398  14.324  1.00 0.00 ? 14  THR A HG22 5  
ATOM 9125  H HG23 . THR A 1 14  ? -3.301  10.623  14.631  1.00 0.00 ? 14  THR A HG23 5  
ATOM 9126  N N    . ARG A 1 15  ? -0.270  10.710  18.785  1.00 0.00 ? 15  ARG A N    5  
ATOM 9127  C CA   . ARG A 1 15  ? 0.960   10.467  19.564  1.00 0.00 ? 15  ARG A CA   5  
ATOM 9128  C C    . ARG A 1 15  ? 1.502   9.031   19.609  1.00 0.00 ? 15  ARG A C    5  
ATOM 9129  O O    . ARG A 1 15  ? 0.766   8.096   19.900  1.00 0.00 ? 15  ARG A O    5  
ATOM 9130  C CB   . ARG A 1 15  ? 0.765   10.980  21.017  1.00 0.00 ? 15  ARG A CB   5  
ATOM 9131  C CG   . ARG A 1 15  ? 2.026   11.151  21.882  1.00 0.00 ? 15  ARG A CG   5  
ATOM 9132  C CD   . ARG A 1 15  ? 1.701   11.841  23.215  1.00 0.00 ? 15  ARG A CD   5  
ATOM 9133  N NE   . ARG A 1 15  ? 2.976   12.018  23.994  1.00 0.00 ? 15  ARG A NE   5  
ATOM 9134  C CZ   . ARG A 1 15  ? 3.023   12.640  25.214  1.00 0.00 ? 15  ARG A CZ   5  
ATOM 9135  N NH1  . ARG A 1 15  ? 1.891   13.144  25.787  1.00 0.00 ? 15  ARG A NH1  5  
ATOM 9136  N NH2  . ARG A 1 15  ? 4.218   12.755  25.864  1.00 0.00 ? 15  ARG A NH2  5  
ATOM 9137  H H    . ARG A 1 15  ? -0.886  11.337  19.258  1.00 0.00 ? 15  ARG A H    5  
ATOM 9138  H HA   . ARG A 1 15  ? 1.715   11.087  19.111  1.00 0.00 ? 15  ARG A HA   5  
ATOM 9139  H HB2  . ARG A 1 15  ? 0.309   11.991  20.949  1.00 0.00 ? 15  ARG A HB2  5  
ATOM 9140  H HB3  . ARG A 1 15  ? 0.026   10.341  21.550  1.00 0.00 ? 15  ARG A HB3  5  
ATOM 9141  H HG2  . ARG A 1 15  ? 2.484   10.160  22.089  1.00 0.00 ? 15  ARG A HG2  5  
ATOM 9142  H HG3  . ARG A 1 15  ? 2.761   11.772  21.323  1.00 0.00 ? 15  ARG A HG3  5  
ATOM 9143  H HD2  . ARG A 1 15  ? 1.250   12.840  23.023  1.00 0.00 ? 15  ARG A HD2  5  
ATOM 9144  H HD3  . ARG A 1 15  ? 0.997   11.216  23.807  1.00 0.00 ? 15  ARG A HD3  5  
ATOM 9145  H HE   . ARG A 1 15  ? 3.826   11.664  23.604  1.00 0.00 ? 15  ARG A HE   5  
ATOM 9146  H HH11 . ARG A 1 15  ? 1.014   13.064  25.314  1.00 0.00 ? 15  ARG A HH11 5  
ATOM 9147  H HH12 . ARG A 1 15  ? 1.939   13.595  26.678  1.00 0.00 ? 15  ARG A HH12 5  
ATOM 9148  H HH21 . ARG A 1 15  ? 5.050   12.388  25.449  1.00 0.00 ? 15  ARG A HH21 5  
ATOM 9149  H HH22 . ARG A 1 15  ? 4.260   13.208  26.755  1.00 0.00 ? 15  ARG A HH22 5  
ATOM 9150  N N    . GLN A 1 16  ? 2.813   8.882   19.260  1.00 0.00 ? 16  GLN A N    5  
ATOM 9151  C CA   . GLN A 1 16  ? 3.629   7.678   19.080  1.00 0.00 ? 16  GLN A CA   5  
ATOM 9152  C C    . GLN A 1 16  ? 4.145   7.744   17.653  1.00 0.00 ? 16  GLN A C    5  
ATOM 9153  O O    . GLN A 1 16  ? 5.293   7.399   17.369  1.00 0.00 ? 16  GLN A O    5  
ATOM 9154  C CB   . GLN A 1 16  ? 3.004   6.296   19.440  1.00 0.00 ? 16  GLN A CB   5  
ATOM 9155  C CG   . GLN A 1 16  ? 3.978   5.098   19.576  1.00 0.00 ? 16  GLN A CG   5  
ATOM 9156  C CD   . GLN A 1 16  ? 4.186   4.313   18.279  1.00 0.00 ? 16  GLN A CD   5  
ATOM 9157  O OE1  . GLN A 1 16  ? 3.441   3.384   17.966  1.00 0.00 ? 16  GLN A OE1  5  
ATOM 9158  N NE2  . GLN A 1 16  ? 5.241   4.662   17.512  1.00 0.00 ? 16  GLN A NE2  5  
ATOM 9159  H H    . GLN A 1 16  ? 3.328   9.707   19.046  1.00 0.00 ? 16  GLN A H    5  
ATOM 9160  H HA   . GLN A 1 16  ? 4.489   7.808   19.719  1.00 0.00 ? 16  GLN A HA   5  
ATOM 9161  H HB2  . GLN A 1 16  ? 2.548   6.421   20.452  1.00 0.00 ? 16  GLN A HB2  5  
ATOM 9162  H HB3  . GLN A 1 16  ? 2.163   6.054   18.758  1.00 0.00 ? 16  GLN A HB3  5  
ATOM 9163  H HG2  . GLN A 1 16  ? 4.951   5.427   19.989  1.00 0.00 ? 16  GLN A HG2  5  
ATOM 9164  H HG3  . GLN A 1 16  ? 3.527   4.381   20.301  1.00 0.00 ? 16  GLN A HG3  5  
ATOM 9165  H HE21 . GLN A 1 16  ? 5.546   5.624   17.560  1.00 0.00 ? 16  GLN A HE21 5  
ATOM 9166  H HE22 . GLN A 1 16  ? 5.388   4.082   16.713  1.00 0.00 ? 16  GLN A HE22 5  
ATOM 9167  N N    . MET A 1 17  ? 3.297   8.282   16.719  1.00 0.00 ? 17  MET A N    5  
ATOM 9168  C CA   . MET A 1 17  ? 3.490   8.590   15.290  1.00 0.00 ? 17  MET A CA   5  
ATOM 9169  C C    . MET A 1 17  ? 4.751   9.392   15.005  1.00 0.00 ? 17  MET A C    5  
ATOM 9170  O O    . MET A 1 17  ? 5.528   9.135   14.095  1.00 0.00 ? 17  MET A O    5  
ATOM 9171  C CB   . MET A 1 17  ? 2.297   9.456   14.783  1.00 0.00 ? 17  MET A CB   5  
ATOM 9172  C CG   . MET A 1 17  ? 2.232   9.774   13.269  1.00 0.00 ? 17  MET A CG   5  
ATOM 9173  S SD   . MET A 1 17  ? 1.334   11.304  12.877  1.00 0.00 ? 17  MET A SD   5  
ATOM 9174  C CE   . MET A 1 17  ? -0.325  10.588  12.932  1.00 0.00 ? 17  MET A CE   5  
ATOM 9175  H H    . MET A 1 17  ? 2.376   8.522   17.037  1.00 0.00 ? 17  MET A H    5  
ATOM 9176  H HA   . MET A 1 17  ? 3.531   7.658   14.748  1.00 0.00 ? 17  MET A HA   5  
ATOM 9177  H HB2  . MET A 1 17  ? 1.373   8.912   15.049  1.00 0.00 ? 17  MET A HB2  5  
ATOM 9178  H HB3  . MET A 1 17  ? 2.254   10.413  15.353  1.00 0.00 ? 17  MET A HB3  5  
ATOM 9179  H HG2  . MET A 1 17  ? 3.252   9.911   12.859  1.00 0.00 ? 17  MET A HG2  5  
ATOM 9180  H HG3  . MET A 1 17  ? 1.784   8.908   12.736  1.00 0.00 ? 17  MET A HG3  5  
ATOM 9181  H HE1  . MET A 1 17  ? -0.553  10.140  13.922  1.00 0.00 ? 17  MET A HE1  5  
ATOM 9182  H HE2  . MET A 1 17  ? -1.092  11.362  12.728  1.00 0.00 ? 17  MET A HE2  5  
ATOM 9183  H HE3  . MET A 1 17  ? -0.435  9.804   12.158  1.00 0.00 ? 17  MET A HE3  5  
ATOM 9184  N N    . TYR A 1 18  ? 4.978   10.399  15.874  1.00 0.00 ? 18  TYR A N    5  
ATOM 9185  C CA   . TYR A 1 18  ? 6.093   11.330  15.917  1.00 0.00 ? 18  TYR A CA   5  
ATOM 9186  C C    . TYR A 1 18  ? 7.455   10.659  16.268  1.00 0.00 ? 18  TYR A C    5  
ATOM 9187  O O    . TYR A 1 18  ? 8.527   11.200  16.003  1.00 0.00 ? 18  TYR A O    5  
ATOM 9188  C CB   . TYR A 1 18  ? 5.694   12.556  16.814  1.00 0.00 ? 18  TYR A CB   5  
ATOM 9189  C CG   . TYR A 1 18  ? 4.243   13.000  16.532  1.00 0.00 ? 18  TYR A CG   5  
ATOM 9190  C CD1  . TYR A 1 18  ? 3.924   13.560  15.302  1.00 0.00 ? 18  TYR A CD1  5  
ATOM 9191  C CD2  . TYR A 1 18  ? 3.188   12.830  17.432  1.00 0.00 ? 18  TYR A CD2  5  
ATOM 9192  C CE1  . TYR A 1 18  ? 2.633   13.946  14.986  1.00 0.00 ? 18  TYR A CE1  5  
ATOM 9193  C CE2  . TYR A 1 18  ? 1.885   13.192  17.102  1.00 0.00 ? 18  TYR A CE2  5  
ATOM 9194  C CZ   . TYR A 1 18  ? 1.603   13.763  15.883  1.00 0.00 ? 18  TYR A CZ   5  
ATOM 9195  O OH   . TYR A 1 18  ? 0.287   14.180  15.550  1.00 0.00 ? 18  TYR A OH   5  
ATOM 9196  H H    . TYR A 1 18  ? 4.291   10.572  16.576  1.00 0.00 ? 18  TYR A H    5  
ATOM 9197  H HA   . TYR A 1 18  ? 6.202   11.671  14.887  1.00 0.00 ? 18  TYR A HA   5  
ATOM 9198  H HB2  . TYR A 1 18  ? 5.813   12.305  17.890  1.00 0.00 ? 18  TYR A HB2  5  
ATOM 9199  H HB3  . TYR A 1 18  ? 6.363   13.417  16.593  1.00 0.00 ? 18  TYR A HB3  5  
ATOM 9200  H HD1  . TYR A 1 18  ? 4.704   13.698  14.567  1.00 0.00 ? 18  TYR A HD1  5  
ATOM 9201  H HD2  . TYR A 1 18  ? 3.354   12.410  18.412  1.00 0.00 ? 18  TYR A HD2  5  
ATOM 9202  H HE1  . TYR A 1 18  ? 2.418   14.385  14.019  1.00 0.00 ? 18  TYR A HE1  5  
ATOM 9203  H HE2  . TYR A 1 18  ? 1.071   13.037  17.799  1.00 0.00 ? 18  TYR A HE2  5  
ATOM 9204  H HH   . TYR A 1 18  ? -0.386  13.706  16.091  1.00 0.00 ? 18  TYR A HH   5  
ATOM 9205  N N    . ASP A 1 19  ? 7.387   9.411   16.839  1.00 0.00 ? 19  ASP A N    5  
ATOM 9206  C CA   . ASP A 1 19  ? 8.480   8.473   17.122  1.00 0.00 ? 19  ASP A CA   5  
ATOM 9207  C C    . ASP A 1 19  ? 8.609   7.435   15.984  1.00 0.00 ? 19  ASP A C    5  
ATOM 9208  O O    . ASP A 1 19  ? 9.089   7.789   14.912  1.00 0.00 ? 19  ASP A O    5  
ATOM 9209  C CB   . ASP A 1 19  ? 8.353   7.766   18.504  1.00 0.00 ? 19  ASP A CB   5  
ATOM 9210  C CG   . ASP A 1 19  ? 8.231   8.817   19.611  1.00 0.00 ? 19  ASP A CG   5  
ATOM 9211  O OD1  . ASP A 1 19  ? 9.196   9.607   19.788  1.00 0.00 ? 19  ASP A OD1  5  
ATOM 9212  O OD2  . ASP A 1 19  ? 7.169   8.843   20.289  1.00 0.00 ? 19  ASP A OD2  5  
ATOM 9213  H H    . ASP A 1 19  ? 6.480   9.024   17.024  1.00 0.00 ? 19  ASP A H    5  
ATOM 9214  H HA   . ASP A 1 19  ? 9.413   9.025   17.130  1.00 0.00 ? 19  ASP A HA   5  
ATOM 9215  H HB2  . ASP A 1 19  ? 7.457   7.111   18.537  1.00 0.00 ? 19  ASP A HB2  5  
ATOM 9216  H HB3  . ASP A 1 19  ? 9.250   7.144   18.708  1.00 0.00 ? 19  ASP A HB3  5  
ATOM 9217  N N    . MET A 1 20  ? 8.175   6.131   16.129  1.00 0.00 ? 20  MET A N    5  
ATOM 9218  C CA   . MET A 1 20  ? 8.340   5.001   15.162  1.00 0.00 ? 20  MET A CA   5  
ATOM 9219  C C    . MET A 1 20  ? 7.826   5.215   13.738  1.00 0.00 ? 20  MET A C    5  
ATOM 9220  O O    . MET A 1 20  ? 8.303   4.623   12.783  1.00 0.00 ? 20  MET A O    5  
ATOM 9221  C CB   . MET A 1 20  ? 7.938   3.561   15.684  1.00 0.00 ? 20  MET A CB   5  
ATOM 9222  C CG   . MET A 1 20  ? 7.696   2.387   14.670  1.00 0.00 ? 20  MET A CG   5  
ATOM 9223  S SD   . MET A 1 20  ? 9.142   1.458   14.041  1.00 0.00 ? 20  MET A SD   5  
ATOM 9224  C CE   . MET A 1 20  ? 10.030  2.285   12.675  1.00 0.00 ? 20  MET A CE   5  
ATOM 9225  H H    . MET A 1 20  ? 7.774   5.881   17.002  1.00 0.00 ? 20  MET A H    5  
ATOM 9226  H HA   . MET A 1 20  ? 9.403   4.932   15.032  1.00 0.00 ? 20  MET A HA   5  
ATOM 9227  H HB2  . MET A 1 20  ? 8.715   3.190   16.391  1.00 0.00 ? 20  MET A HB2  5  
ATOM 9228  H HB3  . MET A 1 20  ? 7.004   3.622   16.270  1.00 0.00 ? 20  MET A HB3  5  
ATOM 9229  H HG2  . MET A 1 20  ? 7.116   1.641   15.258  1.00 0.00 ? 20  MET A HG2  5  
ATOM 9230  H HG3  . MET A 1 20  ? 7.012   2.663   13.845  1.00 0.00 ? 20  MET A HG3  5  
ATOM 9231  H HE1  . MET A 1 20  ? 10.106  3.368   12.832  1.00 0.00 ? 20  MET A HE1  5  
ATOM 9232  H HE2  . MET A 1 20  ? 11.090  1.959   12.668  1.00 0.00 ? 20  MET A HE2  5  
ATOM 9233  H HE3  . MET A 1 20  ? 9.574   2.104   11.665  1.00 0.00 ? 20  MET A HE3  5  
ATOM 9234  N N    . VAL A 1 21  ? 6.832   6.090   13.490  1.00 0.00 ? 21  VAL A N    5  
ATOM 9235  C CA   . VAL A 1 21  ? 6.319   6.290   12.096  1.00 0.00 ? 21  VAL A CA   5  
ATOM 9236  C C    . VAL A 1 21  ? 7.272   7.022   11.143  1.00 0.00 ? 21  VAL A C    5  
ATOM 9237  O O    . VAL A 1 21  ? 7.313   6.708   9.950   1.00 0.00 ? 21  VAL A O    5  
ATOM 9238  C CB   . VAL A 1 21  ? 4.854   6.770   12.097  1.00 0.00 ? 21  VAL A CB   5  
ATOM 9239  C CG1  . VAL A 1 21  ? 4.554   7.993   11.180  1.00 0.00 ? 21  VAL A CG1  5  
ATOM 9240  C CG2  . VAL A 1 21  ? 3.910   5.565   11.893  1.00 0.00 ? 21  VAL A CG2  5  
ATOM 9241  H H    . VAL A 1 21  ? 6.505   6.651   14.280  1.00 0.00 ? 21  VAL A H    5  
ATOM 9242  H HA   . VAL A 1 21  ? 6.347   5.319   11.554  1.00 0.00 ? 21  VAL A HA   5  
ATOM 9243  H HB   . VAL A 1 21  ? 4.630   7.085   13.136  1.00 0.00 ? 21  VAL A HB   5  
ATOM 9244  H HG11 . VAL A 1 21  ? 4.854   7.809   10.130  1.00 0.00 ? 21  VAL A HG11 5  
ATOM 9245  H HG12 . VAL A 1 21  ? 3.467   8.227   11.177  1.00 0.00 ? 21  VAL A HG12 5  
ATOM 9246  H HG13 . VAL A 1 21  ? 5.087   8.915   11.538  1.00 0.00 ? 21  VAL A HG13 5  
ATOM 9247  H HG21 . VAL A 1 21  ? 4.092   4.754   12.634  1.00 0.00 ? 21  VAL A HG21 5  
ATOM 9248  H HG22 . VAL A 1 21  ? 2.844   5.864   12.005  1.00 0.00 ? 21  VAL A HG22 5  
ATOM 9249  H HG23 . VAL A 1 21  ? 4.039   5.128   10.889  1.00 0.00 ? 21  VAL A HG23 5  
ATOM 9250  N N    . VAL A 1 22  ? 8.094   7.986   11.658  1.00 0.00 ? 22  VAL A N    5  
ATOM 9251  C CA   . VAL A 1 22  ? 9.096   8.803   10.943  1.00 0.00 ? 22  VAL A CA   5  
ATOM 9252  C C    . VAL A 1 22  ? 10.142  8.030   10.103  1.00 0.00 ? 22  VAL A C    5  
ATOM 9253  O O    . VAL A 1 22  ? 10.526  8.458   9.021   1.00 0.00 ? 22  VAL A O    5  
ATOM 9254  C CB   . VAL A 1 22  ? 9.770   9.784   11.915  1.00 0.00 ? 22  VAL A CB   5  
ATOM 9255  C CG1  . VAL A 1 22  ? 10.831  10.686  11.240  1.00 0.00 ? 22  VAL A CG1  5  
ATOM 9256  C CG2  . VAL A 1 22  ? 8.688   10.670  12.569  1.00 0.00 ? 22  VAL A CG2  5  
ATOM 9257  H H    . VAL A 1 22  ? 8.037   8.179   12.638  1.00 0.00 ? 22  VAL A H    5  
ATOM 9258  H HA   . VAL A 1 22  ? 8.550   9.403   10.232  1.00 0.00 ? 22  VAL A HA   5  
ATOM 9259  H HB   . VAL A 1 22  ? 10.263  9.200   12.719  1.00 0.00 ? 22  VAL A HB   5  
ATOM 9260  H HG11 . VAL A 1 22  ? 10.404  11.170  10.336  1.00 0.00 ? 22  VAL A HG11 5  
ATOM 9261  H HG12 . VAL A 1 22  ? 11.169  11.475  11.944  1.00 0.00 ? 22  VAL A HG12 5  
ATOM 9262  H HG13 . VAL A 1 22  ? 11.718  10.091  10.936  1.00 0.00 ? 22  VAL A HG13 5  
ATOM 9263  H HG21 . VAL A 1 22  ? 8.101   11.205  11.793  1.00 0.00 ? 22  VAL A HG21 5  
ATOM 9264  H HG22 . VAL A 1 22  ? 7.990   10.069  13.186  1.00 0.00 ? 22  VAL A HG22 5  
ATOM 9265  H HG23 . VAL A 1 22  ? 9.161   11.419  13.239  1.00 0.00 ? 22  VAL A HG23 5  
ATOM 9266  N N    . LYS A 1 23  ? 10.613  6.846   10.575  1.00 0.00 ? 23  LYS A N    5  
ATOM 9267  C CA   . LYS A 1 23  ? 11.495  5.896   9.883   1.00 0.00 ? 23  LYS A CA   5  
ATOM 9268  C C    . LYS A 1 23  ? 10.820  5.077   8.774   1.00 0.00 ? 23  LYS A C    5  
ATOM 9269  O O    . LYS A 1 23  ? 11.432  4.737   7.768   1.00 0.00 ? 23  LYS A O    5  
ATOM 9270  C CB   . LYS A 1 23  ? 12.209  4.913   10.854  1.00 0.00 ? 23  LYS A CB   5  
ATOM 9271  C CG   . LYS A 1 23  ? 13.245  5.557   11.799  1.00 0.00 ? 23  LYS A CG   5  
ATOM 9272  C CD   . LYS A 1 23  ? 12.677  6.495   12.878  1.00 0.00 ? 23  LYS A CD   5  
ATOM 9273  C CE   . LYS A 1 23  ? 11.508  5.917   13.685  1.00 0.00 ? 23  LYS A CE   5  
ATOM 9274  N NZ   . LYS A 1 23  ? 11.921  4.684   14.395  1.00 0.00 ? 23  LYS A NZ   5  
ATOM 9275  H H    . LYS A 1 23  ? 10.317  6.546   11.478  1.00 0.00 ? 23  LYS A H    5  
ATOM 9276  H HA   . LYS A 1 23  ? 12.269  6.465   9.384   1.00 0.00 ? 23  LYS A HA   5  
ATOM 9277  H HB2  . LYS A 1 23  ? 11.449  4.371   11.452  1.00 0.00 ? 23  LYS A HB2  5  
ATOM 9278  H HB3  . LYS A 1 23  ? 12.776  4.142   10.278  1.00 0.00 ? 23  LYS A HB3  5  
ATOM 9279  H HG2  . LYS A 1 23  ? 13.771  4.726   12.324  1.00 0.00 ? 23  LYS A HG2  5  
ATOM 9280  H HG3  . LYS A 1 23  ? 14.009  6.104   11.201  1.00 0.00 ? 23  LYS A HG3  5  
ATOM 9281  H HD2  . LYS A 1 23  ? 13.498  6.770   13.580  1.00 0.00 ? 23  LYS A HD2  5  
ATOM 9282  H HD3  . LYS A 1 23  ? 12.340  7.442   12.404  1.00 0.00 ? 23  LYS A HD3  5  
ATOM 9283  H HE2  . LYS A 1 23  ? 11.197  6.649   14.457  1.00 0.00 ? 23  LYS A HE2  5  
ATOM 9284  H HE3  . LYS A 1 23  ? 10.612  5.684   13.053  1.00 0.00 ? 23  LYS A HE3  5  
ATOM 9285  H HZ1  . LYS A 1 23  ? 12.716  4.899   15.029  1.00 0.00 ? 23  LYS A HZ1  5  
ATOM 9286  H HZ2  . LYS A 1 23  ? 11.120  4.321   14.951  1.00 0.00 ? 23  LYS A HZ2  5  
ATOM 9287  H HZ3  . LYS A 1 23  ? 12.214  3.968   13.700  1.00 0.00 ? 23  LYS A HZ3  5  
ATOM 9288  N N    . ILE A 1 24  ? 9.521   4.699   8.936   1.00 0.00 ? 24  ILE A N    5  
ATOM 9289  C CA   . ILE A 1 24  ? 8.717   3.925   7.971   1.00 0.00 ? 24  ILE A CA   5  
ATOM 9290  C C    . ILE A 1 24  ? 8.217   4.718   6.778   1.00 0.00 ? 24  ILE A C    5  
ATOM 9291  O O    . ILE A 1 24  ? 8.189   4.205   5.665   1.00 0.00 ? 24  ILE A O    5  
ATOM 9292  C CB   . ILE A 1 24  ? 7.811   2.848   8.561   1.00 0.00 ? 24  ILE A CB   5  
ATOM 9293  C CG1  . ILE A 1 24  ? 8.657   1.536   8.770   1.00 0.00 ? 24  ILE A CG1  5  
ATOM 9294  C CG2  . ILE A 1 24  ? 6.483   2.645   7.759   1.00 0.00 ? 24  ILE A CG2  5  
ATOM 9295  C CD1  . ILE A 1 24  ? 7.908   0.473   9.568   1.00 0.00 ? 24  ILE A CD1  5  
ATOM 9296  H H    . ILE A 1 24  ? 9.034   5.008   9.752   1.00 0.00 ? 24  ILE A H    5  
ATOM 9297  H HA   . ILE A 1 24  ? 9.430   3.288   7.463   1.00 0.00 ? 24  ILE A HA   5  
ATOM 9298  H HB   . ILE A 1 24  ? 7.509   3.223   9.574   1.00 0.00 ? 24  ILE A HB   5  
ATOM 9299  H HG12 . ILE A 1 24  ? 9.153   1.054   7.927   1.00 0.00 ? 24  ILE A HG12 5  
ATOM 9300  H HG13 . ILE A 1 24  ? 9.650   1.745   9.161   1.00 0.00 ? 24  ILE A HG13 5  
ATOM 9301  H HG21 . ILE A 1 24  ? 6.651   2.462   6.686   1.00 0.00 ? 24  ILE A HG21 5  
ATOM 9302  H HG22 . ILE A 1 24  ? 5.920   1.768   8.128   1.00 0.00 ? 24  ILE A HG22 5  
ATOM 9303  H HG23 . ILE A 1 24  ? 5.784   3.517   7.867   1.00 0.00 ? 24  ILE A HG23 5  
ATOM 9304  H HD11 . ILE A 1 24  ? 7.573   0.870   10.550  1.00 0.00 ? 24  ILE A HD11 5  
ATOM 9305  H HD12 . ILE A 1 24  ? 6.997   0.133   9.034   1.00 0.00 ? 24  ILE A HD12 5  
ATOM 9306  H HD13 . ILE A 1 24  ? 8.571   -0.398  9.706   1.00 0.00 ? 24  ILE A HD13 5  
ATOM 9307  N N    . ILE A 1 25  ? 7.861   6.032   6.920   1.00 0.00 ? 25  ILE A N    5  
ATOM 9308  C CA   . ILE A 1 25  ? 7.522   6.953   5.795   1.00 0.00 ? 25  ILE A CA   5  
ATOM 9309  C C    . ILE A 1 25  ? 8.598   7.029   4.680   1.00 0.00 ? 25  ILE A C    5  
ATOM 9310  O O    . ILE A 1 25  ? 8.287   7.176   3.498   1.00 0.00 ? 25  ILE A O    5  
ATOM 9311  C CB   . ILE A 1 25  ? 7.017   8.342   6.206   1.00 0.00 ? 25  ILE A CB   5  
ATOM 9312  C CG1  . ILE A 1 25  ? 8.095   9.180   6.937   1.00 0.00 ? 25  ILE A CG1  5  
ATOM 9313  C CG2  . ILE A 1 25  ? 5.724   8.135   7.023   1.00 0.00 ? 25  ILE A CG2  5  
ATOM 9314  C CD1  . ILE A 1 25  ? 7.543   10.254  7.878   1.00 0.00 ? 25  ILE A CD1  5  
ATOM 9315  H H    . ILE A 1 25  ? 7.862   6.424   7.844   1.00 0.00 ? 25  ILE A H    5  
ATOM 9316  H HA   . ILE A 1 25  ? 6.674   6.499   5.299   1.00 0.00 ? 25  ILE A HA   5  
ATOM 9317  H HB   . ILE A 1 25  ? 6.709   8.916   5.297   1.00 0.00 ? 25  ILE A HB   5  
ATOM 9318  H HG12 . ILE A 1 25  ? 8.740   8.506   7.529   1.00 0.00 ? 25  ILE A HG12 5  
ATOM 9319  H HG13 . ILE A 1 25  ? 8.766   9.643   6.184   1.00 0.00 ? 25  ILE A HG13 5  
ATOM 9320  H HG21 . ILE A 1 25  ? 4.997   7.544   6.430   1.00 0.00 ? 25  ILE A HG21 5  
ATOM 9321  H HG22 . ILE A 1 25  ? 5.931   7.595   7.969   1.00 0.00 ? 25  ILE A HG22 5  
ATOM 9322  H HG23 . ILE A 1 25  ? 5.238   9.102   7.274   1.00 0.00 ? 25  ILE A HG23 5  
ATOM 9323  H HD11 . ILE A 1 25  ? 6.922   9.787   8.675   1.00 0.00 ? 25  ILE A HD11 5  
ATOM 9324  H HD12 . ILE A 1 25  ? 8.381   10.780  8.388   1.00 0.00 ? 25  ILE A HD12 5  
ATOM 9325  H HD13 . ILE A 1 25  ? 6.921   10.992  7.328   1.00 0.00 ? 25  ILE A HD13 5  
ATOM 9326  N N    . ASP A 1 26  ? 9.894   6.818   5.074   1.00 0.00 ? 26  ASP A N    5  
ATOM 9327  C CA   . ASP A 1 26  ? 11.081  6.644   4.229   1.00 0.00 ? 26  ASP A CA   5  
ATOM 9328  C C    . ASP A 1 26  ? 11.046  5.409   3.310   1.00 0.00 ? 26  ASP A C    5  
ATOM 9329  O O    . ASP A 1 26  ? 11.477  5.532   2.166   1.00 0.00 ? 26  ASP A O    5  
ATOM 9330  C CB   . ASP A 1 26  ? 12.417  6.652   5.023   1.00 0.00 ? 26  ASP A CB   5  
ATOM 9331  C CG   . ASP A 1 26  ? 12.536  7.948   5.831   1.00 0.00 ? 26  ASP A CG   5  
ATOM 9332  O OD1  . ASP A 1 26  ? 12.477  9.042   5.210   1.00 0.00 ? 26  ASP A OD1  5  
ATOM 9333  O OD2  . ASP A 1 26  ? 12.696  7.857   7.076   1.00 0.00 ? 26  ASP A OD2  5  
ATOM 9334  H H    . ASP A 1 26  ? 10.073  6.685   6.046   1.00 0.00 ? 26  ASP A H    5  
ATOM 9335  H HA   . ASP A 1 26  ? 11.114  7.494   3.560   1.00 0.00 ? 26  ASP A HA   5  
ATOM 9336  H HB2  . ASP A 1 26  ? 12.466  5.782   5.712   1.00 0.00 ? 26  ASP A HB2  5  
ATOM 9337  H HB3  . ASP A 1 26  ? 13.288  6.605   4.330   1.00 0.00 ? 26  ASP A HB3  5  
ATOM 9338  N N    . VAL A 1 27  ? 10.454  4.216   3.727   1.00 0.00 ? 27  VAL A N    5  
ATOM 9339  C CA   . VAL A 1 27  ? 10.185  3.036   2.862   1.00 0.00 ? 27  VAL A CA   5  
ATOM 9340  C C    . VAL A 1 27  ? 9.158   3.396   1.767   1.00 0.00 ? 27  VAL A C    5  
ATOM 9341  O O    . VAL A 1 27  ? 9.358   3.150   0.582   1.00 0.00 ? 27  VAL A O    5  
ATOM 9342  C CB   . VAL A 1 27  ? 9.844   1.653   3.515   1.00 0.00 ? 27  VAL A CB   5  
ATOM 9343  C CG1  . VAL A 1 27  ? 11.109  0.879   3.861   1.00 0.00 ? 27  VAL A CG1  5  
ATOM 9344  C CG2  . VAL A 1 27  ? 9.013   1.586   4.812   1.00 0.00 ? 27  VAL A CG2  5  
ATOM 9345  H H    . VAL A 1 27  ? 10.109  4.133   4.666   1.00 0.00 ? 27  VAL A H    5  
ATOM 9346  H HA   . VAL A 1 27  ? 11.096  2.849   2.309   1.00 0.00 ? 27  VAL A HA   5  
ATOM 9347  H HB   . VAL A 1 27  ? 9.301   1.017   2.766   1.00 0.00 ? 27  VAL A HB   5  
ATOM 9348  H HG11 . VAL A 1 27  ? 11.741  0.669   2.972   1.00 0.00 ? 27  VAL A HG11 5  
ATOM 9349  H HG12 . VAL A 1 27  ? 11.676  1.411   4.657   1.00 0.00 ? 27  VAL A HG12 5  
ATOM 9350  H HG13 . VAL A 1 27  ? 10.769  -0.086  4.307   1.00 0.00 ? 27  VAL A HG13 5  
ATOM 9351  H HG21 . VAL A 1 27  ? 8.054   2.102   4.658   1.00 0.00 ? 27  VAL A HG21 5  
ATOM 9352  H HG22 . VAL A 1 27  ? 8.791   0.508   4.995   1.00 0.00 ? 27  VAL A HG22 5  
ATOM 9353  H HG23 . VAL A 1 27  ? 9.540   1.977   5.727   1.00 0.00 ? 27  VAL A HG23 5  
ATOM 9354  N N    . LEU A 1 28  ? 8.040   4.080   2.122   1.00 0.00 ? 28  LEU A N    5  
ATOM 9355  C CA   . LEU A 1 28  ? 6.986   4.587   1.233   1.00 0.00 ? 28  LEU A CA   5  
ATOM 9356  C C    . LEU A 1 28  ? 7.426   5.679   0.204   1.00 0.00 ? 28  LEU A C    5  
ATOM 9357  O O    . LEU A 1 28  ? 7.244   5.502   -1.006  1.00 0.00 ? 28  LEU A O    5  
ATOM 9358  C CB   . LEU A 1 28  ? 5.765   5.054   2.109   1.00 0.00 ? 28  LEU A CB   5  
ATOM 9359  C CG   . LEU A 1 28  ? 4.907   3.944   2.828   1.00 0.00 ? 28  LEU A CG   5  
ATOM 9360  C CD1  . LEU A 1 28  ? 5.533   2.535   2.924   1.00 0.00 ? 28  LEU A CD1  5  
ATOM 9361  C CD2  . LEU A 1 28  ? 4.505   4.336   4.260   1.00 0.00 ? 28  LEU A CD2  5  
ATOM 9362  H H    . LEU A 1 28  ? 7.886   4.239   3.096   1.00 0.00 ? 28  LEU A H    5  
ATOM 9363  H HA   . LEU A 1 28  ? 6.700   3.759   0.606   1.00 0.00 ? 28  LEU A HA   5  
ATOM 9364  H HB2  . LEU A 1 28  ? 6.153   5.771   2.865   1.00 0.00 ? 28  LEU A HB2  5  
ATOM 9365  H HB3  . LEU A 1 28  ? 5.052   5.632   1.478   1.00 0.00 ? 28  LEU A HB3  5  
ATOM 9366  H HG   . LEU A 1 28  ? 3.948   3.852   2.238   1.00 0.00 ? 28  LEU A HG   5  
ATOM 9367  H HD11 . LEU A 1 28  ? 5.861   2.159   1.936   1.00 0.00 ? 28  LEU A HD11 5  
ATOM 9368  H HD12 . LEU A 1 28  ? 6.407   2.562   3.607   1.00 0.00 ? 28  LEU A HD12 5  
ATOM 9369  H HD13 . LEU A 1 28  ? 4.810   1.807   3.354   1.00 0.00 ? 28  LEU A HD13 5  
ATOM 9370  H HD21 . LEU A 1 28  ? 5.405   4.495   4.892   1.00 0.00 ? 28  LEU A HD21 5  
ATOM 9371  H HD22 . LEU A 1 28  ? 3.874   5.249   4.278   1.00 0.00 ? 28  LEU A HD22 5  
ATOM 9372  H HD23 . LEU A 1 28  ? 3.938   3.493   4.720   1.00 0.00 ? 28  LEU A HD23 5  
ATOM 9373  N N    . ARG A 1 29  ? 8.108   6.787   0.642   1.00 0.00 ? 29  ARG A N    5  
ATOM 9374  C CA   . ARG A 1 29  ? 8.724   7.882   -0.172  1.00 0.00 ? 29  ARG A CA   5  
ATOM 9375  C C    . ARG A 1 29  ? 9.730   7.482   -1.276  1.00 0.00 ? 29  ARG A C    5  
ATOM 9376  O O    . ARG A 1 29  ? 9.949   8.224   -2.224  1.00 0.00 ? 29  ARG A O    5  
ATOM 9377  C CB   . ARG A 1 29  ? 9.360   8.964   0.740   1.00 0.00 ? 29  ARG A CB   5  
ATOM 9378  C CG   . ARG A 1 29  ? 8.330   9.768   1.562   1.00 0.00 ? 29  ARG A CG   5  
ATOM 9379  C CD   . ARG A 1 29  ? 8.934   10.498  2.775   1.00 0.00 ? 29  ARG A CD   5  
ATOM 9380  N NE   . ARG A 1 29  ? 10.029  11.420  2.318   1.00 0.00 ? 29  ARG A NE   5  
ATOM 9381  C CZ   . ARG A 1 29  ? 10.867  12.067  3.189   1.00 0.00 ? 29  ARG A CZ   5  
ATOM 9382  N NH1  . ARG A 1 29  ? 10.715  11.927  4.539   1.00 0.00 ? 29  ARG A NH1  5  
ATOM 9383  N NH2  . ARG A 1 29  ? 11.866  12.857  2.700   1.00 0.00 ? 29  ARG A NH2  5  
ATOM 9384  H H    . ARG A 1 29  ? 8.229   6.899   1.655   1.00 0.00 ? 29  ARG A H    5  
ATOM 9385  H HA   . ARG A 1 29  ? 7.946   8.390   -0.761  1.00 0.00 ? 29  ARG A HA   5  
ATOM 9386  H HB2  . ARG A 1 29  ? 10.063  8.462   1.442   1.00 0.00 ? 29  ARG A HB2  5  
ATOM 9387  H HB3  . ARG A 1 29  ? 9.941   9.706   0.146   1.00 0.00 ? 29  ARG A HB3  5  
ATOM 9388  H HG2  . ARG A 1 29  ? 7.816   10.499  0.899   1.00 0.00 ? 29  ARG A HG2  5  
ATOM 9389  H HG3  . ARG A 1 29  ? 7.549   9.080   1.955   1.00 0.00 ? 29  ARG A HG3  5  
ATOM 9390  H HD2  . ARG A 1 29  ? 8.151   11.093  3.291   1.00 0.00 ? 29  ARG A HD2  5  
ATOM 9391  H HD3  . ARG A 1 29  ? 9.359   9.749   3.480   1.00 0.00 ? 29  ARG A HD3  5  
ATOM 9392  H HE   . ARG A 1 29  ? 10.168  11.545  1.336   1.00 0.00 ? 29  ARG A HE   5  
ATOM 9393  H HH11 . ARG A 1 29  ? 9.986   11.346  4.901   1.00 0.00 ? 29  ARG A HH11 5  
ATOM 9394  H HH12 . ARG A 1 29  ? 11.333  12.403  5.163   1.00 0.00 ? 29  ARG A HH12 5  
ATOM 9395  H HH21 . ARG A 1 29  ? 11.984  12.959  1.712   1.00 0.00 ? 29  ARG A HH21 5  
ATOM 9396  H HH22 . ARG A 1 29  ? 12.482  13.330  3.330   1.00 0.00 ? 29  ARG A HH22 5  
ATOM 9397  N N    . SER A 1 30  ? 10.412  6.327   -1.097  1.00 0.00 ? 30  SER A N    5  
ATOM 9398  C CA   . SER A 1 30  ? 11.481  5.674   -1.890  1.00 0.00 ? 30  SER A CA   5  
ATOM 9399  C C    . SER A 1 30  ? 10.941  5.001   -3.121  1.00 0.00 ? 30  SER A C    5  
ATOM 9400  O O    . SER A 1 30  ? 11.365  5.312   -4.234  1.00 0.00 ? 30  SER A O    5  
ATOM 9401  C CB   . SER A 1 30  ? 12.341  4.723   -0.958  1.00 0.00 ? 30  SER A CB   5  
ATOM 9402  O OG   . SER A 1 30  ? 12.572  3.355   -1.332  1.00 0.00 ? 30  SER A OG   5  
ATOM 9403  H H    . SER A 1 30  ? 10.008  5.821   -0.341  1.00 0.00 ? 30  SER A H    5  
ATOM 9404  H HA   . SER A 1 30  ? 12.111  6.461   -2.338  1.00 0.00 ? 30  SER A HA   5  
ATOM 9405  H HB2  . SER A 1 30  ? 13.334  5.215   -0.847  1.00 0.00 ? 30  SER A HB2  5  
ATOM 9406  H HB3  . SER A 1 30  ? 11.785  4.653   0.015   1.00 0.00 ? 30  SER A HB3  5  
ATOM 9407  H HG   . SER A 1 30  ? 13.202  3.348   -2.061  1.00 0.00 ? 30  SER A HG   5  
ATOM 9408  N N    . HIS A 1 31  ? 9.887   4.132   -2.975  1.00 0.00 ? 31  HIS A N    5  
ATOM 9409  C CA   . HIS A 1 31  ? 9.095   3.512   -4.032  1.00 0.00 ? 31  HIS A CA   5  
ATOM 9410  C C    . HIS A 1 31  ? 8.476   4.548   -4.952  1.00 0.00 ? 31  HIS A C    5  
ATOM 9411  O O    . HIS A 1 31  ? 8.305   4.303   -6.125  1.00 0.00 ? 31  HIS A O    5  
ATOM 9412  C CB   . HIS A 1 31  ? 7.914   2.660   -3.491  1.00 0.00 ? 31  HIS A CB   5  
ATOM 9413  C CG   . HIS A 1 31  ? 8.314   1.492   -2.652  1.00 0.00 ? 31  HIS A CG   5  
ATOM 9414  N ND1  . HIS A 1 31  ? 8.297   1.527   -1.282  1.00 0.00 ? 31  HIS A ND1  5  
ATOM 9415  C CD2  . HIS A 1 31  ? 8.662   0.218   -2.985  1.00 0.00 ? 31  HIS A CD2  5  
ATOM 9416  C CE1  . HIS A 1 31  ? 8.620   0.291   -0.853  1.00 0.00 ? 31  HIS A CE1  5  
ATOM 9417  N NE2  . HIS A 1 31  ? 8.855   -0.535  -1.843  1.00 0.00 ? 31  HIS A NE2  5  
ATOM 9418  H H    . HIS A 1 31  ? 9.562   3.844   -2.078  1.00 0.00 ? 31  HIS A H    5  
ATOM 9419  H HA   . HIS A 1 31  ? 9.749   2.889   -4.626  1.00 0.00 ? 31  HIS A HA   5  
ATOM 9420  H HB2  . HIS A 1 31  ? 7.235   3.287   -2.868  1.00 0.00 ? 31  HIS A HB2  5  
ATOM 9421  H HB3  . HIS A 1 31  ? 7.311   2.229   -4.320  1.00 0.00 ? 31  HIS A HB3  5  
ATOM 9422  H HD1  . HIS A 1 31  ? 8.322   2.345   -0.687  1.00 0.00 ? 31  HIS A HD1  5  
ATOM 9423  H HD2  . HIS A 1 31  ? 8.799   -0.237  -3.956  1.00 0.00 ? 31  HIS A HD2  5  
ATOM 9424  H HE1  . HIS A 1 31  ? 8.633   0.031   0.204   1.00 0.00 ? 31  HIS A HE1  5  
ATOM 9425  N N    . ASN A 1 32  ? 8.163   5.737   -4.365  1.00 0.00 ? 32  ASN A N    5  
ATOM 9426  C CA   . ASN A 1 32  ? 7.517   6.941   -4.873  1.00 0.00 ? 32  ASN A CA   5  
ATOM 9427  C C    . ASN A 1 32  ? 8.356   7.753   -5.828  1.00 0.00 ? 32  ASN A C    5  
ATOM 9428  O O    . ASN A 1 32  ? 7.840   8.329   -6.781  1.00 0.00 ? 32  ASN A O    5  
ATOM 9429  C CB   . ASN A 1 32  ? 6.811   7.755   -3.756  1.00 0.00 ? 32  ASN A CB   5  
ATOM 9430  C CG   . ASN A 1 32  ? 5.519   7.017   -3.401  1.00 0.00 ? 32  ASN A CG   5  
ATOM 9431  O OD1  . ASN A 1 32  ? 4.443   7.609   -3.384  1.00 0.00 ? 32  ASN A OD1  5  
ATOM 9432  N ND2  . ASN A 1 32  ? 5.592   5.679   -3.221  1.00 0.00 ? 32  ASN A ND2  5  
ATOM 9433  H H    . ASN A 1 32  ? 8.400   5.805   -3.401  1.00 0.00 ? 32  ASN A H    5  
ATOM 9434  H HA   . ASN A 1 32  ? 6.719   6.600   -5.493  1.00 0.00 ? 32  ASN A HA   5  
ATOM 9435  H HB2  . ASN A 1 32  ? 7.444   7.859   -2.857  1.00 0.00 ? 32  ASN A HB2  5  
ATOM 9436  H HB3  . ASN A 1 32  ? 6.502   8.765   -4.108  1.00 0.00 ? 32  ASN A HB3  5  
ATOM 9437  H HD21 . ASN A 1 32  ? 6.414   5.323   -2.716  1.00 0.00 ? 32  ASN A HD21 5  
ATOM 9438  H HD22 . ASN A 1 32  ? 4.736   5.148   -3.432  1.00 0.00 ? 32  ASN A HD22 5  
ATOM 9439  N N    . GLU A 1 33  ? 9.693   7.727   -5.640  1.00 0.00 ? 33  GLU A N    5  
ATOM 9440  C CA   . GLU A 1 33  ? 10.726  8.281   -6.518  1.00 0.00 ? 33  GLU A CA   5  
ATOM 9441  C C    . GLU A 1 33  ? 10.889  7.460   -7.813  1.00 0.00 ? 33  GLU A C    5  
ATOM 9442  O O    . GLU A 1 33  ? 10.986  7.969   -8.928  1.00 0.00 ? 33  GLU A O    5  
ATOM 9443  C CB   . GLU A 1 33  ? 12.020  8.351   -5.648  1.00 0.00 ? 33  GLU A CB   5  
ATOM 9444  C CG   . GLU A 1 33  ? 12.031  9.523   -4.652  1.00 0.00 ? 33  GLU A CG   5  
ATOM 9445  C CD   . GLU A 1 33  ? 12.059  10.854  -5.400  1.00 0.00 ? 33  GLU A CD   5  
ATOM 9446  O OE1  . GLU A 1 33  ? 13.060  11.109  -6.122  1.00 0.00 ? 33  GLU A OE1  5  
ATOM 9447  O OE2  . GLU A 1 33  ? 11.081  11.636  -5.257  1.00 0.00 ? 33  GLU A OE2  5  
ATOM 9448  H H    . GLU A 1 33  ? 10.025  7.220   -4.843  1.00 0.00 ? 33  GLU A H    5  
ATOM 9449  H HA   . GLU A 1 33  ? 10.369  9.236   -6.889  1.00 0.00 ? 33  GLU A HA   5  
ATOM 9450  H HB2  . GLU A 1 33  ? 12.102  7.417   -5.054  1.00 0.00 ? 33  GLU A HB2  5  
ATOM 9451  H HB3  . GLU A 1 33  ? 12.962  8.370   -6.199  1.00 0.00 ? 33  GLU A HB3  5  
ATOM 9452  H HG2  . GLU A 1 33  ? 11.126  9.461   -4.023  1.00 0.00 ? 33  GLU A HG2  5  
ATOM 9453  H HG3  . GLU A 1 33  ? 12.922  9.446   -3.993  1.00 0.00 ? 33  GLU A HG3  5  
ATOM 9454  N N    . ALA A 1 34  ? 10.816  6.125   -7.647  1.00 0.00 ? 34  ALA A N    5  
ATOM 9455  C CA   . ALA A 1 34  ? 10.700  5.061   -8.634  1.00 0.00 ? 34  ALA A CA   5  
ATOM 9456  C C    . ALA A 1 34  ? 9.315   4.941   -9.316  1.00 0.00 ? 34  ALA A C    5  
ATOM 9457  O O    . ALA A 1 34  ? 9.140   4.349   -10.383 1.00 0.00 ? 34  ALA A O    5  
ATOM 9458  C CB   . ALA A 1 34  ? 11.183  3.758   -7.982  1.00 0.00 ? 34  ALA A CB   5  
ATOM 9459  H H    . ALA A 1 34  ? 10.739  5.794   -6.707  1.00 0.00 ? 34  ALA A H    5  
ATOM 9460  H HA   . ALA A 1 34  ? 11.374  5.297   -9.448  1.00 0.00 ? 34  ALA A HA   5  
ATOM 9461  H HB1  . ALA A 1 34  ? 10.477  3.424   -7.193  1.00 0.00 ? 34  ALA A HB1  5  
ATOM 9462  H HB2  . ALA A 1 34  ? 12.157  3.945   -7.468  1.00 0.00 ? 34  ALA A HB2  5  
ATOM 9463  H HB3  . ALA A 1 34  ? 11.314  2.956   -8.739  1.00 0.00 ? 34  ALA A HB3  5  
ATOM 9464  N N    . CYS A 1 35  ? 8.245   5.419   -8.616  1.00 0.00 ? 35  CYS A N    5  
ATOM 9465  C CA   . CYS A 1 35  ? 6.824   5.325   -8.959  1.00 0.00 ? 35  CYS A CA   5  
ATOM 9466  C C    . CYS A 1 35  ? 6.383   6.159   -10.134 1.00 0.00 ? 35  CYS A C    5  
ATOM 9467  O O    . CYS A 1 35  ? 5.625   5.709   -10.984 1.00 0.00 ? 35  CYS A O    5  
ATOM 9468  C CB   . CYS A 1 35  ? 5.865   5.519   -7.725  1.00 0.00 ? 35  CYS A CB   5  
ATOM 9469  S SG   . CYS A 1 35  ? 4.976   7.131   -7.439  1.00 0.00 ? 35  CYS A SG   5  
ATOM 9470  H H    . CYS A 1 35  ? 8.441   5.838   -7.730  1.00 0.00 ? 35  CYS A H    5  
ATOM 9471  H HA   . CYS A 1 35  ? 6.716   4.303   -9.285  1.00 0.00 ? 35  CYS A HA   5  
ATOM 9472  H HB2  . CYS A 1 35  ? 5.107   4.696   -7.755  1.00 0.00 ? 35  CYS A HB2  5  
ATOM 9473  H HB3  . CYS A 1 35  ? 6.489   5.319   -6.833  1.00 0.00 ? 35  CYS A HB3  5  
ATOM 9474  H HG   . CYS A 1 35  ? 6.083   7.869   -7.421  1.00 0.00 ? 35  CYS A HG   5  
ATOM 9475  N N    . GLN A 1 36  ? 6.937   7.407   -10.216 1.00 0.00 ? 36  GLN A N    5  
ATOM 9476  C CA   . GLN A 1 36  ? 6.758   8.429   -11.274 1.00 0.00 ? 36  GLN A CA   5  
ATOM 9477  C C    . GLN A 1 36  ? 7.255   8.007   -12.666 1.00 0.00 ? 36  GLN A C    5  
ATOM 9478  O O    . GLN A 1 36  ? 7.085   8.666   -13.690 1.00 0.00 ? 36  GLN A O    5  
ATOM 9479  C CB   . GLN A 1 36  ? 7.256   9.840   -10.838 1.00 0.00 ? 36  GLN A CB   5  
ATOM 9480  C CG   . GLN A 1 36  ? 8.726   9.943   -10.367 1.00 0.00 ? 36  GLN A CG   5  
ATOM 9481  C CD   . GLN A 1 36  ? 9.745   9.928   -11.509 1.00 0.00 ? 36  GLN A CD   5  
ATOM 9482  O OE1  . GLN A 1 36  ? 9.826   10.844  -12.333 1.00 0.00 ? 36  GLN A OE1  5  
ATOM 9483  N NE2  . GLN A 1 36  ? 10.564  8.846   -11.520 1.00 0.00 ? 36  GLN A NE2  5  
ATOM 9484  H H    . GLN A 1 36  ? 7.555   7.680   -9.463  1.00 0.00 ? 36  GLN A H    5  
ATOM 9485  H HA   . GLN A 1 36  ? 5.691   8.535   -11.399 1.00 0.00 ? 36  GLN A HA   5  
ATOM 9486  H HB2  . GLN A 1 36  ? 7.060   10.587  -11.639 1.00 0.00 ? 36  GLN A HB2  5  
ATOM 9487  H HB3  . GLN A 1 36  ? 6.630   10.139  -9.964  1.00 0.00 ? 36  GLN A HB3  5  
ATOM 9488  H HG2  . GLN A 1 36  ? 8.870   10.892  -9.810  1.00 0.00 ? 36  GLN A HG2  5  
ATOM 9489  H HG3  . GLN A 1 36  ? 8.940   9.095   -9.687  1.00 0.00 ? 36  GLN A HG3  5  
ATOM 9490  H HE21 . GLN A 1 36  ? 10.685  8.339   -10.656 1.00 0.00 ? 36  GLN A HE21 5  
ATOM 9491  H HE22 . GLN A 1 36  ? 11.032  8.609   -12.363 1.00 0.00 ? 36  GLN A HE22 5  
ATOM 9492  N N    . GLU A 1 37  ? 7.984   6.873   -12.619 1.00 0.00 ? 37  GLU A N    5  
ATOM 9493  C CA   . GLU A 1 37  ? 8.700   6.220   -13.696 1.00 0.00 ? 37  GLU A CA   5  
ATOM 9494  C C    . GLU A 1 37  ? 7.981   4.972   -14.164 1.00 0.00 ? 37  GLU A C    5  
ATOM 9495  O O    . GLU A 1 37  ? 8.263   4.459   -15.246 1.00 0.00 ? 37  GLU A O    5  
ATOM 9496  C CB   . GLU A 1 37  ? 10.141  5.896   -13.171 1.00 0.00 ? 37  GLU A CB   5  
ATOM 9497  C CG   . GLU A 1 37  ? 10.825  4.539   -13.492 1.00 0.00 ? 37  GLU A CG   5  
ATOM 9498  C CD   . GLU A 1 37  ? 11.477  4.553   -14.876 1.00 0.00 ? 37  GLU A CD   5  
ATOM 9499  O OE1  . GLU A 1 37  ? 12.321  5.454   -15.127 1.00 0.00 ? 37  GLU A OE1  5  
ATOM 9500  O OE2  . GLU A 1 37  ? 11.147  3.655   -15.697 1.00 0.00 ? 37  GLU A OE2  5  
ATOM 9501  H H    . GLU A 1 37  ? 7.927   6.405   -11.713 1.00 0.00 ? 37  GLU A H    5  
ATOM 9502  H HA   . GLU A 1 37  ? 8.778   6.872   -14.559 1.00 0.00 ? 37  GLU A HA   5  
ATOM 9503  H HB2  . GLU A 1 37  ? 10.812  6.740   -13.443 1.00 0.00 ? 37  GLU A HB2  5  
ATOM 9504  H HB3  . GLU A 1 37  ? 10.075  5.912   -12.060 1.00 0.00 ? 37  GLU A HB3  5  
ATOM 9505  H HG2  . GLU A 1 37  ? 11.604  4.370   -12.723 1.00 0.00 ? 37  GLU A HG2  5  
ATOM 9506  H HG3  . GLU A 1 37  ? 10.132  3.677   -13.396 1.00 0.00 ? 37  GLU A HG3  5  
ATOM 9507  N N    . ASN A 1 38  ? 7.048   4.391   -13.370 1.00 0.00 ? 38  ASN A N    5  
ATOM 9508  C CA   . ASN A 1 38  ? 6.523   3.073   -13.678 1.00 0.00 ? 38  ASN A CA   5  
ATOM 9509  C C    . ASN A 1 38  ? 5.039   3.033   -13.422 1.00 0.00 ? 38  ASN A C    5  
ATOM 9510  O O    . ASN A 1 38  ? 4.462   3.923   -12.807 1.00 0.00 ? 38  ASN A O    5  
ATOM 9511  C CB   . ASN A 1 38  ? 7.380   2.105   -12.805 1.00 0.00 ? 38  ASN A CB   5  
ATOM 9512  C CG   . ASN A 1 38  ? 7.202   0.585   -12.902 1.00 0.00 ? 38  ASN A CG   5  
ATOM 9513  O OD1  . ASN A 1 38  ? 6.152   0.003   -13.157 1.00 0.00 ? 38  ASN A OD1  5  
ATOM 9514  N ND2  . ASN A 1 38  ? 8.295   -0.106  -12.487 1.00 0.00 ? 38  ASN A ND2  5  
ATOM 9515  H H    . ASN A 1 38  ? 6.756   4.804   -12.490 1.00 0.00 ? 38  ASN A H    5  
ATOM 9516  H HA   . ASN A 1 38  ? 6.677   2.791   -14.703 1.00 0.00 ? 38  ASN A HA   5  
ATOM 9517  H HB2  . ASN A 1 38  ? 8.416   2.294   -13.138 1.00 0.00 ? 38  ASN A HB2  5  
ATOM 9518  H HB3  . ASN A 1 38  ? 7.330   2.414   -11.739 1.00 0.00 ? 38  ASN A HB3  5  
ATOM 9519  H HD21 . ASN A 1 38  ? 9.135   0.383   -12.256 1.00 0.00 ? 38  ASN A HD21 5  
ATOM 9520  H HD22 . ASN A 1 38  ? 8.113   -1.003  -12.093 1.00 0.00 ? 38  ASN A HD22 5  
ATOM 9521  N N    . LYS A 1 39  ? 4.391   1.913   -13.817 1.00 0.00 ? 39  LYS A N    5  
ATOM 9522  C CA   . LYS A 1 39  ? 3.010   1.614   -13.508 1.00 0.00 ? 39  LYS A CA   5  
ATOM 9523  C C    . LYS A 1 39  ? 2.825   1.056   -12.090 1.00 0.00 ? 39  LYS A C    5  
ATOM 9524  O O    . LYS A 1 39  ? 1.918   1.460   -11.371 1.00 0.00 ? 39  LYS A O    5  
ATOM 9525  C CB   . LYS A 1 39  ? 2.405   0.602   -14.509 1.00 0.00 ? 39  LYS A CB   5  
ATOM 9526  C CG   . LYS A 1 39  ? 3.191   -0.702  -14.761 1.00 0.00 ? 39  LYS A CG   5  
ATOM 9527  C CD   . LYS A 1 39  ? 2.473   -1.825  -14.045 1.00 0.00 ? 39  LYS A CD   5  
ATOM 9528  C CE   . LYS A 1 39  ? 2.127   -2.991  -14.962 1.00 0.00 ? 39  LYS A CE   5  
ATOM 9529  N NZ   . LYS A 1 39  ? 1.596   -4.143  -14.200 1.00 0.00 ? 39  LYS A NZ   5  
ATOM 9530  H H    . LYS A 1 39  ? 4.891   1.178   -14.274 1.00 0.00 ? 39  LYS A H    5  
ATOM 9531  H HA   . LYS A 1 39  ? 2.470   2.544   -13.537 1.00 0.00 ? 39  LYS A HA   5  
ATOM 9532  H HB2  . LYS A 1 39  ? 1.341   0.433   -14.250 1.00 0.00 ? 39  LYS A HB2  5  
ATOM 9533  H HB3  . LYS A 1 39  ? 2.239   0.974   -15.499 1.00 0.00 ? 39  LYS A HB3  5  
ATOM 9534  H HG2  . LYS A 1 39  ? 3.141   -0.918  -15.854 1.00 0.00 ? 39  LYS A HG2  5  
ATOM 9535  H HG3  . LYS A 1 39  ? 4.259   -0.651  -14.482 1.00 0.00 ? 39  LYS A HG3  5  
ATOM 9536  H HD2  . LYS A 1 39  ? 2.974   -2.150  -13.095 1.00 0.00 ? 39  LYS A HD2  5  
ATOM 9537  H HD3  . LYS A 1 39  ? 1.557   -1.252  -13.796 1.00 0.00 ? 39  LYS A HD3  5  
ATOM 9538  H HE2  . LYS A 1 39  ? 1.368   -2.694  -15.715 1.00 0.00 ? 39  LYS A HE2  5  
ATOM 9539  H HE3  . LYS A 1 39  ? 3.049   -3.299  -15.480 1.00 0.00 ? 39  LYS A HE3  5  
ATOM 9540  H HZ1  . LYS A 1 39  ? 2.299   -4.445  -13.496 1.00 0.00 ? 39  LYS A HZ1  5  
ATOM 9541  H HZ2  . LYS A 1 39  ? 0.719   -3.865  -13.716 1.00 0.00 ? 39  LYS A HZ2  5  
ATOM 9542  H HZ3  . LYS A 1 39  ? 1.398   -4.929  -14.852 1.00 0.00 ? 39  LYS A HZ3  5  
ATOM 9543  N N    . ASP A 1 40  ? 3.664   0.069   -11.710 1.00 0.00 ? 40  ASP A N    5  
ATOM 9544  C CA   . ASP A 1 40  ? 3.778   -0.470  -10.371 1.00 0.00 ? 40  ASP A CA   5  
ATOM 9545  C C    . ASP A 1 40  ? 5.160   -1.052  -10.160 1.00 0.00 ? 40  ASP A C    5  
ATOM 9546  O O    . ASP A 1 40  ? 5.314   -2.234  -10.429 1.00 0.00 ? 40  ASP A O    5  
ATOM 9547  C CB   . ASP A 1 40  ? 2.562   -1.274  -9.793  1.00 0.00 ? 40  ASP A CB   5  
ATOM 9548  C CG   . ASP A 1 40  ? 1.911   -2.288  -10.735 1.00 0.00 ? 40  ASP A CG   5  
ATOM 9549  O OD1  . ASP A 1 40  ? 2.570   -3.298  -11.084 1.00 0.00 ? 40  ASP A OD1  5  
ATOM 9550  O OD2  . ASP A 1 40  ? 0.727   -2.064  -11.108 1.00 0.00 ? 40  ASP A OD2  5  
ATOM 9551  H H    . ASP A 1 40  ? 4.415   -0.170  -12.346 1.00 0.00 ? 40  ASP A H    5  
ATOM 9552  H HA   . ASP A 1 40  ? 3.786   0.366   -9.701  1.00 0.00 ? 40  ASP A HA   5  
ATOM 9553  H HB2  . ASP A 1 40  ? 2.818   -1.756  -8.827  1.00 0.00 ? 40  ASP A HB2  5  
ATOM 9554  H HB3  . ASP A 1 40  ? 1.779   -0.518  -9.557  1.00 0.00 ? 40  ASP A HB3  5  
ATOM 9555  N N    . LEU A 1 41  ? 6.236   -0.334  -9.693  1.00 0.00 ? 41  LEU A N    5  
ATOM 9556  C CA   . LEU A 1 41  ? 7.564   -0.942  -9.379  1.00 0.00 ? 41  LEU A CA   5  
ATOM 9557  C C    . LEU A 1 41  ? 7.619   -1.997  -8.248  1.00 0.00 ? 41  LEU A C    5  
ATOM 9558  O O    . LEU A 1 41  ? 8.389   -2.955  -8.286  1.00 0.00 ? 41  LEU A O    5  
ATOM 9559  C CB   . LEU A 1 41  ? 8.725   0.062   -9.319  1.00 0.00 ? 41  LEU A CB   5  
ATOM 9560  C CG   . LEU A 1 41  ? 8.836   1.031   -8.148  1.00 0.00 ? 41  LEU A CG   5  
ATOM 9561  C CD1  . LEU A 1 41  ? 7.525   1.673   -7.771  1.00 0.00 ? 41  LEU A CD1  5  
ATOM 9562  C CD2  . LEU A 1 41  ? 9.680   0.538   -6.972  1.00 0.00 ? 41  LEU A CD2  5  
ATOM 9563  H H    . LEU A 1 41  ? 6.173   0.659   -9.570  1.00 0.00 ? 41  LEU A H    5  
ATOM 9564  H HA   . LEU A 1 41  ? 7.855   -1.460  -10.263 1.00 0.00 ? 41  LEU A HA   5  
ATOM 9565  H HB2  . LEU A 1 41  ? 9.704   -0.473  -9.443  1.00 0.00 ? 41  LEU A HB2  5  
ATOM 9566  H HB3  . LEU A 1 41  ? 8.552   0.763   -10.174 1.00 0.00 ? 41  LEU A HB3  5  
ATOM 9567  H HG   . LEU A 1 41  ? 9.363   1.845   -8.660  1.00 0.00 ? 41  LEU A HG   5  
ATOM 9568  H HD11 . LEU A 1 41  ? 7.177   2.214   -8.688  1.00 0.00 ? 41  LEU A HD11 5  
ATOM 9569  H HD12 . LEU A 1 41  ? 6.788   0.913   -7.453  1.00 0.00 ? 41  LEU A HD12 5  
ATOM 9570  H HD13 . LEU A 1 41  ? 7.616   2.398   -6.952  1.00 0.00 ? 41  LEU A HD13 5  
ATOM 9571  H HD21 . LEU A 1 41  ? 10.677  0.226   -7.354  1.00 0.00 ? 41  LEU A HD21 5  
ATOM 9572  H HD22 . LEU A 1 41  ? 9.811   1.335   -6.212  1.00 0.00 ? 41  LEU A HD22 5  
ATOM 9573  H HD23 . LEU A 1 41  ? 9.205   -0.341  -6.492  1.00 0.00 ? 41  LEU A HD23 5  
ATOM 9574  N N    . GLN A 1 42  ? 6.669   -1.836  -7.302  1.00 0.00 ? 42  GLN A N    5  
ATOM 9575  C CA   . GLN A 1 42  ? 6.163   -2.558  -6.162  1.00 0.00 ? 42  GLN A CA   5  
ATOM 9576  C C    . GLN A 1 42  ? 4.874   -3.370  -6.406  1.00 0.00 ? 42  GLN A C    5  
ATOM 9577  O O    . GLN A 1 42  ? 3.981   -3.230  -5.561  1.00 0.00 ? 42  GLN A O    5  
ATOM 9578  C CB   . GLN A 1 42  ? 6.332   -1.823  -4.811  1.00 0.00 ? 42  GLN A CB   5  
ATOM 9579  C CG   . GLN A 1 42  ? 6.948   -2.719  -3.712  1.00 0.00 ? 42  GLN A CG   5  
ATOM 9580  C CD   . GLN A 1 42  ? 8.250   -3.425  -4.132  1.00 0.00 ? 42  GLN A CD   5  
ATOM 9581  O OE1  . GLN A 1 42  ? 9.243   -2.829  -4.548  1.00 0.00 ? 42  GLN A OE1  5  
ATOM 9582  N NE2  . GLN A 1 42  ? 8.203   -4.785  -4.098  1.00 0.00 ? 42  GLN A NE2  5  
ATOM 9583  H H    . GLN A 1 42  ? 6.143   -1.005  -7.355  1.00 0.00 ? 42  GLN A H    5  
ATOM 9584  H HA   . GLN A 1 42  ? 6.875   -3.364  -6.092  1.00 0.00 ? 42  GLN A HA   5  
ATOM 9585  H HB2  . GLN A 1 42  ? 7.003   -0.955  -4.976  1.00 0.00 ? 42  GLN A HB2  5  
ATOM 9586  H HB3  . GLN A 1 42  ? 5.374   -1.433  -4.399  1.00 0.00 ? 42  GLN A HB3  5  
ATOM 9587  H HG2  . GLN A 1 42  ? 7.155   -2.094  -2.827  1.00 0.00 ? 42  GLN A HG2  5  
ATOM 9588  H HG3  . GLN A 1 42  ? 6.176   -3.467  -3.445  1.00 0.00 ? 42  GLN A HG3  5  
ATOM 9589  H HE21 . GLN A 1 42  ? 7.342   -5.226  -3.835  1.00 0.00 ? 42  GLN A HE21 5  
ATOM 9590  H HE22 . GLN A 1 42  ? 9.031   -5.273  -4.373  1.00 0.00 ? 42  GLN A HE22 5  
ATOM 9591  N N    . PRO A 1 43  ? 4.609   -4.090  -7.576  1.00 0.00 ? 43  PRO A N    5  
ATOM 9592  C CA   . PRO A 1 43  ? 3.326   -4.654  -8.093  1.00 0.00 ? 43  PRO A CA   5  
ATOM 9593  C C    . PRO A 1 43  ? 2.425   -5.363  -7.053  1.00 0.00 ? 43  PRO A C    5  
ATOM 9594  O O    . PRO A 1 43  ? 1.208   -5.303  -7.180  1.00 0.00 ? 43  PRO A O    5  
ATOM 9595  C CB   . PRO A 1 43  ? 3.772   -5.639  -9.209  1.00 0.00 ? 43  PRO A CB   5  
ATOM 9596  C CG   . PRO A 1 43  ? 5.214   -5.998  -8.875  1.00 0.00 ? 43  PRO A CG   5  
ATOM 9597  C CD   . PRO A 1 43  ? 5.717   -4.659  -8.353  1.00 0.00 ? 43  PRO A CD   5  
ATOM 9598  H HA   . PRO A 1 43  ? 2.755   -3.855  -8.580  1.00 0.00 ? 43  PRO A HA   5  
ATOM 9599  H HB2  . PRO A 1 43  ? 3.121   -6.526  -9.338  1.00 0.00 ? 43  PRO A HB2  5  
ATOM 9600  H HB3  . PRO A 1 43  ? 3.791   -5.093  -10.177 1.00 0.00 ? 43  PRO A HB3  5  
ATOM 9601  H HG2  . PRO A 1 43  ? 5.251   -6.770  -8.076  1.00 0.00 ? 43  PRO A HG2  5  
ATOM 9602  H HG3  . PRO A 1 43  ? 5.783   -6.344  -9.762  1.00 0.00 ? 43  PRO A HG3  5  
ATOM 9603  H HD2  . PRO A 1 43  ? 6.654   -4.798  -7.768  1.00 0.00 ? 43  PRO A HD2  5  
ATOM 9604  H HD3  . PRO A 1 43  ? 5.924   -4.004  -9.220  1.00 0.00 ? 43  PRO A HD3  5  
ATOM 9605  N N    . TYR A 1 44  ? 3.041   -5.986  -6.010  1.00 0.00 ? 44  TYR A N    5  
ATOM 9606  C CA   . TYR A 1 44  ? 2.507   -6.590  -4.803  1.00 0.00 ? 44  TYR A CA   5  
ATOM 9607  C C    . TYR A 1 44  ? 3.649   -6.502  -3.785  1.00 0.00 ? 44  TYR A C    5  
ATOM 9608  O O    . TYR A 1 44  ? 4.815   -6.327  -4.149  1.00 0.00 ? 44  TYR A O    5  
ATOM 9609  C CB   . TYR A 1 44  ? 1.984   -8.053  -4.936  1.00 0.00 ? 44  TYR A CB   5  
ATOM 9610  C CG   . TYR A 1 44  ? 0.642   -8.061  -5.662  1.00 0.00 ? 44  TYR A CG   5  
ATOM 9611  C CD1  . TYR A 1 44  ? -0.528  -7.679  -5.005  1.00 0.00 ? 44  TYR A CD1  5  
ATOM 9612  C CD2  . TYR A 1 44  ? 0.542   -8.387  -7.013  1.00 0.00 ? 44  TYR A CD2  5  
ATOM 9613  C CE1  . TYR A 1 44  ? -1.749  -7.690  -5.655  1.00 0.00 ? 44  TYR A CE1  5  
ATOM 9614  C CE2  . TYR A 1 44  ? -0.678  -8.381  -7.666  1.00 0.00 ? 44  TYR A CE2  5  
ATOM 9615  C CZ   . TYR A 1 44  ? -1.825  -8.047  -6.983  1.00 0.00 ? 44  TYR A CZ   5  
ATOM 9616  O OH   . TYR A 1 44  ? -3.061  -8.031  -7.663  1.00 0.00 ? 44  TYR A OH   5  
ATOM 9617  H H    . TYR A 1 44  ? 4.031   -5.938  -5.983  1.00 0.00 ? 44  TYR A H    5  
ATOM 9618  H HA   . TYR A 1 44  ? 1.733   -5.933  -4.428  1.00 0.00 ? 44  TYR A HA   5  
ATOM 9619  H HB2  . TYR A 1 44  ? 2.743   -8.671  -5.463  1.00 0.00 ? 44  TYR A HB2  5  
ATOM 9620  H HB3  . TYR A 1 44  ? 1.838   -8.540  -3.944  1.00 0.00 ? 44  TYR A HB3  5  
ATOM 9621  H HD1  . TYR A 1 44  ? -0.517  -7.339  -3.975  1.00 0.00 ? 44  TYR A HD1  5  
ATOM 9622  H HD2  . TYR A 1 44  ? 1.420   -8.610  -7.605  1.00 0.00 ? 44  TYR A HD2  5  
ATOM 9623  H HE1  . TYR A 1 44  ? -2.648  -7.399  -5.125  1.00 0.00 ? 44  TYR A HE1  5  
ATOM 9624  H HE2  . TYR A 1 44  ? -0.720  -8.634  -8.717  1.00 0.00 ? 44  TYR A HE2  5  
ATOM 9625  H HH   . TYR A 1 44  ? -2.866  -8.026  -8.603  1.00 0.00 ? 44  TYR A HH   5  
ATOM 9626  N N    . MET A 1 45  ? 3.278   -6.573  -2.479  1.00 0.00 ? 45  MET A N    5  
ATOM 9627  C CA   . MET A 1 45  ? 4.141   -6.319  -1.325  1.00 0.00 ? 45  MET A CA   5  
ATOM 9628  C C    . MET A 1 45  ? 3.588   -7.024  -0.070  1.00 0.00 ? 45  MET A C    5  
ATOM 9629  O O    . MET A 1 45  ? 2.412   -6.788  0.201   1.00 0.00 ? 45  MET A O    5  
ATOM 9630  C CB   . MET A 1 45  ? 4.027   -4.770  -1.099  1.00 0.00 ? 45  MET A CB   5  
ATOM 9631  C CG   . MET A 1 45  ? 5.088   -3.939  -0.400  1.00 0.00 ? 45  MET A CG   5  
ATOM 9632  S SD   . MET A 1 45  ? 4.610   -2.183  -0.538  1.00 0.00 ? 45  MET A SD   5  
ATOM 9633  C CE   . MET A 1 45  ? 6.186   -1.567  0.068   1.00 0.00 ? 45  MET A CE   5  
ATOM 9634  H H    . MET A 1 45  ? 2.301   -6.668  -2.277  1.00 0.00 ? 45  MET A H    5  
ATOM 9635  H HA   . MET A 1 45  ? 5.158   -6.627  -1.534  1.00 0.00 ? 45  MET A HA   5  
ATOM 9636  H HB2  . MET A 1 45  ? 3.967   -4.322  -2.117  1.00 0.00 ? 45  MET A HB2  5  
ATOM 9637  H HB3  . MET A 1 45  ? 3.098   -4.504  -0.538  1.00 0.00 ? 45  MET A HB3  5  
ATOM 9638  H HG2  . MET A 1 45  ? 5.134   -4.227  0.666   1.00 0.00 ? 45  MET A HG2  5  
ATOM 9639  H HG3  . MET A 1 45  ? 6.076   -4.112  -0.878  1.00 0.00 ? 45  MET A HG3  5  
ATOM 9640  H HE1  . MET A 1 45  ? 6.407   -1.967  1.076   1.00 0.00 ? 45  MET A HE1  5  
ATOM 9641  H HE2  . MET A 1 45  ? 7.009   -1.897  -0.599  1.00 0.00 ? 45  MET A HE2  5  
ATOM 9642  H HE3  . MET A 1 45  ? 6.194   -0.458  0.107   1.00 0.00 ? 45  MET A HE3  5  
ATOM 9643  N N    . PRO A 1 46  ? 4.224   -7.861  0.795   1.00 0.00 ? 46  PRO A N    5  
ATOM 9644  C CA   . PRO A 1 46  ? 3.633   -8.280  2.084   1.00 0.00 ? 46  PRO A CA   5  
ATOM 9645  C C    . PRO A 1 46  ? 3.623   -7.108  3.096   1.00 0.00 ? 46  PRO A C    5  
ATOM 9646  O O    . PRO A 1 46  ? 4.326   -6.117  2.896   1.00 0.00 ? 46  PRO A O    5  
ATOM 9647  C CB   . PRO A 1 46  ? 4.647   -9.358  2.548   1.00 0.00 ? 46  PRO A CB   5  
ATOM 9648  C CG   . PRO A 1 46  ? 6.004   -8.845  2.043   1.00 0.00 ? 46  PRO A CG   5  
ATOM 9649  C CD   . PRO A 1 46  ? 5.598   -8.357  0.636   1.00 0.00 ? 46  PRO A CD   5  
ATOM 9650  H HA   . PRO A 1 46  ? 2.608   -8.649  1.976   1.00 0.00 ? 46  PRO A HA   5  
ATOM 9651  H HB2  . PRO A 1 46  ? 4.646   -9.561  3.634   1.00 0.00 ? 46  PRO A HB2  5  
ATOM 9652  H HB3  . PRO A 1 46  ? 4.414   -10.314 2.029   1.00 0.00 ? 46  PRO A HB3  5  
ATOM 9653  H HG2  . PRO A 1 46  ? 6.401   -8.041  2.722   1.00 0.00 ? 46  PRO A HG2  5  
ATOM 9654  H HG3  . PRO A 1 46  ? 6.785   -9.628  2.021   1.00 0.00 ? 46  PRO A HG3  5  
ATOM 9655  H HD2  . PRO A 1 46  ? 6.299   -7.545  0.270   1.00 0.00 ? 46  PRO A HD2  5  
ATOM 9656  H HD3  . PRO A 1 46  ? 5.530   -9.284  -0.025  1.00 0.00 ? 46  PRO A HD3  5  
ATOM 9657  N N    . ILE A 1 47  ? 2.892   -7.204  4.245   1.00 0.00 ? 47  ILE A N    5  
ATOM 9658  C CA   . ILE A 1 47  ? 2.858   -6.199  5.334   1.00 0.00 ? 47  ILE A CA   5  
ATOM 9659  C C    . ILE A 1 47  ? 4.253   -6.049  5.980   1.00 0.00 ? 47  ILE A C    5  
ATOM 9660  O O    . ILE A 1 47  ? 4.743   -4.921  6.065   1.00 0.00 ? 47  ILE A O    5  
ATOM 9661  C CB   . ILE A 1 47  ? 1.655   -6.297  6.283   1.00 0.00 ? 47  ILE A CB   5  
ATOM 9662  C CG1  . ILE A 1 47  ? 0.363   -6.585  5.466   1.00 0.00 ? 47  ILE A CG1  5  
ATOM 9663  C CG2  . ILE A 1 47  ? 1.497   -4.982  7.088   1.00 0.00 ? 47  ILE A CG2  5  
ATOM 9664  C CD1  . ILE A 1 47  ? -0.938  -6.338  6.244   1.00 0.00 ? 47  ILE A CD1  5  
ATOM 9665  H H    . ILE A 1 47  ? 2.373   -8.031  4.402   1.00 0.00 ? 47  ILE A H    5  
ATOM 9666  H HA   . ILE A 1 47  ? 2.700   -5.252  4.839   1.00 0.00 ? 47  ILE A HA   5  
ATOM 9667  H HB   . ILE A 1 47  ? 1.792   -7.132  7.000   1.00 0.00 ? 47  ILE A HB   5  
ATOM 9668  H HG12 . ILE A 1 47  ? 0.353   -5.842  4.585   1.00 0.00 ? 47  ILE A HG12 5  
ATOM 9669  H HG13 . ILE A 1 47  ? 0.345   -7.714  5.229   1.00 0.00 ? 47  ILE A HG13 5  
ATOM 9670  H HG21 . ILE A 1 47  ? 2.449   -4.635  7.533   1.00 0.00 ? 47  ILE A HG21 5  
ATOM 9671  H HG22 . ILE A 1 47  ? 1.091   -4.190  6.424   1.00 0.00 ? 47  ILE A HG22 5  
ATOM 9672  H HG23 . ILE A 1 47  ? 0.783   -5.124  7.928   1.00 0.00 ? 47  ILE A HG23 5  
ATOM 9673  H HD11 . ILE A 1 47  ? -0.921  -6.888  7.208   1.00 0.00 ? 47  ILE A HD11 5  
ATOM 9674  H HD12 . ILE A 1 47  ? -1.089  -5.257  6.448   1.00 0.00 ? 47  ILE A HD12 5  
ATOM 9675  H HD13 . ILE A 1 47  ? -1.799  -6.699  5.645   1.00 0.00 ? 47  ILE A HD13 5  
ATOM 9676  N N    . PRO A 1 48  ? 4.992   -7.133  6.362   1.00 0.00 ? 48  PRO A N    5  
ATOM 9677  C CA   . PRO A 1 48  ? 6.426   -7.211  6.579   1.00 0.00 ? 48  PRO A CA   5  
ATOM 9678  C C    . PRO A 1 48  ? 7.389   -6.670  5.522   1.00 0.00 ? 48  PRO A C    5  
ATOM 9679  O O    . PRO A 1 48  ? 8.566   -6.595  5.814   1.00 0.00 ? 48  PRO A O    5  
ATOM 9680  C CB   . PRO A 1 48  ? 6.750   -8.372  7.527   1.00 0.00 ? 48  PRO A CB   5  
ATOM 9681  C CG   . PRO A 1 48  ? 5.408   -9.109  7.649   1.00 0.00 ? 48  PRO A CG   5  
ATOM 9682  C CD   . PRO A 1 48  ? 4.471   -8.480  6.584   1.00 0.00 ? 48  PRO A CD   5  
ATOM 9683  H HA   . PRO A 1 48  ? 6.574   -6.385  7.236   1.00 0.00 ? 48  PRO A HA   5  
ATOM 9684  H HB2  . PRO A 1 48  ? 7.512   -9.052  7.071   1.00 0.00 ? 48  PRO A HB2  5  
ATOM 9685  H HB3  . PRO A 1 48  ? 7.075   -7.937  8.552   1.00 0.00 ? 48  PRO A HB3  5  
ATOM 9686  H HG2  . PRO A 1 48  ? 5.526   -10.199 7.487   1.00 0.00 ? 48  PRO A HG2  5  
ATOM 9687  H HG3  . PRO A 1 48  ? 4.991   -8.946  8.665   1.00 0.00 ? 48  PRO A HG3  5  
ATOM 9688  H HD2  . PRO A 1 48  ? 4.559   -9.061  5.633   1.00 0.00 ? 48  PRO A HD2  5  
ATOM 9689  H HD3  . PRO A 1 48  ? 3.430   -8.488  6.988   1.00 0.00 ? 48  PRO A HD3  5  
ATOM 9690  N N    . HIS A 1 49  ? 7.032   -6.341  4.239   1.00 0.00 ? 49  HIS A N    5  
ATOM 9691  C CA   . HIS A 1 49  ? 7.970   -5.664  3.271   1.00 0.00 ? 49  HIS A CA   5  
ATOM 9692  C C    . HIS A 1 49  ? 8.481   -4.352  3.856   1.00 0.00 ? 49  HIS A C    5  
ATOM 9693  O O    . HIS A 1 49  ? 9.659   -4.032  3.924   1.00 0.00 ? 49  HIS A O    5  
ATOM 9694  C CB   . HIS A 1 49  ? 7.290   -5.235  1.917   1.00 0.00 ? 49  HIS A CB   5  
ATOM 9695  C CG   . HIS A 1 49  ? 8.134   -4.464  0.888   1.00 0.00 ? 49  HIS A CG   5  
ATOM 9696  N ND1  . HIS A 1 49  ? 8.667   -3.207  1.112   1.00 0.00 ? 49  HIS A ND1  5  
ATOM 9697  C CD2  . HIS A 1 49  ? 8.540   -4.799  -0.368  1.00 0.00 ? 49  HIS A CD2  5  
ATOM 9698  C CE1  . HIS A 1 49  ? 9.392   -2.861  0.037   1.00 0.00 ? 49  HIS A CE1  5  
ATOM 9699  N NE2  . HIS A 1 49  ? 9.347   -3.801  -0.892  1.00 0.00 ? 49  HIS A NE2  5  
ATOM 9700  H H    . HIS A 1 49  ? 6.051   -6.380  4.034   1.00 0.00 ? 49  HIS A H    5  
ATOM 9701  H HA   . HIS A 1 49  ? 8.818   -6.292  3.061   1.00 0.00 ? 49  HIS A HA   5  
ATOM 9702  H HB2  . HIS A 1 49  ? 6.878   -6.132  1.433   1.00 0.00 ? 49  HIS A HB2  5  
ATOM 9703  H HB3  . HIS A 1 49  ? 6.389   -4.626  2.116   1.00 0.00 ? 49  HIS A HB3  5  
ATOM 9704  H HD1  . HIS A 1 49  ? 8.586   -2.658  1.944   1.00 0.00 ? 49  HIS A HD1  5  
ATOM 9705  H HD2  . HIS A 1 49  ? 8.237   -5.636  -0.985  1.00 0.00 ? 49  HIS A HD2  5  
ATOM 9706  H HE1  . HIS A 1 49  ? 9.898   -1.883  0.074   1.00 0.00 ? 49  HIS A HE1  5  
ATOM 9707  N N    . VAL A 1 50  ? 7.478   -3.610  4.358   1.00 0.00 ? 50  VAL A N    5  
ATOM 9708  C CA   . VAL A 1 50  ? 7.521   -2.422  5.169   1.00 0.00 ? 50  VAL A CA   5  
ATOM 9709  C C    . VAL A 1 50  ? 7.838   -2.792  6.647   1.00 0.00 ? 50  VAL A C    5  
ATOM 9710  O O    . VAL A 1 50  ? 8.814   -2.263  7.177   1.00 0.00 ? 50  VAL A O    5  
ATOM 9711  C CB   . VAL A 1 50  ? 6.385   -1.443  4.804   1.00 0.00 ? 50  VAL A CB   5  
ATOM 9712  C CG1  . VAL A 1 50  ? 5.305   -2.043  3.882   1.00 0.00 ? 50  VAL A CG1  5  
ATOM 9713  C CG2  . VAL A 1 50  ? 5.766   -0.830  6.054   1.00 0.00 ? 50  VAL A CG2  5  
ATOM 9714  H H    . VAL A 1 50  ? 6.565   -3.976  4.267   1.00 0.00 ? 50  VAL A H    5  
ATOM 9715  H HA   . VAL A 1 50  ? 8.425   -1.894  4.878   1.00 0.00 ? 50  VAL A HA   5  
ATOM 9716  H HB   . VAL A 1 50  ? 6.781   -0.608  4.184   1.00 0.00 ? 50  VAL A HB   5  
ATOM 9717  H HG11 . VAL A 1 50  ? 4.812   -2.891  4.381   1.00 0.00 ? 50  VAL A HG11 5  
ATOM 9718  H HG12 . VAL A 1 50  ? 4.554   -1.240  3.682   1.00 0.00 ? 50  VAL A HG12 5  
ATOM 9719  H HG13 . VAL A 1 50  ? 5.668   -2.374  2.888   1.00 0.00 ? 50  VAL A HG13 5  
ATOM 9720  H HG21 . VAL A 1 50  ? 6.568   -0.311  6.623   1.00 0.00 ? 50  VAL A HG21 5  
ATOM 9721  H HG22 . VAL A 1 50  ? 4.987   -0.095  5.772   1.00 0.00 ? 50  VAL A HG22 5  
ATOM 9722  H HG23 . VAL A 1 50  ? 5.297   -1.649  6.647   1.00 0.00 ? 50  VAL A HG23 5  
ATOM 9723  N N    . ARG A 1 51  ? 7.109   -3.761  7.336   1.00 0.00 ? 51  ARG A N    5  
ATOM 9724  C CA   . ARG A 1 51  ? 7.444   -4.277  8.692   1.00 0.00 ? 51  ARG A CA   5  
ATOM 9725  C C    . ARG A 1 51  ? 8.813   -4.971  8.899   1.00 0.00 ? 51  ARG A C    5  
ATOM 9726  O O    . ARG A 1 51  ? 9.291   -5.107  10.014  1.00 0.00 ? 51  ARG A O    5  
ATOM 9727  C CB   . ARG A 1 51  ? 6.357   -5.093  9.464   1.00 0.00 ? 51  ARG A CB   5  
ATOM 9728  C CG   . ARG A 1 51  ? 4.953   -4.518  9.321   1.00 0.00 ? 51  ARG A CG   5  
ATOM 9729  C CD   . ARG A 1 51  ? 3.835   -5.232  10.106  1.00 0.00 ? 51  ARG A CD   5  
ATOM 9730  N NE   . ARG A 1 51  ? 3.601   -6.631  9.601   1.00 0.00 ? 51  ARG A NE   5  
ATOM 9731  C CZ   . ARG A 1 51  ? 2.464   -7.337  9.902   1.00 0.00 ? 51  ARG A CZ   5  
ATOM 9732  N NH1  . ARG A 1 51  ? 1.463   -6.777  10.641  1.00 0.00 ? 51  ARG A NH1  5  
ATOM 9733  N NH2  . ARG A 1 51  ? 2.327   -8.622  9.460   1.00 0.00 ? 51  ARG A NH2  5  
ATOM 9734  H H    . ARG A 1 51  ? 6.278   -4.171  6.945   1.00 0.00 ? 51  ARG A H    5  
ATOM 9735  H HA   . ARG A 1 51  ? 7.503   -3.375  9.280   1.00 0.00 ? 51  ARG A HA   5  
ATOM 9736  H HB2  . ARG A 1 51  ? 6.334   -6.154  9.166   1.00 0.00 ? 51  ARG A HB2  5  
ATOM 9737  H HB3  . ARG A 1 51  ? 6.600   -5.081  10.553  1.00 0.00 ? 51  ARG A HB3  5  
ATOM 9738  H HG2  . ARG A 1 51  ? 5.055   -3.477  9.678   1.00 0.00 ? 51  ARG A HG2  5  
ATOM 9739  H HG3  . ARG A 1 51  ? 4.644   -4.440  8.269   1.00 0.00 ? 51  ARG A HG3  5  
ATOM 9740  H HD2  . ARG A 1 51  ? 4.083   -5.264  11.188  1.00 0.00 ? 51  ARG A HD2  5  
ATOM 9741  H HD3  . ARG A 1 51  ? 2.896   -4.658  9.956   1.00 0.00 ? 51  ARG A HD3  5  
ATOM 9742  H HE   . ARG A 1 51  ? 4.314   -7.070  9.057   1.00 0.00 ? 51  ARG A HE   5  
ATOM 9743  H HH11 . ARG A 1 51  ? 1.554   -5.837  10.974  1.00 0.00 ? 51  ARG A HH11 5  
ATOM 9744  H HH12 . ARG A 1 51  ? 0.642   -7.306  10.855  1.00 0.00 ? 51  ARG A HH12 5  
ATOM 9745  H HH21 . ARG A 1 51  ? 3.053   -9.043  8.918   1.00 0.00 ? 51  ARG A HH21 5  
ATOM 9746  H HH22 . ARG A 1 51  ? 1.499   -9.139  9.679   1.00 0.00 ? 51  ARG A HH22 5  
ATOM 9747  N N    . ASP A 1 52  ? 9.560   -5.415  7.863   1.00 0.00 ? 52  ASP A N    5  
ATOM 9748  C CA   . ASP A 1 52  ? 10.986  -5.792  8.001   1.00 0.00 ? 52  ASP A CA   5  
ATOM 9749  C C    . ASP A 1 52  ? 11.968  -4.591  8.076   1.00 0.00 ? 52  ASP A C    5  
ATOM 9750  O O    . ASP A 1 52  ? 13.143  -4.774  8.366   1.00 0.00 ? 52  ASP A O    5  
ATOM 9751  C CB   . ASP A 1 52  ? 11.493  -6.778  6.901   1.00 0.00 ? 52  ASP A CB   5  
ATOM 9752  C CG   . ASP A 1 52  ? 10.837  -8.163  7.020   1.00 0.00 ? 52  ASP A CG   5  
ATOM 9753  O OD1  . ASP A 1 52  ? 10.259  -8.480  8.094   1.00 0.00 ? 52  ASP A OD1  5  
ATOM 9754  O OD2  . ASP A 1 52  ? 10.919  -8.927  6.022   1.00 0.00 ? 52  ASP A OD2  5  
ATOM 9755  H H    . ASP A 1 52  ? 9.173   -5.529  6.905   1.00 0.00 ? 52  ASP A H    5  
ATOM 9756  H HA   . ASP A 1 52  ? 11.122  -6.311  8.942   1.00 0.00 ? 52  ASP A HA   5  
ATOM 9757  H HB2  . ASP A 1 52  ? 11.268  -6.358  5.897   1.00 0.00 ? 52  ASP A HB2  5  
ATOM 9758  H HB3  . ASP A 1 52  ? 12.592  -6.943  6.972   1.00 0.00 ? 52  ASP A HB3  5  
ATOM 9759  N N    . SER A 1 53  ? 11.532  -3.339  7.718   1.00 0.00 ? 53  SER A N    5  
ATOM 9760  C CA   . SER A 1 53  ? 12.357  -2.149  7.555   1.00 0.00 ? 53  SER A CA   5  
ATOM 9761  C C    . SER A 1 53  ? 12.545  -1.260  8.742   1.00 0.00 ? 53  SER A C    5  
ATOM 9762  O O    . SER A 1 53  ? 13.372  -0.353  8.666   1.00 0.00 ? 53  SER A O    5  
ATOM 9763  C CB   . SER A 1 53  ? 11.974  -1.240  6.388   1.00 0.00 ? 53  SER A CB   5  
ATOM 9764  O OG   . SER A 1 53  ? 13.089  -0.474  5.891   1.00 0.00 ? 53  SER A OG   5  
ATOM 9765  H H    . SER A 1 53  ? 10.574  -3.111  7.503   1.00 0.00 ? 53  SER A H    5  
ATOM 9766  H HA   . SER A 1 53  ? 13.344  -2.472  7.281   1.00 0.00 ? 53  SER A HA   5  
ATOM 9767  H HB2  . SER A 1 53  ? 11.552  -1.842  5.552   1.00 0.00 ? 53  SER A HB2  5  
ATOM 9768  H HB3  . SER A 1 53  ? 11.189  -0.583  6.807   1.00 0.00 ? 53  SER A HB3  5  
ATOM 9769  H HG   . SER A 1 53  ? 13.563  -0.151  6.680   1.00 0.00 ? 53  SER A HG   5  
ATOM 9770  N N    . LEU A 1 54  ? 11.742  -1.373  9.834   1.00 0.00 ? 54  LEU A N    5  
ATOM 9771  C CA   . LEU A 1 54  ? 11.681  -0.419  10.930  1.00 0.00 ? 54  LEU A CA   5  
ATOM 9772  C C    . LEU A 1 54  ? 13.017  -0.371  11.728  1.00 0.00 ? 54  LEU A C    5  
ATOM 9773  O O    . LEU A 1 54  ? 13.390  0.629   12.340  1.00 0.00 ? 54  LEU A O    5  
ATOM 9774  C CB   . LEU A 1 54  ? 10.597  -0.877  12.002  1.00 0.00 ? 54  LEU A CB   5  
ATOM 9775  C CG   . LEU A 1 54  ? 10.155  -2.363  12.151  1.00 0.00 ? 54  LEU A CG   5  
ATOM 9776  C CD1  . LEU A 1 54  ? 8.838   -2.642  11.442  1.00 0.00 ? 54  LEU A CD1  5  
ATOM 9777  C CD2  . LEU A 1 54  ? 11.182  -3.500  12.049  1.00 0.00 ? 54  LEU A CD2  5  
ATOM 9778  H H    . LEU A 1 54  ? 11.009  -2.040  9.837   1.00 0.00 ? 54  LEU A H    5  
ATOM 9779  H HA   . LEU A 1 54  ? 11.383  0.516   10.428  1.00 0.00 ? 54  LEU A HA   5  
ATOM 9780  H HB2  . LEU A 1 54  ? 10.937  -0.655  13.073  1.00 0.00 ? 54  LEU A HB2  5  
ATOM 9781  H HB3  . LEU A 1 54  ? 9.652   -0.318  11.690  1.00 0.00 ? 54  LEU A HB3  5  
ATOM 9782  H HG   . LEU A 1 54  ? 9.808   -2.508  13.208  1.00 0.00 ? 54  LEU A HG   5  
ATOM 9783  H HD11 . LEU A 1 54  ? 8.030   -1.957  11.767  1.00 0.00 ? 54  LEU A HD11 5  
ATOM 9784  H HD12 . LEU A 1 54  ? 8.999   -2.596  10.355  1.00 0.00 ? 54  LEU A HD12 5  
ATOM 9785  H HD13 . LEU A 1 54  ? 8.524   -3.678  11.699  1.00 0.00 ? 54  LEU A HD13 5  
ATOM 9786  H HD21 . LEU A 1 54  ? 11.902  -3.538  11.220  1.00 0.00 ? 54  LEU A HD21 5  
ATOM 9787  H HD22 . LEU A 1 54  ? 11.777  -3.535  12.988  1.00 0.00 ? 54  LEU A HD22 5  
ATOM 9788  H HD23 . LEU A 1 54  ? 10.595  -4.446  11.978  1.00 0.00 ? 54  LEU A HD23 5  
ATOM 9789  N N    . ILE A 1 55  ? 13.698  -1.540  11.625  1.00 0.00 ? 55  ILE A N    5  
ATOM 9790  C CA   . ILE A 1 55  ? 15.012  -2.009  12.074  1.00 0.00 ? 55  ILE A CA   5  
ATOM 9791  C C    . ILE A 1 55  ? 15.345  -3.137  11.091  1.00 0.00 ? 55  ILE A C    5  
ATOM 9792  O O    . ILE A 1 55  ? 14.516  -4.030  10.932  1.00 0.00 ? 55  ILE A O    5  
ATOM 9793  C CB   . ILE A 1 55  ? 15.040  -2.553  13.517  1.00 0.00 ? 55  ILE A CB   5  
ATOM 9794  C CG1  . ILE A 1 55  ? 14.696  -1.496  14.587  1.00 0.00 ? 55  ILE A CG1  5  
ATOM 9795  C CG2  . ILE A 1 55  ? 16.390  -3.207  13.898  1.00 0.00 ? 55  ILE A CG2  5  
ATOM 9796  C CD1  . ILE A 1 55  ? 13.382  -1.864  15.262  1.00 0.00 ? 55  ILE A CD1  5  
ATOM 9797  H H    . ILE A 1 55  ? 13.185  -2.138  10.987  1.00 0.00 ? 55  ILE A H    5  
ATOM 9798  H HA   . ILE A 1 55  ? 15.731  -1.211  11.949  1.00 0.00 ? 55  ILE A HA   5  
ATOM 9799  H HB   . ILE A 1 55  ? 14.263  -3.350  13.605  1.00 0.00 ? 55  ILE A HB   5  
ATOM 9800  H HG12 . ILE A 1 55  ? 15.504  -1.476  15.363  1.00 0.00 ? 55  ILE A HG12 5  
ATOM 9801  H HG13 . ILE A 1 55  ? 14.581  -0.475  14.152  1.00 0.00 ? 55  ILE A HG13 5  
ATOM 9802  H HG21 . ILE A 1 55  ? 17.246  -2.560  13.615  1.00 0.00 ? 55  ILE A HG21 5  
ATOM 9803  H HG22 . ILE A 1 55  ? 16.408  -3.370  14.999  1.00 0.00 ? 55  ILE A HG22 5  
ATOM 9804  H HG23 . ILE A 1 55  ? 16.480  -4.214  13.446  1.00 0.00 ? 55  ILE A HG23 5  
ATOM 9805  H HD11 . ILE A 1 55  ? 13.429  -2.884  15.702  1.00 0.00 ? 55  ILE A HD11 5  
ATOM 9806  H HD12 . ILE A 1 55  ? 13.204  -1.124  16.063  1.00 0.00 ? 55  ILE A HD12 5  
ATOM 9807  H HD13 . ILE A 1 55  ? 12.555  -1.817  14.517  1.00 0.00 ? 55  ILE A HD13 5  
ATOM 9808  N N    . GLN A 1 56  ? 16.542  -3.158  10.439  1.00 0.00 ? 56  GLN A N    5  
ATOM 9809  C CA   . GLN A 1 56  ? 16.979  -4.153  9.440   1.00 0.00 ? 56  GLN A CA   5  
ATOM 9810  C C    . GLN A 1 56  ? 17.184  -5.652  9.816   1.00 0.00 ? 56  GLN A C    5  
ATOM 9811  O O    . GLN A 1 56  ? 16.641  -6.485  9.095   1.00 0.00 ? 56  GLN A O    5  
ATOM 9812  C CB   . GLN A 1 56  ? 18.256  -3.690  8.657   1.00 0.00 ? 56  GLN A CB   5  
ATOM 9813  C CG   . GLN A 1 56  ? 18.171  -2.288  8.009   1.00 0.00 ? 56  GLN A CG   5  
ATOM 9814  C CD   . GLN A 1 56  ? 19.475  -1.973  7.263   1.00 0.00 ? 56  GLN A CD   5  
ATOM 9815  O OE1  . GLN A 1 56  ? 20.249  -1.095  7.650   1.00 0.00 ? 56  GLN A OE1  5  
ATOM 9816  N NE2  . GLN A 1 56  ? 19.741  -2.720  6.160   1.00 0.00 ? 56  GLN A NE2  5  
ATOM 9817  H H    . GLN A 1 56  ? 17.192  -2.427  10.609  1.00 0.00 ? 56  GLN A H    5  
ATOM 9818  H HA   . GLN A 1 56  ? 16.193  -4.178  8.696   1.00 0.00 ? 56  GLN A HA   5  
ATOM 9819  H HB2  . GLN A 1 56  ? 19.132  -3.623  9.380   1.00 0.00 ? 56  GLN A HB2  5  
ATOM 9820  H HB3  . GLN A 1 56  ? 18.395  -4.418  7.786   1.00 0.00 ? 56  GLN A HB3  5  
ATOM 9821  H HG2  . GLN A 1 56  ? 17.321  -2.235  7.300   1.00 0.00 ? 56  GLN A HG2  5  
ATOM 9822  H HG3  . GLN A 1 56  ? 18.039  -1.504  8.783   1.00 0.00 ? 56  GLN A HG3  5  
ATOM 9823  H HE21 . GLN A 1 56  ? 19.060  -3.379  5.849   1.00 0.00 ? 56  GLN A HE21 5  
ATOM 9824  H HE22 . GLN A 1 56  ? 20.594  -2.544  5.677   1.00 0.00 ? 56  GLN A HE22 5  
ATOM 9825  N N    . PRO A 1 57  ? 17.952  -6.089  10.842  1.00 0.00 ? 57  PRO A N    5  
ATOM 9826  C CA   . PRO A 1 57  ? 18.367  -7.494  11.020  1.00 0.00 ? 57  PRO A CA   5  
ATOM 9827  C C    . PRO A 1 57  ? 17.347  -8.369  11.774  1.00 0.00 ? 57  PRO A C    5  
ATOM 9828  O O    . PRO A 1 57  ? 16.207  -8.498  11.348  1.00 0.00 ? 57  PRO A O    5  
ATOM 9829  C CB   . PRO A 1 57  ? 19.669  -7.302  11.831  1.00 0.00 ? 57  PRO A CB   5  
ATOM 9830  C CG   . PRO A 1 57  ? 19.302  -6.148  12.762  1.00 0.00 ? 57  PRO A CG   5  
ATOM 9831  C CD   . PRO A 1 57  ? 18.697  -5.196  11.732  1.00 0.00 ? 57  PRO A CD   5  
ATOM 9832  H HA   . PRO A 1 57  ? 18.562  -7.975  10.069  1.00 0.00 ? 57  PRO A HA   5  
ATOM 9833  H HB2  . PRO A 1 57  ? 20.073  -8.198  12.335  1.00 0.00 ? 57  PRO A HB2  5  
ATOM 9834  H HB3  . PRO A 1 57  ? 20.466  -6.950  11.134  1.00 0.00 ? 57  PRO A HB3  5  
ATOM 9835  H HG2  . PRO A 1 57  ? 18.513  -6.492  13.481  1.00 0.00 ? 57  PRO A HG2  5  
ATOM 9836  H HG3  . PRO A 1 57  ? 20.170  -5.735  13.313  1.00 0.00 ? 57  PRO A HG3  5  
ATOM 9837  H HD2  . PRO A 1 57  ? 18.025  -4.425  12.197  1.00 0.00 ? 57  PRO A HD2  5  
ATOM 9838  H HD3  . PRO A 1 57  ? 19.557  -4.756  11.147  1.00 0.00 ? 57  PRO A HD3  5  
ATOM 9839  N N    . HIS A 1 58  ? 17.789  -8.990  12.905  1.00 0.00 ? 58  HIS A N    5  
ATOM 9840  C CA   . HIS A 1 58  ? 17.123  -9.893  13.841  1.00 0.00 ? 58  HIS A CA   5  
ATOM 9841  C C    . HIS A 1 58  ? 16.150  -9.242  14.822  1.00 0.00 ? 58  HIS A C    5  
ATOM 9842  O O    . HIS A 1 58  ? 15.221  -9.880  15.300  1.00 0.00 ? 58  HIS A O    5  
ATOM 9843  C CB   . HIS A 1 58  ? 18.137  -10.834 14.548  1.00 0.00 ? 58  HIS A CB   5  
ATOM 9844  C CG   . HIS A 1 58  ? 19.232  -10.105 15.282  1.00 0.00 ? 58  HIS A CG   5  
ATOM 9845  N ND1  . HIS A 1 58  ? 20.556  -10.068 14.897  1.00 0.00 ? 58  HIS A ND1  5  
ATOM 9846  C CD2  . HIS A 1 58  ? 19.160  -9.364  16.419  1.00 0.00 ? 58  HIS A CD2  5  
ATOM 9847  C CE1  . HIS A 1 58  ? 21.211  -9.312  15.813  1.00 0.00 ? 58  HIS A CE1  5  
ATOM 9848  N NE2  . HIS A 1 58  ? 20.404  -8.861  16.751  1.00 0.00 ? 58  HIS A NE2  5  
ATOM 9849  H H    . HIS A 1 58  ? 18.740  -8.828  13.157  1.00 0.00 ? 58  HIS A H    5  
ATOM 9850  H HA   . HIS A 1 58  ? 16.501  -10.550 13.258  1.00 0.00 ? 58  HIS A HA   5  
ATOM 9851  H HB2  . HIS A 1 58  ? 17.608  -11.529 15.241  1.00 0.00 ? 58  HIS A HB2  5  
ATOM 9852  H HB3  . HIS A 1 58  ? 18.615  -11.467 13.765  1.00 0.00 ? 58  HIS A HB3  5  
ATOM 9853  H HD1  . HIS A 1 58  ? 20.979  -10.600 14.161  1.00 0.00 ? 58  HIS A HD1  5  
ATOM 9854  H HD2  . HIS A 1 58  ? 18.291  -9.152  17.027  1.00 0.00 ? 58  HIS A HD2  5  
ATOM 9855  H HE1  . HIS A 1 58  ? 22.284  -9.122  15.778  1.00 0.00 ? 58  HIS A HE1  5  
ATOM 9856  N N    . ASP A 1 59  ? 16.351  -7.936  15.156  1.00 0.00 ? 59  ASP A N    5  
ATOM 9857  C CA   . ASP A 1 59  ? 15.564  -7.084  16.034  1.00 0.00 ? 59  ASP A CA   5  
ATOM 9858  C C    . ASP A 1 59  ? 14.404  -6.435  15.301  1.00 0.00 ? 59  ASP A C    5  
ATOM 9859  O O    . ASP A 1 59  ? 13.718  -5.597  15.866  1.00 0.00 ? 59  ASP A O    5  
ATOM 9860  C CB   . ASP A 1 59  ? 16.425  -5.952  16.672  1.00 0.00 ? 59  ASP A CB   5  
ATOM 9861  C CG   . ASP A 1 59  ? 17.493  -6.538  17.598  1.00 0.00 ? 59  ASP A CG   5  
ATOM 9862  O OD1  . ASP A 1 59  ? 17.112  -7.247  18.569  1.00 0.00 ? 59  ASP A OD1  5  
ATOM 9863  O OD2  . ASP A 1 59  ? 18.699  -6.270  17.355  1.00 0.00 ? 59  ASP A OD2  5  
ATOM 9864  H H    . ASP A 1 59  ? 17.097  -7.415  14.777  1.00 0.00 ? 59  ASP A H    5  
ATOM 9865  H HA   . ASP A 1 59  ? 15.126  -7.672  16.832  1.00 0.00 ? 59  ASP A HA   5  
ATOM 9866  H HB2  . ASP A 1 59  ? 16.936  -5.371  15.866  1.00 0.00 ? 59  ASP A HB2  5  
ATOM 9867  H HB3  . ASP A 1 59  ? 15.800  -5.271  17.297  1.00 0.00 ? 59  ASP A HB3  5  
ATOM 9868  N N    . ARG A 1 60  ? 14.122  -6.789  14.012  1.00 0.00 ? 60  ARG A N    5  
ATOM 9869  C CA   . ARG A 1 60  ? 13.009  -6.297  13.195  1.00 0.00 ? 60  ARG A CA   5  
ATOM 9870  C C    . ARG A 1 60  ? 11.626  -6.592  13.737  1.00 0.00 ? 60  ARG A C    5  
ATOM 9871  O O    . ARG A 1 60  ? 10.728  -5.757  13.755  1.00 0.00 ? 60  ARG A O    5  
ATOM 9872  C CB   . ARG A 1 60  ? 13.091  -6.736  11.709  1.00 0.00 ? 60  ARG A CB   5  
ATOM 9873  C CG   . ARG A 1 60  ? 12.644  -8.140  11.264  1.00 0.00 ? 60  ARG A CG   5  
ATOM 9874  C CD   . ARG A 1 60  ? 13.293  -9.254  12.077  1.00 0.00 ? 60  ARG A CD   5  
ATOM 9875  N NE   . ARG A 1 60  ? 13.338  -10.515 11.266  1.00 0.00 ? 60  ARG A NE   5  
ATOM 9876  C CZ   . ARG A 1 60  ? 13.713  -11.724 11.782  1.00 0.00 ? 60  ARG A CZ   5  
ATOM 9877  N NH1  . ARG A 1 60  ? 13.966  -11.876 13.115  1.00 0.00 ? 60  ARG A NH1  5  
ATOM 9878  N NH2  . ARG A 1 60  ? 13.838  -12.792 10.944  1.00 0.00 ? 60  ARG A NH2  5  
ATOM 9879  H H    . ARG A 1 60  ? 14.709  -7.452  13.547  1.00 0.00 ? 60  ARG A H    5  
ATOM 9880  H HA   . ARG A 1 60  ? 13.105  -5.220  13.190  1.00 0.00 ? 60  ARG A HA   5  
ATOM 9881  H HB2  . ARG A 1 60  ? 12.522  -6.003  11.092  1.00 0.00 ? 60  ARG A HB2  5  
ATOM 9882  H HB3  . ARG A 1 60  ? 14.163  -6.702  11.437  1.00 0.00 ? 60  ARG A HB3  5  
ATOM 9883  H HG2  . ARG A 1 60  ? 11.539  -8.227  11.349  1.00 0.00 ? 60  ARG A HG2  5  
ATOM 9884  H HG3  . ARG A 1 60  ? 12.922  -8.235  10.188  1.00 0.00 ? 60  ARG A HG3  5  
ATOM 9885  H HD2  . ARG A 1 60  ? 14.297  -8.981  12.453  1.00 0.00 ? 60  ARG A HD2  5  
ATOM 9886  H HD3  . ARG A 1 60  ? 12.666  -9.375  12.963  1.00 0.00 ? 60  ARG A HD3  5  
ATOM 9887  H HE   . ARG A 1 60  ? 13.156  -10.451 10.285  1.00 0.00 ? 60  ARG A HE   5  
ATOM 9888  H HH11 . ARG A 1 60  ? 13.878  -11.093 13.731  1.00 0.00 ? 60  ARG A HH11 5  
ATOM 9889  H HH12 . ARG A 1 60  ? 14.236  -12.768 13.474  1.00 0.00 ? 60  ARG A HH12 5  
ATOM 9890  H HH21 . ARG A 1 60  ? 13.651  -12.685 9.968   1.00 0.00 ? 60  ARG A HH21 5  
ATOM 9891  H HH22 . ARG A 1 60  ? 14.107  -13.684 11.308  1.00 0.00 ? 60  ARG A HH22 5  
ATOM 9892  N N    . LYS A 1 61  ? 11.395  -7.810  14.301  1.00 0.00 ? 61  LYS A N    5  
ATOM 9893  C CA   . LYS A 1 61  ? 10.153  -8.232  14.924  1.00 0.00 ? 61  LYS A CA   5  
ATOM 9894  C C    . LYS A 1 61  ? 9.736   -7.458  16.172  1.00 0.00 ? 61  LYS A C    5  
ATOM 9895  O O    . LYS A 1 61  ? 8.562   -7.266  16.493  1.00 0.00 ? 61  LYS A O    5  
ATOM 9896  C CB   . LYS A 1 61  ? 9.452   -9.478  14.311  1.00 0.00 ? 61  LYS A CB   5  
ATOM 9897  C CG   . LYS A 1 61  ? 8.174   -9.995  15.023  1.00 0.00 ? 61  LYS A CG   5  
ATOM 9898  C CD   . LYS A 1 61  ? 8.431   -10.517 16.443  1.00 0.00 ? 61  LYS A CD   5  
ATOM 9899  C CE   . LYS A 1 61  ? 7.391   -11.515 16.961  1.00 0.00 ? 61  LYS A CE   5  
ATOM 9900  N NZ   . LYS A 1 61  ? 7.428   -12.780 16.190  1.00 0.00 ? 61  LYS A NZ   5  
ATOM 9901  H H    . LYS A 1 61  ? 12.109  -8.503  14.320  1.00 0.00 ? 61  LYS A H    5  
ATOM 9902  H HA   . LYS A 1 61  ? 9.497   -7.704  14.330  1.00 0.00 ? 61  LYS A HA   5  
ATOM 9903  H HB2  . LYS A 1 61  ? 9.130   -9.163  13.262  1.00 0.00 ? 61  LYS A HB2  5  
ATOM 9904  H HB3  . LYS A 1 61  ? 10.235  -10.262 14.187  1.00 0.00 ? 61  LYS A HB3  5  
ATOM 9905  H HG2  . LYS A 1 61  ? 7.403   -9.180  15.133  1.00 0.00 ? 61  LYS A HG2  5  
ATOM 9906  H HG3  . LYS A 1 61  ? 7.719   -10.798 14.405  1.00 0.00 ? 61  LYS A HG3  5  
ATOM 9907  H HD2  . LYS A 1 61  ? 9.450   -10.948 16.498  1.00 0.00 ? 61  LYS A HD2  5  
ATOM 9908  H HD3  . LYS A 1 61  ? 8.421   -9.602  17.085  1.00 0.00 ? 61  LYS A HD3  5  
ATOM 9909  H HE2  . LYS A 1 61  ? 7.597   -11.768 18.023  1.00 0.00 ? 61  LYS A HE2  5  
ATOM 9910  H HE3  . LYS A 1 61  ? 6.368   -11.093 16.876  1.00 0.00 ? 61  LYS A HE3  5  
ATOM 9911  H HZ1  . LYS A 1 61  ? 7.234   -12.580 15.188  1.00 0.00 ? 61  LYS A HZ1  5  
ATOM 9912  H HZ2  . LYS A 1 61  ? 8.368   -13.214 16.281  1.00 0.00 ? 61  LYS A HZ2  5  
ATOM 9913  H HZ3  . LYS A 1 61  ? 6.707   -13.433 16.559  1.00 0.00 ? 61  LYS A HZ3  5  
ATOM 9914  N N    . LYS A 1 62  ? 10.753  -6.885  16.854  1.00 0.00 ? 62  LYS A N    5  
ATOM 9915  C CA   . LYS A 1 62  ? 10.612  -5.996  17.987  1.00 0.00 ? 62  LYS A CA   5  
ATOM 9916  C C    . LYS A 1 62  ? 9.888   -4.653  17.749  1.00 0.00 ? 62  LYS A C    5  
ATOM 9917  O O    . LYS A 1 62  ? 9.166   -4.193  18.633  1.00 0.00 ? 62  LYS A O    5  
ATOM 9918  C CB   . LYS A 1 62  ? 12.008  -5.872  18.662  1.00 0.00 ? 62  LYS A CB   5  
ATOM 9919  C CG   . LYS A 1 62  ? 12.070  -4.868  19.821  1.00 0.00 ? 62  LYS A CG   5  
ATOM 9920  C CD   . LYS A 1 62  ? 12.653  -3.472  19.511  1.00 0.00 ? 62  LYS A CD   5  
ATOM 9921  C CE   . LYS A 1 62  ? 14.112  -3.483  19.036  1.00 0.00 ? 62  LYS A CE   5  
ATOM 9922  N NZ   . LYS A 1 62  ? 14.609  -2.103  18.819  1.00 0.00 ? 62  LYS A NZ   5  
ATOM 9923  H H    . LYS A 1 62  ? 11.685  -7.007  16.507  1.00 0.00 ? 62  LYS A H    5  
ATOM 9924  H HA   . LYS A 1 62  ? 9.913   -6.484  18.660  1.00 0.00 ? 62  LYS A HA   5  
ATOM 9925  H HB2  . LYS A 1 62  ? 12.214  -6.880  19.098  1.00 0.00 ? 62  LYS A HB2  5  
ATOM 9926  H HB3  . LYS A 1 62  ? 12.829  -5.710  17.919  1.00 0.00 ? 62  LYS A HB3  5  
ATOM 9927  H HG2  . LYS A 1 62  ? 11.021  -4.742  20.182  1.00 0.00 ? 62  LYS A HG2  5  
ATOM 9928  H HG3  . LYS A 1 62  ? 12.685  -5.338  20.614  1.00 0.00 ? 62  LYS A HG3  5  
ATOM 9929  H HD2  . LYS A 1 62  ? 12.023  -2.980  18.741  1.00 0.00 ? 62  LYS A HD2  5  
ATOM 9930  H HD3  . LYS A 1 62  ? 12.588  -2.863  20.443  1.00 0.00 ? 62  LYS A HD3  5  
ATOM 9931  H HE2  . LYS A 1 62  ? 14.767  -3.965  19.790  1.00 0.00 ? 62  LYS A HE2  5  
ATOM 9932  H HE3  . LYS A 1 62  ? 14.203  -4.019  18.070  1.00 0.00 ? 62  LYS A HE3  5  
ATOM 9933  H HZ1  . LYS A 1 62  ? 14.024  -1.635  18.099  1.00 0.00 ? 62  LYS A HZ1  5  
ATOM 9934  H HZ2  . LYS A 1 62  ? 14.554  -1.572  19.711  1.00 0.00 ? 62  LYS A HZ2  5  
ATOM 9935  H HZ3  . LYS A 1 62  ? 15.597  -2.139  18.496  1.00 0.00 ? 62  LYS A HZ3  5  
ATOM 9936  N N    . MET A 1 63  ? 9.983   -4.004  16.550  1.00 0.00 ? 63  MET A N    5  
ATOM 9937  C CA   . MET A 1 63  ? 9.151   -2.826  16.280  1.00 0.00 ? 63  MET A CA   5  
ATOM 9938  C C    . MET A 1 63  ? 8.120   -3.160  15.213  1.00 0.00 ? 63  MET A C    5  
ATOM 9939  O O    . MET A 1 63  ? 7.321   -2.310  14.825  1.00 0.00 ? 63  MET A O    5  
ATOM 9940  C CB   . MET A 1 63  ? 9.832   -1.433  16.100  1.00 0.00 ? 63  MET A CB   5  
ATOM 9941  C CG   . MET A 1 63  ? 10.419  -0.851  17.407  1.00 0.00 ? 63  MET A CG   5  
ATOM 9942  S SD   . MET A 1 63  ? 10.551  0.974   17.420  1.00 0.00 ? 63  MET A SD   5  
ATOM 9943  C CE   . MET A 1 63  ? 11.804  1.219   16.124  1.00 0.00 ? 63  MET A CE   5  
ATOM 9944  H H    . MET A 1 63  ? 10.528  -4.361  15.786  1.00 0.00 ? 63  MET A H    5  
ATOM 9945  H HA   . MET A 1 63  ? 8.537   -2.616  17.140  1.00 0.00 ? 63  MET A HA   5  
ATOM 9946  H HB2  . MET A 1 63  ? 10.607  -1.485  15.309  1.00 0.00 ? 63  MET A HB2  5  
ATOM 9947  H HB3  . MET A 1 63  ? 9.061   -0.669  15.799  1.00 0.00 ? 63  MET A HB3  5  
ATOM 9948  H HG2  . MET A 1 63  ? 9.694   -1.118  18.237  1.00 0.00 ? 63  MET A HG2  5  
ATOM 9949  H HG3  . MET A 1 63  ? 11.437  -1.306  17.567  1.00 0.00 ? 63  MET A HG3  5  
ATOM 9950  H HE1  . MET A 1 63  ? 11.602  0.593   15.226  1.00 0.00 ? 63  MET A HE1  5  
ATOM 9951  H HE2  . MET A 1 63  ? 11.834  2.276   15.788  1.00 0.00 ? 63  MET A HE2  5  
ATOM 9952  H HE3  . MET A 1 63  ? 12.813  0.948   16.497  1.00 0.00 ? 63  MET A HE3  5  
ATOM 9953  N N    . LYS A 1 64  ? 8.024   -4.455  14.747  1.00 0.00 ? 64  LYS A N    5  
ATOM 9954  C CA   . LYS A 1 64  ? 6.956   -4.935  13.844  1.00 0.00 ? 64  LYS A CA   5  
ATOM 9955  C C    . LYS A 1 64  ? 5.643   -5.045  14.616  1.00 0.00 ? 64  LYS A C    5  
ATOM 9956  O O    . LYS A 1 64  ? 4.564   -4.723  14.123  1.00 0.00 ? 64  LYS A O    5  
ATOM 9957  C CB   . LYS A 1 64  ? 7.366   -6.269  13.150  1.00 0.00 ? 64  LYS A CB   5  
ATOM 9958  C CG   . LYS A 1 64  ? 6.482   -7.526  13.288  1.00 0.00 ? 64  LYS A CG   5  
ATOM 9959  C CD   . LYS A 1 64  ? 5.266   -7.686  12.372  1.00 0.00 ? 64  LYS A CD   5  
ATOM 9960  C CE   . LYS A 1 64  ? 4.499   -8.990  12.647  1.00 0.00 ? 64  LYS A CE   5  
ATOM 9961  N NZ   . LYS A 1 64  ? 5.310   -10.184 12.305  1.00 0.00 ? 64  LYS A NZ   5  
ATOM 9962  H H    . LYS A 1 64  ? 8.648   -5.184  15.068  1.00 0.00 ? 64  LYS A H    5  
ATOM 9963  H HA   . LYS A 1 64  ? 6.829   -4.181  13.102  1.00 0.00 ? 64  LYS A HA   5  
ATOM 9964  H HB2  . LYS A 1 64  ? 7.809   -6.214  12.095  1.00 0.00 ? 64  LYS A HB2  5  
ATOM 9965  H HB3  . LYS A 1 64  ? 8.146   -6.491  13.912  1.00 0.00 ? 64  LYS A HB3  5  
ATOM 9966  H HG2  . LYS A 1 64  ? 7.130   -8.393  13.084  1.00 0.00 ? 64  LYS A HG2  5  
ATOM 9967  H HG3  . LYS A 1 64  ? 6.198   -7.620  14.357  1.00 0.00 ? 64  LYS A HG3  5  
ATOM 9968  H HD2  . LYS A 1 64  ? 4.567   -6.839  12.540  1.00 0.00 ? 64  LYS A HD2  5  
ATOM 9969  H HD3  . LYS A 1 64  ? 5.589   -7.654  11.308  1.00 0.00 ? 64  LYS A HD3  5  
ATOM 9970  H HE2  . LYS A 1 64  ? 4.233   -9.059  13.723  1.00 0.00 ? 64  LYS A HE2  5  
ATOM 9971  H HE3  . LYS A 1 64  ? 3.571   -9.036  12.042  1.00 0.00 ? 64  LYS A HE3  5  
ATOM 9972  H HZ1  . LYS A 1 64  ? 6.188   -10.176 12.862  1.00 0.00 ? 64  LYS A HZ1  5  
ATOM 9973  H HZ2  . LYS A 1 64  ? 4.768   -11.044 12.521  1.00 0.00 ? 64  LYS A HZ2  5  
ATOM 9974  H HZ3  . LYS A 1 64  ? 5.542   -10.166 11.291  1.00 0.00 ? 64  LYS A HZ3  5  
ATOM 9975  N N    . LYS A 1 65  ? 5.774   -5.487  15.907  1.00 0.00 ? 65  LYS A N    5  
ATOM 9976  C CA   . LYS A 1 65  ? 4.693   -5.623  16.882  1.00 0.00 ? 65  LYS A CA   5  
ATOM 9977  C C    . LYS A 1 65  ? 4.044   -4.267  17.323  1.00 0.00 ? 65  LYS A C    5  
ATOM 9978  O O    . LYS A 1 65  ? 2.831   -4.160  17.484  1.00 0.00 ? 65  LYS A O    5  
ATOM 9979  C CB   . LYS A 1 65  ? 5.182   -6.431  18.114  1.00 0.00 ? 65  LYS A CB   5  
ATOM 9980  C CG   . LYS A 1 65  ? 4.085   -6.847  19.119  1.00 0.00 ? 65  LYS A CG   5  
ATOM 9981  C CD   . LYS A 1 65  ? 4.643   -7.731  20.247  1.00 0.00 ? 65  LYS A CD   5  
ATOM 9982  C CE   . LYS A 1 65  ? 3.607   -8.095  21.322  1.00 0.00 ? 65  LYS A CE   5  
ATOM 9983  N NZ   . LYS A 1 65  ? 3.129   -6.890  22.042  1.00 0.00 ? 65  LYS A NZ   5  
ATOM 9984  H H    . LYS A 1 65  ? 6.695   -5.773  16.202  1.00 0.00 ? 65  LYS A H    5  
ATOM 9985  H HA   . LYS A 1 65  ? 3.964   -6.247  16.361  1.00 0.00 ? 65  LYS A HA   5  
ATOM 9986  H HB2  . LYS A 1 65  ? 5.657   -7.363  17.732  1.00 0.00 ? 65  LYS A HB2  5  
ATOM 9987  H HB3  . LYS A 1 65  ? 5.977   -5.865  18.646  1.00 0.00 ? 65  LYS A HB3  5  
ATOM 9988  H HG2  . LYS A 1 65  ? 3.626   -5.939  19.568  1.00 0.00 ? 65  LYS A HG2  5  
ATOM 9989  H HG3  . LYS A 1 65  ? 3.279   -7.400  18.585  1.00 0.00 ? 65  LYS A HG3  5  
ATOM 9990  H HD2  . LYS A 1 65  ? 5.030   -8.673  19.796  1.00 0.00 ? 65  LYS A HD2  5  
ATOM 9991  H HD3  . LYS A 1 65  ? 5.504   -7.211  20.724  1.00 0.00 ? 65  LYS A HD3  5  
ATOM 9992  H HE2  . LYS A 1 65  ? 2.726   -8.589  20.864  1.00 0.00 ? 65  LYS A HE2  5  
ATOM 9993  H HE3  . LYS A 1 65  ? 4.059   -8.775  22.076  1.00 0.00 ? 65  LYS A HE3  5  
ATOM 9994  H HZ1  . LYS A 1 65  ? 3.933   -6.417  22.499  1.00 0.00 ? 65  LYS A HZ1  5  
ATOM 9995  H HZ2  . LYS A 1 65  ? 2.680   -6.240  21.366  1.00 0.00 ? 65  LYS A HZ2  5  
ATOM 9996  H HZ3  . LYS A 1 65  ? 2.435   -7.170  22.765  1.00 0.00 ? 65  LYS A HZ3  5  
ATOM 9997  N N    . VAL A 1 66  ? 4.856   -3.159  17.454  1.00 0.00 ? 66  VAL A N    5  
ATOM 9998  C CA   . VAL A 1 66  ? 4.434   -1.758  17.704  1.00 0.00 ? 66  VAL A CA   5  
ATOM 9999  C C    . VAL A 1 66  ? 3.871   -1.124  16.442  1.00 0.00 ? 66  VAL A C    5  
ATOM 10000 O O    . VAL A 1 66  ? 2.952   -0.309  16.512  1.00 0.00 ? 66  VAL A O    5  
ATOM 10001 C CB   . VAL A 1 66  ? 5.439   -0.811  18.394  1.00 0.00 ? 66  VAL A CB   5  
ATOM 10002 C CG1  . VAL A 1 66  ? 6.550   -0.301  17.464  1.00 0.00 ? 66  VAL A CG1  5  
ATOM 10003 C CG2  . VAL A 1 66  ? 4.715   0.435   18.967  1.00 0.00 ? 66  VAL A CG2  5  
ATOM 10004 H H    . VAL A 1 66  ? 5.831   -3.276  17.332  1.00 0.00 ? 66  VAL A H    5  
ATOM 10005 H HA   . VAL A 1 66  ? 3.600   -1.807  18.391  1.00 0.00 ? 66  VAL A HA   5  
ATOM 10006 H HB   . VAL A 1 66  ? 5.908   -1.383  19.231  1.00 0.00 ? 66  VAL A HB   5  
ATOM 10007 H HG11 . VAL A 1 66  ? 6.921   -1.113  16.823  1.00 0.00 ? 66  VAL A HG11 5  
ATOM 10008 H HG12 . VAL A 1 66  ? 6.170   0.509   16.807  1.00 0.00 ? 66  VAL A HG12 5  
ATOM 10009 H HG13 . VAL A 1 66  ? 7.395   0.113   18.055  1.00 0.00 ? 66  VAL A HG13 5  
ATOM 10010 H HG21 . VAL A 1 66  ? 3.911   0.145   19.673  1.00 0.00 ? 66  VAL A HG21 5  
ATOM 10011 H HG22 . VAL A 1 66  ? 5.444   1.091   19.491  1.00 0.00 ? 66  VAL A HG22 5  
ATOM 10012 H HG23 . VAL A 1 66  ? 4.272   1.056   18.151  1.00 0.00 ? 66  VAL A HG23 5  
ATOM 10013 N N    . TRP A 1 67  ? 4.383   -1.525  15.229  1.00 0.00 ? 67  TRP A N    5  
ATOM 10014 C CA   . TRP A 1 67  ? 3.911   -1.131  13.895  1.00 0.00 ? 67  TRP A CA   5  
ATOM 10015 C C    . TRP A 1 67  ? 2.401   -1.383  13.689  1.00 0.00 ? 67  TRP A C    5  
ATOM 10016 O O    . TRP A 1 67  ? 1.704   -0.556  13.119  1.00 0.00 ? 67  TRP A O    5  
ATOM 10017 C CB   . TRP A 1 67  ? 4.751   -1.763  12.745  1.00 0.00 ? 67  TRP A CB   5  
ATOM 10018 C CG   . TRP A 1 67  ? 4.344   -1.292  11.359  1.00 0.00 ? 67  TRP A CG   5  
ATOM 10019 C CD1  . TRP A 1 67  ? 3.474   -1.936  10.538  1.00 0.00 ? 67  TRP A CD1  5  
ATOM 10020 C CD2  . TRP A 1 67  ? 4.418   0.053   10.864  1.00 0.00 ? 67  TRP A CD2  5  
ATOM 10021 N NE1  . TRP A 1 67  ? 3.226   -1.193  9.430   1.00 0.00 ? 67  TRP A NE1  5  
ATOM 10022 C CE2  . TRP A 1 67  ? 3.687   0.077   9.673   1.00 0.00 ? 67  TRP A CE2  5  
ATOM 10023 C CE3  . TRP A 1 67  ? 4.990   1.176   11.379  1.00 0.00 ? 67  TRP A CE3  5  
ATOM 10024 C CZ2  . TRP A 1 67  ? 3.463   1.236   9.003   1.00 0.00 ? 67  TRP A CZ2  5  
ATOM 10025 C CZ3  . TRP A 1 67  ? 4.760   2.351   10.708  1.00 0.00 ? 67  TRP A CZ3  5  
ATOM 10026 C CH2  . TRP A 1 67  ? 3.970   2.387   9.573   1.00 0.00 ? 67  TRP A CH2  5  
ATOM 10027 H H    . TRP A 1 67  ? 5.145   -2.173  15.196  1.00 0.00 ? 67  TRP A H    5  
ATOM 10028 H HA   . TRP A 1 67  ? 4.081   -0.066  13.813  1.00 0.00 ? 67  TRP A HA   5  
ATOM 10029 H HB2  . TRP A 1 67  ? 5.834   -1.522  12.916  1.00 0.00 ? 67  TRP A HB2  5  
ATOM 10030 H HB3  . TRP A 1 67  ? 4.608   -2.874  12.749  1.00 0.00 ? 67  TRP A HB3  5  
ATOM 10031 H HD1  . TRP A 1 67  ? 2.960   -2.842  10.807  1.00 0.00 ? 67  TRP A HD1  5  
ATOM 10032 H HE1  . TRP A 1 67  ? 2.719   -1.494  8.652   1.00 0.00 ? 67  TRP A HE1  5  
ATOM 10033 H HE3  . TRP A 1 67  ? 5.603   1.182   12.267  1.00 0.00 ? 67  TRP A HE3  5  
ATOM 10034 H HZ2  . TRP A 1 67  ? 2.861   1.236   8.101   1.00 0.00 ? 67  TRP A HZ2  5  
ATOM 10035 H HZ3  . TRP A 1 67  ? 5.230   3.253   11.071  1.00 0.00 ? 67  TRP A HZ3  5  
ATOM 10036 H HH2  . TRP A 1 67  ? 3.847   3.331   9.072   1.00 0.00 ? 67  TRP A HH2  5  
ATOM 10037 N N    . ASP A 1 68  ? 1.868   -2.498  14.268  1.00 0.00 ? 68  ASP A N    5  
ATOM 10038 C CA   . ASP A 1 68  ? 0.454   -2.900  14.370  1.00 0.00 ? 68  ASP A CA   5  
ATOM 10039 C C    . ASP A 1 68  ? -0.452  -1.820  15.020  1.00 0.00 ? 68  ASP A C    5  
ATOM 10040 O O    . ASP A 1 68  ? -1.534  -1.493  14.538  1.00 0.00 ? 68  ASP A O    5  
ATOM 10041 C CB   . ASP A 1 68  ? 0.379   -4.213  15.208  1.00 0.00 ? 68  ASP A CB   5  
ATOM 10042 C CG   . ASP A 1 68  ? 1.213   -5.355  14.604  1.00 0.00 ? 68  ASP A CG   5  
ATOM 10043 O OD1  . ASP A 1 68  ? 1.571   -5.290  13.399  1.00 0.00 ? 68  ASP A OD1  5  
ATOM 10044 O OD2  . ASP A 1 68  ? 1.481   -6.330  15.357  1.00 0.00 ? 68  ASP A OD2  5  
ATOM 10045 H H    . ASP A 1 68  ? 2.505   -3.123  14.721  1.00 0.00 ? 68  ASP A H    5  
ATOM 10046 H HA   . ASP A 1 68  ? 0.077   -3.070  13.370  1.00 0.00 ? 68  ASP A HA   5  
ATOM 10047 H HB2  . ASP A 1 68  ? 0.750   -3.999  16.233  1.00 0.00 ? 68  ASP A HB2  5  
ATOM 10048 H HB3  . ASP A 1 68  ? -0.646  -4.599  15.312  1.00 0.00 ? 68  ASP A HB3  5  
ATOM 10049 N N    . ARG A 1 69  ? 0.064   -1.199  16.114  1.00 0.00 ? 69  ARG A N    5  
ATOM 10050 C CA   . ARG A 1 69  ? -0.441  -0.014  16.805  1.00 0.00 ? 69  ARG A CA   5  
ATOM 10051 C C    . ARG A 1 69  ? -0.124  1.311   16.078  1.00 0.00 ? 69  ARG A C    5  
ATOM 10052 O O    . ARG A 1 69  ? -1.031  2.101   15.839  1.00 0.00 ? 69  ARG A O    5  
ATOM 10053 C CB   . ARG A 1 69  ? 0.038   -0.069  18.284  1.00 0.00 ? 69  ARG A CB   5  
ATOM 10054 C CG   . ARG A 1 69  ? -0.974  0.436   19.335  1.00 0.00 ? 69  ARG A CG   5  
ATOM 10055 C CD   . ARG A 1 69  ? -1.128  1.964   19.396  1.00 0.00 ? 69  ARG A CD   5  
ATOM 10056 N NE   . ARG A 1 69  ? -2.132  2.332   20.458  1.00 0.00 ? 69  ARG A NE   5  
ATOM 10057 C CZ   . ARG A 1 69  ? -3.481  2.436   20.231  1.00 0.00 ? 69  ARG A CZ   5  
ATOM 10058 N NH1  . ARG A 1 69  ? -4.011  2.181   19.001  1.00 0.00 ? 69  ARG A NH1  5  
ATOM 10059 N NH2  . ARG A 1 69  ? -4.304  2.805   21.256  1.00 0.00 ? 69  ARG A NH2  5  
ATOM 10060 H H    . ARG A 1 69  ? 0.940   -1.526  16.458  1.00 0.00 ? 69  ARG A H    5  
ATOM 10061 H HA   . ARG A 1 69  ? -1.528  -0.047  16.798  1.00 0.00 ? 69  ARG A HA   5  
ATOM 10062 H HB2  . ARG A 1 69  ? 0.201   -1.151  18.512  1.00 0.00 ? 69  ARG A HB2  5  
ATOM 10063 H HB3  . ARG A 1 69  ? 1.023   0.428   18.419  1.00 0.00 ? 69  ARG A HB3  5  
ATOM 10064 H HG2  . ARG A 1 69  ? -1.960  -0.040  19.134  1.00 0.00 ? 69  ARG A HG2  5  
ATOM 10065 H HG3  . ARG A 1 69  ? -0.630  0.087   20.336  1.00 0.00 ? 69  ARG A HG3  5  
ATOM 10066 H HD2  . ARG A 1 69  ? -0.156  2.424   19.688  1.00 0.00 ? 69  ARG A HD2  5  
ATOM 10067 H HD3  . ARG A 1 69  ? -1.450  2.380   18.415  1.00 0.00 ? 69  ARG A HD3  5  
ATOM 10068 H HE   . ARG A 1 69  ? -1.791  2.528   21.377  1.00 0.00 ? 69  ARG A HE   5  
ATOM 10069 H HH11 . ARG A 1 69  ? -3.413  1.908   18.247  1.00 0.00 ? 69  ARG A HH11 5  
ATOM 10070 H HH12 . ARG A 1 69  ? -4.996  2.266   18.853  1.00 0.00 ? 69  ARG A HH12 5  
ATOM 10071 H HH21 . ARG A 1 69  ? -3.923  2.995   22.160  1.00 0.00 ? 69  ARG A HH21 5  
ATOM 10072 H HH22 . ARG A 1 69  ? -5.289  2.885   21.100  1.00 0.00 ? 69  ARG A HH22 5  
ATOM 10073 N N    . ALA A 1 70  ? 1.158   1.579   15.653  1.00 0.00 ? 70  ALA A N    5  
ATOM 10074 C CA   . ALA A 1 70  ? 1.681   2.767   14.932  1.00 0.00 ? 70  ALA A CA   5  
ATOM 10075 C C    . ALA A 1 70  ? 0.942   3.148   13.633  1.00 0.00 ? 70  ALA A C    5  
ATOM 10076 O O    . ALA A 1 70  ? 0.762   4.319   13.284  1.00 0.00 ? 70  ALA A O    5  
ATOM 10077 C CB   . ALA A 1 70  ? 3.194   2.645   14.634  1.00 0.00 ? 70  ALA A CB   5  
ATOM 10078 H H    . ALA A 1 70  ? 1.866   0.887   15.856  1.00 0.00 ? 70  ALA A H    5  
ATOM 10079 H HA   . ALA A 1 70  ? 1.591   3.590   15.626  1.00 0.00 ? 70  ALA A HA   5  
ATOM 10080 H HB1  . ALA A 1 70  ? 3.639   3.633   14.385  1.00 0.00 ? 70  ALA A HB1  5  
ATOM 10081 H HB2  . ALA A 1 70  ? 3.709   2.260   15.541  1.00 0.00 ? 70  ALA A HB2  5  
ATOM 10082 H HB3  . ALA A 1 70  ? 3.395   1.942   13.801  1.00 0.00 ? 70  ALA A HB3  5  
ATOM 10083 N N    . VAL A 1 71  ? 0.435   2.078   12.947  1.00 0.00 ? 71  VAL A N    5  
ATOM 10084 C CA   . VAL A 1 71  ? -0.485  2.022   11.792  1.00 0.00 ? 71  VAL A CA   5  
ATOM 10085 C C    . VAL A 1 71  ? -1.825  2.702   12.051  1.00 0.00 ? 71  VAL A C    5  
ATOM 10086 O O    . VAL A 1 71  ? -2.367  3.316   11.139  1.00 0.00 ? 71  VAL A O    5  
ATOM 10087 C CB   . VAL A 1 71  ? -0.711  0.594   11.257  1.00 0.00 ? 71  VAL A CB   5  
ATOM 10088 C CG1  . VAL A 1 71  ? -1.905  0.416   10.286  1.00 0.00 ? 71  VAL A CG1  5  
ATOM 10089 C CG2  . VAL A 1 71  ? 0.533   0.218   10.451  1.00 0.00 ? 71  VAL A CG2  5  
ATOM 10090 H H    . VAL A 1 71  ? 0.715   1.182   13.306  1.00 0.00 ? 71  VAL A H    5  
ATOM 10091 H HA   . VAL A 1 71  ? -0.028  2.590   10.995  1.00 0.00 ? 71  VAL A HA   5  
ATOM 10092 H HB   . VAL A 1 71  ? -0.834  -0.111  12.112  1.00 0.00 ? 71  VAL A HB   5  
ATOM 10093 H HG11 . VAL A 1 71  ? -1.823  1.151   9.455   1.00 0.00 ? 71  VAL A HG11 5  
ATOM 10094 H HG12 . VAL A 1 71  ? -1.875  -0.601  9.840   1.00 0.00 ? 71  VAL A HG12 5  
ATOM 10095 H HG13 . VAL A 1 71  ? -2.889  0.537   10.781  1.00 0.00 ? 71  VAL A HG13 5  
ATOM 10096 H HG21 . VAL A 1 71  ? 1.460   0.396   11.031  1.00 0.00 ? 71  VAL A HG21 5  
ATOM 10097 H HG22 . VAL A 1 71  ? 0.499   -0.855  10.166  1.00 0.00 ? 71  VAL A HG22 5  
ATOM 10098 H HG23 . VAL A 1 71  ? 0.591   0.822   9.521   1.00 0.00 ? 71  VAL A HG23 5  
ATOM 10099 N N    . ASP A 1 72  ? -2.368  2.682   13.313  1.00 0.00 ? 72  ASP A N    5  
ATOM 10100 C CA   . ASP A 1 72  ? -3.592  3.383   13.764  1.00 0.00 ? 72  ASP A CA   5  
ATOM 10101 C C    . ASP A 1 72  ? -3.484  4.920   13.595  1.00 0.00 ? 72  ASP A C    5  
ATOM 10102 O O    . ASP A 1 72  ? -4.418  5.581   13.164  1.00 0.00 ? 72  ASP A O    5  
ATOM 10103 C CB   . ASP A 1 72  ? -4.015  2.889   15.192  1.00 0.00 ? 72  ASP A CB   5  
ATOM 10104 C CG   . ASP A 1 72  ? -5.313  3.511   15.724  1.00 0.00 ? 72  ASP A CG   5  
ATOM 10105 O OD1  . ASP A 1 72  ? -6.379  3.289   15.090  1.00 0.00 ? 72  ASP A OD1  5  
ATOM 10106 O OD2  . ASP A 1 72  ? -5.250  4.216   16.766  1.00 0.00 ? 72  ASP A OD2  5  
ATOM 10107 H H    . ASP A 1 72  ? -1.883  2.178   14.038  1.00 0.00 ? 72  ASP A H    5  
ATOM 10108 H HA   . ASP A 1 72  ? -4.384  3.082   13.091  1.00 0.00 ? 72  ASP A HA   5  
ATOM 10109 H HB2  . ASP A 1 72  ? -4.183  1.790   15.119  1.00 0.00 ? 72  ASP A HB2  5  
ATOM 10110 H HB3  . ASP A 1 72  ? -3.192  3.021   15.926  1.00 0.00 ? 72  ASP A HB3  5  
ATOM 10111 N N    . PHE A 1 73  ? -2.272  5.479   13.829  1.00 0.00 ? 73  PHE A N    5  
ATOM 10112 C CA   . PHE A 1 73  ? -1.752  6.819   13.532  1.00 0.00 ? 73  PHE A CA   5  
ATOM 10113 C C    . PHE A 1 73  ? -1.386  7.012   12.028  1.00 0.00 ? 73  PHE A C    5  
ATOM 10114 O O    . PHE A 1 73  ? -1.917  7.925   11.399  1.00 0.00 ? 73  PHE A O    5  
ATOM 10115 C CB   . PHE A 1 73  ? -0.549  7.123   14.468  1.00 0.00 ? 73  PHE A CB   5  
ATOM 10116 C CG   . PHE A 1 73  ? -0.780  6.599   15.870  1.00 0.00 ? 73  PHE A CG   5  
ATOM 10117 C CD1  . PHE A 1 73  ? -1.951  6.856   16.564  1.00 0.00 ? 73  PHE A CD1  5  
ATOM 10118 C CD2  . PHE A 1 73  ? 0.169   5.789   16.466  1.00 0.00 ? 73  PHE A CD2  5  
ATOM 10119 C CE1  . PHE A 1 73  ? -2.181  6.280   17.797  1.00 0.00 ? 73  PHE A CE1  5  
ATOM 10120 C CE2  . PHE A 1 73  ? -0.074  5.177   17.678  1.00 0.00 ? 73  PHE A CE2  5  
ATOM 10121 C CZ   . PHE A 1 73  ? -1.251  5.429   18.350  1.00 0.00 ? 73  PHE A CZ   5  
ATOM 10122 H H    . PHE A 1 73  ? -1.604  4.885   14.272  1.00 0.00 ? 73  PHE A H    5  
ATOM 10123 H HA   . PHE A 1 73  ? -2.498  7.591   13.751  1.00 0.00 ? 73  PHE A HA   5  
ATOM 10124 H HB2  . PHE A 1 73  ? 0.384   6.662   14.081  1.00 0.00 ? 73  PHE A HB2  5  
ATOM 10125 H HB3  . PHE A 1 73  ? -0.404  8.217   14.551  1.00 0.00 ? 73  PHE A HB3  5  
ATOM 10126 H HD1  . PHE A 1 73  ? -2.717  7.485   16.130  1.00 0.00 ? 73  PHE A HD1  5  
ATOM 10127 H HD2  . PHE A 1 73  ? 1.097   5.600   15.951  1.00 0.00 ? 73  PHE A HD2  5  
ATOM 10128 H HE1  . PHE A 1 73  ? -3.104  6.483   18.322  1.00 0.00 ? 73  PHE A HE1  5  
ATOM 10129 H HE2  . PHE A 1 73  ? 0.648   4.492   18.105  1.00 0.00 ? 73  PHE A HE2  5  
ATOM 10130 H HZ   . PHE A 1 73  ? -1.442  4.956   19.302  1.00 0.00 ? 73  PHE A HZ   5  
ATOM 10131 N N    . LEU A 1 74  ? -0.495  6.169   11.375  1.00 0.00 ? 74  LEU A N    5  
ATOM 10132 C CA   . LEU A 1 74  ? -0.155  6.267   9.907   1.00 0.00 ? 74  LEU A CA   5  
ATOM 10133 C C    . LEU A 1 74  ? -1.351  6.139   8.916   1.00 0.00 ? 74  LEU A C    5  
ATOM 10134 O O    . LEU A 1 74  ? -1.430  6.890   7.947   1.00 0.00 ? 74  LEU A O    5  
ATOM 10135 C CB   . LEU A 1 74  ? 0.988   5.275   9.465   1.00 0.00 ? 74  LEU A CB   5  
ATOM 10136 C CG   . LEU A 1 74  ? 1.608   5.560   8.068   1.00 0.00 ? 74  LEU A CG   5  
ATOM 10137 C CD1  . LEU A 1 74  ? 3.036   6.126   8.171   1.00 0.00 ? 74  LEU A CD1  5  
ATOM 10138 C CD2  . LEU A 1 74  ? 1.551   4.323   7.157   1.00 0.00 ? 74  LEU A CD2  5  
ATOM 10139 H H    . LEU A 1 74  ? -0.023  5.433   11.902  1.00 0.00 ? 74  LEU A H    5  
ATOM 10140 H HA   . LEU A 1 74  ? 0.223   7.276   9.688   1.00 0.00 ? 74  LEU A HA   5  
ATOM 10141 H HB2  . LEU A 1 74  ? 1.860   5.346   10.176  1.00 0.00 ? 74  LEU A HB2  5  
ATOM 10142 H HB3  . LEU A 1 74  ? 0.573   4.225   9.459   1.00 0.00 ? 74  LEU A HB3  5  
ATOM 10143 H HG   . LEU A 1 74  ? 1.012   6.355   7.561   1.00 0.00 ? 74  LEU A HG   5  
ATOM 10144 H HD11 . LEU A 1 74  ? 3.055   6.996   8.857   1.00 0.00 ? 74  LEU A HD11 5  
ATOM 10145 H HD12 . LEU A 1 74  ? 3.756   5.375   8.548   1.00 0.00 ? 74  LEU A HD12 5  
ATOM 10146 H HD13 . LEU A 1 74  ? 3.390   6.461   7.177   1.00 0.00 ? 74  LEU A HD13 5  
ATOM 10147 H HD21 . LEU A 1 74  ? 1.972   3.429   7.653   1.00 0.00 ? 74  LEU A HD21 5  
ATOM 10148 H HD22 . LEU A 1 74  ? 0.501   4.107   6.865   1.00 0.00 ? 74  LEU A HD22 5  
ATOM 10149 H HD23 . LEU A 1 74  ? 2.133   4.506   6.230   1.00 0.00 ? 74  LEU A HD23 5  
ATOM 10150 N N    . ALA A 1 75  ? -2.332  5.217   9.145   1.00 0.00 ? 75  ALA A N    5  
ATOM 10151 C CA   . ALA A 1 75  ? -3.546  5.018   8.350   1.00 0.00 ? 75  ALA A CA   5  
ATOM 10152 C C    . ALA A 1 75  ? -4.624  6.130   8.373   1.00 0.00 ? 75  ALA A C    5  
ATOM 10153 O O    . ALA A 1 75  ? -5.546  6.104   7.563   1.00 0.00 ? 75  ALA A O    5  
ATOM 10154 C CB   . ALA A 1 75  ? -4.165  3.639   8.666   1.00 0.00 ? 75  ALA A CB   5  
ATOM 10155 H H    . ALA A 1 75  ? -2.273  4.552   9.909   1.00 0.00 ? 75  ALA A H    5  
ATOM 10156 H HA   . ALA A 1 75  ? -3.231  4.957   7.317   1.00 0.00 ? 75  ALA A HA   5  
ATOM 10157 H HB1  . ALA A 1 75  ? -4.994  3.390   7.968   1.00 0.00 ? 75  ALA A HB1  5  
ATOM 10158 H HB2  . ALA A 1 75  ? -3.381  2.856   8.562   1.00 0.00 ? 75  ALA A HB2  5  
ATOM 10159 H HB3  . ALA A 1 75  ? -4.550  3.607   9.709   1.00 0.00 ? 75  ALA A HB3  5  
ATOM 10160 N N    . ALA A 1 76  ? -4.547  7.142   9.298   1.00 0.00 ? 76  ALA A N    5  
ATOM 10161 C CA   . ALA A 1 76  ? -5.466  8.266   9.476   1.00 0.00 ? 76  ALA A CA   5  
ATOM 10162 C C    . ALA A 1 76  ? -5.360  9.404   8.437   1.00 0.00 ? 76  ALA A C    5  
ATOM 10163 O O    . ALA A 1 76  ? -5.973  10.459  8.574   1.00 0.00 ? 76  ALA A O    5  
ATOM 10164 C CB   . ALA A 1 76  ? -5.320  8.811   10.920  1.00 0.00 ? 76  ALA A CB   5  
ATOM 10165 H H    . ALA A 1 76  ? -3.798  7.184   9.959   1.00 0.00 ? 76  ALA A H    5  
ATOM 10166 H HA   . ALA A 1 76  ? -6.475  7.881   9.387   1.00 0.00 ? 76  ALA A HA   5  
ATOM 10167 H HB1  . ALA A 1 76  ? -4.312  9.246   11.093  1.00 0.00 ? 76  ALA A HB1  5  
ATOM 10168 H HB2  . ALA A 1 76  ? -5.462  7.981   11.647  1.00 0.00 ? 76  ALA A HB2  5  
ATOM 10169 H HB3  . ALA A 1 76  ? -6.088  9.586   11.135  1.00 0.00 ? 76  ALA A HB3  5  
ATOM 10170 N N    . ASN A 1 77  ? -4.559  9.207   7.364   1.00 0.00 ? 77  ASN A N    5  
ATOM 10171 C CA   . ASN A 1 77  ? -4.351  10.117  6.255   1.00 0.00 ? 77  ASN A CA   5  
ATOM 10172 C C    . ASN A 1 77  ? -4.466  9.288   4.978   1.00 0.00 ? 77  ASN A C    5  
ATOM 10173 O O    . ASN A 1 77  ? -4.590  8.066   5.021   1.00 0.00 ? 77  ASN A O    5  
ATOM 10174 C CB   . ASN A 1 77  ? -3.001  10.905  6.378   1.00 0.00 ? 77  ASN A CB   5  
ATOM 10175 C CG   . ASN A 1 77  ? -1.778  10.003  6.588   1.00 0.00 ? 77  ASN A CG   5  
ATOM 10176 O OD1  . ASN A 1 77  ? -1.134  9.566   5.634   1.00 0.00 ? 77  ASN A OD1  5  
ATOM 10177 N ND2  . ASN A 1 77  ? -1.450  9.699   7.869   1.00 0.00 ? 77  ASN A ND2  5  
ATOM 10178 H H    . ASN A 1 77  ? -4.100  8.325   7.269   1.00 0.00 ? 77  ASN A H    5  
ATOM 10179 H HA   . ASN A 1 77  ? -5.159  10.836  6.214   1.00 0.00 ? 77  ASN A HA   5  
ATOM 10180 H HB2  . ASN A 1 77  ? -2.815  11.521  5.475   1.00 0.00 ? 77  ASN A HB2  5  
ATOM 10181 H HB3  . ASN A 1 77  ? -3.081  11.598  7.242   1.00 0.00 ? 77  ASN A HB3  5  
ATOM 10182 H HD21 . ASN A 1 77  ? -2.030  9.993   8.625   1.00 0.00 ? 77  ASN A HD21 5  
ATOM 10183 H HD22 . ASN A 1 77  ? -0.871  8.888   7.982   1.00 0.00 ? 77  ASN A HD22 5  
ATOM 10184 N N    . GLU A 1 78  ? -4.417  9.941   3.794   1.00 0.00 ? 78  GLU A N    5  
ATOM 10185 C CA   . GLU A 1 78  ? -4.483  9.304   2.486   1.00 0.00 ? 78  GLU A CA   5  
ATOM 10186 C C    . GLU A 1 78  ? -3.119  9.457   1.833   1.00 0.00 ? 78  GLU A C    5  
ATOM 10187 O O    . GLU A 1 78  ? -2.539  10.541  1.865   1.00 0.00 ? 78  GLU A O    5  
ATOM 10188 C CB   . GLU A 1 78  ? -5.603  9.952   1.619   1.00 0.00 ? 78  GLU A CB   5  
ATOM 10189 C CG   . GLU A 1 78  ? -5.855  9.300   0.241   1.00 0.00 ? 78  GLU A CG   5  
ATOM 10190 C CD   . GLU A 1 78  ? -6.244  7.830   0.401   1.00 0.00 ? 78  GLU A CD   5  
ATOM 10191 O OE1  . GLU A 1 78  ? -7.291  7.560   1.051   1.00 0.00 ? 78  GLU A OE1  5  
ATOM 10192 O OE2  . GLU A 1 78  ? -5.503  6.957   -0.126  1.00 0.00 ? 78  GLU A OE2  5  
ATOM 10193 H H    . GLU A 1 78  ? -4.300  10.929  3.759   1.00 0.00 ? 78  GLU A H    5  
ATOM 10194 H HA   . GLU A 1 78  ? -4.686  8.242   2.580   1.00 0.00 ? 78  GLU A HA   5  
ATOM 10195 H HB2  . GLU A 1 78  ? -6.550  9.905   2.202   1.00 0.00 ? 78  GLU A HB2  5  
ATOM 10196 H HB3  . GLU A 1 78  ? -5.375  11.030  1.459   1.00 0.00 ? 78  GLU A HB3  5  
ATOM 10197 H HG2  . GLU A 1 78  ? -6.682  9.837   -0.270  1.00 0.00 ? 78  GLU A HG2  5  
ATOM 10198 H HG3  . GLU A 1 78  ? -4.949  9.382   -0.396  1.00 0.00 ? 78  GLU A HG3  5  
ATOM 10199 N N    . SER A 1 79  ? -2.576  8.369   1.240   1.00 0.00 ? 79  SER A N    5  
ATOM 10200 C CA   . SER A 1 79  ? -1.262  8.357   0.613   1.00 0.00 ? 79  SER A CA   5  
ATOM 10201 C C    . SER A 1 79  ? -1.334  7.521   -0.659  1.00 0.00 ? 79  SER A C    5  
ATOM 10202 O O    . SER A 1 79  ? -2.412  7.238   -1.181  1.00 0.00 ? 79  SER A O    5  
ATOM 10203 C CB   . SER A 1 79  ? -0.187  7.856   1.633   1.00 0.00 ? 79  SER A CB   5  
ATOM 10204 O OG   . SER A 1 79  ? 1.159   8.077   1.205   1.00 0.00 ? 79  SER A OG   5  
ATOM 10205 H H    . SER A 1 79  ? -3.068  7.502   1.238   1.00 0.00 ? 79  SER A H    5  
ATOM 10206 H HA   . SER A 1 79  ? -0.985  9.356   0.296   1.00 0.00 ? 79  SER A HA   5  
ATOM 10207 H HB2  . SER A 1 79  ? -0.339  8.435   2.573   1.00 0.00 ? 79  SER A HB2  5  
ATOM 10208 H HB3  . SER A 1 79  ? -0.343  6.783   1.879   1.00 0.00 ? 79  SER A HB3  5  
ATOM 10209 H HG   . SER A 1 79  ? 1.693   8.111   2.012   1.00 0.00 ? 79  SER A HG   5  
ATOM 10210 N N    . ARG A 1 80  ? -0.153  7.110   -1.191  1.00 0.00 ? 80  ARG A N    5  
ATOM 10211 C CA   . ARG A 1 80  ? 0.006   6.371   -2.445  1.00 0.00 ? 80  ARG A CA   5  
ATOM 10212 C C    . ARG A 1 80  ? 0.111   4.855   -2.325  1.00 0.00 ? 80  ARG A C    5  
ATOM 10213 O O    . ARG A 1 80  ? 0.307   4.181   -3.336  1.00 0.00 ? 80  ARG A O    5  
ATOM 10214 C CB   . ARG A 1 80  ? 1.180   6.932   -3.298  1.00 0.00 ? 80  ARG A CB   5  
ATOM 10215 C CG   . ARG A 1 80  ? 0.946   8.343   -3.880  1.00 0.00 ? 80  ARG A CG   5  
ATOM 10216 C CD   . ARG A 1 80  ? 0.307   8.357   -5.285  1.00 0.00 ? 80  ARG A CD   5  
ATOM 10217 N NE   . ARG A 1 80  ? -1.094  7.813   -5.211  1.00 0.00 ? 80  ARG A NE   5  
ATOM 10218 C CZ   . ARG A 1 80  ? -1.817  7.417   -6.304  1.00 0.00 ? 80  ARG A CZ   5  
ATOM 10219 N NH1  . ARG A 1 80  ? -1.319  7.561   -7.565  1.00 0.00 ? 80  ARG A NH1  5  
ATOM 10220 N NH2  . ARG A 1 80  ? -3.052  6.864   -6.122  1.00 0.00 ? 80  ARG A NH2  5  
ATOM 10221 H H    . ARG A 1 80  ? 0.667   7.393   -0.683  1.00 0.00 ? 80  ARG A H    5  
ATOM 10222 H HA   . ARG A 1 80  ? -0.886  6.513   -3.040  1.00 0.00 ? 80  ARG A HA   5  
ATOM 10223 H HB2  . ARG A 1 80  ? 2.089   6.970   -2.656  1.00 0.00 ? 80  ARG A HB2  5  
ATOM 10224 H HB3  . ARG A 1 80  ? 1.404   6.276   -4.171  1.00 0.00 ? 80  ARG A HB3  5  
ATOM 10225 H HG2  . ARG A 1 80  ? 0.348   8.964   -3.178  1.00 0.00 ? 80  ARG A HG2  5  
ATOM 10226 H HG3  . ARG A 1 80  ? 1.946   8.828   -3.980  1.00 0.00 ? 80  ARG A HG3  5  
ATOM 10227 H HD2  . ARG A 1 80  ? 0.259   9.398   -5.670  1.00 0.00 ? 80  ARG A HD2  5  
ATOM 10228 H HD3  . ARG A 1 80  ? 0.919   7.731   -5.974  1.00 0.00 ? 80  ARG A HD3  5  
ATOM 10229 H HE   . ARG A 1 80  ? -1.499  7.691   -4.304  1.00 0.00 ? 80  ARG A HE   5  
ATOM 10230 H HH11 . ARG A 1 80  ? -0.412  7.960   -7.702  1.00 0.00 ? 80  ARG A HH11 5  
ATOM 10231 H HH12 . ARG A 1 80  ? -1.855  7.257   -8.352  1.00 0.00 ? 80  ARG A HH12 5  
ATOM 10232 H HH21 . ARG A 1 80  ? -3.417  6.751   -5.198  1.00 0.00 ? 80  ARG A HH21 5  
ATOM 10233 H HH22 . ARG A 1 80  ? -3.585  6.563   -6.913  1.00 0.00 ? 80  ARG A HH22 5  
ATOM 10234 N N    . VAL A 1 81  ? -0.054  4.241   -1.115  1.00 0.00 ? 81  VAL A N    5  
ATOM 10235 C CA   . VAL A 1 81  ? -0.093  2.773   -0.992  1.00 0.00 ? 81  VAL A CA   5  
ATOM 10236 C C    . VAL A 1 81  ? -1.522  2.313   -0.644  1.00 0.00 ? 81  VAL A C    5  
ATOM 10237 O O    . VAL A 1 81  ? -2.228  2.958   0.139   1.00 0.00 ? 81  VAL A O    5  
ATOM 10238 C CB   . VAL A 1 81  ? 1.051   2.210   -0.124  1.00 0.00 ? 81  VAL A CB   5  
ATOM 10239 C CG1  . VAL A 1 81  ? 0.666   1.853   1.327   1.00 0.00 ? 81  VAL A CG1  5  
ATOM 10240 C CG2  . VAL A 1 81  ? 1.735   1.024   -0.852  1.00 0.00 ? 81  VAL A CG2  5  
ATOM 10241 H H    . VAL A 1 81  ? -0.204  4.745   -0.262  1.00 0.00 ? 81  VAL A H    5  
ATOM 10242 H HA   . VAL A 1 81  ? 0.085   2.349   -1.970  1.00 0.00 ? 81  VAL A HA   5  
ATOM 10243 H HB   . VAL A 1 81  ? 1.808   3.025   -0.050  1.00 0.00 ? 81  VAL A HB   5  
ATOM 10244 H HG11 . VAL A 1 81  ? 0.190   2.716   1.838   1.00 0.00 ? 81  VAL A HG11 5  
ATOM 10245 H HG12 . VAL A 1 81  ? -0.030  0.990   1.343   1.00 0.00 ? 81  VAL A HG12 5  
ATOM 10246 H HG13 . VAL A 1 81  ? 1.575   1.560   1.895   1.00 0.00 ? 81  VAL A HG13 5  
ATOM 10247 H HG21 . VAL A 1 81  ? 2.105   1.319   -1.862  1.00 0.00 ? 81  VAL A HG21 5  
ATOM 10248 H HG22 . VAL A 1 81  ? 2.631   0.674   -0.297  1.00 0.00 ? 81  VAL A HG22 5  
ATOM 10249 H HG23 . VAL A 1 81  ? 1.053   0.155   -0.953  1.00 0.00 ? 81  VAL A HG23 5  
ATOM 10250 N N    . ARG A 1 82  ? -1.978  1.182   -1.267  1.00 0.00 ? 82  ARG A N    5  
ATOM 10251 C CA   . ARG A 1 82  ? -3.319  0.614   -1.167  1.00 0.00 ? 82  ARG A CA   5  
ATOM 10252 C C    . ARG A 1 82  ? -3.269  -0.805  -0.621  1.00 0.00 ? 82  ARG A C    5  
ATOM 10253 O O    . ARG A 1 82  ? -2.411  -1.596  -1.018  1.00 0.00 ? 82  ARG A O    5  
ATOM 10254 C CB   . ARG A 1 82  ? -3.959  0.602   -2.588  1.00 0.00 ? 82  ARG A CB   5  
ATOM 10255 C CG   . ARG A 1 82  ? -5.435  0.153   -2.675  1.00 0.00 ? 82  ARG A CG   5  
ATOM 10256 C CD   . ARG A 1 82  ? -5.626  -1.286  -3.191  1.00 0.00 ? 82  ARG A CD   5  
ATOM 10257 N NE   . ARG A 1 82  ? -7.076  -1.677  -3.083  1.00 0.00 ? 82  ARG A NE   5  
ATOM 10258 C CZ   . ARG A 1 82  ? -8.016  -1.442  -4.052  1.00 0.00 ? 82  ARG A CZ   5  
ATOM 10259 N NH1  . ARG A 1 82  ? -7.689  -0.821  -5.221  1.00 0.00 ? 82  ARG A NH1  5  
ATOM 10260 N NH2  . ARG A 1 82  ? -9.305  -1.841  -3.838  1.00 0.00 ? 82  ARG A NH2  5  
ATOM 10261 H H    . ARG A 1 82  ? -1.404  0.627   -1.877  1.00 0.00 ? 82  ARG A H    5  
ATOM 10262 H HA   . ARG A 1 82  ? -3.935  1.208   -0.504  1.00 0.00 ? 82  ARG A HA   5  
ATOM 10263 H HB2  . ARG A 1 82  ? -3.914  1.652   -2.957  1.00 0.00 ? 82  ARG A HB2  5  
ATOM 10264 H HB3  . ARG A 1 82  ? -3.341  -0.004  -3.290  1.00 0.00 ? 82  ARG A HB3  5  
ATOM 10265 H HG2  . ARG A 1 82  ? -5.911  0.276   -1.678  1.00 0.00 ? 82  ARG A HG2  5  
ATOM 10266 H HG3  . ARG A 1 82  ? -5.958  0.839   -3.380  1.00 0.00 ? 82  ARG A HG3  5  
ATOM 10267 H HD2  . ARG A 1 82  ? -5.269  -1.385  -4.240  1.00 0.00 ? 82  ARG A HD2  5  
ATOM 10268 H HD3  . ARG A 1 82  ? -5.057  -2.003  -2.565  1.00 0.00 ? 82  ARG A HD3  5  
ATOM 10269 H HE   . ARG A 1 82  ? -7.370  -2.139  -2.247  1.00 0.00 ? 82  ARG A HE   5  
ATOM 10270 H HH11 . ARG A 1 82  ? -6.747  -0.531  -5.386  1.00 0.00 ? 82  ARG A HH11 5  
ATOM 10271 H HH12 . ARG A 1 82  ? -8.393  -0.659  -5.914  1.00 0.00 ? 82  ARG A HH12 5  
ATOM 10272 H HH21 . ARG A 1 82  ? -9.553  -2.295  -2.983  1.00 0.00 ? 82  ARG A HH21 5  
ATOM 10273 H HH22 . ARG A 1 82  ? -10.002 -1.672  -4.536  1.00 0.00 ? 82  ARG A HH22 5  
ATOM 10274 N N    . THR A 1 83  ? -4.211  -1.167  0.304   1.00 0.00 ? 83  THR A N    5  
ATOM 10275 C CA   . THR A 1 83  ? -4.360  -2.496  0.920   1.00 0.00 ? 83  THR A CA   5  
ATOM 10276 C C    . THR A 1 83  ? -5.573  -3.235  0.362   1.00 0.00 ? 83  THR A C    5  
ATOM 10277 O O    . THR A 1 83  ? -6.652  -2.667  0.189   1.00 0.00 ? 83  THR A O    5  
ATOM 10278 C CB   . THR A 1 83  ? -4.449  -2.511  2.464   1.00 0.00 ? 83  THR A CB   5  
ATOM 10279 O OG1  . THR A 1 83  ? -3.793  -1.394  3.045   1.00 0.00 ? 83  THR A OG1  5  
ATOM 10280 C CG2  . THR A 1 83  ? -3.749  -3.769  3.004   1.00 0.00 ? 83  THR A CG2  5  
ATOM 10281 H H    . THR A 1 83  ? -4.889  -0.502  0.609   1.00 0.00 ? 83  THR A H    5  
ATOM 10282 H HA   . THR A 1 83  ? -3.502  -3.098  0.667   1.00 0.00 ? 83  THR A HA   5  
ATOM 10283 H HB   . THR A 1 83  ? -5.494  -2.517  2.854   1.00 0.00 ? 83  THR A HB   5  
ATOM 10284 H HG1  . THR A 1 83  ? -2.848  -1.569  2.947   1.00 0.00 ? 83  THR A HG1  5  
ATOM 10285 H HG21 . THR A 1 83  ? -4.217  -4.687  2.591   1.00 0.00 ? 83  THR A HG21 5  
ATOM 10286 H HG22 . THR A 1 83  ? -2.676  -3.779  2.718   1.00 0.00 ? 83  THR A HG22 5  
ATOM 10287 H HG23 . THR A 1 83  ? -3.825  -3.811  4.111   1.00 0.00 ? 83  THR A HG23 5  
ATOM 10288 N N    . GLU A 1 84  ? -5.414  -4.558  0.096   1.00 0.00 ? 84  GLU A N    5  
ATOM 10289 C CA   . GLU A 1 84  ? -6.488  -5.445  -0.347  1.00 0.00 ? 84  GLU A CA   5  
ATOM 10290 C C    . GLU A 1 84  ? -6.231  -6.852  0.185   1.00 0.00 ? 84  GLU A C    5  
ATOM 10291 O O    . GLU A 1 84  ? -5.102  -7.171  0.558   1.00 0.00 ? 84  GLU A O    5  
ATOM 10292 C CB   . GLU A 1 84  ? -6.652  -5.446  -1.897  1.00 0.00 ? 84  GLU A CB   5  
ATOM 10293 C CG   . GLU A 1 84  ? -5.342  -5.671  -2.683  1.00 0.00 ? 84  GLU A CG   5  
ATOM 10294 C CD   . GLU A 1 84  ? -5.655  -5.631  -4.180  1.00 0.00 ? 84  GLU A CD   5  
ATOM 10295 O OE1  . GLU A 1 84  ? -6.251  -4.618  -4.637  1.00 0.00 ? 84  GLU A OE1  5  
ATOM 10296 O OE2  . GLU A 1 84  ? -5.299  -6.609  -4.889  1.00 0.00 ? 84  GLU A OE2  5  
ATOM 10297 H H    . GLU A 1 84  ? -4.523  -5.010  0.235   1.00 0.00 ? 84  GLU A H    5  
ATOM 10298 H HA   . GLU A 1 84  ? -7.428  -5.131  0.095   1.00 0.00 ? 84  GLU A HA   5  
ATOM 10299 H HB2  . GLU A 1 84  ? -7.374  -6.267  -2.197  1.00 0.00 ? 84  GLU A HB2  5  
ATOM 10300 H HB3  . GLU A 1 84  ? -7.013  -4.401  -2.165  1.00 0.00 ? 84  GLU A HB3  5  
ATOM 10301 H HG2  . GLU A 1 84  ? -4.643  -4.809  -2.456  1.00 0.00 ? 84  GLU A HG2  5  
ATOM 10302 H HG3  . GLU A 1 84  ? -4.936  -6.698  -2.432  1.00 0.00 ? 84  GLU A HG3  5  
ATOM 10303 N N    . THR A 1 85  ? -7.253  -7.760  0.209   1.00 0.00 ? 85  THR A N    5  
ATOM 10304 C CA   . THR A 1 85  ? -7.079  -9.195  0.519   1.00 0.00 ? 85  THR A CA   5  
ATOM 10305 C C    . THR A 1 85  ? -7.053  -9.904  -0.836  1.00 0.00 ? 85  THR A C    5  
ATOM 10306 O O    . THR A 1 85  ? -8.049  -9.908  -1.559  1.00 0.00 ? 85  THR A O    5  
ATOM 10307 C CB   . THR A 1 85  ? -8.145  -9.817  1.438   1.00 0.00 ? 85  THR A CB   5  
ATOM 10308 O OG1  . THR A 1 85  ? -8.792  -8.837  2.232   1.00 0.00 ? 85  THR A OG1  5  
ATOM 10309 C CG2  . THR A 1 85  ? -7.438  -10.763 2.423   1.00 0.00 ? 85  THR A CG2  5  
ATOM 10310 H H    . THR A 1 85  ? -8.178  -7.509  -0.062  1.00 0.00 ? 85  THR A H    5  
ATOM 10311 H HA   . THR A 1 85  ? -6.121  -9.352  0.996   1.00 0.00 ? 85  THR A HA   5  
ATOM 10312 H HB   . THR A 1 85  ? -8.948  -10.359 0.890   1.00 0.00 ? 85  THR A HB   5  
ATOM 10313 H HG1  . THR A 1 85  ? -8.098  -8.464  2.782   1.00 0.00 ? 85  THR A HG1  5  
ATOM 10314 H HG21 . THR A 1 85  ? -6.651  -10.209 2.988   1.00 0.00 ? 85  THR A HG21 5  
ATOM 10315 H HG22 . THR A 1 85  ? -8.163  -11.185 3.150   1.00 0.00 ? 85  THR A HG22 5  
ATOM 10316 H HG23 . THR A 1 85  ? -6.955  -11.602 1.878   1.00 0.00 ? 85  THR A HG23 5  
ATOM 10317 N N    . ARG A 1 86  ? -5.885  -10.461 -1.254  1.00 0.00 ? 86  ARG A N    5  
ATOM 10318 C CA   . ARG A 1 86  ? -5.726  -10.937 -2.624  1.00 0.00 ? 86  ARG A CA   5  
ATOM 10319 C C    . ARG A 1 86  ? -4.974  -12.253 -2.655  1.00 0.00 ? 86  ARG A C    5  
ATOM 10320 O O    . ARG A 1 86  ? -4.080  -12.476 -1.838  1.00 0.00 ? 86  ARG A O    5  
ATOM 10321 C CB   . ARG A 1 86  ? -4.977  -9.835  -3.439  1.00 0.00 ? 86  ARG A CB   5  
ATOM 10322 C CG   . ARG A 1 86  ? -4.792  -10.083 -4.952  1.00 0.00 ? 86  ARG A CG   5  
ATOM 10323 C CD   . ARG A 1 86  ? -6.118  -10.178 -5.724  1.00 0.00 ? 86  ARG A CD   5  
ATOM 10324 N NE   . ARG A 1 86  ? -5.813  -10.382 -7.187  1.00 0.00 ? 86  ARG A NE   5  
ATOM 10325 C CZ   . ARG A 1 86  ? -5.880  -11.590 -7.831  1.00 0.00 ? 86  ARG A CZ   5  
ATOM 10326 N NH1  . ARG A 1 86  ? -6.274  -12.721 -7.178  1.00 0.00 ? 86  ARG A NH1  5  
ATOM 10327 N NH2  . ARG A 1 86  ? -5.547  -11.661 -9.154  1.00 0.00 ? 86  ARG A NH2  5  
ATOM 10328 H H    . ARG A 1 86  ? -5.055  -10.473 -0.686  1.00 0.00 ? 86  ARG A H    5  
ATOM 10329 H HA   . ARG A 1 86  ? -6.691  -11.116 -3.085  1.00 0.00 ? 86  ARG A HA   5  
ATOM 10330 H HB2  . ARG A 1 86  ? -5.661  -8.909  -3.388  1.00 0.00 ? 86  ARG A HB2  5  
ATOM 10331 H HB3  . ARG A 1 86  ? -3.924  -9.729  -2.992  1.00 0.00 ? 86  ARG A HB3  5  
ATOM 10332 H HG2  . ARG A 1 86  ? -4.237  -9.190  -5.365  1.00 0.00 ? 86  ARG A HG2  5  
ATOM 10333 H HG3  . ARG A 1 86  ? -4.209  -11.037 -5.104  1.00 0.00 ? 86  ARG A HG3  5  
ATOM 10334 H HD2  . ARG A 1 86  ? -6.758  -10.997 -5.330  1.00 0.00 ? 86  ARG A HD2  5  
ATOM 10335 H HD3  . ARG A 1 86  ? -6.673  -9.220  -5.633  1.00 0.00 ? 86  ARG A HD3  5  
ATOM 10336 H HE   . ARG A 1 86  ? -5.521  -9.584  -7.715  1.00 0.00 ? 86  ARG A HE   5  
ATOM 10337 H HH11 . ARG A 1 86  ? -6.518  -12.678 -6.209  1.00 0.00 ? 86  ARG A HH11 5  
ATOM 10338 H HH12 . ARG A 1 86  ? -6.315  -13.593 -7.666  1.00 0.00 ? 86  ARG A HH12 5  
ATOM 10339 H HH21 . ARG A 1 86  ? -5.258  -10.836 -9.640  1.00 0.00 ? 86  ARG A HH21 5  
ATOM 10340 H HH22 . ARG A 1 86  ? -5.597  -12.536 -9.635  1.00 0.00 ? 86  ARG A HH22 5  
ATOM 10341 N N    . ARG A 1 87  ? -5.319  -13.153 -3.631  1.00 0.00 ? 87  ARG A N    5  
ATOM 10342 C CA   . ARG A 1 87  ? -4.710  -14.454 -3.886  1.00 0.00 ? 87  ARG A CA   5  
ATOM 10343 C C    . ARG A 1 87  ? -3.464  -14.326 -4.767  1.00 0.00 ? 87  ARG A C    5  
ATOM 10344 O O    . ARG A 1 87  ? -3.529  -13.817 -5.882  1.00 0.00 ? 87  ARG A O    5  
ATOM 10345 C CB   . ARG A 1 87  ? -5.720  -15.456 -4.501  1.00 0.00 ? 87  ARG A CB   5  
ATOM 10346 C CG   . ARG A 1 87  ? -5.229  -16.919 -4.511  1.00 0.00 ? 87  ARG A CG   5  
ATOM 10347 C CD   . ARG A 1 87  ? -6.231  -17.920 -5.115  1.00 0.00 ? 87  ARG A CD   5  
ATOM 10348 N NE   . ARG A 1 87  ? -7.511  -17.926 -4.316  1.00 0.00 ? 87  ARG A NE   5  
ATOM 10349 C CZ   . ARG A 1 87  ? -7.678  -18.597 -3.132  1.00 0.00 ? 87  ARG A CZ   5  
ATOM 10350 N NH1  . ARG A 1 87  ? -6.669  -19.335 -2.586  1.00 0.00 ? 87  ARG A NH1  5  
ATOM 10351 N NH2  . ARG A 1 87  ? -8.878  -18.518 -2.484  1.00 0.00 ? 87  ARG A NH2  5  
ATOM 10352 H H    . ARG A 1 87  ? -6.037  -12.927 -4.282  1.00 0.00 ? 87  ARG A H    5  
ATOM 10353 H HA   . ARG A 1 87  ? -4.434  -14.877 -2.939  1.00 0.00 ? 87  ARG A HA   5  
ATOM 10354 H HB2  . ARG A 1 87  ? -6.638  -15.416 -3.873  1.00 0.00 ? 87  ARG A HB2  5  
ATOM 10355 H HB3  . ARG A 1 87  ? -6.022  -15.141 -5.521  1.00 0.00 ? 87  ARG A HB3  5  
ATOM 10356 H HG2  . ARG A 1 87  ? -4.265  -17.008 -5.070  1.00 0.00 ? 87  ARG A HG2  5  
ATOM 10357 H HG3  . ARG A 1 87  ? -5.037  -17.216 -3.453  1.00 0.00 ? 87  ARG A HG3  5  
ATOM 10358 H HD2  . ARG A 1 87  ? -6.486  -17.617 -6.153  1.00 0.00 ? 87  ARG A HD2  5  
ATOM 10359 H HD3  . ARG A 1 87  ? -5.799  -18.944 -5.143  1.00 0.00 ? 87  ARG A HD3  5  
ATOM 10360 H HE   . ARG A 1 87  ? -8.283  -17.401 -4.672  1.00 0.00 ? 87  ARG A HE   5  
ATOM 10361 H HH11 . ARG A 1 87  ? -5.785  -19.392 -3.049  1.00 0.00 ? 87  ARG A HH11 5  
ATOM 10362 H HH12 . ARG A 1 87  ? -6.811  -19.813 -1.719  1.00 0.00 ? 87  ARG A HH12 5  
ATOM 10363 H HH21 . ARG A 1 87  ? -9.622  -17.978 -2.877  1.00 0.00 ? 87  ARG A HH21 5  
ATOM 10364 H HH22 . ARG A 1 87  ? -9.010  -18.999 -1.618  1.00 0.00 ? 87  ARG A HH22 5  
ATOM 10365 N N    . ILE A 1 88  ? -2.285  -14.765 -4.265  1.00 0.00 ? 88  ILE A N    5  
ATOM 10366 C CA   . ILE A 1 88  ? -0.982  -14.602 -4.899  1.00 0.00 ? 88  ILE A CA   5  
ATOM 10367 C C    . ILE A 1 88  ? -0.226  -15.904 -4.732  1.00 0.00 ? 88  ILE A C    5  
ATOM 10368 O O    . ILE A 1 88  ? 0.002   -16.360 -3.616  1.00 0.00 ? 88  ILE A O    5  
ATOM 10369 C CB   . ILE A 1 88  ? -0.203  -13.399 -4.323  1.00 0.00 ? 88  ILE A CB   5  
ATOM 10370 C CG1  . ILE A 1 88  ? -0.326  -13.258 -2.778  1.00 0.00 ? 88  ILE A CG1  5  
ATOM 10371 C CG2  . ILE A 1 88  ? -0.708  -12.144 -5.068  1.00 0.00 ? 88  ILE A CG2  5  
ATOM 10372 C CD1  . ILE A 1 88  ? 0.165   -11.924 -2.206  1.00 0.00 ? 88  ILE A CD1  5  
ATOM 10373 H H    . ILE A 1 88  ? -2.253  -15.192 -3.347  1.00 0.00 ? 88  ILE A H    5  
ATOM 10374 H HA   . ILE A 1 88  ? -1.099  -14.456 -5.965  1.00 0.00 ? 88  ILE A HA   5  
ATOM 10375 H HB   . ILE A 1 88  ? 0.880   -13.500 -4.562  1.00 0.00 ? 88  ILE A HB   5  
ATOM 10376 H HG12 . ILE A 1 88  ? -1.396  -13.336 -2.463  1.00 0.00 ? 88  ILE A HG12 5  
ATOM 10377 H HG13 . ILE A 1 88  ? 0.267   -14.080 -2.304  1.00 0.00 ? 88  ILE A HG13 5  
ATOM 10378 H HG21 . ILE A 1 88  ? -0.612  -12.276 -6.166  1.00 0.00 ? 88  ILE A HG21 5  
ATOM 10379 H HG22 . ILE A 1 88  ? -1.781  -11.986 -4.824  1.00 0.00 ? 88  ILE A HG22 5  
ATOM 10380 H HG23 . ILE A 1 88  ? -0.140  -11.239 -4.770  1.00 0.00 ? 88  ILE A HG23 5  
ATOM 10381 H HD11 . ILE A 1 88  ? 1.196   -11.685 -2.543  1.00 0.00 ? 88  ILE A HD11 5  
ATOM 10382 H HD12 . ILE A 1 88  ? -0.526  -11.108 -2.510  1.00 0.00 ? 88  ILE A HD12 5  
ATOM 10383 H HD13 . ILE A 1 88  ? 0.139   -11.957 -1.092  1.00 0.00 ? 88  ILE A HD13 5  
ATOM 10384 N N    . GLY A 1 89  ? 0.129   -16.591 -5.865  1.00 0.00 ? 89  GLY A N    5  
ATOM 10385 C CA   . GLY A 1 89  ? 0.815   -17.924 -5.868  1.00 0.00 ? 89  GLY A CA   5  
ATOM 10386 C C    . GLY A 1 89  ? -0.074  -19.070 -5.429  1.00 0.00 ? 89  GLY A C    5  
ATOM 10387 O O    . GLY A 1 89  ? 0.396   -20.111 -4.984  1.00 0.00 ? 89  GLY A O    5  
ATOM 10388 H H    . GLY A 1 89  ? -0.123  -16.136 -6.724  1.00 0.00 ? 89  GLY A H    5  
ATOM 10389 H HA2  . GLY A 1 89  ? 1.163   -18.216 -6.879  1.00 0.00 ? 89  GLY A HA2  5  
ATOM 10390 H HA3  . GLY A 1 89  ? 1.603   -17.875 -5.099  1.00 0.00 ? 89  GLY A HA3  5  
ATOM 10391 N N    . GLY A 1 90  ? -1.409  -18.855 -5.518  1.00 0.00 ? 90  GLY A N    5  
ATOM 10392 C CA   . GLY A 1 90  ? -2.457  -19.778 -5.045  1.00 0.00 ? 90  GLY A CA   5  
ATOM 10393 C C    . GLY A 1 90  ? -2.877  -19.603 -3.594  1.00 0.00 ? 90  GLY A C    5  
ATOM 10394 O O    . GLY A 1 90  ? -3.589  -20.456 -3.074  1.00 0.00 ? 90  GLY A O    5  
ATOM 10395 H H    . GLY A 1 90  ? -1.651  -17.972 -5.926  1.00 0.00 ? 90  GLY A H    5  
ATOM 10396 H HA2  . GLY A 1 90  ? -3.360  -19.666 -5.637  1.00 0.00 ? 90  GLY A HA2  5  
ATOM 10397 H HA3  . GLY A 1 90  ? -2.089  -20.794 -5.123  1.00 0.00 ? 90  GLY A HA3  5  
ATOM 10398 N N    . ALA A 1 91  ? -2.476  -18.515 -2.874  1.00 0.00 ? 91  ALA A N    5  
ATOM 10399 C CA   . ALA A 1 91  ? -2.825  -18.342 -1.472  1.00 0.00 ? 91  ALA A CA   5  
ATOM 10400 C C    . ALA A 1 91  ? -3.194  -16.883 -1.246  1.00 0.00 ? 91  ALA A C    5  
ATOM 10401 O O    . ALA A 1 91  ? -2.540  -15.988 -1.778  1.00 0.00 ? 91  ALA A O    5  
ATOM 10402 C CB   . ALA A 1 91  ? -1.637  -18.764 -0.581  1.00 0.00 ? 91  ALA A CB   5  
ATOM 10403 H H    . ALA A 1 91  ? -1.890  -17.779 -3.228  1.00 0.00 ? 91  ALA A H    5  
ATOM 10404 H HA   . ALA A 1 91  ? -3.689  -18.940 -1.204  1.00 0.00 ? 91  ALA A HA   5  
ATOM 10405 H HB1  . ALA A 1 91  ? -0.719  -18.209 -0.869  1.00 0.00 ? 91  ALA A HB1  5  
ATOM 10406 H HB2  . ALA A 1 91  ? -1.847  -18.591 0.496   1.00 0.00 ? 91  ALA A HB2  5  
ATOM 10407 H HB3  . ALA A 1 91  ? -1.436  -19.848 -0.720  1.00 0.00 ? 91  ALA A HB3  5  
ATOM 10408 N N    . ASP A 1 92  ? -4.279  -16.596 -0.475  1.00 0.00 ? 92  ASP A N    5  
ATOM 10409 C CA   . ASP A 1 92  ? -4.798  -15.254 -0.192  1.00 0.00 ? 92  ASP A CA   5  
ATOM 10410 C C    . ASP A 1 92  ? -4.348  -14.692 1.164   1.00 0.00 ? 92  ASP A C    5  
ATOM 10411 O O    . ASP A 1 92  ? -4.582  -15.296 2.205   1.00 0.00 ? 92  ASP A O    5  
ATOM 10412 C CB   . ASP A 1 92  ? -6.346  -15.132 -0.399  1.00 0.00 ? 92  ASP A CB   5  
ATOM 10413 C CG   . ASP A 1 92  ? -7.177  -16.108 0.450   1.00 0.00 ? 92  ASP A CG   5  
ATOM 10414 O OD1  . ASP A 1 92  ? -7.087  -17.342 0.212   1.00 0.00 ? 92  ASP A OD1  5  
ATOM 10415 O OD2  . ASP A 1 92  ? -7.921  -15.621 1.342   1.00 0.00 ? 92  ASP A OD2  5  
ATOM 10416 H H    . ASP A 1 92  ? -4.806  -17.323 -0.052  1.00 0.00 ? 92  ASP A H    5  
ATOM 10417 H HA   . ASP A 1 92  ? -4.396  -14.597 -0.938  1.00 0.00 ? 92  ASP A HA   5  
ATOM 10418 H HB2  . ASP A 1 92  ? -6.672  -14.086 -0.172  1.00 0.00 ? 92  ASP A HB2  5  
ATOM 10419 H HB3  . ASP A 1 92  ? -6.557  -15.354 -1.479  1.00 0.00 ? 92  ASP A HB3  5  
ATOM 10420 N N    . PHE A 1 93  ? -3.687  -13.508 1.185   1.00 0.00 ? 93  PHE A N    5  
ATOM 10421 C CA   . PHE A 1 93  ? -3.149  -12.865 2.376   1.00 0.00 ? 93  PHE A CA   5  
ATOM 10422 C C    . PHE A 1 93  ? -3.744  -11.478 2.437   1.00 0.00 ? 93  PHE A C    5  
ATOM 10423 O O    . PHE A 1 93  ? -4.319  -11.013 1.450   1.00 0.00 ? 93  PHE A O    5  
ATOM 10424 C CB   . PHE A 1 93  ? -1.594  -12.686 2.272   1.00 0.00 ? 93  PHE A CB   5  
ATOM 10425 C CG   . PHE A 1 93  ? -0.927  -14.017 2.018   1.00 0.00 ? 93  PHE A CG   5  
ATOM 10426 C CD1  . PHE A 1 93  ? -0.623  -14.911 3.029   1.00 0.00 ? 93  PHE A CD1  5  
ATOM 10427 C CD2  . PHE A 1 93  ? -0.644  -14.383 0.716   1.00 0.00 ? 93  PHE A CD2  5  
ATOM 10428 C CE1  . PHE A 1 93  ? -0.060  -16.143 2.733   1.00 0.00 ? 93  PHE A CE1  5  
ATOM 10429 C CE2  . PHE A 1 93  ? -0.085  -15.602 0.412   1.00 0.00 ? 93  PHE A CE2  5  
ATOM 10430 C CZ   . PHE A 1 93  ? 0.203   -16.493 1.422   1.00 0.00 ? 93  PHE A CZ   5  
ATOM 10431 H H    . PHE A 1 93  ? -3.527  -12.983 0.350   1.00 0.00 ? 93  PHE A H    5  
ATOM 10432 H HA   . PHE A 1 93  ? -3.404  -13.399 3.275   1.00 0.00 ? 93  PHE A HA   5  
ATOM 10433 H HB2  . PHE A 1 93  ? -1.343  -12.042 1.385   1.00 0.00 ? 93  PHE A HB2  5  
ATOM 10434 H HB3  . PHE A 1 93  ? -1.155  -12.233 3.203   1.00 0.00 ? 93  PHE A HB3  5  
ATOM 10435 H HD1  . PHE A 1 93  ? -0.848  -14.651 4.053   1.00 0.00 ? 93  PHE A HD1  5  
ATOM 10436 H HD2  . PHE A 1 93  ? -0.912  -13.711 -0.083  1.00 0.00 ? 93  PHE A HD2  5  
ATOM 10437 H HE1  . PHE A 1 93  ? 0.160   -16.843 3.529   1.00 0.00 ? 93  PHE A HE1  5  
ATOM 10438 H HE2  . PHE A 1 93  ? 0.090   -15.867 -0.624  1.00 0.00 ? 93  PHE A HE2  5  
ATOM 10439 H HZ   . PHE A 1 93  ? 0.608   -17.464 1.166   1.00 0.00 ? 93  PHE A HZ   5  
ATOM 10440 N N    . LEU A 1 94  ? -3.504  -10.726 3.561   1.00 0.00 ? 94  LEU A N    5  
ATOM 10441 C CA   . LEU A 1 94  ? -3.731  -9.280  3.609   1.00 0.00 ? 94  LEU A CA   5  
ATOM 10442 C C    . LEU A 1 94  ? -2.356  -8.717  3.231   1.00 0.00 ? 94  LEU A C    5  
ATOM 10443 O O    . LEU A 1 94  ? -1.349  -8.967  3.896   1.00 0.00 ? 94  LEU A O    5  
ATOM 10444 C CB   . LEU A 1 94  ? -4.312  -8.686  4.917   1.00 0.00 ? 94  LEU A CB   5  
ATOM 10445 C CG   . LEU A 1 94  ? -5.038  -7.328  4.684   1.00 0.00 ? 94  LEU A CG   5  
ATOM 10446 C CD1  . LEU A 1 94  ? -6.407  -7.529  3.993   1.00 0.00 ? 94  LEU A CD1  5  
ATOM 10447 C CD2  . LEU A 1 94  ? -5.299  -6.614  6.022   1.00 0.00 ? 94  LEU A CD2  5  
ATOM 10448 H H    . LEU A 1 94  ? -3.001  -11.098 4.338   1.00 0.00 ? 94  LEU A H    5  
ATOM 10449 H HA   . LEU A 1 94  ? -4.453  -9.019  2.847   1.00 0.00 ? 94  LEU A HA   5  
ATOM 10450 H HB2  . LEU A 1 94  ? -5.074  -9.403  5.314   1.00 0.00 ? 94  LEU A HB2  5  
ATOM 10451 H HB3  . LEU A 1 94  ? -3.507  -8.553  5.681   1.00 0.00 ? 94  LEU A HB3  5  
ATOM 10452 H HG   . LEU A 1 94  ? -4.380  -6.698  4.015   1.00 0.00 ? 94  LEU A HG   5  
ATOM 10453 H HD11 . LEU A 1 94  ? -7.032  -8.219  4.602   1.00 0.00 ? 94  LEU A HD11 5  
ATOM 10454 H HD12 . LEU A 1 94  ? -6.963  -6.568  3.901   1.00 0.00 ? 94  LEU A HD12 5  
ATOM 10455 H HD13 . LEU A 1 94  ? -6.293  -7.960  2.977   1.00 0.00 ? 94  LEU A HD13 5  
ATOM 10456 H HD21 . LEU A 1 94  ? -4.361  -6.421  6.586   1.00 0.00 ? 94  LEU A HD21 5  
ATOM 10457 H HD22 . LEU A 1 94  ? -5.839  -5.651  5.874   1.00 0.00 ? 94  LEU A HD22 5  
ATOM 10458 H HD23 . LEU A 1 94  ? -5.948  -7.256  6.656   1.00 0.00 ? 94  LEU A HD23 5  
ATOM 10459 N N    . VAL A 1 95  ? -2.322  -8.061  2.055   1.00 0.00 ? 95  VAL A N    5  
ATOM 10460 C CA   . VAL A 1 95  ? -1.126  -7.702  1.317   1.00 0.00 ? 95  VAL A CA   5  
ATOM 10461 C C    . VAL A 1 95  ? -1.248  -6.233  0.904   1.00 0.00 ? 95  VAL A C    5  
ATOM 10462 O O    . VAL A 1 95  ? -2.354  -5.716  0.694   1.00 0.00 ? 95  VAL A O    5  
ATOM 10463 C CB   . VAL A 1 95  ? -1.071  -8.705  0.137   1.00 0.00 ? 95  VAL A CB   5  
ATOM 10464 C CG1  . VAL A 1 95  ? -2.233  -8.564  -0.885  1.00 0.00 ? 95  VAL A CG1  5  
ATOM 10465 C CG2  . VAL A 1 95  ? 0.269   -8.671  -0.608  1.00 0.00 ? 95  VAL A CG2  5  
ATOM 10466 H H    . VAL A 1 95  ? -3.157  -7.825  1.549   1.00 0.00 ? 95  VAL A H    5  
ATOM 10467 H HA   . VAL A 1 95  ? -0.204  -7.839  1.897   1.00 0.00 ? 95  VAL A HA   5  
ATOM 10468 H HB   . VAL A 1 95  ? -1.117  -9.720  0.623   1.00 0.00 ? 95  VAL A HB   5  
ATOM 10469 H HG11 . VAL A 1 95  ? -3.247  -8.612  -0.441  1.00 0.00 ? 95  VAL A HG11 5  
ATOM 10470 H HG12 . VAL A 1 95  ? -2.156  -7.596  -1.429  1.00 0.00 ? 95  VAL A HG12 5  
ATOM 10471 H HG13 . VAL A 1 95  ? -2.173  -9.360  -1.660  1.00 0.00 ? 95  VAL A HG13 5  
ATOM 10472 H HG21 . VAL A 1 95  ? 1.092   -8.919  0.092   1.00 0.00 ? 95  VAL A HG21 5  
ATOM 10473 H HG22 . VAL A 1 95  ? 0.281   -9.432  -1.413  1.00 0.00 ? 95  VAL A HG22 5  
ATOM 10474 H HG23 . VAL A 1 95  ? 0.440   -7.677  -1.078  1.00 0.00 ? 95  VAL A HG23 5  
ATOM 10475 N N    . TRP A 1 96  ? -0.106  -5.517  0.750   1.00 0.00 ? 96  TRP A N    5  
ATOM 10476 C CA   . TRP A 1 96  ? -0.124  -4.119  0.225   1.00 0.00 ? 96  TRP A CA   5  
ATOM 10477 C C    . TRP A 1 96  ? 0.346   -4.170  -1.243  1.00 0.00 ? 96  TRP A C    5  
ATOM 10478 O O    . TRP A 1 96  ? 0.872   -5.175  -1.719  1.00 0.00 ? 96  TRP A O    5  
ATOM 10479 C CB   . TRP A 1 96  ? 0.883   -3.248  1.058   1.00 0.00 ? 96  TRP A CB   5  
ATOM 10480 C CG   . TRP A 1 96  ? 0.308   -2.404  2.191   1.00 0.00 ? 96  TRP A CG   5  
ATOM 10481 C CD1  . TRP A 1 96  ? -0.762  -1.561  2.147   1.00 0.00 ? 96  TRP A CD1  5  
ATOM 10482 C CD2  . TRP A 1 96  ? 0.945   -2.168  3.460   1.00 0.00 ? 96  TRP A CD2  5  
ATOM 10483 N NE1  . TRP A 1 96  ? -0.851  -0.827  3.310   1.00 0.00 ? 96  TRP A NE1  5  
ATOM 10484 C CE2  . TRP A 1 96  ? 0.218   -1.170  4.114   1.00 0.00 ? 96  TRP A CE2  5  
ATOM 10485 C CE3  . TRP A 1 96  ? 2.061   -2.713  4.023   1.00 0.00 ? 96  TRP A CE3  5  
ATOM 10486 C CZ2  . TRP A 1 96  ? 0.626   -0.683  5.329   1.00 0.00 ? 96  TRP A CZ2  5  
ATOM 10487 C CZ3  . TRP A 1 96  ? 2.441   -2.253  5.267   1.00 0.00 ? 96  TRP A CZ3  5  
ATOM 10488 C CH2  . TRP A 1 96  ? 1.767   -1.226  5.893   1.00 0.00 ? 96  TRP A CH2  5  
ATOM 10489 H H    . TRP A 1 96  ? 0.809   -5.980  0.906   1.00 0.00 ? 96  TRP A H    5  
ATOM 10490 H HA   . TRP A 1 96  ? -1.120  -3.602  0.210   1.00 0.00 ? 96  TRP A HA   5  
ATOM 10491 H HB2  . TRP A 1 96  ? 1.674   -3.918  1.457   1.00 0.00 ? 96  TRP A HB2  5  
ATOM 10492 H HB3  . TRP A 1 96  ? 1.401   -2.490  0.429   1.00 0.00 ? 96  TRP A HB3  5  
ATOM 10493 H HD1  . TRP A 1 96  ? -1.406  -1.466  1.294   1.00 0.00 ? 96  TRP A HD1  5  
ATOM 10494 H HE1  . TRP A 1 96  ? -1.478  -0.097  3.502   1.00 0.00 ? 96  TRP A HE1  5  
ATOM 10495 H HE3  . TRP A 1 96  ? 2.632   -3.477  3.514   1.00 0.00 ? 96  TRP A HE3  5  
ATOM 10496 H HZ2  . TRP A 1 96  ? 0.098   0.114   5.832   1.00 0.00 ? 96  TRP A HZ2  5  
ATOM 10497 H HZ3  . TRP A 1 96  ? 3.296   -2.689  5.769   1.00 0.00 ? 96  TRP A HZ3  5  
ATOM 10498 H HH2  . TRP A 1 96  ? 2.170   -0.838  6.824   1.00 0.00 ? 96  TRP A HH2  5  
ATOM 10499 N N    . ARG A 1 97  ? 0.212   -3.052  -1.999  1.00 0.00 ? 97  ARG A N    5  
ATOM 10500 C CA   . ARG A 1 97  ? 0.767   -2.921  -3.347  1.00 0.00 ? 97  ARG A CA   5  
ATOM 10501 C C    . ARG A 1 97  ? 0.905   -1.437  -3.632  1.00 0.00 ? 97  ARG A C    5  
ATOM 10502 O O    . ARG A 1 97  ? 0.165   -0.636  -3.040  1.00 0.00 ? 97  ARG A O    5  
ATOM 10503 C CB   . ARG A 1 97  ? -0.078  -3.630  -4.440  1.00 0.00 ? 97  ARG A CB   5  
ATOM 10504 C CG   . ARG A 1 97  ? -1.494  -3.059  -4.644  1.00 0.00 ? 97  ARG A CG   5  
ATOM 10505 C CD   . ARG A 1 97  ? -2.374  -3.977  -5.504  1.00 0.00 ? 97  ARG A CD   5  
ATOM 10506 N NE   . ARG A 1 97  ? -3.662  -3.262  -5.823  1.00 0.00 ? 97  ARG A NE   5  
ATOM 10507 C CZ   . ARG A 1 97  ? -3.856  -2.502  -6.947  1.00 0.00 ? 97  ARG A CZ   5  
ATOM 10508 N NH1  . ARG A 1 97  ? -2.879  -2.374  -7.890  1.00 0.00 ? 97  ARG A NH1  5  
ATOM 10509 N NH2  . ARG A 1 97  ? -5.048  -1.858  -7.122  1.00 0.00 ? 97  ARG A NH2  5  
ATOM 10510 H H    . ARG A 1 97  ? -0.269  -2.235  -1.652  1.00 0.00 ? 97  ARG A H    5  
ATOM 10511 H HA   . ARG A 1 97  ? 1.775   -3.337  -3.368  1.00 0.00 ? 97  ARG A HA   5  
ATOM 10512 H HB2  . ARG A 1 97  ? 0.452   -3.587  -5.418  1.00 0.00 ? 97  ARG A HB2  5  
ATOM 10513 H HB3  . ARG A 1 97  ? -0.136  -4.709  -4.169  1.00 0.00 ? 97  ARG A HB3  5  
ATOM 10514 H HG2  . ARG A 1 97  ? -1.983  -2.900  -3.655  1.00 0.00 ? 97  ARG A HG2  5  
ATOM 10515 H HG3  . ARG A 1 97  ? -1.396  -2.070  -5.149  1.00 0.00 ? 97  ARG A HG3  5  
ATOM 10516 H HD2  . ARG A 1 97  ? -1.847  -4.279  -6.436  1.00 0.00 ? 97  ARG A HD2  5  
ATOM 10517 H HD3  . ARG A 1 97  ? -2.632  -4.895  -4.934  1.00 0.00 ? 97  ARG A HD3  5  
ATOM 10518 H HE   . ARG A 1 97  ? -4.408  -3.325  -5.160  1.00 0.00 ? 97  ARG A HE   5  
ATOM 10519 H HH11 . ARG A 1 97  ? -2.003  -2.842  -7.768  1.00 0.00 ? 97  ARG A HH11 5  
ATOM 10520 H HH12 . ARG A 1 97  ? -3.037  -1.812  -8.702  1.00 0.00 ? 97  ARG A HH12 5  
ATOM 10521 H HH21 . ARG A 1 97  ? -5.767  -1.942  -6.432  1.00 0.00 ? 97  ARG A HH21 5  
ATOM 10522 H HH22 . ARG A 1 97  ? -5.197  -1.296  -7.935  1.00 0.00 ? 97  ARG A HH22 5  
ATOM 10523 N N    . TRP A 1 98  ? 1.856   -1.039  -4.538  1.00 0.00 ? 98  TRP A N    5  
ATOM 10524 C CA   . TRP A 1 98  ? 2.102   0.355   -4.899  1.00 0.00 ? 98  TRP A CA   5  
ATOM 10525 C C    . TRP A 1 98  ? 1.323   0.836   -6.130  1.00 0.00 ? 98  TRP A C    5  
ATOM 10526 O O    . TRP A 1 98  ? 1.535   0.344   -7.232  1.00 0.00 ? 98  TRP A O    5  
ATOM 10527 C CB   . TRP A 1 98  ? 3.642   0.596   -5.048  1.00 0.00 ? 98  TRP A CB   5  
ATOM 10528 C CG   . TRP A 1 98  ? 4.043   1.986   -4.602  1.00 0.00 ? 98  TRP A CG   5  
ATOM 10529 C CD1  . TRP A 1 98  ? 3.691   3.158   -5.188  1.00 0.00 ? 98  TRP A CD1  5  
ATOM 10530 C CD2  . TRP A 1 98  ? 4.243   2.282   -3.216  1.00 0.00 ? 98  TRP A CD2  5  
ATOM 10531 N NE1  . TRP A 1 98  ? 3.353   4.067   -4.253  1.00 0.00 ? 98  TRP A NE1  5  
ATOM 10532 C CE2  . TRP A 1 98  ? 3.686   3.539   -3.013  1.00 0.00 ? 98  TRP A CE2  5  
ATOM 10533 C CE3  . TRP A 1 98  ? 4.775   1.540   -2.196  1.00 0.00 ? 98  TRP A CE3  5  
ATOM 10534 C CZ2  . TRP A 1 98  ? 3.628   4.073   -1.765  1.00 0.00 ? 98  TRP A CZ2  5  
ATOM 10535 C CZ3  . TRP A 1 98  ? 4.861   2.150   -0.965  1.00 0.00 ? 98  TRP A CZ3  5  
ATOM 10536 C CH2  . TRP A 1 98  ? 4.264   3.380   -0.760  1.00 0.00 ? 98  TRP A CH2  5  
ATOM 10537 H H    . TRP A 1 98  ? 2.447   -1.702  -5.018  1.00 0.00 ? 98  TRP A H    5  
ATOM 10538 H HA   . TRP A 1 98  ? 1.769   0.984   -4.084  1.00 0.00 ? 98  TRP A HA   5  
ATOM 10539 H HB2  . TRP A 1 98  ? 4.079   -0.070  -4.234  1.00 0.00 ? 98  TRP A HB2  5  
ATOM 10540 H HB3  . TRP A 1 98  ? 3.986   0.414   -6.126  1.00 0.00 ? 98  TRP A HB3  5  
ATOM 10541 H HD1  . TRP A 1 98  ? 3.883   3.435   -6.196  1.00 0.00 ? 98  TRP A HD1  5  
ATOM 10542 H HE1  . TRP A 1 98  ? 2.662   4.731   -4.485  1.00 0.00 ? 98  TRP A HE1  5  
ATOM 10543 H HE3  . TRP A 1 98  ? 5.194   0.554   -2.341  1.00 0.00 ? 98  TRP A HE3  5  
ATOM 10544 H HZ2  . TRP A 1 98  ? 3.186   5.040   -1.580  1.00 0.00 ? 98  TRP A HZ2  5  
ATOM 10545 H HZ3  . TRP A 1 98  ? 5.352   1.645   -0.143  1.00 0.00 ? 98  TRP A HZ3  5  
ATOM 10546 H HH2  . TRP A 1 98  ? 4.267   3.802   0.223   1.00 0.00 ? 98  TRP A HH2  5  
ATOM 10547 N N    . ILE A 1 99  ? 0.428   1.851   -5.963  1.00 0.00 ? 99  ILE A N    5  
ATOM 10548 C CA   . ILE A 1 99  ? -0.350  2.530   -7.002  1.00 0.00 ? 99  ILE A CA   5  
ATOM 10549 C C    . ILE A 1 99  ? 0.242   3.912   -7.177  1.00 0.00 ? 99  ILE A C    5  
ATOM 10550 O O    . ILE A 1 99  ? 0.604   4.610   -6.236  1.00 0.00 ? 99  ILE A O    5  
ATOM 10551 C CB   . ILE A 1 99  ? -1.854  2.513   -6.793  1.00 0.00 ? 99  ILE A CB   5  
ATOM 10552 C CG1  . ILE A 1 99  ? -2.312  3.075   -5.423  1.00 0.00 ? 99  ILE A CG1  5  
ATOM 10553 C CG2  . ILE A 1 99  ? -2.239  1.035   -6.988  1.00 0.00 ? 99  ILE A CG2  5  
ATOM 10554 C CD1  . ILE A 1 99  ? -3.840  3.177   -5.323  1.00 0.00 ? 99  ILE A CD1  5  
ATOM 10555 H H    . ILE A 1 99  ? 0.290   2.267   -5.069  1.00 0.00 ? 99  ILE A H    5  
ATOM 10556 H HA   . ILE A 1 99  ? -0.175  2.028   -7.945  1.00 0.00 ? 99  ILE A HA   5  
ATOM 10557 H HB   . ILE A 1 99  ? -2.355  3.106   -7.595  1.00 0.00 ? 99  ILE A HB   5  
ATOM 10558 H HG12 . ILE A 1 99  ? -1.939  2.399   -4.612  1.00 0.00 ? 99  ILE A HG12 5  
ATOM 10559 H HG13 . ILE A 1 99  ? -1.893  4.105   -5.288  1.00 0.00 ? 99  ILE A HG13 5  
ATOM 10560 H HG21 . ILE A 1 99  ? -1.742  0.626   -7.894  1.00 0.00 ? 99  ILE A HG21 5  
ATOM 10561 H HG22 . ILE A 1 99  ? -1.875  0.447   -6.117  1.00 0.00 ? 99  ILE A HG22 5  
ATOM 10562 H HG23 . ILE A 1 99  ? -3.336  0.911   -7.093  1.00 0.00 ? 99  ILE A HG23 5  
ATOM 10563 H HD11 . ILE A 1 99  ? -4.237  3.817   -6.140  1.00 0.00 ? 99  ILE A HD11 5  
ATOM 10564 H HD12 . ILE A 1 99  ? -4.310  2.174   -5.402  1.00 0.00 ? 99  ILE A HD12 5  
ATOM 10565 H HD13 . ILE A 1 99  ? -4.140  3.625   -4.352  1.00 0.00 ? 99  ILE A HD13 5  
ATOM 10566 N N    . GLN A 1 100 ? 0.534   4.249   -8.454  1.00 0.00 ? 100 GLN A N    5  
ATOM 10567 C CA   . GLN A 1 100 ? 1.390   5.372   -8.796  1.00 0.00 ? 100 GLN A CA   5  
ATOM 10568 C C    . GLN A 1 100 ? 0.935   6.018   -10.107 1.00 0.00 ? 100 GLN A C    5  
ATOM 10569 O O    . GLN A 1 100 ? 0.335   5.300   -10.907 1.00 0.00 ? 100 GLN A O    5  
ATOM 10570 C CB   . GLN A 1 100 ? 2.857   4.815   -8.811  1.00 0.00 ? 100 GLN A CB   5  
ATOM 10571 C CG   . GLN A 1 100 ? 2.886   3.268   -8.955  1.00 0.00 ? 100 GLN A CG   5  
ATOM 10572 C CD   . GLN A 1 100 ? 4.255   2.647   -9.003  1.00 0.00 ? 100 GLN A CD   5  
ATOM 10573 O OE1  . GLN A 1 100 ? 4.726   1.973   -8.088  1.00 0.00 ? 100 GLN A OE1  5  
ATOM 10574 N NE2  . GLN A 1 100 ? 4.908   2.872   -10.159 1.00 0.00 ? 100 GLN A NE2  5  
ATOM 10575 H H    . GLN A 1 100 ? 0.262   3.676   -9.225  1.00 0.00 ? 100 GLN A H    5  
ATOM 10576 H HA   . GLN A 1 100 ? 1.253   6.106   -8.009  1.00 0.00 ? 100 GLN A HA   5  
ATOM 10577 H HB2  . GLN A 1 100 ? 3.614   5.331   -9.482  1.00 0.00 ? 100 GLN A HB2  5  
ATOM 10578 H HB3  . GLN A 1 100 ? 3.230   4.968   -7.770  1.00 0.00 ? 100 GLN A HB3  5  
ATOM 10579 H HG2  . GLN A 1 100 ? 2.423   2.761   -8.084  1.00 0.00 ? 100 GLN A HG2  5  
ATOM 10580 H HG3  . GLN A 1 100 ? 2.318   3.002   -9.859  1.00 0.00 ? 100 GLN A HG3  5  
ATOM 10581 H HE21 . GLN A 1 100 ? 4.484   3.462   -10.864 1.00 0.00 ? 100 GLN A HE21 5  
ATOM 10582 H HE22 . GLN A 1 100 ? 5.859   2.612   -10.243 1.00 0.00 ? 100 GLN A HE22 5  
ATOM 10583 N N    . PRO A 1 101 ? 1.178   7.345   -10.390 1.00 0.00 ? 101 PRO A N    5  
ATOM 10584 C CA   . PRO A 1 101 ? 0.762   8.074   -11.610 1.00 0.00 ? 101 PRO A CA   5  
ATOM 10585 C C    . PRO A 1 101 ? 1.400   7.658   -12.950 1.00 0.00 ? 101 PRO A C    5  
ATOM 10586 O O    . PRO A 1 101 ? 2.493   7.104   -12.942 1.00 0.00 ? 101 PRO A O    5  
ATOM 10587 C CB   . PRO A 1 101 ? 1.228   9.525   -11.322 1.00 0.00 ? 101 PRO A CB   5  
ATOM 10588 C CG   . PRO A 1 101 ? 1.232   9.636   -9.808  1.00 0.00 ? 101 PRO A CG   5  
ATOM 10589 C CD   . PRO A 1 101 ? 1.814   8.274   -9.447  1.00 0.00 ? 101 PRO A CD   5  
ATOM 10590 H HA   . PRO A 1 101 ? -0.312  7.989   -11.708 1.00 0.00 ? 101 PRO A HA   5  
ATOM 10591 H HB2  . PRO A 1 101 ? 2.307   9.670   -11.588 1.00 0.00 ? 101 PRO A HB2  5  
ATOM 10592 H HB3  . PRO A 1 101 ? 0.607   10.280  -11.843 1.00 0.00 ? 101 PRO A HB3  5  
ATOM 10593 H HG2  . PRO A 1 101 ? 1.854   10.473  -9.430  1.00 0.00 ? 101 PRO A HG2  5  
ATOM 10594 H HG3  . PRO A 1 101 ? 0.195   9.730   -9.416  1.00 0.00 ? 101 PRO A HG3  5  
ATOM 10595 H HD2  . PRO A 1 101 ? 2.912   8.258   -9.629  1.00 0.00 ? 101 PRO A HD2  5  
ATOM 10596 H HD3  . PRO A 1 101 ? 1.605   8.110   -8.375  1.00 0.00 ? 101 PRO A HD3  5  
ATOM 10597 N N    . SER A 1 102 ? 0.748   7.974   -14.098 1.00 0.00 ? 102 SER A N    5  
ATOM 10598 C CA   . SER A 1 102 ? 1.183   7.717   -15.484 1.00 0.00 ? 102 SER A CA   5  
ATOM 10599 C C    . SER A 1 102 ? 0.841   6.316   -16.020 1.00 0.00 ? 102 SER A C    5  
ATOM 10600 O O    . SER A 1 102 ? 0.031   5.583   -15.460 1.00 0.00 ? 102 SER A O    5  
ATOM 10601 C CB   . SER A 1 102 ? 2.655   8.161   -15.804 1.00 0.00 ? 102 SER A CB   5  
ATOM 10602 O OG   . SER A 1 102 ? 2.918   8.303   -17.211 1.00 0.00 ? 102 SER A OG   5  
ATOM 10603 H H    . SER A 1 102 ? -0.127  8.429   -14.007 1.00 0.00 ? 102 SER A H    5  
ATOM 10604 H HA   . SER A 1 102 ? 0.571   8.381   -16.075 1.00 0.00 ? 102 SER A HA   5  
ATOM 10605 H HB2  . SER A 1 102 ? 2.796   9.155   -15.315 1.00 0.00 ? 102 SER A HB2  5  
ATOM 10606 H HB3  . SER A 1 102 ? 3.380   7.454   -15.341 1.00 0.00 ? 102 SER A HB3  5  
ATOM 10607 H HG   . SER A 1 102 ? 3.777   8.733   -17.298 1.00 0.00 ? 102 SER A HG   5  
ATOM 10608 N N    . ALA A 1 103 ? 1.438   5.924   -17.168 1.00 0.00 ? 103 ALA A N    5  
ATOM 10609 C CA   . ALA A 1 103 ? 1.159   4.675   -17.862 1.00 0.00 ? 103 ALA A CA   5  
ATOM 10610 C C    . ALA A 1 103 ? 2.396   4.073   -18.527 1.00 0.00 ? 103 ALA A C    5  
ATOM 10611 O O    . ALA A 1 103 ? 2.503   4.012   -19.752 1.00 0.00 ? 103 ALA A O    5  
ATOM 10612 C CB   . ALA A 1 103 ? 0.030   4.893   -18.900 1.00 0.00 ? 103 ALA A CB   5  
ATOM 10613 H H    . ALA A 1 103 ? 2.084   6.575   -17.578 1.00 0.00 ? 103 ALA A H    5  
ATOM 10614 H HA   . ALA A 1 103 ? 0.821   3.927   -17.155 1.00 0.00 ? 103 ALA A HA   5  
ATOM 10615 H HB1  . ALA A 1 103 ? -0.244  3.945   -19.411 1.00 0.00 ? 103 ALA A HB1  5  
ATOM 10616 H HB2  . ALA A 1 103 ? -0.875  5.277   -18.382 1.00 0.00 ? 103 ALA A HB2  5  
ATOM 10617 H HB3  . ALA A 1 103 ? 0.326   5.639   -19.668 1.00 0.00 ? 103 ALA A HB3  5  
ATOM 10618 N N    . SER A 1 104 ? 3.360   3.565   -17.713 1.00 0.00 ? 104 SER A N    5  
ATOM 10619 C CA   . SER A 1 104 ? 4.574   2.898   -18.195 1.00 0.00 ? 104 SER A CA   5  
ATOM 10620 C C    . SER A 1 104 ? 4.412   1.363   -18.233 1.00 0.00 ? 104 SER A C    5  
ATOM 10621 O O    . SER A 1 104 ? 3.395   0.836   -18.683 1.00 0.00 ? 104 SER A O    5  
ATOM 10622 C CB   . SER A 1 104 ? 5.833   3.285   -17.367 1.00 0.00 ? 104 SER A CB   5  
ATOM 10623 O OG   . SER A 1 104 ? 5.844   4.666   -17.007 1.00 0.00 ? 104 SER A OG   5  
ATOM 10624 H H    . SER A 1 104 ? 3.276   3.637   -16.723 1.00 0.00 ? 104 SER A H    5  
ATOM 10625 H HA   . SER A 1 104 ? 4.775   3.217   -19.213 1.00 0.00 ? 104 SER A HA   5  
ATOM 10626 H HB2  . SER A 1 104 ? 5.845   2.716   -16.420 1.00 0.00 ? 104 SER A HB2  5  
ATOM 10627 H HB3  . SER A 1 104 ? 6.758   3.059   -17.945 1.00 0.00 ? 104 SER A HB3  5  
ATOM 10628 H HG   . SER A 1 104 ? 6.634   4.807   -16.459 1.00 0.00 ? 104 SER A HG   5  
ATOM 10629 N N    . CYS A 1 105 ? 5.429   0.585   -17.771 1.00 0.00 ? 105 CYS A N    5  
ATOM 10630 C CA   . CYS A 1 105 ? 5.411   -0.869  -17.785 1.00 0.00 ? 105 CYS A CA   5  
ATOM 10631 C C    . CYS A 1 105 ? 6.372   -1.354  -16.708 1.00 0.00 ? 105 CYS A C    5  
ATOM 10632 O O    . CYS A 1 105 ? 7.057   -0.533  -16.099 1.00 0.00 ? 105 CYS A O    5  
ATOM 10633 C CB   . CYS A 1 105 ? 5.750   -1.437  -19.200 1.00 0.00 ? 105 CYS A CB   5  
ATOM 10634 S SG   . CYS A 1 105 ? 7.285   -0.777  -19.959 1.00 0.00 ? 105 CYS A SG   5  
ATOM 10635 H H    . CYS A 1 105 ? 6.282   0.943   -17.399 1.00 0.00 ? 105 CYS A H    5  
ATOM 10636 H HA   . CYS A 1 105 ? 4.430   -1.222  -17.495 1.00 0.00 ? 105 CYS A HA   5  
ATOM 10637 H HB2  . CYS A 1 105 ? 5.770   -2.549  -19.184 1.00 0.00 ? 105 CYS A HB2  5  
ATOM 10638 H HB3  . CYS A 1 105 ? 4.894   -1.162  -19.856 1.00 0.00 ? 105 CYS A HB3  5  
ATOM 10639 H HG   . CYS A 1 105 ? 6.927   -1.032  -21.209 1.00 0.00 ? 105 CYS A HG   5  
ATOM 10640 N N    . ASP A 1 106 ? 6.431   -2.694  -16.468 1.00 0.00 ? 106 ASP A N    5  
ATOM 10641 C CA   . ASP A 1 106 ? 7.298   -3.353  -15.496 1.00 0.00 ? 106 ASP A CA   5  
ATOM 10642 C C    . ASP A 1 106 ? 7.683   -4.709  -16.095 1.00 0.00 ? 106 ASP A C    5  
ATOM 10643 O O    . ASP A 1 106 ? 6.867   -5.336  -16.766 1.00 0.00 ? 106 ASP A O    5  
ATOM 10644 C CB   . ASP A 1 106 ? 6.570   -3.513  -14.118 1.00 0.00 ? 106 ASP A CB   5  
ATOM 10645 C CG   . ASP A 1 106 ? 7.482   -3.987  -12.975 1.00 0.00 ? 106 ASP A CG   5  
ATOM 10646 O OD1  . ASP A 1 106 ? 8.514   -3.313  -12.718 1.00 0.00 ? 106 ASP A OD1  5  
ATOM 10647 O OD2  . ASP A 1 106 ? 7.149   -5.027  -12.347 1.00 0.00 ? 106 ASP A OD2  5  
ATOM 10648 H H    . ASP A 1 106 ? 5.871   -3.344  -16.987 1.00 0.00 ? 106 ASP A H    5  
ATOM 10649 H HA   . ASP A 1 106 ? 8.209   -2.780  -15.376 1.00 0.00 ? 106 ASP A HA   5  
ATOM 10650 H HB2  . ASP A 1 106 ? 6.170   -2.517  -13.825 1.00 0.00 ? 106 ASP A HB2  5  
ATOM 10651 H HB3  . ASP A 1 106 ? 5.699   -4.194  -14.215 1.00 0.00 ? 106 ASP A HB3  5  
ATOM 10652 N N    . LYS A 1 107 ? 8.942   -5.169  -15.858 1.00 0.00 ? 107 LYS A N    5  
ATOM 10653 C CA   . LYS A 1 107 ? 9.506   -6.426  -16.366 1.00 0.00 ? 107 LYS A CA   5  
ATOM 10654 C C    . LYS A 1 107 ? 9.806   -7.433  -15.253 1.00 0.00 ? 107 LYS A C    5  
ATOM 10655 O O    . LYS A 1 107 ? 10.285  -8.536  -15.505 1.00 0.00 ? 107 LYS A O    5  
ATOM 10656 C CB   . LYS A 1 107 ? 10.793  -6.145  -17.196 1.00 0.00 ? 107 LYS A CB   5  
ATOM 10657 C CG   . LYS A 1 107 ? 11.913  -5.387  -16.459 1.00 0.00 ? 107 LYS A CG   5  
ATOM 10658 C CD   . LYS A 1 107 ? 13.112  -5.083  -17.375 1.00 0.00 ? 107 LYS A CD   5  
ATOM 10659 C CE   . LYS A 1 107 ? 14.228  -4.317  -16.652 1.00 0.00 ? 107 LYS A CE   5  
ATOM 10660 N NZ   . LYS A 1 107 ? 15.354  -4.027  -17.567 1.00 0.00 ? 107 LYS A NZ   5  
ATOM 10661 H H    . LYS A 1 107 ? 9.574   -4.608  -15.332 1.00 0.00 ? 107 LYS A H    5  
ATOM 10662 H HA   . LYS A 1 107 ? 8.800   -6.915  -17.028 1.00 0.00 ? 107 LYS A HA   5  
ATOM 10663 H HB2  . LYS A 1 107 ? 11.202  -7.097  -17.604 1.00 0.00 ? 107 LYS A HB2  5  
ATOM 10664 H HB3  . LYS A 1 107 ? 10.490  -5.526  -18.071 1.00 0.00 ? 107 LYS A HB3  5  
ATOM 10665 H HG2  . LYS A 1 107 ? 11.526  -4.421  -16.069 1.00 0.00 ? 107 LYS A HG2  5  
ATOM 10666 H HG3  . LYS A 1 107 ? 12.277  -5.988  -15.595 1.00 0.00 ? 107 LYS A HG3  5  
ATOM 10667 H HD2  . LYS A 1 107 ? 13.514  -6.045  -17.763 1.00 0.00 ? 107 LYS A HD2  5  
ATOM 10668 H HD3  . LYS A 1 107 ? 12.757  -4.482  -18.243 1.00 0.00 ? 107 LYS A HD3  5  
ATOM 10669 H HE2  . LYS A 1 107 ? 13.847  -3.347  -16.267 1.00 0.00 ? 107 LYS A HE2  5  
ATOM 10670 H HE3  . LYS A 1 107 ? 14.625  -4.917  -15.807 1.00 0.00 ? 107 LYS A HE3  5  
ATOM 10671 H HZ1  . LYS A 1 107 ? 15.735  -4.918  -17.943 1.00 0.00 ? 107 LYS A HZ1  5  
ATOM 10672 H HZ2  . LYS A 1 107 ? 15.017  -3.436  -18.354 1.00 0.00 ? 107 LYS A HZ2  5  
ATOM 10673 H HZ3  . LYS A 1 107 ? 16.100  -3.521  -17.050 1.00 0.00 ? 107 LYS A HZ3  5  
ATOM 10674 N N    . ILE A 1 108 ? 9.512   -7.020  -13.990 1.00 0.00 ? 108 ILE A N    5  
ATOM 10675 C CA   . ILE A 1 108 ? 9.694   -7.680  -12.690 1.00 0.00 ? 108 ILE A CA   5  
ATOM 10676 C C    . ILE A 1 108 ? 11.096  -7.422  -12.128 1.00 0.00 ? 108 ILE A C    5  
ATOM 10677 O O    . ILE A 1 108 ? 12.108  -7.777  -12.724 1.00 0.00 ? 108 ILE A O    5  
ATOM 10678 C CB   . ILE A 1 108 ? 9.196   -9.133  -12.601 1.00 0.00 ? 108 ILE A CB   5  
ATOM 10679 C CG1  . ILE A 1 108 ? 7.676   -9.143  -12.941 1.00 0.00 ? 108 ILE A CG1  5  
ATOM 10680 C CG2  . ILE A 1 108 ? 9.475   -9.749  -11.203 1.00 0.00 ? 108 ILE A CG2  5  
ATOM 10681 C CD1  . ILE A 1 108 ? 6.996   -10.515 -12.818 1.00 0.00 ? 108 ILE A CD1  5  
ATOM 10682 H H    . ILE A 1 108 ? 9.120   -6.115  -13.924 1.00 0.00 ? 108 ILE A H    5  
ATOM 10683 H HA   . ILE A 1 108 ? 9.034   -7.137  -12.030 1.00 0.00 ? 108 ILE A HA   5  
ATOM 10684 H HB   . ILE A 1 108 ? 9.739   -9.743  -13.360 1.00 0.00 ? 108 ILE A HB   5  
ATOM 10685 H HG12 . ILE A 1 108 ? 7.151   -8.426  -12.264 1.00 0.00 ? 108 ILE A HG12 5  
ATOM 10686 H HG13 . ILE A 1 108 ? 7.545   -8.775  -13.989 1.00 0.00 ? 108 ILE A HG13 5  
ATOM 10687 H HG21 . ILE A 1 108 ? 9.008   -9.148  -10.396 1.00 0.00 ? 108 ILE A HG21 5  
ATOM 10688 H HG22 . ILE A 1 108 ? 9.072   -10.782 -11.148 1.00 0.00 ? 108 ILE A HG22 5  
ATOM 10689 H HG23 . ILE A 1 108 ? 10.563  -9.834  -11.002 1.00 0.00 ? 108 ILE A HG23 5  
ATOM 10690 H HD11 . ILE A 1 108 ? 7.480   -11.274 -13.472 1.00 0.00 ? 108 ILE A HD11 5  
ATOM 10691 H HD12 . ILE A 1 108 ? 7.029   -10.885 -11.772 1.00 0.00 ? 108 ILE A HD12 5  
ATOM 10692 H HD13 . ILE A 1 108 ? 5.925   -10.450 -13.109 1.00 0.00 ? 108 ILE A HD13 5  
ATOM 10693 N N    . LEU A 1 109 ? 11.171  -6.742  -10.946 1.00 0.00 ? 109 LEU A N    5  
ATOM 10694 C CA   . LEU A 1 109 ? 12.405  -6.301  -10.298 1.00 0.00 ? 109 LEU A CA   5  
ATOM 10695 C C    . LEU A 1 109 ? 13.239  -7.346  -9.557  1.00 0.00 ? 109 LEU A C    5  
ATOM 10696 O O    . LEU A 1 109 ? 14.427  -7.494  -9.830  1.00 0.00 ? 109 LEU A O    5  
ATOM 10697 C CB   . LEU A 1 109 ? 12.036  -5.156  -9.299  1.00 0.00 ? 109 LEU A CB   5  
ATOM 10698 C CG   . LEU A 1 109 ? 13.199  -4.341  -8.678  1.00 0.00 ? 109 LEU A CG   5  
ATOM 10699 C CD1  . LEU A 1 109 ? 13.988  -3.566  -9.745  1.00 0.00 ? 109 LEU A CD1  5  
ATOM 10700 C CD2  . LEU A 1 109 ? 12.658  -3.377  -7.606  1.00 0.00 ? 109 LEU A CD2  5  
ATOM 10701 H H    . LEU A 1 109 ? 10.339  -6.440  -10.482 1.00 0.00 ? 109 LEU A H    5  
ATOM 10702 H HA   . LEU A 1 109 ? 13.057  -5.892  -11.060 1.00 0.00 ? 109 LEU A HA   5  
ATOM 10703 H HB2  . LEU A 1 109 ? 11.403  -4.433  -9.858  1.00 0.00 ? 109 LEU A HB2  5  
ATOM 10704 H HB3  . LEU A 1 109 ? 11.406  -5.552  -8.472  1.00 0.00 ? 109 LEU A HB3  5  
ATOM 10705 H HG   . LEU A 1 109 ? 13.904  -5.036  -8.162  1.00 0.00 ? 109 LEU A HG   5  
ATOM 10706 H HD11 . LEU A 1 109 ? 13.312  -2.884  -10.303 1.00 0.00 ? 109 LEU A HD11 5  
ATOM 10707 H HD12 . LEU A 1 109 ? 14.784  -2.961  -9.260  1.00 0.00 ? 109 LEU A HD12 5  
ATOM 10708 H HD13 . LEU A 1 109 ? 14.474  -4.260  -10.462 1.00 0.00 ? 109 LEU A HD13 5  
ATOM 10709 H HD21 . LEU A 1 109 ? 11.918  -2.680  -8.052  1.00 0.00 ? 109 LEU A HD21 5  
ATOM 10710 H HD22 . LEU A 1 109 ? 12.168  -3.943  -6.785  1.00 0.00 ? 109 LEU A HD22 5  
ATOM 10711 H HD23 . LEU A 1 109 ? 13.488  -2.779  -7.170  1.00 0.00 ? 109 LEU A HD23 5  
ATOM 10712 N N    . VAL A 1 110 ? 12.603  -8.009  -8.549  1.00 0.00 ? 110 VAL A N    5  
ATOM 10713 C CA   . VAL A 1 110 ? 13.142  -8.899  -7.511  1.00 0.00 ? 110 VAL A CA   5  
ATOM 10714 C C    . VAL A 1 110 ? 13.611  -8.023  -6.336  1.00 0.00 ? 110 VAL A C    5  
ATOM 10715 O O    . VAL A 1 110 ? 14.625  -7.335  -6.425  1.00 0.00 ? 110 VAL A O    5  
ATOM 10716 C CB   . VAL A 1 110 ? 14.171  -9.959  -7.941  1.00 0.00 ? 110 VAL A CB   5  
ATOM 10717 C CG1  . VAL A 1 110 ? 14.572  -10.869 -6.756  1.00 0.00 ? 110 VAL A CG1  5  
ATOM 10718 C CG2  . VAL A 1 110 ? 13.561  -10.834 -9.057  1.00 0.00 ? 110 VAL A CG2  5  
ATOM 10719 H H    . VAL A 1 110 ? 11.639  -7.812  -8.435  1.00 0.00 ? 110 VAL A H    5  
ATOM 10720 H HA   . VAL A 1 110 ? 12.293  -9.458  -7.149  1.00 0.00 ? 110 VAL A HA   5  
ATOM 10721 H HB   . VAL A 1 110 ? 15.088  -9.463  -8.337  1.00 0.00 ? 110 VAL A HB   5  
ATOM 10722 H HG11 . VAL A 1 110 ? 13.672  -11.299 -6.266  1.00 0.00 ? 110 VAL A HG11 5  
ATOM 10723 H HG12 . VAL A 1 110 ? 15.201  -11.708 -7.124  1.00 0.00 ? 110 VAL A HG12 5  
ATOM 10724 H HG13 . VAL A 1 110 ? 15.162  -10.316 -5.995  1.00 0.00 ? 110 VAL A HG13 5  
ATOM 10725 H HG21 . VAL A 1 110 ? 12.610  -11.296 -8.720  1.00 0.00 ? 110 VAL A HG21 5  
ATOM 10726 H HG22 . VAL A 1 110 ? 13.366  -10.235 -9.970  1.00 0.00 ? 110 VAL A HG22 5  
ATOM 10727 H HG23 . VAL A 1 110 ? 14.270  -11.645 -9.328  1.00 0.00 ? 110 VAL A HG23 5  
ATOM 10728 N N    . ILE A 1 111 ? 12.847  -8.015  -5.203  1.00 0.00 ? 111 ILE A N    5  
ATOM 10729 C CA   . ILE A 1 111 ? 13.021  -7.208  -3.986  1.00 0.00 ? 111 ILE A CA   5  
ATOM 10730 C C    . ILE A 1 111 ? 14.307  -7.524  -3.179  1.00 0.00 ? 111 ILE A C    5  
ATOM 10731 O O    . ILE A 1 111 ? 14.449  -8.667  -2.741  1.00 0.00 ? 111 ILE A O    5  
ATOM 10732 C CB   . ILE A 1 111 ? 11.796  -7.325  -3.037  1.00 0.00 ? 111 ILE A CB   5  
ATOM 10733 C CG1  . ILE A 1 111 ? 10.443  -7.402  -3.813  1.00 0.00 ? 111 ILE A CG1  5  
ATOM 10734 C CG2  . ILE A 1 111 ? 11.771  -6.113  -2.059  1.00 0.00 ? 111 ILE A CG2  5  
ATOM 10735 C CD1  . ILE A 1 111 ? 9.930   -8.817  -4.159  1.00 0.00 ? 111 ILE A CD1  5  
ATOM 10736 H H    . ILE A 1 111 ? 12.031  -8.578  -5.137  1.00 0.00 ? 111 ILE A H    5  
ATOM 10737 H HA   . ILE A 1 111 ? 13.033  -6.182  -4.323  1.00 0.00 ? 111 ILE A HA   5  
ATOM 10738 H HB   . ILE A 1 111 ? 11.872  -8.248  -2.413  1.00 0.00 ? 111 ILE A HB   5  
ATOM 10739 H HG12 . ILE A 1 111 ? 9.652   -6.948  -3.166  1.00 0.00 ? 111 ILE A HG12 5  
ATOM 10740 H HG13 . ILE A 1 111 ? 10.528  -6.766  -4.726  1.00 0.00 ? 111 ILE A HG13 5  
ATOM 10741 H HG21 . ILE A 1 111 ? 12.715  -6.016  -1.487  1.00 0.00 ? 111 ILE A HG21 5  
ATOM 10742 H HG22 . ILE A 1 111 ? 11.597  -5.166  -2.614  1.00 0.00 ? 111 ILE A HG22 5  
ATOM 10743 H HG23 . ILE A 1 111 ? 10.955  -6.227  -1.314  1.00 0.00 ? 111 ILE A HG23 5  
ATOM 10744 H HD11 . ILE A 1 111 ? 10.637  -9.386  -4.795  1.00 0.00 ? 111 ILE A HD11 5  
ATOM 10745 H HD12 . ILE A 1 111 ? 9.750   -9.410  -3.235  1.00 0.00 ? 111 ILE A HD12 5  
ATOM 10746 H HD13 . ILE A 1 111 ? 8.964   -8.751  -4.707  1.00 0.00 ? 111 ILE A HD13 5  
ATOM 10747 N N    . PRO A 1 112 ? 15.273  -6.604  -2.910  1.00 0.00 ? 112 PRO A N    5  
ATOM 10748 C CA   . PRO A 1 112 ? 16.522  -6.886  -2.185  1.00 0.00 ? 112 PRO A CA   5  
ATOM 10749 C C    . PRO A 1 112 ? 16.351  -6.915  -0.643  1.00 0.00 ? 112 PRO A C    5  
ATOM 10750 O O    . PRO A 1 112 ? 16.799  -6.001  0.051   1.00 0.00 ? 112 PRO A O    5  
ATOM 10751 C CB   . PRO A 1 112 ? 17.446  -5.750  -2.681  1.00 0.00 ? 112 PRO A CB   5  
ATOM 10752 C CG   . PRO A 1 112 ? 16.511  -4.560  -2.924  1.00 0.00 ? 112 PRO A CG   5  
ATOM 10753 C CD   . PRO A 1 112 ? 15.224  -5.229  -3.413  1.00 0.00 ? 112 PRO A CD   5  
ATOM 10754 H HA   . PRO A 1 112 ? 16.928  -7.847  -2.477  1.00 0.00 ? 112 PRO A HA   5  
ATOM 10755 H HB2  . PRO A 1 112 ? 18.273  -5.505  -1.984  1.00 0.00 ? 112 PRO A HB2  5  
ATOM 10756 H HB3  . PRO A 1 112 ? 17.887  -6.054  -3.659  1.00 0.00 ? 112 PRO A HB3  5  
ATOM 10757 H HG2  . PRO A 1 112 ? 16.316  -4.040  -1.960  1.00 0.00 ? 112 PRO A HG2  5  
ATOM 10758 H HG3  . PRO A 1 112 ? 16.924  -3.835  -3.655  1.00 0.00 ? 112 PRO A HG3  5  
ATOM 10759 H HD2  . PRO A 1 112 ? 14.334  -4.685  -3.021  1.00 0.00 ? 112 PRO A HD2  5  
ATOM 10760 H HD3  . PRO A 1 112 ? 15.207  -5.239  -4.527  1.00 0.00 ? 112 PRO A HD3  5  
ATOM 10761 N N    . SER A 1 113 ? 15.726  -7.988  -0.096  1.00 0.00 ? 113 SER A N    5  
ATOM 10762 C CA   . SER A 1 113 ? 15.512  -8.206  1.333   1.00 0.00 ? 113 SER A CA   5  
ATOM 10763 C C    . SER A 1 113 ? 15.310  -9.706  1.531   1.00 0.00 ? 113 SER A C    5  
ATOM 10764 O O    . SER A 1 113 ? 15.453  -10.479 0.586   1.00 0.00 ? 113 SER A O    5  
ATOM 10765 C CB   . SER A 1 113 ? 14.309  -7.382  1.904   1.00 0.00 ? 113 SER A CB   5  
ATOM 10766 O OG   . SER A 1 113 ? 14.294  -7.326  3.337   1.00 0.00 ? 113 SER A OG   5  
ATOM 10767 H H    . SER A 1 113 ? 15.386  -8.724  -0.688  1.00 0.00 ? 113 SER A H    5  
ATOM 10768 H HA   . SER A 1 113 ? 16.413  -7.933  1.870   1.00 0.00 ? 113 SER A HA   5  
ATOM 10769 H HB2  . SER A 1 113 ? 14.411  -6.340  1.528   1.00 0.00 ? 113 SER A HB2  5  
ATOM 10770 H HB3  . SER A 1 113 ? 13.346  -7.782  1.516   1.00 0.00 ? 113 SER A HB3  5  
ATOM 10771 H HG   . SER A 1 113 ? 13.480  -6.868  3.585   1.00 0.00 ? 113 SER A HG   5  
ATOM 10772 N N    . LYS A 1 114 ? 14.961  -10.136 2.771   1.00 0.00 ? 114 LYS A N    5  
ATOM 10773 C CA   . LYS A 1 114 ? 14.681  -11.517 3.169   1.00 0.00 ? 114 LYS A CA   5  
ATOM 10774 C C    . LYS A 1 114 ? 13.443  -11.497 4.064   1.00 0.00 ? 114 LYS A C    5  
ATOM 10775 O O    . LYS A 1 114 ? 12.816  -10.455 4.214   1.00 0.00 ? 114 LYS A O    5  
ATOM 10776 C CB   . LYS A 1 114 ? 15.877  -12.190 3.908   1.00 0.00 ? 114 LYS A CB   5  
ATOM 10777 C CG   . LYS A 1 114 ? 17.098  -12.453 3.008   1.00 0.00 ? 114 LYS A CG   5  
ATOM 10778 C CD   . LYS A 1 114 ? 18.117  -13.416 3.645   1.00 0.00 ? 114 LYS A CD   5  
ATOM 10779 C CE   . LYS A 1 114 ? 18.803  -12.891 4.918   1.00 0.00 ? 114 LYS A CE   5  
ATOM 10780 N NZ   . LYS A 1 114 ? 19.580  -11.659 4.646   1.00 0.00 ? 114 LYS A NZ   5  
ATOM 10781 H H    . LYS A 1 114 ? 14.824  -9.441  3.486   1.00 0.00 ? 114 LYS A H    5  
ATOM 10782 H HA   . LYS A 1 114 ? 14.425  -12.110 2.300   1.00 0.00 ? 114 LYS A HA   5  
ATOM 10783 H HB2  . LYS A 1 114 ? 16.190  -11.561 4.771   1.00 0.00 ? 114 LYS A HB2  5  
ATOM 10784 H HB3  . LYS A 1 114 ? 15.581  -13.189 4.302   1.00 0.00 ? 114 LYS A HB3  5  
ATOM 10785 H HG2  . LYS A 1 114 ? 16.736  -12.915 2.060   1.00 0.00 ? 114 LYS A HG2  5  
ATOM 10786 H HG3  . LYS A 1 114 ? 17.588  -11.493 2.738   1.00 0.00 ? 114 LYS A HG3  5  
ATOM 10787 H HD2  . LYS A 1 114 ? 17.597  -14.368 3.896   1.00 0.00 ? 114 LYS A HD2  5  
ATOM 10788 H HD3  . LYS A 1 114 ? 18.899  -13.653 2.890   1.00 0.00 ? 114 LYS A HD3  5  
ATOM 10789 H HE2  . LYS A 1 114 ? 18.058  -12.656 5.706   1.00 0.00 ? 114 LYS A HE2  5  
ATOM 10790 H HE3  . LYS A 1 114 ? 19.512  -13.652 5.308   1.00 0.00 ? 114 LYS A HE3  5  
ATOM 10791 H HZ1  . LYS A 1 114 ? 18.942  -10.921 4.283   1.00 0.00 ? 114 LYS A HZ1  5  
ATOM 10792 H HZ2  . LYS A 1 114 ? 20.027  -11.331 5.526   1.00 0.00 ? 114 LYS A HZ2  5  
ATOM 10793 H HZ3  . LYS A 1 114 ? 20.314  -11.862 3.938   1.00 0.00 ? 114 LYS A HZ3  5  
ATOM 10794 N N    . VAL A 1 115 ? 13.060  -12.642 4.691   1.00 0.00 ? 115 VAL A N    5  
ATOM 10795 C CA   . VAL A 1 115 ? 11.923  -12.755 5.597   1.00 0.00 ? 115 VAL A CA   5  
ATOM 10796 C C    . VAL A 1 115 ? 12.149  -14.056 6.359   1.00 0.00 ? 115 VAL A C    5  
ATOM 10797 O O    . VAL A 1 115 ? 13.032  -14.830 5.985   1.00 0.00 ? 115 VAL A O    5  
ATOM 10798 C CB   . VAL A 1 115 ? 10.561  -12.692 4.872   1.00 0.00 ? 115 VAL A CB   5  
ATOM 10799 C CG1  . VAL A 1 115 ? 10.282  -13.931 3.991   1.00 0.00 ? 115 VAL A CG1  5  
ATOM 10800 C CG2  . VAL A 1 115 ? 9.398   -12.387 5.843   1.00 0.00 ? 115 VAL A CG2  5  
ATOM 10801 H H    . VAL A 1 115 ? 13.555  -13.509 4.596   1.00 0.00 ? 115 VAL A H    5  
ATOM 10802 H HA   . VAL A 1 115 ? 11.984  -11.950 6.318   1.00 0.00 ? 115 VAL A HA   5  
ATOM 10803 H HB   . VAL A 1 115 ? 10.613  -11.815 4.181   1.00 0.00 ? 115 VAL A HB   5  
ATOM 10804 H HG11 . VAL A 1 115 ? 11.127  -14.118 3.295   1.00 0.00 ? 115 VAL A HG11 5  
ATOM 10805 H HG12 . VAL A 1 115 ? 10.114  -14.842 4.602   1.00 0.00 ? 115 VAL A HG12 5  
ATOM 10806 H HG13 . VAL A 1 115 ? 9.366   -13.761 3.387   1.00 0.00 ? 115 VAL A HG13 5  
ATOM 10807 H HG21 . VAL A 1 115 ? 9.650   -11.523 6.493   1.00 0.00 ? 115 VAL A HG21 5  
ATOM 10808 H HG22 . VAL A 1 115 ? 8.489   -12.132 5.259   1.00 0.00 ? 115 VAL A HG22 5  
ATOM 10809 H HG23 . VAL A 1 115 ? 9.149   -13.266 6.472   1.00 0.00 ? 115 VAL A HG23 5  
ATOM 10810 N N    . TRP A 1 116 ? 11.359  -14.336 7.426   1.00 0.00 ? 116 TRP A N    5  
ATOM 10811 C CA   . TRP A 1 116 ? 11.406  -15.574 8.193   1.00 0.00 ? 116 TRP A CA   5  
ATOM 10812 C C    . TRP A 1 116 ? 10.032  -15.727 8.845   1.00 0.00 ? 116 TRP A C    5  
ATOM 10813 O O    . TRP A 1 116 ? 9.048   -15.227 8.308   1.00 0.00 ? 116 TRP A O    5  
ATOM 10814 C CB   . TRP A 1 116 ? 12.579  -15.607 9.234   1.00 0.00 ? 116 TRP A CB   5  
ATOM 10815 C CG   . TRP A 1 116 ? 12.950  -16.973 9.809   1.00 0.00 ? 116 TRP A CG   5  
ATOM 10816 C CD1  . TRP A 1 116 ? 12.759  -18.207 9.255   1.00 0.00 ? 116 TRP A CD1  5  
ATOM 10817 C CD2  . TRP A 1 116 ? 13.558  -17.199 11.097  1.00 0.00 ? 116 TRP A CD2  5  
ATOM 10818 N NE1  . TRP A 1 116 ? 13.168  -19.181 10.132  1.00 0.00 ? 116 TRP A NE1  5  
ATOM 10819 C CE2  . TRP A 1 116 ? 13.665  -18.579 11.264  1.00 0.00 ? 116 TRP A CE2  5  
ATOM 10820 C CE3  . TRP A 1 116 ? 13.997  -16.333 12.062  1.00 0.00 ? 116 TRP A CE3  5  
ATOM 10821 C CZ2  . TRP A 1 116 ? 14.201  -19.118 12.396  1.00 0.00 ? 116 TRP A CZ2  5  
ATOM 10822 C CZ3  . TRP A 1 116 ? 14.543  -16.879 13.208  1.00 0.00 ? 116 TRP A CZ3  5  
ATOM 10823 C CH2  . TRP A 1 116 ? 14.634  -18.247 13.375  1.00 0.00 ? 116 TRP A CH2  5  
ATOM 10824 H H    . TRP A 1 116 ? 10.634  -13.703 7.690   1.00 0.00 ? 116 TRP A H    5  
ATOM 10825 H HA   . TRP A 1 116 ? 11.511  -16.396 7.494   1.00 0.00 ? 116 TRP A HA   5  
ATOM 10826 H HB2  . TRP A 1 116 ? 13.494  -15.252 8.714   1.00 0.00 ? 116 TRP A HB2  5  
ATOM 10827 H HB3  . TRP A 1 116 ? 12.390  -14.891 10.062  1.00 0.00 ? 116 TRP A HB3  5  
ATOM 10828 H HD1  . TRP A 1 116 ? 12.348  -18.388 8.271   1.00 0.00 ? 116 TRP A HD1  5  
ATOM 10829 H HE1  . TRP A 1 116 ? 13.229  -20.137 9.948   1.00 0.00 ? 116 TRP A HE1  5  
ATOM 10830 H HE3  . TRP A 1 116 ? 13.922  -15.261 11.962  1.00 0.00 ? 116 TRP A HE3  5  
ATOM 10831 H HZ2  . TRP A 1 116 ? 14.301  -20.186 12.530  1.00 0.00 ? 116 TRP A HZ2  5  
ATOM 10832 H HZ3  . TRP A 1 116 ? 14.912  -16.226 13.990  1.00 0.00 ? 116 TRP A HZ3  5  
ATOM 10833 H HH2  . TRP A 1 116 ? 15.069  -18.640 14.284  1.00 0.00 ? 116 TRP A HH2  5  
ATOM 10834 N N    . GLN A 1 117 ? 9.955   -16.397 10.027  1.00 0.00 ? 117 GLN A N    5  
ATOM 10835 C CA   . GLN A 1 117 ? 8.767   -16.628 10.853  1.00 0.00 ? 117 GLN A CA   5  
ATOM 10836 C C    . GLN A 1 117 ? 8.522   -15.482 11.833  1.00 0.00 ? 117 GLN A C    5  
ATOM 10837 O O    . GLN A 1 117 ? 7.396   -15.192 12.236  1.00 0.00 ? 117 GLN A O    5  
ATOM 10838 C CB   . GLN A 1 117 ? 8.949   -17.970 11.625  1.00 0.00 ? 117 GLN A CB   5  
ATOM 10839 C CG   . GLN A 1 117 ? 7.778   -18.439 12.533  1.00 0.00 ? 117 GLN A CG   5  
ATOM 10840 C CD   . GLN A 1 117 ? 7.984   -18.108 14.023  1.00 0.00 ? 117 GLN A CD   5  
ATOM 10841 O OE1  . GLN A 1 117 ? 8.834   -18.711 14.689  1.00 0.00 ? 117 GLN A OE1  5  
ATOM 10842 N NE2  . GLN A 1 117 ? 7.192   -17.146 14.558  1.00 0.00 ? 117 GLN A NE2  5  
ATOM 10843 H H    . GLN A 1 117 ? 10.800  -16.791 10.383  1.00 0.00 ? 117 GLN A H    5  
ATOM 10844 H HA   . GLN A 1 117 ? 7.892   -16.700 10.216  1.00 0.00 ? 117 GLN A HA   5  
ATOM 10845 H HB2  . GLN A 1 117 ? 9.076   -18.757 10.845  1.00 0.00 ? 117 GLN A HB2  5  
ATOM 10846 H HB3  . GLN A 1 117 ? 9.896   -17.959 12.210  1.00 0.00 ? 117 GLN A HB3  5  
ATOM 10847 H HG2  . GLN A 1 117 ? 6.807   -18.047 12.171  1.00 0.00 ? 117 GLN A HG2  5  
ATOM 10848 H HG3  . GLN A 1 117 ? 7.736   -19.551 12.484  1.00 0.00 ? 117 GLN A HG3  5  
ATOM 10849 H HE21 . GLN A 1 117 ? 6.691   -16.525 13.953  1.00 0.00 ? 117 GLN A HE21 5  
ATOM 10850 H HE22 . GLN A 1 117 ? 7.267   -16.990 15.539  1.00 0.00 ? 117 GLN A HE22 5  
ATOM 10851 N N    . GLY A 1 118 ? 9.628   -14.829 12.245  1.00 0.00 ? 118 GLY A N    5  
ATOM 10852 C CA   . GLY A 1 118 ? 9.680   -13.743 13.192  1.00 0.00 ? 118 GLY A CA   5  
ATOM 10853 C C    . GLY A 1 118 ? 10.920  -13.997 13.983  1.00 0.00 ? 118 GLY A C    5  
ATOM 10854 O O    . GLY A 1 118 ? 11.923  -14.457 13.437  1.00 0.00 ? 118 GLY A O    5  
ATOM 10855 H H    . GLY A 1 118 ? 10.520  -15.115 11.902  1.00 0.00 ? 118 GLY A H    5  
ATOM 10856 H HA2  . GLY A 1 118 ? 9.801   -12.813 12.653  1.00 0.00 ? 118 GLY A HA2  5  
ATOM 10857 H HA3  . GLY A 1 118 ? 8.826   -13.763 13.857  1.00 0.00 ? 118 GLY A HA3  5  
ATOM 10858 N N    . GLN A 1 119 ? 10.841  -13.708 15.298  1.00 0.00 ? 119 GLN A N    5  
ATOM 10859 C CA   . GLN A 1 119 ? 11.857  -13.877 16.313  1.00 0.00 ? 119 GLN A CA   5  
ATOM 10860 C C    . GLN A 1 119 ? 11.127  -14.545 17.471  1.00 0.00 ? 119 GLN A C    5  
ATOM 10861 O O    . GLN A 1 119 ? 9.979   -14.206 17.757  1.00 0.00 ? 119 GLN A O    5  
ATOM 10862 C CB   . GLN A 1 119 ? 12.407  -12.479 16.738  1.00 0.00 ? 119 GLN A CB   5  
ATOM 10863 C CG   . GLN A 1 119 ? 13.530  -12.464 17.810  1.00 0.00 ? 119 GLN A CG   5  
ATOM 10864 C CD   . GLN A 1 119 ? 13.225  -11.472 18.947  1.00 0.00 ? 119 GLN A CD   5  
ATOM 10865 O OE1  . GLN A 1 119 ? 13.297  -10.253 18.777  1.00 0.00 ? 119 GLN A OE1  5  
ATOM 10866 N NE2  . GLN A 1 119 ? 12.886  -12.018 20.145  1.00 0.00 ? 119 GLN A NE2  5  
ATOM 10867 H H    . GLN A 1 119 ? 9.991   -13.351 15.685  1.00 0.00 ? 119 GLN A H    5  
ATOM 10868 H HA   . GLN A 1 119 ? 12.649  -14.531 15.967  1.00 0.00 ? 119 GLN A HA   5  
ATOM 10869 H HB2  . GLN A 1 119 ? 12.818  -11.991 15.825  1.00 0.00 ? 119 GLN A HB2  5  
ATOM 10870 H HB3  . GLN A 1 119 ? 11.558  -11.833 17.059  1.00 0.00 ? 119 GLN A HB3  5  
ATOM 10871 H HG2  . GLN A 1 119 ? 13.704  -13.471 18.230  1.00 0.00 ? 119 GLN A HG2  5  
ATOM 10872 H HG3  . GLN A 1 119 ? 14.480  -12.132 17.336  1.00 0.00 ? 119 GLN A HG3  5  
ATOM 10873 H HE21 . GLN A 1 119 ? 12.819  -13.018 20.265  1.00 0.00 ? 119 GLN A HE21 5  
ATOM 10874 H HE22 . GLN A 1 119 ? 12.715  -11.396 20.906  1.00 0.00 ? 119 GLN A HE22 5  
ATOM 10875 N N    . ALA A 1 120 ? 11.767  -15.499 18.189  1.00 0.00 ? 120 ALA A N    5  
ATOM 10876 C CA   . ALA A 1 120 ? 11.183  -16.207 19.325  1.00 0.00 ? 120 ALA A CA   5  
ATOM 10877 C C    . ALA A 1 120 ? 11.723  -15.726 20.677  1.00 0.00 ? 120 ALA A C    5  
ATOM 10878 O O    . ALA A 1 120 ? 12.629  -14.893 20.745  1.00 0.00 ? 120 ALA A O    5  
ATOM 10879 C CB   . ALA A 1 120 ? 11.414  -17.724 19.153  1.00 0.00 ? 120 ALA A CB   5  
ATOM 10880 H H    . ALA A 1 120 ? 12.704  -15.749 17.968  1.00 0.00 ? 120 ALA A H    5  
ATOM 10881 H HA   . ALA A 1 120 ? 10.111  -16.047 19.356  1.00 0.00 ? 120 ALA A HA   5  
ATOM 10882 H HB1  . ALA A 1 120 ? 10.937  -18.050 18.205  1.00 0.00 ? 120 ALA A HB1  5  
ATOM 10883 H HB2  . ALA A 1 120 ? 12.496  -17.971 19.087  1.00 0.00 ? 120 ALA A HB2  5  
ATOM 10884 H HB3  . ALA A 1 120 ? 10.962  -18.320 19.973  1.00 0.00 ? 120 ALA A HB3  5  
ATOM 10885 N N    . PHE A 1 121 ? 11.138  -16.262 21.781  1.00 0.00 ? 121 PHE A N    5  
ATOM 10886 C CA   . PHE A 1 121 ? 11.494  -15.980 23.163  1.00 0.00 ? 121 PHE A CA   5  
ATOM 10887 C C    . PHE A 1 121 ? 11.186  -17.243 23.971  1.00 0.00 ? 121 PHE A C    5  
ATOM 10888 O O    . PHE A 1 121 ? 10.126  -17.364 24.577  1.00 0.00 ? 121 PHE A O    5  
ATOM 10889 C CB   . PHE A 1 121 ? 10.723  -14.734 23.715  1.00 0.00 ? 121 PHE A CB   5  
ATOM 10890 C CG   . PHE A 1 121 ? 11.256  -14.240 25.045  1.00 0.00 ? 121 PHE A CG   5  
ATOM 10891 C CD1  . PHE A 1 121 ? 12.525  -13.693 25.139  1.00 0.00 ? 121 PHE A CD1  5  
ATOM 10892 C CD2  . PHE A 1 121 ? 10.483  -14.324 26.192  1.00 0.00 ? 121 PHE A CD2  5  
ATOM 10893 C CE1  . PHE A 1 121 ? 13.010  -13.233 26.348  1.00 0.00 ? 121 PHE A CE1  5  
ATOM 10894 C CE2  . PHE A 1 121 ? 10.961  -13.864 27.401  1.00 0.00 ? 121 PHE A CE2  5  
ATOM 10895 C CZ   . PHE A 1 121 ? 12.227  -13.320 27.481  1.00 0.00 ? 121 PHE A CZ   5  
ATOM 10896 H H    . PHE A 1 121 ? 10.399  -16.921 21.661  1.00 0.00 ? 121 PHE A H    5  
ATOM 10897 H HA   . PHE A 1 121 ? 12.561  -15.799 23.223  1.00 0.00 ? 121 PHE A HA   5  
ATOM 10898 H HB2  . PHE A 1 121 ? 10.843  -13.893 22.998  1.00 0.00 ? 121 PHE A HB2  5  
ATOM 10899 H HB3  . PHE A 1 121 ? 9.634   -14.941 23.807  1.00 0.00 ? 121 PHE A HB3  5  
ATOM 10900 H HD1  . PHE A 1 121 ? 13.142  -13.617 24.254  1.00 0.00 ? 121 PHE A HD1  5  
ATOM 10901 H HD2  . PHE A 1 121 ? 9.491   -14.754 26.141  1.00 0.00 ? 121 PHE A HD2  5  
ATOM 10902 H HE1  . PHE A 1 121 ? 13.997  -12.792 26.412  1.00 0.00 ? 121 PHE A HE1  5  
ATOM 10903 H HE2  . PHE A 1 121 ? 10.340  -13.921 28.286  1.00 0.00 ? 121 PHE A HE2  5  
ATOM 10904 H HZ   . PHE A 1 121 ? 12.598  -12.949 28.429  1.00 0.00 ? 121 PHE A HZ   5  
ATOM 10905 N N    . HIS A 1 122 ? 12.112  -18.236 23.977  1.00 0.00 ? 122 HIS A N    5  
ATOM 10906 C CA   . HIS A 1 122 ? 11.981  -19.501 24.699  1.00 0.00 ? 122 HIS A CA   5  
ATOM 10907 C C    . HIS A 1 122 ? 13.281  -19.670 25.470  1.00 0.00 ? 122 HIS A C    5  
ATOM 10908 O O    . HIS A 1 122 ? 14.146  -20.473 25.133  1.00 0.00 ? 122 HIS A O    5  
ATOM 10909 C CB   . HIS A 1 122 ? 11.702  -20.679 23.718  1.00 0.00 ? 122 HIS A CB   5  
ATOM 10910 C CG   . HIS A 1 122 ? 10.609  -21.626 24.152  1.00 0.00 ? 122 HIS A CG   5  
ATOM 10911 N ND1  . HIS A 1 122 ? 10.765  -22.730 24.962  1.00 0.00 ? 122 HIS A ND1  5  
ATOM 10912 C CD2  . HIS A 1 122 ? 9.291   -21.616 23.807  1.00 0.00 ? 122 HIS A CD2  5  
ATOM 10913 C CE1  . HIS A 1 122 ? 9.550   -23.327 25.060  1.00 0.00 ? 122 HIS A CE1  5  
ATOM 10914 N NE2  . HIS A 1 122 ? 8.631   -22.690 24.371  1.00 0.00 ? 122 HIS A NE2  5  
ATOM 10915 H H    . HIS A 1 122 ? 12.961  -18.153 23.460  1.00 0.00 ? 122 HIS A H    5  
ATOM 10916 H HA   . HIS A 1 122 ? 11.177  -19.451 25.424  1.00 0.00 ? 122 HIS A HA   5  
ATOM 10917 H HB2  . HIS A 1 122 ? 11.327  -20.225 22.774  1.00 0.00 ? 122 HIS A HB2  5  
ATOM 10918 H HB3  . HIS A 1 122 ? 12.613  -21.252 23.444  1.00 0.00 ? 122 HIS A HB3  5  
ATOM 10919 H HD1  . HIS A 1 122 ? 11.614  -23.098 25.367  1.00 0.00 ? 122 HIS A HD1  5  
ATOM 10920 H HD2  . HIS A 1 122 ? 8.746   -20.916 23.188  1.00 0.00 ? 122 HIS A HD2  5  
ATOM 10921 H HE1  . HIS A 1 122 ? 9.383   -24.232 25.643  1.00 0.00 ? 122 HIS A HE1  5  
ATOM 10922 N N    . LEU A 1 123 ? 13.465  -18.850 26.531  1.00 0.00 ? 123 LEU A N    5  
ATOM 10923 C CA   . LEU A 1 123 ? 14.689  -18.694 27.311  1.00 0.00 ? 123 LEU A CA   5  
ATOM 10924 C C    . LEU A 1 123 ? 14.759  -19.543 28.583  1.00 0.00 ? 123 LEU A C    5  
ATOM 10925 O O    . LEU A 1 123 ? 14.932  -19.043 29.693  1.00 0.00 ? 123 LEU A O    5  
ATOM 10926 C CB   . LEU A 1 123 ? 14.852  -17.180 27.627  1.00 0.00 ? 123 LEU A CB   5  
ATOM 10927 C CG   . LEU A 1 123 ? 16.288  -16.683 27.908  1.00 0.00 ? 123 LEU A CG   5  
ATOM 10928 C CD1  . LEU A 1 123 ? 17.191  -16.798 26.667  1.00 0.00 ? 123 LEU A CD1  5  
ATOM 10929 C CD2  . LEU A 1 123 ? 16.242  -15.227 28.396  1.00 0.00 ? 123 LEU A CD2  5  
ATOM 10930 H H    . LEU A 1 123 ? 12.746  -18.208 26.780  1.00 0.00 ? 123 LEU A H    5  
ATOM 10931 H HA   . LEU A 1 123 ? 15.529  -18.993 26.697  1.00 0.00 ? 123 LEU A HA   5  
ATOM 10932 H HB2  . LEU A 1 123 ? 14.492  -16.608 26.742  1.00 0.00 ? 123 LEU A HB2  5  
ATOM 10933 H HB3  . LEU A 1 123 ? 14.191  -16.888 28.473  1.00 0.00 ? 123 LEU A HB3  5  
ATOM 10934 H HG   . LEU A 1 123 ? 16.730  -17.299 28.726  1.00 0.00 ? 123 LEU A HG   5  
ATOM 10935 H HD11 . LEU A 1 123 ? 16.733  -16.256 25.811  1.00 0.00 ? 123 LEU A HD11 5  
ATOM 10936 H HD12 . LEU A 1 123 ? 18.185  -16.349 26.873  1.00 0.00 ? 123 LEU A HD12 5  
ATOM 10937 H HD13 . LEU A 1 123 ? 17.343  -17.857 26.376  1.00 0.00 ? 123 LEU A HD13 5  
ATOM 10938 H HD21 . LEU A 1 123 ? 15.635  -15.153 29.324  1.00 0.00 ? 123 LEU A HD21 5  
ATOM 10939 H HD22 . LEU A 1 123 ? 17.266  -14.857 28.615  1.00 0.00 ? 123 LEU A HD22 5  
ATOM 10940 H HD23 . LEU A 1 123 ? 15.787  -14.573 27.621  1.00 0.00 ? 123 LEU A HD23 5  
ATOM 10941 N N    . ASP A 1 124 ? 14.640  -20.884 28.435  1.00 0.00 ? 124 ASP A N    5  
ATOM 10942 C CA   . ASP A 1 124 ? 14.694  -21.849 29.524  1.00 0.00 ? 124 ASP A CA   5  
ATOM 10943 C C    . ASP A 1 124 ? 15.438  -23.060 28.983  1.00 0.00 ? 124 ASP A C    5  
ATOM 10944 O O    . ASP A 1 124 ? 15.092  -23.589 27.928  1.00 0.00 ? 124 ASP A O    5  
ATOM 10945 C CB   . ASP A 1 124 ? 13.250  -22.215 30.000  1.00 0.00 ? 124 ASP A CB   5  
ATOM 10946 C CG   . ASP A 1 124 ? 13.212  -23.123 31.237  1.00 0.00 ? 124 ASP A CG   5  
ATOM 10947 O OD1  . ASP A 1 124 ? 13.786  -22.731 32.286  1.00 0.00 ? 124 ASP A OD1  5  
ATOM 10948 O OD2  . ASP A 1 124 ? 12.600  -24.219 31.137  1.00 0.00 ? 124 ASP A OD2  5  
ATOM 10949 H H    . ASP A 1 124 ? 14.499  -21.284 27.529  1.00 0.00 ? 124 ASP A H    5  
ATOM 10950 H HA   . ASP A 1 124 ? 15.265  -21.449 30.355  1.00 0.00 ? 124 ASP A HA   5  
ATOM 10951 H HB2  . ASP A 1 124 ? 12.727  -21.269 30.266  1.00 0.00 ? 124 ASP A HB2  5  
ATOM 10952 H HB3  . ASP A 1 124 ? 12.677  -22.682 29.170  1.00 0.00 ? 124 ASP A HB3  5  
ATOM 10953 N N    . ARG A 1 125 ? 16.486  -23.566 29.694  1.00 0.00 ? 125 ARG A N    5  
ATOM 10954 C CA   . ARG A 1 125 ? 17.324  -24.695 29.260  1.00 0.00 ? 125 ARG A CA   5  
ATOM 10955 C C    . ARG A 1 125 ? 16.769  -26.092 29.577  1.00 0.00 ? 125 ARG A C    5  
ATOM 10956 O O    . ARG A 1 125 ? 17.439  -26.959 30.134  1.00 0.00 ? 125 ARG A O    5  
ATOM 10957 C CB   . ARG A 1 125 ? 18.781  -24.532 29.778  1.00 0.00 ? 125 ARG A CB   5  
ATOM 10958 C CG   . ARG A 1 125 ? 19.478  -23.207 29.379  1.00 0.00 ? 125 ARG A CG   5  
ATOM 10959 C CD   . ARG A 1 125 ? 19.743  -23.013 27.869  1.00 0.00 ? 125 ARG A CD   5  
ATOM 10960 N NE   . ARG A 1 125 ? 18.492  -22.515 27.189  1.00 0.00 ? 125 ARG A NE   5  
ATOM 10961 C CZ   . ARG A 1 125 ? 18.281  -22.576 25.836  1.00 0.00 ? 125 ARG A CZ   5  
ATOM 10962 N NH1  . ARG A 1 125 ? 19.238  -23.065 24.997  1.00 0.00 ? 125 ARG A NH1  5  
ATOM 10963 N NH2  . ARG A 1 125 ? 17.090  -22.146 25.326  1.00 0.00 ? 125 ARG A NH2  5  
ATOM 10964 H H    . ARG A 1 125 ? 16.770  -23.150 30.553  1.00 0.00 ? 125 ARG A H    5  
ATOM 10965 H HA   . ARG A 1 125 ? 17.397  -24.677 28.182  1.00 0.00 ? 125 ARG A HA   5  
ATOM 10966 H HB2  . ARG A 1 125 ? 18.781  -24.598 30.889  1.00 0.00 ? 125 ARG A HB2  5  
ATOM 10967 H HB3  . ARG A 1 125 ? 19.416  -25.364 29.394  1.00 0.00 ? 125 ARG A HB3  5  
ATOM 10968 H HG2  . ARG A 1 125 ? 18.919  -22.333 29.777  1.00 0.00 ? 125 ARG A HG2  5  
ATOM 10969 H HG3  . ARG A 1 125 ? 20.475  -23.211 29.879  1.00 0.00 ? 125 ARG A HG3  5  
ATOM 10970 H HD2  . ARG A 1 125 ? 20.527  -22.239 27.728  1.00 0.00 ? 125 ARG A HD2  5  
ATOM 10971 H HD3  . ARG A 1 125 ? 20.080  -23.973 27.419  1.00 0.00 ? 125 ARG A HD3  5  
ATOM 10972 H HE   . ARG A 1 125 ? 17.759  -22.155 27.766  1.00 0.00 ? 125 ARG A HE   5  
ATOM 10973 H HH11 . ARG A 1 125 ? 20.110  -23.386 25.368  1.00 0.00 ? 125 ARG A HH11 5  
ATOM 10974 H HH12 . ARG A 1 125 ? 19.067  -23.106 24.013  1.00 0.00 ? 125 ARG A HH12 5  
ATOM 10975 H HH21 . ARG A 1 125 ? 16.382  -21.790 25.937  1.00 0.00 ? 125 ARG A HH21 5  
ATOM 10976 H HH22 . ARG A 1 125 ? 16.925  -22.187 24.340  1.00 0.00 ? 125 ARG A HH22 5  
ATOM 10977 N N    . ARG A 1 126 ? 15.502  -26.317 29.162  1.00 0.00 ? 126 ARG A N    5  
ATOM 10978 C CA   . ARG A 1 126 ? 14.753  -27.561 29.247  1.00 0.00 ? 126 ARG A CA   5  
ATOM 10979 C C    . ARG A 1 126 ? 14.047  -27.740 27.912  1.00 0.00 ? 126 ARG A C    5  
ATOM 10980 O O    . ARG A 1 126 ? 14.505  -28.490 27.057  1.00 0.00 ? 126 ARG A O    5  
ATOM 10981 C CB   . ARG A 1 126 ? 13.751  -27.613 30.437  1.00 0.00 ? 126 ARG A CB   5  
ATOM 10982 C CG   . ARG A 1 126 ? 14.445  -27.708 31.813  1.00 0.00 ? 126 ARG A CG   5  
ATOM 10983 C CD   . ARG A 1 126 ? 13.478  -27.867 32.996  1.00 0.00 ? 126 ARG A CD   5  
ATOM 10984 N NE   . ARG A 1 126 ? 12.639  -26.623 33.103  1.00 0.00 ? 126 ARG A NE   5  
ATOM 10985 C CZ   . ARG A 1 126 ? 11.739  -26.403 34.111  1.00 0.00 ? 126 ARG A CZ   5  
ATOM 10986 N NH1  . ARG A 1 126 ? 11.551  -27.325 35.099  1.00 0.00 ? 126 ARG A NH1  5  
ATOM 10987 N NH2  . ARG A 1 126 ? 11.021  -25.241 34.124  1.00 0.00 ? 126 ARG A NH2  5  
ATOM 10988 H H    . ARG A 1 126 ? 15.047  -25.547 28.714  1.00 0.00 ? 126 ARG A H    5  
ATOM 10989 H HA   . ARG A 1 126 ? 15.435  -28.398 29.331  1.00 0.00 ? 126 ARG A HA   5  
ATOM 10990 H HB2  . ARG A 1 126 ? 13.102  -26.711 30.429  1.00 0.00 ? 126 ARG A HB2  5  
ATOM 10991 H HB3  . ARG A 1 126 ? 13.098  -28.512 30.349  1.00 0.00 ? 126 ARG A HB3  5  
ATOM 10992 H HG2  . ARG A 1 126 ? 15.126  -28.590 31.804  1.00 0.00 ? 126 ARG A HG2  5  
ATOM 10993 H HG3  . ARG A 1 126 ? 15.076  -26.806 31.975  1.00 0.00 ? 126 ARG A HG3  5  
ATOM 10994 H HD2  . ARG A 1 126 ? 12.813  -28.744 32.836  1.00 0.00 ? 126 ARG A HD2  5  
ATOM 10995 H HD3  . ARG A 1 126 ? 14.056  -27.997 33.937  1.00 0.00 ? 126 ARG A HD3  5  
ATOM 10996 H HE   . ARG A 1 126 ? 12.744  -25.922 32.396  1.00 0.00 ? 126 ARG A HE   5  
ATOM 10997 H HH11 . ARG A 1 126 ? 12.076  -28.176 35.093  1.00 0.00 ? 126 ARG A HH11 5  
ATOM 10998 H HH12 . ARG A 1 126 ? 10.891  -27.148 35.829  1.00 0.00 ? 126 ARG A HH12 5  
ATOM 10999 H HH21 . ARG A 1 126 ? 11.156  -24.563 33.401  1.00 0.00 ? 126 ARG A HH21 5  
ATOM 11000 H HH22 . ARG A 1 126 ? 10.361  -25.069 34.856  1.00 0.00 ? 126 ARG A HH22 5  
ATOM 11001 N N    . LEU A 1 127 ? 12.903  -27.037 27.691  1.00 0.00 ? 127 LEU A N    5  
ATOM 11002 C CA   . LEU A 1 127 ? 12.103  -27.058 26.463  1.00 0.00 ? 127 LEU A CA   5  
ATOM 11003 C C    . LEU A 1 127 ? 12.474  -25.898 25.539  1.00 0.00 ? 127 LEU A C    5  
ATOM 11004 O O    . LEU A 1 127 ? 12.475  -24.732 25.935  1.00 0.00 ? 127 LEU A O    5  
ATOM 11005 C CB   . LEU A 1 127 ? 10.585  -26.991 26.805  1.00 0.00 ? 127 LEU A CB   5  
ATOM 11006 C CG   . LEU A 1 127 ? 9.587   -27.024 25.615  1.00 0.00 ? 127 LEU A CG   5  
ATOM 11007 C CD1  . LEU A 1 127 ? 9.745   -28.272 24.732  1.00 0.00 ? 127 LEU A CD1  5  
ATOM 11008 C CD2  . LEU A 1 127 ? 8.138   -26.911 26.125  1.00 0.00 ? 127 LEU A CD2  5  
ATOM 11009 H H    . LEU A 1 127 ? 12.545  -26.423 28.385  1.00 0.00 ? 127 LEU A H    5  
ATOM 11010 H HA   . LEU A 1 127 ? 12.291  -27.979 25.928  1.00 0.00 ? 127 LEU A HA   5  
ATOM 11011 H HB2  . LEU A 1 127 ? 10.349  -27.862 27.458  1.00 0.00 ? 127 LEU A HB2  5  
ATOM 11012 H HB3  . LEU A 1 127 ? 10.383  -26.076 27.404  1.00 0.00 ? 127 LEU A HB3  5  
ATOM 11013 H HG   . LEU A 1 127 ? 9.770   -26.134 24.966  1.00 0.00 ? 127 LEU A HG   5  
ATOM 11014 H HD11 . LEU A 1 127 ? 9.588   -29.192 25.331  1.00 0.00 ? 127 LEU A HD11 5  
ATOM 11015 H HD12 . LEU A 1 127 ? 8.995   -28.265 23.912  1.00 0.00 ? 127 LEU A HD12 5  
ATOM 11016 H HD13 . LEU A 1 127 ? 10.752  -28.320 24.269  1.00 0.00 ? 127 LEU A HD13 5  
ATOM 11017 H HD21 . LEU A 1 127 ? 8.012   -25.996 26.742  1.00 0.00 ? 127 LEU A HD21 5  
ATOM 11018 H HD22 . LEU A 1 127 ? 7.433   -26.862 25.267  1.00 0.00 ? 127 LEU A HD22 5  
ATOM 11019 H HD23 . LEU A 1 127 ? 7.880   -27.794 26.750  1.00 0.00 ? 127 LEU A HD23 5  
ATOM 11020 N N    . GLU A 1 128 ? 12.775  -26.192 24.255  1.00 0.00 ? 128 GLU A N    5  
ATOM 11021 C CA   . GLU A 1 128 ? 13.171  -25.189 23.294  1.00 0.00 ? 128 GLU A CA   5  
ATOM 11022 C C    . GLU A 1 128 ? 12.551  -25.523 21.958  1.00 0.00 ? 128 GLU A C    5  
ATOM 11023 O O    . GLU A 1 128 ? 11.999  -26.604 21.762  1.00 0.00 ? 128 GLU A O    5  
ATOM 11024 C CB   . GLU A 1 128 ? 14.719  -25.056 23.218  1.00 0.00 ? 128 GLU A CB   5  
ATOM 11025 C CG   . GLU A 1 128 ? 15.478  -26.341 22.835  1.00 0.00 ? 128 GLU A CG   5  
ATOM 11026 C CD   . GLU A 1 128 ? 16.980  -26.059 22.832  1.00 0.00 ? 128 GLU A CD   5  
ATOM 11027 O OE1  . GLU A 1 128 ? 17.531  -25.776 23.929  1.00 0.00 ? 128 GLU A OE1  5  
ATOM 11028 O OE2  . GLU A 1 128 ? 17.595  -26.124 21.734  1.00 0.00 ? 128 GLU A OE2  5  
ATOM 11029 H H    . GLU A 1 128 ? 12.742  -27.121 23.888  1.00 0.00 ? 128 GLU A H    5  
ATOM 11030 H HA   . GLU A 1 128 ? 12.763  -24.223 23.562  1.00 0.00 ? 128 GLU A HA   5  
ATOM 11031 H HB2  . GLU A 1 128 ? 14.998  -24.229 22.529  1.00 0.00 ? 128 GLU A HB2  5  
ATOM 11032 H HB3  . GLU A 1 128 ? 15.062  -24.750 24.233  1.00 0.00 ? 128 GLU A HB3  5  
ATOM 11033 H HG2  . GLU A 1 128 ? 15.261  -27.149 23.565  1.00 0.00 ? 128 GLU A HG2  5  
ATOM 11034 H HG3  . GLU A 1 128 ? 15.168  -26.690 21.828  1.00 0.00 ? 128 GLU A HG3  5  
ATOM 11035 N N    . ARG A 1 129 ? 12.647  -24.542 21.026  1.00 0.00 ? 129 ARG A N    5  
ATOM 11036 C CA   . ARG A 1 129 ? 12.176  -24.526 19.652  1.00 0.00 ? 129 ARG A CA   5  
ATOM 11037 C C    . ARG A 1 129 ? 10.668  -24.337 19.485  1.00 0.00 ? 129 ARG A C    5  
ATOM 11038 O O    . ARG A 1 129 ? 10.021  -25.301 19.070  1.00 0.00 ? 129 ARG A O    5  
ATOM 11039 C CB   . ARG A 1 129 ? 12.654  -25.750 18.803  1.00 0.00 ? 129 ARG A CB   5  
ATOM 11040 C CG   . ARG A 1 129 ? 14.177  -25.980 18.797  1.00 0.00 ? 129 ARG A CG   5  
ATOM 11041 C CD   . ARG A 1 129 ? 14.976  -24.893 18.066  1.00 0.00 ? 129 ARG A CD   5  
ATOM 11042 N NE   . ARG A 1 129 ? 16.431  -25.268 18.132  1.00 0.00 ? 129 ARG A NE   5  
ATOM 11043 C CZ   . ARG A 1 129 ? 17.417  -24.566 17.493  1.00 0.00 ? 129 ARG A CZ   5  
ATOM 11044 N NH1  . ARG A 1 129 ? 17.122  -23.455 16.758  1.00 0.00 ? 129 ARG A NH1  5  
ATOM 11045 N NH2  . ARG A 1 129 ? 18.713  -24.987 17.593  1.00 0.00 ? 129 ARG A NH2  5  
ATOM 11046 H H    . ARG A 1 129 ? 13.113  -23.711 21.298  1.00 0.00 ? 129 ARG A H    5  
ATOM 11047 H HA   . ARG A 1 129 ? 12.639  -23.658 19.203  1.00 0.00 ? 129 ARG A HA   5  
ATOM 11048 H HB2  . ARG A 1 129 ? 12.184  -26.677 19.207  1.00 0.00 ? 129 ARG A HB2  5  
ATOM 11049 H HB3  . ARG A 1 129 ? 12.333  -25.644 17.744  1.00 0.00 ? 129 ARG A HB3  5  
ATOM 11050 H HG2  . ARG A 1 129 ? 14.547  -26.068 19.841  1.00 0.00 ? 129 ARG A HG2  5  
ATOM 11051 H HG3  . ARG A 1 129 ? 14.368  -26.960 18.302  1.00 0.00 ? 129 ARG A HG3  5  
ATOM 11052 H HD2  . ARG A 1 129 ? 14.655  -24.838 17.001  1.00 0.00 ? 129 ARG A HD2  5  
ATOM 11053 H HD3  . ARG A 1 129 ? 14.837  -23.906 18.559  1.00 0.00 ? 129 ARG A HD3  5  
ATOM 11054 H HE   . ARG A 1 129 ? 16.687  -26.076 18.662  1.00 0.00 ? 129 ARG A HE   5  
ATOM 11055 H HH11 . ARG A 1 129 ? 16.176  -23.143 16.682  1.00 0.00 ? 129 ARG A HH11 5  
ATOM 11056 H HH12 . ARG A 1 129 ? 17.854  -22.953 16.297  1.00 0.00 ? 129 ARG A HH12 5  
ATOM 11057 H HH21 . ARG A 1 129 ? 18.933  -25.801 18.130  1.00 0.00 ? 129 ARG A HH21 5  
ATOM 11058 H HH22 . ARG A 1 129 ? 19.439  -24.482 17.128  1.00 0.00 ? 129 ARG A HH22 5  
ATOM 11059 N N    . PRO A 1 130 ? 10.010  -23.160 19.704  1.00 0.00 ? 130 PRO A N    5  
ATOM 11060 C CA   . PRO A 1 130 ? 8.579   -22.918 19.411  1.00 0.00 ? 130 PRO A CA   5  
ATOM 11061 C C    . PRO A 1 130 ? 8.346   -22.722 17.892  1.00 0.00 ? 130 PRO A C    5  
ATOM 11062 O O    . PRO A 1 130 ? 7.833   -21.706 17.433  1.00 0.00 ? 130 PRO A O    5  
ATOM 11063 C CB   . PRO A 1 130 ? 8.281   -21.656 20.236  1.00 0.00 ? 130 PRO A CB   5  
ATOM 11064 C CG   . PRO A 1 130 ? 9.591   -20.865 20.191  1.00 0.00 ? 130 PRO A CG   5  
ATOM 11065 C CD   . PRO A 1 130 ? 10.665  -21.959 20.216  1.00 0.00 ? 130 PRO A CD   5  
ATOM 11066 H HA   . PRO A 1 130 ? 7.968   -23.750 19.734  1.00 0.00 ? 130 PRO A HA   5  
ATOM 11067 H HB2  . PRO A 1 130 ? 7.411   -21.075 19.862  1.00 0.00 ? 130 PRO A HB2  5  
ATOM 11068 H HB3  . PRO A 1 130 ? 8.071   -21.967 21.284  1.00 0.00 ? 130 PRO A HB3  5  
ATOM 11069 H HG2  . PRO A 1 130 ? 9.651   -20.315 19.224  1.00 0.00 ? 130 PRO A HG2  5  
ATOM 11070 H HG3  . PRO A 1 130 ? 9.688   -20.152 21.033  1.00 0.00 ? 130 PRO A HG3  5  
ATOM 11071 H HD2  . PRO A 1 130 ? 11.537  -21.658 19.591  1.00 0.00 ? 130 PRO A HD2  5  
ATOM 11072 H HD3  . PRO A 1 130 ? 10.987  -22.143 21.265  1.00 0.00 ? 130 PRO A HD3  5  
ATOM 11073 N N    . HIS A 1 131 ? 8.768   -23.748 17.136  1.00 0.00 ? 131 HIS A N    5  
ATOM 11074 C CA   . HIS A 1 131 ? 8.782   -23.889 15.703  1.00 0.00 ? 131 HIS A CA   5  
ATOM 11075 C C    . HIS A 1 131 ? 8.535   -25.376 15.491  1.00 0.00 ? 131 HIS A C    5  
ATOM 11076 O O    . HIS A 1 131 ? 7.663   -25.795 14.735  1.00 0.00 ? 131 HIS A O    5  
ATOM 11077 C CB   . HIS A 1 131 ? 10.137  -23.413 15.059  1.00 0.00 ? 131 HIS A CB   5  
ATOM 11078 C CG   . HIS A 1 131 ? 10.875  -22.298 15.789  1.00 0.00 ? 131 HIS A CG   5  
ATOM 11079 N ND1  . HIS A 1 131 ? 10.556  -20.950 15.813  1.00 0.00 ? 131 HIS A ND1  5  
ATOM 11080 C CD2  . HIS A 1 131 ? 11.987  -22.417 16.573  1.00 0.00 ? 131 HIS A CD2  5  
ATOM 11081 C CE1  . HIS A 1 131 ? 11.474  -20.343 16.611  1.00 0.00 ? 131 HIS A CE1  5  
ATOM 11082 N NE2  . HIS A 1 131 ? 12.358  -21.194 17.101  1.00 0.00 ? 131 HIS A NE2  5  
ATOM 11083 H H    . HIS A 1 131 ? 9.154   -24.499 17.677  1.00 0.00 ? 131 HIS A H    5  
ATOM 11084 H HA   . HIS A 1 131 ? 7.948   -23.345 15.274  1.00 0.00 ? 131 HIS A HA   5  
ATOM 11085 H HB2  . HIS A 1 131 ? 10.872  -24.245 15.021  1.00 0.00 ? 131 HIS A HB2  5  
ATOM 11086 H HB3  . HIS A 1 131 ? 9.947   -23.102 14.009  1.00 0.00 ? 131 HIS A HB3  5  
ATOM 11087 H HD1  . HIS A 1 131 ? 9.805   -20.478 15.331  1.00 0.00 ? 131 HIS A HD1  5  
ATOM 11088 H HD2  . HIS A 1 131 ? 12.575  -23.299 16.794  1.00 0.00 ? 131 HIS A HD2  5  
ATOM 11089 H HE1  . HIS A 1 131 ? 11.480  -19.271 16.797  1.00 0.00 ? 131 HIS A HE1  5  
ATOM 11090 N N    . ARG A 1 132 ? 9.316   -26.235 16.205  1.00 0.00 ? 132 ARG A N    5  
ATOM 11091 C CA   . ARG A 1 132 ? 9.207   -27.689 16.168  1.00 0.00 ? 132 ARG A CA   5  
ATOM 11092 C C    . ARG A 1 132 ? 8.470   -28.253 17.384  1.00 0.00 ? 132 ARG A C    5  
ATOM 11093 O O    . ARG A 1 132 ? 7.685   -29.190 17.251  1.00 0.00 ? 132 ARG A O    5  
ATOM 11094 C CB   . ARG A 1 132 ? 10.608  -28.346 16.022  1.00 0.00 ? 132 ARG A CB   5  
ATOM 11095 C CG   . ARG A 1 132 ? 11.263  -28.044 14.659  1.00 0.00 ? 132 ARG A CG   5  
ATOM 11096 C CD   . ARG A 1 132 ? 12.602  -28.766 14.434  1.00 0.00 ? 132 ARG A CD   5  
ATOM 11097 N NE   . ARG A 1 132 ? 13.626  -28.246 15.407  1.00 0.00 ? 132 ARG A NE   5  
ATOM 11098 C CZ   . ARG A 1 132 ? 14.926  -28.681 15.415  1.00 0.00 ? 132 ARG A CZ   5  
ATOM 11099 N NH1  . ARG A 1 132 ? 15.348  -29.638 14.536  1.00 0.00 ? 132 ARG A NH1  5  
ATOM 11100 N NH2  . ARG A 1 132 ? 15.811  -28.153 16.308  1.00 0.00 ? 132 ARG A NH2  5  
ATOM 11101 H H    . ARG A 1 132 ? 10.028  -25.893 16.808  1.00 0.00 ? 132 ARG A H    5  
ATOM 11102 H HA   . ARG A 1 132 ? 8.624   -28.002 15.309  1.00 0.00 ? 132 ARG A HA   5  
ATOM 11103 H HB2  . ARG A 1 132 ? 11.276  -27.982 16.834  1.00 0.00 ? 132 ARG A HB2  5  
ATOM 11104 H HB3  . ARG A 1 132 ? 10.532  -29.456 16.106  1.00 0.00 ? 132 ARG A HB3  5  
ATOM 11105 H HG2  . ARG A 1 132 ? 10.567  -28.374 13.851  1.00 0.00 ? 132 ARG A HG2  5  
ATOM 11106 H HG3  . ARG A 1 132 ? 11.412  -26.948 14.545  1.00 0.00 ? 132 ARG A HG3  5  
ATOM 11107 H HD2  . ARG A 1 132 ? 12.472  -29.861 14.587  1.00 0.00 ? 132 ARG A HD2  5  
ATOM 11108 H HD3  . ARG A 1 132 ? 12.958  -28.572 13.398  1.00 0.00 ? 132 ARG A HD3  5  
ATOM 11109 H HE   . ARG A 1 132 ? 13.349  -27.547 16.067  1.00 0.00 ? 132 ARG A HE   5  
ATOM 11110 H HH11 . ARG A 1 132 ? 14.705  -30.030 13.878  1.00 0.00 ? 132 ARG A HH11 5  
ATOM 11111 H HH12 . ARG A 1 132 ? 16.298  -29.947 14.553  1.00 0.00 ? 132 ARG A HH12 5  
ATOM 11112 H HH21 . ARG A 1 132 ? 15.510  -27.452 16.955  1.00 0.00 ? 132 ARG A HH21 5  
ATOM 11113 H HH22 . ARG A 1 132 ? 16.761  -28.468 16.317  1.00 0.00 ? 132 ARG A HH22 5  
ATOM 11114 N N    . ASP A 1 133 ? 8.730   -27.702 18.610  1.00 0.00 ? 133 ASP A N    5  
ATOM 11115 C CA   . ASP A 1 133 ? 8.149   -28.073 19.906  1.00 0.00 ? 133 ASP A CA   5  
ATOM 11116 C C    . ASP A 1 133 ? 8.545   -29.458 20.431  1.00 0.00 ? 133 ASP A C    5  
ATOM 11117 O O    . ASP A 1 133 ? 8.897   -29.604 21.603  1.00 0.00 ? 133 ASP A O    5  
ATOM 11118 C CB   . ASP A 1 133 ? 6.603   -27.825 19.977  1.00 0.00 ? 133 ASP A CB   5  
ATOM 11119 C CG   . ASP A 1 133 ? 6.074   -27.689 21.414  1.00 0.00 ? 133 ASP A CG   5  
ATOM 11120 O OD1  . ASP A 1 133 ? 6.540   -26.765 22.132  1.00 0.00 ? 133 ASP A OD1  5  
ATOM 11121 O OD2  . ASP A 1 133 ? 5.199   -28.507 21.803  1.00 0.00 ? 133 ASP A OD2  5  
ATOM 11122 H H    . ASP A 1 133 ? 9.367   -26.923 18.686  1.00 0.00 ? 133 ASP A H    5  
ATOM 11123 H HA   . ASP A 1 133 ? 8.603   -27.378 20.601  1.00 0.00 ? 133 ASP A HA   5  
ATOM 11124 H HB2  . ASP A 1 133 ? 6.387   -26.866 19.455  1.00 0.00 ? 133 ASP A HB2  5  
ATOM 11125 H HB3  . ASP A 1 133 ? 6.053   -28.626 19.442  1.00 0.00 ? 133 ASP A HB3  5  
ATOM 11126 N N    . GLY A 1 1   ? -14.574 30.056  20.405  1.00 0.00 ? 1   GLY A N    6  
ATOM 11127 C CA   . GLY A 1 1   ? -14.449 30.894  19.234  1.00 0.00 ? 1   GLY A CA   6  
ATOM 11128 C C    . GLY A 1 1   ? -13.367 30.376  18.341  1.00 0.00 ? 1   GLY A C    6  
ATOM 11129 O O    . GLY A 1 1   ? -13.203 30.822  17.207  1.00 0.00 ? 1   GLY A O    6  
ATOM 11130 H H    . GLY A 1 1   ? -15.327 30.232  21.039  1.00 0.00 ? 1   GLY A H    6  
ATOM 11131 H HA2  . GLY A 1 1   ? -15.378 30.851  18.686  1.00 0.00 ? 1   GLY A HA2  6  
ATOM 11132 H HA3  . GLY A 1 1   ? -14.169 31.886  19.557  1.00 0.00 ? 1   GLY A HA3  6  
ATOM 11133 N N    . SER A 1 2   ? -12.573 29.409  18.847  1.00 0.00 ? 2   SER A N    6  
ATOM 11134 C CA   . SER A 1 2   ? -11.469 28.742  18.165  1.00 0.00 ? 2   SER A CA   6  
ATOM 11135 C C    . SER A 1 2   ? -11.007 27.623  19.100  1.00 0.00 ? 2   SER A C    6  
ATOM 11136 O O    . SER A 1 2   ? -11.258 27.753  20.299  1.00 0.00 ? 2   SER A O    6  
ATOM 11137 C CB   . SER A 1 2   ? -10.278 29.686  17.805  1.00 0.00 ? 2   SER A CB   6  
ATOM 11138 O OG   . SER A 1 2   ? -10.619 30.510  16.690  1.00 0.00 ? 2   SER A OG   6  
ATOM 11139 H H    . SER A 1 2   ? -12.758 29.103  19.784  1.00 0.00 ? 2   SER A H    6  
ATOM 11140 H HA   . SER A 1 2   ? -11.869 28.295  17.265  1.00 0.00 ? 2   SER A HA   6  
ATOM 11141 H HB2  . SER A 1 2   ? -10.029 30.332  18.676  1.00 0.00 ? 2   SER A HB2  6  
ATOM 11142 H HB3  . SER A 1 2   ? -9.368  29.114  17.519  1.00 0.00 ? 2   SER A HB3  6  
ATOM 11143 H HG   . SER A 1 2   ? -11.570 30.739  16.792  1.00 0.00 ? 2   SER A HG   6  
ATOM 11144 N N    . PRO A 1 3   ? -10.372 26.502  18.662  1.00 0.00 ? 3   PRO A N    6  
ATOM 11145 C CA   . PRO A 1 3   ? -9.981  25.370  19.519  1.00 0.00 ? 3   PRO A CA   6  
ATOM 11146 C C    . PRO A 1 3   ? -8.664  25.578  20.301  1.00 0.00 ? 3   PRO A C    6  
ATOM 11147 O O    . PRO A 1 3   ? -8.051  26.642  20.236  1.00 0.00 ? 3   PRO A O    6  
ATOM 11148 C CB   . PRO A 1 3   ? -9.869  24.180  18.522  1.00 0.00 ? 3   PRO A CB   6  
ATOM 11149 C CG   . PRO A 1 3   ? -10.476 24.688  17.206  1.00 0.00 ? 3   PRO A CG   6  
ATOM 11150 C CD   . PRO A 1 3   ? -10.144 26.175  17.258  1.00 0.00 ? 3   PRO A CD   6  
ATOM 11151 H HA   . PRO A 1 3   ? -10.764 25.181  20.244  1.00 0.00 ? 3   PRO A HA   6  
ATOM 11152 H HB2  . PRO A 1 3   ? -8.798  23.920  18.288  1.00 0.00 ? 3   PRO A HB2  6  
ATOM 11153 H HB3  . PRO A 1 3   ? -10.454 23.299  18.899  1.00 0.00 ? 3   PRO A HB3  6  
ATOM 11154 H HG2  . PRO A 1 3   ? -10.057 24.175  16.317  1.00 0.00 ? 3   PRO A HG2  6  
ATOM 11155 H HG3  . PRO A 1 3   ? -11.581 24.552  17.223  1.00 0.00 ? 3   PRO A HG3  6  
ATOM 11156 H HD2  . PRO A 1 3   ? -9.058  26.326  17.059  1.00 0.00 ? 3   PRO A HD2  6  
ATOM 11157 H HD3  . PRO A 1 3   ? -10.753 26.747  16.524  1.00 0.00 ? 3   PRO A HD3  6  
ATOM 11158 N N    . GLU A 1 4   ? -8.208  24.540  21.041  1.00 0.00 ? 4   GLU A N    6  
ATOM 11159 C CA   . GLU A 1 4   ? -6.998  24.568  21.839  1.00 0.00 ? 4   GLU A CA   6  
ATOM 11160 C C    . GLU A 1 4   ? -6.506  23.143  22.000  1.00 0.00 ? 4   GLU A C    6  
ATOM 11161 O O    . GLU A 1 4   ? -7.267  22.186  21.860  1.00 0.00 ? 4   GLU A O    6  
ATOM 11162 C CB   . GLU A 1 4   ? -7.232  25.207  23.246  1.00 0.00 ? 4   GLU A CB   6  
ATOM 11163 C CG   . GLU A 1 4   ? -8.484  24.686  23.989  1.00 0.00 ? 4   GLU A CG   6  
ATOM 11164 C CD   . GLU A 1 4   ? -8.666  25.416  25.320  1.00 0.00 ? 4   GLU A CD   6  
ATOM 11165 O OE1  . GLU A 1 4   ? -8.682  26.675  25.314  1.00 0.00 ? 4   GLU A OE1  6  
ATOM 11166 O OE2  . GLU A 1 4   ? -8.810  24.719  26.359  1.00 0.00 ? 4   GLU A OE2  6  
ATOM 11167 H H    . GLU A 1 4   ? -8.695  23.671  21.077  1.00 0.00 ? 4   GLU A H    6  
ATOM 11168 H HA   . GLU A 1 4   ? -6.220  25.112  21.314  1.00 0.00 ? 4   GLU A HA   6  
ATOM 11169 H HB2  . GLU A 1 4   ? -6.337  25.080  23.892  1.00 0.00 ? 4   GLU A HB2  6  
ATOM 11170 H HB3  . GLU A 1 4   ? -7.347  26.301  23.097  1.00 0.00 ? 4   GLU A HB3  6  
ATOM 11171 H HG2  . GLU A 1 4   ? -9.391  24.861  23.372  1.00 0.00 ? 4   GLU A HG2  6  
ATOM 11172 H HG3  . GLU A 1 4   ? -8.392  23.595  24.175  1.00 0.00 ? 4   GLU A HG3  6  
ATOM 11173 N N    . PHE A 1 5   ? -5.200  22.981  22.341  1.00 0.00 ? 5   PHE A N    6  
ATOM 11174 C CA   . PHE A 1 5   ? -4.578  21.684  22.613  1.00 0.00 ? 5   PHE A CA   6  
ATOM 11175 C C    . PHE A 1 5   ? -4.060  21.721  24.053  1.00 0.00 ? 5   PHE A C    6  
ATOM 11176 O O    . PHE A 1 5   ? -2.913  21.395  24.351  1.00 0.00 ? 5   PHE A O    6  
ATOM 11177 C CB   . PHE A 1 5   ? -3.467  21.345  21.558  1.00 0.00 ? 5   PHE A CB   6  
ATOM 11178 C CG   . PHE A 1 5   ? -2.959  19.901  21.460  1.00 0.00 ? 5   PHE A CG   6  
ATOM 11179 C CD1  . PHE A 1 5   ? -3.392  18.798  22.203  1.00 0.00 ? 5   PHE A CD1  6  
ATOM 11180 C CD2  . PHE A 1 5   ? -1.970  19.671  20.515  1.00 0.00 ? 5   PHE A CD2  6  
ATOM 11181 C CE1  . PHE A 1 5   ? -2.838  17.545  22.015  1.00 0.00 ? 5   PHE A CE1  6  
ATOM 11182 C CE2  . PHE A 1 5   ? -1.439  18.413  20.308  1.00 0.00 ? 5   PHE A CE2  6  
ATOM 11183 C CZ   . PHE A 1 5   ? -1.869  17.341  21.060  1.00 0.00 ? 5   PHE A CZ   6  
ATOM 11184 H H    . PHE A 1 5   ? -4.617  23.785  22.439  1.00 0.00 ? 5   PHE A H    6  
ATOM 11185 H HA   . PHE A 1 5   ? -5.349  20.927  22.567  1.00 0.00 ? 5   PHE A HA   6  
ATOM 11186 H HB2  . PHE A 1 5   ? -3.886  21.586  20.555  1.00 0.00 ? 5   PHE A HB2  6  
ATOM 11187 H HB3  . PHE A 1 5   ? -2.583  22.004  21.712  1.00 0.00 ? 5   PHE A HB3  6  
ATOM 11188 H HD1  . PHE A 1 5   ? -4.163  18.854  22.956  1.00 0.00 ? 5   PHE A HD1  6  
ATOM 11189 H HD2  . PHE A 1 5   ? -1.609  20.497  19.914  1.00 0.00 ? 5   PHE A HD2  6  
ATOM 11190 H HE1  . PHE A 1 5   ? -3.180  16.714  22.619  1.00 0.00 ? 5   PHE A HE1  6  
ATOM 11191 H HE2  . PHE A 1 5   ? -0.676  18.264  19.554  1.00 0.00 ? 5   PHE A HE2  6  
ATOM 11192 H HZ   . PHE A 1 5   ? -1.451  16.356  20.902  1.00 0.00 ? 5   PHE A HZ   6  
ATOM 11193 N N    . ARG A 1 6   ? -4.953  22.134  24.995  1.00 0.00 ? 6   ARG A N    6  
ATOM 11194 C CA   . ARG A 1 6   ? -4.709  22.319  26.426  1.00 0.00 ? 6   ARG A CA   6  
ATOM 11195 C C    . ARG A 1 6   ? -4.654  21.020  27.232  1.00 0.00 ? 6   ARG A C    6  
ATOM 11196 O O    . ARG A 1 6   ? -3.956  20.905  28.236  1.00 0.00 ? 6   ARG A O    6  
ATOM 11197 C CB   . ARG A 1 6   ? -5.771  23.303  26.978  1.00 0.00 ? 6   ARG A CB   6  
ATOM 11198 C CG   . ARG A 1 6   ? -5.433  23.964  28.326  1.00 0.00 ? 6   ARG A CG   6  
ATOM 11199 C CD   . ARG A 1 6   ? -6.395  25.122  28.626  1.00 0.00 ? 6   ARG A CD   6  
ATOM 11200 N NE   . ARG A 1 6   ? -5.964  25.801  29.898  1.00 0.00 ? 6   ARG A NE   6  
ATOM 11201 C CZ   . ARG A 1 6   ? -6.574  26.927  30.383  1.00 0.00 ? 6   ARG A CZ   6  
ATOM 11202 N NH1  . ARG A 1 6   ? -7.626  27.493  29.724  1.00 0.00 ? 6   ARG A NH1  6  
ATOM 11203 N NH2  . ARG A 1 6   ? -6.120  27.490  31.542  1.00 0.00 ? 6   ARG A NH2  6  
ATOM 11204 H H    . ARG A 1 6   ? -5.862  22.409  24.692  1.00 0.00 ? 6   ARG A H    6  
ATOM 11205 H HA   . ARG A 1 6   ? -3.740  22.791  26.541  1.00 0.00 ? 6   ARG A HA   6  
ATOM 11206 H HB2  . ARG A 1 6   ? -5.857  24.134  26.240  1.00 0.00 ? 6   ARG A HB2  6  
ATOM 11207 H HB3  . ARG A 1 6   ? -6.772  22.818  27.032  1.00 0.00 ? 6   ARG A HB3  6  
ATOM 11208 H HG2  . ARG A 1 6   ? -5.476  23.212  29.145  1.00 0.00 ? 6   ARG A HG2  6  
ATOM 11209 H HG3  . ARG A 1 6   ? -4.394  24.360  28.280  1.00 0.00 ? 6   ARG A HG3  6  
ATOM 11210 H HD2  . ARG A 1 6   ? -6.371  25.854  27.783  1.00 0.00 ? 6   ARG A HD2  6  
ATOM 11211 H HD3  . ARG A 1 6   ? -7.430  24.736  28.752  1.00 0.00 ? 6   ARG A HD3  6  
ATOM 11212 H HE   . ARG A 1 6   ? -5.196  25.412  30.408  1.00 0.00 ? 6   ARG A HE   6  
ATOM 11213 H HH11 . ARG A 1 6   ? -7.962  27.084  28.875  1.00 0.00 ? 6   ARG A HH11 6  
ATOM 11214 H HH12 . ARG A 1 6   ? -8.059  28.317  30.089  1.00 0.00 ? 6   ARG A HH12 6  
ATOM 11215 H HH21 . ARG A 1 6   ? -5.349  27.078  32.028  1.00 0.00 ? 6   ARG A HH21 6  
ATOM 11216 H HH22 . ARG A 1 6   ? -6.559  28.312  31.903  1.00 0.00 ? 6   ARG A HH22 6  
ATOM 11217 N N    . TRP A 1 7   ? -5.385  19.982  26.742  1.00 0.00 ? 7   TRP A N    6  
ATOM 11218 C CA   . TRP A 1 7   ? -5.397  18.607  27.235  1.00 0.00 ? 7   TRP A CA   6  
ATOM 11219 C C    . TRP A 1 7   ? -4.545  17.709  26.325  1.00 0.00 ? 7   TRP A C    6  
ATOM 11220 O O    . TRP A 1 7   ? -4.065  18.149  25.285  1.00 0.00 ? 7   TRP A O    6  
ATOM 11221 C CB   . TRP A 1 7   ? -6.870  18.104  27.420  1.00 0.00 ? 7   TRP A CB   6  
ATOM 11222 C CG   . TRP A 1 7   ? -7.772  17.685  26.237  1.00 0.00 ? 7   TRP A CG   6  
ATOM 11223 C CD1  . TRP A 1 7   ? -7.500  17.434  24.915  1.00 0.00 ? 7   TRP A CD1  6  
ATOM 11224 C CD2  . TRP A 1 7   ? -9.164  17.340  26.420  1.00 0.00 ? 7   TRP A CD2  6  
ATOM 11225 N NE1  . TRP A 1 7   ? -8.600  16.888  24.296  1.00 0.00 ? 7   TRP A NE1  6  
ATOM 11226 C CE2  . TRP A 1 7   ? -9.642  16.862  25.199  1.00 0.00 ? 7   TRP A CE2  6  
ATOM 11227 C CE3  . TRP A 1 7   ? -9.978  17.399  27.521  1.00 0.00 ? 7   TRP A CE3  6  
ATOM 11228 C CZ2  . TRP A 1 7   ? -10.935 16.434  25.061  1.00 0.00 ? 7   TRP A CZ2  6  
ATOM 11229 C CZ3  . TRP A 1 7   ? -11.284 16.973  27.381  1.00 0.00 ? 7   TRP A CZ3  6  
ATOM 11230 C CH2  . TRP A 1 7   ? -11.756 16.499  26.171  1.00 0.00 ? 7   TRP A CH2  6  
ATOM 11231 H H    . TRP A 1 7   ? -5.932  20.106  25.920  1.00 0.00 ? 7   TRP A H    6  
ATOM 11232 H HA   . TRP A 1 7   ? -4.930  18.581  28.213  1.00 0.00 ? 7   TRP A HA   6  
ATOM 11233 H HB2  . TRP A 1 7   ? -6.866  17.249  28.129  1.00 0.00 ? 7   TRP A HB2  6  
ATOM 11234 H HB3  . TRP A 1 7   ? -7.385  18.944  27.938  1.00 0.00 ? 7   TRP A HB3  6  
ATOM 11235 H HD1  . TRP A 1 7   ? -6.558  17.609  24.416  1.00 0.00 ? 7   TRP A HD1  6  
ATOM 11236 H HE1  . TRP A 1 7   ? -8.573  16.353  23.475  1.00 0.00 ? 7   TRP A HE1  6  
ATOM 11237 H HE3  . TRP A 1 7   ? -9.642  17.778  28.475  1.00 0.00 ? 7   TRP A HE3  6  
ATOM 11238 H HZ2  . TRP A 1 7   ? -11.321 16.060  24.124  1.00 0.00 ? 7   TRP A HZ2  6  
ATOM 11239 H HZ3  . TRP A 1 7   ? -11.953 17.012  28.232  1.00 0.00 ? 7   TRP A HZ3  6  
ATOM 11240 H HH2  . TRP A 1 7   ? -12.788 16.179  26.094  1.00 0.00 ? 7   TRP A HH2  6  
ATOM 11241 N N    . THR A 1 8   ? -4.347  16.405  26.658  1.00 0.00 ? 8   THR A N    6  
ATOM 11242 C CA   . THR A 1 8   ? -3.527  15.474  25.865  1.00 0.00 ? 8   THR A CA   6  
ATOM 11243 C C    . THR A 1 8   ? -4.352  14.582  24.951  1.00 0.00 ? 8   THR A C    6  
ATOM 11244 O O    . THR A 1 8   ? -3.801  13.897  24.095  1.00 0.00 ? 8   THR A O    6  
ATOM 11245 C CB   . THR A 1 8   ? -2.561  14.635  26.718  1.00 0.00 ? 8   THR A CB   6  
ATOM 11246 O OG1  . THR A 1 8   ? -1.556  14.005  25.926  1.00 0.00 ? 8   THR A OG1  6  
ATOM 11247 C CG2  . THR A 1 8   ? -3.280  13.551  27.550  1.00 0.00 ? 8   THR A CG2  6  
ATOM 11248 H H    . THR A 1 8   ? -4.735  16.033  27.494  1.00 0.00 ? 8   THR A H    6  
ATOM 11249 H HA   . THR A 1 8   ? -2.879  16.040  25.204  1.00 0.00 ? 8   THR A HA   6  
ATOM 11250 H HB   . THR A 1 8   ? -2.037  15.329  27.416  1.00 0.00 ? 8   THR A HB   6  
ATOM 11251 H HG1  . THR A 1 8   ? -2.019  13.699  25.132  1.00 0.00 ? 8   THR A HG1  6  
ATOM 11252 H HG21 . THR A 1 8   ? -4.071  13.995  28.184  1.00 0.00 ? 8   THR A HG21 6  
ATOM 11253 H HG22 . THR A 1 8   ? -3.746  12.781  26.899  1.00 0.00 ? 8   THR A HG22 6  
ATOM 11254 H HG23 . THR A 1 8   ? -2.544  13.041  28.207  1.00 0.00 ? 8   THR A HG23 6  
ATOM 11255 N N    . LYS A 1 9   ? -5.696  14.513  25.146  1.00 0.00 ? 9   LYS A N    6  
ATOM 11256 C CA   . LYS A 1 9   ? -6.670  13.628  24.492  1.00 0.00 ? 9   LYS A CA   6  
ATOM 11257 C C    . LYS A 1 9   ? -6.754  13.606  22.979  1.00 0.00 ? 9   LYS A C    6  
ATOM 11258 O O    . LYS A 1 9   ? -7.077  12.580  22.385  1.00 0.00 ? 9   LYS A O    6  
ATOM 11259 C CB   . LYS A 1 9   ? -8.045  13.584  25.199  1.00 0.00 ? 9   LYS A CB   6  
ATOM 11260 C CG   . LYS A 1 9   ? -7.932  13.451  26.728  1.00 0.00 ? 9   LYS A CG   6  
ATOM 11261 C CD   . LYS A 1 9   ? -9.305  13.460  27.410  1.00 0.00 ? 9   LYS A CD   6  
ATOM 11262 C CE   . LYS A 1 9   ? -9.207  13.435  28.939  1.00 0.00 ? 9   LYS A CE   6  
ATOM 11263 N NZ   . LYS A 1 9   ? -10.552 13.469  29.558  1.00 0.00 ? 9   LYS A NZ   6  
ATOM 11264 H H    . LYS A 1 9   ? -6.092  15.092  25.853  1.00 0.00 ? 9   LYS A H    6  
ATOM 11265 H HA   . LYS A 1 9   ? -6.214  12.656  24.633  1.00 0.00 ? 9   LYS A HA   6  
ATOM 11266 H HB2  . LYS A 1 9   ? -8.619  14.504  24.981  1.00 0.00 ? 9   LYS A HB2  6  
ATOM 11267 H HB3  . LYS A 1 9   ? -8.642  12.725  24.819  1.00 0.00 ? 9   LYS A HB3  6  
ATOM 11268 H HG2  . LYS A 1 9   ? -7.395  12.512  26.987  1.00 0.00 ? 9   LYS A HG2  6  
ATOM 11269 H HG3  . LYS A 1 9   ? -7.350  14.302  27.143  1.00 0.00 ? 9   LYS A HG3  6  
ATOM 11270 H HD2  . LYS A 1 9   ? -9.846  14.382  27.098  1.00 0.00 ? 9   LYS A HD2  6  
ATOM 11271 H HD3  . LYS A 1 9   ? -9.889  12.581  27.057  1.00 0.00 ? 9   LYS A HD3  6  
ATOM 11272 H HE2  . LYS A 1 9   ? -8.698  12.511  29.283  1.00 0.00 ? 9   LYS A HE2  6  
ATOM 11273 H HE3  . LYS A 1 9   ? -8.646  14.322  29.304  1.00 0.00 ? 9   LYS A HE3  6  
ATOM 11274 H HZ1  . LYS A 1 9   ? -11.047 14.336  29.265  1.00 0.00 ? 9   LYS A HZ1  6  
ATOM 11275 H HZ2  . LYS A 1 9   ? -11.097 12.639  29.248  1.00 0.00 ? 9   LYS A HZ2  6  
ATOM 11276 H HZ3  . LYS A 1 9   ? -10.458 13.456  30.593  1.00 0.00 ? 9   LYS A HZ3  6  
ATOM 11277 N N    . GLU A 1 10  ? -6.385  14.737  22.314  1.00 0.00 ? 10  GLU A N    6  
ATOM 11278 C CA   . GLU A 1 10  ? -6.176  14.862  20.856  1.00 0.00 ? 10  GLU A CA   6  
ATOM 11279 C C    . GLU A 1 10  ? -5.110  13.908  20.243  1.00 0.00 ? 10  GLU A C    6  
ATOM 11280 O O    . GLU A 1 10  ? -5.100  13.654  19.046  1.00 0.00 ? 10  GLU A O    6  
ATOM 11281 C CB   . GLU A 1 10  ? -5.953  16.327  20.406  1.00 0.00 ? 10  GLU A CB   6  
ATOM 11282 C CG   . GLU A 1 10  ? -7.077  17.262  20.889  1.00 0.00 ? 10  GLU A CG   6  
ATOM 11283 C CD   . GLU A 1 10  ? -6.997  18.612  20.176  1.00 0.00 ? 10  GLU A CD   6  
ATOM 11284 O OE1  . GLU A 1 10  ? -5.949  19.297  20.311  1.00 0.00 ? 10  GLU A OE1  6  
ATOM 11285 O OE2  . GLU A 1 10  ? -7.986  18.978  19.487  1.00 0.00 ? 10  GLU A OE2  6  
ATOM 11286 H H    . GLU A 1 10  ? -6.153  15.541  22.864  1.00 0.00 ? 10  GLU A H    6  
ATOM 11287 H HA   . GLU A 1 10  ? -7.107  14.560  20.393  1.00 0.00 ? 10  GLU A HA   6  
ATOM 11288 H HB2  . GLU A 1 10  ? -4.980  16.702  20.786  1.00 0.00 ? 10  GLU A HB2  6  
ATOM 11289 H HB3  . GLU A 1 10  ? -5.921  16.367  19.291  1.00 0.00 ? 10  GLU A HB3  6  
ATOM 11290 H HG2  . GLU A 1 10  ? -8.061  16.793  20.675  1.00 0.00 ? 10  GLU A HG2  6  
ATOM 11291 H HG3  . GLU A 1 10  ? -6.993  17.421  21.984  1.00 0.00 ? 10  GLU A HG3  6  
ATOM 11292 N N    . GLU A 1 11  ? -4.251  13.272  21.097  1.00 0.00 ? 11  GLU A N    6  
ATOM 11293 C CA   . GLU A 1 11  ? -3.347  12.146  20.843  1.00 0.00 ? 11  GLU A CA   6  
ATOM 11294 C C    . GLU A 1 11  ? -4.099  10.841  20.615  1.00 0.00 ? 11  GLU A C    6  
ATOM 11295 O O    . GLU A 1 11  ? -3.572  9.996   19.893  1.00 0.00 ? 11  GLU A O    6  
ATOM 11296 C CB   . GLU A 1 11  ? -2.417  11.923  22.068  1.00 0.00 ? 11  GLU A CB   6  
ATOM 11297 C CG   . GLU A 1 11  ? -1.351  13.027  22.211  1.00 0.00 ? 11  GLU A CG   6  
ATOM 11298 C CD   . GLU A 1 11  ? -0.406  12.992  21.005  1.00 0.00 ? 11  GLU A CD   6  
ATOM 11299 O OE1  . GLU A 1 11  ? 0.282   11.953  20.821  1.00 0.00 ? 11  GLU A OE1  6  
ATOM 11300 O OE2  . GLU A 1 11  ? -0.362  14.002  20.253  1.00 0.00 ? 11  GLU A OE2  6  
ATOM 11301 H H    . GLU A 1 11  ? -4.280  13.517  22.066  1.00 0.00 ? 11  GLU A H    6  
ATOM 11302 H HA   . GLU A 1 11  ? -2.775  12.282  19.901  1.00 0.00 ? 11  GLU A HA   6  
ATOM 11303 H HB2  . GLU A 1 11  ? -3.056  11.890  23.001  1.00 0.00 ? 11  GLU A HB2  6  
ATOM 11304 H HB3  . GLU A 1 11  ? -1.864  10.956  22.000  1.00 0.00 ? 11  GLU A HB3  6  
ATOM 11305 H HG2  . GLU A 1 11  ? -1.856  14.027  22.256  1.00 0.00 ? 11  GLU A HG2  6  
ATOM 11306 H HG3  . GLU A 1 11  ? -0.749  12.820  23.135  1.00 0.00 ? 11  GLU A HG3  6  
ATOM 11307 N N    . GLU A 1 12  ? -5.335  10.627  21.188  1.00 0.00 ? 12  GLU A N    6  
ATOM 11308 C CA   . GLU A 1 12  ? -6.165  9.414   21.018  1.00 0.00 ? 12  GLU A CA   6  
ATOM 11309 C C    . GLU A 1 12  ? -6.570  9.137   19.563  1.00 0.00 ? 12  GLU A C    6  
ATOM 11310 O O    . GLU A 1 12  ? -6.486  8.014   19.085  1.00 0.00 ? 12  GLU A O    6  
ATOM 11311 C CB   . GLU A 1 12  ? -7.389  9.395   21.971  1.00 0.00 ? 12  GLU A CB   6  
ATOM 11312 C CG   . GLU A 1 12  ? -6.966  9.359   23.453  1.00 0.00 ? 12  GLU A CG   6  
ATOM 11313 C CD   . GLU A 1 12  ? -8.198  9.233   24.349  1.00 0.00 ? 12  GLU A CD   6  
ATOM 11314 O OE1  . GLU A 1 12  ? -8.930  8.215   24.211  1.00 0.00 ? 12  GLU A OE1  6  
ATOM 11315 O OE2  . GLU A 1 12  ? -8.419  10.145  25.189  1.00 0.00 ? 12  GLU A OE2  6  
ATOM 11316 H H    . GLU A 1 12  ? -5.768  11.341  21.759  1.00 0.00 ? 12  GLU A H    6  
ATOM 11317 H HA   . GLU A 1 12  ? -5.552  8.567   21.299  1.00 0.00 ? 12  GLU A HA   6  
ATOM 11318 H HB2  . GLU A 1 12  ? -8.021  10.290  21.785  1.00 0.00 ? 12  GLU A HB2  6  
ATOM 11319 H HB3  . GLU A 1 12  ? -8.005  8.487   21.775  1.00 0.00 ? 12  GLU A HB3  6  
ATOM 11320 H HG2  . GLU A 1 12  ? -6.303  8.484   23.627  1.00 0.00 ? 12  GLU A HG2  6  
ATOM 11321 H HG3  . GLU A 1 12  ? -6.404  10.281  23.711  1.00 0.00 ? 12  GLU A HG3  6  
ATOM 11322 N N    . GLU A 1 13  ? -6.890  10.223  18.808  1.00 0.00 ? 13  GLU A N    6  
ATOM 11323 C CA   . GLU A 1 13  ? -7.082  10.311  17.352  1.00 0.00 ? 13  GLU A CA   6  
ATOM 11324 C C    . GLU A 1 13  ? -5.887  9.858   16.474  1.00 0.00 ? 13  GLU A C    6  
ATOM 11325 O O    . GLU A 1 13  ? -6.046  9.279   15.402  1.00 0.00 ? 13  GLU A O    6  
ATOM 11326 C CB   . GLU A 1 13  ? -7.303  11.820  17.027  1.00 0.00 ? 13  GLU A CB   6  
ATOM 11327 C CG   . GLU A 1 13  ? -8.698  12.317  17.445  1.00 0.00 ? 13  GLU A CG   6  
ATOM 11328 C CD   . GLU A 1 13  ? -8.817  13.809  17.137  1.00 0.00 ? 13  GLU A CD   6  
ATOM 11329 O OE1  . GLU A 1 13  ? -8.050  14.603  17.744  1.00 0.00 ? 13  GLU A OE1  6  
ATOM 11330 O OE2  . GLU A 1 13  ? -9.678  14.174  16.292  1.00 0.00 ? 13  GLU A OE2  6  
ATOM 11331 H H    . GLU A 1 13  ? -7.000  11.089  19.297  1.00 0.00 ? 13  GLU A H    6  
ATOM 11332 H HA   . GLU A 1 13  ? -7.943  9.722   17.062  1.00 0.00 ? 13  GLU A HA   6  
ATOM 11333 H HB2  . GLU A 1 13  ? -6.546  12.409  17.597  1.00 0.00 ? 13  GLU A HB2  6  
ATOM 11334 H HB3  . GLU A 1 13  ? -7.137  12.057  15.948  1.00 0.00 ? 13  GLU A HB3  6  
ATOM 11335 H HG2  . GLU A 1 13  ? -9.466  11.756  16.838  1.00 0.00 ? 13  GLU A HG2  6  
ATOM 11336 H HG3  . GLU A 1 13  ? -8.819  12.178  18.558  1.00 0.00 ? 13  GLU A HG3  6  
ATOM 11337 N N    . THR A 1 14  ? -4.649  10.178  16.933  1.00 0.00 ? 14  THR A N    6  
ATOM 11338 C CA   . THR A 1 14  ? -3.352  9.927   16.339  1.00 0.00 ? 14  THR A CA   6  
ATOM 11339 C C    . THR A 1 14  ? -2.872  8.509   16.538  1.00 0.00 ? 14  THR A C    6  
ATOM 11340 O O    . THR A 1 14  ? -2.274  7.917   15.657  1.00 0.00 ? 14  THR A O    6  
ATOM 11341 C CB   . THR A 1 14  ? -2.278  10.916  16.809  1.00 0.00 ? 14  THR A CB   6  
ATOM 11342 O OG1  . THR A 1 14  ? -1.794  10.773  18.141  1.00 0.00 ? 14  THR A OG1  6  
ATOM 11343 C CG2  . THR A 1 14  ? -2.760  12.363  16.552  1.00 0.00 ? 14  THR A CG2  6  
ATOM 11344 H H    . THR A 1 14  ? -4.560  10.608  17.817  1.00 0.00 ? 14  THR A H    6  
ATOM 11345 H HA   . THR A 1 14  ? -3.386  10.134  15.271  1.00 0.00 ? 14  THR A HA   6  
ATOM 11346 H HB   . THR A 1 14  ? -1.372  10.722  16.221  1.00 0.00 ? 14  THR A HB   6  
ATOM 11347 H HG1  . THR A 1 14  ? -2.557  10.546  18.709  1.00 0.00 ? 14  THR A HG1  6  
ATOM 11348 H HG21 . THR A 1 14  ? -2.997  12.505  15.475  1.00 0.00 ? 14  THR A HG21 6  
ATOM 11349 H HG22 . THR A 1 14  ? -3.678  12.641  17.110  1.00 0.00 ? 14  THR A HG22 6  
ATOM 11350 H HG23 . THR A 1 14  ? -1.965  13.084  16.842  1.00 0.00 ? 14  THR A HG23 6  
ATOM 11351 N N    . ARG A 1 15  ? -3.019  8.012   17.800  1.00 0.00 ? 15  ARG A N    6  
ATOM 11352 C CA   . ARG A 1 15  ? -2.491  6.756   18.325  1.00 0.00 ? 15  ARG A CA   6  
ATOM 11353 C C    . ARG A 1 15  ? -0.980  6.799   18.625  1.00 0.00 ? 15  ARG A C    6  
ATOM 11354 O O    . ARG A 1 15  ? -0.394  5.834   19.097  1.00 0.00 ? 15  ARG A O    6  
ATOM 11355 C CB   . ARG A 1 15  ? -2.945  5.493   17.546  1.00 0.00 ? 15  ARG A CB   6  
ATOM 11356 C CG   . ARG A 1 15  ? -4.474  5.261   17.530  1.00 0.00 ? 15  ARG A CG   6  
ATOM 11357 C CD   . ARG A 1 15  ? -5.049  4.511   18.749  1.00 0.00 ? 15  ARG A CD   6  
ATOM 11358 N NE   . ARG A 1 15  ? -5.060  5.404   19.959  1.00 0.00 ? 15  ARG A NE   6  
ATOM 11359 C CZ   . ARG A 1 15  ? -5.538  5.005   21.179  1.00 0.00 ? 15  ARG A CZ   6  
ATOM 11360 N NH1  . ARG A 1 15  ? -5.998  3.735   21.369  1.00 0.00 ? 15  ARG A NH1  6  
ATOM 11361 N NH2  . ARG A 1 15  ? -5.544  5.889   22.219  1.00 0.00 ? 15  ARG A NH2  6  
ATOM 11362 H H    . ARG A 1 15  ? -3.503  8.556   18.489  1.00 0.00 ? 15  ARG A H    6  
ATOM 11363 H HA   . ARG A 1 15  ? -2.936  6.668   19.303  1.00 0.00 ? 15  ARG A HA   6  
ATOM 11364 H HB2  . ARG A 1 15  ? -2.593  5.574   16.493  1.00 0.00 ? 15  ARG A HB2  6  
ATOM 11365 H HB3  . ARG A 1 15  ? -2.478  4.581   17.971  1.00 0.00 ? 15  ARG A HB3  6  
ATOM 11366 H HG2  . ARG A 1 15  ? -5.025  6.212   17.368  1.00 0.00 ? 15  ARG A HG2  6  
ATOM 11367 H HG3  . ARG A 1 15  ? -4.687  4.612   16.655  1.00 0.00 ? 15  ARG A HG3  6  
ATOM 11368 H HD2  . ARG A 1 15  ? -6.096  4.209   18.526  1.00 0.00 ? 15  ARG A HD2  6  
ATOM 11369 H HD3  . ARG A 1 15  ? -4.439  3.605   18.962  1.00 0.00 ? 15  ARG A HD3  6  
ATOM 11370 H HE   . ARG A 1 15  ? -4.725  6.340   19.859  1.00 0.00 ? 15  ARG A HE   6  
ATOM 11371 H HH11 . ARG A 1 15  ? -5.985  3.081   20.612  1.00 0.00 ? 15  ARG A HH11 6  
ATOM 11372 H HH12 . ARG A 1 15  ? -6.337  3.455   22.267  1.00 0.00 ? 15  ARG A HH12 6  
ATOM 11373 H HH21 . ARG A 1 15  ? -5.209  6.822   22.084  1.00 0.00 ? 15  ARG A HH21 6  
ATOM 11374 H HH22 . ARG A 1 15  ? -5.890  5.605   23.113  1.00 0.00 ? 15  ARG A HH22 6  
ATOM 11375 N N    . GLN A 1 16  ? -0.343  7.981   18.402  1.00 0.00 ? 16  GLN A N    6  
ATOM 11376 C CA   . GLN A 1 16  ? 1.031   8.376   18.678  1.00 0.00 ? 16  GLN A CA   6  
ATOM 11377 C C    . GLN A 1 16  ? 2.021   8.091   17.547  1.00 0.00 ? 16  GLN A C    6  
ATOM 11378 O O    . GLN A 1 16  ? 2.603   7.015   17.427  1.00 0.00 ? 16  GLN A O    6  
ATOM 11379 C CB   . GLN A 1 16  ? 1.532   7.961   20.085  1.00 0.00 ? 16  GLN A CB   6  
ATOM 11380 C CG   . GLN A 1 16  ? 2.529   8.955   20.701  1.00 0.00 ? 16  GLN A CG   6  
ATOM 11381 C CD   . GLN A 1 16  ? 2.852   8.552   22.138  1.00 0.00 ? 16  GLN A CD   6  
ATOM 11382 O OE1  . GLN A 1 16  ? 3.976   8.130   22.412  1.00 0.00 ? 16  GLN A OE1  6  
ATOM 11383 N NE2  . GLN A 1 16  ? 1.869   8.696   23.060  1.00 0.00 ? 16  GLN A NE2  6  
ATOM 11384 H H    . GLN A 1 16  ? -0.901  8.720   18.028  1.00 0.00 ? 16  GLN A H    6  
ATOM 11385 H HA   . GLN A 1 16  ? 0.957   9.453   18.732  1.00 0.00 ? 16  GLN A HA   6  
ATOM 11386 H HB2  . GLN A 1 16  ? 0.633   7.931   20.744  1.00 0.00 ? 16  GLN A HB2  6  
ATOM 11387 H HB3  . GLN A 1 16  ? 1.947   6.928   20.068  1.00 0.00 ? 16  GLN A HB3  6  
ATOM 11388 H HG2  . GLN A 1 16  ? 3.479   8.963   20.128  1.00 0.00 ? 16  GLN A HG2  6  
ATOM 11389 H HG3  . GLN A 1 16  ? 2.108   9.981   20.700  1.00 0.00 ? 16  GLN A HG3  6  
ATOM 11390 H HE21 . GLN A 1 16  ? 0.983   9.079   22.813  1.00 0.00 ? 16  GLN A HE21 6  
ATOM 11391 H HE22 . GLN A 1 16  ? 2.080   8.428   23.995  1.00 0.00 ? 16  GLN A HE22 6  
ATOM 11392 N N    . MET A 1 17  ? 2.203   9.087   16.644  1.00 0.00 ? 17  MET A N    6  
ATOM 11393 C CA   . MET A 1 17  ? 3.064   9.083   15.470  1.00 0.00 ? 17  MET A CA   6  
ATOM 11394 C C    . MET A 1 17  ? 4.577   9.149   15.671  1.00 0.00 ? 17  MET A C    6  
ATOM 11395 O O    . MET A 1 17  ? 5.324   8.382   15.070  1.00 0.00 ? 17  MET A O    6  
ATOM 11396 C CB   . MET A 1 17  ? 2.553   10.171  14.485  1.00 0.00 ? 17  MET A CB   6  
ATOM 11397 C CG   . MET A 1 17  ? 2.599   11.628  14.980  1.00 0.00 ? 17  MET A CG   6  
ATOM 11398 S SD   . MET A 1 17  ? 1.632   12.793  13.972  1.00 0.00 ? 17  MET A SD   6  
ATOM 11399 C CE   . MET A 1 17  ? 0.063   12.654  14.887  1.00 0.00 ? 17  MET A CE   6  
ATOM 11400 H H    . MET A 1 17  ? 1.717   9.947   16.767  1.00 0.00 ? 17  MET A H    6  
ATOM 11401 H HA   . MET A 1 17  ? 2.911   8.128   14.974  1.00 0.00 ? 17  MET A HA   6  
ATOM 11402 H HB2  . MET A 1 17  ? 3.067   10.111  13.501  1.00 0.00 ? 17  MET A HB2  6  
ATOM 11403 H HB3  . MET A 1 17  ? 1.479   9.949   14.304  1.00 0.00 ? 17  MET A HB3  6  
ATOM 11404 H HG2  . MET A 1 17  ? 2.239   11.684  16.027  1.00 0.00 ? 17  MET A HG2  6  
ATOM 11405 H HG3  . MET A 1 17  ? 3.662   11.953  14.984  1.00 0.00 ? 17  MET A HG3  6  
ATOM 11406 H HE1  . MET A 1 17  ? 0.205   12.902  15.960  1.00 0.00 ? 17  MET A HE1  6  
ATOM 11407 H HE2  . MET A 1 17  ? -0.701  13.350  14.477  1.00 0.00 ? 17  MET A HE2  6  
ATOM 11408 H HE3  . MET A 1 17  ? -0.394  11.638  14.822  1.00 0.00 ? 17  MET A HE3  6  
ATOM 11409 N N    . TYR A 1 18  ? 5.046   10.113  16.509  1.00 0.00 ? 18  TYR A N    6  
ATOM 11410 C CA   . TYR A 1 18  ? 6.403   10.617  16.745  1.00 0.00 ? 18  TYR A CA   6  
ATOM 11411 C C    . TYR A 1 18  ? 7.533   9.651   17.082  1.00 0.00 ? 18  TYR A C    6  
ATOM 11412 O O    . TYR A 1 18  ? 8.697   10.014  16.939  1.00 0.00 ? 18  TYR A O    6  
ATOM 11413 C CB   . TYR A 1 18  ? 6.397   11.728  17.858  1.00 0.00 ? 18  TYR A CB   6  
ATOM 11414 C CG   . TYR A 1 18  ? 5.221   12.672  17.670  1.00 0.00 ? 18  TYR A CG   6  
ATOM 11415 C CD1  . TYR A 1 18  ? 5.269   13.630  16.668  1.00 0.00 ? 18  TYR A CD1  6  
ATOM 11416 C CD2  . TYR A 1 18  ? 4.056   12.567  18.428  1.00 0.00 ? 18  TYR A CD2  6  
ATOM 11417 C CE1  . TYR A 1 18  ? 4.174   14.427  16.393  1.00 0.00 ? 18  TYR A CE1  6  
ATOM 11418 C CE2  . TYR A 1 18  ? 2.965   13.368  18.151  1.00 0.00 ? 18  TYR A CE2  6  
ATOM 11419 C CZ   . TYR A 1 18  ? 3.015   14.276  17.123  1.00 0.00 ? 18  TYR A CZ   6  
ATOM 11420 O OH   . TYR A 1 18  ? 1.845   14.992  16.806  1.00 0.00 ? 18  TYR A OH   6  
ATOM 11421 H H    . TYR A 1 18  ? 4.363   10.679  16.960  1.00 0.00 ? 18  TYR A H    6  
ATOM 11422 H HA   . TYR A 1 18  ? 6.696   11.079  15.805  1.00 0.00 ? 18  TYR A HA   6  
ATOM 11423 H HB2  . TYR A 1 18  ? 6.361   11.281  18.876  1.00 0.00 ? 18  TYR A HB2  6  
ATOM 11424 H HB3  . TYR A 1 18  ? 7.333   12.329  17.809  1.00 0.00 ? 18  TYR A HB3  6  
ATOM 11425 H HD1  . TYR A 1 18  ? 6.157   13.744  16.057  1.00 0.00 ? 18  TYR A HD1  6  
ATOM 11426 H HD2  . TYR A 1 18  ? 3.951   11.845  19.227  1.00 0.00 ? 18  TYR A HD2  6  
ATOM 11427 H HE1  . TYR A 1 18  ? 4.224   15.131  15.573  1.00 0.00 ? 18  TYR A HE1  6  
ATOM 11428 H HE2  . TYR A 1 18  ? 2.051   13.263  18.720  1.00 0.00 ? 18  TYR A HE2  6  
ATOM 11429 H HH   . TYR A 1 18  ? 2.043   15.593  16.083  1.00 0.00 ? 18  TYR A HH   6  
ATOM 11430 N N    . ASP A 1 19  ? 7.217   8.406   17.525  1.00 0.00 ? 19  ASP A N    6  
ATOM 11431 C CA   . ASP A 1 19  ? 8.185   7.361   17.861  1.00 0.00 ? 19  ASP A CA   6  
ATOM 11432 C C    . ASP A 1 19  ? 8.603   6.548   16.636  1.00 0.00 ? 19  ASP A C    6  
ATOM 11433 O O    . ASP A 1 19  ? 9.555   6.896   15.947  1.00 0.00 ? 19  ASP A O    6  
ATOM 11434 C CB   . ASP A 1 19  ? 7.647   6.411   18.971  1.00 0.00 ? 19  ASP A CB   6  
ATOM 11435 C CG   . ASP A 1 19  ? 7.356   7.218   20.238  1.00 0.00 ? 19  ASP A CG   6  
ATOM 11436 O OD1  . ASP A 1 19  ? 8.323   7.773   20.825  1.00 0.00 ? 19  ASP A OD1  6  
ATOM 11437 O OD2  . ASP A 1 19  ? 6.162   7.286   20.633  1.00 0.00 ? 19  ASP A OD2  6  
ATOM 11438 H H    . ASP A 1 19  ? 6.254   8.165   17.631  1.00 0.00 ? 19  ASP A H    6  
ATOM 11439 H HA   . ASP A 1 19  ? 9.092   7.820   18.239  1.00 0.00 ? 19  ASP A HA   6  
ATOM 11440 H HB2  . ASP A 1 19  ? 6.705   5.919   18.641  1.00 0.00 ? 19  ASP A HB2  6  
ATOM 11441 H HB3  . ASP A 1 19  ? 8.392   5.624   19.223  1.00 0.00 ? 19  ASP A HB3  6  
ATOM 11442 N N    . MET A 1 20  ? 7.892   5.422   16.345  1.00 0.00 ? 20  MET A N    6  
ATOM 11443 C CA   . MET A 1 20  ? 8.118   4.466   15.261  1.00 0.00 ? 20  MET A CA   6  
ATOM 11444 C C    . MET A 1 20  ? 7.683   4.860   13.858  1.00 0.00 ? 20  MET A C    6  
ATOM 11445 O O    . MET A 1 20  ? 8.231   4.342   12.896  1.00 0.00 ? 20  MET A O    6  
ATOM 11446 C CB   . MET A 1 20  ? 7.853   2.956   15.691  1.00 0.00 ? 20  MET A CB   6  
ATOM 11447 C CG   . MET A 1 20  ? 7.185   1.960   14.706  1.00 0.00 ? 20  MET A CG   6  
ATOM 11448 S SD   . MET A 1 20  ? 8.341   0.749   13.984  1.00 0.00 ? 20  MET A SD   6  
ATOM 11449 C CE   . MET A 1 20  ? 9.565   1.826   13.173  1.00 0.00 ? 20  MET A CE   6  
ATOM 11450 H H    . MET A 1 20  ? 7.129   5.191   16.942  1.00 0.00 ? 20  MET A H    6  
ATOM 11451 H HA   . MET A 1 20  ? 9.183   4.562   15.069  1.00 0.00 ? 20  MET A HA   6  
ATOM 11452 H HB2  . MET A 1 20  ? 8.814   2.449   15.984  1.00 0.00 ? 20  MET A HB2  6  
ATOM 11453 H HB3  . MET A 1 20  ? 7.220   2.962   16.605  1.00 0.00 ? 20  MET A HB3  6  
ATOM 11454 H HG2  . MET A 1 20  ? 6.435   1.387   15.299  1.00 0.00 ? 20  MET A HG2  6  
ATOM 11455 H HG3  . MET A 1 20  ? 6.595   2.460   13.914  1.00 0.00 ? 20  MET A HG3  6  
ATOM 11456 H HE1  . MET A 1 20  ? 9.883   2.634   13.847  1.00 0.00 ? 20  MET A HE1  6  
ATOM 11457 H HE2  . MET A 1 20  ? 10.518  1.318   12.951  1.00 0.00 ? 20  MET A HE2  6  
ATOM 11458 H HE3  . MET A 1 20  ? 9.168   2.291   12.243  1.00 0.00 ? 20  MET A HE3  6  
ATOM 11459 N N    . VAL A 1 21  ? 6.694   5.760   13.602  1.00 0.00 ? 21  VAL A N    6  
ATOM 11460 C CA   . VAL A 1 21  ? 6.308   6.045   12.166  1.00 0.00 ? 21  VAL A CA   6  
ATOM 11461 C C    . VAL A 1 21  ? 7.298   6.843   11.349  1.00 0.00 ? 21  VAL A C    6  
ATOM 11462 O O    . VAL A 1 21  ? 7.388   6.639   10.142  1.00 0.00 ? 21  VAL A O    6  
ATOM 11463 C CB   . VAL A 1 21  ? 4.875   6.511   11.867  1.00 0.00 ? 21  VAL A CB   6  
ATOM 11464 C CG1  . VAL A 1 21  ? 3.905   5.731   12.774  1.00 0.00 ? 21  VAL A CG1  6  
ATOM 11465 C CG2  . VAL A 1 21  ? 4.713   8.054   11.965  1.00 0.00 ? 21  VAL A CG2  6  
ATOM 11466 H H    . VAL A 1 21  ? 6.255   6.258   14.380  1.00 0.00 ? 21  VAL A H    6  
ATOM 11467 H HA   . VAL A 1 21  ? 6.394   5.101   11.586  1.00 0.00 ? 21  VAL A HA   6  
ATOM 11468 H HB   . VAL A 1 21  ? 4.614   6.191   10.820  1.00 0.00 ? 21  VAL A HB   6  
ATOM 11469 H HG11 . VAL A 1 21  ? 4.094   4.636   12.676  1.00 0.00 ? 21  VAL A HG11 6  
ATOM 11470 H HG12 . VAL A 1 21  ? 4.010   6.023   13.838  1.00 0.00 ? 21  VAL A HG12 6  
ATOM 11471 H HG13 . VAL A 1 21  ? 2.853   5.926   12.462  1.00 0.00 ? 21  VAL A HG13 6  
ATOM 11472 H HG21 . VAL A 1 21  ? 5.361   8.466   12.763  1.00 0.00 ? 21  VAL A HG21 6  
ATOM 11473 H HG22 . VAL A 1 21  ? 4.983   8.589   11.027  1.00 0.00 ? 21  VAL A HG22 6  
ATOM 11474 H HG23 . VAL A 1 21  ? 3.672   8.319   12.225  1.00 0.00 ? 21  VAL A HG23 6  
ATOM 11475 N N    . VAL A 1 22  ? 8.051   7.785   11.980  1.00 0.00 ? 22  VAL A N    6  
ATOM 11476 C CA   . VAL A 1 22  ? 8.999   8.714   11.351  1.00 0.00 ? 22  VAL A CA   6  
ATOM 11477 C C    . VAL A 1 22  ? 10.077  8.105   10.422  1.00 0.00 ? 22  VAL A C    6  
ATOM 11478 O O    . VAL A 1 22  ? 10.333  8.648   9.351   1.00 0.00 ? 22  VAL A O    6  
ATOM 11479 C CB   . VAL A 1 22  ? 9.629   9.617   12.415  1.00 0.00 ? 22  VAL A CB   6  
ATOM 11480 C CG1  . VAL A 1 22  ? 10.542  10.699  11.796  1.00 0.00 ? 22  VAL A CG1  6  
ATOM 11481 C CG2  . VAL A 1 22  ? 8.512   10.294  13.240  1.00 0.00 ? 22  VAL A CG2  6  
ATOM 11482 H H    . VAL A 1 22  ? 7.929   7.909   12.965  1.00 0.00 ? 22  VAL A H    6  
ATOM 11483 H HA   . VAL A 1 22  ? 8.411   9.363   10.723  1.00 0.00 ? 22  VAL A HA   6  
ATOM 11484 H HB   . VAL A 1 22  ? 10.236  8.992   13.102  1.00 0.00 ? 22  VAL A HB   6  
ATOM 11485 H HG11 . VAL A 1 22  ? 10.005  11.234  10.985  1.00 0.00 ? 22  VAL A HG11 6  
ATOM 11486 H HG12 . VAL A 1 22  ? 10.844  11.430  12.576  1.00 0.00 ? 22  VAL A HG12 6  
ATOM 11487 H HG13 . VAL A 1 22  ? 11.462  10.241  11.370  1.00 0.00 ? 22  VAL A HG13 6  
ATOM 11488 H HG21 . VAL A 1 22  ? 7.803   10.831  12.574  1.00 0.00 ? 22  VAL A HG21 6  
ATOM 11489 H HG22 . VAL A 1 22  ? 7.951   9.561   13.853  1.00 0.00 ? 22  VAL A HG22 6  
ATOM 11490 H HG23 . VAL A 1 22  ? 8.960   11.034  13.939  1.00 0.00 ? 22  VAL A HG23 6  
ATOM 11491 N N    . LYS A 1 23  ? 10.713  6.943   10.753  1.00 0.00 ? 23  LYS A N    6  
ATOM 11492 C CA   . LYS A 1 23  ? 11.644  6.236   9.853   1.00 0.00 ? 23  LYS A CA   6  
ATOM 11493 C C    . LYS A 1 23  ? 11.009  5.477   8.693   1.00 0.00 ? 23  LYS A C    6  
ATOM 11494 O O    . LYS A 1 23  ? 11.634  5.199   7.672   1.00 0.00 ? 23  LYS A O    6  
ATOM 11495 C CB   . LYS A 1 23  ? 12.595  5.305   10.640  1.00 0.00 ? 23  LYS A CB   6  
ATOM 11496 C CG   . LYS A 1 23  ? 11.898  4.155   11.393  1.00 0.00 ? 23  LYS A CG   6  
ATOM 11497 C CD   . LYS A 1 23  ? 12.265  4.139   12.878  1.00 0.00 ? 23  LYS A CD   6  
ATOM 11498 C CE   . LYS A 1 23  ? 11.550  5.250   13.651  1.00 0.00 ? 23  LYS A CE   6  
ATOM 11499 N NZ   . LYS A 1 23  ? 11.814  5.109   15.099  1.00 0.00 ? 23  LYS A NZ   6  
ATOM 11500 H H    . LYS A 1 23  ? 10.502  6.501   11.638  1.00 0.00 ? 23  LYS A H    6  
ATOM 11501 H HA   . LYS A 1 23  ? 12.249  6.975   9.338   1.00 0.00 ? 23  LYS A HA   6  
ATOM 11502 H HB2  . LYS A 1 23  ? 13.378  4.879   9.972   1.00 0.00 ? 23  LYS A HB2  6  
ATOM 11503 H HB3  . LYS A 1 23  ? 13.134  5.941   11.376  1.00 0.00 ? 23  LYS A HB3  6  
ATOM 11504 H HG2  . LYS A 1 23  ? 10.790  4.240   11.316  1.00 0.00 ? 23  LYS A HG2  6  
ATOM 11505 H HG3  . LYS A 1 23  ? 12.187  3.184   10.931  1.00 0.00 ? 23  LYS A HG3  6  
ATOM 11506 H HD2  . LYS A 1 23  ? 11.979  3.152   13.300  1.00 0.00 ? 23  LYS A HD2  6  
ATOM 11507 H HD3  . LYS A 1 23  ? 13.365  4.243   12.994  1.00 0.00 ? 23  LYS A HD3  6  
ATOM 11508 H HE2  . LYS A 1 23  ? 11.903  6.253   13.337  1.00 0.00 ? 23  LYS A HE2  6  
ATOM 11509 H HE3  . LYS A 1 23  ? 10.448  5.197   13.471  1.00 0.00 ? 23  LYS A HE3  6  
ATOM 11510 H HZ1  . LYS A 1 23  ? 11.470  4.184   15.425  1.00 0.00 ? 23  LYS A HZ1  6  
ATOM 11511 H HZ2  . LYS A 1 23  ? 12.837  5.181   15.273  1.00 0.00 ? 23  LYS A HZ2  6  
ATOM 11512 H HZ3  . LYS A 1 23  ? 11.320  5.864   15.616  1.00 0.00 ? 23  LYS A HZ3  6  
ATOM 11513 N N    . ILE A 1 24  ? 9.718   5.101   8.848   1.00 0.00 ? 24  ILE A N    6  
ATOM 11514 C CA   . ILE A 1 24  ? 8.922   4.322   7.904   1.00 0.00 ? 24  ILE A CA   6  
ATOM 11515 C C    . ILE A 1 24  ? 8.403   5.021   6.707   1.00 0.00 ? 24  ILE A C    6  
ATOM 11516 O O    . ILE A 1 24  ? 8.331   4.430   5.646   1.00 0.00 ? 24  ILE A O    6  
ATOM 11517 C CB   . ILE A 1 24  ? 7.917   3.388   8.548   1.00 0.00 ? 24  ILE A CB   6  
ATOM 11518 C CG1  . ILE A 1 24  ? 8.326   1.897   8.249   1.00 0.00 ? 24  ILE A CG1  6  
ATOM 11519 C CG2  . ILE A 1 24  ? 6.453   3.856   8.247   1.00 0.00 ? 24  ILE A CG2  6  
ATOM 11520 C CD1  . ILE A 1 24  ? 9.741   1.544   8.667   1.00 0.00 ? 24  ILE A CD1  6  
ATOM 11521 H H    . ILE A 1 24  ? 9.247   5.374   9.685   1.00 0.00 ? 24  ILE A H    6  
ATOM 11522 H HA   . ILE A 1 24  ? 9.621   3.699   7.379   1.00 0.00 ? 24  ILE A HA   6  
ATOM 11523 H HB   . ILE A 1 24  ? 8.030   3.506   9.654   1.00 0.00 ? 24  ILE A HB   6  
ATOM 11524 H HG12 . ILE A 1 24  ? 7.804   1.196   8.933   1.00 0.00 ? 24  ILE A HG12 6  
ATOM 11525 H HG13 . ILE A 1 24  ? 8.184   1.559   7.196   1.00 0.00 ? 24  ILE A HG13 6  
ATOM 11526 H HG21 . ILE A 1 24  ? 6.323   4.960   8.289   1.00 0.00 ? 24  ILE A HG21 6  
ATOM 11527 H HG22 . ILE A 1 24  ? 6.114   3.507   7.240   1.00 0.00 ? 24  ILE A HG22 6  
ATOM 11528 H HG23 . ILE A 1 24  ? 5.764   3.507   9.031   1.00 0.00 ? 24  ILE A HG23 6  
ATOM 11529 H HD11 . ILE A 1 24  ? 9.888   1.891   9.715   1.00 0.00 ? 24  ILE A HD11 6  
ATOM 11530 H HD12 . ILE A 1 24  ? 9.791   0.432   8.651   1.00 0.00 ? 24  ILE A HD12 6  
ATOM 11531 H HD13 . ILE A 1 24  ? 10.559  1.895   8.014   1.00 0.00 ? 24  ILE A HD13 6  
ATOM 11532 N N    . ILE A 1 25  ? 8.014   6.316   6.807   1.00 0.00 ? 25  ILE A N    6  
ATOM 11533 C CA   . ILE A 1 25  ? 7.543   7.214   5.733   1.00 0.00 ? 25  ILE A CA   6  
ATOM 11534 C C    . ILE A 1 25  ? 8.543   7.322   4.565   1.00 0.00 ? 25  ILE A C    6  
ATOM 11535 O O    . ILE A 1 25  ? 8.183   7.422   3.390   1.00 0.00 ? 25  ILE A O    6  
ATOM 11536 C CB   . ILE A 1 25  ? 6.918   8.486   6.307   1.00 0.00 ? 25  ILE A CB   6  
ATOM 11537 C CG1  . ILE A 1 25  ? 7.914   9.273   7.204   1.00 0.00 ? 25  ILE A CG1  6  
ATOM 11538 C CG2  . ILE A 1 25  ? 5.640   8.027   7.063   1.00 0.00 ? 25  ILE A CG2  6  
ATOM 11539 C CD1  . ILE A 1 25  ? 7.277   10.076  8.348   1.00 0.00 ? 25  ILE A CD1  6  
ATOM 11540 H H    . ILE A 1 25  ? 8.069   6.753   7.707   1.00 0.00 ? 25  ILE A H    6  
ATOM 11541 H HA   . ILE A 1 25  ? 6.733   6.666   5.246   1.00 0.00 ? 25  ILE A HA   6  
ATOM 11542 H HB   . ILE A 1 25  ? 6.581   9.162   5.488   1.00 0.00 ? 25  ILE A HB   6  
ATOM 11543 H HG12 . ILE A 1 25  ? 8.635   8.568   7.665   1.00 0.00 ? 25  ILE A HG12 6  
ATOM 11544 H HG13 . ILE A 1 25  ? 8.510   9.951   6.554   1.00 0.00 ? 25  ILE A HG13 6  
ATOM 11545 H HG21 . ILE A 1 25  ? 4.944   7.496   6.382   1.00 0.00 ? 25  ILE A HG21 6  
ATOM 11546 H HG22 . ILE A 1 25  ? 5.875   7.337   7.902   1.00 0.00 ? 25  ILE A HG22 6  
ATOM 11547 H HG23 . ILE A 1 25  ? 5.087   8.897   7.477   1.00 0.00 ? 25  ILE A HG23 6  
ATOM 11548 H HD11 . ILE A 1 25  ? 6.556   10.829  7.966   1.00 0.00 ? 25  ILE A HD11 6  
ATOM 11549 H HD12 . ILE A 1 25  ? 6.745   9.406   9.061   1.00 0.00 ? 25  ILE A HD12 6  
ATOM 11550 H HD13 . ILE A 1 25  ? 8.063   10.589  8.947   1.00 0.00 ? 25  ILE A HD13 6  
ATOM 11551 N N    . ASP A 1 26  ? 9.854   7.136   4.927   1.00 0.00 ? 26  ASP A N    6  
ATOM 11552 C CA   . ASP A 1 26  ? 10.979  6.818   4.042   1.00 0.00 ? 26  ASP A CA   6  
ATOM 11553 C C    . ASP A 1 26  ? 10.846  5.491   3.220   1.00 0.00 ? 26  ASP A C    6  
ATOM 11554 O O    . ASP A 1 26  ? 11.518  5.367   2.200