data_2CK0
# 
_entry.id   2CK0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CK0         
RCSB  RCSB001179   
WWPDB D_1000001179 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CK0 
_pdbx_database_status.recvd_initial_deposition_date   1999-06-13 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pan, Y.H.'   1 
'Amzel, L.M.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structures of Angiotensin II and a Phage-Display Selected Cyclic Peptide in 
Complex with Fab131: Making Angiotensin II Analogs
;
'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 
1       
;Structures of Angiotensin II and a Phage-Display Selected Cyclic Peptide in 
Complex with Fab131: Making Angiotensin II Analogs
;
'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pan, Y.H.'   1  
primary 'Lee, K.H.'   2  
primary 'Li, M.'      3  
primary 'Ronco, P.'   4  
primary 'Amzel, L.M.' 5  
1       'Pan, Y.H.'   6  
1       'Lee, K.H.'   7  
1       'Li, M.'      8  
1       'Ronco, P.'   9  
1       'Amzel, L.M.' 10 
# 
_cell.entry_id           2CK0 
_cell.length_a           84.220 
_cell.length_b           84.220 
_cell.length_c           142.310 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2CK0 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'PROTEIN (IMMUNOGLOBULIN; LIGHT CHAIN)' 23904.543 1  ? ? 'FAB FRAGMENT' 'IGG1, KAPPA' 
2 polymer nat 'PROTEIN (IMMUNOGLOBULIN; HEAVY CHAIN)' 23650.486 1  ? ? 'FAB FRAGMENT' 'IGG1, KAPPA' 
3 polymer nat 'PROTEIN (11-MER; CYCLIC PEPTIDE)'      1195.388  1  ? ? ?              SYNTHETIC     
4 water   nat water                                   18.015    50 ? ? ?              ?             
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DIQLTQSPSSLAVSAGEKVTMNCKSSQNLLHSITRKNYLAWYRQKPGQSPKLLIYWASTRGSGVPDRFTGSGSGTDFTLT
ISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
;
;DIQLTQSPSSLAVSAGEKVTMNCKSSQNLLHSITRKNYLAWYRQKPGQSPKLLIYWASTRGSGVPDRFTGSGSGTDFTLT
ISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSER
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
;
L ? 
2 'polypeptide(L)' no no 
;QVQLQESGGGLVQPRGSLKLSCAASGFTFNTDAMNWVRQAPGKGLEWVARIRSKGFNFATYYADSVRDRFTISRDDSQSM
LYLQMNNLKTEDTGIYYCVRGRDGEAMDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVT
WNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVN
;
;QVQLQESGGGLVQPRGSLKLSCAASGFTFNTDAMNWVRQAPGKGLEWVARIRSKGFNFATYYADSVRDRFTISRDDSQSM
LYLQMNNLKTEDTGIYYCVRGRDGEAMDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVT
WNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVN
;
H ? 
3 'polypeptide(L)' no no CKEWLSTAPCG CKEWLSTAPCG P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ILE n 
1 3   GLN n 
1 4   LEU n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   SER n 
1 10  SER n 
1 11  LEU n 
1 12  ALA n 
1 13  VAL n 
1 14  SER n 
1 15  ALA n 
1 16  GLY n 
1 17  GLU n 
1 18  LYS n 
1 19  VAL n 
1 20  THR n 
1 21  MET n 
1 22  ASN n 
1 23  CYS n 
1 24  LYS n 
1 25  SER n 
1 26  SER n 
1 27  GLN n 
1 28  ASN n 
1 29  LEU n 
1 30  LEU n 
1 31  HIS n 
1 32  SER n 
1 33  ILE n 
1 34  THR n 
1 35  ARG n 
1 36  LYS n 
1 37  ASN n 
1 38  TYR n 
1 39  LEU n 
1 40  ALA n 
1 41  TRP n 
1 42  TYR n 
1 43  ARG n 
1 44  GLN n 
1 45  LYS n 
1 46  PRO n 
1 47  GLY n 
1 48  GLN n 
1 49  SER n 
1 50  PRO n 
1 51  LYS n 
1 52  LEU n 
1 53  LEU n 
1 54  ILE n 
1 55  TYR n 
1 56  TRP n 
1 57  ALA n 
1 58  SER n 
1 59  THR n 
1 60  ARG n 
1 61  GLY n 
1 62  SER n 
1 63  GLY n 
1 64  VAL n 
1 65  PRO n 
1 66  ASP n 
1 67  ARG n 
1 68  PHE n 
1 69  THR n 
1 70  GLY n 
1 71  SER n 
1 72  GLY n 
1 73  SER n 
1 74  GLY n 
1 75  THR n 
1 76  ASP n 
1 77  PHE n 
1 78  THR n 
1 79  LEU n 
1 80  THR n 
1 81  ILE n 
1 82  SER n 
1 83  SER n 
1 84  VAL n 
1 85  GLN n 
1 86  ALA n 
1 87  GLU n 
1 88  ASP n 
1 89  LEU n 
1 90  ALA n 
1 91  VAL n 
1 92  TYR n 
1 93  TYR n 
1 94  CYS n 
1 95  LYS n 
1 96  GLN n 
1 97  SER n 
1 98  TYR n 
1 99  ASN n 
1 100 LEU n 
1 101 TYR n 
1 102 THR n 
1 103 PHE n 
1 104 GLY n 
1 105 GLY n 
1 106 GLY n 
1 107 THR n 
1 108 LYS n 
1 109 LEU n 
1 110 GLU n 
1 111 ILE n 
1 112 LYS n 
1 113 ARG n 
1 114 ALA n 
1 115 ASP n 
1 116 ALA n 
1 117 ALA n 
1 118 PRO n 
1 119 THR n 
1 120 VAL n 
1 121 SER n 
1 122 ILE n 
1 123 PHE n 
1 124 PRO n 
1 125 PRO n 
1 126 SER n 
1 127 SER n 
1 128 GLU n 
1 129 GLN n 
1 130 LEU n 
1 131 THR n 
1 132 SER n 
1 133 GLY n 
1 134 GLY n 
1 135 ALA n 
1 136 SER n 
1 137 VAL n 
1 138 VAL n 
1 139 CYS n 
1 140 PHE n 
1 141 LEU n 
1 142 ASN n 
1 143 ASN n 
1 144 PHE n 
1 145 TYR n 
1 146 PRO n 
1 147 LYS n 
1 148 ASP n 
1 149 ILE n 
1 150 ASN n 
1 151 VAL n 
1 152 LYS n 
1 153 TRP n 
1 154 LYS n 
1 155 ILE n 
1 156 ASP n 
1 157 GLY n 
1 158 SER n 
1 159 GLU n 
1 160 ARG n 
1 161 GLN n 
1 162 ASN n 
1 163 GLY n 
1 164 VAL n 
1 165 LEU n 
1 166 ASN n 
1 167 SER n 
1 168 TRP n 
1 169 THR n 
1 170 ASP n 
1 171 GLN n 
1 172 ASP n 
1 173 SER n 
1 174 LYS n 
1 175 ASP n 
1 176 SER n 
1 177 THR n 
1 178 TYR n 
1 179 SER n 
1 180 MET n 
1 181 SER n 
1 182 SER n 
1 183 THR n 
1 184 LEU n 
1 185 THR n 
1 186 LEU n 
1 187 THR n 
1 188 LYS n 
1 189 ASP n 
1 190 GLU n 
1 191 TYR n 
1 192 GLU n 
1 193 ARG n 
1 194 HIS n 
1 195 ASN n 
1 196 SER n 
1 197 TYR n 
1 198 THR n 
1 199 CYS n 
1 200 GLU n 
1 201 ALA n 
1 202 THR n 
1 203 HIS n 
1 204 LYS n 
1 205 THR n 
1 206 SER n 
1 207 THR n 
1 208 SER n 
1 209 PRO n 
1 210 ILE n 
1 211 VAL n 
1 212 LYS n 
1 213 SER n 
1 214 PHE n 
1 215 ASN n 
1 216 ARG n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   GLN n 
2 6   GLU n 
2 7   SER n 
2 8   GLY n 
2 9   GLY n 
2 10  GLY n 
2 11  LEU n 
2 12  VAL n 
2 13  GLN n 
2 14  PRO n 
2 15  ARG n 
2 16  GLY n 
2 17  SER n 
2 18  LEU n 
2 19  LYS n 
2 20  LEU n 
2 21  SER n 
2 22  CYS n 
2 23  ALA n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  PHE n 
2 28  THR n 
2 29  PHE n 
2 30  ASN n 
2 31  THR n 
2 32  ASP n 
2 33  ALA n 
2 34  MET n 
2 35  ASN n 
2 36  TRP n 
2 37  VAL n 
2 38  ARG n 
2 39  GLN n 
2 40  ALA n 
2 41  PRO n 
2 42  GLY n 
2 43  LYS n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  VAL n 
2 49  ALA n 
2 50  ARG n 
2 51  ILE n 
2 52  ARG n 
2 53  SER n 
2 54  LYS n 
2 55  GLY n 
2 56  PHE n 
2 57  ASN n 
2 58  PHE n 
2 59  ALA n 
2 60  THR n 
2 61  TYR n 
2 62  TYR n 
2 63  ALA n 
2 64  ASP n 
2 65  SER n 
2 66  VAL n 
2 67  ARG n 
2 68  ASP n 
2 69  ARG n 
2 70  PHE n 
2 71  THR n 
2 72  ILE n 
2 73  SER n 
2 74  ARG n 
2 75  ASP n 
2 76  ASP n 
2 77  SER n 
2 78  GLN n 
2 79  SER n 
2 80  MET n 
2 81  LEU n 
2 82  TYR n 
2 83  LEU n 
2 84  GLN n 
2 85  MET n 
2 86  ASN n 
2 87  ASN n 
2 88  LEU n 
2 89  LYS n 
2 90  THR n 
2 91  GLU n 
2 92  ASP n 
2 93  THR n 
2 94  GLY n 
2 95  ILE n 
2 96  TYR n 
2 97  TYR n 
2 98  CYS n 
2 99  VAL n 
2 100 ARG n 
2 101 GLY n 
2 102 ARG n 
2 103 ASP n 
2 104 GLY n 
2 105 GLU n 
2 106 ALA n 
2 107 MET n 
2 108 ASP n 
2 109 TYR n 
2 110 TRP n 
2 111 GLY n 
2 112 GLN n 
2 113 GLY n 
2 114 THR n 
2 115 THR n 
2 116 LEU n 
2 117 THR n 
2 118 VAL n 
2 119 SER n 
2 120 SER n 
2 121 ALA n 
2 122 LYS n 
2 123 THR n 
2 124 THR n 
2 125 PRO n 
2 126 PRO n 
2 127 SER n 
2 128 VAL n 
2 129 TYR n 
2 130 PRO n 
2 131 LEU n 
2 132 ALA n 
2 133 PRO n 
2 134 GLY n 
2 135 SER n 
2 136 ALA n 
2 137 ALA n 
2 138 GLN n 
2 139 THR n 
2 140 ASN n 
2 141 SER n 
2 142 MET n 
2 143 VAL n 
2 144 THR n 
2 145 LEU n 
2 146 GLY n 
2 147 CYS n 
2 148 LEU n 
2 149 VAL n 
2 150 LYS n 
2 151 GLY n 
2 152 TYR n 
2 153 PHE n 
2 154 PRO n 
2 155 GLU n 
2 156 PRO n 
2 157 VAL n 
2 158 THR n 
2 159 VAL n 
2 160 THR n 
2 161 TRP n 
2 162 ASN n 
2 163 SER n 
2 164 GLY n 
2 165 SER n 
2 166 LEU n 
2 167 SER n 
2 168 SER n 
2 169 GLY n 
2 170 VAL n 
2 171 HIS n 
2 172 THR n 
2 173 PHE n 
2 174 PRO n 
2 175 ALA n 
2 176 VAL n 
2 177 LEU n 
2 178 GLN n 
2 179 SER n 
2 180 ASP n 
2 181 LEU n 
2 182 TYR n 
2 183 THR n 
2 184 LEU n 
2 185 SER n 
2 186 SER n 
2 187 SER n 
2 188 VAL n 
2 189 THR n 
2 190 VAL n 
2 191 PRO n 
2 192 SER n 
2 193 SER n 
2 194 PRO n 
2 195 ARG n 
2 196 PRO n 
2 197 SER n 
2 198 GLU n 
2 199 THR n 
2 200 VAL n 
2 201 THR n 
2 202 CYS n 
2 203 ASN n 
2 204 VAL n 
2 205 ALA n 
2 206 HIS n 
2 207 PRO n 
2 208 ALA n 
2 209 SER n 
2 210 SER n 
2 211 THR n 
2 212 LYS n 
2 213 VAL n 
2 214 ASP n 
2 215 LYS n 
2 216 LYS n 
2 217 ILE n 
2 218 VAL n 
2 219 ASN n 
3 1   CYS n 
3 2   LYS n 
3 3   GLU n 
3 4   TRP n 
3 5   LEU n 
3 6   SER n 
3 7   THR n 
3 8   ALA n 
3 9   PRO n 
3 10  CYS n 
3 11  GLY n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'house mouse' 'Mus musculus'        10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? HYBRIDOMA ? ? ?                           
2 1 sample ? ? 'house mouse' 'Mus musculus'        10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? HYBRIDOMA ? ? ?                           
3 1 sample ? ? ?             'synthetic construct' 32630 ?   ? ? ? ? ? ? ? ? ? ? ? ? ?         ? ? 'CYCLIC PEPTIDE, SYNTHETIC' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 GB  U62649 1 1407830 ? ? ? 
2 PDB 2CK0   2 2CK0    ? ? ? 
3 PDB 2CK0   3 2CK0    ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2CK0 L 1 ? 216 ? 1407830 1 ? 216 ? 1 210 
2 2 2CK0 H 1 ? 219 ? 2CK0    1 ? 216 ? 1 216 
3 3 2CK0 P 1 ? 11  ? 2CK0    1 ? 11  ? 1 11  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2CK0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.52 
_exptl_crystal.density_percent_sol   51 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    'pH 7.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                MONOCHROMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2CK0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   24870 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         90. 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.1 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 2CK0 
_refine.ls_number_reflns_obs                     18572 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                0.1 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    73.5 
_refine.ls_R_factor_obs                          0.2 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2 
_refine.ls_R_factor_R_free                       0.296 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  960 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               30.9 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3373 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             50 
_refine_hist.number_atoms_total               3423 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.40  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      27.9  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.20  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM11.WAT  TOPH11.WAT   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2CK0 
_struct.title                     
'ANTI-ANTI-IDIOTYPIC ANTIBODY AGAINST HUMAN ANGIOTENSIN II, COMPLEX WITH A SYNTHETIC CYCLIC PEPTIDE' 
_struct.pdbx_descriptor           IMMUNOGLOBULIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CK0 
_struct_keywords.pdbx_keywords   IMMUNOGLOBULIN 
_struct_keywords.text            IMMUNOGLOBULIN 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 86  ? ASP A 88  ? ALA L 80  ASP L 82  5 ? 3 
HELX_P HELX_P2 2 SER A 127 ? SER A 132 ? SER L 121 SER L 126 1 ? 6 
HELX_P HELX_P3 3 LYS A 188 ? GLU A 192 ? LYS L 182 GLU L 186 1 ? 5 
HELX_P HELX_P4 4 PHE B 29  ? THR B 31  ? PHE H 29  THR H 31  5 ? 3 
HELX_P HELX_P5 5 LYS B 54  B PHE B 56  ? LYS H 52  PHE H 53  5 ? 3 
HELX_P HELX_P6 6 THR B 90  ? ASP B 92  ? THR H 87  ASP H 89  5 ? 3 
HELX_P HELX_P7 7 ASN B 162 ? GLY B 164 ? ASN H 159 GLY H 161 5 ? 3 
HELX_P HELX_P8 8 PRO B 207 ? SER B 209 ? PRO H 204 SER H 206 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           C 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            1 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           C 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            10 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            P 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             1 
_struct_conn.ptnr2_auth_asym_id            P 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             10 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.026 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 7   A . ? SER 7   L PRO 8   A ? PRO 8   L 1 -0.16 
2 TYR 145 A . ? TYR 139 L PRO 146 A ? PRO 140 L 1 -0.06 
3 PHE 153 B . ? PHE 150 H PRO 154 B ? PRO 151 H 1 -0.26 
4 GLU 155 B . ? GLU 152 H PRO 156 B ? PRO 153 H 1 0.10  
5 ARG 195 B . ? ARG 192 H PRO 196 B ? PRO 193 H 1 0.08  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 3 ? 
D ? 4 ? 
E ? 3 ? 
F ? 4 ? 
G ? 6 ? 
H ? 4 ? 
I ? 3 ? 
J ? 2 ? 
K ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 4   ? SER A 7   ? LEU L 4   SER L 7   
A 2 VAL A 19  ? SER A 25  ? VAL L 19  SER L 25  
A 3 ASP A 76  ? ILE A 81  ? ASP L 70  ILE L 75  
A 4 PHE A 68  ? SER A 73  ? PHE L 62  SER L 67  
B 1 SER A 10  ? SER A 14  ? SER L 10  SER L 14  
B 2 LYS A 108 ? LYS A 112 ? LYS L 102 LYS L 106 
C 1 VAL A 91  ? GLN A 96  ? VAL L 85  GLN L 90  
C 2 LEU A 39  ? GLN A 44  ? LEU L 33  GLN L 38  
C 3 PRO A 50  ? ILE A 54  ? PRO L 44  ILE L 48  
D 1 THR A 119 ? PHE A 123 ? THR L 113 PHE L 117 
D 2 GLY A 134 ? ASN A 142 ? GLY L 128 ASN L 136 
D 3 MET A 180 ? THR A 187 ? MET L 174 THR L 181 
D 4 VAL A 164 ? TRP A 168 ? VAL L 158 TRP L 162 
E 1 ASN A 150 ? ILE A 155 ? ASN L 144 ILE L 149 
E 2 SER A 196 ? THR A 202 ? SER L 190 THR L 196 
E 3 ILE A 210 ? ASN A 215 ? ILE L 204 ASN L 209 
F 1 GLN B 3   ? SER B 7   ? GLN H 3   SER H 7   
F 2 LEU B 18  ? SER B 25  ? LEU H 18  SER H 25  
F 3 MET B 80  ? MET B 85  ? MET H 77  MET H 82  
F 4 PHE B 70  ? ASP B 75  ? PHE H 67  ASP H 72  
G 1 GLY B 10  ? VAL B 12  ? GLY H 10  VAL H 12  
G 2 THR B 114 ? VAL B 118 ? THR H 111 VAL H 115 
G 3 GLY B 94  ? ARG B 100 ? GLY H 91  ARG H 97  
G 4 MET B 34  ? GLN B 39  ? MET H 34  GLN H 39  
G 5 LEU B 45  ? ILE B 51  ? LEU H 45  ILE H 51  
G 6 THR B 60  ? TYR B 62  ? THR H 57  TYR H 59  
H 1 SER B 127 ? LEU B 131 ? SER H 124 LEU H 128 
H 2 VAL B 143 ? TYR B 152 ? VAL H 140 TYR H 149 
H 3 TYR B 182 ? VAL B 190 ? TYR H 179 VAL H 187 
H 4 VAL B 170 ? THR B 172 ? VAL H 167 THR H 169 
I 1 THR B 158 ? TRP B 161 ? THR H 155 TRP H 158 
I 2 THR B 201 ? HIS B 206 ? THR H 198 HIS H 203 
I 3 THR B 211 ? LYS B 216 ? THR H 208 LYS H 213 
J 1 VAL B 176 ? GLN B 178 ? VAL H 173 GLN H 175 
J 2 LEU B 181 ? THR B 183 ? LEU H 178 THR H 180 
K 1 VAL B 99  ? GLY B 101 ? VAL H 96  GLY H 98  
K 2 MET B 107 ? TRP B 110 ? MET H 104 TRP H 107 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 5   ? O THR L 5   N LYS A 24  ? N LYS L 24  
A 2 3 O VAL A 19  ? O VAL L 19  N ILE A 81  ? N ILE L 75  
A 3 4 O ASP A 76  ? O ASP L 70  N SER A 73  ? N SER L 67  
B 1 2 O LEU A 11  ? O LEU L 11  N LYS A 108 ? N LYS L 102 
C 1 2 O VAL A 91  ? O VAL L 85  N GLN A 44  ? N GLN L 38  
C 2 3 O TRP A 41  ? O TRP L 35  N ILE A 54  ? N ILE L 48  
D 1 2 O THR A 119 ? O THR L 113 N ASN A 142 ? N ASN L 136 
D 2 3 O ALA A 135 ? O ALA L 129 N LEU A 186 ? N LEU L 180 
D 3 4 O SER A 181 ? O SER L 175 N SER A 167 ? N SER L 161 
E 1 2 O ASN A 150 ? O ASN L 144 N THR A 202 ? N THR L 196 
E 2 3 O TYR A 197 ? O TYR L 191 N PHE A 214 ? N PHE L 208 
F 1 2 O GLN B 3   ? O GLN H 3   N SER B 25  ? N SER H 25  
F 2 3 O LEU B 18  ? O LEU H 18  N MET B 85  ? N MET H 82  
F 3 4 O MET B 80  ? O MET H 77  N ASP B 75  ? N ASP H 72  
G 1 2 O GLY B 10  ? O GLY H 10  N THR B 117 ? N THR H 114 
G 2 3 O THR B 114 ? O THR H 111 N TYR B 96  ? N TYR H 93  
G 3 4 O ILE B 95  ? O ILE H 92  N GLN B 39  ? N GLN H 39  
G 4 5 O MET B 34  ? O MET H 34  N ILE B 51  ? N ILE H 51  
G 5 6 O ARG B 50  ? O ARG H 50  N TYR B 61  ? N TYR H 58  
H 1 2 O SER B 127 ? O SER H 124 N LYS B 150 ? N LYS H 147 
H 2 3 O VAL B 143 ? O VAL H 140 N VAL B 190 ? N VAL H 187 
H 3 4 O SER B 187 ? O SER H 184 N HIS B 171 ? N HIS H 168 
I 1 2 O THR B 158 ? O THR H 155 N ALA B 205 ? N ALA H 202 
I 2 3 O CYS B 202 ? O CYS H 199 N LYS B 215 ? N LYS H 212 
J 1 2 O VAL B 176 ? O VAL H 173 N THR B 183 ? N THR H 180 
K 1 2 O ARG B 100 ? O ARG H 97  N TYR B 109 ? N TYR H 106 
# 
_database_PDB_matrix.entry_id          2CK0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CK0 
_atom_sites.fract_transf_matrix[1][1]   0.011874 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011874 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007027 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 54.462 -1.094  20.156  1.00 71.56 ? 1   ASP L N   1 
ATOM   2    C CA  . ASP A 1 1   ? 55.275 0.024   19.692  1.00 67.22 ? 1   ASP L CA  1 
ATOM   3    C C   . ASP A 1 1   ? 54.572 1.297   20.141  1.00 61.77 ? 1   ASP L C   1 
ATOM   4    O O   . ASP A 1 1   ? 53.398 1.500   19.837  1.00 60.29 ? 1   ASP L O   1 
ATOM   5    C CB  . ASP A 1 1   ? 55.394 -0.008  18.159  1.00 73.07 ? 1   ASP L CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 56.582 0.799   17.635  1.00 78.14 ? 1   ASP L CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 56.357 1.841   16.978  1.00 79.52 ? 1   ASP L OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 57.740 0.377   17.860  1.00 78.74 ? 1   ASP L OD2 1 
ATOM   9    N N   . ILE A 1 2   ? 55.273 2.111   20.922  1.00 56.52 ? 2   ILE L N   1 
ATOM   10   C CA  . ILE A 1 2   ? 54.724 3.370   21.421  1.00 48.95 ? 2   ILE L CA  1 
ATOM   11   C C   . ILE A 1 2   ? 54.801 4.411   20.312  1.00 49.87 ? 2   ILE L C   1 
ATOM   12   O O   . ILE A 1 2   ? 55.865 4.610   19.726  1.00 50.98 ? 2   ILE L O   1 
ATOM   13   C CB  . ILE A 1 2   ? 55.538 3.887   22.617  1.00 43.45 ? 2   ILE L CB  1 
ATOM   14   C CG1 . ILE A 1 2   ? 55.580 2.822   23.716  1.00 43.89 ? 2   ILE L CG1 1 
ATOM   15   C CG2 . ILE A 1 2   ? 54.955 5.200   23.121  1.00 37.22 ? 2   ILE L CG2 1 
ATOM   16   C CD1 . ILE A 1 2   ? 56.524 3.145   24.863  1.00 44.30 ? 2   ILE L CD1 1 
ATOM   17   N N   . GLN A 1 3   ? 53.686 5.065   20.010  1.00 45.57 ? 3   GLN L N   1 
ATOM   18   C CA  . GLN A 1 3   ? 53.695 6.079   18.973  1.00 42.73 ? 3   GLN L CA  1 
ATOM   19   C C   . GLN A 1 3   ? 53.603 7.487   19.546  1.00 36.58 ? 3   GLN L C   1 
ATOM   20   O O   . GLN A 1 3   ? 52.670 7.813   20.275  1.00 38.46 ? 3   GLN L O   1 
ATOM   21   C CB  . GLN A 1 3   ? 52.577 5.842   17.956  1.00 48.88 ? 3   GLN L CB  1 
ATOM   22   C CG  . GLN A 1 3   ? 52.707 6.718   16.707  1.00 61.96 ? 3   GLN L CG  1 
ATOM   23   C CD  . GLN A 1 3   ? 54.069 6.571   16.016  1.00 71.06 ? 3   GLN L CD  1 
ATOM   24   O OE1 . GLN A 1 3   ? 54.309 5.605   15.289  1.00 74.90 ? 3   GLN L OE1 1 
ATOM   25   N NE2 . GLN A 1 3   ? 54.958 7.535   16.239  1.00 73.57 ? 3   GLN L NE2 1 
ATOM   26   N N   . LEU A 1 4   ? 54.596 8.309   19.234  1.00 31.22 ? 4   LEU L N   1 
ATOM   27   C CA  . LEU A 1 4   ? 54.628 9.688   19.699  1.00 30.65 ? 4   LEU L CA  1 
ATOM   28   C C   . LEU A 1 4   ? 54.068 10.558  18.586  1.00 29.65 ? 4   LEU L C   1 
ATOM   29   O O   . LEU A 1 4   ? 54.382 10.337  17.421  1.00 35.48 ? 4   LEU L O   1 
ATOM   30   C CB  . LEU A 1 4   ? 56.069 10.122  19.983  1.00 28.44 ? 4   LEU L CB  1 
ATOM   31   C CG  . LEU A 1 4   ? 56.918 9.297   20.949  1.00 28.30 ? 4   LEU L CG  1 
ATOM   32   C CD1 . LEU A 1 4   ? 58.345 9.818   20.946  1.00 26.83 ? 4   LEU L CD1 1 
ATOM   33   C CD2 . LEU A 1 4   ? 56.327 9.350   22.339  1.00 31.98 ? 4   LEU L CD2 1 
ATOM   34   N N   . THR A 1 5   ? 53.244 11.539  18.929  1.00 29.88 ? 5   THR L N   1 
ATOM   35   C CA  . THR A 1 5   ? 52.677 12.430  17.924  1.00 32.78 ? 5   THR L CA  1 
ATOM   36   C C   . THR A 1 5   ? 53.026 13.858  18.330  1.00 33.43 ? 5   THR L C   1 
ATOM   37   O O   . THR A 1 5   ? 52.868 14.226  19.492  1.00 29.90 ? 5   THR L O   1 
ATOM   38   C CB  . THR A 1 5   ? 51.126 12.264  17.799  1.00 33.69 ? 5   THR L CB  1 
ATOM   39   O OG1 . THR A 1 5   ? 50.455 13.392  18.379  1.00 40.72 ? 5   THR L OG1 1 
ATOM   40   C CG2 . THR A 1 5   ? 50.652 10.994  18.499  1.00 33.96 ? 5   THR L CG2 1 
ATOM   41   N N   . GLN A 1 6   ? 53.522 14.656  17.388  1.00 33.07 ? 6   GLN L N   1 
ATOM   42   C CA  . GLN A 1 6   ? 53.890 16.040  17.686  1.00 29.31 ? 6   GLN L CA  1 
ATOM   43   C C   . GLN A 1 6   ? 52.983 17.059  16.994  1.00 32.53 ? 6   GLN L C   1 
ATOM   44   O O   . GLN A 1 6   ? 52.378 16.771  15.962  1.00 36.72 ? 6   GLN L O   1 
ATOM   45   C CB  . GLN A 1 6   ? 55.364 16.293  17.344  1.00 20.21 ? 6   GLN L CB  1 
ATOM   46   C CG  . GLN A 1 6   ? 56.322 15.363  18.075  1.00 5.41  ? 6   GLN L CG  1 
ATOM   47   C CD  . GLN A 1 6   ? 57.768 15.698  17.824  1.00 11.49 ? 6   GLN L CD  1 
ATOM   48   O OE1 . GLN A 1 6   ? 58.160 16.851  17.869  1.00 17.42 ? 6   GLN L OE1 1 
ATOM   49   N NE2 . GLN A 1 6   ? 58.585 14.678  17.594  1.00 7.27  ? 6   GLN L NE2 1 
ATOM   50   N N   . SER A 1 7   ? 52.912 18.255  17.563  1.00 35.96 ? 7   SER L N   1 
ATOM   51   C CA  . SER A 1 7   ? 52.081 19.325  17.040  1.00 34.54 ? 7   SER L CA  1 
ATOM   52   C C   . SER A 1 7   ? 52.579 20.661  17.582  1.00 36.78 ? 7   SER L C   1 
ATOM   53   O O   . SER A 1 7   ? 52.991 20.760  18.744  1.00 32.54 ? 7   SER L O   1 
ATOM   54   C CB  . SER A 1 7   ? 50.634 19.112  17.477  1.00 40.30 ? 7   SER L CB  1 
ATOM   55   O OG  . SER A 1 7   ? 50.550 18.936  18.886  1.00 49.21 ? 7   SER L OG  1 
ATOM   56   N N   . PRO A 1 8   ? 52.586 21.704  16.738  1.00 39.94 ? 8   PRO L N   1 
ATOM   57   C CA  . PRO A 1 8   ? 52.167 21.707  15.333  1.00 37.21 ? 8   PRO L CA  1 
ATOM   58   C C   . PRO A 1 8   ? 53.209 20.982  14.498  1.00 37.06 ? 8   PRO L C   1 
ATOM   59   O O   . PRO A 1 8   ? 54.236 20.556  15.019  1.00 36.34 ? 8   PRO L O   1 
ATOM   60   C CB  . PRO A 1 8   ? 52.179 23.194  14.980  1.00 40.52 ? 8   PRO L CB  1 
ATOM   61   C CG  . PRO A 1 8   ? 52.054 23.893  16.304  1.00 45.40 ? 8   PRO L CG  1 
ATOM   62   C CD  . PRO A 1 8   ? 52.943 23.064  17.170  1.00 42.68 ? 8   PRO L CD  1 
ATOM   63   N N   . SER A 1 9   ? 52.945 20.832  13.208  1.00 39.57 ? 9   SER L N   1 
ATOM   64   C CA  . SER A 1 9   ? 53.901 20.180  12.323  1.00 42.08 ? 9   SER L CA  1 
ATOM   65   C C   . SER A 1 9   ? 54.929 21.231  11.905  1.00 40.50 ? 9   SER L C   1 
ATOM   66   O O   . SER A 1 9   ? 56.078 20.919  11.572  1.00 41.61 ? 9   SER L O   1 
ATOM   67   C CB  . SER A 1 9   ? 53.185 19.575  11.107  1.00 45.68 ? 9   SER L CB  1 
ATOM   68   O OG  . SER A 1 9   ? 52.142 20.426  10.652  1.00 56.64 ? 9   SER L OG  1 
ATOM   69   N N   . SER A 1 10  ? 54.518 22.489  11.982  1.00 38.32 ? 10  SER L N   1 
ATOM   70   C CA  . SER A 1 10  ? 55.386 23.597  11.636  1.00 37.60 ? 10  SER L CA  1 
ATOM   71   C C   . SER A 1 10  ? 54.973 24.765  12.523  1.00 32.34 ? 10  SER L C   1 
ATOM   72   O O   . SER A 1 10  ? 53.830 24.842  12.967  1.00 30.83 ? 10  SER L O   1 
ATOM   73   C CB  . SER A 1 10  ? 55.230 23.960  10.148  1.00 39.50 ? 10  SER L CB  1 
ATOM   74   O OG  . SER A 1 10  ? 56.222 24.883  9.704   1.00 35.98 ? 10  SER L OG  1 
ATOM   75   N N   . LEU A 1 11  ? 55.918 25.653  12.791  1.00 26.93 ? 11  LEU L N   1 
ATOM   76   C CA  . LEU A 1 11  ? 55.685 26.817  13.617  1.00 29.47 ? 11  LEU L CA  1 
ATOM   77   C C   . LEU A 1 11  ? 56.486 27.950  13.034  1.00 27.25 ? 11  LEU L C   1 
ATOM   78   O O   . LEU A 1 11  ? 57.527 27.729  12.425  1.00 27.57 ? 11  LEU L O   1 
ATOM   79   C CB  . LEU A 1 11  ? 56.178 26.563  15.040  1.00 39.01 ? 11  LEU L CB  1 
ATOM   80   C CG  . LEU A 1 11  ? 55.248 25.867  16.028  1.00 41.01 ? 11  LEU L CG  1 
ATOM   81   C CD1 . LEU A 1 11  ? 56.037 25.458  17.266  1.00 41.47 ? 11  LEU L CD1 1 
ATOM   82   C CD2 . LEU A 1 11  ? 54.110 26.809  16.390  1.00 40.58 ? 11  LEU L CD2 1 
ATOM   83   N N   . ALA A 1 12  ? 56.009 29.166  13.227  1.00 28.56 ? 12  ALA L N   1 
ATOM   84   C CA  . ALA A 1 12  ? 56.713 30.331  12.725  1.00 36.13 ? 12  ALA L CA  1 
ATOM   85   C C   . ALA A 1 12  ? 56.561 31.415  13.772  1.00 37.17 ? 12  ALA L C   1 
ATOM   86   O O   . ALA A 1 12  ? 55.445 31.835  14.083  1.00 42.30 ? 12  ALA L O   1 
ATOM   87   C CB  . ALA A 1 12  ? 56.126 30.783  11.385  1.00 39.29 ? 12  ALA L CB  1 
ATOM   88   N N   . VAL A 1 13  ? 57.673 31.810  14.371  1.00 34.14 ? 13  VAL L N   1 
ATOM   89   C CA  . VAL A 1 13  ? 57.629 32.837  15.390  1.00 35.34 ? 13  VAL L CA  1 
ATOM   90   C C   . VAL A 1 13  ? 58.718 33.830  15.068  1.00 34.11 ? 13  VAL L C   1 
ATOM   91   O O   . VAL A 1 13  ? 59.613 33.537  14.288  1.00 34.51 ? 13  VAL L O   1 
ATOM   92   C CB  . VAL A 1 13  ? 57.808 32.250  16.837  1.00 38.78 ? 13  VAL L CB  1 
ATOM   93   C CG1 . VAL A 1 13  ? 57.070 30.917  16.961  1.00 35.67 ? 13  VAL L CG1 1 
ATOM   94   C CG2 . VAL A 1 13  ? 59.276 32.101  17.214  1.00 34.73 ? 13  VAL L CG2 1 
ATOM   95   N N   . SER A 1 14  ? 58.621 35.016  15.646  1.00 35.41 ? 14  SER L N   1 
ATOM   96   C CA  . SER A 1 14  ? 59.594 36.059  15.417  1.00 33.63 ? 14  SER L CA  1 
ATOM   97   C C   . SER A 1 14  ? 60.745 35.953  16.404  1.00 32.98 ? 14  SER L C   1 
ATOM   98   O O   . SER A 1 14  ? 60.607 35.358  17.468  1.00 35.47 ? 14  SER L O   1 
ATOM   99   C CB  . SER A 1 14  ? 58.900 37.401  15.555  1.00 36.43 ? 14  SER L CB  1 
ATOM   100  O OG  . SER A 1 14  ? 57.691 37.386  14.811  1.00 46.62 ? 14  SER L OG  1 
ATOM   101  N N   . ALA A 1 15  ? 61.891 36.503  16.030  1.00 35.27 ? 15  ALA L N   1 
ATOM   102  C CA  . ALA A 1 15  ? 63.057 36.481  16.896  1.00 39.49 ? 15  ALA L CA  1 
ATOM   103  C C   . ALA A 1 15  ? 62.756 37.263  18.181  1.00 42.56 ? 15  ALA L C   1 
ATOM   104  O O   . ALA A 1 15  ? 62.197 38.361  18.133  1.00 44.12 ? 15  ALA L O   1 
ATOM   105  C CB  . ALA A 1 15  ? 64.254 37.081  16.176  1.00 35.21 ? 15  ALA L CB  1 
ATOM   106  N N   . GLY A 1 16  ? 63.119 36.687  19.323  1.00 44.25 ? 16  GLY L N   1 
ATOM   107  C CA  . GLY A 1 16  ? 62.872 37.338  20.595  1.00 42.14 ? 16  GLY L CA  1 
ATOM   108  C C   . GLY A 1 16  ? 61.651 36.762  21.283  1.00 41.57 ? 16  GLY L C   1 
ATOM   109  O O   . GLY A 1 16  ? 61.539 36.827  22.508  1.00 46.27 ? 16  GLY L O   1 
ATOM   110  N N   . GLU A 1 17  ? 60.736 36.193  20.503  1.00 39.00 ? 17  GLU L N   1 
ATOM   111  C CA  . GLU A 1 17  ? 59.525 35.600  21.054  1.00 40.38 ? 17  GLU L CA  1 
ATOM   112  C C   . GLU A 1 17  ? 59.805 34.252  21.703  1.00 38.68 ? 17  GLU L C   1 
ATOM   113  O O   . GLU A 1 17  ? 60.925 33.738  21.652  1.00 34.74 ? 17  GLU L O   1 
ATOM   114  C CB  . GLU A 1 17  ? 58.449 35.436  19.972  1.00 48.72 ? 17  GLU L CB  1 
ATOM   115  C CG  . GLU A 1 17  ? 57.723 36.732  19.594  1.00 62.24 ? 17  GLU L CG  1 
ATOM   116  C CD  . GLU A 1 17  ? 56.637 36.534  18.533  1.00 68.79 ? 17  GLU L CD  1 
ATOM   117  O OE1 . GLU A 1 17  ? 56.615 35.467  17.878  1.00 70.16 ? 17  GLU L OE1 1 
ATOM   118  O OE2 . GLU A 1 17  ? 55.806 37.455  18.350  1.00 71.23 ? 17  GLU L OE2 1 
ATOM   119  N N   . LYS A 1 18  ? 58.776 33.695  22.329  1.00 40.90 ? 18  LYS L N   1 
ATOM   120  C CA  . LYS A 1 18  ? 58.870 32.406  22.996  1.00 44.84 ? 18  LYS L CA  1 
ATOM   121  C C   . LYS A 1 18  ? 57.926 31.485  22.236  1.00 45.37 ? 18  LYS L C   1 
ATOM   122  O O   . LYS A 1 18  ? 56.871 31.924  21.773  1.00 49.99 ? 18  LYS L O   1 
ATOM   123  C CB  . LYS A 1 18  ? 58.422 32.540  24.454  1.00 46.46 ? 18  LYS L CB  1 
ATOM   124  C CG  . LYS A 1 18  ? 58.708 31.328  25.328  1.00 48.67 ? 18  LYS L CG  1 
ATOM   125  C CD  . LYS A 1 18  ? 57.838 31.331  26.576  1.00 51.09 ? 18  LYS L CD  1 
ATOM   126  C CE  . LYS A 1 18  ? 56.342 31.415  26.218  1.00 52.05 ? 18  LYS L CE  1 
ATOM   127  N NZ  . LYS A 1 18  ? 55.888 30.403  25.213  1.00 45.35 ? 18  LYS L NZ  1 
ATOM   128  N N   . VAL A 1 19  ? 58.305 30.220  22.099  1.00 45.45 ? 19  VAL L N   1 
ATOM   129  C CA  . VAL A 1 19  ? 57.499 29.250  21.371  1.00 40.92 ? 19  VAL L CA  1 
ATOM   130  C C   . VAL A 1 19  ? 57.289 27.977  22.182  1.00 39.05 ? 19  VAL L C   1 
ATOM   131  O O   . VAL A 1 19  ? 58.152 27.570  22.962  1.00 44.10 ? 19  VAL L O   1 
ATOM   132  C CB  . VAL A 1 19  ? 58.152 28.907  20.003  1.00 40.51 ? 19  VAL L CB  1 
ATOM   133  C CG1 . VAL A 1 19  ? 59.478 28.190  20.197  1.00 36.68 ? 19  VAL L CG1 1 
ATOM   134  C CG2 . VAL A 1 19  ? 57.213 28.080  19.158  1.00 47.22 ? 19  VAL L CG2 1 
ATOM   135  N N   . THR A 1 20  ? 56.148 27.339  21.971  1.00 34.45 ? 20  THR L N   1 
ATOM   136  C CA  . THR A 1 20  ? 55.812 26.122  22.677  1.00 30.70 ? 20  THR L CA  1 
ATOM   137  C C   . THR A 1 20  ? 55.287 25.058  21.716  1.00 31.57 ? 20  THR L C   1 
ATOM   138  O O   . THR A 1 20  ? 54.340 25.302  20.971  1.00 38.35 ? 20  THR L O   1 
ATOM   139  C CB  . THR A 1 20  ? 54.748 26.431  23.723  1.00 33.68 ? 20  THR L CB  1 
ATOM   140  O OG1 . THR A 1 20  ? 55.308 27.291  24.725  1.00 35.99 ? 20  THR L OG1 1 
ATOM   141  C CG2 . THR A 1 20  ? 54.223 25.162  24.359  1.00 29.02 ? 20  THR L CG2 1 
ATOM   142  N N   . MET A 1 21  ? 55.902 23.883  21.729  1.00 31.09 ? 21  MET L N   1 
ATOM   143  C CA  . MET A 1 21  ? 55.473 22.790  20.863  1.00 33.15 ? 21  MET L CA  1 
ATOM   144  C C   . MET A 1 21  ? 55.147 21.582  21.733  1.00 33.86 ? 21  MET L C   1 
ATOM   145  O O   . MET A 1 21  ? 55.679 21.452  22.836  1.00 36.94 ? 21  MET L O   1 
ATOM   146  C CB  . MET A 1 21  ? 56.551 22.465  19.821  1.00 34.44 ? 21  MET L CB  1 
ATOM   147  C CG  . MET A 1 21  ? 57.906 22.092  20.381  1.00 29.90 ? 21  MET L CG  1 
ATOM   148  S SD  . MET A 1 21  ? 59.215 22.237  19.154  1.00 31.30 ? 21  MET L SD  1 
ATOM   149  C CE  . MET A 1 21  ? 59.314 23.997  19.008  1.00 28.42 ? 21  MET L CE  1 
ATOM   150  N N   . ASN A 1 22  ? 54.286 20.699  21.242  1.00 33.52 ? 22  ASN L N   1 
ATOM   151  C CA  . ASN A 1 22  ? 53.866 19.543  22.017  1.00 31.73 ? 22  ASN L CA  1 
ATOM   152  C C   . ASN A 1 22  ? 54.216 18.190  21.431  1.00 32.32 ? 22  ASN L C   1 
ATOM   153  O O   . ASN A 1 22  ? 54.332 18.030  20.224  1.00 34.41 ? 22  ASN L O   1 
ATOM   154  C CB  . ASN A 1 22  ? 52.354 19.589  22.236  1.00 38.15 ? 22  ASN L CB  1 
ATOM   155  C CG  . ASN A 1 22  ? 51.914 20.800  23.029  1.00 46.69 ? 22  ASN L CG  1 
ATOM   156  O OD1 . ASN A 1 22  ? 51.820 20.756  24.259  1.00 53.27 ? 22  ASN L OD1 1 
ATOM   157  N ND2 . ASN A 1 22  ? 51.630 21.890  22.328  1.00 48.69 ? 22  ASN L ND2 1 
ATOM   158  N N   . CYS A 1 23  ? 54.276 17.197  22.310  1.00 30.67 ? 23  CYS L N   1 
ATOM   159  C CA  . CYS A 1 23  ? 54.568 15.820  21.953  1.00 24.40 ? 23  CYS L CA  1 
ATOM   160  C C   . CYS A 1 23  ? 53.655 14.973  22.836  1.00 29.30 ? 23  CYS L C   1 
ATOM   161  O O   . CYS A 1 23  ? 53.582 15.200  24.043  1.00 36.67 ? 23  CYS L O   1 
ATOM   162  C CB  . CYS A 1 23  ? 56.022 15.522  22.270  1.00 20.71 ? 23  CYS L CB  1 
ATOM   163  S SG  . CYS A 1 23  ? 56.466 13.767  22.206  1.00 30.83 ? 23  CYS L SG  1 
ATOM   164  N N   . LYS A 1 24  ? 52.914 14.047  22.246  1.00 28.04 ? 24  LYS L N   1 
ATOM   165  C CA  . LYS A 1 24  ? 52.015 13.203  23.019  1.00 35.90 ? 24  LYS L CA  1 
ATOM   166  C C   . LYS A 1 24  ? 52.312 11.724  22.797  1.00 35.17 ? 24  LYS L C   1 
ATOM   167  O O   . LYS A 1 24  ? 52.373 11.257  21.664  1.00 38.49 ? 24  LYS L O   1 
ATOM   168  C CB  . LYS A 1 24  ? 50.556 13.517  22.687  1.00 36.83 ? 24  LYS L CB  1 
ATOM   169  C CG  . LYS A 1 24  ? 49.565 12.625  23.409  1.00 43.97 ? 24  LYS L CG  1 
ATOM   170  C CD  . LYS A 1 24  ? 48.156 13.172  23.311  1.00 55.66 ? 24  LYS L CD  1 
ATOM   171  C CE  . LYS A 1 24  ? 47.166 12.281  24.058  1.00 66.04 ? 24  LYS L CE  1 
ATOM   172  N NZ  . LYS A 1 24  ? 47.485 12.130  25.513  1.00 74.80 ? 24  LYS L NZ  1 
ATOM   173  N N   . SER A 1 25  ? 52.504 10.999  23.889  1.00 33.09 ? 25  SER L N   1 
ATOM   174  C CA  . SER A 1 25  ? 52.818 9.585   23.834  1.00 32.41 ? 25  SER L CA  1 
ATOM   175  C C   . SER A 1 25  ? 51.545 8.755   23.766  1.00 36.90 ? 25  SER L C   1 
ATOM   176  O O   . SER A 1 25  ? 50.502 9.161   24.286  1.00 40.39 ? 25  SER L O   1 
ATOM   177  C CB  . SER A 1 25  ? 53.643 9.199   25.061  1.00 31.18 ? 25  SER L CB  1 
ATOM   178  O OG  . SER A 1 25  ? 54.164 7.888   24.950  1.00 26.92 ? 25  SER L OG  1 
ATOM   179  N N   . SER A 1 26  ? 51.627 7.612   23.088  1.00 39.19 ? 26  SER L N   1 
ATOM   180  C CA  . SER A 1 26  ? 50.496 6.704   22.940  1.00 35.18 ? 26  SER L CA  1 
ATOM   181  C C   . SER A 1 26  ? 50.403 5.858   24.192  1.00 36.49 ? 26  SER L C   1 
ATOM   182  O O   . SER A 1 26  ? 49.378 5.240   24.461  1.00 35.51 ? 26  SER L O   1 
ATOM   183  C CB  . SER A 1 26  ? 50.711 5.792   21.741  1.00 38.30 ? 26  SER L CB  1 
ATOM   184  O OG  . SER A 1 26  ? 51.786 4.898   21.984  1.00 40.68 ? 26  SER L OG  1 
ATOM   185  N N   . GLN A 1 27  ? 51.531 5.730   24.880  1.00 35.57 ? 27  GLN L N   1 
ATOM   186  C CA  . GLN A 1 27  ? 51.587 4.981   26.121  1.00 38.45 ? 27  GLN L CA  1 
ATOM   187  C C   . GLN A 1 27  ? 52.205 5.882   27.177  1.00 37.39 ? 27  GLN L C   1 
ATOM   188  O O   . GLN A 1 27  ? 52.900 6.840   26.850  1.00 34.72 ? 27  GLN L O   1 
ATOM   189  C CB  . GLN A 1 27  ? 52.391 3.693   25.965  1.00 39.19 ? 27  GLN L CB  1 
ATOM   190  C CG  . GLN A 1 27  ? 51.670 2.630   25.147  1.00 49.42 ? 27  GLN L CG  1 
ATOM   191  C CD  . GLN A 1 27  ? 52.160 1.214   25.427  1.00 58.57 ? 27  GLN L CD  1 
ATOM   192  O OE1 . GLN A 1 27  ? 51.563 0.240   24.962  1.00 63.10 ? 27  GLN L OE1 1 
ATOM   193  N NE2 . GLN A 1 27  ? 53.240 1.089   26.197  1.00 61.04 ? 27  GLN L NE2 1 
ATOM   194  N N   . ASN A 1 28  ? 51.895 5.610   28.438  1.00 37.33 ? 28  ASN L N   1 
ATOM   195  C CA  . ASN A 1 28  ? 52.420 6.401   29.541  1.00 31.56 ? 28  ASN L CA  1 
ATOM   196  C C   . ASN A 1 28  ? 53.911 6.139   29.722  1.00 29.14 ? 28  ASN L C   1 
ATOM   197  O O   . ASN A 1 28  ? 54.340 4.993   29.853  1.00 32.32 ? 28  ASN L O   1 
ATOM   198  C CB  . ASN A 1 28  ? 51.667 6.074   30.817  1.00 31.90 ? 28  ASN L CB  1 
ATOM   199  C CG  . ASN A 1 28  ? 52.088 6.941   31.961  1.00 34.18 ? 28  ASN L CG  1 
ATOM   200  O OD1 . ASN A 1 28  ? 52.992 6.596   32.713  1.00 40.25 ? 28  ASN L OD1 1 
ATOM   201  N ND2 . ASN A 1 28  ? 51.454 8.092   32.087  1.00 35.77 ? 28  ASN L ND2 1 
ATOM   202  N N   . LEU A 1 29  ? 54.697 7.207   29.732  1.00 26.71 ? 29  LEU L N   1 
ATOM   203  C CA  . LEU A 1 29  ? 56.142 7.099   29.867  1.00 25.94 ? 29  LEU L CA  1 
ATOM   204  C C   . LEU A 1 29  ? 56.688 7.283   31.286  1.00 28.43 ? 29  LEU L C   1 
ATOM   205  O O   . LEU A 1 29  ? 57.908 7.259   31.485  1.00 34.19 ? 29  LEU L O   1 
ATOM   206  C CB  . LEU A 1 29  ? 56.810 8.102   28.932  1.00 17.69 ? 29  LEU L CB  1 
ATOM   207  C CG  . LEU A 1 29  ? 56.484 7.941   27.447  1.00 23.80 ? 29  LEU L CG  1 
ATOM   208  C CD1 . LEU A 1 29  ? 57.019 9.118   26.673  1.00 20.78 ? 29  LEU L CD1 1 
ATOM   209  C CD2 . LEU A 1 29  ? 57.068 6.645   26.937  1.00 17.16 ? 29  LEU L CD2 1 
ATOM   210  N N   . LEU A 1 30  ? 55.805 7.496   32.256  1.00 28.84 ? 30  LEU L N   1 
ATOM   211  C CA  . LEU A 1 30  ? 56.224 7.685   33.639  1.00 28.27 ? 30  LEU L CA  1 
ATOM   212  C C   . LEU A 1 30  ? 56.501 6.342   34.308  1.00 27.95 ? 30  LEU L C   1 
ATOM   213  O O   . LEU A 1 30  ? 55.625 5.482   34.392  1.00 26.01 ? 30  LEU L O   1 
ATOM   214  C CB  . LEU A 1 30  ? 55.159 8.472   34.414  1.00 30.76 ? 30  LEU L CB  1 
ATOM   215  C CG  . LEU A 1 30  ? 55.202 8.618   35.944  1.00 35.47 ? 30  LEU L CG  1 
ATOM   216  C CD1 . LEU A 1 30  ? 56.472 9.276   36.423  1.00 30.81 ? 30  LEU L CD1 1 
ATOM   217  C CD2 . LEU A 1 30  ? 54.010 9.437   36.393  1.00 39.04 ? 30  LEU L CD2 1 
ATOM   218  N N   . HIS A 1 31  ? 57.747 6.146   34.725  1.00 32.38 ? 31  HIS L N   1 
ATOM   219  C CA  . HIS A 1 31  ? 58.149 4.923   35.408  1.00 39.76 ? 31  HIS L CA  1 
ATOM   220  C C   . HIS A 1 31  ? 57.709 4.976   36.877  1.00 44.44 ? 31  HIS L C   1 
ATOM   221  O O   . HIS A 1 31  ? 58.133 5.853   37.639  1.00 44.33 ? 31  HIS L O   1 
ATOM   222  C CB  . HIS A 1 31  ? 59.661 4.752   35.337  1.00 40.48 ? 31  HIS L CB  1 
ATOM   223  C CG  . HIS A 1 31  ? 60.146 3.437   35.861  1.00 47.28 ? 31  HIS L CG  1 
ATOM   224  N ND1 . HIS A 1 31  ? 61.352 3.295   36.512  1.00 52.05 ? 31  HIS L ND1 1 
ATOM   225  C CD2 . HIS A 1 31  ? 59.600 2.200   35.807  1.00 49.20 ? 31  HIS L CD2 1 
ATOM   226  C CE1 . HIS A 1 31  ? 61.531 2.027   36.835  1.00 51.44 ? 31  HIS L CE1 1 
ATOM   227  N NE2 . HIS A 1 31  ? 60.481 1.341   36.418  1.00 52.35 ? 31  HIS L NE2 1 
ATOM   228  N N   . SER A 1 32  A 56.895 4.004   37.271  1.00 49.10 ? 31  SER L N   1 
ATOM   229  C CA  . SER A 1 32  A 56.368 3.908   38.629  1.00 49.22 ? 31  SER L CA  1 
ATOM   230  C C   . SER A 1 32  A 57.403 3.991   39.748  1.00 46.83 ? 31  SER L C   1 
ATOM   231  O O   . SER A 1 32  A 57.201 4.711   40.720  1.00 44.86 ? 31  SER L O   1 
ATOM   232  C CB  . SER A 1 32  A 55.544 2.626   38.765  1.00 52.40 ? 31  SER L CB  1 
ATOM   233  O OG  . SER A 1 32  A 56.217 1.534   38.153  1.00 60.22 ? 31  SER L OG  1 
ATOM   234  N N   . ILE A 1 33  B 58.515 3.277   39.590  1.00 46.52 ? 31  ILE L N   1 
ATOM   235  C CA  . ILE A 1 33  B 59.575 3.248   40.597  1.00 50.18 ? 31  ILE L CA  1 
ATOM   236  C C   . ILE A 1 33  B 60.404 4.530   40.732  1.00 51.21 ? 31  ILE L C   1 
ATOM   237  O O   . ILE A 1 33  B 60.394 5.169   41.785  1.00 55.87 ? 31  ILE L O   1 
ATOM   238  C CB  . ILE A 1 33  B 60.501 1.998   40.408  1.00 53.28 ? 31  ILE L CB  1 
ATOM   239  C CG1 . ILE A 1 33  B 59.879 0.772   41.089  1.00 56.08 ? 31  ILE L CG1 1 
ATOM   240  C CG2 . ILE A 1 33  B 61.896 2.234   40.989  1.00 51.63 ? 31  ILE L CG2 1 
ATOM   241  C CD1 . ILE A 1 33  B 58.526 0.366   40.545  1.00 57.62 ? 31  ILE L CD1 1 
ATOM   242  N N   . THR A 1 34  C 61.129 4.900   39.682  1.00 48.48 ? 31  THR L N   1 
ATOM   243  C CA  . THR A 1 34  C 61.963 6.098   39.727  1.00 41.85 ? 31  THR L CA  1 
ATOM   244  C C   . THR A 1 34  C 61.166 7.392   39.607  1.00 37.94 ? 31  THR L C   1 
ATOM   245  O O   . THR A 1 34  C 61.675 8.470   39.905  1.00 30.68 ? 31  THR L O   1 
ATOM   246  C CB  . THR A 1 34  C 63.047 6.066   38.627  1.00 47.69 ? 31  THR L CB  1 
ATOM   247  O OG1 . THR A 1 34  C 62.451 5.712   37.370  1.00 46.83 ? 31  THR L OG1 1 
ATOM   248  C CG2 . THR A 1 34  C 64.119 5.050   38.973  1.00 49.19 ? 31  THR L CG2 1 
ATOM   249  N N   . ARG A 1 35  D 59.914 7.280   39.171  1.00 38.37 ? 31  ARG L N   1 
ATOM   250  C CA  . ARG A 1 35  D 59.050 8.443   38.998  1.00 39.31 ? 31  ARG L CA  1 
ATOM   251  C C   . ARG A 1 35  D 59.573 9.341   37.879  1.00 36.71 ? 31  ARG L C   1 
ATOM   252  O O   . ARG A 1 35  D 59.173 10.499  37.772  1.00 39.41 ? 31  ARG L O   1 
ATOM   253  C CB  . ARG A 1 35  D 58.940 9.239   40.305  1.00 41.16 ? 31  ARG L CB  1 
ATOM   254  C CG  . ARG A 1 35  D 58.383 8.462   41.481  1.00 42.95 ? 31  ARG L CG  1 
ATOM   255  C CD  . ARG A 1 35  D 56.865 8.405   41.472  1.00 55.29 ? 31  ARG L CD  1 
ATOM   256  N NE  . ARG A 1 35  D 56.329 7.437   40.517  1.00 66.45 ? 31  ARG L NE  1 
ATOM   257  C CZ  . ARG A 1 35  D 55.030 7.261   40.286  1.00 70.71 ? 31  ARG L CZ  1 
ATOM   258  N NH1 . ARG A 1 35  D 54.130 7.933   40.992  1.00 72.68 ? 31  ARG L NH1 1 
ATOM   259  N NH2 . ARG A 1 35  D 54.625 6.390   39.369  1.00 71.72 ? 31  ARG L NH2 1 
ATOM   260  N N   . LYS A 1 36  E 60.478 8.802   37.060  1.00 36.06 ? 31  LYS L N   1 
ATOM   261  C CA  . LYS A 1 36  E 61.055 9.523   35.925  1.00 31.71 ? 31  LYS L CA  1 
ATOM   262  C C   . LYS A 1 36  E 60.228 9.304   34.669  1.00 28.57 ? 31  LYS L C   1 
ATOM   263  O O   . LYS A 1 36  E 59.699 8.212   34.451  1.00 24.82 ? 31  LYS L O   1 
ATOM   264  C CB  . LYS A 1 36  E 62.475 9.035   35.631  1.00 31.00 ? 31  LYS L CB  1 
ATOM   265  C CG  . LYS A 1 36  E 63.553 9.726   36.414  1.00 36.20 ? 31  LYS L CG  1 
ATOM   266  C CD  . LYS A 1 36  E 64.837 8.925   36.373  1.00 40.99 ? 31  LYS L CD  1 
ATOM   267  C CE  . LYS A 1 36  E 65.848 9.477   37.362  1.00 43.25 ? 31  LYS L CE  1 
ATOM   268  N NZ  . LYS A 1 36  E 67.050 8.616   37.423  1.00 48.54 ? 31  LYS L NZ  1 
ATOM   269  N N   . ASN A 1 37  F 60.126 10.348  33.853  1.00 28.05 ? 31  ASN L N   1 
ATOM   270  C CA  . ASN A 1 37  F 59.416 10.287  32.581  1.00 27.73 ? 31  ASN L CA  1 
ATOM   271  C C   . ASN A 1 37  F 60.474 10.099  31.496  1.00 28.93 ? 31  ASN L C   1 
ATOM   272  O O   . ASN A 1 37  F 61.302 10.998  31.260  1.00 27.39 ? 31  ASN L O   1 
ATOM   273  C CB  . ASN A 1 37  F 58.661 11.579  32.325  1.00 26.64 ? 31  ASN L CB  1 
ATOM   274  C CG  . ASN A 1 37  F 57.328 11.603  33.000  1.00 36.35 ? 31  ASN L CG  1 
ATOM   275  O OD1 . ASN A 1 37  F 56.492 10.729  32.772  1.00 39.05 ? 31  ASN L OD1 1 
ATOM   276  N ND2 . ASN A 1 37  F 57.103 12.613  33.825  1.00 39.30 ? 31  ASN L ND2 1 
ATOM   277  N N   . TYR A 1 38  ? 60.454 8.939   30.844  1.00 21.99 ? 32  TYR L N   1 
ATOM   278  C CA  . TYR A 1 38  ? 61.433 8.648   29.811  1.00 25.93 ? 32  TYR L CA  1 
ATOM   279  C C   . TYR A 1 38  ? 61.121 9.278   28.469  1.00 26.57 ? 32  TYR L C   1 
ATOM   280  O O   . TYR A 1 38  ? 60.709 8.601   27.533  1.00 24.60 ? 32  TYR L O   1 
ATOM   281  C CB  . TYR A 1 38  ? 61.638 7.142   29.669  1.00 25.76 ? 32  TYR L CB  1 
ATOM   282  C CG  . TYR A 1 38  ? 62.145 6.513   30.940  1.00 33.06 ? 32  TYR L CG  1 
ATOM   283  C CD1 . TYR A 1 38  ? 61.285 5.815   31.783  1.00 37.89 ? 32  TYR L CD1 1 
ATOM   284  C CD2 . TYR A 1 38  ? 63.474 6.652   31.324  1.00 33.25 ? 32  TYR L CD2 1 
ATOM   285  C CE1 . TYR A 1 38  ? 61.730 5.275   32.972  1.00 40.24 ? 32  TYR L CE1 1 
ATOM   286  C CE2 . TYR A 1 38  ? 63.932 6.117   32.517  1.00 41.85 ? 32  TYR L CE2 1 
ATOM   287  C CZ  . TYR A 1 38  ? 63.053 5.429   33.339  1.00 43.12 ? 32  TYR L CZ  1 
ATOM   288  O OH  . TYR A 1 38  ? 63.495 4.904   34.532  1.00 46.14 ? 32  TYR L OH  1 
ATOM   289  N N   . LEU A 1 39  ? 61.317 10.586  28.395  1.00 28.00 ? 33  LEU L N   1 
ATOM   290  C CA  . LEU A 1 39  ? 61.088 11.331  27.174  1.00 27.53 ? 33  LEU L CA  1 
ATOM   291  C C   . LEU A 1 39  ? 62.206 12.350  26.999  1.00 28.42 ? 33  LEU L C   1 
ATOM   292  O O   . LEU A 1 39  ? 62.543 13.086  27.934  1.00 28.09 ? 33  LEU L O   1 
ATOM   293  C CB  . LEU A 1 39  ? 59.743 12.040  27.204  1.00 22.57 ? 33  LEU L CB  1 
ATOM   294  C CG  . LEU A 1 39  ? 59.529 12.689  25.849  1.00 25.82 ? 33  LEU L CG  1 
ATOM   295  C CD1 . LEU A 1 39  ? 58.413 11.973  25.139  1.00 24.10 ? 33  LEU L CD1 1 
ATOM   296  C CD2 . LEU A 1 39  ? 59.248 14.163  26.010  1.00 26.33 ? 33  LEU L CD2 1 
ATOM   297  N N   . ALA A 1 40  ? 62.787 12.378  25.803  1.00 26.36 ? 34  ALA L N   1 
ATOM   298  C CA  . ALA A 1 40  ? 63.874 13.290  25.501  1.00 19.46 ? 34  ALA L CA  1 
ATOM   299  C C   . ALA A 1 40  ? 63.521 14.171  24.311  1.00 23.05 ? 34  ALA L C   1 
ATOM   300  O O   . ALA A 1 40  ? 62.603 13.863  23.548  1.00 22.60 ? 34  ALA L O   1 
ATOM   301  C CB  . ALA A 1 40  ? 65.133 12.508  25.230  1.00 11.87 ? 34  ALA L CB  1 
ATOM   302  N N   . TRP A 1 41  ? 64.241 15.278  24.169  1.00 19.28 ? 35  TRP L N   1 
ATOM   303  C CA  . TRP A 1 41  ? 64.017 16.215  23.080  1.00 19.11 ? 35  TRP L CA  1 
ATOM   304  C C   . TRP A 1 41  ? 65.307 16.433  22.320  1.00 19.26 ? 35  TRP L C   1 
ATOM   305  O O   . TRP A 1 41  ? 66.375 16.618  22.914  1.00 20.46 ? 35  TRP L O   1 
ATOM   306  C CB  . TRP A 1 41  ? 63.515 17.564  23.609  1.00 18.43 ? 35  TRP L CB  1 
ATOM   307  C CG  . TRP A 1 41  ? 62.102 17.545  24.074  1.00 21.73 ? 35  TRP L CG  1 
ATOM   308  C CD1 . TRP A 1 41  ? 61.658 17.287  25.340  1.00 20.01 ? 35  TRP L CD1 1 
ATOM   309  C CD2 . TRP A 1 41  ? 60.935 17.803  23.283  1.00 22.40 ? 35  TRP L CD2 1 
ATOM   310  N NE1 . TRP A 1 41  ? 60.288 17.367  25.389  1.00 20.40 ? 35  TRP L NE1 1 
ATOM   311  C CE2 . TRP A 1 41  ? 59.813 17.683  24.143  1.00 22.60 ? 35  TRP L CE2 1 
ATOM   312  C CE3 . TRP A 1 41  ? 60.726 18.124  21.930  1.00 17.78 ? 35  TRP L CE3 1 
ATOM   313  C CZ2 . TRP A 1 41  ? 58.499 17.875  23.698  1.00 18.14 ? 35  TRP L CZ2 1 
ATOM   314  C CZ3 . TRP A 1 41  ? 59.424 18.315  21.483  1.00 15.09 ? 35  TRP L CZ3 1 
ATOM   315  C CH2 . TRP A 1 41  ? 58.323 18.190  22.369  1.00 21.33 ? 35  TRP L CH2 1 
ATOM   316  N N   . TYR A 1 42  ? 65.203 16.436  21.000  1.00 19.37 ? 36  TYR L N   1 
ATOM   317  C CA  . TYR A 1 42  ? 66.359 16.645  20.140  1.00 18.94 ? 36  TYR L CA  1 
ATOM   318  C C   . TYR A 1 42  ? 65.981 17.640  19.065  1.00 17.94 ? 36  TYR L C   1 
ATOM   319  O O   . TYR A 1 42  ? 64.804 17.944  18.861  1.00 21.60 ? 36  TYR L O   1 
ATOM   320  C CB  . TYR A 1 42  ? 66.750 15.345  19.445  1.00 21.46 ? 36  TYR L CB  1 
ATOM   321  C CG  . TYR A 1 42  ? 67.195 14.233  20.355  1.00 19.42 ? 36  TYR L CG  1 
ATOM   322  C CD1 . TYR A 1 42  ? 66.274 13.451  21.028  1.00 17.04 ? 36  TYR L CD1 1 
ATOM   323  C CD2 . TYR A 1 42  ? 68.548 13.935  20.503  1.00 22.69 ? 36  TYR L CD2 1 
ATOM   324  C CE1 . TYR A 1 42  ? 66.688 12.393  21.827  1.00 23.08 ? 36  TYR L CE1 1 
ATOM   325  C CE2 . TYR A 1 42  ? 68.973 12.884  21.300  1.00 24.20 ? 36  TYR L CE2 1 
ATOM   326  C CZ  . TYR A 1 42  ? 68.038 12.118  21.958  1.00 23.88 ? 36  TYR L CZ  1 
ATOM   327  O OH  . TYR A 1 42  ? 68.451 11.076  22.753  1.00 34.17 ? 36  TYR L OH  1 
ATOM   328  N N   . ARG A 1 43  ? 66.982 18.179  18.400  1.00 16.18 ? 37  ARG L N   1 
ATOM   329  C CA  . ARG A 1 43  ? 66.718 19.087  17.308  1.00 23.08 ? 37  ARG L CA  1 
ATOM   330  C C   . ARG A 1 43  ? 67.775 18.835  16.261  1.00 23.97 ? 37  ARG L C   1 
ATOM   331  O O   . ARG A 1 43  ? 68.878 18.384  16.579  1.00 26.21 ? 37  ARG L O   1 
ATOM   332  C CB  . ARG A 1 43  ? 66.716 20.543  17.752  1.00 18.85 ? 37  ARG L CB  1 
ATOM   333  C CG  . ARG A 1 43  ? 68.072 21.154  18.008  1.00 22.25 ? 37  ARG L CG  1 
ATOM   334  C CD  . ARG A 1 43  ? 67.861 22.627  18.245  1.00 26.36 ? 37  ARG L CD  1 
ATOM   335  N NE  . ARG A 1 43  ? 69.076 23.368  18.543  1.00 30.32 ? 37  ARG L NE  1 
ATOM   336  C CZ  . ARG A 1 43  ? 69.075 24.662  18.845  1.00 35.45 ? 37  ARG L CZ  1 
ATOM   337  N NH1 . ARG A 1 43  ? 67.925 25.325  18.885  1.00 26.98 ? 37  ARG L NH1 1 
ATOM   338  N NH2 . ARG A 1 43  ? 70.215 25.299  19.085  1.00 38.62 ? 37  ARG L NH2 1 
ATOM   339  N N   . GLN A 1 44  ? 67.406 19.037  15.004  1.00 27.93 ? 38  GLN L N   1 
ATOM   340  C CA  . GLN A 1 44  ? 68.333 18.832  13.906  1.00 24.15 ? 38  GLN L CA  1 
ATOM   341  C C   . GLN A 1 44  ? 68.338 20.066  13.029  1.00 23.47 ? 38  GLN L C   1 
ATOM   342  O O   . GLN A 1 44  ? 67.306 20.449  12.481  1.00 20.73 ? 38  GLN L O   1 
ATOM   343  C CB  . GLN A 1 44  ? 67.930 17.600  13.096  1.00 18.76 ? 38  GLN L CB  1 
ATOM   344  C CG  . GLN A 1 44  ? 68.955 17.199  12.069  1.00 21.86 ? 38  GLN L CG  1 
ATOM   345  C CD  . GLN A 1 44  ? 68.645 15.875  11.425  1.00 23.48 ? 38  GLN L CD  1 
ATOM   346  O OE1 . GLN A 1 44  ? 67.485 15.497  11.272  1.00 22.71 ? 38  GLN L OE1 1 
ATOM   347  N NE2 . GLN A 1 44  ? 69.688 15.147  11.055  1.00 30.07 ? 38  GLN L NE2 1 
ATOM   348  N N   . LYS A 1 45  ? 69.477 20.745  12.989  1.00 29.52 ? 39  LYS L N   1 
ATOM   349  C CA  . LYS A 1 45  ? 69.624 21.932  12.158  1.00 38.35 ? 39  LYS L CA  1 
ATOM   350  C C   . LYS A 1 45  ? 69.844 21.498  10.704  1.00 43.06 ? 39  LYS L C   1 
ATOM   351  O O   . LYS A 1 45  ? 70.336 20.393  10.450  1.00 42.31 ? 39  LYS L O   1 
ATOM   352  C CB  . LYS A 1 45  ? 70.795 22.783  12.646  1.00 37.48 ? 39  LYS L CB  1 
ATOM   353  C CG  . LYS A 1 45  ? 70.490 23.565  13.902  1.00 45.98 ? 39  LYS L CG  1 
ATOM   354  C CD  . LYS A 1 45  ? 71.656 24.444  14.273  1.00 51.45 ? 39  LYS L CD  1 
ATOM   355  C CE  . LYS A 1 45  ? 71.358 25.232  15.531  1.00 56.65 ? 39  LYS L CE  1 
ATOM   356  N NZ  . LYS A 1 45  ? 72.475 26.158  15.884  1.00 60.86 ? 39  LYS L NZ  1 
ATOM   357  N N   . PRO A 1 46  ? 69.481 22.359  9.731   1.00 46.80 ? 40  PRO L N   1 
ATOM   358  C CA  . PRO A 1 46  ? 69.655 22.017  8.316   1.00 44.27 ? 40  PRO L CA  1 
ATOM   359  C C   . PRO A 1 46  ? 71.044 21.477  7.996   1.00 42.07 ? 40  PRO L C   1 
ATOM   360  O O   . PRO A 1 46  ? 72.062 22.146  8.214   1.00 40.09 ? 40  PRO L O   1 
ATOM   361  C CB  . PRO A 1 46  ? 69.372 23.343  7.616   1.00 46.15 ? 40  PRO L CB  1 
ATOM   362  C CG  . PRO A 1 46  ? 68.307 23.935  8.480   1.00 48.39 ? 40  PRO L CG  1 
ATOM   363  C CD  . PRO A 1 46  ? 68.875 23.698  9.865   1.00 48.36 ? 40  PRO L CD  1 
ATOM   364  N N   . GLY A 1 47  ? 71.064 20.222  7.561   1.00 38.33 ? 41  GLY L N   1 
ATOM   365  C CA  . GLY A 1 47  ? 72.307 19.572  7.201   1.00 43.42 ? 41  GLY L CA  1 
ATOM   366  C C   . GLY A 1 47  ? 73.278 19.263  8.325   1.00 46.38 ? 41  GLY L C   1 
ATOM   367  O O   . GLY A 1 47  ? 74.491 19.311  8.108   1.00 49.57 ? 41  GLY L O   1 
ATOM   368  N N   . GLN A 1 48  ? 72.762 18.935  9.510   1.00 44.48 ? 42  GLN L N   1 
ATOM   369  C CA  . GLN A 1 48  ? 73.599 18.592  10.658  1.00 39.31 ? 42  GLN L CA  1 
ATOM   370  C C   . GLN A 1 48  ? 73.009 17.380  11.371  1.00 38.52 ? 42  GLN L C   1 
ATOM   371  O O   . GLN A 1 48  ? 71.853 17.022  11.133  1.00 38.19 ? 42  GLN L O   1 
ATOM   372  C CB  . GLN A 1 48  ? 73.655 19.756  11.632  1.00 39.82 ? 42  GLN L CB  1 
ATOM   373  C CG  . GLN A 1 48  ? 74.312 20.985  11.086  1.00 50.50 ? 42  GLN L CG  1 
ATOM   374  C CD  . GLN A 1 48  ? 74.172 22.171  12.017  1.00 61.15 ? 42  GLN L CD  1 
ATOM   375  O OE1 . GLN A 1 48  ? 74.644 22.145  13.159  1.00 66.88 ? 42  GLN L OE1 1 
ATOM   376  N NE2 . GLN A 1 48  ? 73.518 23.221  11.537  1.00 68.10 ? 42  GLN L NE2 1 
ATOM   377  N N   . SER A 1 49  ? 73.805 16.729  12.218  1.00 34.62 ? 43  SER L N   1 
ATOM   378  C CA  . SER A 1 49  ? 73.332 15.573  12.983  1.00 28.21 ? 43  SER L CA  1 
ATOM   379  C C   . SER A 1 49  ? 72.398 16.078  14.086  1.00 23.59 ? 43  SER L C   1 
ATOM   380  O O   . SER A 1 49  ? 72.418 17.264  14.434  1.00 21.73 ? 43  SER L O   1 
ATOM   381  C CB  . SER A 1 49  ? 74.506 14.851  13.639  1.00 30.19 ? 43  SER L CB  1 
ATOM   382  O OG  . SER A 1 49  ? 75.667 14.917  12.834  1.00 41.75 ? 43  SER L OG  1 
ATOM   383  N N   . PRO A 1 50  ? 71.526 15.207  14.606  1.00 19.58 ? 44  PRO L N   1 
ATOM   384  C CA  . PRO A 1 50  ? 70.611 15.634  15.672  1.00 19.98 ? 44  PRO L CA  1 
ATOM   385  C C   . PRO A 1 50  ? 71.414 15.932  16.941  1.00 23.21 ? 44  PRO L C   1 
ATOM   386  O O   . PRO A 1 50  ? 72.512 15.391  17.132  1.00 23.43 ? 44  PRO L O   1 
ATOM   387  C CB  . PRO A 1 50  ? 69.723 14.403  15.874  1.00 16.67 ? 44  PRO L CB  1 
ATOM   388  C CG  . PRO A 1 50  ? 69.767 13.718  14.548  1.00 13.90 ? 44  PRO L CG  1 
ATOM   389  C CD  . PRO A 1 50  ? 71.222 13.839  14.172  1.00 14.25 ? 44  PRO L CD  1 
ATOM   390  N N   . LYS A 1 51  ? 70.898 16.822  17.782  1.00 27.46 ? 45  LYS L N   1 
ATOM   391  C CA  . LYS A 1 51  ? 71.580 17.153  19.029  1.00 30.36 ? 45  LYS L CA  1 
ATOM   392  C C   . LYS A 1 51  ? 70.605 16.983  20.184  1.00 28.36 ? 45  LYS L C   1 
ATOM   393  O O   . LYS A 1 51  ? 69.416 17.290  20.049  1.00 26.61 ? 45  LYS L O   1 
ATOM   394  C CB  . LYS A 1 51  ? 72.128 18.581  19.021  1.00 29.86 ? 45  LYS L CB  1 
ATOM   395  C CG  . LYS A 1 51  ? 73.291 18.750  20.002  1.00 42.47 ? 45  LYS L CG  1 
ATOM   396  C CD  . LYS A 1 51  ? 73.519 20.187  20.444  1.00 47.68 ? 45  LYS L CD  1 
ATOM   397  C CE  . LYS A 1 51  ? 72.441 20.655  21.415  1.00 53.45 ? 45  LYS L CE  1 
ATOM   398  N NZ  . LYS A 1 51  ? 72.640 22.072  21.853  1.00 57.16 ? 45  LYS L NZ  1 
ATOM   399  N N   . LEU A 1 52  ? 71.095 16.435  21.293  1.00 26.47 ? 46  LEU L N   1 
ATOM   400  C CA  . LEU A 1 52  ? 70.256 16.225  22.468  1.00 24.94 ? 46  LEU L CA  1 
ATOM   401  C C   . LEU A 1 52  ? 70.042 17.553  23.165  1.00 22.81 ? 46  LEU L C   1 
ATOM   402  O O   . LEU A 1 52  ? 70.983 18.322  23.355  1.00 21.34 ? 46  LEU L O   1 
ATOM   403  C CB  . LEU A 1 52  ? 70.901 15.203  23.424  1.00 24.95 ? 46  LEU L CB  1 
ATOM   404  C CG  . LEU A 1 52  ? 70.190 14.627  24.669  1.00 20.43 ? 46  LEU L CG  1 
ATOM   405  C CD1 . LEU A 1 52  ? 70.578 15.384  25.913  1.00 26.99 ? 46  LEU L CD1 1 
ATOM   406  C CD2 . LEU A 1 52  ? 68.686 14.585  24.508  1.00 17.70 ? 46  LEU L CD2 1 
ATOM   407  N N   . LEU A 1 53  ? 68.787 17.856  23.464  1.00 22.40 ? 47  LEU L N   1 
ATOM   408  C CA  . LEU A 1 53  ? 68.459 19.088  24.163  1.00 24.02 ? 47  LEU L CA  1 
ATOM   409  C C   . LEU A 1 53  ? 68.007 18.824  25.604  1.00 25.27 ? 47  LEU L C   1 
ATOM   410  O O   . LEU A 1 53  ? 68.460 19.493  26.529  1.00 24.71 ? 47  LEU L O   1 
ATOM   411  C CB  . LEU A 1 53  ? 67.350 19.856  23.433  1.00 21.38 ? 47  LEU L CB  1 
ATOM   412  C CG  . LEU A 1 53  ? 67.609 20.514  22.070  1.00 14.72 ? 47  LEU L CG  1 
ATOM   413  C CD1 . LEU A 1 53  ? 66.431 21.400  21.738  1.00 13.55 ? 47  LEU L CD1 1 
ATOM   414  C CD2 . LEU A 1 53  ? 68.860 21.350  22.091  1.00 9.94  ? 47  LEU L CD2 1 
ATOM   415  N N   . ILE A 1 54  ? 67.183 17.795  25.793  1.00 25.43 ? 48  ILE L N   1 
ATOM   416  C CA  . ILE A 1 54  ? 66.600 17.475  27.095  1.00 23.54 ? 48  ILE L CA  1 
ATOM   417  C C   . ILE A 1 54  ? 66.307 15.991  27.256  1.00 25.78 ? 48  ILE L C   1 
ATOM   418  O O   . ILE A 1 54  ? 65.969 15.329  26.284  1.00 28.13 ? 48  ILE L O   1 
ATOM   419  C CB  . ILE A 1 54  ? 65.242 18.229  27.224  1.00 21.58 ? 48  ILE L CB  1 
ATOM   420  C CG1 . ILE A 1 54  ? 65.488 19.703  27.503  1.00 17.23 ? 48  ILE L CG1 1 
ATOM   421  C CG2 . ILE A 1 54  ? 64.328 17.595  28.262  1.00 22.17 ? 48  ILE L CG2 1 
ATOM   422  C CD1 . ILE A 1 54  ? 64.243 20.506  27.474  1.00 29.58 ? 48  ILE L CD1 1 
ATOM   423  N N   . TYR A 1 55  ? 66.451 15.474  28.479  1.00 31.75 ? 49  TYR L N   1 
ATOM   424  C CA  . TYR A 1 55  ? 66.124 14.076  28.792  1.00 28.77 ? 49  TYR L CA  1 
ATOM   425  C C   . TYR A 1 55  ? 65.377 13.995  30.140  1.00 30.49 ? 49  TYR L C   1 
ATOM   426  O O   . TYR A 1 55  ? 65.370 14.964  30.917  1.00 34.44 ? 49  TYR L O   1 
ATOM   427  C CB  . TYR A 1 55  ? 67.345 13.148  28.734  1.00 23.40 ? 49  TYR L CB  1 
ATOM   428  C CG  . TYR A 1 55  ? 68.405 13.396  29.768  1.00 24.09 ? 49  TYR L CG  1 
ATOM   429  C CD1 . TYR A 1 55  ? 69.237 14.505  29.687  1.00 23.26 ? 49  TYR L CD1 1 
ATOM   430  C CD2 . TYR A 1 55  ? 68.586 12.507  30.827  1.00 25.55 ? 49  TYR L CD2 1 
ATOM   431  C CE1 . TYR A 1 55  ? 70.227 14.728  30.641  1.00 28.84 ? 49  TYR L CE1 1 
ATOM   432  C CE2 . TYR A 1 55  ? 69.571 12.716  31.783  1.00 20.52 ? 49  TYR L CE2 1 
ATOM   433  C CZ  . TYR A 1 55  ? 70.386 13.826  31.686  1.00 25.40 ? 49  TYR L CZ  1 
ATOM   434  O OH  . TYR A 1 55  ? 71.358 14.036  32.631  1.00 26.63 ? 49  TYR L OH  1 
ATOM   435  N N   . TRP A 1 56  ? 64.718 12.867  30.395  1.00 25.68 ? 50  TRP L N   1 
ATOM   436  C CA  . TRP A 1 56  ? 63.917 12.682  31.604  1.00 24.19 ? 50  TRP L CA  1 
ATOM   437  C C   . TRP A 1 56  ? 62.866 13.786  31.635  1.00 25.19 ? 50  TRP L C   1 
ATOM   438  O O   . TRP A 1 56  ? 62.486 14.275  32.694  1.00 31.39 ? 50  TRP L O   1 
ATOM   439  C CB  . TRP A 1 56  ? 64.764 12.723  32.888  1.00 23.64 ? 50  TRP L CB  1 
ATOM   440  C CG  . TRP A 1 56  ? 65.740 11.589  33.043  1.00 20.82 ? 50  TRP L CG  1 
ATOM   441  C CD1 . TRP A 1 56  ? 65.701 10.363  32.425  1.00 20.16 ? 50  TRP L CD1 1 
ATOM   442  C CD2 . TRP A 1 56  ? 66.942 11.604  33.821  1.00 22.18 ? 50  TRP L CD2 1 
ATOM   443  N NE1 . TRP A 1 56  ? 66.818 9.626   32.761  1.00 18.60 ? 50  TRP L NE1 1 
ATOM   444  C CE2 . TRP A 1 56  ? 67.594 10.363  33.616  1.00 19.11 ? 50  TRP L CE2 1 
ATOM   445  C CE3 . TRP A 1 56  ? 67.537 12.550  34.664  1.00 17.12 ? 50  TRP L CE3 1 
ATOM   446  C CZ2 . TRP A 1 56  ? 68.811 10.049  34.222  1.00 17.48 ? 50  TRP L CZ2 1 
ATOM   447  C CZ3 . TRP A 1 56  ? 68.745 12.236  35.261  1.00 22.99 ? 50  TRP L CZ3 1 
ATOM   448  C CH2 . TRP A 1 56  ? 69.372 10.993  35.036  1.00 21.22 ? 50  TRP L CH2 1 
ATOM   449  N N   . ALA A 1 57  ? 62.467 14.236  30.453  1.00 22.73 ? 51  ALA L N   1 
ATOM   450  C CA  . ALA A 1 57  ? 61.446 15.262  30.296  1.00 17.64 ? 51  ALA L CA  1 
ATOM   451  C C   . ALA A 1 57  ? 61.750 16.684  30.740  1.00 16.89 ? 51  ALA L C   1 
ATOM   452  O O   . ALA A 1 57  ? 61.062 17.600  30.303  1.00 22.02 ? 51  ALA L O   1 
ATOM   453  C CB  . ALA A 1 57  ? 60.132 14.792  30.917  1.00 12.49 ? 51  ALA L CB  1 
ATOM   454  N N   . SER A 1 58  ? 62.767 16.895  31.573  1.00 21.02 ? 52  SER L N   1 
ATOM   455  C CA  . SER A 1 58  ? 63.071 18.251  32.047  1.00 17.81 ? 52  SER L CA  1 
ATOM   456  C C   . SER A 1 58  ? 64.552 18.587  32.209  1.00 19.35 ? 52  SER L C   1 
ATOM   457  O O   . SER A 1 58  ? 64.935 19.762  32.148  1.00 25.53 ? 52  SER L O   1 
ATOM   458  C CB  . SER A 1 58  ? 62.371 18.511  33.393  1.00 27.86 ? 52  SER L CB  1 
ATOM   459  O OG  . SER A 1 58  ? 60.961 18.324  33.330  1.00 29.18 ? 52  SER L OG  1 
ATOM   460  N N   . THR A 1 59  ? 65.386 17.582  32.452  1.00 15.03 ? 53  THR L N   1 
ATOM   461  C CA  . THR A 1 59  ? 66.808 17.837  32.649  1.00 13.48 ? 53  THR L CA  1 
ATOM   462  C C   . THR A 1 59  ? 67.460 18.275  31.344  1.00 16.36 ? 53  THR L C   1 
ATOM   463  O O   . THR A 1 59  ? 67.438 17.525  30.362  1.00 18.15 ? 53  THR L O   1 
ATOM   464  C CB  . THR A 1 59  ? 67.535 16.566  33.121  1.00 13.84 ? 53  THR L CB  1 
ATOM   465  O OG1 . THR A 1 59  ? 66.833 15.995  34.227  1.00 22.28 ? 53  THR L OG1 1 
ATOM   466  C CG2 . THR A 1 59  ? 68.966 16.875  33.518  1.00 7.44  ? 53  THR L CG2 1 
ATOM   467  N N   . ARG A 1 60  ? 68.005 19.488  31.318  1.00 14.52 ? 54  ARG L N   1 
ATOM   468  C CA  . ARG A 1 60  ? 68.691 19.971  30.126  1.00 19.38 ? 54  ARG L CA  1 
ATOM   469  C C   . ARG A 1 60  ? 69.961 19.135  29.990  1.00 19.31 ? 54  ARG L C   1 
ATOM   470  O O   . ARG A 1 60  ? 70.500 18.651  30.976  1.00 18.39 ? 54  ARG L O   1 
ATOM   471  C CB  . ARG A 1 60  ? 69.064 21.454  30.258  1.00 18.42 ? 54  ARG L CB  1 
ATOM   472  C CG  . ARG A 1 60  ? 67.880 22.393  30.383  1.00 24.30 ? 54  ARG L CG  1 
ATOM   473  C CD  . ARG A 1 60  ? 68.317 23.811  30.715  1.00 28.49 ? 54  ARG L CD  1 
ATOM   474  N NE  . ARG A 1 60  ? 67.169 24.706  30.903  1.00 46.24 ? 54  ARG L NE  1 
ATOM   475  C CZ  . ARG A 1 60  ? 66.365 24.712  31.970  1.00 48.06 ? 54  ARG L CZ  1 
ATOM   476  N NH1 . ARG A 1 60  ? 66.577 23.866  32.972  1.00 48.07 ? 54  ARG L NH1 1 
ATOM   477  N NH2 . ARG A 1 60  ? 65.344 25.555  32.044  1.00 53.67 ? 54  ARG L NH2 1 
ATOM   478  N N   . GLY A 1 61  ? 70.388 18.890  28.762  1.00 21.97 ? 55  GLY L N   1 
ATOM   479  C CA  . GLY A 1 61  ? 71.600 18.130  28.563  1.00 14.74 ? 55  GLY L CA  1 
ATOM   480  C C   . GLY A 1 61  ? 72.771 19.044  28.846  1.00 16.58 ? 55  GLY L C   1 
ATOM   481  O O   . GLY A 1 61  ? 72.610 20.257  28.957  1.00 21.26 ? 55  GLY L O   1 
ATOM   482  N N   . SER A 1 62  ? 73.962 18.471  28.917  1.00 19.72 ? 56  SER L N   1 
ATOM   483  C CA  . SER A 1 62  ? 75.160 19.233  29.204  1.00 23.26 ? 56  SER L CA  1 
ATOM   484  C C   . SER A 1 62  ? 75.416 20.323  28.159  1.00 28.84 ? 56  SER L C   1 
ATOM   485  O O   . SER A 1 62  ? 75.361 20.070  26.954  1.00 35.58 ? 56  SER L O   1 
ATOM   486  C CB  . SER A 1 62  ? 76.346 18.272  29.285  1.00 21.91 ? 56  SER L CB  1 
ATOM   487  O OG  . SER A 1 62  ? 77.443 18.865  29.949  1.00 36.33 ? 56  SER L OG  1 
ATOM   488  N N   . GLY A 1 63  ? 75.652 21.543  28.625  1.00 32.46 ? 57  GLY L N   1 
ATOM   489  C CA  . GLY A 1 63  ? 75.933 22.650  27.728  1.00 29.34 ? 57  GLY L CA  1 
ATOM   490  C C   . GLY A 1 63  ? 74.714 23.324  27.124  1.00 31.19 ? 57  GLY L C   1 
ATOM   491  O O   . GLY A 1 63  ? 74.823 24.431  26.599  1.00 36.18 ? 57  GLY L O   1 
ATOM   492  N N   . VAL A 1 64  ? 73.559 22.671  27.179  1.00 27.58 ? 58  VAL L N   1 
ATOM   493  C CA  . VAL A 1 64  ? 72.337 23.239  26.623  1.00 26.27 ? 58  VAL L CA  1 
ATOM   494  C C   . VAL A 1 64  ? 71.876 24.416  27.497  1.00 33.51 ? 58  VAL L C   1 
ATOM   495  O O   . VAL A 1 64  ? 71.622 24.249  28.692  1.00 37.05 ? 58  VAL L O   1 
ATOM   496  C CB  . VAL A 1 64  ? 71.233 22.159  26.538  1.00 22.29 ? 58  VAL L CB  1 
ATOM   497  C CG1 . VAL A 1 64  ? 69.976 22.717  25.906  1.00 22.67 ? 58  VAL L CG1 1 
ATOM   498  C CG2 . VAL A 1 64  ? 71.733 20.964  25.758  1.00 21.74 ? 58  VAL L CG2 1 
ATOM   499  N N   . PRO A 1 65  ? 71.767 25.622  26.912  1.00 37.01 ? 59  PRO L N   1 
ATOM   500  C CA  . PRO A 1 65  ? 71.344 26.838  27.622  1.00 39.33 ? 59  PRO L CA  1 
ATOM   501  C C   . PRO A 1 65  ? 69.965 26.743  28.259  1.00 40.63 ? 59  PRO L C   1 
ATOM   502  O O   . PRO A 1 65  ? 69.109 25.981  27.807  1.00 46.49 ? 59  PRO L O   1 
ATOM   503  C CB  . PRO A 1 65  ? 71.393 27.908  26.531  1.00 39.01 ? 59  PRO L CB  1 
ATOM   504  C CG  . PRO A 1 65  ? 71.107 27.128  25.285  1.00 42.70 ? 59  PRO L CG  1 
ATOM   505  C CD  . PRO A 1 65  ? 71.963 25.904  25.480  1.00 41.06 ? 59  PRO L CD  1 
ATOM   506  N N   . ASP A 1 66  ? 69.730 27.591  29.255  1.00 41.38 ? 60  ASP L N   1 
ATOM   507  C CA  . ASP A 1 66  ? 68.470 27.595  29.997  1.00 41.62 ? 60  ASP L CA  1 
ATOM   508  C C   . ASP A 1 66  ? 67.237 28.057  29.236  1.00 38.63 ? 60  ASP L C   1 
ATOM   509  O O   . ASP A 1 66  ? 66.138 28.105  29.795  1.00 38.75 ? 60  ASP L O   1 
ATOM   510  C CB  . ASP A 1 66  ? 68.613 28.381  31.311  1.00 46.77 ? 60  ASP L CB  1 
ATOM   511  C CG  . ASP A 1 66  ? 68.990 29.846  31.098  1.00 54.01 ? 60  ASP L CG  1 
ATOM   512  O OD1 . ASP A 1 66  ? 69.391 30.230  29.974  1.00 58.89 ? 60  ASP L OD1 1 
ATOM   513  O OD2 . ASP A 1 66  ? 68.884 30.620  32.074  1.00 59.78 ? 60  ASP L OD2 1 
ATOM   514  N N   . ARG A 1 67  ? 67.411 28.400  27.966  1.00 33.93 ? 61  ARG L N   1 
ATOM   515  C CA  . ARG A 1 67  ? 66.286 28.849  27.162  1.00 31.25 ? 61  ARG L CA  1 
ATOM   516  C C   . ARG A 1 67  ? 65.360 27.665  26.897  1.00 30.04 ? 61  ARG L C   1 
ATOM   517  O O   . ARG A 1 67  ? 64.139 27.825  26.767  1.00 28.45 ? 61  ARG L O   1 
ATOM   518  C CB  . ARG A 1 67  ? 66.784 29.435  25.842  1.00 40.77 ? 61  ARG L CB  1 
ATOM   519  C CG  . ARG A 1 67  ? 67.762 30.584  26.014  1.00 44.09 ? 61  ARG L CG  1 
ATOM   520  C CD  . ARG A 1 67  ? 68.075 31.260  24.687  1.00 45.27 ? 61  ARG L CD  1 
ATOM   521  N NE  . ARG A 1 67  ? 68.905 30.439  23.810  1.00 44.80 ? 61  ARG L NE  1 
ATOM   522  C CZ  . ARG A 1 67  ? 68.470 29.853  22.698  1.00 46.78 ? 61  ARG L CZ  1 
ATOM   523  N NH1 . ARG A 1 67  ? 67.205 29.985  22.321  1.00 43.20 ? 61  ARG L NH1 1 
ATOM   524  N NH2 . ARG A 1 67  ? 69.315 29.164  21.943  1.00 45.07 ? 61  ARG L NH2 1 
ATOM   525  N N   . PHE A 1 68  ? 65.947 26.472  26.863  1.00 22.05 ? 62  PHE L N   1 
ATOM   526  C CA  . PHE A 1 68  ? 65.194 25.255  26.606  1.00 27.32 ? 62  PHE L CA  1 
ATOM   527  C C   . PHE A 1 68  ? 64.611 24.660  27.891  1.00 26.59 ? 62  PHE L C   1 
ATOM   528  O O   . PHE A 1 68  ? 65.341 24.234  28.782  1.00 25.98 ? 62  PHE L O   1 
ATOM   529  C CB  . PHE A 1 68  ? 66.082 24.239  25.863  1.00 28.12 ? 62  PHE L CB  1 
ATOM   530  C CG  . PHE A 1 68  ? 66.612 24.754  24.542  1.00 31.78 ? 62  PHE L CG  1 
ATOM   531  C CD1 . PHE A 1 68  ? 67.905 25.274  24.447  1.00 31.09 ? 62  PHE L CD1 1 
ATOM   532  C CD2 . PHE A 1 68  ? 65.792 24.799  23.411  1.00 29.74 ? 62  PHE L CD2 1 
ATOM   533  C CE1 . PHE A 1 68  ? 68.367 25.839  23.246  1.00 27.47 ? 62  PHE L CE1 1 
ATOM   534  C CE2 . PHE A 1 68  ? 66.250 25.361  22.210  1.00 17.41 ? 62  PHE L CE2 1 
ATOM   535  C CZ  . PHE A 1 68  ? 67.535 25.881  22.136  1.00 17.01 ? 62  PHE L CZ  1 
ATOM   536  N N   . THR A 1 69  ? 63.289 24.645  27.978  1.00 23.41 ? 63  THR L N   1 
ATOM   537  C CA  . THR A 1 69  ? 62.594 24.111  29.137  1.00 26.53 ? 63  THR L CA  1 
ATOM   538  C C   . THR A 1 69  ? 61.673 22.970  28.716  1.00 26.18 ? 63  THR L C   1 
ATOM   539  O O   . THR A 1 69  ? 60.785 23.154  27.880  1.00 32.08 ? 63  THR L O   1 
ATOM   540  C CB  . THR A 1 69  ? 61.740 25.218  29.810  1.00 29.42 ? 63  THR L CB  1 
ATOM   541  O OG1 . THR A 1 69  ? 62.591 26.292  30.231  1.00 36.48 ? 63  THR L OG1 1 
ATOM   542  C CG2 . THR A 1 69  ? 60.989 24.675  31.008  1.00 31.01 ? 63  THR L CG2 1 
ATOM   543  N N   . GLY A 1 70  ? 61.885 21.791  29.283  1.00 23.67 ? 64  GLY L N   1 
ATOM   544  C CA  . GLY A 1 70  ? 61.040 20.660  28.955  1.00 24.12 ? 64  GLY L CA  1 
ATOM   545  C C   . GLY A 1 70  ? 60.101 20.395  30.112  1.00 27.34 ? 64  GLY L C   1 
ATOM   546  O O   . GLY A 1 70  ? 60.505 20.493  31.276  1.00 28.85 ? 64  GLY L O   1 
ATOM   547  N N   . SER A 1 71  ? 58.862 20.034  29.815  1.00 26.47 ? 65  SER L N   1 
ATOM   548  C CA  . SER A 1 71  ? 57.901 19.777  30.870  1.00 26.23 ? 65  SER L CA  1 
ATOM   549  C C   . SER A 1 71  ? 56.897 18.724  30.501  1.00 26.57 ? 65  SER L C   1 
ATOM   550  O O   . SER A 1 71  ? 56.995 18.108  29.439  1.00 36.52 ? 65  SER L O   1 
ATOM   551  C CB  . SER A 1 71  ? 57.187 21.065  31.269  1.00 25.22 ? 65  SER L CB  1 
ATOM   552  O OG  . SER A 1 71  ? 56.832 21.838  30.144  1.00 41.59 ? 65  SER L OG  1 
ATOM   553  N N   . GLY A 1 72  ? 55.949 18.501  31.404  1.00 27.23 ? 66  GLY L N   1 
ATOM   554  C CA  . GLY A 1 72  ? 54.906 17.515  31.188  1.00 24.45 ? 66  GLY L CA  1 
ATOM   555  C C   . GLY A 1 72  ? 55.210 16.208  31.896  1.00 20.37 ? 66  GLY L C   1 
ATOM   556  O O   . GLY A 1 72  ? 56.323 15.998  32.376  1.00 20.95 ? 66  GLY L O   1 
ATOM   557  N N   . SER A 1 73  ? 54.240 15.308  31.915  1.00 20.34 ? 67  SER L N   1 
ATOM   558  C CA  . SER A 1 73  ? 54.418 14.030  32.566  1.00 26.40 ? 67  SER L CA  1 
ATOM   559  C C   . SER A 1 73  ? 53.342 13.081  32.070  1.00 28.66 ? 67  SER L C   1 
ATOM   560  O O   . SER A 1 73  ? 52.280 13.518  31.621  1.00 28.77 ? 67  SER L O   1 
ATOM   561  C CB  . SER A 1 73  ? 54.278 14.216  34.075  1.00 34.07 ? 67  SER L CB  1 
ATOM   562  O OG  . SER A 1 73  ? 54.517 13.008  34.770  1.00 47.78 ? 67  SER L OG  1 
ATOM   563  N N   . GLY A 1 74  ? 53.626 11.787  32.130  1.00 26.18 ? 68  GLY L N   1 
ATOM   564  C CA  . GLY A 1 74  ? 52.652 10.800  31.709  1.00 31.34 ? 68  GLY L CA  1 
ATOM   565  C C   . GLY A 1 74  ? 52.597 10.489  30.225  1.00 38.06 ? 68  GLY L C   1 
ATOM   566  O O   . GLY A 1 74  ? 53.231 9.535   29.761  1.00 36.44 ? 68  GLY L O   1 
ATOM   567  N N   . THR A 1 75  ? 51.779 11.243  29.497  1.00 39.67 ? 69  THR L N   1 
ATOM   568  C CA  . THR A 1 75  ? 51.615 11.056  28.056  1.00 38.70 ? 69  THR L CA  1 
ATOM   569  C C   . THR A 1 75  ? 51.684 12.388  27.325  1.00 38.36 ? 69  THR L C   1 
ATOM   570  O O   . THR A 1 75  ? 51.694 12.430  26.094  1.00 43.67 ? 69  THR L O   1 
ATOM   571  C CB  . THR A 1 75  ? 50.245 10.422  27.713  1.00 38.36 ? 69  THR L CB  1 
ATOM   572  O OG1 . THR A 1 75  ? 49.194 11.244  28.244  1.00 39.39 ? 69  THR L OG1 1 
ATOM   573  C CG2 . THR A 1 75  ? 50.139 8.998   28.269  1.00 25.62 ? 69  THR L CG2 1 
ATOM   574  N N   . ASP A 1 76  ? 51.718 13.477  28.079  1.00 33.30 ? 70  ASP L N   1 
ATOM   575  C CA  . ASP A 1 76  ? 51.760 14.795  27.479  1.00 32.27 ? 70  ASP L CA  1 
ATOM   576  C C   . ASP A 1 76  ? 52.993 15.549  27.922  1.00 29.68 ? 70  ASP L C   1 
ATOM   577  O O   . ASP A 1 76  ? 53.257 15.668  29.126  1.00 33.45 ? 70  ASP L O   1 
ATOM   578  C CB  . ASP A 1 76  ? 50.500 15.564  27.856  1.00 37.69 ? 70  ASP L CB  1 
ATOM   579  C CG  . ASP A 1 76  ? 49.237 14.802  27.515  1.00 44.80 ? 70  ASP L CG  1 
ATOM   580  O OD1 . ASP A 1 76  ? 48.363 14.652  28.393  1.00 51.96 ? 70  ASP L OD1 1 
ATOM   581  O OD2 . ASP A 1 76  ? 49.125 14.332  26.368  1.00 54.06 ? 70  ASP L OD2 1 
ATOM   582  N N   . PHE A 1 77  ? 53.779 16.004  26.948  1.00 23.18 ? 71  PHE L N   1 
ATOM   583  C CA  . PHE A 1 77  ? 54.999 16.760  27.220  1.00 20.92 ? 71  PHE L CA  1 
ATOM   584  C C   . PHE A 1 77  ? 55.097 17.993  26.333  1.00 22.70 ? 71  PHE L C   1 
ATOM   585  O O   . PHE A 1 77  ? 54.425 18.097  25.301  1.00 23.23 ? 71  PHE L O   1 
ATOM   586  C CB  . PHE A 1 77  ? 56.237 15.893  27.054  1.00 18.57 ? 71  PHE L CB  1 
ATOM   587  C CG  . PHE A 1 77  ? 56.163 14.602  27.794  1.00 22.26 ? 71  PHE L CG  1 
ATOM   588  C CD1 . PHE A 1 77  ? 55.542 13.500  27.226  1.00 16.60 ? 71  PHE L CD1 1 
ATOM   589  C CD2 . PHE A 1 77  ? 56.722 14.477  29.058  1.00 22.69 ? 71  PHE L CD2 1 
ATOM   590  C CE1 . PHE A 1 77  ? 55.479 12.288  27.905  1.00 22.41 ? 71  PHE L CE1 1 
ATOM   591  C CE2 . PHE A 1 77  ? 56.661 13.266  29.742  1.00 20.59 ? 71  PHE L CE2 1 
ATOM   592  C CZ  . PHE A 1 77  ? 56.039 12.172  29.162  1.00 18.91 ? 71  PHE L CZ  1 
ATOM   593  N N   . THR A 1 78  ? 55.978 18.905  26.713  1.00 24.32 ? 72  THR L N   1 
ATOM   594  C CA  . THR A 1 78  ? 56.124 20.144  25.988  1.00 23.75 ? 72  THR L CA  1 
ATOM   595  C C   . THR A 1 78  ? 57.564 20.653  26.024  1.00 26.89 ? 72  THR L C   1 
ATOM   596  O O   . THR A 1 78  ? 58.337 20.308  26.923  1.00 28.73 ? 72  THR L O   1 
ATOM   597  C CB  . THR A 1 78  ? 55.197 21.212  26.614  1.00 23.97 ? 72  THR L CB  1 
ATOM   598  O OG1 . THR A 1 78  ? 53.849 20.728  26.645  1.00 29.50 ? 72  THR L OG1 1 
ATOM   599  C CG2 . THR A 1 78  ? 55.222 22.484  25.821  1.00 32.73 ? 72  THR L CG2 1 
ATOM   600  N N   . LEU A 1 79  ? 57.948 21.372  24.974  1.00 23.96 ? 73  LEU L N   1 
ATOM   601  C CA  . LEU A 1 79  ? 59.261 21.982  24.903  1.00 24.06 ? 73  LEU L CA  1 
ATOM   602  C C   . LEU A 1 79  ? 58.926 23.436  24.676  1.00 26.11 ? 73  LEU L C   1 
ATOM   603  O O   . LEU A 1 79  ? 58.072 23.758  23.847  1.00 26.23 ? 73  LEU L O   1 
ATOM   604  C CB  . LEU A 1 79  ? 60.108 21.461  23.742  1.00 13.16 ? 73  LEU L CB  1 
ATOM   605  C CG  . LEU A 1 79  ? 61.468 22.175  23.613  1.00 15.65 ? 73  LEU L CG  1 
ATOM   606  C CD1 . LEU A 1 79  ? 62.375 21.780  24.749  1.00 16.29 ? 73  LEU L CD1 1 
ATOM   607  C CD2 . LEU A 1 79  ? 62.149 21.830  22.304  1.00 19.47 ? 73  LEU L CD2 1 
ATOM   608  N N   . THR A 1 80  ? 59.541 24.296  25.479  1.00 30.48 ? 74  THR L N   1 
ATOM   609  C CA  . THR A 1 80  ? 59.332 25.731  25.410  1.00 25.64 ? 74  THR L CA  1 
ATOM   610  C C   . THR A 1 80  ? 60.672 26.390  25.139  1.00 25.16 ? 74  THR L C   1 
ATOM   611  O O   . THR A 1 80  ? 61.666 26.063  25.788  1.00 28.41 ? 74  THR L O   1 
ATOM   612  C CB  . THR A 1 80  ? 58.765 26.267  26.757  1.00 24.28 ? 74  THR L CB  1 
ATOM   613  O OG1 . THR A 1 80  ? 57.488 25.662  27.019  1.00 27.57 ? 74  THR L OG1 1 
ATOM   614  C CG2 . THR A 1 80  ? 58.607 27.779  26.729  1.00 23.25 ? 74  THR L CG2 1 
ATOM   615  N N   . ILE A 1 81  ? 60.716 27.270  24.144  1.00 24.58 ? 75  ILE L N   1 
ATOM   616  C CA  . ILE A 1 81  ? 61.944 27.981  23.838  1.00 24.67 ? 75  ILE L CA  1 
ATOM   617  C C   . ILE A 1 81  ? 61.648 29.456  24.027  1.00 28.02 ? 75  ILE L C   1 
ATOM   618  O O   . ILE A 1 81  ? 60.615 29.950  23.576  1.00 23.98 ? 75  ILE L O   1 
ATOM   619  C CB  . ILE A 1 81  ? 62.442 27.705  22.414  1.00 28.43 ? 75  ILE L CB  1 
ATOM   620  C CG1 . ILE A 1 81  ? 62.420 26.197  22.148  1.00 24.68 ? 75  ILE L CG1 1 
ATOM   621  C CG2 . ILE A 1 81  ? 63.882 28.214  22.255  1.00 23.81 ? 75  ILE L CG2 1 
ATOM   622  C CD1 . ILE A 1 81  ? 62.853 25.813  20.759  1.00 37.95 ? 75  ILE L CD1 1 
ATOM   623  N N   . SER A 1 82  ? 62.516 30.131  24.771  1.00 30.52 ? 76  SER L N   1 
ATOM   624  C CA  . SER A 1 82  ? 62.361 31.548  25.055  1.00 34.78 ? 76  SER L CA  1 
ATOM   625  C C   . SER A 1 82  ? 63.504 32.273  24.379  1.00 34.18 ? 76  SER L C   1 
ATOM   626  O O   . SER A 1 82  ? 64.613 31.741  24.297  1.00 29.99 ? 76  SER L O   1 
ATOM   627  C CB  . SER A 1 82  ? 62.412 31.780  26.564  1.00 43.57 ? 76  SER L CB  1 
ATOM   628  O OG  . SER A 1 82  ? 61.444 30.974  27.222  1.00 56.15 ? 76  SER L OG  1 
ATOM   629  N N   . SER A 1 83  ? 63.235 33.484  23.901  1.00 33.74 ? 77  SER L N   1 
ATOM   630  C CA  . SER A 1 83  ? 64.248 34.257  23.202  1.00 37.49 ? 77  SER L CA  1 
ATOM   631  C C   . SER A 1 83  ? 64.656 33.477  21.935  1.00 37.96 ? 77  SER L C   1 
ATOM   632  O O   . SER A 1 83  ? 65.854 33.266  21.677  1.00 38.67 ? 77  SER L O   1 
ATOM   633  C CB  . SER A 1 83  ? 65.459 34.474  24.116  1.00 35.94 ? 77  SER L CB  1 
ATOM   634  O OG  . SER A 1 83  ? 66.432 35.294  23.498  1.00 43.84 ? 77  SER L OG  1 
ATOM   635  N N   . VAL A 1 84  ? 63.656 33.025  21.174  1.00 32.71 ? 78  VAL L N   1 
ATOM   636  C CA  . VAL A 1 84  ? 63.897 32.271  19.943  1.00 31.87 ? 78  VAL L CA  1 
ATOM   637  C C   . VAL A 1 84  ? 64.739 33.113  18.992  1.00 34.56 ? 78  VAL L C   1 
ATOM   638  O O   . VAL A 1 84  ? 64.335 34.204  18.591  1.00 34.83 ? 78  VAL L O   1 
ATOM   639  C CB  . VAL A 1 84  ? 62.588 31.912  19.212  1.00 31.70 ? 78  VAL L CB  1 
ATOM   640  C CG1 . VAL A 1 84  ? 62.904 31.141  17.949  1.00 32.31 ? 78  VAL L CG1 1 
ATOM   641  C CG2 . VAL A 1 84  ? 61.663 31.106  20.107  1.00 28.65 ? 78  VAL L CG2 1 
ATOM   642  N N   . GLN A 1 85  ? 65.920 32.620  18.654  1.00 33.19 ? 79  GLN L N   1 
ATOM   643  C CA  . GLN A 1 85  ? 66.798 33.348  17.758  1.00 37.67 ? 79  GLN L CA  1 
ATOM   644  C C   . GLN A 1 85  ? 66.975 32.647  16.413  1.00 36.24 ? 79  GLN L C   1 
ATOM   645  O O   . GLN A 1 85  ? 66.604 31.487  16.247  1.00 32.17 ? 79  GLN L O   1 
ATOM   646  C CB  . GLN A 1 85  ? 68.147 33.625  18.437  1.00 41.84 ? 79  GLN L CB  1 
ATOM   647  C CG  . GLN A 1 85  ? 68.756 32.434  19.164  1.00 55.61 ? 79  GLN L CG  1 
ATOM   648  C CD  . GLN A 1 85  ? 69.972 32.814  19.995  1.00 62.50 ? 79  GLN L CD  1 
ATOM   649  O OE1 . GLN A 1 85  ? 71.089 32.363  19.729  1.00 65.52 ? 79  GLN L OE1 1 
ATOM   650  N NE2 . GLN A 1 85  ? 69.758 33.635  21.015  1.00 63.44 ? 79  GLN L NE2 1 
ATOM   651  N N   . ALA A 1 86  ? 67.554 33.368  15.462  1.00 38.96 ? 80  ALA L N   1 
ATOM   652  C CA  . ALA A 1 86  ? 67.790 32.873  14.112  1.00 38.06 ? 80  ALA L CA  1 
ATOM   653  C C   . ALA A 1 86  ? 68.440 31.500  14.100  1.00 39.23 ? 80  ALA L C   1 
ATOM   654  O O   . ALA A 1 86  ? 68.091 30.638  13.297  1.00 39.65 ? 80  ALA L O   1 
ATOM   655  C CB  . ALA A 1 86  ? 68.659 33.864  13.352  1.00 37.79 ? 80  ALA L CB  1 
ATOM   656  N N   . GLU A 1 87  ? 69.334 31.279  15.051  1.00 39.40 ? 81  GLU L N   1 
ATOM   657  C CA  . GLU A 1 87  ? 70.062 30.026  15.145  1.00 35.94 ? 81  GLU L CA  1 
ATOM   658  C C   . GLU A 1 87  ? 69.222 28.844  15.608  1.00 32.13 ? 81  GLU L C   1 
ATOM   659  O O   . GLU A 1 87  ? 69.718 27.729  15.642  1.00 30.28 ? 81  GLU L O   1 
ATOM   660  C CB  . GLU A 1 87  ? 71.267 30.192  16.080  1.00 44.88 ? 81  GLU L CB  1 
ATOM   661  C CG  . GLU A 1 87  ? 72.359 31.160  15.589  1.00 58.53 ? 81  GLU L CG  1 
ATOM   662  C CD  . GLU A 1 87  ? 71.869 32.593  15.363  1.00 65.19 ? 81  GLU L CD  1 
ATOM   663  O OE1 . GLU A 1 87  ? 72.199 33.164  14.301  1.00 70.49 ? 81  GLU L OE1 1 
ATOM   664  O OE2 . GLU A 1 87  ? 71.164 33.152  16.235  1.00 66.75 ? 81  GLU L OE2 1 
ATOM   665  N N   . ASP A 1 88  ? 67.960 29.068  15.957  1.00 27.33 ? 82  ASP L N   1 
ATOM   666  C CA  . ASP A 1 88  ? 67.123 27.974  16.438  1.00 28.98 ? 82  ASP L CA  1 
ATOM   667  C C   . ASP A 1 88  ? 66.284 27.259  15.400  1.00 32.93 ? 82  ASP L C   1 
ATOM   668  O O   . ASP A 1 88  ? 65.621 26.270  15.722  1.00 32.09 ? 82  ASP L O   1 
ATOM   669  C CB  . ASP A 1 88  ? 66.213 28.433  17.580  1.00 29.51 ? 82  ASP L CB  1 
ATOM   670  C CG  . ASP A 1 88  ? 66.986 28.847  18.808  1.00 24.26 ? 82  ASP L CG  1 
ATOM   671  O OD1 . ASP A 1 88  ? 66.552 29.801  19.476  1.00 25.20 ? 82  ASP L OD1 1 
ATOM   672  O OD2 . ASP A 1 88  ? 68.037 28.236  19.091  1.00 28.37 ? 82  ASP L OD2 1 
ATOM   673  N N   . LEU A 1 89  ? 66.277 27.758  14.168  1.00 35.37 ? 83  LEU L N   1 
ATOM   674  C CA  . LEU A 1 89  ? 65.483 27.109  13.133  1.00 31.87 ? 83  LEU L CA  1 
ATOM   675  C C   . LEU A 1 89  ? 66.028 25.712  12.882  1.00 28.22 ? 83  LEU L C   1 
ATOM   676  O O   . LEU A 1 89  ? 67.231 25.517  12.650  1.00 21.47 ? 83  LEU L O   1 
ATOM   677  C CB  . LEU A 1 89  ? 65.403 27.960  11.854  1.00 37.71 ? 83  LEU L CB  1 
ATOM   678  C CG  . LEU A 1 89  ? 66.628 28.576  11.177  1.00 36.66 ? 83  LEU L CG  1 
ATOM   679  C CD1 . LEU A 1 89  ? 67.073 27.688  10.015  1.00 40.66 ? 83  LEU L CD1 1 
ATOM   680  C CD2 . LEU A 1 89  ? 66.263 29.981  10.669  1.00 33.16 ? 83  LEU L CD2 1 
ATOM   681  N N   . ALA A 1 90  ? 65.136 24.740  13.021  1.00 24.09 ? 84  ALA L N   1 
ATOM   682  C CA  . ALA A 1 90  ? 65.475 23.341  12.854  1.00 23.04 ? 84  ALA L CA  1 
ATOM   683  C C   . ALA A 1 90  ? 64.209 22.534  13.066  1.00 21.03 ? 84  ALA L C   1 
ATOM   684  O O   . ALA A 1 90  ? 63.106 23.074  13.090  1.00 23.13 ? 84  ALA L O   1 
ATOM   685  C CB  . ALA A 1 90  ? 66.523 22.939  13.885  1.00 27.16 ? 84  ALA L CB  1 
ATOM   686  N N   . VAL A 1 91  ? 64.366 21.227  13.150  1.00 24.61 ? 85  VAL L N   1 
ATOM   687  C CA  . VAL A 1 91  ? 63.242 20.340  13.389  1.00 22.27 ? 85  VAL L CA  1 
ATOM   688  C C   . VAL A 1 91  ? 63.469 19.774  14.800  1.00 24.23 ? 85  VAL L C   1 
ATOM   689  O O   . VAL A 1 91  ? 64.597 19.395  15.166  1.00 15.44 ? 85  VAL L O   1 
ATOM   690  C CB  . VAL A 1 91  ? 63.197 19.209  12.339  1.00 22.15 ? 85  VAL L CB  1 
ATOM   691  C CG1 . VAL A 1 91  ? 62.021 18.278  12.596  1.00 20.21 ? 85  VAL L CG1 1 
ATOM   692  C CG2 . VAL A 1 91  ? 63.081 19.805  10.955  1.00 24.09 ? 85  VAL L CG2 1 
ATOM   693  N N   . TYR A 1 92  ? 62.417 19.785  15.608  1.00 21.94 ? 86  TYR L N   1 
ATOM   694  C CA  . TYR A 1 92  ? 62.501 19.296  16.978  1.00 20.86 ? 86  TYR L CA  1 
ATOM   695  C C   . TYR A 1 92  ? 61.791 17.964  17.130  1.00 18.11 ? 86  TYR L C   1 
ATOM   696  O O   . TYR A 1 92  ? 60.612 17.853  16.808  1.00 18.90 ? 86  TYR L O   1 
ATOM   697  C CB  . TYR A 1 92  ? 61.918 20.344  17.927  1.00 14.87 ? 86  TYR L CB  1 
ATOM   698  C CG  . TYR A 1 92  ? 62.739 21.607  17.961  1.00 20.39 ? 86  TYR L CG  1 
ATOM   699  C CD1 . TYR A 1 92  ? 63.602 21.866  19.024  1.00 14.61 ? 86  TYR L CD1 1 
ATOM   700  C CD2 . TYR A 1 92  ? 62.695 22.523  16.908  1.00 20.44 ? 86  TYR L CD2 1 
ATOM   701  C CE1 . TYR A 1 92  ? 64.398 22.993  19.042  1.00 17.47 ? 86  TYR L CE1 1 
ATOM   702  C CE2 . TYR A 1 92  ? 63.498 23.659  16.915  1.00 21.97 ? 86  TYR L CE2 1 
ATOM   703  C CZ  . TYR A 1 92  ? 64.347 23.884  17.989  1.00 20.66 ? 86  TYR L CZ  1 
ATOM   704  O OH  . TYR A 1 92  ? 65.156 24.988  18.012  1.00 20.99 ? 86  TYR L OH  1 
ATOM   705  N N   . TYR A 1 93  ? 62.513 16.944  17.578  1.00 16.90 ? 87  TYR L N   1 
ATOM   706  C CA  . TYR A 1 93  ? 61.916 15.624  17.752  1.00 23.88 ? 87  TYR L CA  1 
ATOM   707  C C   . TYR A 1 93  ? 61.895 15.232  19.217  1.00 29.06 ? 87  TYR L C   1 
ATOM   708  O O   . TYR A 1 93  ? 62.825 15.543  19.960  1.00 32.84 ? 87  TYR L O   1 
ATOM   709  C CB  . TYR A 1 93  ? 62.723 14.537  17.019  1.00 31.14 ? 87  TYR L CB  1 
ATOM   710  C CG  . TYR A 1 93  ? 62.952 14.747  15.533  1.00 33.33 ? 87  TYR L CG  1 
ATOM   711  C CD1 . TYR A 1 93  ? 62.045 14.263  14.585  1.00 30.60 ? 87  TYR L CD1 1 
ATOM   712  C CD2 . TYR A 1 93  ? 64.092 15.414  15.078  1.00 31.44 ? 87  TYR L CD2 1 
ATOM   713  C CE1 . TYR A 1 93  ? 62.274 14.440  13.220  1.00 33.45 ? 87  TYR L CE1 1 
ATOM   714  C CE2 . TYR A 1 93  ? 64.326 15.596  13.724  1.00 30.45 ? 87  TYR L CE2 1 
ATOM   715  C CZ  . TYR A 1 93  ? 63.417 15.109  12.803  1.00 31.43 ? 87  TYR L CZ  1 
ATOM   716  O OH  . TYR A 1 93  ? 63.665 15.309  11.470  1.00 42.08 ? 87  TYR L OH  1 
ATOM   717  N N   . CYS A 1 94  ? 60.814 14.601  19.647  1.00 25.82 ? 88  CYS L N   1 
ATOM   718  C CA  . CYS A 1 94  ? 60.748 14.105  21.004  1.00 26.05 ? 88  CYS L CA  1 
ATOM   719  C C   . CYS A 1 94  ? 60.955 12.617  20.780  1.00 26.89 ? 88  CYS L C   1 
ATOM   720  O O   . CYS A 1 94  ? 60.570 12.085  19.734  1.00 29.65 ? 88  CYS L O   1 
ATOM   721  C CB  . CYS A 1 94  ? 59.397 14.396  21.663  1.00 26.78 ? 88  CYS L CB  1 
ATOM   722  S SG  . CYS A 1 94  ? 57.944 13.719  20.818  1.00 29.99 ? 88  CYS L SG  1 
ATOM   723  N N   . LYS A 1 95  ? 61.641 11.966  21.705  1.00 24.57 ? 89  LYS L N   1 
ATOM   724  C CA  . LYS A 1 95  ? 61.914 10.547  21.588  1.00 24.77 ? 89  LYS L CA  1 
ATOM   725  C C   . LYS A 1 95  ? 61.552 9.898   22.912  1.00 27.58 ? 89  LYS L C   1 
ATOM   726  O O   . LYS A 1 95  ? 61.623 10.551  23.950  1.00 34.25 ? 89  LYS L O   1 
ATOM   727  C CB  . LYS A 1 95  ? 63.403 10.344  21.308  1.00 17.38 ? 89  LYS L CB  1 
ATOM   728  C CG  . LYS A 1 95  ? 63.837 8.891   21.222  1.00 16.79 ? 89  LYS L CG  1 
ATOM   729  C CD  . LYS A 1 95  ? 65.325 8.745   21.501  1.00 8.42  ? 89  LYS L CD  1 
ATOM   730  C CE  . LYS A 1 95  ? 65.632 9.148   22.946  1.00 21.07 ? 89  LYS L CE  1 
ATOM   731  N NZ  . LYS A 1 95  ? 67.043 8.917   23.366  1.00 13.56 ? 89  LYS L NZ  1 
ATOM   732  N N   . GLN A 1 96  ? 61.163 8.628   22.882  1.00 27.48 ? 90  GLN L N   1 
ATOM   733  C CA  . GLN A 1 96  ? 60.825 7.914   24.103  1.00 26.57 ? 90  GLN L CA  1 
ATOM   734  C C   . GLN A 1 96  ? 61.833 6.792   24.341  1.00 28.57 ? 90  GLN L C   1 
ATOM   735  O O   . GLN A 1 96  ? 62.344 6.196   23.389  1.00 27.68 ? 90  GLN L O   1 
ATOM   736  C CB  . GLN A 1 96  ? 59.384 7.383   24.052  1.00 24.11 ? 90  GLN L CB  1 
ATOM   737  C CG  . GLN A 1 96  ? 59.122 6.227   23.118  1.00 28.18 ? 90  GLN L CG  1 
ATOM   738  C CD  . GLN A 1 96  ? 59.430 4.880   23.734  1.00 25.52 ? 90  GLN L CD  1 
ATOM   739  O OE1 . GLN A 1 96  ? 59.666 4.770   24.931  1.00 34.84 ? 90  GLN L OE1 1 
ATOM   740  N NE2 . GLN A 1 96  ? 59.412 3.842   22.918  1.00 30.07 ? 90  GLN L NE2 1 
ATOM   741  N N   . SER A 1 97  ? 62.143 6.531   25.607  1.00 26.79 ? 91  SER L N   1 
ATOM   742  C CA  . SER A 1 97  ? 63.096 5.481   25.952  1.00 26.04 ? 91  SER L CA  1 
ATOM   743  C C   . SER A 1 97  ? 62.480 4.444   26.896  1.00 29.99 ? 91  SER L C   1 
ATOM   744  O O   . SER A 1 97  ? 63.184 3.557   27.393  1.00 32.33 ? 91  SER L O   1 
ATOM   745  C CB  . SER A 1 97  ? 64.331 6.089   26.623  1.00 24.60 ? 91  SER L CB  1 
ATOM   746  O OG  . SER A 1 97  ? 64.496 7.462   26.298  1.00 31.02 ? 91  SER L OG  1 
ATOM   747  N N   . TYR A 1 98  ? 61.173 4.541   27.134  1.00 30.78 ? 92  TYR L N   1 
ATOM   748  C CA  . TYR A 1 98  ? 60.509 3.617   28.039  1.00 31.74 ? 92  TYR L CA  1 
ATOM   749  C C   . TYR A 1 98  ? 60.655 2.160   27.624  1.00 33.68 ? 92  TYR L C   1 
ATOM   750  O O   . TYR A 1 98  ? 60.779 1.278   28.472  1.00 36.26 ? 92  TYR L O   1 
ATOM   751  C CB  . TYR A 1 98  ? 59.032 3.966   28.239  1.00 34.47 ? 92  TYR L CB  1 
ATOM   752  C CG  . TYR A 1 98  ? 58.512 3.359   29.523  1.00 41.69 ? 92  TYR L CG  1 
ATOM   753  C CD1 . TYR A 1 98  ? 57.896 2.110   29.532  1.00 40.92 ? 92  TYR L CD1 1 
ATOM   754  C CD2 . TYR A 1 98  ? 58.745 3.984   30.750  1.00 43.33 ? 92  TYR L CD2 1 
ATOM   755  C CE1 . TYR A 1 98  ? 57.538 1.496   30.728  1.00 50.17 ? 92  TYR L CE1 1 
ATOM   756  C CE2 . TYR A 1 98  ? 58.392 3.380   31.948  1.00 47.89 ? 92  TYR L CE2 1 
ATOM   757  C CZ  . TYR A 1 98  ? 57.792 2.134   31.932  1.00 51.48 ? 92  TYR L CZ  1 
ATOM   758  O OH  . TYR A 1 98  ? 57.466 1.520   33.124  1.00 57.83 ? 92  TYR L OH  1 
ATOM   759  N N   . ASN A 1 99  ? 60.558 1.899   26.328  1.00 31.80 ? 93  ASN L N   1 
ATOM   760  C CA  . ASN A 1 99  ? 60.721 0.548   25.803  1.00 32.29 ? 93  ASN L CA  1 
ATOM   761  C C   . ASN A 1 99  ? 61.263 0.717   24.400  1.00 29.02 ? 93  ASN L C   1 
ATOM   762  O O   . ASN A 1 99  ? 60.576 1.249   23.535  1.00 26.92 ? 93  ASN L O   1 
ATOM   763  C CB  . ASN A 1 99  ? 59.401 -0.211  25.773  1.00 31.67 ? 93  ASN L CB  1 
ATOM   764  C CG  . ASN A 1 99  ? 59.585 -1.658  25.353  1.00 36.38 ? 93  ASN L CG  1 
ATOM   765  O OD1 . ASN A 1 99  ? 58.740 -2.225  24.673  1.00 40.32 ? 93  ASN L OD1 1 
ATOM   766  N ND2 . ASN A 1 99  ? 60.698 -2.262  25.759  1.00 35.31 ? 93  ASN L ND2 1 
ATOM   767  N N   . LEU A 1 100 ? 62.507 0.300   24.191  1.00 29.04 ? 94  LEU L N   1 
ATOM   768  C CA  . LEU A 1 100 ? 63.170 0.467   22.899  1.00 32.44 ? 94  LEU L CA  1 
ATOM   769  C C   . LEU A 1 100 ? 63.159 1.981   22.662  1.00 31.97 ? 94  LEU L C   1 
ATOM   770  O O   . LEU A 1 100 ? 63.073 2.742   23.631  1.00 30.29 ? 94  LEU L O   1 
ATOM   771  C CB  . LEU A 1 100 ? 62.427 -0.286  21.786  1.00 33.19 ? 94  LEU L CB  1 
ATOM   772  C CG  . LEU A 1 100 ? 62.371 -1.814  21.916  1.00 34.62 ? 94  LEU L CG  1 
ATOM   773  C CD1 . LEU A 1 100 ? 61.822 -2.415  20.632  1.00 30.62 ? 94  LEU L CD1 1 
ATOM   774  C CD2 . LEU A 1 100 ? 63.758 -2.377  22.204  1.00 31.64 ? 94  LEU L CD2 1 
ATOM   775  N N   . TYR A 1 101 ? 63.305 2.432   21.421  1.00 23.19 ? 95  TYR L N   1 
ATOM   776  C CA  . TYR A 1 101 ? 63.260 3.867   21.159  1.00 25.21 ? 95  TYR L CA  1 
ATOM   777  C C   . TYR A 1 101 ? 62.196 4.184   20.118  1.00 26.36 ? 95  TYR L C   1 
ATOM   778  O O   . TYR A 1 101 ? 61.837 3.336   19.303  1.00 31.82 ? 95  TYR L O   1 
ATOM   779  C CB  . TYR A 1 101 ? 64.593 4.393   20.659  1.00 21.71 ? 95  TYR L CB  1 
ATOM   780  C CG  . TYR A 1 101 ? 65.710 4.412   21.665  1.00 30.06 ? 95  TYR L CG  1 
ATOM   781  C CD1 . TYR A 1 101 ? 65.649 5.222   22.800  1.00 35.13 ? 95  TYR L CD1 1 
ATOM   782  C CD2 . TYR A 1 101 ? 66.855 3.658   21.459  1.00 27.17 ? 95  TYR L CD2 1 
ATOM   783  C CE1 . TYR A 1 101 ? 66.713 5.274   23.702  1.00 27.27 ? 95  TYR L CE1 1 
ATOM   784  C CE2 . TYR A 1 101 ? 67.911 3.705   22.342  1.00 30.04 ? 95  TYR L CE2 1 
ATOM   785  C CZ  . TYR A 1 101 ? 67.840 4.513   23.462  1.00 29.28 ? 95  TYR L CZ  1 
ATOM   786  O OH  . TYR A 1 101 ? 68.919 4.562   24.317  1.00 30.40 ? 95  TYR L OH  1 
ATOM   787  N N   . THR A 1 102 ? 61.700 5.410   20.143  1.00 24.22 ? 96  THR L N   1 
ATOM   788  C CA  . THR A 1 102 ? 60.687 5.845   19.200  1.00 22.04 ? 96  THR L CA  1 
ATOM   789  C C   . THR A 1 102 ? 60.674 7.371   19.152  1.00 24.16 ? 96  THR L C   1 
ATOM   790  O O   . THR A 1 102 ? 60.594 8.023   20.193  1.00 21.14 ? 96  THR L O   1 
ATOM   791  C CB  . THR A 1 102 ? 59.309 5.315   19.601  1.00 23.07 ? 96  THR L CB  1 
ATOM   792  O OG1 . THR A 1 102 ? 59.244 3.911   19.330  1.00 24.63 ? 96  THR L OG1 1 
ATOM   793  C CG2 . THR A 1 102 ? 58.224 6.012   18.817  1.00 33.36 ? 96  THR L CG2 1 
ATOM   794  N N   . PHE A 1 103 ? 60.877 7.932   17.958  1.00 22.32 ? 97  PHE L N   1 
ATOM   795  C CA  . PHE A 1 103 ? 60.874 9.381   17.788  1.00 17.80 ? 97  PHE L CA  1 
ATOM   796  C C   . PHE A 1 103 ? 59.509 9.840   17.273  1.00 21.61 ? 97  PHE L C   1 
ATOM   797  O O   . PHE A 1 103 ? 58.681 9.029   16.844  1.00 22.46 ? 97  PHE L O   1 
ATOM   798  C CB  . PHE A 1 103 ? 61.942 9.826   16.787  1.00 14.80 ? 97  PHE L CB  1 
ATOM   799  C CG  . PHE A 1 103 ? 63.363 9.583   17.225  1.00 9.93  ? 97  PHE L CG  1 
ATOM   800  C CD1 . PHE A 1 103 ? 63.924 8.319   17.137  1.00 6.29  ? 97  PHE L CD1 1 
ATOM   801  C CD2 . PHE A 1 103 ? 64.169 10.649  17.631  1.00 7.89  ? 97  PHE L CD2 1 
ATOM   802  C CE1 . PHE A 1 103 ? 65.268 8.108   17.435  1.00 3.92  ? 97  PHE L CE1 1 
ATOM   803  C CE2 . PHE A 1 103 ? 65.514 10.453  17.933  1.00 11.91 ? 97  PHE L CE2 1 
ATOM   804  C CZ  . PHE A 1 103 ? 66.067 9.176   17.833  1.00 7.62  ? 97  PHE L CZ  1 
ATOM   805  N N   . GLY A 1 104 ? 59.269 11.142  17.330  1.00 22.37 ? 98  GLY L N   1 
ATOM   806  C CA  . GLY A 1 104 ? 58.016 11.670  16.828  1.00 27.99 ? 98  GLY L CA  1 
ATOM   807  C C   . GLY A 1 104 ? 58.238 12.204  15.424  1.00 32.44 ? 98  GLY L C   1 
ATOM   808  O O   . GLY A 1 104 ? 59.384 12.279  14.963  1.00 36.34 ? 98  GLY L O   1 
ATOM   809  N N   . GLY A 1 105 ? 57.159 12.606  14.756  1.00 32.01 ? 99  GLY L N   1 
ATOM   810  C CA  . GLY A 1 105 ? 57.271 13.137  13.407  1.00 34.17 ? 99  GLY L CA  1 
ATOM   811  C C   . GLY A 1 105 ? 58.115 14.399  13.291  1.00 37.06 ? 99  GLY L C   1 
ATOM   812  O O   . GLY A 1 105 ? 58.587 14.749  12.210  1.00 42.91 ? 99  GLY L O   1 
ATOM   813  N N   . GLY A 1 106 ? 58.325 15.075  14.411  1.00 35.04 ? 100 GLY L N   1 
ATOM   814  C CA  . GLY A 1 106 ? 59.109 16.288  14.387  1.00 28.94 ? 100 GLY L CA  1 
ATOM   815  C C   . GLY A 1 106 ? 58.218 17.489  14.181  1.00 26.73 ? 100 GLY L C   1 
ATOM   816  O O   . GLY A 1 106 ? 57.097 17.364  13.689  1.00 30.43 ? 100 GLY L O   1 
ATOM   817  N N   . THR A 1 107 ? 58.704 18.644  14.620  1.00 24.84 ? 101 THR L N   1 
ATOM   818  C CA  . THR A 1 107 ? 58.003 19.911  14.486  1.00 21.48 ? 101 THR L CA  1 
ATOM   819  C C   . THR A 1 107 ? 59.048 20.857  13.909  1.00 24.99 ? 101 THR L C   1 
ATOM   820  O O   . THR A 1 107 ? 60.174 20.913  14.407  1.00 28.11 ? 101 THR L O   1 
ATOM   821  C CB  . THR A 1 107 ? 57.509 20.418  15.861  1.00 18.19 ? 101 THR L CB  1 
ATOM   822  O OG1 . THR A 1 107 ? 56.433 19.587  16.321  1.00 20.89 ? 101 THR L OG1 1 
ATOM   823  C CG2 . THR A 1 107 ? 57.039 21.851  15.782  1.00 8.32  ? 101 THR L CG2 1 
ATOM   824  N N   . LYS A 1 108 ? 58.711 21.531  12.814  1.00 28.74 ? 102 LYS L N   1 
ATOM   825  C CA  . LYS A 1 108 ? 59.647 22.452  12.181  1.00 32.13 ? 102 LYS L CA  1 
ATOM   826  C C   . LYS A 1 108 ? 59.414 23.871  12.670  1.00 28.58 ? 102 LYS L C   1 
ATOM   827  O O   . LYS A 1 108 ? 58.273 24.311  12.766  1.00 31.05 ? 102 LYS L O   1 
ATOM   828  C CB  . LYS A 1 108 ? 59.503 22.403  10.653  1.00 37.85 ? 102 LYS L CB  1 
ATOM   829  C CG  . LYS A 1 108 ? 60.760 22.862  9.903   1.00 45.10 ? 102 LYS L CG  1 
ATOM   830  C CD  . LYS A 1 108 ? 60.533 23.149  8.407   1.00 52.44 ? 102 LYS L CD  1 
ATOM   831  C CE  . LYS A 1 108 ? 60.015 21.940  7.626   1.00 57.25 ? 102 LYS L CE  1 
ATOM   832  N NZ  . LYS A 1 108 ? 58.520 21.833  7.641   1.00 60.69 ? 102 LYS L NZ  1 
ATOM   833  N N   . LEU A 1 109 ? 60.495 24.580  12.977  1.00 25.60 ? 103 LEU L N   1 
ATOM   834  C CA  . LEU A 1 109 ? 60.413 25.960  13.444  1.00 27.93 ? 103 LEU L CA  1 
ATOM   835  C C   . LEU A 1 109 ? 60.962 26.874  12.366  1.00 28.88 ? 103 LEU L C   1 
ATOM   836  O O   . LEU A 1 109 ? 62.063 26.659  11.864  1.00 27.09 ? 103 LEU L O   1 
ATOM   837  C CB  . LEU A 1 109 ? 61.227 26.158  14.738  1.00 29.04 ? 103 LEU L CB  1 
ATOM   838  C CG  . LEU A 1 109 ? 61.300 27.555  15.378  1.00 23.04 ? 103 LEU L CG  1 
ATOM   839  C CD1 . LEU A 1 109 ? 59.971 27.911  16.026  1.00 26.53 ? 103 LEU L CD1 1 
ATOM   840  C CD2 . LEU A 1 109 ? 62.388 27.576  16.423  1.00 28.27 ? 103 LEU L CD2 1 
ATOM   841  N N   . GLU A 1 110 ? 60.209 27.920  12.056  1.00 33.24 ? 104 GLU L N   1 
ATOM   842  C CA  . GLU A 1 110 ? 60.599 28.890  11.045  1.00 38.96 ? 104 GLU L CA  1 
ATOM   843  C C   . GLU A 1 110 ? 60.620 30.267  11.692  1.00 36.45 ? 104 GLU L C   1 
ATOM   844  O O   . GLU A 1 110 ? 59.832 30.552  12.600  1.00 33.03 ? 104 GLU L O   1 
ATOM   845  C CB  . GLU A 1 110 ? 59.593 28.871  9.890   1.00 49.59 ? 104 GLU L CB  1 
ATOM   846  C CG  . GLU A 1 110 ? 59.293 27.472  9.349   1.00 61.13 ? 104 GLU L CG  1 
ATOM   847  C CD  . GLU A 1 110 ? 58.066 27.433  8.456   1.00 67.27 ? 104 GLU L CD  1 
ATOM   848  O OE1 . GLU A 1 110 ? 58.238 27.199  7.244   1.00 75.36 ? 104 GLU L OE1 1 
ATOM   849  O OE2 . GLU A 1 110 ? 56.933 27.628  8.960   1.00 68.21 ? 104 GLU L OE2 1 
ATOM   850  N N   . ILE A 1 111 ? 61.516 31.123  11.220  1.00 36.98 ? 105 ILE L N   1 
ATOM   851  C CA  . ILE A 1 111 ? 61.639 32.466  11.762  1.00 41.36 ? 105 ILE L CA  1 
ATOM   852  C C   . ILE A 1 111 ? 60.894 33.491  10.913  1.00 39.03 ? 105 ILE L C   1 
ATOM   853  O O   . ILE A 1 111 ? 61.190 33.674  9.735   1.00 45.58 ? 105 ILE L O   1 
ATOM   854  C CB  . ILE A 1 111 ? 63.130 32.887  11.916  1.00 46.26 ? 105 ILE L CB  1 
ATOM   855  C CG1 . ILE A 1 111 ? 63.862 31.926  12.864  1.00 48.46 ? 105 ILE L CG1 1 
ATOM   856  C CG2 . ILE A 1 111 ? 63.231 34.325  12.443  1.00 49.12 ? 105 ILE L CG2 1 
ATOM   857  C CD1 . ILE A 1 111 ? 63.341 31.940  14.304  1.00 47.44 ? 105 ILE L CD1 1 
ATOM   858  N N   . LYS A 1 112 ? 59.904 34.130  11.523  1.00 37.53 ? 106 LYS L N   1 
ATOM   859  C CA  . LYS A 1 112 ? 59.093 35.151  10.883  1.00 35.36 ? 106 LYS L CA  1 
ATOM   860  C C   . LYS A 1 112 ? 59.930 36.412  10.815  1.00 34.22 ? 106 LYS L C   1 
ATOM   861  O O   . LYS A 1 112 ? 60.300 36.952  11.854  1.00 37.57 ? 106 LYS L O   1 
ATOM   862  C CB  . LYS A 1 112 ? 57.859 35.421  11.736  1.00 36.87 ? 106 LYS L CB  1 
ATOM   863  C CG  . LYS A 1 112 ? 56.539 35.127  11.055  1.00 47.87 ? 106 LYS L CG  1 
ATOM   864  C CD  . LYS A 1 112 ? 55.414 34.968  12.077  1.00 58.95 ? 106 LYS L CD  1 
ATOM   865  C CE  . LYS A 1 112 ? 55.275 36.189  12.987  1.00 65.24 ? 106 LYS L CE  1 
ATOM   866  N NZ  . LYS A 1 112 ? 54.318 35.943  14.108  1.00 67.46 ? 106 LYS L NZ  1 
ATOM   867  N N   . ARG A 1 113 ? 60.253 36.866  9.605   1.00 33.34 ? 107 ARG L N   1 
ATOM   868  C CA  . ARG A 1 113 ? 61.050 38.080  9.428   1.00 31.18 ? 107 ARG L CA  1 
ATOM   869  C C   . ARG A 1 113 ? 60.400 39.058  8.466   1.00 28.61 ? 107 ARG L C   1 
ATOM   870  O O   . ARG A 1 113 ? 59.270 38.849  8.025   1.00 31.34 ? 107 ARG L O   1 
ATOM   871  C CB  . ARG A 1 113 ? 62.477 37.761  8.956   1.00 26.93 ? 107 ARG L CB  1 
ATOM   872  C CG  . ARG A 1 113 ? 62.567 37.041  7.620   1.00 32.40 ? 107 ARG L CG  1 
ATOM   873  C CD  . ARG A 1 113 ? 63.890 37.334  6.920   1.00 28.07 ? 107 ARG L CD  1 
ATOM   874  N NE  . ARG A 1 113 ? 63.898 38.673  6.337   1.00 26.63 ? 107 ARG L NE  1 
ATOM   875  C CZ  . ARG A 1 113 ? 64.995 39.331  5.974   1.00 26.42 ? 107 ARG L CZ  1 
ATOM   876  N NH1 . ARG A 1 113 ? 66.182 38.779  6.142   1.00 27.41 ? 107 ARG L NH1 1 
ATOM   877  N NH2 . ARG A 1 113 ? 64.902 40.531  5.409   1.00 28.62 ? 107 ARG L NH2 1 
ATOM   878  N N   . ALA A 1 114 ? 61.119 40.134  8.169   1.00 25.75 ? 108 ALA L N   1 
ATOM   879  C CA  . ALA A 1 114 ? 60.650 41.172  7.260   1.00 30.90 ? 108 ALA L CA  1 
ATOM   880  C C   . ALA A 1 114 ? 60.651 40.677  5.816   1.00 34.09 ? 108 ALA L C   1 
ATOM   881  O O   . ALA A 1 114 ? 61.541 39.923  5.411   1.00 34.87 ? 108 ALA L O   1 
ATOM   882  C CB  . ALA A 1 114 ? 61.546 42.387  7.372   1.00 34.37 ? 108 ALA L CB  1 
ATOM   883  N N   . ASP A 1 115 ? 59.676 41.132  5.034   1.00 34.76 ? 109 ASP L N   1 
ATOM   884  C CA  . ASP A 1 115 ? 59.584 40.733  3.636   1.00 33.48 ? 109 ASP L CA  1 
ATOM   885  C C   . ASP A 1 115 ? 60.857 41.127  2.906   1.00 33.43 ? 109 ASP L C   1 
ATOM   886  O O   . ASP A 1 115 ? 61.486 42.129  3.248   1.00 37.78 ? 109 ASP L O   1 
ATOM   887  C CB  . ASP A 1 115 ? 58.389 41.399  2.976   1.00 33.76 ? 109 ASP L CB  1 
ATOM   888  C CG  . ASP A 1 115 ? 57.075 40.840  3.455   1.00 38.42 ? 109 ASP L CG  1 
ATOM   889  O OD1 . ASP A 1 115 ? 57.043 39.677  3.909   1.00 41.99 ? 109 ASP L OD1 1 
ATOM   890  O OD2 . ASP A 1 115 ? 56.063 41.562  3.362   1.00 46.61 ? 109 ASP L OD2 1 
ATOM   891  N N   . ALA A 1 116 ? 61.236 40.335  1.911   1.00 32.37 ? 110 ALA L N   1 
ATOM   892  C CA  . ALA A 1 116 ? 62.445 40.593  1.137   1.00 32.43 ? 110 ALA L CA  1 
ATOM   893  C C   . ALA A 1 116 ? 62.228 40.094  -0.279  1.00 31.26 ? 110 ALA L C   1 
ATOM   894  O O   . ALA A 1 116 ? 61.820 38.950  -0.484  1.00 31.94 ? 110 ALA L O   1 
ATOM   895  C CB  . ALA A 1 116 ? 63.645 39.878  1.778   1.00 32.53 ? 110 ALA L CB  1 
ATOM   896  N N   . ALA A 1 117 ? 62.456 40.963  -1.256  1.00 32.58 ? 111 ALA L N   1 
ATOM   897  C CA  . ALA A 1 117 ? 62.270 40.588  -2.654  1.00 29.24 ? 111 ALA L CA  1 
ATOM   898  C C   . ALA A 1 117 ? 63.430 39.724  -3.114  1.00 30.67 ? 111 ALA L C   1 
ATOM   899  O O   . ALA A 1 117 ? 64.544 39.858  -2.615  1.00 32.65 ? 111 ALA L O   1 
ATOM   900  C CB  . ALA A 1 117 ? 62.168 41.827  -3.519  1.00 32.31 ? 111 ALA L CB  1 
ATOM   901  N N   . PRO A 1 118 ? 63.185 38.814  -4.065  1.00 32.13 ? 112 PRO L N   1 
ATOM   902  C CA  . PRO A 1 118 ? 64.286 37.965  -4.531  1.00 33.36 ? 112 PRO L CA  1 
ATOM   903  C C   . PRO A 1 118 ? 65.226 38.684  -5.493  1.00 36.64 ? 112 PRO L C   1 
ATOM   904  O O   . PRO A 1 118 ? 64.879 39.722  -6.057  1.00 39.88 ? 112 PRO L O   1 
ATOM   905  C CB  . PRO A 1 118 ? 63.556 36.818  -5.220  1.00 28.34 ? 112 PRO L CB  1 
ATOM   906  C CG  . PRO A 1 118 ? 62.354 37.490  -5.785  1.00 29.07 ? 112 PRO L CG  1 
ATOM   907  C CD  . PRO A 1 118 ? 61.907 38.421  -4.686  1.00 27.65 ? 112 PRO L CD  1 
ATOM   908  N N   . THR A 1 119 ? 66.434 38.156  -5.635  1.00 36.99 ? 113 THR L N   1 
ATOM   909  C CA  . THR A 1 119 ? 67.405 38.712  -6.567  1.00 40.41 ? 113 THR L CA  1 
ATOM   910  C C   . THR A 1 119 ? 67.489 37.704  -7.711  1.00 38.04 ? 113 THR L C   1 
ATOM   911  O O   . THR A 1 119 ? 68.167 36.684  -7.599  1.00 39.31 ? 113 THR L O   1 
ATOM   912  C CB  . THR A 1 119 ? 68.768 38.875  -5.903  1.00 42.78 ? 113 THR L CB  1 
ATOM   913  O OG1 . THR A 1 119 ? 68.633 39.749  -4.775  1.00 53.46 ? 113 THR L OG1 1 
ATOM   914  C CG2 . THR A 1 119 ? 69.774 39.458  -6.885  1.00 40.99 ? 113 THR L CG2 1 
ATOM   915  N N   . VAL A 1 120 ? 66.750 37.963  -8.786  1.00 37.47 ? 114 VAL L N   1 
ATOM   916  C CA  . VAL A 1 120 ? 66.717 37.037  -9.916  1.00 40.12 ? 114 VAL L CA  1 
ATOM   917  C C   . VAL A 1 120 ? 67.968 37.081  -10.800 1.00 40.68 ? 114 VAL L C   1 
ATOM   918  O O   . VAL A 1 120 ? 68.628 38.119  -10.922 1.00 43.08 ? 114 VAL L O   1 
ATOM   919  C CB  . VAL A 1 120 ? 65.436 37.233  -10.761 1.00 35.98 ? 114 VAL L CB  1 
ATOM   920  C CG1 . VAL A 1 120 ? 65.218 36.046  -11.699 1.00 34.20 ? 114 VAL L CG1 1 
ATOM   921  C CG2 . VAL A 1 120 ? 64.238 37.396  -9.843  1.00 34.21 ? 114 VAL L CG2 1 
ATOM   922  N N   . SER A 1 121 ? 68.315 35.932  -11.368 1.00 36.65 ? 115 SER L N   1 
ATOM   923  C CA  . SER A 1 121 ? 69.474 35.812  -12.236 1.00 38.46 ? 115 SER L CA  1 
ATOM   924  C C   . SER A 1 121 ? 69.238 34.657  -13.206 1.00 40.18 ? 115 SER L C   1 
ATOM   925  O O   . SER A 1 121 ? 68.992 33.519  -12.786 1.00 36.36 ? 115 SER L O   1 
ATOM   926  C CB  . SER A 1 121 ? 70.735 35.552  -11.402 1.00 41.00 ? 115 SER L CB  1 
ATOM   927  O OG  . SER A 1 121 ? 70.888 36.516  -10.370 1.00 45.96 ? 115 SER L OG  1 
ATOM   928  N N   . ILE A 1 122 ? 69.268 34.959  -14.501 1.00 41.31 ? 116 ILE L N   1 
ATOM   929  C CA  . ILE A 1 122 ? 69.049 33.938  -15.523 1.00 38.90 ? 116 ILE L CA  1 
ATOM   930  C C   . ILE A 1 122 ? 70.369 33.614  -16.206 1.00 38.41 ? 116 ILE L C   1 
ATOM   931  O O   . ILE A 1 122 ? 71.164 34.504  -16.479 1.00 45.20 ? 116 ILE L O   1 
ATOM   932  C CB  . ILE A 1 122 ? 67.956 34.372  -16.539 1.00 31.52 ? 116 ILE L CB  1 
ATOM   933  C CG1 . ILE A 1 122 ? 67.714 33.272  -17.565 1.00 27.74 ? 116 ILE L CG1 1 
ATOM   934  C CG2 . ILE A 1 122 ? 68.327 35.668  -17.209 1.00 31.90 ? 116 ILE L CG2 1 
ATOM   935  C CD1 . ILE A 1 122 ? 66.396 33.409  -18.270 1.00 30.15 ? 116 ILE L CD1 1 
ATOM   936  N N   . PHE A 1 123 ? 70.619 32.331  -16.433 1.00 41.37 ? 117 PHE L N   1 
ATOM   937  C CA  . PHE A 1 123 ? 71.857 31.879  -17.050 1.00 37.65 ? 117 PHE L CA  1 
ATOM   938  C C   . PHE A 1 123 ? 71.603 31.089  -18.318 1.00 39.11 ? 117 PHE L C   1 
ATOM   939  O O   . PHE A 1 123 ? 70.830 30.127  -18.316 1.00 39.42 ? 117 PHE L O   1 
ATOM   940  C CB  . PHE A 1 123 ? 72.646 30.991  -16.079 1.00 38.53 ? 117 PHE L CB  1 
ATOM   941  C CG  . PHE A 1 123 ? 73.254 31.732  -14.941 1.00 34.45 ? 117 PHE L CG  1 
ATOM   942  C CD1 . PHE A 1 123 ? 74.582 32.131  -14.993 1.00 37.16 ? 117 PHE L CD1 1 
ATOM   943  C CD2 . PHE A 1 123 ? 72.498 32.049  -13.822 1.00 38.97 ? 117 PHE L CD2 1 
ATOM   944  C CE1 . PHE A 1 123 ? 75.158 32.841  -13.946 1.00 42.40 ? 117 PHE L CE1 1 
ATOM   945  C CE2 . PHE A 1 123 ? 73.062 32.762  -12.765 1.00 45.30 ? 117 PHE L CE2 1 
ATOM   946  C CZ  . PHE A 1 123 ? 74.399 33.160  -12.828 1.00 43.98 ? 117 PHE L CZ  1 
ATOM   947  N N   . PRO A 1 124 ? 72.237 31.497  -19.426 1.00 38.65 ? 118 PRO L N   1 
ATOM   948  C CA  . PRO A 1 124 ? 72.093 30.823  -20.716 1.00 37.20 ? 118 PRO L CA  1 
ATOM   949  C C   . PRO A 1 124 ? 72.841 29.498  -20.608 1.00 39.82 ? 118 PRO L C   1 
ATOM   950  O O   . PRO A 1 124 ? 73.727 29.351  -19.756 1.00 42.80 ? 118 PRO L O   1 
ATOM   951  C CB  . PRO A 1 124 ? 72.814 31.776  -21.674 1.00 41.03 ? 118 PRO L CB  1 
ATOM   952  C CG  . PRO A 1 124 ? 72.747 33.108  -20.982 1.00 37.36 ? 118 PRO L CG  1 
ATOM   953  C CD  . PRO A 1 124 ? 73.038 32.722  -19.568 1.00 39.93 ? 118 PRO L CD  1 
ATOM   954  N N   . PRO A 1 125 ? 72.494 28.513  -21.453 1.00 37.99 ? 119 PRO L N   1 
ATOM   955  C CA  . PRO A 1 125 ? 73.141 27.194  -21.447 1.00 39.04 ? 119 PRO L CA  1 
ATOM   956  C C   . PRO A 1 125 ? 74.633 27.312  -21.719 1.00 44.44 ? 119 PRO L C   1 
ATOM   957  O O   . PRO A 1 125 ? 75.050 28.144  -22.520 1.00 51.31 ? 119 PRO L O   1 
ATOM   958  C CB  . PRO A 1 125 ? 72.448 26.476  -22.598 1.00 37.70 ? 119 PRO L CB  1 
ATOM   959  C CG  . PRO A 1 125 ? 71.102 27.124  -22.643 1.00 38.43 ? 119 PRO L CG  1 
ATOM   960  C CD  . PRO A 1 125 ? 71.434 28.570  -22.469 1.00 32.75 ? 119 PRO L CD  1 
ATOM   961  N N   . SER A 1 126 ? 75.444 26.497  -21.056 1.00 50.09 ? 120 SER L N   1 
ATOM   962  C CA  . SER A 1 126 ? 76.884 26.558  -21.287 1.00 53.19 ? 120 SER L CA  1 
ATOM   963  C C   . SER A 1 126 ? 77.221 25.937  -22.640 1.00 53.71 ? 120 SER L C   1 
ATOM   964  O O   . SER A 1 126 ? 76.518 25.040  -23.127 1.00 51.78 ? 120 SER L O   1 
ATOM   965  C CB  . SER A 1 126 ? 77.670 25.851  -20.170 1.00 53.63 ? 120 SER L CB  1 
ATOM   966  O OG  . SER A 1 126 ? 77.427 24.454  -20.152 1.00 57.98 ? 120 SER L OG  1 
ATOM   967  N N   . SER A 1 127 ? 78.302 26.415  -23.242 1.00 54.91 ? 121 SER L N   1 
ATOM   968  C CA  . SER A 1 127 ? 78.742 25.910  -24.529 1.00 57.11 ? 121 SER L CA  1 
ATOM   969  C C   . SER A 1 127 ? 79.059 24.424  -24.433 1.00 57.46 ? 121 SER L C   1 
ATOM   970  O O   . SER A 1 127 ? 78.827 23.674  -25.381 1.00 61.46 ? 121 SER L O   1 
ATOM   971  C CB  . SER A 1 127 ? 79.963 26.693  -24.992 1.00 62.26 ? 121 SER L CB  1 
ATOM   972  O OG  . SER A 1 127 ? 80.784 27.013  -23.884 1.00 71.91 ? 121 SER L OG  1 
ATOM   973  N N   . GLU A 1 128 ? 79.551 24.000  -23.271 1.00 57.27 ? 122 GLU L N   1 
ATOM   974  C CA  . GLU A 1 128 ? 79.887 22.598  -23.034 1.00 52.57 ? 122 GLU L CA  1 
ATOM   975  C C   . GLU A 1 128 ? 78.642 21.722  -23.030 1.00 48.46 ? 122 GLU L C   1 
ATOM   976  O O   . GLU A 1 128 ? 78.672 20.584  -23.497 1.00 47.80 ? 122 GLU L O   1 
ATOM   977  C CB  . GLU A 1 128 ? 80.612 22.434  -21.702 1.00 56.59 ? 122 GLU L CB  1 
ATOM   978  C CG  . GLU A 1 128 ? 81.909 23.206  -21.595 1.00 61.85 ? 122 GLU L CG  1 
ATOM   979  C CD  . GLU A 1 128 ? 82.684 22.877  -20.329 1.00 65.12 ? 122 GLU L CD  1 
ATOM   980  O OE1 . GLU A 1 128 ? 82.629 21.712  -19.862 1.00 64.94 ? 122 GLU L OE1 1 
ATOM   981  O OE2 . GLU A 1 128 ? 83.362 23.788  -19.809 1.00 68.50 ? 122 GLU L OE2 1 
ATOM   982  N N   . GLN A 1 129 ? 77.549 22.245  -22.484 1.00 48.05 ? 123 GLN L N   1 
ATOM   983  C CA  . GLN A 1 129 ? 76.311 21.481  -22.437 1.00 47.80 ? 123 GLN L CA  1 
ATOM   984  C C   . GLN A 1 129 ? 75.710 21.407  -23.830 1.00 46.48 ? 123 GLN L C   1 
ATOM   985  O O   . GLN A 1 129 ? 75.212 20.358  -24.243 1.00 47.01 ? 123 GLN L O   1 
ATOM   986  C CB  . GLN A 1 129 ? 75.300 22.085  -21.458 1.00 47.07 ? 123 GLN L CB  1 
ATOM   987  C CG  . GLN A 1 129 ? 74.153 21.124  -21.162 1.00 43.22 ? 123 GLN L CG  1 
ATOM   988  C CD  . GLN A 1 129 ? 73.040 21.740  -20.352 1.00 45.22 ? 123 GLN L CD  1 
ATOM   989  O OE1 . GLN A 1 129 ? 72.943 22.965  -20.213 1.00 41.20 ? 123 GLN L OE1 1 
ATOM   990  N NE2 . GLN A 1 129 ? 72.173 20.891  -19.823 1.00 46.62 ? 123 GLN L NE2 1 
ATOM   991  N N   . LEU A 1 130 ? 75.752 22.522  -24.549 1.00 43.80 ? 124 LEU L N   1 
ATOM   992  C CA  . LEU A 1 130 ? 75.231 22.556  -25.911 1.00 50.08 ? 124 LEU L CA  1 
ATOM   993  C C   . LEU A 1 130 ? 75.873 21.426  -26.727 1.00 51.55 ? 124 LEU L C   1 
ATOM   994  O O   . LEU A 1 130 ? 75.173 20.627  -27.356 1.00 49.40 ? 124 LEU L O   1 
ATOM   995  C CB  . LEU A 1 130 ? 75.529 23.913  -26.549 1.00 48.40 ? 124 LEU L CB  1 
ATOM   996  C CG  . LEU A 1 130 ? 74.740 25.078  -25.956 1.00 43.46 ? 124 LEU L CG  1 
ATOM   997  C CD1 . LEU A 1 130 ? 75.388 26.397  -26.326 1.00 40.81 ? 124 LEU L CD1 1 
ATOM   998  C CD2 . LEU A 1 130 ? 73.299 25.002  -26.437 1.00 39.91 ? 124 LEU L CD2 1 
ATOM   999  N N   . THR A 1 131 ? 77.196 21.310  -26.622 1.00 52.40 ? 125 THR L N   1 
ATOM   1000 C CA  . THR A 1 131 ? 77.960 20.283  -27.323 1.00 54.50 ? 125 THR L CA  1 
ATOM   1001 C C   . THR A 1 131 ? 77.527 18.870  -26.921 1.00 54.55 ? 125 THR L C   1 
ATOM   1002 O O   . THR A 1 131 ? 77.918 17.890  -27.548 1.00 57.33 ? 125 THR L O   1 
ATOM   1003 C CB  . THR A 1 131 ? 79.479 20.452  -27.061 1.00 55.56 ? 125 THR L CB  1 
ATOM   1004 O OG1 . THR A 1 131 ? 79.877 21.793  -27.376 1.00 59.57 ? 125 THR L OG1 1 
ATOM   1005 C CG2 . THR A 1 131 ? 80.283 19.504  -27.927 1.00 56.97 ? 125 THR L CG2 1 
ATOM   1006 N N   . SER A 1 132 ? 76.711 18.768  -25.881 1.00 58.29 ? 126 SER L N   1 
ATOM   1007 C CA  . SER A 1 132 ? 76.228 17.475  -25.407 1.00 63.44 ? 126 SER L CA  1 
ATOM   1008 C C   . SER A 1 132 ? 74.858 17.132  -26.000 1.00 60.94 ? 126 SER L C   1 
ATOM   1009 O O   . SER A 1 132 ? 74.355 16.016  -25.839 1.00 56.66 ? 126 SER L O   1 
ATOM   1010 C CB  . SER A 1 132 ? 76.165 17.469  -23.875 1.00 68.33 ? 126 SER L CB  1 
ATOM   1011 O OG  . SER A 1 132 ? 77.425 17.812  -23.305 1.00 76.66 ? 126 SER L OG  1 
ATOM   1012 N N   . GLY A 1 133 ? 74.264 18.100  -26.689 1.00 60.51 ? 127 GLY L N   1 
ATOM   1013 C CA  . GLY A 1 133 ? 72.966 17.888  -27.302 1.00 63.49 ? 127 GLY L CA  1 
ATOM   1014 C C   . GLY A 1 133 ? 71.811 18.422  -26.479 1.00 63.67 ? 127 GLY L C   1 
ATOM   1015 O O   . GLY A 1 133 ? 70.652 18.380  -26.918 1.00 65.85 ? 127 GLY L O   1 
ATOM   1016 N N   . GLY A 1 134 ? 72.126 18.962  -25.305 1.00 61.13 ? 128 GLY L N   1 
ATOM   1017 C CA  . GLY A 1 134 ? 71.097 19.498  -24.436 1.00 51.64 ? 128 GLY L CA  1 
ATOM   1018 C C   . GLY A 1 134 ? 71.315 20.961  -24.123 1.00 44.81 ? 128 GLY L C   1 
ATOM   1019 O O   . GLY A 1 134 ? 72.393 21.506  -24.381 1.00 41.50 ? 128 GLY L O   1 
ATOM   1020 N N   . ALA A 1 135 ? 70.282 21.593  -23.575 1.00 41.99 ? 129 ALA L N   1 
ATOM   1021 C CA  . ALA A 1 135 ? 70.330 23.000  -23.201 1.00 41.76 ? 129 ALA L CA  1 
ATOM   1022 C C   . ALA A 1 135 ? 69.484 23.209  -21.947 1.00 39.07 ? 129 ALA L C   1 
ATOM   1023 O O   . ALA A 1 135 ? 68.304 22.858  -21.933 1.00 38.11 ? 129 ALA L O   1 
ATOM   1024 C CB  . ALA A 1 135 ? 69.802 23.868  -24.343 1.00 44.12 ? 129 ALA L CB  1 
ATOM   1025 N N   . SER A 1 136 ? 70.102 23.730  -20.885 1.00 36.84 ? 130 SER L N   1 
ATOM   1026 C CA  . SER A 1 136 ? 69.405 23.994  -19.627 1.00 28.97 ? 130 SER L CA  1 
ATOM   1027 C C   . SER A 1 136 ? 69.534 25.460  -19.247 1.00 28.66 ? 130 SER L C   1 
ATOM   1028 O O   . SER A 1 136 ? 70.645 25.975  -19.069 1.00 27.30 ? 130 SER L O   1 
ATOM   1029 C CB  . SER A 1 136 ? 69.963 23.124  -18.500 1.00 26.18 ? 130 SER L CB  1 
ATOM   1030 O OG  . SER A 1 136 ? 69.726 21.747  -18.754 1.00 28.70 ? 130 SER L OG  1 
ATOM   1031 N N   . VAL A 1 137 ? 68.406 26.157  -19.205 1.00 27.90 ? 131 VAL L N   1 
ATOM   1032 C CA  . VAL A 1 137 ? 68.414 27.563  -18.823 1.00 29.28 ? 131 VAL L CA  1 
ATOM   1033 C C   . VAL A 1 137 ? 68.140 27.533  -17.322 1.00 28.45 ? 131 VAL L C   1 
ATOM   1034 O O   . VAL A 1 137 ? 67.202 26.863  -16.869 1.00 22.26 ? 131 VAL L O   1 
ATOM   1035 C CB  . VAL A 1 137 ? 67.321 28.371  -19.548 1.00 27.85 ? 131 VAL L CB  1 
ATOM   1036 C CG1 . VAL A 1 137 ? 67.622 29.853  -19.427 1.00 30.56 ? 131 VAL L CG1 1 
ATOM   1037 C CG2 . VAL A 1 137 ? 67.239 27.968  -21.008 1.00 29.88 ? 131 VAL L CG2 1 
ATOM   1038 N N   . VAL A 1 138 ? 68.998 28.190  -16.553 1.00 27.70 ? 132 VAL L N   1 
ATOM   1039 C CA  . VAL A 1 138 ? 68.861 28.194  -15.102 1.00 34.10 ? 132 VAL L CA  1 
ATOM   1040 C C   . VAL A 1 138 ? 68.546 29.579  -14.562 1.00 36.31 ? 132 VAL L C   1 
ATOM   1041 O O   . VAL A 1 138 ? 69.130 30.576  -14.986 1.00 39.04 ? 132 VAL L O   1 
ATOM   1042 C CB  . VAL A 1 138 ? 70.155 27.668  -14.398 1.00 32.68 ? 132 VAL L CB  1 
ATOM   1043 C CG1 . VAL A 1 138 ? 70.008 27.753  -12.881 1.00 31.77 ? 132 VAL L CG1 1 
ATOM   1044 C CG2 . VAL A 1 138 ? 70.452 26.233  -14.808 1.00 22.69 ? 132 VAL L CG2 1 
ATOM   1045 N N   . CYS A 1 139 ? 67.616 29.635  -13.622 1.00 33.64 ? 133 CYS L N   1 
ATOM   1046 C CA  . CYS A 1 139 ? 67.257 30.892  -13.017 1.00 33.92 ? 133 CYS L CA  1 
ATOM   1047 C C   . CYS A 1 139 ? 67.423 30.726  -11.504 1.00 35.28 ? 133 CYS L C   1 
ATOM   1048 O O   . CYS A 1 139 ? 66.956 29.731  -10.941 1.00 38.33 ? 133 CYS L O   1 
ATOM   1049 C CB  . CYS A 1 139 ? 65.816 31.240  -13.368 1.00 32.97 ? 133 CYS L CB  1 
ATOM   1050 S SG  . CYS A 1 139 ? 65.331 32.899  -12.811 1.00 37.61 ? 133 CYS L SG  1 
ATOM   1051 N N   . PHE A 1 140 ? 68.161 31.643  -10.873 1.00 30.07 ? 134 PHE L N   1 
ATOM   1052 C CA  . PHE A 1 140 ? 68.381 31.620  -9.430  1.00 25.99 ? 134 PHE L CA  1 
ATOM   1053 C C   . PHE A 1 140 ? 67.624 32.790  -8.828  1.00 30.39 ? 134 PHE L C   1 
ATOM   1054 O O   . PHE A 1 140 ? 67.845 33.935  -9.222  1.00 33.48 ? 134 PHE L O   1 
ATOM   1055 C CB  . PHE A 1 140 ? 69.856 31.825  -9.077  1.00 21.83 ? 134 PHE L CB  1 
ATOM   1056 C CG  . PHE A 1 140 ? 70.744 30.651  -9.376  1.00 19.07 ? 134 PHE L CG  1 
ATOM   1057 C CD1 . PHE A 1 140 ? 72.026 30.855  -9.873  1.00 20.76 ? 134 PHE L CD1 1 
ATOM   1058 C CD2 . PHE A 1 140 ? 70.318 29.355  -9.149  1.00 21.78 ? 134 PHE L CD2 1 
ATOM   1059 C CE1 . PHE A 1 140 ? 72.869 29.787  -10.139 1.00 20.51 ? 134 PHE L CE1 1 
ATOM   1060 C CE2 . PHE A 1 140 ? 71.156 28.275  -9.413  1.00 21.07 ? 134 PHE L CE2 1 
ATOM   1061 C CZ  . PHE A 1 140 ? 72.433 28.494  -9.908  1.00 22.63 ? 134 PHE L CZ  1 
ATOM   1062 N N   . LEU A 1 141 ? 66.708 32.505  -7.910  1.00 30.83 ? 135 LEU L N   1 
ATOM   1063 C CA  . LEU A 1 141 ? 65.948 33.548  -7.217  1.00 32.28 ? 135 LEU L CA  1 
ATOM   1064 C C   . LEU A 1 141 ? 66.386 33.402  -5.763  1.00 31.71 ? 135 LEU L C   1 
ATOM   1065 O O   . LEU A 1 141 ? 65.952 32.491  -5.058  1.00 36.10 ? 135 LEU L O   1 
ATOM   1066 C CB  . LEU A 1 141 ? 64.445 33.313  -7.338  1.00 29.70 ? 135 LEU L CB  1 
ATOM   1067 C CG  . LEU A 1 141 ? 63.849 33.116  -8.730  1.00 31.29 ? 135 LEU L CG  1 
ATOM   1068 C CD1 . LEU A 1 141 ? 64.188 31.720  -9.287  1.00 25.82 ? 135 LEU L CD1 1 
ATOM   1069 C CD2 . LEU A 1 141 ? 62.347 33.288  -8.615  1.00 30.03 ? 135 LEU L CD2 1 
ATOM   1070 N N   . ASN A 1 142 ? 67.272 34.283  -5.322  1.00 34.93 ? 136 ASN L N   1 
ATOM   1071 C CA  . ASN A 1 142 ? 67.823 34.198  -3.976  1.00 34.08 ? 136 ASN L CA  1 
ATOM   1072 C C   . ASN A 1 142 ? 67.497 35.277  -2.961  1.00 30.64 ? 136 ASN L C   1 
ATOM   1073 O O   . ASN A 1 142 ? 67.250 36.429  -3.304  1.00 33.03 ? 136 ASN L O   1 
ATOM   1074 C CB  . ASN A 1 142 ? 69.349 34.094  -4.062  1.00 29.85 ? 136 ASN L CB  1 
ATOM   1075 C CG  . ASN A 1 142 ? 69.822 32.860  -4.812  1.00 27.21 ? 136 ASN L CG  1 
ATOM   1076 O OD1 . ASN A 1 142 ? 70.986 32.781  -5.193  1.00 24.81 ? 136 ASN L OD1 1 
ATOM   1077 N ND2 . ASN A 1 142 ? 68.943 31.877  -4.988  1.00 21.77 ? 136 ASN L ND2 1 
ATOM   1078 N N   . ASN A 1 143 ? 67.558 34.872  -1.697  1.00 29.80 ? 137 ASN L N   1 
ATOM   1079 C CA  . ASN A 1 143 ? 67.361 35.739  -0.540  1.00 28.26 ? 137 ASN L CA  1 
ATOM   1080 C C   . ASN A 1 143 ? 66.009 36.420  -0.360  1.00 28.21 ? 137 ASN L C   1 
ATOM   1081 O O   . ASN A 1 143 ? 65.949 37.598  -0.029  1.00 35.04 ? 137 ASN L O   1 
ATOM   1082 C CB  . ASN A 1 143 ? 68.481 36.779  -0.498  1.00 34.56 ? 137 ASN L CB  1 
ATOM   1083 C CG  . ASN A 1 143 ? 69.846 36.177  -0.786  1.00 41.69 ? 137 ASN L CG  1 
ATOM   1084 O OD1 . ASN A 1 143 ? 70.197 35.114  -0.269  1.00 44.75 ? 137 ASN L OD1 1 
ATOM   1085 N ND2 . ASN A 1 143 ? 70.607 36.832  -1.651  1.00 48.39 ? 137 ASN L ND2 1 
ATOM   1086 N N   . PHE A 1 144 ? 64.923 35.668  -0.460  1.00 23.52 ? 138 PHE L N   1 
ATOM   1087 C CA  . PHE A 1 144 ? 63.612 36.274  -0.306  1.00 22.70 ? 138 PHE L CA  1 
ATOM   1088 C C   . PHE A 1 144 ? 62.798 35.710  0.868   1.00 24.53 ? 138 PHE L C   1 
ATOM   1089 O O   . PHE A 1 144 ? 63.106 34.649  1.416   1.00 21.62 ? 138 PHE L O   1 
ATOM   1090 C CB  . PHE A 1 144 ? 62.825 36.170  -1.630  1.00 21.04 ? 138 PHE L CB  1 
ATOM   1091 C CG  . PHE A 1 144 ? 62.654 34.759  -2.131  1.00 18.19 ? 138 PHE L CG  1 
ATOM   1092 C CD1 . PHE A 1 144 ? 61.574 33.982  -1.710  1.00 16.73 ? 138 PHE L CD1 1 
ATOM   1093 C CD2 . PHE A 1 144 ? 63.599 34.187  -2.970  1.00 19.41 ? 138 PHE L CD2 1 
ATOM   1094 C CE1 . PHE A 1 144 ? 61.444 32.651  -2.112  1.00 16.19 ? 138 PHE L CE1 1 
ATOM   1095 C CE2 . PHE A 1 144 ? 63.478 32.854  -3.380  1.00 14.53 ? 138 PHE L CE2 1 
ATOM   1096 C CZ  . PHE A 1 144 ? 62.400 32.087  -2.948  1.00 16.59 ? 138 PHE L CZ  1 
ATOM   1097 N N   . TYR A 1 145 ? 61.759 36.446  1.246   1.00 26.31 ? 139 TYR L N   1 
ATOM   1098 C CA  . TYR A 1 145 ? 60.844 36.071  2.323   1.00 24.14 ? 139 TYR L CA  1 
ATOM   1099 C C   . TYR A 1 145 ? 59.544 36.846  2.064   1.00 20.46 ? 139 TYR L C   1 
ATOM   1100 O O   . TYR A 1 145 ? 59.582 38.041  1.752   1.00 18.47 ? 139 TYR L O   1 
ATOM   1101 C CB  . TYR A 1 145 ? 61.418 36.464  3.703   1.00 26.11 ? 139 TYR L CB  1 
ATOM   1102 C CG  . TYR A 1 145 ? 60.611 35.898  4.853   1.00 19.35 ? 139 TYR L CG  1 
ATOM   1103 C CD1 . TYR A 1 145 ? 59.470 36.550  5.313   1.00 18.44 ? 139 TYR L CD1 1 
ATOM   1104 C CD2 . TYR A 1 145 ? 60.919 34.657  5.398   1.00 20.58 ? 139 TYR L CD2 1 
ATOM   1105 C CE1 . TYR A 1 145 ? 58.648 35.976  6.272   1.00 15.99 ? 139 TYR L CE1 1 
ATOM   1106 C CE2 . TYR A 1 145 ? 60.101 34.071  6.353   1.00 21.61 ? 139 TYR L CE2 1 
ATOM   1107 C CZ  . TYR A 1 145 ? 58.963 34.735  6.779   1.00 22.91 ? 139 TYR L CZ  1 
ATOM   1108 O OH  . TYR A 1 145 ? 58.104 34.132  7.671   1.00 26.56 ? 139 TYR L OH  1 
ATOM   1109 N N   . PRO A 1 146 ? 58.380 36.184  2.168   1.00 17.14 ? 140 PRO L N   1 
ATOM   1110 C CA  . PRO A 1 146 ? 58.130 34.779  2.502   1.00 15.82 ? 140 PRO L CA  1 
ATOM   1111 C C   . PRO A 1 146 ? 58.599 33.743  1.486   1.00 22.67 ? 140 PRO L C   1 
ATOM   1112 O O   . PRO A 1 146 ? 59.112 34.079  0.422   1.00 28.43 ? 140 PRO L O   1 
ATOM   1113 C CB  . PRO A 1 146 ? 56.621 34.734  2.699   1.00 12.96 ? 140 PRO L CB  1 
ATOM   1114 C CG  . PRO A 1 146 ? 56.124 35.867  1.888   1.00 17.59 ? 140 PRO L CG  1 
ATOM   1115 C CD  . PRO A 1 146 ? 57.119 36.941  2.137   1.00 12.57 ? 140 PRO L CD  1 
ATOM   1116 N N   . LYS A 1 147 ? 58.421 32.481  1.846   1.00 24.38 ? 141 LYS L N   1 
ATOM   1117 C CA  . LYS A 1 147 ? 58.839 31.351  1.032   1.00 31.14 ? 141 LYS L CA  1 
ATOM   1118 C C   . LYS A 1 147 ? 58.094 31.232  -0.295  1.00 34.20 ? 141 LYS L C   1 
ATOM   1119 O O   . LYS A 1 147 ? 58.677 30.822  -1.302  1.00 38.17 ? 141 LYS L O   1 
ATOM   1120 C CB  . LYS A 1 147 ? 58.661 30.060  1.841   1.00 35.60 ? 141 LYS L CB  1 
ATOM   1121 C CG  . LYS A 1 147 ? 59.336 28.823  1.256   1.00 44.24 ? 141 LYS L CG  1 
ATOM   1122 C CD  . LYS A 1 147 ? 59.060 27.595  2.121   1.00 49.17 ? 141 LYS L CD  1 
ATOM   1123 C CE  . LYS A 1 147 ? 59.794 26.350  1.611   1.00 53.03 ? 141 LYS L CE  1 
ATOM   1124 N NZ  . LYS A 1 147 ? 61.281 26.418  1.782   1.00 54.55 ? 141 LYS L NZ  1 
ATOM   1125 N N   . ASP A 1 148 ? 56.809 31.573  -0.287  1.00 35.91 ? 142 ASP L N   1 
ATOM   1126 C CA  . ASP A 1 148 ? 55.973 31.469  -1.478  1.00 33.87 ? 142 ASP L CA  1 
ATOM   1127 C C   . ASP A 1 148 ? 56.371 32.426  -2.574  1.00 35.11 ? 142 ASP L C   1 
ATOM   1128 O O   . ASP A 1 148 ? 56.501 33.627  -2.354  1.00 35.25 ? 142 ASP L O   1 
ATOM   1129 C CB  . ASP A 1 148 ? 54.507 31.677  -1.129  1.00 33.51 ? 142 ASP L CB  1 
ATOM   1130 C CG  . ASP A 1 148 ? 54.075 30.846  0.059   1.00 41.59 ? 142 ASP L CG  1 
ATOM   1131 O OD1 . ASP A 1 148 ? 53.525 31.433  1.017   1.00 47.89 ? 142 ASP L OD1 1 
ATOM   1132 O OD2 . ASP A 1 148 ? 54.301 29.613  0.047   1.00 40.16 ? 142 ASP L OD2 1 
ATOM   1133 N N   . ILE A 1 149 ? 56.638 31.858  -3.743  1.00 34.59 ? 143 ILE L N   1 
ATOM   1134 C CA  . ILE A 1 149 ? 57.010 32.619  -4.922  1.00 27.44 ? 143 ILE L CA  1 
ATOM   1135 C C   . ILE A 1 149 ? 56.600 31.777  -6.115  1.00 27.46 ? 143 ILE L C   1 
ATOM   1136 O O   . ILE A 1 149 ? 56.613 30.550  -6.045  1.00 30.39 ? 143 ILE L O   1 
ATOM   1137 C CB  . ILE A 1 149 ? 58.508 32.896  -4.969  1.00 16.69 ? 143 ILE L CB  1 
ATOM   1138 C CG1 . ILE A 1 149 ? 58.784 34.034  -5.940  1.00 12.27 ? 143 ILE L CG1 1 
ATOM   1139 C CG2 . ILE A 1 149 ? 59.275 31.644  -5.355  1.00 19.36 ? 143 ILE L CG2 1 
ATOM   1140 C CD1 . ILE A 1 149 ? 60.212 34.526  -5.907  1.00 13.18 ? 143 ILE L CD1 1 
ATOM   1141 N N   . ASN A 1 150 ? 56.150 32.435  -7.174  1.00 29.25 ? 144 ASN L N   1 
ATOM   1142 C CA  . ASN A 1 150 ? 55.734 31.743  -8.386  1.00 29.88 ? 144 ASN L CA  1 
ATOM   1143 C C   . ASN A 1 150 ? 56.772 32.057  -9.450  1.00 28.55 ? 144 ASN L C   1 
ATOM   1144 O O   . ASN A 1 150 ? 57.215 33.201  -9.552  1.00 29.15 ? 144 ASN L O   1 
ATOM   1145 C CB  . ASN A 1 150 ? 54.358 32.259  -8.824  1.00 33.94 ? 144 ASN L CB  1 
ATOM   1146 C CG  . ASN A 1 150 ? 53.885 31.645  -10.121 1.00 30.97 ? 144 ASN L CG  1 
ATOM   1147 O OD1 . ASN A 1 150 ? 53.409 30.516  -10.144 1.00 30.33 ? 144 ASN L OD1 1 
ATOM   1148 N ND2 . ASN A 1 150 ? 54.011 32.390  -11.209 1.00 33.46 ? 144 ASN L ND2 1 
ATOM   1149 N N   . VAL A 1 151 ? 57.214 31.047  -10.190 1.00 28.43 ? 145 VAL L N   1 
ATOM   1150 C CA  . VAL A 1 151 ? 58.189 31.271  -11.257 1.00 27.34 ? 145 VAL L CA  1 
ATOM   1151 C C   . VAL A 1 151 ? 57.680 30.737  -12.600 1.00 30.08 ? 145 VAL L C   1 
ATOM   1152 O O   . VAL A 1 151 ? 57.297 29.563  -12.721 1.00 24.40 ? 145 VAL L O   1 
ATOM   1153 C CB  . VAL A 1 151 ? 59.581 30.662  -10.926 1.00 30.35 ? 145 VAL L CB  1 
ATOM   1154 C CG1 . VAL A 1 151 ? 59.518 29.138  -10.890 1.00 34.27 ? 145 VAL L CG1 1 
ATOM   1155 C CG2 . VAL A 1 151 ? 60.620 31.135  -11.937 1.00 27.08 ? 145 VAL L CG2 1 
ATOM   1156 N N   . LYS A 1 152 ? 57.589 31.628  -13.584 1.00 30.78 ? 146 LYS L N   1 
ATOM   1157 C CA  . LYS A 1 152 ? 57.141 31.253  -14.922 1.00 34.29 ? 146 LYS L CA  1 
ATOM   1158 C C   . LYS A 1 152 ? 58.303 31.353  -15.893 1.00 32.90 ? 146 LYS L C   1 
ATOM   1159 O O   . LYS A 1 152 ? 59.151 32.239  -15.767 1.00 30.18 ? 146 LYS L O   1 
ATOM   1160 C CB  . LYS A 1 152 ? 56.000 32.152  -15.411 1.00 25.55 ? 146 LYS L CB  1 
ATOM   1161 C CG  . LYS A 1 152 ? 54.683 31.931  -14.698 1.00 26.02 ? 146 LYS L CG  1 
ATOM   1162 C CD  . LYS A 1 152 ? 53.574 32.765  -15.313 1.00 25.56 ? 146 LYS L CD  1 
ATOM   1163 C CE  . LYS A 1 152 ? 52.364 32.884  -14.388 1.00 27.37 ? 146 LYS L CE  1 
ATOM   1164 N NZ  . LYS A 1 152 ? 52.609 33.853  -13.265 1.00 33.64 ? 146 LYS L NZ  1 
ATOM   1165 N N   . TRP A 1 153 ? 58.365 30.395  -16.812 1.00 37.17 ? 147 TRP L N   1 
ATOM   1166 C CA  . TRP A 1 153 ? 59.380 30.359  -17.860 1.00 33.89 ? 147 TRP L CA  1 
ATOM   1167 C C   . TRP A 1 153 ? 58.637 30.733  -19.129 1.00 35.40 ? 147 TRP L C   1 
ATOM   1168 O O   . TRP A 1 153 ? 57.627 30.105  -19.453 1.00 32.46 ? 147 TRP L O   1 
ATOM   1169 C CB  . TRP A 1 153 ? 59.932 28.947  -18.017 1.00 33.70 ? 147 TRP L CB  1 
ATOM   1170 C CG  . TRP A 1 153 ? 61.094 28.671  -17.147 1.00 39.62 ? 147 TRP L CG  1 
ATOM   1171 C CD1 . TRP A 1 153 ? 61.141 27.833  -16.067 1.00 34.63 ? 147 TRP L CD1 1 
ATOM   1172 C CD2 . TRP A 1 153 ? 62.400 29.238  -17.277 1.00 45.97 ? 147 TRP L CD2 1 
ATOM   1173 N NE1 . TRP A 1 153 ? 62.398 27.847  -15.515 1.00 35.44 ? 147 TRP L NE1 1 
ATOM   1174 C CE2 . TRP A 1 153 ? 63.193 28.698  -16.238 1.00 43.70 ? 147 TRP L CE2 1 
ATOM   1175 C CE3 . TRP A 1 153 ? 62.980 30.151  -18.174 1.00 47.42 ? 147 TRP L CE3 1 
ATOM   1176 C CZ2 . TRP A 1 153 ? 64.539 29.041  -16.071 1.00 45.18 ? 147 TRP L CZ2 1 
ATOM   1177 C CZ3 . TRP A 1 153 ? 64.319 30.492  -18.007 1.00 46.11 ? 147 TRP L CZ3 1 
ATOM   1178 C CH2 . TRP A 1 153 ? 65.083 29.937  -16.963 1.00 48.20 ? 147 TRP L CH2 1 
ATOM   1179 N N   . LYS A 1 154 ? 59.088 31.785  -19.808 1.00 40.00 ? 148 LYS L N   1 
ATOM   1180 C CA  . LYS A 1 154 ? 58.455 32.229  -21.056 1.00 43.40 ? 148 LYS L CA  1 
ATOM   1181 C C   . LYS A 1 154 ? 59.445 32.222  -22.206 1.00 44.54 ? 148 LYS L C   1 
ATOM   1182 O O   . LYS A 1 154 ? 60.481 32.889  -22.143 1.00 41.48 ? 148 LYS L O   1 
ATOM   1183 C CB  . LYS A 1 154 ? 57.868 33.636  -20.912 1.00 39.73 ? 148 LYS L CB  1 
ATOM   1184 C CG  . LYS A 1 154 ? 56.618 33.701  -20.055 1.00 45.15 ? 148 LYS L CG  1 
ATOM   1185 C CD  . LYS A 1 154 ? 56.404 35.108  -19.529 1.00 47.10 ? 148 LYS L CD  1 
ATOM   1186 C CE  . LYS A 1 154 ? 55.274 35.161  -18.526 1.00 44.44 ? 148 LYS L CE  1 
ATOM   1187 N NZ  . LYS A 1 154 ? 53.929 34.954  -19.120 1.00 51.45 ? 148 LYS L NZ  1 
ATOM   1188 N N   . ILE A 1 155 ? 59.135 31.446  -23.239 1.00 46.29 ? 149 ILE L N   1 
ATOM   1189 C CA  . ILE A 1 155 ? 59.984 31.362  -24.421 1.00 53.15 ? 149 ILE L CA  1 
ATOM   1190 C C   . ILE A 1 155 ? 59.341 32.165  -25.557 1.00 53.80 ? 149 ILE L C   1 
ATOM   1191 O O   . ILE A 1 155 ? 58.319 31.756  -26.116 1.00 50.51 ? 149 ILE L O   1 
ATOM   1192 C CB  . ILE A 1 155 ? 60.171 29.906  -24.868 1.00 54.11 ? 149 ILE L CB  1 
ATOM   1193 C CG1 . ILE A 1 155 ? 60.730 29.073  -23.715 1.00 54.77 ? 149 ILE L CG1 1 
ATOM   1194 C CG2 . ILE A 1 155 ? 61.117 29.848  -26.044 1.00 56.19 ? 149 ILE L CG2 1 
ATOM   1195 C CD1 . ILE A 1 155 ? 60.892 27.611  -24.047 1.00 58.13 ? 149 ILE L CD1 1 
ATOM   1196 N N   . ASP A 1 156 ? 59.925 33.323  -25.865 1.00 56.14 ? 150 ASP L N   1 
ATOM   1197 C CA  . ASP A 1 156 ? 59.424 34.220  -26.917 1.00 59.01 ? 150 ASP L CA  1 
ATOM   1198 C C   . ASP A 1 156 ? 58.117 34.921  -26.523 1.00 59.27 ? 150 ASP L C   1 
ATOM   1199 O O   . ASP A 1 156 ? 57.616 35.778  -27.259 1.00 60.34 ? 150 ASP L O   1 
ATOM   1200 C CB  . ASP A 1 156 ? 59.233 33.467  -28.254 1.00 57.34 ? 150 ASP L CB  1 
ATOM   1201 C CG  . ASP A 1 156 ? 60.554 33.168  -28.967 1.00 54.63 ? 150 ASP L CG  1 
ATOM   1202 O OD1 . ASP A 1 156 ? 61.432 34.065  -28.987 1.00 49.03 ? 150 ASP L OD1 1 
ATOM   1203 O OD2 . ASP A 1 156 ? 60.702 32.047  -29.517 1.00 39.43 ? 150 ASP L OD2 1 
ATOM   1204 N N   . GLY A 1 157 ? 57.602 34.596  -25.339 1.00 57.16 ? 151 GLY L N   1 
ATOM   1205 C CA  . GLY A 1 157 ? 56.359 35.187  -24.871 1.00 51.17 ? 151 GLY L CA  1 
ATOM   1206 C C   . GLY A 1 157 ? 55.304 34.129  -24.599 1.00 49.41 ? 151 GLY L C   1 
ATOM   1207 O O   . GLY A 1 157 ? 54.160 34.447  -24.279 1.00 51.76 ? 151 GLY L O   1 
ATOM   1208 N N   . SER A 1 158 ? 55.675 32.869  -24.785 1.00 46.86 ? 152 SER L N   1 
ATOM   1209 C CA  . SER A 1 158 ? 54.782 31.747  -24.541 1.00 49.45 ? 152 SER L CA  1 
ATOM   1210 C C   . SER A 1 158 ? 55.274 31.088  -23.239 1.00 51.97 ? 152 SER L C   1 
ATOM   1211 O O   . SER A 1 158 ? 56.484 31.028  -22.979 1.00 53.52 ? 152 SER L O   1 
ATOM   1212 C CB  . SER A 1 158 ? 54.847 30.768  -25.721 1.00 49.37 ? 152 SER L CB  1 
ATOM   1213 O OG  . SER A 1 158 ? 53.848 29.760  -25.650 1.00 55.00 ? 152 SER L OG  1 
ATOM   1214 N N   . GLU A 1 159 ? 54.343 30.627  -22.409 1.00 50.09 ? 153 GLU L N   1 
ATOM   1215 C CA  . GLU A 1 159 ? 54.698 30.009  -21.139 1.00 42.91 ? 153 GLU L CA  1 
ATOM   1216 C C   . GLU A 1 159 ? 55.057 28.545  -21.277 1.00 37.64 ? 153 GLU L C   1 
ATOM   1217 O O   . GLU A 1 159 ? 54.223 27.727  -21.657 1.00 39.50 ? 153 GLU L O   1 
ATOM   1218 C CB  . GLU A 1 159 ? 53.569 30.168  -20.110 1.00 42.71 ? 153 GLU L CB  1 
ATOM   1219 C CG  . GLU A 1 159 ? 53.950 29.629  -18.732 1.00 44.49 ? 153 GLU L CG  1 
ATOM   1220 C CD  . GLU A 1 159 ? 52.892 29.828  -17.663 1.00 47.18 ? 153 GLU L CD  1 
ATOM   1221 O OE1 . GLU A 1 159 ? 52.958 29.107  -16.643 1.00 44.69 ? 153 GLU L OE1 1 
ATOM   1222 O OE2 . GLU A 1 159 ? 52.020 30.710  -17.817 1.00 48.79 ? 153 GLU L OE2 1 
ATOM   1223 N N   . ARG A 1 160 ? 56.291 28.221  -20.917 1.00 35.10 ? 154 ARG L N   1 
ATOM   1224 C CA  . ARG A 1 160 ? 56.789 26.856  -20.966 1.00 37.79 ? 154 ARG L CA  1 
ATOM   1225 C C   . ARG A 1 160 ? 56.723 26.240  -19.571 1.00 37.00 ? 154 ARG L C   1 
ATOM   1226 O O   . ARG A 1 160 ? 57.469 26.641  -18.686 1.00 43.08 ? 154 ARG L O   1 
ATOM   1227 C CB  . ARG A 1 160 ? 58.235 26.862  -21.465 1.00 39.47 ? 154 ARG L CB  1 
ATOM   1228 C CG  . ARG A 1 160 ? 58.844 25.484  -21.605 1.00 50.69 ? 154 ARG L CG  1 
ATOM   1229 C CD  . ARG A 1 160 ? 57.965 24.579  -22.450 1.00 55.96 ? 154 ARG L CD  1 
ATOM   1230 N NE  . ARG A 1 160 ? 58.552 23.254  -22.584 1.00 64.31 ? 154 ARG L NE  1 
ATOM   1231 C CZ  . ARG A 1 160 ? 59.295 22.868  -23.617 1.00 69.77 ? 154 ARG L CZ  1 
ATOM   1232 N NH1 . ARG A 1 160 ? 59.560 23.723  -24.595 1.00 72.50 ? 154 ARG L NH1 1 
ATOM   1233 N NH2 . ARG A 1 160 ? 59.796 21.639  -23.660 1.00 72.77 ? 154 ARG L NH2 1 
ATOM   1234 N N   . GLN A 1 161 ? 55.815 25.289  -19.368 1.00 38.53 ? 155 GLN L N   1 
ATOM   1235 C CA  . GLN A 1 161 ? 55.661 24.635  -18.067 1.00 37.06 ? 155 GLN L CA  1 
ATOM   1236 C C   . GLN A 1 161 ? 56.270 23.247  -17.947 1.00 42.28 ? 155 GLN L C   1 
ATOM   1237 O O   . GLN A 1 161 ? 56.535 22.792  -16.832 1.00 47.65 ? 155 GLN L O   1 
ATOM   1238 C CB  . GLN A 1 161 ? 54.190 24.583  -17.635 1.00 35.12 ? 155 GLN L CB  1 
ATOM   1239 C CG  . GLN A 1 161 ? 53.738 25.791  -16.806 1.00 31.06 ? 155 GLN L CG  1 
ATOM   1240 C CD  . GLN A 1 161 ? 52.290 25.698  -16.332 1.00 30.96 ? 155 GLN L CD  1 
ATOM   1241 O OE1 . GLN A 1 161 ? 51.641 26.717  -16.084 1.00 29.66 ? 155 GLN L OE1 1 
ATOM   1242 N NE2 . GLN A 1 161 ? 51.777 24.481  -16.210 1.00 31.62 ? 155 GLN L NE2 1 
ATOM   1243 N N   . ASN A 1 162 ? 56.479 22.565  -19.070 1.00 44.83 ? 156 ASN L N   1 
ATOM   1244 C CA  . ASN A 1 162 ? 57.068 21.223  -19.040 1.00 48.19 ? 156 ASN L CA  1 
ATOM   1245 C C   . ASN A 1 162 ? 58.590 21.295  -19.108 1.00 48.37 ? 156 ASN L C   1 
ATOM   1246 O O   . ASN A 1 162 ? 59.146 22.093  -19.864 1.00 46.24 ? 156 ASN L O   1 
ATOM   1247 C CB  . ASN A 1 162 ? 56.543 20.358  -20.188 1.00 55.83 ? 156 ASN L CB  1 
ATOM   1248 C CG  . ASN A 1 162 ? 55.038 20.158  -20.130 1.00 67.29 ? 156 ASN L CG  1 
ATOM   1249 O OD1 . ASN A 1 162 ? 54.286 21.091  -19.848 1.00 75.02 ? 156 ASN L OD1 1 
ATOM   1250 N ND2 . ASN A 1 162 ? 54.590 18.943  -20.416 1.00 72.70 ? 156 ASN L ND2 1 
ATOM   1251 N N   . GLY A 1 163 ? 59.253 20.474  -18.295 1.00 49.71 ? 157 GLY L N   1 
ATOM   1252 C CA  . GLY A 1 163 ? 60.708 20.451  -18.270 1.00 47.45 ? 157 GLY L CA  1 
ATOM   1253 C C   . GLY A 1 163 ? 61.327 21.420  -17.277 1.00 46.09 ? 157 GLY L C   1 
ATOM   1254 O O   . GLY A 1 163 ? 62.472 21.855  -17.443 1.00 43.54 ? 157 GLY L O   1 
ATOM   1255 N N   . VAL A 1 164 ? 60.566 21.761  -16.243 1.00 48.04 ? 158 VAL L N   1 
ATOM   1256 C CA  . VAL A 1 164 ? 61.034 22.679  -15.213 1.00 46.52 ? 158 VAL L CA  1 
ATOM   1257 C C   . VAL A 1 164 ? 61.319 21.924  -13.922 1.00 45.03 ? 158 VAL L C   1 
ATOM   1258 O O   . VAL A 1 164 ? 60.500 21.131  -13.464 1.00 44.92 ? 158 VAL L O   1 
ATOM   1259 C CB  . VAL A 1 164 ? 59.998 23.789  -14.940 1.00 48.03 ? 158 VAL L CB  1 
ATOM   1260 C CG1 . VAL A 1 164 ? 60.466 24.679  -13.798 1.00 45.04 ? 158 VAL L CG1 1 
ATOM   1261 C CG2 . VAL A 1 164 ? 59.778 24.624  -16.207 1.00 47.01 ? 158 VAL L CG2 1 
ATOM   1262 N N   . LEU A 1 165 ? 62.502 22.155  -13.364 1.00 44.99 ? 159 LEU L N   1 
ATOM   1263 C CA  . LEU A 1 165 ? 62.923 21.523  -12.121 1.00 41.31 ? 159 LEU L CA  1 
ATOM   1264 C C   . LEU A 1 165 ? 63.173 22.616  -11.079 1.00 36.36 ? 159 LEU L C   1 
ATOM   1265 O O   . LEU A 1 165 ? 64.143 23.373  -11.169 1.00 29.52 ? 159 LEU L O   1 
ATOM   1266 C CB  . LEU A 1 165 ? 64.188 20.692  -12.368 1.00 47.87 ? 159 LEU L CB  1 
ATOM   1267 C CG  . LEU A 1 165 ? 64.801 19.861  -11.234 1.00 53.49 ? 159 LEU L CG  1 
ATOM   1268 C CD1 . LEU A 1 165 ? 65.431 18.599  -11.811 1.00 56.28 ? 159 LEU L CD1 1 
ATOM   1269 C CD2 . LEU A 1 165 ? 65.829 20.680  -10.456 1.00 54.38 ? 159 LEU L CD2 1 
ATOM   1270 N N   . ASN A 1 166 ? 62.252 22.731  -10.127 1.00 35.90 ? 160 ASN L N   1 
ATOM   1271 C CA  . ASN A 1 166 ? 62.352 23.733  -9.065  1.00 34.80 ? 160 ASN L CA  1 
ATOM   1272 C C   . ASN A 1 166 ? 62.925 23.120  -7.785  1.00 34.07 ? 160 ASN L C   1 
ATOM   1273 O O   . ASN A 1 166 ? 62.703 21.938  -7.505  1.00 33.34 ? 160 ASN L O   1 
ATOM   1274 C CB  . ASN A 1 166 ? 60.978 24.351  -8.798  1.00 30.30 ? 160 ASN L CB  1 
ATOM   1275 C CG  . ASN A 1 166 ? 60.549 25.309  -9.891  1.00 34.23 ? 160 ASN L CG  1 
ATOM   1276 O OD1 . ASN A 1 166 ? 61.368 25.759  -10.685 1.00 36.52 ? 160 ASN L OD1 1 
ATOM   1277 N ND2 . ASN A 1 166 ? 59.267 25.649  -9.920  1.00 38.23 ? 160 ASN L ND2 1 
ATOM   1278 N N   . SER A 1 167 ? 63.661 23.912  -7.014  1.00 31.96 ? 161 SER L N   1 
ATOM   1279 C CA  . SER A 1 167 ? 64.252 23.408  -5.782  1.00 34.63 ? 161 SER L CA  1 
ATOM   1280 C C   . SER A 1 167 ? 64.576 24.517  -4.790  1.00 34.01 ? 161 SER L C   1 
ATOM   1281 O O   . SER A 1 167 ? 65.503 25.295  -5.018  1.00 39.74 ? 161 SER L O   1 
ATOM   1282 C CB  . SER A 1 167 ? 65.527 22.645  -6.114  1.00 33.28 ? 161 SER L CB  1 
ATOM   1283 O OG  . SER A 1 167 ? 65.996 21.937  -4.991  1.00 42.52 ? 161 SER L OG  1 
ATOM   1284 N N   . TRP A 1 168 ? 63.810 24.603  -3.701  1.00 34.20 ? 162 TRP L N   1 
ATOM   1285 C CA  . TRP A 1 168 ? 64.052 25.628  -2.681  1.00 33.84 ? 162 TRP L CA  1 
ATOM   1286 C C   . TRP A 1 168 ? 65.130 25.208  -1.713  1.00 29.84 ? 162 TRP L C   1 
ATOM   1287 O O   . TRP A 1 168 ? 65.488 24.044  -1.618  1.00 30.60 ? 162 TRP L O   1 
ATOM   1288 C CB  . TRP A 1 168 ? 62.817 25.879  -1.821  1.00 38.04 ? 162 TRP L CB  1 
ATOM   1289 C CG  . TRP A 1 168 ? 61.791 26.755  -2.401  1.00 38.90 ? 162 TRP L CG  1 
ATOM   1290 C CD1 . TRP A 1 168 ? 61.436 28.009  -1.974  1.00 34.54 ? 162 TRP L CD1 1 
ATOM   1291 C CD2 . TRP A 1 168 ? 60.889 26.411  -3.448  1.00 35.61 ? 162 TRP L CD2 1 
ATOM   1292 N NE1 . TRP A 1 168 ? 60.349 28.454  -2.685  1.00 38.49 ? 162 TRP L NE1 1 
ATOM   1293 C CE2 . TRP A 1 168 ? 59.992 27.494  -3.597  1.00 37.53 ? 162 TRP L CE2 1 
ATOM   1294 C CE3 . TRP A 1 168 ? 60.747 25.286  -4.272  1.00 33.76 ? 162 TRP L CE3 1 
ATOM   1295 C CZ2 . TRP A 1 168 ? 58.963 27.485  -4.537  1.00 41.17 ? 162 TRP L CZ2 1 
ATOM   1296 C CZ3 . TRP A 1 168 ? 59.729 25.274  -5.204  1.00 40.72 ? 162 TRP L CZ3 1 
ATOM   1297 C CH2 . TRP A 1 168 ? 58.844 26.371  -5.331  1.00 44.31 ? 162 TRP L CH2 1 
ATOM   1298 N N   . THR A 1 169 ? 65.600 26.162  -0.938  1.00 26.41 ? 163 THR L N   1 
ATOM   1299 C CA  . THR A 1 169 ? 66.576 25.853  0.073   1.00 31.60 ? 163 THR L CA  1 
ATOM   1300 C C   . THR A 1 169 ? 65.862 25.979  1.425   1.00 34.43 ? 163 THR L C   1 
ATOM   1301 O O   . THR A 1 169 ? 64.702 26.408  1.495   1.00 32.56 ? 163 THR L O   1 
ATOM   1302 C CB  . THR A 1 169 ? 67.719 26.839  0.021   1.00 28.03 ? 163 THR L CB  1 
ATOM   1303 O OG1 . THR A 1 169 ? 67.206 28.161  0.211   1.00 29.55 ? 163 THR L OG1 1 
ATOM   1304 C CG2 . THR A 1 169 ? 68.423 26.751  -1.307  1.00 31.40 ? 163 THR L CG2 1 
ATOM   1305 N N   . ASP A 1 170 ? 66.530 25.548  2.490   1.00 40.67 ? 164 ASP L N   1 
ATOM   1306 C CA  . ASP A 1 170 ? 65.967 25.683  3.832   1.00 41.95 ? 164 ASP L CA  1 
ATOM   1307 C C   . ASP A 1 170 ? 66.171 27.147  4.204   1.00 36.87 ? 164 ASP L C   1 
ATOM   1308 O O   . ASP A 1 170 ? 66.954 27.852  3.547   1.00 35.38 ? 164 ASP L O   1 
ATOM   1309 C CB  . ASP A 1 170 ? 66.705 24.789  4.832   1.00 43.04 ? 164 ASP L CB  1 
ATOM   1310 C CG  . ASP A 1 170 ? 66.314 23.336  4.709   1.00 45.73 ? 164 ASP L CG  1 
ATOM   1311 O OD1 . ASP A 1 170 ? 65.108 23.029  4.851   1.00 46.26 ? 164 ASP L OD1 1 
ATOM   1312 O OD2 . ASP A 1 170 ? 67.215 22.502  4.476   1.00 52.63 ? 164 ASP L OD2 1 
ATOM   1313 N N   . GLN A 1 171 ? 65.458 27.619  5.219   1.00 29.92 ? 165 GLN L N   1 
ATOM   1314 C CA  . GLN A 1 171 ? 65.615 29.007  5.626   1.00 30.55 ? 165 GLN L CA  1 
ATOM   1315 C C   . GLN A 1 171 ? 67.046 29.164  6.106   1.00 29.66 ? 165 GLN L C   1 
ATOM   1316 O O   . GLN A 1 171 ? 67.596 28.266  6.738   1.00 31.13 ? 165 GLN L O   1 
ATOM   1317 C CB  . GLN A 1 171 ? 64.631 29.356  6.733   1.00 30.13 ? 165 GLN L CB  1 
ATOM   1318 C CG  . GLN A 1 171 ? 64.520 30.837  7.017   1.00 32.27 ? 165 GLN L CG  1 
ATOM   1319 C CD  . GLN A 1 171 ? 63.400 31.154  7.992   1.00 34.20 ? 165 GLN L CD  1 
ATOM   1320 O OE1 . GLN A 1 171 ? 62.905 30.269  8.691   1.00 32.82 ? 165 GLN L OE1 1 
ATOM   1321 N NE2 . GLN A 1 171 ? 62.986 32.414  8.038   1.00 35.13 ? 165 GLN L NE2 1 
ATOM   1322 N N   . ASP A 1 172 ? 67.676 30.262  5.729   1.00 32.12 ? 166 ASP L N   1 
ATOM   1323 C CA  . ASP A 1 172 ? 69.053 30.511  6.117   1.00 41.78 ? 166 ASP L CA  1 
ATOM   1324 C C   . ASP A 1 172 ? 69.133 30.858  7.596   1.00 46.57 ? 166 ASP L C   1 
ATOM   1325 O O   . ASP A 1 172 ? 68.481 31.794  8.054   1.00 47.32 ? 166 ASP L O   1 
ATOM   1326 C CB  . ASP A 1 172 ? 69.625 31.650  5.279   1.00 46.32 ? 166 ASP L CB  1 
ATOM   1327 C CG  . ASP A 1 172 ? 71.135 31.722  5.335   1.00 51.36 ? 166 ASP L CG  1 
ATOM   1328 O OD1 . ASP A 1 172 ? 71.678 32.787  4.969   1.00 52.06 ? 166 ASP L OD1 1 
ATOM   1329 O OD2 . ASP A 1 172 ? 71.778 30.718  5.717   1.00 52.76 ? 166 ASP L OD2 1 
ATOM   1330 N N   . SER A 1 173 ? 69.968 30.130  8.327   1.00 52.41 ? 167 SER L N   1 
ATOM   1331 C CA  . SER A 1 173 ? 70.136 30.346  9.761   1.00 57.95 ? 167 SER L CA  1 
ATOM   1332 C C   . SER A 1 173 ? 70.606 31.746  10.135  1.00 55.86 ? 167 SER L C   1 
ATOM   1333 O O   . SER A 1 173 ? 70.435 32.169  11.270  1.00 56.69 ? 167 SER L O   1 
ATOM   1334 C CB  . SER A 1 173 ? 71.092 29.302  10.338  1.00 62.58 ? 167 SER L CB  1 
ATOM   1335 O OG  . SER A 1 173 ? 70.682 27.996  9.957   1.00 72.13 ? 167 SER L OG  1 
ATOM   1336 N N   . LYS A 1 174 ? 71.218 32.455  9.193   1.00 58.11 ? 168 LYS L N   1 
ATOM   1337 C CA  . LYS A 1 174 ? 71.679 33.807  9.474   1.00 60.76 ? 168 LYS L CA  1 
ATOM   1338 C C   . LYS A 1 174 ? 70.687 34.895  9.064   1.00 59.88 ? 168 LYS L C   1 
ATOM   1339 O O   . LYS A 1 174 ? 70.140 35.582  9.935   1.00 64.37 ? 168 LYS L O   1 
ATOM   1340 C CB  . LYS A 1 174 ? 73.064 34.081  8.871   1.00 66.39 ? 168 LYS L CB  1 
ATOM   1341 C CG  . LYS A 1 174 ? 73.196 33.816  7.385   1.00 70.31 ? 168 LYS L CG  1 
ATOM   1342 C CD  . LYS A 1 174 ? 74.478 34.421  6.826   1.00 74.22 ? 168 LYS L CD  1 
ATOM   1343 C CE  . LYS A 1 174 ? 74.341 35.924  6.623   1.00 72.18 ? 168 LYS L CE  1 
ATOM   1344 N NZ  . LYS A 1 174 ? 73.381 36.215  5.524   1.00 73.14 ? 168 LYS L NZ  1 
ATOM   1345 N N   . ASP A 1 175 ? 70.430 35.046  7.762   1.00 47.61 ? 169 ASP L N   1 
ATOM   1346 C CA  . ASP A 1 175 ? 69.502 36.084  7.322   1.00 39.85 ? 169 ASP L CA  1 
ATOM   1347 C C   . ASP A 1 175 ? 68.016 35.724  7.378   1.00 34.64 ? 169 ASP L C   1 
ATOM   1348 O O   . ASP A 1 175 ? 67.160 36.603  7.324   1.00 23.03 ? 169 ASP L O   1 
ATOM   1349 C CB  . ASP A 1 175 ? 69.887 36.635  5.941   1.00 46.28 ? 169 ASP L CB  1 
ATOM   1350 C CG  . ASP A 1 175 ? 69.931 35.573  4.863   1.00 44.90 ? 169 ASP L CG  1 
ATOM   1351 O OD1 . ASP A 1 175 ? 69.124 34.624  4.899   1.00 49.60 ? 169 ASP L OD1 1 
ATOM   1352 O OD2 . ASP A 1 175 ? 70.781 35.701  3.962   1.00 49.26 ? 169 ASP L OD2 1 
ATOM   1353 N N   . SER A 1 176 ? 67.714 34.437  7.498   1.00 35.43 ? 170 SER L N   1 
ATOM   1354 C CA  . SER A 1 176 ? 66.328 33.967  7.577   1.00 41.72 ? 170 SER L CA  1 
ATOM   1355 C C   . SER A 1 176 ? 65.530 34.070  6.268   1.00 40.81 ? 170 SER L C   1 
ATOM   1356 O O   . SER A 1 176 ? 64.296 34.089  6.290   1.00 38.74 ? 170 SER L O   1 
ATOM   1357 C CB  . SER A 1 176 ? 65.584 34.707  8.693   1.00 45.28 ? 170 SER L CB  1 
ATOM   1358 O OG  . SER A 1 176 ? 66.392 34.832  9.849   1.00 53.52 ? 170 SER L OG  1 
ATOM   1359 N N   . THR A 1 177 ? 66.229 34.094  5.135   1.00 41.31 ? 171 THR L N   1 
ATOM   1360 C CA  . THR A 1 177 ? 65.581 34.193  3.829   1.00 37.09 ? 171 THR L CA  1 
ATOM   1361 C C   . THR A 1 177 ? 65.739 32.894  3.056   1.00 36.37 ? 171 THR L C   1 
ATOM   1362 O O   . THR A 1 177 ? 66.699 32.154  3.277   1.00 38.98 ? 171 THR L O   1 
ATOM   1363 C CB  . THR A 1 177 ? 66.187 35.330  2.975   1.00 35.28 ? 171 THR L CB  1 
ATOM   1364 O OG1 . THR A 1 177 ? 67.562 35.037  2.679   1.00 35.06 ? 171 THR L OG1 1 
ATOM   1365 C CG2 . THR A 1 177 ? 66.092 36.659  3.708   1.00 28.07 ? 171 THR L CG2 1 
ATOM   1366 N N   . TYR A 1 178 ? 64.818 32.641  2.129   1.00 33.85 ? 172 TYR L N   1 
ATOM   1367 C CA  . TYR A 1 178 ? 64.849 31.441  1.301   1.00 32.62 ? 172 TYR L CA  1 
ATOM   1368 C C   . TYR A 1 178 ? 65.471 31.701  -0.077  1.00 34.47 ? 172 TYR L C   1 
ATOM   1369 O O   . TYR A 1 178 ? 65.665 32.849  -0.479  1.00 36.27 ? 172 TYR L O   1 
ATOM   1370 C CB  . TYR A 1 178 ? 63.437 30.909  1.124   1.00 29.70 ? 172 TYR L CB  1 
ATOM   1371 C CG  . TYR A 1 178 ? 62.732 30.617  2.424   1.00 30.59 ? 172 TYR L CG  1 
ATOM   1372 C CD1 . TYR A 1 178 ? 62.696 29.322  2.943   1.00 34.63 ? 172 TYR L CD1 1 
ATOM   1373 C CD2 . TYR A 1 178 ? 62.074 31.626  3.124   1.00 29.13 ? 172 TYR L CD2 1 
ATOM   1374 C CE1 . TYR A 1 178 ? 62.012 29.038  4.128   1.00 30.75 ? 172 TYR L CE1 1 
ATOM   1375 C CE2 . TYR A 1 178 ? 61.391 31.353  4.305   1.00 27.05 ? 172 TYR L CE2 1 
ATOM   1376 C CZ  . TYR A 1 178 ? 61.360 30.057  4.797   1.00 31.67 ? 172 TYR L CZ  1 
ATOM   1377 O OH  . TYR A 1 178 ? 60.642 29.769  5.932   1.00 39.64 ? 172 TYR L OH  1 
ATOM   1378 N N   . SER A 1 179 ? 65.816 30.629  -0.779  1.00 35.66 ? 173 SER L N   1 
ATOM   1379 C CA  . SER A 1 179 ? 66.396 30.716  -2.114  1.00 33.60 ? 173 SER L CA  1 
ATOM   1380 C C   . SER A 1 179 ? 65.793 29.615  -2.973  1.00 36.95 ? 173 SER L C   1 
ATOM   1381 O O   . SER A 1 179 ? 65.327 28.587  -2.446  1.00 37.77 ? 173 SER L O   1 
ATOM   1382 C CB  . SER A 1 179 ? 67.918 30.597  -2.072  1.00 29.56 ? 173 SER L CB  1 
ATOM   1383 O OG  . SER A 1 179 ? 68.508 31.857  -1.777  1.00 26.45 ? 173 SER L OG  1 
ATOM   1384 N N   . MET A 1 180 ? 65.790 29.837  -4.286  1.00 31.86 ? 174 MET L N   1 
ATOM   1385 C CA  . MET A 1 180 ? 65.208 28.883  -5.217  1.00 28.36 ? 174 MET L CA  1 
ATOM   1386 C C   . MET A 1 180 ? 65.909 28.866  -6.565  1.00 25.26 ? 174 MET L C   1 
ATOM   1387 O O   . MET A 1 180 ? 66.382 29.897  -7.030  1.00 24.17 ? 174 MET L O   1 
ATOM   1388 C CB  . MET A 1 180 ? 63.740 29.236  -5.434  1.00 29.56 ? 174 MET L CB  1 
ATOM   1389 C CG  . MET A 1 180 ? 63.027 28.335  -6.404  1.00 33.06 ? 174 MET L CG  1 
ATOM   1390 S SD  . MET A 1 180 ? 61.411 28.960  -6.750  1.00 42.09 ? 174 MET L SD  1 
ATOM   1391 C CE  . MET A 1 180 ? 60.782 27.684  -7.718  1.00 32.67 ? 174 MET L CE  1 
ATOM   1392 N N   . SER A 1 181 ? 66.018 27.683  -7.162  1.00 24.15 ? 175 SER L N   1 
ATOM   1393 C CA  . SER A 1 181 ? 66.614 27.554  -8.476  1.00 27.08 ? 175 SER L CA  1 
ATOM   1394 C C   . SER A 1 181 ? 65.590 26.867  -9.366  1.00 29.20 ? 175 SER L C   1 
ATOM   1395 O O   . SER A 1 181 ? 64.920 25.911  -8.939  1.00 26.13 ? 175 SER L O   1 
ATOM   1396 C CB  . SER A 1 181 ? 67.907 26.751  -8.438  1.00 25.84 ? 175 SER L CB  1 
ATOM   1397 O OG  . SER A 1 181 ? 67.656 25.367  -8.294  1.00 37.37 ? 175 SER L OG  1 
ATOM   1398 N N   . SER A 1 182 ? 65.415 27.418  -10.566 1.00 30.57 ? 176 SER L N   1 
ATOM   1399 C CA  . SER A 1 182 ? 64.479 26.890  -11.553 1.00 31.16 ? 176 SER L CA  1 
ATOM   1400 C C   . SER A 1 182 ? 65.328 26.513  -12.757 1.00 33.37 ? 176 SER L C   1 
ATOM   1401 O O   . SER A 1 182 ? 66.178 27.302  -13.207 1.00 28.75 ? 176 SER L O   1 
ATOM   1402 C CB  . SER A 1 182 ? 63.450 27.953  -11.942 1.00 30.39 ? 176 SER L CB  1 
ATOM   1403 O OG  . SER A 1 182 ? 62.343 27.383  -12.618 1.00 27.47 ? 176 SER L OG  1 
ATOM   1404 N N   . THR A 1 183 ? 65.142 25.287  -13.228 1.00 31.89 ? 177 THR L N   1 
ATOM   1405 C CA  . THR A 1 183 ? 65.903 24.785  -14.360 1.00 37.60 ? 177 THR L CA  1 
ATOM   1406 C C   . THR A 1 183 ? 64.994 24.335  -15.488 1.00 35.21 ? 177 THR L C   1 
ATOM   1407 O O   . THR A 1 183 ? 64.152 23.458  -15.303 1.00 32.43 ? 177 THR L O   1 
ATOM   1408 C CB  . THR A 1 183 ? 66.826 23.598  -13.942 1.00 38.92 ? 177 THR L CB  1 
ATOM   1409 O OG1 . THR A 1 183 ? 67.820 24.061  -13.022 1.00 46.16 ? 177 THR L OG1 1 
ATOM   1410 C CG2 . THR A 1 183 ? 67.531 23.007  -15.142 1.00 39.76 ? 177 THR L CG2 1 
ATOM   1411 N N   . LEU A 1 184 ? 65.132 24.994  -16.635 1.00 38.00 ? 178 LEU L N   1 
ATOM   1412 C CA  . LEU A 1 184 ? 64.371 24.652  -17.828 1.00 35.50 ? 178 LEU L CA  1 
ATOM   1413 C C   . LEU A 1 184 ? 65.330 23.880  -18.726 1.00 35.08 ? 178 LEU L C   1 
ATOM   1414 O O   . LEU A 1 184 ? 66.420 24.364  -19.053 1.00 29.60 ? 178 LEU L O   1 
ATOM   1415 C CB  . LEU A 1 184 ? 63.885 25.919  -18.541 1.00 36.45 ? 178 LEU L CB  1 
ATOM   1416 C CG  . LEU A 1 184 ? 63.203 25.780  -19.908 1.00 34.55 ? 178 LEU L CG  1 
ATOM   1417 C CD1 . LEU A 1 184 ? 62.015 24.826  -19.834 1.00 28.11 ? 178 LEU L CD1 1 
ATOM   1418 C CD2 . LEU A 1 184 ? 62.780 27.158  -20.416 1.00 31.32 ? 178 LEU L CD2 1 
ATOM   1419 N N   . THR A 1 185 ? 64.967 22.652  -19.059 1.00 35.80 ? 179 THR L N   1 
ATOM   1420 C CA  . THR A 1 185 ? 65.815 21.850  -19.920 1.00 46.61 ? 179 THR L CA  1 
ATOM   1421 C C   . THR A 1 185 ? 65.130 21.494  -21.231 1.00 49.89 ? 179 THR L C   1 
ATOM   1422 O O   . THR A 1 185 ? 64.067 20.863  -21.246 1.00 54.88 ? 179 THR L O   1 
ATOM   1423 C CB  . THR A 1 185 ? 66.306 20.577  -19.214 1.00 47.12 ? 179 THR L CB  1 
ATOM   1424 O OG1 . THR A 1 185 ? 67.305 20.937  -18.254 1.00 53.29 ? 179 THR L OG1 1 
ATOM   1425 C CG2 . THR A 1 185 ? 66.913 19.593  -20.214 1.00 51.25 ? 179 THR L CG2 1 
ATOM   1426 N N   . LEU A 1 186 ? 65.726 21.961  -22.323 1.00 46.92 ? 180 LEU L N   1 
ATOM   1427 C CA  . LEU A 1 186 ? 65.229 21.698  -23.661 1.00 45.54 ? 180 LEU L CA  1 
ATOM   1428 C C   . LEU A 1 186 ? 66.379 21.005  -24.381 1.00 46.58 ? 180 LEU L C   1 
ATOM   1429 O O   . LEU A 1 186 ? 67.394 20.660  -23.762 1.00 45.98 ? 180 LEU L O   1 
ATOM   1430 C CB  . LEU A 1 186 ? 64.875 23.001  -24.393 1.00 40.85 ? 180 LEU L CB  1 
ATOM   1431 C CG  . LEU A 1 186 ? 64.462 24.257  -23.622 1.00 39.95 ? 180 LEU L CG  1 
ATOM   1432 C CD1 . LEU A 1 186 ? 65.706 24.906  -23.009 1.00 37.58 ? 180 LEU L CD1 1 
ATOM   1433 C CD2 . LEU A 1 186 ? 63.780 25.245  -24.563 1.00 35.79 ? 180 LEU L CD2 1 
ATOM   1434 N N   . THR A 1 187 ? 66.219 20.799  -25.684 1.00 48.21 ? 181 THR L N   1 
ATOM   1435 C CA  . THR A 1 187 ? 67.248 20.160  -26.491 1.00 43.50 ? 181 THR L CA  1 
ATOM   1436 C C   . THR A 1 187 ? 67.993 21.239  -27.239 1.00 44.36 ? 181 THR L C   1 
ATOM   1437 O O   . THR A 1 187 ? 67.558 22.394  -27.270 1.00 40.15 ? 181 THR L O   1 
ATOM   1438 C CB  . THR A 1 187 ? 66.634 19.223  -27.528 1.00 43.20 ? 181 THR L CB  1 
ATOM   1439 O OG1 . THR A 1 187 ? 65.554 19.897  -28.197 1.00 45.88 ? 181 THR L OG1 1 
ATOM   1440 C CG2 . THR A 1 187 ? 66.136 17.941  -26.873 1.00 40.03 ? 181 THR L CG2 1 
ATOM   1441 N N   . LYS A 1 188 ? 69.114 20.863  -27.845 1.00 50.06 ? 182 LYS L N   1 
ATOM   1442 C CA  . LYS A 1 188 ? 69.894 21.810  -28.631 1.00 55.85 ? 182 LYS L CA  1 
ATOM   1443 C C   . LYS A 1 188 ? 68.945 22.346  -29.711 1.00 56.12 ? 182 LYS L C   1 
ATOM   1444 O O   . LYS A 1 188 ? 68.876 23.546  -29.956 1.00 51.58 ? 182 LYS L O   1 
ATOM   1445 C CB  . LYS A 1 188 ? 71.089 21.105  -29.286 1.00 57.77 ? 182 LYS L CB  1 
ATOM   1446 C CG  . LYS A 1 188 ? 72.200 22.054  -29.707 1.00 54.46 ? 182 LYS L CG  1 
ATOM   1447 C CD  . LYS A 1 188 ? 73.249 21.369  -30.565 1.00 50.14 ? 182 LYS L CD  1 
ATOM   1448 C CE  . LYS A 1 188 ? 74.483 22.247  -30.699 1.00 47.72 ? 182 LYS L CE  1 
ATOM   1449 N NZ  . LYS A 1 188 ? 74.145 23.653  -31.047 1.00 42.06 ? 182 LYS L NZ  1 
ATOM   1450 N N   . ASP A 1 189 ? 68.154 21.434  -30.273 1.00 60.11 ? 183 ASP L N   1 
ATOM   1451 C CA  . ASP A 1 189 ? 67.171 21.732  -31.313 1.00 62.70 ? 183 ASP L CA  1 
ATOM   1452 C C   . ASP A 1 189 ? 66.241 22.860  -30.874 1.00 61.52 ? 183 ASP L C   1 
ATOM   1453 O O   . ASP A 1 189 ? 66.315 23.978  -31.392 1.00 60.76 ? 183 ASP L O   1 
ATOM   1454 C CB  . ASP A 1 189 ? 66.322 20.488  -31.609 1.00 72.65 ? 183 ASP L CB  1 
ATOM   1455 C CG  . ASP A 1 189 ? 67.159 19.232  -31.824 1.00 83.16 ? 183 ASP L CG  1 
ATOM   1456 O OD1 . ASP A 1 189 ? 67.096 18.670  -32.939 1.00 90.43 ? 183 ASP L OD1 1 
ATOM   1457 O OD2 . ASP A 1 189 ? 67.856 18.788  -30.880 1.00 85.15 ? 183 ASP L OD2 1 
ATOM   1458 N N   . GLU A 1 190 ? 65.377 22.559  -29.906 1.00 57.58 ? 184 GLU L N   1 
ATOM   1459 C CA  . GLU A 1 190 ? 64.421 23.530  -29.390 1.00 55.37 ? 184 GLU L CA  1 
ATOM   1460 C C   . GLU A 1 190 ? 65.071 24.853  -28.985 1.00 55.39 ? 184 GLU L C   1 
ATOM   1461 O O   . GLU A 1 190 ? 64.486 25.920  -29.181 1.00 53.44 ? 184 GLU L O   1 
ATOM   1462 C CB  . GLU A 1 190 ? 63.651 22.939  -28.209 1.00 60.33 ? 184 GLU L CB  1 
ATOM   1463 C CG  . GLU A 1 190 ? 62.202 22.586  -28.513 1.00 68.73 ? 184 GLU L CG  1 
ATOM   1464 C CD  . GLU A 1 190 ? 61.343 23.808  -28.804 1.00 73.30 ? 184 GLU L CD  1 
ATOM   1465 O OE1 . GLU A 1 190 ? 60.757 24.374  -27.855 1.00 77.12 ? 184 GLU L OE1 1 
ATOM   1466 O OE2 . GLU A 1 190 ? 61.246 24.202  -29.984 1.00 79.03 ? 184 GLU L OE2 1 
ATOM   1467 N N   . TYR A 1 191 ? 66.276 24.787  -28.425 1.00 53.34 ? 185 TYR L N   1 
ATOM   1468 C CA  . TYR A 1 191 ? 66.981 25.993  -28.011 1.00 53.10 ? 185 TYR L CA  1 
ATOM   1469 C C   . TYR A 1 191 ? 67.310 26.820  -29.252 1.00 55.80 ? 185 TYR L C   1 
ATOM   1470 O O   . TYR A 1 191 ? 67.115 28.039  -29.273 1.00 54.39 ? 185 TYR L O   1 
ATOM   1471 C CB  . TYR A 1 191 ? 68.261 25.637  -27.239 1.00 47.32 ? 185 TYR L CB  1 
ATOM   1472 C CG  . TYR A 1 191 ? 68.930 26.839  -26.604 1.00 40.91 ? 185 TYR L CG  1 
ATOM   1473 C CD1 . TYR A 1 191 ? 70.219 27.219  -26.973 1.00 37.40 ? 185 TYR L CD1 1 
ATOM   1474 C CD2 . TYR A 1 191 ? 68.251 27.628  -25.671 1.00 36.17 ? 185 TYR L CD2 1 
ATOM   1475 C CE1 . TYR A 1 191 ? 70.815 28.361  -26.436 1.00 38.20 ? 185 TYR L CE1 1 
ATOM   1476 C CE2 . TYR A 1 191 ? 68.836 28.769  -25.129 1.00 32.45 ? 185 TYR L CE2 1 
ATOM   1477 C CZ  . TYR A 1 191 ? 70.116 29.131  -25.517 1.00 35.94 ? 185 TYR L CZ  1 
ATOM   1478 O OH  . TYR A 1 191 ? 70.697 30.266  -24.994 1.00 37.14 ? 185 TYR L OH  1 
ATOM   1479 N N   . GLU A 1 192 ? 67.764 26.127  -30.294 1.00 59.23 ? 186 GLU L N   1 
ATOM   1480 C CA  . GLU A 1 192 ? 68.119 26.739  -31.569 1.00 62.46 ? 186 GLU L CA  1 
ATOM   1481 C C   . GLU A 1 192 ? 66.902 27.404  -32.209 1.00 63.27 ? 186 GLU L C   1 
ATOM   1482 O O   . GLU A 1 192 ? 67.029 28.399  -32.928 1.00 62.87 ? 186 GLU L O   1 
ATOM   1483 C CB  . GLU A 1 192 ? 68.655 25.676  -32.538 1.00 66.49 ? 186 GLU L CB  1 
ATOM   1484 C CG  . GLU A 1 192 ? 69.995 25.054  -32.164 1.00 68.67 ? 186 GLU L CG  1 
ATOM   1485 C CD  . GLU A 1 192 ? 70.285 23.759  -32.929 1.00 72.21 ? 186 GLU L CD  1 
ATOM   1486 O OE1 . GLU A 1 192 ? 71.475 23.418  -33.088 1.00 78.59 ? 186 GLU L OE1 1 
ATOM   1487 O OE2 . GLU A 1 192 ? 69.334 23.068  -33.358 1.00 70.48 ? 186 GLU L OE2 1 
ATOM   1488 N N   . ARG A 1 193 ? 65.727 26.832  -31.966 1.00 61.89 ? 187 ARG L N   1 
ATOM   1489 C CA  . ARG A 1 193 ? 64.490 27.349  -32.536 1.00 60.22 ? 187 ARG L CA  1 
ATOM   1490 C C   . ARG A 1 193 ? 63.925 28.617  -31.904 1.00 59.75 ? 187 ARG L C   1 
ATOM   1491 O O   . ARG A 1 193 ? 62.958 29.178  -32.426 1.00 64.96 ? 187 ARG L O   1 
ATOM   1492 C CB  . ARG A 1 193 ? 63.401 26.273  -32.517 1.00 58.55 ? 187 ARG L CB  1 
ATOM   1493 C CG  . ARG A 1 193 ? 63.705 25.052  -33.358 1.00 64.54 ? 187 ARG L CG  1 
ATOM   1494 C CD  . ARG A 1 193 ? 62.515 24.114  -33.378 1.00 69.08 ? 187 ARG L CD  1 
ATOM   1495 N NE  . ARG A 1 193 ? 62.844 22.808  -33.948 1.00 73.76 ? 187 ARG L NE  1 
ATOM   1496 C CZ  . ARG A 1 193 ? 62.135 21.701  -33.740 1.00 77.08 ? 187 ARG L CZ  1 
ATOM   1497 N NH1 . ARG A 1 193 ? 61.048 21.728  -32.974 1.00 78.09 ? 187 ARG L NH1 1 
ATOM   1498 N NH2 . ARG A 1 193 ? 62.514 20.559  -34.296 1.00 79.13 ? 187 ARG L NH2 1 
ATOM   1499 N N   . HIS A 1 194 ? 64.499 29.091  -30.802 1.00 53.82 ? 188 HIS L N   1 
ATOM   1500 C CA  . HIS A 1 194 ? 63.932 30.271  -30.158 1.00 50.10 ? 188 HIS L CA  1 
ATOM   1501 C C   . HIS A 1 194 ? 64.920 31.373  -29.877 1.00 49.75 ? 188 HIS L C   1 
ATOM   1502 O O   . HIS A 1 194 ? 66.121 31.157  -29.912 1.00 53.45 ? 188 HIS L O   1 
ATOM   1503 C CB  . HIS A 1 194 ? 63.201 29.860  -28.882 1.00 48.35 ? 188 HIS L CB  1 
ATOM   1504 C CG  . HIS A 1 194 ? 62.169 28.799  -29.107 1.00 44.44 ? 188 HIS L CG  1 
ATOM   1505 N ND1 . HIS A 1 194 ? 60.971 29.052  -29.740 1.00 44.18 ? 188 HIS L ND1 1 
ATOM   1506 C CD2 . HIS A 1 194 ? 62.189 27.468  -28.858 1.00 43.55 ? 188 HIS L CD2 1 
ATOM   1507 C CE1 . HIS A 1 194 ? 60.300 27.921  -29.878 1.00 45.78 ? 188 HIS L CE1 1 
ATOM   1508 N NE2 . HIS A 1 194 ? 61.018 26.945  -29.351 1.00 40.24 ? 188 HIS L NE2 1 
ATOM   1509 N N   . ASN A 1 195 ? 64.404 32.562  -29.592 1.00 50.65 ? 189 ASN L N   1 
ATOM   1510 C CA  . ASN A 1 195 ? 65.263 33.707  -29.323 1.00 55.94 ? 189 ASN L CA  1 
ATOM   1511 C C   . ASN A 1 195 ? 65.334 34.154  -27.867 1.00 56.33 ? 189 ASN L C   1 
ATOM   1512 O O   . ASN A 1 195 ? 66.302 33.856  -27.173 1.00 55.51 ? 189 ASN L O   1 
ATOM   1513 C CB  . ASN A 1 195 ? 64.870 34.892  -30.209 1.00 61.09 ? 189 ASN L CB  1 
ATOM   1514 C CG  . ASN A 1 195 ? 65.578 34.882  -31.547 1.00 65.12 ? 189 ASN L CG  1 
ATOM   1515 O OD1 . ASN A 1 195 ? 66.585 35.570  -31.733 1.00 65.67 ? 189 ASN L OD1 1 
ATOM   1516 N ND2 . ASN A 1 195 ? 65.047 34.115  -32.496 1.00 66.24 ? 189 ASN L ND2 1 
ATOM   1517 N N   . SER A 1 196 ? 64.326 34.897  -27.416 1.00 57.35 ? 190 SER L N   1 
ATOM   1518 C CA  . SER A 1 196 ? 64.308 35.407  -26.050 1.00 58.16 ? 190 SER L CA  1 
ATOM   1519 C C   . SER A 1 196 ? 63.741 34.455  -25.010 1.00 54.88 ? 190 SER L C   1 
ATOM   1520 O O   . SER A 1 196 ? 62.677 33.852  -25.203 1.00 53.35 ? 190 SER L O   1 
ATOM   1521 C CB  . SER A 1 196 ? 63.564 36.740  -25.978 1.00 58.50 ? 190 SER L CB  1 
ATOM   1522 O OG  . SER A 1 196 ? 63.770 37.360  -24.720 1.00 63.65 ? 190 SER L OG  1 
ATOM   1523 N N   . TYR A 1 197 ? 64.481 34.329  -23.912 1.00 52.76 ? 191 TYR L N   1 
ATOM   1524 C CA  . TYR A 1 197 ? 64.111 33.483  -22.787 1.00 47.43 ? 191 TYR L CA  1 
ATOM   1525 C C   . TYR A 1 197 ? 63.940 34.378  -21.577 1.00 45.29 ? 191 TYR L C   1 
ATOM   1526 O O   . TYR A 1 197 ? 64.706 35.328  -21.376 1.00 41.34 ? 191 TYR L O   1 
ATOM   1527 C CB  . TYR A 1 197 ? 65.177 32.426  -22.529 1.00 43.36 ? 191 TYR L CB  1 
ATOM   1528 C CG  . TYR A 1 197 ? 65.202 31.353  -23.580 1.00 43.02 ? 191 TYR L CG  1 
ATOM   1529 C CD1 . TYR A 1 197 ? 64.587 30.124  -23.357 1.00 45.63 ? 191 TYR L CD1 1 
ATOM   1530 C CD2 . TYR A 1 197 ? 65.826 31.567  -24.807 1.00 44.85 ? 191 TYR L CD2 1 
ATOM   1531 C CE1 . TYR A 1 197 ? 64.590 29.127  -24.334 1.00 49.35 ? 191 TYR L CE1 1 
ATOM   1532 C CE2 . TYR A 1 197 ? 65.837 30.578  -25.793 1.00 47.08 ? 191 TYR L CE2 1 
ATOM   1533 C CZ  . TYR A 1 197 ? 65.219 29.359  -25.550 1.00 48.69 ? 191 TYR L CZ  1 
ATOM   1534 O OH  . TYR A 1 197 ? 65.240 28.368  -26.508 1.00 49.89 ? 191 TYR L OH  1 
ATOM   1535 N N   . THR A 1 198 ? 62.913 34.082  -20.791 1.00 46.32 ? 192 THR L N   1 
ATOM   1536 C CA  . THR A 1 198 ? 62.602 34.876  -19.618 1.00 48.61 ? 192 THR L CA  1 
ATOM   1537 C C   . THR A 1 198 ? 62.190 34.063  -18.389 1.00 46.63 ? 192 THR L C   1 
ATOM   1538 O O   . THR A 1 198 ? 61.491 33.043  -18.481 1.00 43.09 ? 192 THR L O   1 
ATOM   1539 C CB  . THR A 1 198 ? 61.467 35.876  -19.945 1.00 50.86 ? 192 THR L CB  1 
ATOM   1540 O OG1 . THR A 1 198 ? 61.842 36.671  -21.078 1.00 50.88 ? 192 THR L OG1 1 
ATOM   1541 C CG2 . THR A 1 198 ? 61.179 36.785  -18.754 1.00 44.42 ? 192 THR L CG2 1 
ATOM   1542 N N   . CYS A 1 199 ? 62.667 34.531  -17.244 1.00 44.07 ? 193 CYS L N   1 
ATOM   1543 C CA  . CYS A 1 199 ? 62.362 33.950  -15.951 1.00 40.22 ? 193 CYS L CA  1 
ATOM   1544 C C   . CYS A 1 199 ? 61.488 35.016  -15.291 1.00 38.83 ? 193 CYS L C   1 
ATOM   1545 O O   . CYS A 1 199 ? 61.952 36.141  -15.029 1.00 34.03 ? 193 CYS L O   1 
ATOM   1546 C CB  . CYS A 1 199 ? 63.647 33.758  -15.149 1.00 43.33 ? 193 CYS L CB  1 
ATOM   1547 S SG  . CYS A 1 199 ? 63.425 33.068  -13.476 1.00 43.09 ? 193 CYS L SG  1 
ATOM   1548 N N   . GLU A 1 200 ? 60.212 34.695  -15.112 1.00 32.99 ? 194 GLU L N   1 
ATOM   1549 C CA  . GLU A 1 200 ? 59.269 35.621  -14.507 1.00 34.86 ? 194 GLU L CA  1 
ATOM   1550 C C   . GLU A 1 200 ? 58.920 35.169  -13.083 1.00 33.10 ? 194 GLU L C   1 
ATOM   1551 O O   . GLU A 1 200 ? 58.439 34.052  -12.880 1.00 30.66 ? 194 GLU L O   1 
ATOM   1552 C CB  . GLU A 1 200 ? 58.011 35.709  -15.373 1.00 36.25 ? 194 GLU L CB  1 
ATOM   1553 C CG  . GLU A 1 200 ? 57.092 36.855  -14.998 1.00 43.12 ? 194 GLU L CG  1 
ATOM   1554 C CD  . GLU A 1 200 ? 55.842 36.898  -15.845 1.00 47.65 ? 194 GLU L CD  1 
ATOM   1555 O OE1 . GLU A 1 200 ? 55.756 37.781  -16.722 1.00 52.37 ? 194 GLU L OE1 1 
ATOM   1556 O OE2 . GLU A 1 200 ? 54.943 36.056  -15.633 1.00 52.49 ? 194 GLU L OE2 1 
ATOM   1557 N N   . ALA A 1 201 ? 59.117 36.056  -12.113 1.00 29.55 ? 195 ALA L N   1 
ATOM   1558 C CA  . ALA A 1 201 ? 58.856 35.748  -10.711 1.00 28.25 ? 195 ALA L CA  1 
ATOM   1559 C C   . ALA A 1 201 ? 57.775 36.621  -10.092 1.00 27.26 ? 195 ALA L C   1 
ATOM   1560 O O   . ALA A 1 201 ? 57.862 37.837  -10.142 1.00 32.44 ? 195 ALA L O   1 
ATOM   1561 C CB  . ALA A 1 201 ? 60.139 35.894  -9.917  1.00 27.11 ? 195 ALA L CB  1 
ATOM   1562 N N   . THR A 1 202 ? 56.755 36.001  -9.513  1.00 27.94 ? 196 THR L N   1 
ATOM   1563 C CA  . THR A 1 202 ? 55.681 36.743  -8.859  1.00 30.25 ? 196 THR L CA  1 
ATOM   1564 C C   . THR A 1 202 ? 55.814 36.452  -7.360  1.00 29.97 ? 196 THR L C   1 
ATOM   1565 O O   . THR A 1 202 ? 55.861 35.288  -6.954  1.00 26.11 ? 196 THR L O   1 
ATOM   1566 C CB  . THR A 1 202 ? 54.301 36.302  -9.370  1.00 29.49 ? 196 THR L CB  1 
ATOM   1567 O OG1 . THR A 1 202 ? 54.330 36.233  -10.801 1.00 35.84 ? 196 THR L OG1 1 
ATOM   1568 C CG2 . THR A 1 202 ? 53.231 37.305  -8.941  1.00 22.24 ? 196 THR L CG2 1 
ATOM   1569 N N   . HIS A 1 203 ? 55.880 37.515  -6.561  1.00 31.65 ? 197 HIS L N   1 
ATOM   1570 C CA  . HIS A 1 203 ? 56.070 37.443  -5.109  1.00 34.01 ? 197 HIS L CA  1 
ATOM   1571 C C   . HIS A 1 203 ? 55.407 38.696  -4.529  1.00 38.45 ? 197 HIS L C   1 
ATOM   1572 O O   . HIS A 1 203 ? 55.464 39.767  -5.141  1.00 44.14 ? 197 HIS L O   1 
ATOM   1573 C CB  . HIS A 1 203 ? 57.579 37.497  -4.831  1.00 33.88 ? 197 HIS L CB  1 
ATOM   1574 C CG  . HIS A 1 203 ? 57.981 37.080  -3.452  1.00 34.98 ? 197 HIS L CG  1 
ATOM   1575 N ND1 . HIS A 1 203 ? 58.632 37.924  -2.578  1.00 35.07 ? 197 HIS L ND1 1 
ATOM   1576 C CD2 . HIS A 1 203 ? 57.874 35.891  -2.815  1.00 35.70 ? 197 HIS L CD2 1 
ATOM   1577 C CE1 . HIS A 1 203 ? 58.906 37.272  -1.462  1.00 32.53 ? 197 HIS L CE1 1 
ATOM   1578 N NE2 . HIS A 1 203 ? 58.456 36.037  -1.580  1.00 36.22 ? 197 HIS L NE2 1 
ATOM   1579 N N   . LYS A 1 204 ? 54.858 38.587  -3.322  1.00 40.89 ? 198 LYS L N   1 
ATOM   1580 C CA  . LYS A 1 204 ? 54.178 39.705  -2.658  1.00 40.47 ? 198 LYS L CA  1 
ATOM   1581 C C   . LYS A 1 204 ? 55.010 40.962  -2.427  1.00 38.49 ? 198 LYS L C   1 
ATOM   1582 O O   . LYS A 1 204 ? 54.468 42.012  -2.097  1.00 42.80 ? 198 LYS L O   1 
ATOM   1583 C CB  . LYS A 1 204 ? 53.591 39.263  -1.317  1.00 41.58 ? 198 LYS L CB  1 
ATOM   1584 C CG  . LYS A 1 204 ? 54.625 38.942  -0.264  1.00 43.40 ? 198 LYS L CG  1 
ATOM   1585 C CD  . LYS A 1 204 ? 53.979 38.781  1.094   1.00 49.33 ? 198 LYS L CD  1 
ATOM   1586 C CE  . LYS A 1 204 ? 53.383 40.096  1.565   1.00 52.89 ? 198 LYS L CE  1 
ATOM   1587 N NZ  . LYS A 1 204 ? 52.833 39.987  2.942   1.00 58.17 ? 198 LYS L NZ  1 
ATOM   1588 N N   . THR A 1 205 ? 56.322 40.864  -2.574  1.00 39.02 ? 199 THR L N   1 
ATOM   1589 C CA  . THR A 1 205 ? 57.175 42.021  -2.357  1.00 39.80 ? 199 THR L CA  1 
ATOM   1590 C C   . THR A 1 205 ? 57.189 43.008  -3.523  1.00 43.83 ? 199 THR L C   1 
ATOM   1591 O O   . THR A 1 205 ? 57.854 44.043  -3.461  1.00 45.34 ? 199 THR L O   1 
ATOM   1592 C CB  . THR A 1 205 ? 58.583 41.586  -2.022  1.00 36.93 ? 199 THR L CB  1 
ATOM   1593 O OG1 . THR A 1 205 ? 59.060 40.715  -3.051  1.00 36.63 ? 199 THR L OG1 1 
ATOM   1594 C CG2 . THR A 1 205 ? 58.585 40.833  -0.697  1.00 43.12 ? 199 THR L CG2 1 
ATOM   1595 N N   . SER A 1 206 ? 56.466 42.687  -4.589  1.00 46.99 ? 200 SER L N   1 
ATOM   1596 C CA  . SER A 1 206 ? 56.400 43.577  -5.734  1.00 47.74 ? 200 SER L CA  1 
ATOM   1597 C C   . SER A 1 206 ? 55.001 43.579  -6.319  1.00 46.89 ? 200 SER L C   1 
ATOM   1598 O O   . SER A 1 206 ? 54.260 42.601  -6.191  1.00 42.69 ? 200 SER L O   1 
ATOM   1599 C CB  . SER A 1 206 ? 57.408 43.180  -6.810  1.00 52.50 ? 200 SER L CB  1 
ATOM   1600 O OG  . SER A 1 206 ? 57.485 44.187  -7.813  1.00 57.93 ? 200 SER L OG  1 
ATOM   1601 N N   . THR A 1 207 ? 54.661 44.691  -6.962  1.00 46.17 ? 201 THR L N   1 
ATOM   1602 C CA  . THR A 1 207 ? 53.361 44.887  -7.585  1.00 47.57 ? 201 THR L CA  1 
ATOM   1603 C C   . THR A 1 207 ? 53.321 44.172  -8.932  1.00 45.45 ? 201 THR L C   1 
ATOM   1604 O O   . THR A 1 207 ? 52.311 43.578  -9.313  1.00 46.71 ? 201 THR L O   1 
ATOM   1605 C CB  . THR A 1 207 ? 53.113 46.388  -7.820  1.00 51.28 ? 201 THR L CB  1 
ATOM   1606 O OG1 . THR A 1 207 ? 53.917 47.151  -6.903  1.00 53.94 ? 201 THR L OG1 1 
ATOM   1607 C CG2 . THR A 1 207 ? 51.636 46.729  -7.608  1.00 51.72 ? 201 THR L CG2 1 
ATOM   1608 N N   . SER A 1 208 ? 54.440 44.219  -9.636  1.00 43.80 ? 202 SER L N   1 
ATOM   1609 C CA  . SER A 1 208 ? 54.547 43.602  -10.942 1.00 44.14 ? 202 SER L CA  1 
ATOM   1610 C C   . SER A 1 208 ? 55.571 42.488  -10.852 1.00 43.98 ? 202 SER L C   1 
ATOM   1611 O O   . SER A 1 208 ? 56.509 42.574  -10.064 1.00 47.99 ? 202 SER L O   1 
ATOM   1612 C CB  . SER A 1 208 ? 55.024 44.650  -11.942 1.00 47.94 ? 202 SER L CB  1 
ATOM   1613 O OG  . SER A 1 208 ? 54.408 45.902  -11.684 1.00 56.29 ? 202 SER L OG  1 
ATOM   1614 N N   . PRO A 1 209 ? 55.406 41.422  -11.649 1.00 40.38 ? 203 PRO L N   1 
ATOM   1615 C CA  . PRO A 1 209 ? 56.350 40.306  -11.629 1.00 39.09 ? 203 PRO L CA  1 
ATOM   1616 C C   . PRO A 1 209 ? 57.756 40.793  -11.938 1.00 40.54 ? 203 PRO L C   1 
ATOM   1617 O O   . PRO A 1 209 ? 57.935 41.894  -12.458 1.00 40.58 ? 203 PRO L O   1 
ATOM   1618 C CB  . PRO A 1 209 ? 55.838 39.418  -12.756 1.00 38.76 ? 203 PRO L CB  1 
ATOM   1619 C CG  . PRO A 1 209 ? 54.375 39.659  -12.736 1.00 36.63 ? 203 PRO L CG  1 
ATOM   1620 C CD  . PRO A 1 209 ? 54.308 41.155  -12.591 1.00 40.85 ? 203 PRO L CD  1 
ATOM   1621 N N   . ILE A 1 210 ? 58.750 39.989  -11.578 1.00 41.73 ? 204 ILE L N   1 
ATOM   1622 C CA  . ILE A 1 210 ? 60.145 40.311  -11.842 1.00 41.96 ? 204 ILE L CA  1 
ATOM   1623 C C   . ILE A 1 210 ? 60.470 39.488  -13.085 1.00 44.93 ? 204 ILE L C   1 
ATOM   1624 O O   . ILE A 1 210 ? 60.190 38.289  -13.135 1.00 40.15 ? 204 ILE L O   1 
ATOM   1625 C CB  . ILE A 1 210 ? 61.087 39.848  -10.691 1.00 43.32 ? 204 ILE L CB  1 
ATOM   1626 C CG1 . ILE A 1 210 ? 60.617 40.376  -9.326  1.00 43.15 ? 204 ILE L CG1 1 
ATOM   1627 C CG2 . ILE A 1 210 ? 62.507 40.293  -10.972 1.00 42.17 ? 204 ILE L CG2 1 
ATOM   1628 C CD1 . ILE A 1 210 ? 60.765 41.868  -9.133  1.00 44.55 ? 204 ILE L CD1 1 
ATOM   1629 N N   . VAL A 1 211 ? 60.996 40.141  -14.112 1.00 49.52 ? 205 VAL L N   1 
ATOM   1630 C CA  . VAL A 1 211 ? 61.351 39.453  -15.352 1.00 48.63 ? 205 VAL L CA  1 
ATOM   1631 C C   . VAL A 1 211 ? 62.840 39.592  -15.616 1.00 47.73 ? 205 VAL L C   1 
ATOM   1632 O O   . VAL A 1 211 ? 63.399 40.688  -15.521 1.00 48.33 ? 205 VAL L O   1 
ATOM   1633 C CB  . VAL A 1 211 ? 60.567 40.005  -16.577 1.00 48.08 ? 205 VAL L CB  1 
ATOM   1634 C CG1 . VAL A 1 211 ? 59.440 39.056  -16.950 1.00 45.47 ? 205 VAL L CG1 1 
ATOM   1635 C CG2 . VAL A 1 211 ? 60.009 41.408  -16.277 1.00 47.77 ? 205 VAL L CG2 1 
ATOM   1636 N N   . LYS A 1 212 ? 63.496 38.469  -15.861 1.00 46.57 ? 206 LYS L N   1 
ATOM   1637 C CA  . LYS A 1 212 ? 64.918 38.482  -16.155 1.00 50.70 ? 206 LYS L CA  1 
ATOM   1638 C C   . LYS A 1 212 ? 65.006 37.757  -17.482 1.00 52.79 ? 206 LYS L C   1 
ATOM   1639 O O   . LYS A 1 212 ? 64.666 36.576  -17.570 1.00 54.58 ? 206 LYS L O   1 
ATOM   1640 C CB  . LYS A 1 212 ? 65.699 37.746  -15.070 1.00 54.37 ? 206 LYS L CB  1 
ATOM   1641 C CG  . LYS A 1 212 ? 66.959 38.466  -14.646 1.00 56.40 ? 206 LYS L CG  1 
ATOM   1642 C CD  . LYS A 1 212 ? 66.633 39.771  -13.934 1.00 56.12 ? 206 LYS L CD  1 
ATOM   1643 C CE  . LYS A 1 212 ? 67.872 40.647  -13.796 1.00 63.02 ? 206 LYS L CE  1 
ATOM   1644 N NZ  . LYS A 1 212 ? 69.027 39.930  -13.174 1.00 69.60 ? 206 LYS L NZ  1 
ATOM   1645 N N   . SER A 1 213 ? 65.430 38.465  -18.521 1.00 56.01 ? 207 SER L N   1 
ATOM   1646 C CA  . SER A 1 213 ? 65.482 37.865  -19.844 1.00 59.93 ? 207 SER L CA  1 
ATOM   1647 C C   . SER A 1 213 ? 66.822 37.970  -20.543 1.00 60.58 ? 207 SER L C   1 
ATOM   1648 O O   . SER A 1 213 ? 67.708 38.715  -20.118 1.00 62.60 ? 207 SER L O   1 
ATOM   1649 C CB  . SER A 1 213 ? 64.421 38.513  -20.734 1.00 58.24 ? 207 SER L CB  1 
ATOM   1650 O OG  . SER A 1 213 ? 63.227 38.765  -20.016 1.00 60.17 ? 207 SER L OG  1 
ATOM   1651 N N   . PHE A 1 214 ? 66.957 37.199  -21.615 1.00 60.34 ? 208 PHE L N   1 
ATOM   1652 C CA  . PHE A 1 214 ? 68.153 37.201  -22.442 1.00 62.40 ? 208 PHE L CA  1 
ATOM   1653 C C   . PHE A 1 214 ? 67.718 36.620  -23.778 1.00 65.13 ? 208 PHE L C   1 
ATOM   1654 O O   . PHE A 1 214 ? 66.974 35.639  -23.812 1.00 64.72 ? 208 PHE L O   1 
ATOM   1655 C CB  . PHE A 1 214 ? 69.289 36.364  -21.816 1.00 57.11 ? 208 PHE L CB  1 
ATOM   1656 C CG  . PHE A 1 214 ? 69.238 34.900  -22.156 1.00 53.55 ? 208 PHE L CG  1 
ATOM   1657 C CD1 . PHE A 1 214 ? 69.784 34.428  -23.346 1.00 57.71 ? 208 PHE L CD1 1 
ATOM   1658 C CD2 . PHE A 1 214 ? 68.613 34.000  -21.310 1.00 53.15 ? 208 PHE L CD2 1 
ATOM   1659 C CE1 . PHE A 1 214 ? 69.700 33.080  -23.691 1.00 59.12 ? 208 PHE L CE1 1 
ATOM   1660 C CE2 . PHE A 1 214 ? 68.525 32.654  -21.644 1.00 55.36 ? 208 PHE L CE2 1 
ATOM   1661 C CZ  . PHE A 1 214 ? 69.068 32.192  -22.839 1.00 55.47 ? 208 PHE L CZ  1 
ATOM   1662 N N   . ASN A 1 215 ? 68.079 37.286  -24.870 1.00 69.76 ? 209 ASN L N   1 
ATOM   1663 C CA  . ASN A 1 215 ? 67.735 36.785  -26.195 1.00 70.67 ? 209 ASN L CA  1 
ATOM   1664 C C   . ASN A 1 215 ? 68.984 36.055  -26.635 1.00 68.28 ? 209 ASN L C   1 
ATOM   1665 O O   . ASN A 1 215 ? 70.091 36.538  -26.401 1.00 69.64 ? 209 ASN L O   1 
ATOM   1666 C CB  . ASN A 1 215 ? 67.409 37.921  -27.168 1.00 74.00 ? 209 ASN L CB  1 
ATOM   1667 C CG  . ASN A 1 215 ? 66.800 37.416  -28.472 1.00 79.24 ? 209 ASN L CG  1 
ATOM   1668 O OD1 . ASN A 1 215 ? 65.597 37.556  -28.703 1.00 77.95 ? 209 ASN L OD1 1 
ATOM   1669 N ND2 . ASN A 1 215 ? 67.620 36.803  -29.316 1.00 81.72 ? 209 ASN L ND2 1 
ATOM   1670 N N   . ARG A 1 216 ? 68.803 34.883  -27.226 1.00 65.62 ? 210 ARG L N   1 
ATOM   1671 C CA  . ARG A 1 216 ? 69.908 34.053  -27.678 1.00 69.37 ? 210 ARG L CA  1 
ATOM   1672 C C   . ARG A 1 216 ? 70.819 34.761  -28.695 1.00 75.49 ? 210 ARG L C   1 
ATOM   1673 O O   . ARG A 1 216 ? 71.890 35.260  -28.280 1.00 74.89 ? 210 ARG L O   1 
ATOM   1674 C CB  . ARG A 1 216 ? 69.345 32.760  -28.255 1.00 61.85 ? 210 ARG L CB  1 
ATOM   1675 C CG  . ARG A 1 216 ? 70.363 31.692  -28.519 1.00 63.44 ? 210 ARG L CG  1 
ATOM   1676 C CD  . ARG A 1 216 ? 69.672 30.477  -29.079 1.00 68.11 ? 210 ARG L CD  1 
ATOM   1677 N NE  . ARG A 1 216 ? 68.890 30.832  -30.257 1.00 75.83 ? 210 ARG L NE  1 
ATOM   1678 C CZ  . ARG A 1 216 ? 68.974 30.210  -31.426 1.00 80.18 ? 210 ARG L CZ  1 
ATOM   1679 N NH1 . ARG A 1 216 ? 69.794 29.177  -31.566 1.00 84.38 ? 210 ARG L NH1 1 
ATOM   1680 N NH2 . ARG A 1 216 ? 68.252 30.627  -32.459 1.00 83.76 ? 210 ARG L NH2 1 
ATOM   1681 O OXT . ARG A 1 216 ? 70.450 34.831  -29.892 1.00 84.96 ? 210 ARG L OXT 1 
ATOM   1682 N N   . GLN B 2 1   ? 88.206 15.234  22.343  1.00 64.86 ? 1   GLN H N   1 
ATOM   1683 C CA  . GLN B 2 1   ? 86.777 15.403  22.100  1.00 62.78 ? 1   GLN H CA  1 
ATOM   1684 C C   . GLN B 2 1   ? 86.171 14.127  21.524  1.00 61.38 ? 1   GLN H C   1 
ATOM   1685 O O   . GLN B 2 1   ? 86.845 13.369  20.817  1.00 58.85 ? 1   GLN H O   1 
ATOM   1686 C CB  . GLN B 2 1   ? 86.528 16.563  21.135  1.00 63.18 ? 1   GLN H CB  1 
ATOM   1687 C CG  . GLN B 2 1   ? 87.055 16.322  19.730  1.00 69.02 ? 1   GLN H CG  1 
ATOM   1688 C CD  . GLN B 2 1   ? 86.633 17.403  18.763  1.00 74.22 ? 1   GLN H CD  1 
ATOM   1689 O OE1 . GLN B 2 1   ? 85.836 17.165  17.855  1.00 78.76 ? 1   GLN H OE1 1 
ATOM   1690 N NE2 . GLN B 2 1   ? 87.160 18.605  18.954  1.00 77.48 ? 1   GLN H NE2 1 
ATOM   1691 N N   . VAL B 2 2   ? 84.901 13.893  21.833  1.00 59.74 ? 2   VAL H N   1 
ATOM   1692 C CA  . VAL B 2 2   ? 84.206 12.712  21.342  1.00 57.63 ? 2   VAL H CA  1 
ATOM   1693 C C   . VAL B 2 2   ? 84.139 12.829  19.832  1.00 52.70 ? 2   VAL H C   1 
ATOM   1694 O O   . VAL B 2 2   ? 83.793 13.888  19.303  1.00 51.86 ? 2   VAL H O   1 
ATOM   1695 C CB  . VAL B 2 2   ? 82.781 12.611  21.913  1.00 60.66 ? 2   VAL H CB  1 
ATOM   1696 C CG1 . VAL B 2 2   ? 82.148 11.287  21.506  1.00 63.68 ? 2   VAL H CG1 1 
ATOM   1697 C CG2 . VAL B 2 2   ? 82.815 12.743  23.429  1.00 65.12 ? 2   VAL H CG2 1 
ATOM   1698 N N   . GLN B 2 3   ? 84.480 11.748  19.143  1.00 45.53 ? 3   GLN H N   1 
ATOM   1699 C CA  . GLN B 2 3   ? 84.481 11.740  17.689  1.00 43.46 ? 3   GLN H CA  1 
ATOM   1700 C C   . GLN B 2 3   ? 83.972 10.391  17.196  1.00 41.48 ? 3   GLN H C   1 
ATOM   1701 O O   . GLN B 2 3   ? 84.559 9.349   17.496  1.00 43.80 ? 3   GLN H O   1 
ATOM   1702 C CB  . GLN B 2 3   ? 85.906 11.978  17.184  1.00 47.24 ? 3   GLN H CB  1 
ATOM   1703 C CG  . GLN B 2 3   ? 86.016 12.547  15.786  1.00 51.02 ? 3   GLN H CG  1 
ATOM   1704 C CD  . GLN B 2 3   ? 85.407 13.927  15.671  1.00 57.46 ? 3   GLN H CD  1 
ATOM   1705 O OE1 . GLN B 2 3   ? 84.741 14.236  14.688  1.00 65.24 ? 3   GLN H OE1 1 
ATOM   1706 N NE2 . GLN B 2 3   ? 85.622 14.763  16.679  1.00 59.23 ? 3   GLN H NE2 1 
ATOM   1707 N N   . LEU B 2 4   ? 82.835 10.408  16.513  1.00 37.46 ? 4   LEU H N   1 
ATOM   1708 C CA  . LEU B 2 4   ? 82.250 9.192   15.961  1.00 34.36 ? 4   LEU H CA  1 
ATOM   1709 C C   . LEU B 2 4   ? 82.280 9.349   14.437  1.00 34.93 ? 4   LEU H C   1 
ATOM   1710 O O   . LEU B 2 4   ? 81.581 10.200  13.881  1.00 37.14 ? 4   LEU H O   1 
ATOM   1711 C CB  . LEU B 2 4   ? 80.807 9.032   16.445  1.00 29.41 ? 4   LEU H CB  1 
ATOM   1712 C CG  . LEU B 2 4   ? 80.563 8.889   17.943  1.00 24.13 ? 4   LEU H CG  1 
ATOM   1713 C CD1 . LEU B 2 4   ? 79.078 8.859   18.200  1.00 16.39 ? 4   LEU H CD1 1 
ATOM   1714 C CD2 . LEU B 2 4   ? 81.206 7.625   18.441  1.00 18.83 ? 4   LEU H CD2 1 
ATOM   1715 N N   . GLN B 2 5   ? 83.100 8.554   13.765  1.00 30.13 ? 5   GLN H N   1 
ATOM   1716 C CA  . GLN B 2 5   ? 83.217 8.647   12.314  1.00 35.18 ? 5   GLN H CA  1 
ATOM   1717 C C   . GLN B 2 5   ? 82.771 7.372   11.602  1.00 33.36 ? 5   GLN H C   1 
ATOM   1718 O O   . GLN B 2 5   ? 83.444 6.341   11.670  1.00 33.57 ? 5   GLN H O   1 
ATOM   1719 C CB  . GLN B 2 5   ? 84.657 9.033   11.945  1.00 38.14 ? 5   GLN H CB  1 
ATOM   1720 C CG  . GLN B 2 5   ? 85.022 8.870   10.490  1.00 47.40 ? 5   GLN H CG  1 
ATOM   1721 C CD  . GLN B 2 5   ? 85.514 7.471   10.182  1.00 59.68 ? 5   GLN H CD  1 
ATOM   1722 O OE1 . GLN B 2 5   ? 86.477 6.995   10.781  1.00 66.22 ? 5   GLN H OE1 1 
ATOM   1723 N NE2 . GLN B 2 5   ? 84.839 6.794   9.262   1.00 70.42 ? 5   GLN H NE2 1 
ATOM   1724 N N   . GLU B 2 6   ? 81.630 7.444   10.925  1.00 31.61 ? 6   GLU H N   1 
ATOM   1725 C CA  . GLU B 2 6   ? 81.098 6.290   10.205  1.00 32.78 ? 6   GLU H CA  1 
ATOM   1726 C C   . GLU B 2 6   ? 81.544 6.271   8.741   1.00 32.73 ? 6   GLU H C   1 
ATOM   1727 O O   . GLU B 2 6   ? 81.783 7.319   8.132   1.00 28.41 ? 6   GLU H O   1 
ATOM   1728 C CB  . GLU B 2 6   ? 79.563 6.204   10.316  1.00 32.49 ? 6   GLU H CB  1 
ATOM   1729 C CG  . GLU B 2 6   ? 78.803 7.508   10.133  1.00 39.49 ? 6   GLU H CG  1 
ATOM   1730 C CD  . GLU B 2 6   ? 78.716 8.345   11.404  1.00 46.34 ? 6   GLU H CD  1 
ATOM   1731 O OE1 . GLU B 2 6   ? 77.727 8.210   12.154  1.00 44.07 ? 6   GLU H OE1 1 
ATOM   1732 O OE2 . GLU B 2 6   ? 79.627 9.160   11.648  1.00 52.67 ? 6   GLU H OE2 1 
ATOM   1733 N N   . SER B 2 7   ? 81.713 5.077   8.194   1.00 26.93 ? 7   SER H N   1 
ATOM   1734 C CA  . SER B 2 7   ? 82.133 4.946   6.812   1.00 29.74 ? 7   SER H CA  1 
ATOM   1735 C C   . SER B 2 7   ? 81.536 3.664   6.246   1.00 33.81 ? 7   SER H C   1 
ATOM   1736 O O   . SER B 2 7   ? 81.013 2.840   7.000   1.00 38.04 ? 7   SER H O   1 
ATOM   1737 C CB  . SER B 2 7   ? 83.659 4.900   6.736   1.00 25.33 ? 7   SER H CB  1 
ATOM   1738 O OG  . SER B 2 7   ? 84.157 3.680   7.252   1.00 25.73 ? 7   SER H OG  1 
ATOM   1739 N N   . GLY B 2 8   ? 81.524 3.537   4.923   1.00 31.10 ? 8   GLY H N   1 
ATOM   1740 C CA  . GLY B 2 8   ? 81.012 2.319   4.323   1.00 25.72 ? 8   GLY H CA  1 
ATOM   1741 C C   . GLY B 2 8   ? 79.662 2.377   3.652   1.00 24.43 ? 8   GLY H C   1 
ATOM   1742 O O   . GLY B 2 8   ? 79.190 1.357   3.141   1.00 26.26 ? 8   GLY H O   1 
ATOM   1743 N N   . GLY B 2 9   ? 79.010 3.532   3.683   1.00 18.21 ? 9   GLY H N   1 
ATOM   1744 C CA  . GLY B 2 9   ? 77.720 3.624   3.027   1.00 24.43 ? 9   GLY H CA  1 
ATOM   1745 C C   . GLY B 2 9   ? 77.911 3.592   1.521   1.00 28.29 ? 9   GLY H C   1 
ATOM   1746 O O   . GLY B 2 9   ? 79.045 3.622   1.038   1.00 31.09 ? 9   GLY H O   1 
ATOM   1747 N N   . GLY B 2 10  ? 76.824 3.544   0.766   1.00 30.37 ? 10  GLY H N   1 
ATOM   1748 C CA  . GLY B 2 10  ? 76.968 3.515   -0.675  1.00 33.96 ? 10  GLY H CA  1 
ATOM   1749 C C   . GLY B 2 10  ? 75.786 2.929   -1.412  1.00 37.67 ? 10  GLY H C   1 
ATOM   1750 O O   . GLY B 2 10  ? 74.721 2.706   -0.830  1.00 40.69 ? 10  GLY H O   1 
ATOM   1751 N N   . LEU B 2 11  ? 75.970 2.705   -2.709  1.00 36.30 ? 11  LEU H N   1 
ATOM   1752 C CA  . LEU B 2 11  ? 74.928 2.145   -3.557  1.00 30.71 ? 11  LEU H CA  1 
ATOM   1753 C C   . LEU B 2 11  ? 74.983 0.627   -3.489  1.00 26.62 ? 11  LEU H C   1 
ATOM   1754 O O   . LEU B 2 11  ? 76.053 0.027   -3.611  1.00 23.88 ? 11  LEU H O   1 
ATOM   1755 C CB  . LEU B 2 11  ? 75.122 2.629   -4.992  1.00 35.87 ? 11  LEU H CB  1 
ATOM   1756 C CG  . LEU B 2 11  ? 74.207 2.136   -6.110  1.00 35.62 ? 11  LEU H CG  1 
ATOM   1757 C CD1 . LEU B 2 11  ? 72.739 2.311   -5.744  1.00 31.93 ? 11  LEU H CD1 1 
ATOM   1758 C CD2 . LEU B 2 11  ? 74.545 2.927   -7.365  1.00 38.73 ? 11  LEU H CD2 1 
ATOM   1759 N N   . VAL B 2 12  ? 73.839 0.012   -3.226  1.00 25.32 ? 12  VAL H N   1 
ATOM   1760 C CA  . VAL B 2 12  ? 73.758 -1.439  -3.139  1.00 27.35 ? 12  VAL H CA  1 
ATOM   1761 C C   . VAL B 2 12  ? 72.438 -1.859  -3.768  1.00 30.90 ? 12  VAL H C   1 
ATOM   1762 O O   . VAL B 2 12  ? 71.451 -1.112  -3.715  1.00 28.27 ? 12  VAL H O   1 
ATOM   1763 C CB  . VAL B 2 12  ? 73.794 -1.937  -1.673  1.00 23.60 ? 12  VAL H CB  1 
ATOM   1764 C CG1 . VAL B 2 12  ? 73.779 -3.450  -1.637  1.00 26.22 ? 12  VAL H CG1 1 
ATOM   1765 C CG2 . VAL B 2 12  ? 75.019 -1.415  -0.970  1.00 31.15 ? 12  VAL H CG2 1 
ATOM   1766 N N   . GLN B 2 13  ? 72.431 -3.032  -4.398  1.00 33.07 ? 13  GLN H N   1 
ATOM   1767 C CA  . GLN B 2 13  ? 71.223 -3.527  -5.038  1.00 35.24 ? 13  GLN H CA  1 
ATOM   1768 C C   . GLN B 2 13  ? 70.344 -4.264  -4.042  1.00 31.64 ? 13  GLN H C   1 
ATOM   1769 O O   . GLN B 2 13  ? 70.833 -4.820  -3.053  1.00 30.72 ? 13  GLN H O   1 
ATOM   1770 C CB  . GLN B 2 13  ? 71.543 -4.405  -6.263  1.00 41.46 ? 13  GLN H CB  1 
ATOM   1771 C CG  . GLN B 2 13  ? 72.329 -5.676  -5.993  1.00 49.48 ? 13  GLN H CG  1 
ATOM   1772 C CD  . GLN B 2 13  ? 72.357 -6.608  -7.195  1.00 54.64 ? 13  GLN H CD  1 
ATOM   1773 O OE1 . GLN B 2 13  ? 72.109 -7.810  -7.067  1.00 61.60 ? 13  GLN H OE1 1 
ATOM   1774 N NE2 . GLN B 2 13  ? 72.661 -6.061  -8.370  1.00 53.90 ? 13  GLN H NE2 1 
ATOM   1775 N N   . PRO B 2 14  ? 69.024 -4.215  -4.256  1.00 29.51 ? 14  PRO H N   1 
ATOM   1776 C CA  . PRO B 2 14  ? 68.037 -4.863  -3.399  1.00 30.50 ? 14  PRO H CA  1 
ATOM   1777 C C   . PRO B 2 14  ? 68.464 -6.281  -3.111  1.00 33.96 ? 14  PRO H C   1 
ATOM   1778 O O   . PRO B 2 14  ? 69.088 -6.921  -3.951  1.00 36.05 ? 14  PRO H O   1 
ATOM   1779 C CB  . PRO B 2 14  ? 66.789 -4.818  -4.255  1.00 33.13 ? 14  PRO H CB  1 
ATOM   1780 C CG  . PRO B 2 14  ? 66.937 -3.495  -4.946  1.00 31.66 ? 14  PRO H CG  1 
ATOM   1781 C CD  . PRO B 2 14  ? 68.368 -3.545  -5.391  1.00 28.02 ? 14  PRO H CD  1 
ATOM   1782 N N   . ARG B 2 15  ? 68.145 -6.755  -1.913  1.00 34.28 ? 15  ARG H N   1 
ATOM   1783 C CA  . ARG B 2 15  ? 68.508 -8.098  -1.480  1.00 32.42 ? 15  ARG H CA  1 
ATOM   1784 C C   . ARG B 2 15  ? 70.019 -8.259  -1.333  1.00 28.37 ? 15  ARG H C   1 
ATOM   1785 O O   . ARG B 2 15  ? 70.512 -9.365  -1.120  1.00 28.89 ? 15  ARG H O   1 
ATOM   1786 C CB  . ARG B 2 15  ? 67.942 -9.155  -2.431  1.00 39.27 ? 15  ARG H CB  1 
ATOM   1787 C CG  . ARG B 2 15  ? 66.569 -9.667  -2.060  1.00 45.07 ? 15  ARG H CG  1 
ATOM   1788 C CD  . ARG B 2 15  ? 66.629 -10.531 -0.804  1.00 56.09 ? 15  ARG H CD  1 
ATOM   1789 N NE  . ARG B 2 15  ? 66.287 -9.781  0.400   1.00 62.40 ? 15  ARG H NE  1 
ATOM   1790 C CZ  . ARG B 2 15  ? 65.044 -9.603  0.844   1.00 72.29 ? 15  ARG H CZ  1 
ATOM   1791 N NH1 . ARG B 2 15  ? 64.020 -10.143 0.191   1.00 77.39 ? 15  ARG H NH1 1 
ATOM   1792 N NH2 . ARG B 2 15  ? 64.815 -8.883  1.939   1.00 75.74 ? 15  ARG H NH2 1 
ATOM   1793 N N   . GLY B 2 16  ? 70.749 -7.153  -1.439  1.00 27.76 ? 16  GLY H N   1 
ATOM   1794 C CA  . GLY B 2 16  ? 72.196 -7.199  -1.275  1.00 30.95 ? 16  GLY H CA  1 
ATOM   1795 C C   . GLY B 2 16  ? 72.584 -7.002  0.188   1.00 33.33 ? 16  GLY H C   1 
ATOM   1796 O O   . GLY B 2 16  ? 71.713 -6.967  1.070   1.00 31.27 ? 16  GLY H O   1 
ATOM   1797 N N   . SER B 2 17  ? 73.876 -6.826  0.453   1.00 29.70 ? 17  SER H N   1 
ATOM   1798 C CA  . SER B 2 17  ? 74.337 -6.641  1.816   1.00 27.55 ? 17  SER H CA  1 
ATOM   1799 C C   . SER B 2 17  ? 75.430 -5.594  1.909   1.00 29.90 ? 17  SER H C   1 
ATOM   1800 O O   . SER B 2 17  ? 76.281 -5.496  1.029   1.00 35.14 ? 17  SER H O   1 
ATOM   1801 C CB  . SER B 2 17  ? 74.860 -7.960  2.380   1.00 21.43 ? 17  SER H CB  1 
ATOM   1802 O OG  . SER B 2 17  ? 76.232 -8.147  2.076   1.00 22.72 ? 17  SER H OG  1 
ATOM   1803 N N   . LEU B 2 18  ? 75.466 -4.887  3.032   1.00 29.06 ? 18  LEU H N   1 
ATOM   1804 C CA  . LEU B 2 18  ? 76.462 -3.853  3.253   1.00 24.95 ? 18  LEU H CA  1 
ATOM   1805 C C   . LEU B 2 18  ? 76.868 -3.828  4.735   1.00 27.34 ? 18  LEU H C   1 
ATOM   1806 O O   . LEU B 2 18  ? 76.071 -4.169  5.601   1.00 31.79 ? 18  LEU H O   1 
ATOM   1807 C CB  . LEU B 2 18  ? 75.874 -2.506  2.831   1.00 18.65 ? 18  LEU H CB  1 
ATOM   1808 C CG  . LEU B 2 18  ? 76.858 -1.354  2.659   1.00 30.06 ? 18  LEU H CG  1 
ATOM   1809 C CD1 . LEU B 2 18  ? 77.836 -1.670  1.533   1.00 28.89 ? 18  LEU H CD1 1 
ATOM   1810 C CD2 . LEU B 2 18  ? 76.108 -0.077  2.361   1.00 31.47 ? 18  LEU H CD2 1 
ATOM   1811 N N   . LYS B 2 19  ? 78.110 -3.455  5.023   1.00 26.84 ? 19  LYS H N   1 
ATOM   1812 C CA  . LYS B 2 19  ? 78.579 -3.379  6.402   1.00 24.23 ? 19  LYS H CA  1 
ATOM   1813 C C   . LYS B 2 19  ? 79.088 -1.984  6.722   1.00 19.29 ? 19  LYS H C   1 
ATOM   1814 O O   . LYS B 2 19  ? 80.031 -1.509  6.104   1.00 26.51 ? 19  LYS H O   1 
ATOM   1815 C CB  . LYS B 2 19  ? 79.703 -4.385  6.665   1.00 25.73 ? 19  LYS H CB  1 
ATOM   1816 C CG  . LYS B 2 19  ? 80.006 -4.586  8.148   1.00 24.67 ? 19  LYS H CG  1 
ATOM   1817 C CD  . LYS B 2 19  ? 81.281 -5.371  8.366   1.00 25.53 ? 19  LYS H CD  1 
ATOM   1818 C CE  . LYS B 2 19  ? 82.494 -4.513  8.003   1.00 44.13 ? 19  LYS H CE  1 
ATOM   1819 N NZ  . LYS B 2 19  ? 83.796 -5.251  8.065   1.00 48.90 ? 19  LYS H NZ  1 
ATOM   1820 N N   . LEU B 2 20  ? 78.451 -1.323  7.678   1.00 23.57 ? 20  LEU H N   1 
ATOM   1821 C CA  . LEU B 2 20  ? 78.858 0.016   8.097   1.00 22.55 ? 20  LEU H CA  1 
ATOM   1822 C C   . LEU B 2 20  ? 79.864 -0.096  9.251   1.00 22.45 ? 20  LEU H C   1 
ATOM   1823 O O   . LEU B 2 20  ? 79.969 -1.139  9.894   1.00 26.67 ? 20  LEU H O   1 
ATOM   1824 C CB  . LEU B 2 20  ? 77.635 0.811   8.548   1.00 23.35 ? 20  LEU H CB  1 
ATOM   1825 C CG  . LEU B 2 20  ? 76.484 0.854   7.546   1.00 25.96 ? 20  LEU H CG  1 
ATOM   1826 C CD1 . LEU B 2 20  ? 75.359 1.715   8.083   1.00 25.01 ? 20  LEU H CD1 1 
ATOM   1827 C CD2 . LEU B 2 20  ? 76.987 1.405   6.226   1.00 28.41 ? 20  LEU H CD2 1 
ATOM   1828 N N   . SER B 2 21  ? 80.621 0.963   9.494   1.00 20.66 ? 21  SER H N   1 
ATOM   1829 C CA  . SER B 2 21  ? 81.601 0.969   10.564  1.00 22.86 ? 21  SER H CA  1 
ATOM   1830 C C   . SER B 2 21  ? 81.623 2.318   11.235  1.00 25.90 ? 21  SER H C   1 
ATOM   1831 O O   . SER B 2 21  ? 81.346 3.340   10.600  1.00 25.62 ? 21  SER H O   1 
ATOM   1832 C CB  . SER B 2 21  ? 82.994 0.661   10.030  1.00 25.33 ? 21  SER H CB  1 
ATOM   1833 O OG  . SER B 2 21  ? 83.178 -0.734  9.912   1.00 37.14 ? 21  SER H OG  1 
ATOM   1834 N N   . CYS B 2 22  ? 81.989 2.316   12.513  1.00 27.67 ? 22  CYS H N   1 
ATOM   1835 C CA  . CYS B 2 22  ? 82.058 3.537   13.297  1.00 24.03 ? 22  CYS H CA  1 
ATOM   1836 C C   . CYS B 2 22  ? 83.304 3.538   14.157  1.00 27.41 ? 22  CYS H C   1 
ATOM   1837 O O   . CYS B 2 22  ? 83.559 2.593   14.901  1.00 32.58 ? 22  CYS H O   1 
ATOM   1838 C CB  . CYS B 2 22  ? 80.839 3.644   14.189  1.00 21.16 ? 22  CYS H CB  1 
ATOM   1839 S SG  . CYS B 2 22  ? 80.680 5.226   15.065  1.00 26.78 ? 22  CYS H SG  1 
ATOM   1840 N N   . ALA B 2 23  ? 84.118 4.568   14.001  1.00 26.07 ? 23  ALA H N   1 
ATOM   1841 C CA  . ALA B 2 23  ? 85.322 4.688   14.788  1.00 27.61 ? 23  ALA H CA  1 
ATOM   1842 C C   . ALA B 2 23  ? 84.996 5.692   15.880  1.00 30.21 ? 23  ALA H C   1 
ATOM   1843 O O   . ALA B 2 23  ? 84.609 6.827   15.588  1.00 27.65 ? 23  ALA H O   1 
ATOM   1844 C CB  . ALA B 2 23  ? 86.453 5.188   13.928  1.00 30.84 ? 23  ALA H CB  1 
ATOM   1845 N N   . ALA B 2 24  ? 85.090 5.255   17.131  1.00 35.20 ? 24  ALA H N   1 
ATOM   1846 C CA  . ALA B 2 24  ? 84.801 6.121   18.272  1.00 38.73 ? 24  ALA H CA  1 
ATOM   1847 C C   . ALA B 2 24  ? 86.086 6.695   18.862  1.00 40.56 ? 24  ALA H C   1 
ATOM   1848 O O   . ALA B 2 24  ? 87.125 6.029   18.864  1.00 41.20 ? 24  ALA H O   1 
ATOM   1849 C CB  . ALA B 2 24  ? 84.024 5.353   19.337  1.00 35.38 ? 24  ALA H CB  1 
ATOM   1850 N N   . SER B 2 25  ? 86.010 7.936   19.339  1.00 43.07 ? 25  SER H N   1 
ATOM   1851 C CA  . SER B 2 25  ? 87.153 8.626   19.938  1.00 44.43 ? 25  SER H CA  1 
ATOM   1852 C C   . SER B 2 25  ? 86.709 9.637   20.985  1.00 43.45 ? 25  SER H C   1 
ATOM   1853 O O   . SER B 2 25  ? 85.567 10.098  20.969  1.00 42.88 ? 25  SER H O   1 
ATOM   1854 C CB  . SER B 2 25  ? 87.979 9.355   18.865  1.00 47.18 ? 25  SER H CB  1 
ATOM   1855 O OG  . SER B 2 25  ? 88.898 8.484   18.223  1.00 51.48 ? 25  SER H OG  1 
ATOM   1856 N N   . GLY B 2 26  ? 87.611 9.939   21.916  1.00 46.65 ? 26  GLY H N   1 
ATOM   1857 C CA  . GLY B 2 26  ? 87.336 10.914  22.961  1.00 45.78 ? 26  GLY H CA  1 
ATOM   1858 C C   . GLY B 2 26  ? 86.623 10.474  24.226  1.00 42.21 ? 26  GLY H C   1 
ATOM   1859 O O   . GLY B 2 26  ? 86.402 11.301  25.104  1.00 45.76 ? 26  GLY H O   1 
ATOM   1860 N N   . PHE B 2 27  ? 86.257 9.199   24.329  1.00 46.04 ? 27  PHE H N   1 
ATOM   1861 C CA  . PHE B 2 27  ? 85.563 8.681   25.512  1.00 46.17 ? 27  PHE H CA  1 
ATOM   1862 C C   . PHE B 2 27  ? 85.845 7.194   25.679  1.00 48.58 ? 27  PHE H C   1 
ATOM   1863 O O   . PHE B 2 27  ? 86.328 6.535   24.744  1.00 51.55 ? 27  PHE H O   1 
ATOM   1864 C CB  . PHE B 2 27  ? 84.044 8.902   25.406  1.00 44.93 ? 27  PHE H CB  1 
ATOM   1865 C CG  . PHE B 2 27  ? 83.353 7.992   24.411  1.00 41.26 ? 27  PHE H CG  1 
ATOM   1866 C CD1 . PHE B 2 27  ? 82.618 6.895   24.848  1.00 38.21 ? 27  PHE H CD1 1 
ATOM   1867 C CD2 . PHE B 2 27  ? 83.408 8.253   23.046  1.00 42.66 ? 27  PHE H CD2 1 
ATOM   1868 C CE1 . PHE B 2 27  ? 81.943 6.072   23.947  1.00 31.86 ? 27  PHE H CE1 1 
ATOM   1869 C CE2 . PHE B 2 27  ? 82.737 7.436   22.139  1.00 38.63 ? 27  PHE H CE2 1 
ATOM   1870 C CZ  . PHE B 2 27  ? 82.000 6.340   22.598  1.00 34.38 ? 27  PHE H CZ  1 
ATOM   1871 N N   . THR B 2 28  ? 85.539 6.666   26.860  1.00 46.74 ? 28  THR H N   1 
ATOM   1872 C CA  . THR B 2 28  ? 85.752 5.250   27.135  1.00 46.09 ? 28  THR H CA  1 
ATOM   1873 C C   . THR B 2 28  ? 84.676 4.391   26.469  1.00 46.35 ? 28  THR H C   1 
ATOM   1874 O O   . THR B 2 28  ? 83.586 4.170   27.011  1.00 45.23 ? 28  THR H O   1 
ATOM   1875 C CB  . THR B 2 28  ? 85.814 4.959   28.645  1.00 46.49 ? 28  THR H CB  1 
ATOM   1876 O OG1 . THR B 2 28  ? 85.428 6.128   29.387  1.00 48.24 ? 28  THR H OG1 1 
ATOM   1877 C CG2 . THR B 2 28  ? 87.225 4.539   29.032  1.00 40.54 ? 28  THR H CG2 1 
ATOM   1878 N N   . PHE B 2 29  ? 84.996 3.941   25.262  1.00 43.12 ? 29  PHE H N   1 
ATOM   1879 C CA  . PHE B 2 29  ? 84.107 3.117   24.459  1.00 40.18 ? 29  PHE H CA  1 
ATOM   1880 C C   . PHE B 2 29  ? 83.678 1.861   25.209  1.00 38.57 ? 29  PHE H C   1 
ATOM   1881 O O   . PHE B 2 29  ? 82.522 1.462   25.148  1.00 42.18 ? 29  PHE H O   1 
ATOM   1882 C CB  . PHE B 2 29  ? 84.825 2.737   23.155  1.00 38.36 ? 29  PHE H CB  1 
ATOM   1883 C CG  . PHE B 2 29  ? 83.947 2.067   22.141  1.00 29.74 ? 29  PHE H CG  1 
ATOM   1884 C CD1 . PHE B 2 29  ? 82.963 2.782   21.480  1.00 28.38 ? 29  PHE H CD1 1 
ATOM   1885 C CD2 . PHE B 2 29  ? 84.122 0.723   21.831  1.00 28.57 ? 29  PHE H CD2 1 
ATOM   1886 C CE1 . PHE B 2 29  ? 82.164 2.169   20.519  1.00 34.16 ? 29  PHE H CE1 1 
ATOM   1887 C CE2 . PHE B 2 29  ? 83.328 0.104   20.875  1.00 30.78 ? 29  PHE H CE2 1 
ATOM   1888 C CZ  . PHE B 2 29  ? 82.346 0.831   20.217  1.00 25.92 ? 29  PHE H CZ  1 
ATOM   1889 N N   . ASN B 2 30  ? 84.610 1.269   25.948  1.00 39.03 ? 30  ASN H N   1 
ATOM   1890 C CA  . ASN B 2 30  ? 84.357 0.038   26.698  1.00 40.14 ? 30  ASN H CA  1 
ATOM   1891 C C   . ASN B 2 30  ? 83.214 0.140   27.709  1.00 34.01 ? 30  ASN H C   1 
ATOM   1892 O O   . ASN B 2 30  ? 82.671 -0.875  28.151  1.00 35.00 ? 30  ASN H O   1 
ATOM   1893 C CB  . ASN B 2 30  ? 85.640 -0.424  27.416  1.00 48.86 ? 30  ASN H CB  1 
ATOM   1894 C CG  . ASN B 2 30  ? 86.012 0.469   28.603  1.00 58.75 ? 30  ASN H CG  1 
ATOM   1895 O OD1 . ASN B 2 30  ? 85.891 1.694   28.535  1.00 63.31 ? 30  ASN H OD1 1 
ATOM   1896 N ND2 . ASN B 2 30  ? 86.459 -0.145  29.694  1.00 63.74 ? 30  ASN H ND2 1 
ATOM   1897 N N   . THR B 2 31  ? 82.834 1.352   28.068  1.00 22.32 ? 31  THR H N   1 
ATOM   1898 C CA  . THR B 2 31  ? 81.782 1.505   29.041  1.00 23.68 ? 31  THR H CA  1 
ATOM   1899 C C   . THR B 2 31  ? 80.420 1.909   28.524  1.00 26.41 ? 31  THR H C   1 
ATOM   1900 O O   . THR B 2 31  ? 79.414 1.630   29.169  1.00 28.98 ? 31  THR H O   1 
ATOM   1901 C CB  . THR B 2 31  ? 82.212 2.474   30.141  1.00 29.49 ? 31  THR H CB  1 
ATOM   1902 O OG1 . THR B 2 31  ? 82.910 3.584   29.559  1.00 31.62 ? 31  THR H OG1 1 
ATOM   1903 C CG2 . THR B 2 31  ? 83.129 1.760   31.130  1.00 29.22 ? 31  THR H CG2 1 
ATOM   1904 N N   . ASP B 2 32  ? 80.359 2.522   27.349  1.00 27.42 ? 32  ASP H N   1 
ATOM   1905 C CA  . ASP B 2 32  ? 79.069 2.962   26.841  1.00 26.16 ? 32  ASP H CA  1 
ATOM   1906 C C   . ASP B 2 32  ? 78.330 2.012   25.899  1.00 25.96 ? 32  ASP H C   1 
ATOM   1907 O O   . ASP B 2 32  ? 78.933 1.159   25.248  1.00 24.57 ? 32  ASP H O   1 
ATOM   1908 C CB  . ASP B 2 32  ? 79.210 4.329   26.173  1.00 31.77 ? 32  ASP H CB  1 
ATOM   1909 C CG  . ASP B 2 32  ? 79.803 5.363   27.087  1.00 35.01 ? 32  ASP H CG  1 
ATOM   1910 O OD1 . ASP B 2 32  ? 81.043 5.447   27.141  1.00 47.02 ? 32  ASP H OD1 1 
ATOM   1911 O OD2 . ASP B 2 32  ? 79.038 6.095   27.747  1.00 43.49 ? 32  ASP H OD2 1 
ATOM   1912 N N   . ALA B 2 33  ? 77.007 2.152   25.885  1.00 22.71 ? 33  ALA H N   1 
ATOM   1913 C CA  . ALA B 2 33  ? 76.138 1.388   25.008  1.00 25.65 ? 33  ALA H CA  1 
ATOM   1914 C C   . ALA B 2 33  ? 76.154 2.204   23.718  1.00 26.94 ? 33  ALA H C   1 
ATOM   1915 O O   . ALA B 2 33  ? 76.149 3.441   23.766  1.00 26.14 ? 33  ALA H O   1 
ATOM   1916 C CB  . ALA B 2 33  ? 74.730 1.346   25.564  1.00 22.30 ? 33  ALA H CB  1 
ATOM   1917 N N   . MET B 2 34  ? 76.166 1.524   22.575  1.00 28.06 ? 34  MET H N   1 
ATOM   1918 C CA  . MET B 2 34  ? 76.202 2.195   21.273  1.00 22.40 ? 34  MET H CA  1 
ATOM   1919 C C   . MET B 2 34  ? 74.967 1.902   20.431  1.00 20.29 ? 34  MET H C   1 
ATOM   1920 O O   . MET B 2 34  ? 74.427 0.795   20.470  1.00 24.31 ? 34  MET H O   1 
ATOM   1921 C CB  . MET B 2 34  ? 77.454 1.766   20.519  1.00 23.22 ? 34  MET H CB  1 
ATOM   1922 C CG  . MET B 2 34  ? 78.758 2.162   21.209  1.00 25.45 ? 34  MET H CG  1 
ATOM   1923 S SD  . MET B 2 34  ? 78.927 3.942   21.455  1.00 30.57 ? 34  MET H SD  1 
ATOM   1924 C CE  . MET B 2 34  ? 79.364 4.517   19.766  1.00 27.37 ? 34  MET H CE  1 
ATOM   1925 N N   . ASN B 2 35  ? 74.538 2.885   19.650  1.00 16.63 ? 35  ASN H N   1 
ATOM   1926 C CA  . ASN B 2 35  ? 73.357 2.720   18.805  1.00 19.78 ? 35  ASN H CA  1 
ATOM   1927 C C   . ASN B 2 35  ? 73.546 3.152   17.354  1.00 20.86 ? 35  ASN H C   1 
ATOM   1928 O O   . ASN B 2 35  ? 74.484 3.867   17.005  1.00 19.88 ? 35  ASN H O   1 
ATOM   1929 C CB  . ASN B 2 35  ? 72.173 3.524   19.354  1.00 19.58 ? 35  ASN H CB  1 
ATOM   1930 C CG  . ASN B 2 35  ? 71.839 3.170   20.779  1.00 20.55 ? 35  ASN H CG  1 
ATOM   1931 O OD1 . ASN B 2 35  ? 70.833 2.517   21.053  1.00 11.07 ? 35  ASN H OD1 1 
ATOM   1932 N ND2 . ASN B 2 35  ? 72.692 3.594   21.700  1.00 11.77 ? 35  ASN H ND2 1 
ATOM   1933 N N   . TRP B 2 36  ? 72.613 2.719   16.522  1.00 18.78 ? 36  TRP H N   1 
ATOM   1934 C CA  . TRP B 2 36  ? 72.592 3.090   15.129  1.00 14.78 ? 36  TRP H CA  1 
ATOM   1935 C C   . TRP B 2 36  ? 71.174 3.604   14.894  1.00 17.03 ? 36  TRP H C   1 
ATOM   1936 O O   . TRP B 2 36  ? 70.183 2.924   15.207  1.00 13.76 ? 36  TRP H O   1 
ATOM   1937 C CB  . TRP B 2 36  ? 72.864 1.888   14.224  1.00 13.72 ? 36  TRP H CB  1 
ATOM   1938 C CG  . TRP B 2 36  ? 74.301 1.465   14.094  1.00 12.38 ? 36  TRP H CG  1 
ATOM   1939 C CD1 . TRP B 2 36  ? 74.879 0.371   14.661  1.00 18.46 ? 36  TRP H CD1 1 
ATOM   1940 C CD2 . TRP B 2 36  ? 75.308 2.061   13.254  1.00 16.60 ? 36  TRP H CD2 1 
ATOM   1941 N NE1 . TRP B 2 36  ? 76.176 0.237   14.221  1.00 21.41 ? 36  TRP H NE1 1 
ATOM   1942 C CE2 . TRP B 2 36  ? 76.464 1.260   13.357  1.00 14.46 ? 36  TRP H CE2 1 
ATOM   1943 C CE3 . TRP B 2 36  ? 75.340 3.187   12.416  1.00 14.10 ? 36  TRP H CE3 1 
ATOM   1944 C CZ2 . TRP B 2 36  ? 77.643 1.547   12.654  1.00 15.09 ? 36  TRP H CZ2 1 
ATOM   1945 C CZ3 . TRP B 2 36  ? 76.518 3.471   11.717  1.00 8.21  ? 36  TRP H CZ3 1 
ATOM   1946 C CH2 . TRP B 2 36  ? 77.650 2.654   11.842  1.00 3.78  ? 36  TRP H CH2 1 
ATOM   1947 N N   . VAL B 2 37  ? 71.086 4.847   14.444  1.00 18.03 ? 37  VAL H N   1 
ATOM   1948 C CA  . VAL B 2 37  ? 69.811 5.477   14.127  1.00 25.82 ? 37  VAL H CA  1 
ATOM   1949 C C   . VAL B 2 37  ? 69.926 5.817   12.637  1.00 28.73 ? 37  VAL H C   1 
ATOM   1950 O O   . VAL B 2 37  ? 71.030 6.060   12.149  1.00 27.69 ? 37  VAL H O   1 
ATOM   1951 C CB  . VAL B 2 37  ? 69.620 6.796   14.916  1.00 23.98 ? 37  VAL H CB  1 
ATOM   1952 C CG1 . VAL B 2 37  ? 68.307 7.452   14.537  1.00 32.39 ? 37  VAL H CG1 1 
ATOM   1953 C CG2 . VAL B 2 37  ? 69.656 6.536   16.404  1.00 25.60 ? 37  VAL H CG2 1 
ATOM   1954 N N   . ARG B 2 38  ? 68.813 5.793   11.911  1.00 29.57 ? 38  ARG H N   1 
ATOM   1955 C CA  . ARG B 2 38  ? 68.841 6.129   10.488  1.00 29.72 ? 38  ARG H CA  1 
ATOM   1956 C C   . ARG B 2 38  ? 67.760 7.135   10.162  1.00 28.27 ? 38  ARG H C   1 
ATOM   1957 O O   . ARG B 2 38  ? 66.770 7.262   10.886  1.00 26.26 ? 38  ARG H O   1 
ATOM   1958 C CB  . ARG B 2 38  ? 68.666 4.892   9.601   1.00 25.93 ? 38  ARG H CB  1 
ATOM   1959 C CG  . ARG B 2 38  ? 67.240 4.364   9.490   1.00 16.76 ? 38  ARG H CG  1 
ATOM   1960 C CD  . ARG B 2 38  ? 67.304 2.960   8.921   1.00 24.48 ? 38  ARG H CD  1 
ATOM   1961 N NE  . ARG B 2 38  ? 66.005 2.313   8.769   1.00 20.65 ? 38  ARG H NE  1 
ATOM   1962 C CZ  . ARG B 2 38  ? 65.848 1.078   8.300   1.00 23.63 ? 38  ARG H CZ  1 
ATOM   1963 N NH1 . ARG B 2 38  ? 66.906 0.360   7.933   1.00 23.54 ? 38  ARG H NH1 1 
ATOM   1964 N NH2 . ARG B 2 38  ? 64.635 0.550   8.214   1.00 27.98 ? 38  ARG H NH2 1 
ATOM   1965 N N   . GLN B 2 39  ? 67.960 7.837   9.057   1.00 26.22 ? 39  GLN H N   1 
ATOM   1966 C CA  . GLN B 2 39  ? 67.023 8.836   8.605   1.00 21.83 ? 39  GLN H CA  1 
ATOM   1967 C C   . GLN B 2 39  ? 66.796 8.641   7.102   1.00 29.43 ? 39  GLN H C   1 
ATOM   1968 O O   . GLN B 2 39  ? 67.732 8.741   6.288   1.00 22.24 ? 39  GLN H O   1 
ATOM   1969 C CB  . GLN B 2 39  ? 67.581 10.217  8.907   1.00 14.68 ? 39  GLN H CB  1 
ATOM   1970 C CG  . GLN B 2 39  ? 66.603 11.342  8.762   1.00 25.35 ? 39  GLN H CG  1 
ATOM   1971 C CD  . GLN B 2 39  ? 67.184 12.643  9.266   1.00 33.39 ? 39  GLN H CD  1 
ATOM   1972 O OE1 . GLN B 2 39  ? 68.402 12.767  9.447   1.00 35.52 ? 39  GLN H OE1 1 
ATOM   1973 N NE2 . GLN B 2 39  ? 66.322 13.617  9.511   1.00 36.25 ? 39  GLN H NE2 1 
ATOM   1974 N N   . ALA B 2 40  ? 65.558 8.282   6.767   1.00 33.88 ? 40  ALA H N   1 
ATOM   1975 C CA  . ALA B 2 40  ? 65.131 8.053   5.396   1.00 37.12 ? 40  ALA H CA  1 
ATOM   1976 C C   . ALA B 2 40  ? 65.046 9.392   4.676   1.00 44.96 ? 40  ALA H C   1 
ATOM   1977 O O   . ALA B 2 40  ? 64.692 10.406  5.283   1.00 44.45 ? 40  ALA H O   1 
ATOM   1978 C CB  . ALA B 2 40  ? 63.785 7.370   5.387   1.00 36.88 ? 40  ALA H CB  1 
ATOM   1979 N N   . PRO B 2 41  ? 65.334 9.405   3.362   1.00 51.88 ? 41  PRO H N   1 
ATOM   1980 C CA  . PRO B 2 41  ? 65.313 10.596  2.500   1.00 51.97 ? 41  PRO H CA  1 
ATOM   1981 C C   . PRO B 2 41  ? 64.131 11.531  2.737   1.00 50.09 ? 41  PRO H C   1 
ATOM   1982 O O   . PRO B 2 41  ? 63.000 11.230  2.359   1.00 43.26 ? 41  PRO H O   1 
ATOM   1983 C CB  . PRO B 2 41  ? 65.289 9.991   1.101   1.00 55.24 ? 41  PRO H CB  1 
ATOM   1984 C CG  . PRO B 2 41  ? 66.141 8.762   1.272   1.00 53.44 ? 41  PRO H CG  1 
ATOM   1985 C CD  . PRO B 2 41  ? 65.602 8.192   2.564   1.00 53.08 ? 41  PRO H CD  1 
ATOM   1986 N N   . GLY B 2 42  ? 64.419 12.664  3.372   1.00 52.11 ? 42  GLY H N   1 
ATOM   1987 C CA  . GLY B 2 42  ? 63.397 13.651  3.675   1.00 55.36 ? 42  GLY H CA  1 
ATOM   1988 C C   . GLY B 2 42  ? 62.381 13.186  4.704   1.00 57.36 ? 42  GLY H C   1 
ATOM   1989 O O   . GLY B 2 42  ? 61.207 13.545  4.627   1.00 62.24 ? 42  GLY H O   1 
ATOM   1990 N N   . LYS B 2 43  ? 62.821 12.401  5.681   1.00 57.28 ? 43  LYS H N   1 
ATOM   1991 C CA  . LYS B 2 43  ? 61.915 11.898  6.708   1.00 55.13 ? 43  LYS H CA  1 
ATOM   1992 C C   . LYS B 2 43  ? 62.494 12.120  8.114   1.00 51.37 ? 43  LYS H C   1 
ATOM   1993 O O   . LYS B 2 43  ? 63.524 12.789  8.280   1.00 45.55 ? 43  LYS H O   1 
ATOM   1994 C CB  . LYS B 2 43  ? 61.653 10.401  6.484   1.00 58.85 ? 43  LYS H CB  1 
ATOM   1995 C CG  . LYS B 2 43  ? 61.343 10.016  5.047   1.00 66.70 ? 43  LYS H CG  1 
ATOM   1996 C CD  . LYS B 2 43  ? 60.018 10.590  4.564   1.00 73.76 ? 43  LYS H CD  1 
ATOM   1997 C CE  . LYS B 2 43  ? 58.840 9.898   5.225   1.00 80.63 ? 43  LYS H CE  1 
ATOM   1998 N NZ  . LYS B 2 43  ? 58.838 8.427   4.966   1.00 84.99 ? 43  LYS H NZ  1 
ATOM   1999 N N   . GLY B 2 44  ? 61.807 11.576  9.120   1.00 47.59 ? 44  GLY H N   1 
ATOM   2000 C CA  . GLY B 2 44  ? 62.267 11.687  10.492  1.00 40.91 ? 44  GLY H CA  1 
ATOM   2001 C C   . GLY B 2 44  ? 63.276 10.597  10.814  1.00 36.47 ? 44  GLY H C   1 
ATOM   2002 O O   . GLY B 2 44  ? 63.666 9.822   9.940   1.00 39.55 ? 44  GLY H O   1 
ATOM   2003 N N   . LEU B 2 45  ? 63.675 10.509  12.079  1.00 32.96 ? 45  LEU H N   1 
ATOM   2004 C CA  . LEU B 2 45  ? 64.648 9.515   12.518  1.00 20.65 ? 45  LEU H CA  1 
ATOM   2005 C C   . LEU B 2 45  ? 63.986 8.212   12.972  1.00 18.41 ? 45  LEU H C   1 
ATOM   2006 O O   . LEU B 2 45  ? 62.858 8.207   13.474  1.00 20.10 ? 45  LEU H O   1 
ATOM   2007 C CB  . LEU B 2 45  ? 65.500 10.096  13.646  1.00 19.59 ? 45  LEU H CB  1 
ATOM   2008 C CG  . LEU B 2 45  ? 66.200 11.416  13.311  1.00 21.36 ? 45  LEU H CG  1 
ATOM   2009 C CD1 . LEU B 2 45  ? 66.280 12.290  14.538  1.00 23.37 ? 45  LEU H CD1 1 
ATOM   2010 C CD2 . LEU B 2 45  ? 67.574 11.164  12.742  1.00 19.41 ? 45  LEU H CD2 1 
ATOM   2011 N N   . GLU B 2 46  ? 64.678 7.103   12.763  1.00 14.79 ? 46  GLU H N   1 
ATOM   2012 C CA  . GLU B 2 46  ? 64.178 5.801   13.172  1.00 17.57 ? 46  GLU H CA  1 
ATOM   2013 C C   . GLU B 2 46  ? 65.331 5.056   13.831  1.00 19.96 ? 46  GLU H C   1 
ATOM   2014 O O   . GLU B 2 46  ? 66.370 4.843   13.207  1.00 24.51 ? 46  GLU H O   1 
ATOM   2015 C CB  . GLU B 2 46  ? 63.675 5.018   11.958  1.00 20.54 ? 46  GLU H CB  1 
ATOM   2016 C CG  . GLU B 2 46  ? 63.298 3.569   12.260  1.00 27.64 ? 46  GLU H CG  1 
ATOM   2017 C CD  . GLU B 2 46  ? 62.990 2.746   11.015  1.00 31.57 ? 46  GLU H CD  1 
ATOM   2018 O OE1 . GLU B 2 46  ? 63.533 3.071   9.932   1.00 33.93 ? 46  GLU H OE1 1 
ATOM   2019 O OE2 . GLU B 2 46  ? 62.212 1.767   11.125  1.00 30.00 ? 46  GLU H OE2 1 
ATOM   2020 N N   . TRP B 2 47  ? 65.198 4.754   15.121  1.00 23.20 ? 47  TRP H N   1 
ATOM   2021 C CA  . TRP B 2 47  ? 66.243 4.022   15.831  1.00 17.44 ? 47  TRP H CA  1 
ATOM   2022 C C   . TRP B 2 47  ? 66.324 2.628   15.202  1.00 18.68 ? 47  TRP H C   1 
ATOM   2023 O O   . TRP B 2 47  ? 65.298 1.986   14.977  1.00 18.13 ? 47  TRP H O   1 
ATOM   2024 C CB  . TRP B 2 47  ? 65.932 3.945   17.334  1.00 9.99  ? 47  TRP H CB  1 
ATOM   2025 C CG  . TRP B 2 47  ? 66.756 2.940   18.063  1.00 4.35  ? 47  TRP H CG  1 
ATOM   2026 C CD1 . TRP B 2 47  ? 68.080 3.040   18.396  1.00 2.00  ? 47  TRP H CD1 1 
ATOM   2027 C CD2 . TRP B 2 47  ? 66.343 1.625   18.443  1.00 2.00  ? 47  TRP H CD2 1 
ATOM   2028 N NE1 . TRP B 2 47  ? 68.518 1.851   18.938  1.00 4.17  ? 47  TRP H NE1 1 
ATOM   2029 C CE2 . TRP B 2 47  ? 67.467 0.971   18.979  1.00 2.00  ? 47  TRP H CE2 1 
ATOM   2030 C CE3 . TRP B 2 47  ? 65.131 0.938   18.377  1.00 4.26  ? 47  TRP H CE3 1 
ATOM   2031 C CZ2 . TRP B 2 47  ? 67.412 -0.336  19.447  1.00 8.84  ? 47  TRP H CZ2 1 
ATOM   2032 C CZ3 . TRP B 2 47  ? 65.076 -0.366  18.847  1.00 8.96  ? 47  TRP H CZ3 1 
ATOM   2033 C CH2 . TRP B 2 47  ? 66.209 -0.987  19.374  1.00 7.83  ? 47  TRP H CH2 1 
ATOM   2034 N N   . VAL B 2 48  ? 67.543 2.162   14.949  1.00 18.32 ? 48  VAL H N   1 
ATOM   2035 C CA  . VAL B 2 48  ? 67.756 0.869   14.305  1.00 24.00 ? 48  VAL H CA  1 
ATOM   2036 C C   . VAL B 2 48  ? 68.214 -0.275  15.205  1.00 28.79 ? 48  VAL H C   1 
ATOM   2037 O O   . VAL B 2 48  ? 67.562 -1.322  15.272  1.00 31.26 ? 48  VAL H O   1 
ATOM   2038 C CB  . VAL B 2 48  ? 68.783 1.001   13.142  1.00 20.11 ? 48  VAL H CB  1 
ATOM   2039 C CG1 . VAL B 2 48  ? 69.152 -0.368  12.602  1.00 14.15 ? 48  VAL H CG1 1 
ATOM   2040 C CG2 . VAL B 2 48  ? 68.222 1.873   12.047  1.00 25.77 ? 48  VAL H CG2 1 
ATOM   2041 N N   . ALA B 2 49  ? 69.373 -0.106  15.835  1.00 30.28 ? 49  ALA H N   1 
ATOM   2042 C CA  . ALA B 2 49  ? 69.917 -1.147  16.691  1.00 32.54 ? 49  ALA H CA  1 
ATOM   2043 C C   . ALA B 2 49  ? 70.617 -0.560  17.906  1.00 35.71 ? 49  ALA H C   1 
ATOM   2044 O O   . ALA B 2 49  ? 70.928 0.640   17.939  1.00 40.74 ? 49  ALA H O   1 
ATOM   2045 C CB  . ALA B 2 49  ? 70.875 -2.014  15.898  1.00 30.70 ? 49  ALA H CB  1 
ATOM   2046 N N   . ARG B 2 50  ? 70.864 -1.413  18.900  1.00 36.16 ? 50  ARG H N   1 
ATOM   2047 C CA  . ARG B 2 50  ? 71.533 -1.009  20.138  1.00 27.37 ? 50  ARG H CA  1 
ATOM   2048 C C   . ARG B 2 50  ? 72.348 -2.164  20.710  1.00 19.19 ? 50  ARG H C   1 
ATOM   2049 O O   . ARG B 2 50  ? 71.876 -3.304  20.738  1.00 20.04 ? 50  ARG H O   1 
ATOM   2050 C CB  . ARG B 2 50  ? 70.494 -0.576  21.178  1.00 29.50 ? 50  ARG H CB  1 
ATOM   2051 C CG  . ARG B 2 50  ? 71.085 -0.229  22.530  1.00 32.52 ? 50  ARG H CG  1 
ATOM   2052 C CD  . ARG B 2 50  ? 70.004 0.077   23.535  1.00 33.22 ? 50  ARG H CD  1 
ATOM   2053 N NE  . ARG B 2 50  ? 70.547 0.641   24.768  1.00 39.28 ? 50  ARG H NE  1 
ATOM   2054 C CZ  . ARG B 2 50  ? 70.017 0.471   25.979  1.00 39.31 ? 50  ARG H CZ  1 
ATOM   2055 N NH1 . ARG B 2 50  ? 68.917 -0.256  26.144  1.00 31.91 ? 50  ARG H NH1 1 
ATOM   2056 N NH2 . ARG B 2 50  ? 70.596 1.031   27.032  1.00 38.55 ? 50  ARG H NH2 1 
ATOM   2057 N N   . ILE B 2 51  ? 73.581 -1.883  21.115  1.00 13.91 ? 51  ILE H N   1 
ATOM   2058 C CA  . ILE B 2 51  ? 74.426 -2.903  21.730  1.00 17.29 ? 51  ILE H CA  1 
ATOM   2059 C C   . ILE B 2 51  ? 75.008 -2.401  23.068  1.00 18.70 ? 51  ILE H C   1 
ATOM   2060 O O   . ILE B 2 51  ? 75.807 -1.466  23.106  1.00 20.58 ? 51  ILE H O   1 
ATOM   2061 C CB  . ILE B 2 51  ? 75.546 -3.393  20.789  1.00 13.95 ? 51  ILE H CB  1 
ATOM   2062 C CG1 . ILE B 2 51  ? 76.340 -4.506  21.472  1.00 11.81 ? 51  ILE H CG1 1 
ATOM   2063 C CG2 . ILE B 2 51  ? 76.459 -2.241  20.370  1.00 4.70  ? 51  ILE H CG2 1 
ATOM   2064 C CD1 . ILE B 2 51  ? 76.954 -5.482  20.505  1.00 19.96 ? 51  ILE H CD1 1 
ATOM   2065 N N   . ARG B 2 52  ? 74.540 -2.982  24.167  1.00 21.23 ? 52  ARG H N   1 
ATOM   2066 C CA  . ARG B 2 52  ? 74.990 -2.601  25.507  1.00 19.62 ? 52  ARG H CA  1 
ATOM   2067 C C   . ARG B 2 52  ? 76.435 -3.028  25.749  1.00 22.59 ? 52  ARG H C   1 
ATOM   2068 O O   . ARG B 2 52  ? 76.983 -3.818  24.986  1.00 32.23 ? 52  ARG H O   1 
ATOM   2069 C CB  . ARG B 2 52  ? 74.075 -3.224  26.554  1.00 12.75 ? 52  ARG H CB  1 
ATOM   2070 C CG  . ARG B 2 52  ? 72.619 -2.956  26.292  1.00 10.62 ? 52  ARG H CG  1 
ATOM   2071 C CD  . ARG B 2 52  ? 71.799 -3.171  27.527  1.00 21.17 ? 52  ARG H CD  1 
ATOM   2072 N NE  . ARG B 2 52  ? 72.061 -2.128  28.512  1.00 24.72 ? 52  ARG H NE  1 
ATOM   2073 C CZ  . ARG B 2 52  ? 71.196 -1.745  29.442  1.00 23.16 ? 52  ARG H CZ  1 
ATOM   2074 N NH1 . ARG B 2 52  ? 69.990 -2.285  29.475  1.00 23.55 ? 52  ARG H NH1 1 
ATOM   2075 N NH2 . ARG B 2 52  ? 71.534 -0.820  30.331  1.00 25.21 ? 52  ARG H NH2 1 
ATOM   2076 N N   . SER B 2 53  A 77.037 -2.530  26.823  1.00 23.46 ? 52  SER H N   1 
ATOM   2077 C CA  . SER B 2 53  A 78.427 -2.835  27.150  1.00 20.87 ? 52  SER H CA  1 
ATOM   2078 C C   . SER B 2 53  A 78.693 -4.250  27.632  1.00 18.66 ? 52  SER H C   1 
ATOM   2079 O O   . SER B 2 53  A 77.766 -5.022  27.893  1.00 20.72 ? 52  SER H O   1 
ATOM   2080 C CB  . SER B 2 53  A 78.959 -1.830  28.174  1.00 24.40 ? 52  SER H CB  1 
ATOM   2081 O OG  . SER B 2 53  A 78.118 -1.745  29.313  1.00 34.36 ? 52  SER H OG  1 
ATOM   2082 N N   . LYS B 2 54  B 79.975 -4.594  27.721  1.00 19.43 ? 52  LYS H N   1 
ATOM   2083 C CA  . LYS B 2 54  B 80.409 -5.913  28.186  1.00 26.16 ? 52  LYS H CA  1 
ATOM   2084 C C   . LYS B 2 54  B 79.864 -6.203  29.591  1.00 30.85 ? 52  LYS H C   1 
ATOM   2085 O O   . LYS B 2 54  B 79.501 -7.338  29.908  1.00 29.22 ? 52  LYS H O   1 
ATOM   2086 C CB  . LYS B 2 54  B 81.939 -5.973  28.191  1.00 23.19 ? 52  LYS H CB  1 
ATOM   2087 C CG  . LYS B 2 54  B 82.546 -7.247  28.765  1.00 28.55 ? 52  LYS H CG  1 
ATOM   2088 C CD  . LYS B 2 54  B 81.973 -8.520  28.147  1.00 31.19 ? 52  LYS H CD  1 
ATOM   2089 C CE  . LYS B 2 54  B 82.846 -9.731  28.483  1.00 36.68 ? 52  LYS H CE  1 
ATOM   2090 N NZ  . LYS B 2 54  B 83.145 -9.875  29.945  1.00 33.62 ? 52  LYS H NZ  1 
ATOM   2091 N N   . GLY B 2 55  C 79.778 -5.154  30.408  1.00 35.07 ? 52  GLY H N   1 
ATOM   2092 C CA  . GLY B 2 55  C 79.270 -5.288  31.762  1.00 33.81 ? 52  GLY H CA  1 
ATOM   2093 C C   . GLY B 2 55  C 77.826 -5.733  31.772  1.00 32.58 ? 52  GLY H C   1 
ATOM   2094 O O   . GLY B 2 55  C 77.267 -6.045  32.819  1.00 34.16 ? 52  GLY H O   1 
ATOM   2095 N N   . PHE B 2 56  ? 77.199 -5.700  30.604  1.00 30.64 ? 53  PHE H N   1 
ATOM   2096 C CA  . PHE B 2 56  ? 75.822 -6.133  30.474  1.00 25.93 ? 53  PHE H CA  1 
ATOM   2097 C C   . PHE B 2 56  ? 75.783 -7.247  29.452  1.00 21.62 ? 53  PHE H C   1 
ATOM   2098 O O   . PHE B 2 56  ? 74.787 -7.433  28.755  1.00 20.37 ? 53  PHE H O   1 
ATOM   2099 C CB  . PHE B 2 56  ? 74.922 -4.981  30.050  1.00 28.99 ? 53  PHE H CB  1 
ATOM   2100 C CG  . PHE B 2 56  ? 74.789 -3.900  31.083  1.00 29.13 ? 53  PHE H CG  1 
ATOM   2101 C CD1 . PHE B 2 56  ? 75.842 -3.034  31.342  1.00 33.69 ? 53  PHE H CD1 1 
ATOM   2102 C CD2 . PHE B 2 56  ? 73.579 -3.697  31.737  1.00 27.39 ? 53  PHE H CD2 1 
ATOM   2103 C CE1 . PHE B 2 56  ? 75.686 -1.974  32.233  1.00 40.98 ? 53  PHE H CE1 1 
ATOM   2104 C CE2 . PHE B 2 56  ? 73.413 -2.645  32.622  1.00 29.40 ? 53  PHE H CE2 1 
ATOM   2105 C CZ  . PHE B 2 56  ? 74.464 -1.778  32.872  1.00 34.84 ? 53  PHE H CZ  1 
ATOM   2106 N N   . ASN B 2 57  ? 76.890 -7.978  29.375  1.00 21.36 ? 54  ASN H N   1 
ATOM   2107 C CA  . ASN B 2 57  ? 77.046 -9.121  28.477  1.00 26.96 ? 54  ASN H CA  1 
ATOM   2108 C C   . ASN B 2 57  ? 76.707 -8.899  26.998  1.00 28.35 ? 54  ASN H C   1 
ATOM   2109 O O   . ASN B 2 57  ? 76.182 -9.798  26.323  1.00 25.62 ? 54  ASN H O   1 
ATOM   2110 C CB  . ASN B 2 57  ? 76.281 -10.328 29.031  1.00 27.31 ? 54  ASN H CB  1 
ATOM   2111 C CG  . ASN B 2 57  ? 76.917 -10.900 30.289  1.00 25.20 ? 54  ASN H CG  1 
ATOM   2112 O OD1 . ASN B 2 57  ? 78.143 -11.004 30.401  1.00 23.28 ? 54  ASN H OD1 1 
ATOM   2113 N ND2 . ASN B 2 57  ? 76.085 -11.284 31.232  1.00 27.53 ? 54  ASN H ND2 1 
ATOM   2114 N N   . PHE B 2 58  ? 77.004 -7.694  26.514  1.00 26.17 ? 55  PHE H N   1 
ATOM   2115 C CA  . PHE B 2 58  ? 76.779 -7.311  25.126  1.00 20.71 ? 55  PHE H CA  1 
ATOM   2116 C C   . PHE B 2 58  ? 75.348 -7.471  24.624  1.00 24.88 ? 55  PHE H C   1 
ATOM   2117 O O   . PHE B 2 58  ? 75.131 -7.834  23.469  1.00 33.37 ? 55  PHE H O   1 
ATOM   2118 C CB  . PHE B 2 58  ? 77.725 -8.082  24.205  1.00 13.62 ? 55  PHE H CB  1 
ATOM   2119 C CG  . PHE B 2 58  ? 79.176 -7.740  24.388  1.00 15.19 ? 55  PHE H CG  1 
ATOM   2120 C CD1 . PHE B 2 58  ? 79.578 -6.429  24.581  1.00 11.77 ? 55  PHE H CD1 1 
ATOM   2121 C CD2 . PHE B 2 58  ? 80.147 -8.731  24.305  1.00 14.66 ? 55  PHE H CD2 1 
ATOM   2122 C CE1 . PHE B 2 58  ? 80.924 -6.108  24.680  1.00 14.70 ? 55  PHE H CE1 1 
ATOM   2123 C CE2 . PHE B 2 58  ? 81.501 -8.420  24.407  1.00 18.88 ? 55  PHE H CE2 1 
ATOM   2124 C CZ  . PHE B 2 58  ? 81.888 -7.108  24.592  1.00 14.32 ? 55  PHE H CZ  1 
ATOM   2125 N N   . ALA B 2 59  ? 74.371 -7.166  25.462  1.00 21.91 ? 56  ALA H N   1 
ATOM   2126 C CA  . ALA B 2 59  ? 72.979 -7.287  25.058  1.00 22.94 ? 56  ALA H CA  1 
ATOM   2127 C C   . ALA B 2 59  ? 72.666 -6.456  23.798  1.00 26.19 ? 56  ALA H C   1 
ATOM   2128 O O   . ALA B 2 59  ? 73.024 -5.279  23.720  1.00 26.53 ? 56  ALA H O   1 
ATOM   2129 C CB  . ALA B 2 59  ? 72.074 -6.873  26.209  1.00 19.86 ? 56  ALA H CB  1 
ATOM   2130 N N   . THR B 2 60  ? 72.002 -7.077  22.821  1.00 28.70 ? 57  THR H N   1 
ATOM   2131 C CA  . THR B 2 60  ? 71.621 -6.413  21.564  1.00 26.98 ? 57  THR H CA  1 
ATOM   2132 C C   . THR B 2 60  ? 70.099 -6.270  21.405  1.00 28.63 ? 57  THR H C   1 
ATOM   2133 O O   . THR B 2 60  ? 69.332 -7.177  21.751  1.00 29.63 ? 57  THR H O   1 
ATOM   2134 C CB  . THR B 2 60  ? 72.141 -7.190  20.319  1.00 22.05 ? 57  THR H CB  1 
ATOM   2135 O OG1 . THR B 2 60  ? 71.710 -8.559  20.382  1.00 16.77 ? 57  THR H OG1 1 
ATOM   2136 C CG2 . THR B 2 60  ? 73.653 -7.135  20.231  1.00 14.06 ? 57  THR H CG2 1 
ATOM   2137 N N   . TYR B 2 61  ? 69.665 -5.139  20.860  1.00 27.44 ? 58  TYR H N   1 
ATOM   2138 C CA  . TYR B 2 61  ? 68.247 -4.893  20.629  1.00 23.96 ? 58  TYR H CA  1 
ATOM   2139 C C   . TYR B 2 61  ? 68.117 -4.390  19.200  1.00 25.03 ? 58  TYR H C   1 
ATOM   2140 O O   . TYR B 2 61  ? 68.985 -3.654  18.725  1.00 26.17 ? 58  TYR H O   1 
ATOM   2141 C CB  . TYR B 2 61  ? 67.712 -3.841  21.608  1.00 30.21 ? 58  TYR H CB  1 
ATOM   2142 C CG  . TYR B 2 61  ? 67.796 -4.261  23.056  1.00 24.99 ? 58  TYR H CG  1 
ATOM   2143 C CD1 . TYR B 2 61  ? 66.765 -4.983  23.649  1.00 27.19 ? 58  TYR H CD1 1 
ATOM   2144 C CD2 . TYR B 2 61  ? 68.924 -3.978  23.816  1.00 30.83 ? 58  TYR H CD2 1 
ATOM   2145 C CE1 . TYR B 2 61  ? 66.855 -5.421  24.961  1.00 31.51 ? 58  TYR H CE1 1 
ATOM   2146 C CE2 . TYR B 2 61  ? 69.028 -4.412  25.132  1.00 38.65 ? 58  TYR H CE2 1 
ATOM   2147 C CZ  . TYR B 2 61  ? 67.991 -5.136  25.699  1.00 37.71 ? 58  TYR H CZ  1 
ATOM   2148 O OH  . TYR B 2 61  ? 68.106 -5.587  26.994  1.00 42.46 ? 58  TYR H OH  1 
ATOM   2149 N N   . TYR B 2 62  ? 67.033 -4.774  18.527  1.00 22.68 ? 59  TYR H N   1 
ATOM   2150 C CA  . TYR B 2 62  ? 66.785 -4.381  17.139  1.00 19.43 ? 59  TYR H CA  1 
ATOM   2151 C C   . TYR B 2 62  ? 65.347 -3.941  16.911  1.00 18.97 ? 59  TYR H C   1 
ATOM   2152 O O   . TYR B 2 62  ? 64.419 -4.539  17.449  1.00 20.28 ? 59  TYR H O   1 
ATOM   2153 C CB  . TYR B 2 62  ? 67.049 -5.559  16.200  1.00 17.69 ? 59  TYR H CB  1 
ATOM   2154 C CG  . TYR B 2 62  ? 68.447 -6.093  16.232  1.00 12.43 ? 59  TYR H CG  1 
ATOM   2155 C CD1 . TYR B 2 62  ? 69.463 -5.478  15.503  1.00 13.30 ? 59  TYR H CD1 1 
ATOM   2156 C CD2 . TYR B 2 62  ? 68.757 -7.243  16.963  1.00 20.25 ? 59  TYR H CD2 1 
ATOM   2157 C CE1 . TYR B 2 62  ? 70.757 -5.993  15.494  1.00 11.65 ? 59  TYR H CE1 1 
ATOM   2158 C CE2 . TYR B 2 62  ? 70.054 -7.770  16.963  1.00 18.54 ? 59  TYR H CE2 1 
ATOM   2159 C CZ  . TYR B 2 62  ? 71.042 -7.139  16.226  1.00 15.71 ? 59  TYR H CZ  1 
ATOM   2160 O OH  . TYR B 2 62  ? 72.319 -7.649  16.220  1.00 19.60 ? 59  TYR H OH  1 
ATOM   2161 N N   . ALA B 2 63  ? 65.157 -2.907  16.098  1.00 19.97 ? 60  ALA H N   1 
ATOM   2162 C CA  . ALA B 2 63  ? 63.812 -2.449  15.779  1.00 20.28 ? 60  ALA H CA  1 
ATOM   2163 C C   . ALA B 2 63  ? 63.094 -3.592  15.069  1.00 22.72 ? 60  ALA H C   1 
ATOM   2164 O O   . ALA B 2 63  ? 63.730 -4.411  14.415  1.00 23.72 ? 60  ALA H O   1 
ATOM   2165 C CB  . ALA B 2 63  ? 63.875 -1.250  14.885  1.00 16.83 ? 60  ALA H CB  1 
ATOM   2166 N N   . ASP B 2 64  ? 61.773 -3.647  15.185  1.00 33.63 ? 61  ASP H N   1 
ATOM   2167 C CA  . ASP B 2 64  ? 60.997 -4.714  14.552  1.00 40.00 ? 61  ASP H CA  1 
ATOM   2168 C C   . ASP B 2 64  ? 61.295 -4.867  13.060  1.00 41.36 ? 61  ASP H C   1 
ATOM   2169 O O   . ASP B 2 64  ? 61.476 -5.980  12.573  1.00 41.00 ? 61  ASP H O   1 
ATOM   2170 C CB  . ASP B 2 64  ? 59.493 -4.472  14.730  1.00 51.98 ? 61  ASP H CB  1 
ATOM   2171 C CG  . ASP B 2 64  ? 59.055 -4.472  16.192  1.00 61.54 ? 61  ASP H CG  1 
ATOM   2172 O OD1 . ASP B 2 64  ? 58.618 -3.403  16.673  1.00 69.86 ? 61  ASP H OD1 1 
ATOM   2173 O OD2 . ASP B 2 64  ? 59.118 -5.537  16.850  1.00 61.91 ? 61  ASP H OD2 1 
ATOM   2174 N N   . SER B 2 65  ? 61.371 -3.740  12.357  1.00 39.31 ? 62  SER H N   1 
ATOM   2175 C CA  . SER B 2 65  ? 61.618 -3.706  10.916  1.00 38.72 ? 62  SER H CA  1 
ATOM   2176 C C   . SER B 2 65  ? 63.019 -4.115  10.445  1.00 39.68 ? 62  SER H C   1 
ATOM   2177 O O   . SER B 2 65  ? 63.232 -4.377  9.259   1.00 42.00 ? 62  SER H O   1 
ATOM   2178 C CB  . SER B 2 65  ? 61.316 -2.301  10.385  1.00 39.33 ? 62  SER H CB  1 
ATOM   2179 O OG  . SER B 2 65  ? 62.141 -1.321  11.011  1.00 38.04 ? 62  SER H OG  1 
ATOM   2180 N N   . VAL B 2 66  ? 63.967 -4.172  11.368  1.00 37.54 ? 63  VAL H N   1 
ATOM   2181 C CA  . VAL B 2 66  ? 65.343 -4.501  11.036  1.00 29.33 ? 63  VAL H CA  1 
ATOM   2182 C C   . VAL B 2 66  ? 65.788 -5.830  11.638  1.00 31.87 ? 63  VAL H C   1 
ATOM   2183 O O   . VAL B 2 66  ? 66.848 -6.370  11.291  1.00 32.26 ? 63  VAL H O   1 
ATOM   2184 C CB  . VAL B 2 66  ? 66.238 -3.325  11.489  1.00 29.01 ? 63  VAL H CB  1 
ATOM   2185 C CG1 . VAL B 2 66  ? 67.517 -3.790  12.138  1.00 31.68 ? 63  VAL H CG1 1 
ATOM   2186 C CG2 . VAL B 2 66  ? 66.511 -2.420  10.314  1.00 27.68 ? 63  VAL H CG2 1 
ATOM   2187 N N   . ARG B 2 67  ? 64.943 -6.386  12.496  1.00 35.57 ? 64  ARG H N   1 
ATOM   2188 C CA  . ARG B 2 67  ? 65.245 -7.636  13.176  1.00 39.01 ? 64  ARG H CA  1 
ATOM   2189 C C   . ARG B 2 67  ? 65.560 -8.803  12.234  1.00 38.64 ? 64  ARG H C   1 
ATOM   2190 O O   . ARG B 2 67  ? 65.049 -8.879  11.115  1.00 41.88 ? 64  ARG H O   1 
ATOM   2191 C CB  . ARG B 2 67  ? 64.098 -7.999  14.129  1.00 40.14 ? 64  ARG H CB  1 
ATOM   2192 C CG  . ARG B 2 67  ? 64.454 -9.050  15.175  1.00 43.61 ? 64  ARG H CG  1 
ATOM   2193 C CD  . ARG B 2 67  ? 63.365 -9.156  16.230  1.00 49.80 ? 64  ARG H CD  1 
ATOM   2194 N NE  . ARG B 2 67  ? 63.152 -7.886  16.927  1.00 52.76 ? 64  ARG H NE  1 
ATOM   2195 C CZ  . ARG B 2 67  ? 61.963 -7.305  17.084  1.00 54.90 ? 64  ARG H CZ  1 
ATOM   2196 N NH1 . ARG B 2 67  ? 60.871 -7.882  16.594  1.00 57.57 ? 64  ARG H NH1 1 
ATOM   2197 N NH2 . ARG B 2 67  ? 61.868 -6.136  17.713  1.00 52.93 ? 64  ARG H NH2 1 
ATOM   2198 N N   . ASP B 2 68  ? 66.466 -9.667  12.681  1.00 36.84 ? 65  ASP H N   1 
ATOM   2199 C CA  . ASP B 2 68  ? 66.883 -10.850 11.942  1.00 32.96 ? 65  ASP H CA  1 
ATOM   2200 C C   . ASP B 2 68  ? 67.573 -10.586 10.626  1.00 31.88 ? 65  ASP H C   1 
ATOM   2201 O O   . ASP B 2 68  ? 68.022 -11.526 9.979   1.00 31.66 ? 65  ASP H O   1 
ATOM   2202 C CB  . ASP B 2 68  ? 65.709 -11.808 11.730  1.00 39.72 ? 65  ASP H CB  1 
ATOM   2203 C CG  . ASP B 2 68  ? 65.391 -12.637 12.968  1.00 45.11 ? 65  ASP H CG  1 
ATOM   2204 O OD1 . ASP B 2 68  ? 64.452 -13.455 12.901  1.00 47.28 ? 65  ASP H OD1 1 
ATOM   2205 O OD2 . ASP B 2 68  ? 66.080 -12.490 13.999  1.00 45.17 ? 65  ASP H OD2 1 
ATOM   2206 N N   . ARG B 2 69  ? 67.654 -9.319  10.231  1.00 29.97 ? 66  ARG H N   1 
ATOM   2207 C CA  . ARG B 2 69  ? 68.313 -8.943  8.990   1.00 27.15 ? 66  ARG H CA  1 
ATOM   2208 C C   . ARG B 2 69  ? 69.642 -8.260  9.259   1.00 26.72 ? 66  ARG H C   1 
ATOM   2209 O O   . ARG B 2 69  ? 70.651 -8.625  8.666   1.00 29.37 ? 66  ARG H O   1 
ATOM   2210 C CB  . ARG B 2 69  ? 67.416 -8.042  8.158   1.00 28.39 ? 66  ARG H CB  1 
ATOM   2211 C CG  . ARG B 2 69  ? 66.257 -8.778  7.508   1.00 34.59 ? 66  ARG H CG  1 
ATOM   2212 C CD  . ARG B 2 69  ? 65.318 -7.796  6.845   1.00 30.81 ? 66  ARG H CD  1 
ATOM   2213 N NE  . ARG B 2 69  ? 66.083 -6.844  6.059   1.00 31.43 ? 66  ARG H NE  1 
ATOM   2214 C CZ  . ARG B 2 69  ? 65.964 -5.528  6.149   1.00 32.84 ? 66  ARG H CZ  1 
ATOM   2215 N NH1 . ARG B 2 69  ? 65.036 -5.026  6.934   1.00 33.03 ? 66  ARG H NH1 1 
ATOM   2216 N NH2 . ARG B 2 69  ? 66.778 -4.713  5.489   1.00 29.56 ? 66  ARG H NH2 1 
ATOM   2217 N N   . PHE B 2 70  ? 69.649 -7.279  10.160  1.00 28.96 ? 67  PHE H N   1 
ATOM   2218 C CA  . PHE B 2 70  ? 70.882 -6.562  10.502  1.00 27.07 ? 67  PHE H CA  1 
ATOM   2219 C C   . PHE B 2 70  ? 71.596 -7.189  11.702  1.00 26.66 ? 67  PHE H C   1 
ATOM   2220 O O   . PHE B 2 70  ? 71.024 -7.996  12.430  1.00 26.37 ? 67  PHE H O   1 
ATOM   2221 C CB  . PHE B 2 70  ? 70.589 -5.086  10.785  1.00 24.88 ? 67  PHE H CB  1 
ATOM   2222 C CG  . PHE B 2 70  ? 70.048 -4.323  9.597   1.00 30.58 ? 67  PHE H CG  1 
ATOM   2223 C CD1 . PHE B 2 70  ? 69.576 -4.986  8.462   1.00 31.59 ? 67  PHE H CD1 1 
ATOM   2224 C CD2 . PHE B 2 70  ? 70.000 -2.929  9.619   1.00 30.35 ? 67  PHE H CD2 1 
ATOM   2225 C CE1 . PHE B 2 70  ? 69.063 -4.269  7.378   1.00 30.24 ? 67  PHE H CE1 1 
ATOM   2226 C CE2 . PHE B 2 70  ? 69.488 -2.207  8.531   1.00 31.13 ? 67  PHE H CE2 1 
ATOM   2227 C CZ  . PHE B 2 70  ? 69.021 -2.875  7.416   1.00 22.52 ? 67  PHE H CZ  1 
ATOM   2228 N N   . THR B 2 71  ? 72.854 -6.829  11.906  1.00 26.92 ? 68  THR H N   1 
ATOM   2229 C CA  . THR B 2 71  ? 73.603 -7.366  13.027  1.00 26.16 ? 68  THR H CA  1 
ATOM   2230 C C   . THR B 2 71  ? 74.595 -6.385  13.617  1.00 27.26 ? 68  THR H C   1 
ATOM   2231 O O   . THR B 2 71  ? 75.664 -6.136  13.049  1.00 28.99 ? 68  THR H O   1 
ATOM   2232 C CB  . THR B 2 71  ? 74.317 -8.671  12.662  1.00 24.57 ? 68  THR H CB  1 
ATOM   2233 O OG1 . THR B 2 71  ? 73.331 -9.662  12.353  1.00 29.65 ? 68  THR H OG1 1 
ATOM   2234 C CG2 . THR B 2 71  ? 75.196 -9.161  13.824  1.00 24.52 ? 68  THR H CG2 1 
ATOM   2235 N N   . ILE B 2 72  ? 74.228 -5.832  14.767  1.00 24.70 ? 69  ILE H N   1 
ATOM   2236 C CA  . ILE B 2 72  ? 75.086 -4.884  15.454  1.00 21.10 ? 69  ILE H CA  1 
ATOM   2237 C C   . ILE B 2 72  ? 76.126 -5.664  16.252  1.00 20.44 ? 69  ILE H C   1 
ATOM   2238 O O   . ILE B 2 72  ? 75.845 -6.739  16.783  1.00 24.64 ? 69  ILE H O   1 
ATOM   2239 C CB  . ILE B 2 72  ? 74.263 -3.935  16.367  1.00 18.21 ? 69  ILE H CB  1 
ATOM   2240 C CG1 . ILE B 2 72  ? 75.137 -2.794  16.882  1.00 13.84 ? 69  ILE H CG1 1 
ATOM   2241 C CG2 . ILE B 2 72  ? 73.607 -4.704  17.509  1.00 15.01 ? 69  ILE H CG2 1 
ATOM   2242 C CD1 . ILE B 2 72  ? 74.339 -1.695  17.545  1.00 12.03 ? 69  ILE H CD1 1 
ATOM   2243 N N   . SER B 2 73  ? 77.348 -5.162  16.261  1.00 15.86 ? 70  SER H N   1 
ATOM   2244 C CA  . SER B 2 73  ? 78.418 -5.798  16.991  1.00 13.03 ? 70  SER H CA  1 
ATOM   2245 C C   . SER B 2 73  ? 79.415 -4.695  17.314  1.00 16.13 ? 70  SER H C   1 
ATOM   2246 O O   . SER B 2 73  ? 79.230 -3.549  16.898  1.00 11.71 ? 70  SER H O   1 
ATOM   2247 C CB  . SER B 2 73  ? 79.052 -6.908  16.150  1.00 17.90 ? 70  SER H CB  1 
ATOM   2248 O OG  . SER B 2 73  ? 79.836 -6.385  15.098  1.00 25.17 ? 70  SER H OG  1 
ATOM   2249 N N   . ARG B 2 74  ? 80.459 -5.018  18.062  1.00 17.65 ? 71  ARG H N   1 
ATOM   2250 C CA  . ARG B 2 74  ? 81.433 -4.008  18.432  1.00 16.30 ? 71  ARG H CA  1 
ATOM   2251 C C   . ARG B 2 74  ? 82.776 -4.651  18.698  1.00 16.90 ? 71  ARG H C   1 
ATOM   2252 O O   . ARG B 2 74  ? 82.894 -5.873  18.793  1.00 19.89 ? 71  ARG H O   1 
ATOM   2253 C CB  . ARG B 2 74  ? 80.974 -3.261  19.702  1.00 21.97 ? 71  ARG H CB  1 
ATOM   2254 C CG  . ARG B 2 74  ? 80.948 -4.127  20.986  1.00 16.59 ? 71  ARG H CG  1 
ATOM   2255 C CD  . ARG B 2 74  ? 81.183 -3.304  22.248  1.00 14.50 ? 71  ARG H CD  1 
ATOM   2256 N NE  . ARG B 2 74  ? 79.977 -2.639  22.710  1.00 18.60 ? 71  ARG H NE  1 
ATOM   2257 C CZ  . ARG B 2 74  ? 79.936 -1.464  23.338  1.00 19.94 ? 71  ARG H CZ  1 
ATOM   2258 N NH1 . ARG B 2 74  ? 81.043 -0.787  23.612  1.00 12.03 ? 71  ARG H NH1 1 
ATOM   2259 N NH2 . ARG B 2 74  ? 78.760 -0.926  23.626  1.00 25.97 ? 71  ARG H NH2 1 
ATOM   2260 N N   . ASP B 2 75  ? 83.784 -3.806  18.825  1.00 19.05 ? 72  ASP H N   1 
ATOM   2261 C CA  . ASP B 2 75  ? 85.135 -4.235  19.115  1.00 26.68 ? 72  ASP H CA  1 
ATOM   2262 C C   . ASP B 2 75  ? 85.693 -3.208  20.104  1.00 31.41 ? 72  ASP H C   1 
ATOM   2263 O O   . ASP B 2 75  ? 86.254 -2.181  19.706  1.00 32.85 ? 72  ASP H O   1 
ATOM   2264 C CB  . ASP B 2 75  ? 85.962 -4.252  17.835  1.00 28.39 ? 72  ASP H CB  1 
ATOM   2265 C CG  . ASP B 2 75  ? 87.277 -4.950  18.013  1.00 33.61 ? 72  ASP H CG  1 
ATOM   2266 O OD1 . ASP B 2 75  ? 87.870 -4.846  19.103  1.00 41.24 ? 72  ASP H OD1 1 
ATOM   2267 O OD2 . ASP B 2 75  ? 87.721 -5.612  17.060  1.00 42.56 ? 72  ASP H OD2 1 
ATOM   2268 N N   . ASP B 2 76  ? 85.486 -3.469  21.391  1.00 33.55 ? 73  ASP H N   1 
ATOM   2269 C CA  . ASP B 2 76  ? 85.948 -2.579  22.450  1.00 34.56 ? 73  ASP H CA  1 
ATOM   2270 C C   . ASP B 2 76  ? 87.441 -2.254  22.378  1.00 35.89 ? 73  ASP H C   1 
ATOM   2271 O O   . ASP B 2 76  ? 87.847 -1.152  22.734  1.00 41.87 ? 73  ASP H O   1 
ATOM   2272 C CB  . ASP B 2 76  ? 85.628 -3.170  23.827  1.00 35.92 ? 73  ASP H CB  1 
ATOM   2273 C CG  . ASP B 2 76  ? 84.145 -3.137  24.160  1.00 37.97 ? 73  ASP H CG  1 
ATOM   2274 O OD1 . ASP B 2 76  ? 83.651 -4.092  24.799  1.00 36.66 ? 73  ASP H OD1 1 
ATOM   2275 O OD2 . ASP B 2 76  ? 83.477 -2.149  23.808  1.00 38.56 ? 73  ASP H OD2 1 
ATOM   2276 N N   . SER B 2 77  ? 88.258 -3.199  21.923  1.00 34.06 ? 74  SER H N   1 
ATOM   2277 C CA  . SER B 2 77  ? 89.697 -2.962  21.841  1.00 41.79 ? 74  SER H CA  1 
ATOM   2278 C C   . SER B 2 77  ? 90.117 -2.029  20.709  1.00 41.53 ? 74  SER H C   1 
ATOM   2279 O O   . SER B 2 77  ? 91.219 -1.483  20.733  1.00 41.74 ? 74  SER H O   1 
ATOM   2280 C CB  . SER B 2 77  ? 90.455 -4.281  21.727  1.00 45.05 ? 74  SER H CB  1 
ATOM   2281 O OG  . SER B 2 77  ? 90.069 -4.973  20.557  1.00 54.27 ? 74  SER H OG  1 
ATOM   2282 N N   . GLN B 2 78  ? 89.261 -1.880  19.701  1.00 43.69 ? 75  GLN H N   1 
ATOM   2283 C CA  . GLN B 2 78  ? 89.558 -1.002  18.571  1.00 43.64 ? 75  GLN H CA  1 
ATOM   2284 C C   . GLN B 2 78  ? 88.624 0.201   18.570  1.00 43.06 ? 75  GLN H C   1 
ATOM   2285 O O   . GLN B 2 78  ? 88.826 1.152   17.816  1.00 42.18 ? 75  GLN H O   1 
ATOM   2286 C CB  . GLN B 2 78  ? 89.421 -1.760  17.246  1.00 48.16 ? 75  GLN H CB  1 
ATOM   2287 C CG  . GLN B 2 78  ? 90.412 -2.910  17.050  1.00 54.56 ? 75  GLN H CG  1 
ATOM   2288 C CD  . GLN B 2 78  ? 91.853 -2.444  16.887  1.00 57.46 ? 75  GLN H CD  1 
ATOM   2289 O OE1 . GLN B 2 78  ? 92.132 -1.455  16.208  1.00 60.19 ? 75  GLN H OE1 1 
ATOM   2290 N NE2 . GLN B 2 78  ? 92.779 -3.178  17.488  1.00 58.57 ? 75  GLN H NE2 1 
ATOM   2291 N N   . SER B 2 79  ? 87.607 0.152   19.429  1.00 41.84 ? 76  SER H N   1 
ATOM   2292 C CA  . SER B 2 79  ? 86.615 1.218   19.545  1.00 40.49 ? 76  SER H CA  1 
ATOM   2293 C C   . SER B 2 79  ? 85.811 1.357   18.254  1.00 40.98 ? 76  SER H C   1 
ATOM   2294 O O   . SER B 2 79  ? 85.468 2.470   17.833  1.00 40.71 ? 76  SER H O   1 
ATOM   2295 C CB  . SER B 2 79  ? 87.289 2.542   19.898  1.00 41.81 ? 76  SER H CB  1 
ATOM   2296 O OG  . SER B 2 79  ? 88.037 2.409   21.089  1.00 42.45 ? 76  SER H OG  1 
ATOM   2297 N N   . MET B 2 80  ? 85.498 0.211   17.649  1.00 36.38 ? 77  MET H N   1 
ATOM   2298 C CA  . MET B 2 80  ? 84.744 0.160   16.405  1.00 28.63 ? 77  MET H CA  1 
ATOM   2299 C C   . MET B 2 80  ? 83.363 -0.418  16.631  1.00 27.11 ? 77  MET H C   1 
ATOM   2300 O O   . MET B 2 80  ? 83.207 -1.412  17.339  1.00 30.47 ? 77  MET H O   1 
ATOM   2301 C CB  . MET B 2 80  ? 85.471 -0.711  15.372  1.00 26.42 ? 77  MET H CB  1 
ATOM   2302 C CG  . MET B 2 80  ? 86.835 -0.195  14.948  1.00 25.82 ? 77  MET H CG  1 
ATOM   2303 S SD  . MET B 2 80  ? 86.716 1.392   14.119  1.00 32.97 ? 77  MET H SD  1 
ATOM   2304 C CE  . MET B 2 80  ? 85.878 0.861   12.720  1.00 14.44 ? 77  MET H CE  1 
ATOM   2305 N N   . LEU B 2 81  ? 82.365 0.212   16.025  1.00 26.98 ? 78  LEU H N   1 
ATOM   2306 C CA  . LEU B 2 81  ? 80.983 -0.237  16.103  1.00 26.46 ? 78  LEU H CA  1 
ATOM   2307 C C   . LEU B 2 81  ? 80.598 -0.664  14.670  1.00 29.00 ? 78  LEU H C   1 
ATOM   2308 O O   . LEU B 2 81  ? 80.880 0.063   13.713  1.00 34.70 ? 78  LEU H O   1 
ATOM   2309 C CB  . LEU B 2 81  ? 80.099 0.916   16.589  1.00 24.15 ? 78  LEU H CB  1 
ATOM   2310 C CG  . LEU B 2 81  ? 78.596 0.652   16.655  1.00 21.24 ? 78  LEU H CG  1 
ATOM   2311 C CD1 . LEU B 2 81  ? 78.298 -0.306  17.796  1.00 27.50 ? 78  LEU H CD1 1 
ATOM   2312 C CD2 . LEU B 2 81  ? 77.838 1.948   16.815  1.00 17.07 ? 78  LEU H CD2 1 
ATOM   2313 N N   . TYR B 2 82  ? 79.985 -1.832  14.506  1.00 24.02 ? 79  TYR H N   1 
ATOM   2314 C CA  . TYR B 2 82  ? 79.615 -2.293  13.164  1.00 24.07 ? 79  TYR H CA  1 
ATOM   2315 C C   . TYR B 2 82  ? 78.129 -2.578  13.006  1.00 24.61 ? 79  TYR H C   1 
ATOM   2316 O O   . TYR B 2 82  ? 77.431 -2.837  13.983  1.00 29.00 ? 79  TYR H O   1 
ATOM   2317 C CB  . TYR B 2 82  ? 80.381 -3.566  12.808  1.00 23.54 ? 79  TYR H CB  1 
ATOM   2318 C CG  . TYR B 2 82  ? 81.877 -3.447  12.935  1.00 23.45 ? 79  TYR H CG  1 
ATOM   2319 C CD1 . TYR B 2 82  ? 82.638 -2.872  11.925  1.00 28.08 ? 79  TYR H CD1 1 
ATOM   2320 C CD2 . TYR B 2 82  ? 82.531 -3.898  14.078  1.00 29.66 ? 79  TYR H CD2 1 
ATOM   2321 C CE1 . TYR B 2 82  ? 84.019 -2.742  12.051  1.00 33.76 ? 79  TYR H CE1 1 
ATOM   2322 C CE2 . TYR B 2 82  ? 83.908 -3.776  14.217  1.00 29.24 ? 79  TYR H CE2 1 
ATOM   2323 C CZ  . TYR B 2 82  ? 84.649 -3.195  13.206  1.00 35.37 ? 79  TYR H CZ  1 
ATOM   2324 O OH  . TYR B 2 82  ? 86.016 -3.053  13.364  1.00 38.82 ? 79  TYR H OH  1 
ATOM   2325 N N   . LEU B 2 83  ? 77.633 -2.464  11.778  1.00 20.40 ? 80  LEU H N   1 
ATOM   2326 C CA  . LEU B 2 83  ? 76.235 -2.768  11.470  1.00 17.54 ? 80  LEU H CA  1 
ATOM   2327 C C   . LEU B 2 83  ? 76.272 -3.537  10.155  1.00 22.01 ? 80  LEU H C   1 
ATOM   2328 O O   . LEU B 2 83  ? 76.508 -2.957  9.098   1.00 24.04 ? 80  LEU H O   1 
ATOM   2329 C CB  . LEU B 2 83  ? 75.372 -1.507  11.328  1.00 2.00  ? 80  LEU H CB  1 
ATOM   2330 C CG  . LEU B 2 83  ? 73.906 -1.788  10.968  1.00 12.36 ? 80  LEU H CG  1 
ATOM   2331 C CD1 . LEU B 2 83  ? 73.270 -2.666  12.023  1.00 12.35 ? 80  LEU H CD1 1 
ATOM   2332 C CD2 . LEU B 2 83  ? 73.096 -0.505  10.776  1.00 12.64 ? 80  LEU H CD2 1 
ATOM   2333 N N   . GLN B 2 84  ? 76.197 -4.859  10.256  1.00 20.46 ? 81  GLN H N   1 
ATOM   2334 C CA  . GLN B 2 84  ? 76.202 -5.735  9.093   1.00 17.36 ? 81  GLN H CA  1 
ATOM   2335 C C   . GLN B 2 84  ? 74.756 -5.822  8.649   1.00 22.51 ? 81  GLN H C   1 
ATOM   2336 O O   . GLN B 2 84  ? 73.905 -6.286  9.404   1.00 24.52 ? 81  GLN H O   1 
ATOM   2337 C CB  . GLN B 2 84  ? 76.705 -7.115  9.492   1.00 20.90 ? 81  GLN H CB  1 
ATOM   2338 C CG  . GLN B 2 84  ? 76.469 -8.203  8.481   1.00 24.30 ? 81  GLN H CG  1 
ATOM   2339 C CD  . GLN B 2 84  ? 77.247 -7.975  7.214   1.00 27.20 ? 81  GLN H CD  1 
ATOM   2340 O OE1 . GLN B 2 84  ? 78.475 -7.907  7.227   1.00 28.05 ? 81  GLN H OE1 1 
ATOM   2341 N NE2 . GLN B 2 84  ? 76.537 -7.832  6.111   1.00 30.44 ? 81  GLN H NE2 1 
ATOM   2342 N N   . MET B 2 85  ? 74.480 -5.352  7.438   1.00 20.17 ? 82  MET H N   1 
ATOM   2343 C CA  . MET B 2 85  ? 73.134 -5.341  6.891   1.00 17.38 ? 82  MET H CA  1 
ATOM   2344 C C   . MET B 2 85  ? 72.988 -6.419  5.825   1.00 19.38 ? 82  MET H C   1 
ATOM   2345 O O   . MET B 2 85  ? 73.807 -6.520  4.925   1.00 22.50 ? 82  MET H O   1 
ATOM   2346 C CB  . MET B 2 85  ? 72.861 -3.965  6.289   1.00 21.53 ? 82  MET H CB  1 
ATOM   2347 C CG  . MET B 2 85  ? 72.976 -2.814  7.283   1.00 13.33 ? 82  MET H CG  1 
ATOM   2348 S SD  . MET B 2 85  ? 73.535 -1.253  6.561   1.00 22.01 ? 82  MET H SD  1 
ATOM   2349 C CE  . MET B 2 85  ? 71.963 -0.500  6.165   1.00 17.93 ? 82  MET H CE  1 
ATOM   2350 N N   . ASN B 2 86  ? 71.940 -7.220  5.924   1.00 22.41 ? 83  ASN H N   1 
ATOM   2351 C CA  . ASN B 2 86  ? 71.695 -8.289  4.960   1.00 23.79 ? 83  ASN H CA  1 
ATOM   2352 C C   . ASN B 2 86  ? 70.278 -8.172  4.433   1.00 24.45 ? 83  ASN H C   1 
ATOM   2353 O O   . ASN B 2 86  ? 69.458 -7.443  5.005   1.00 23.92 ? 83  ASN H O   1 
ATOM   2354 C CB  . ASN B 2 86  ? 71.908 -9.664  5.603   1.00 18.38 ? 83  ASN H CB  1 
ATOM   2355 C CG  . ASN B 2 86  ? 73.376 -10.018 5.749   1.00 23.34 ? 83  ASN H CG  1 
ATOM   2356 O OD1 . ASN B 2 86  ? 74.231 -9.141  5.821   1.00 27.39 ? 83  ASN H OD1 1 
ATOM   2357 N ND2 . ASN B 2 86  ? 73.676 -11.308 5.779   1.00 33.53 ? 83  ASN H ND2 1 
ATOM   2358 N N   . ASN B 2 87  ? 70.001 -8.865  3.331   1.00 24.90 ? 84  ASN H N   1 
ATOM   2359 C CA  . ASN B 2 87  ? 68.681 -8.836  2.703   1.00 26.46 ? 84  ASN H CA  1 
ATOM   2360 C C   . ASN B 2 87  ? 68.142 -7.420  2.622   1.00 25.68 ? 84  ASN H C   1 
ATOM   2361 O O   . ASN B 2 87  ? 66.969 -7.164  2.896   1.00 25.27 ? 84  ASN H O   1 
ATOM   2362 C CB  . ASN B 2 87  ? 67.706 -9.736  3.453   1.00 31.01 ? 84  ASN H CB  1 
ATOM   2363 C CG  . ASN B 2 87  ? 67.979 -11.206 3.213   1.00 43.40 ? 84  ASN H CG  1 
ATOM   2364 O OD1 . ASN B 2 87  ? 69.120 -11.667 3.318   1.00 41.13 ? 84  ASN H OD1 1 
ATOM   2365 N ND2 . ASN B 2 87  ? 66.933 -11.952 2.876   1.00 51.45 ? 84  ASN H ND2 1 
ATOM   2366 N N   . LEU B 2 88  ? 69.024 -6.504  2.232   1.00 29.52 ? 85  LEU H N   1 
ATOM   2367 C CA  . LEU B 2 88  ? 68.686 -5.097  2.112   1.00 29.60 ? 85  LEU H CA  1 
ATOM   2368 C C   . LEU B 2 88  ? 67.444 -4.888  1.280   1.00 32.71 ? 85  LEU H C   1 
ATOM   2369 O O   . LEU B 2 88  ? 67.162 -5.648  0.355   1.00 37.06 ? 85  LEU H O   1 
ATOM   2370 C CB  . LEU B 2 88  ? 69.865 -4.322  1.536   1.00 28.71 ? 85  LEU H CB  1 
ATOM   2371 C CG  . LEU B 2 88  ? 70.908 -3.963  2.596   1.00 28.18 ? 85  LEU H CG  1 
ATOM   2372 C CD1 . LEU B 2 88  ? 72.247 -3.703  1.971   1.00 20.88 ? 85  LEU H CD1 1 
ATOM   2373 C CD2 . LEU B 2 88  ? 70.431 -2.765  3.401   1.00 22.18 ? 85  LEU H CD2 1 
ATOM   2374 N N   . LYS B 2 89  ? 66.707 -3.843  1.612   1.00 34.65 ? 86  LYS H N   1 
ATOM   2375 C CA  . LYS B 2 89  ? 65.472 -3.515  0.931   1.00 36.22 ? 86  LYS H CA  1 
ATOM   2376 C C   . LYS B 2 89  ? 65.503 -2.028  0.630   1.00 39.97 ? 86  LYS H C   1 
ATOM   2377 O O   . LYS B 2 89  ? 66.291 -1.295  1.219   1.00 42.08 ? 86  LYS H O   1 
ATOM   2378 C CB  . LYS B 2 89  ? 64.293 -3.889  1.832   1.00 36.78 ? 86  LYS H CB  1 
ATOM   2379 C CG  . LYS B 2 89  ? 64.142 -5.408  2.015   1.00 43.80 ? 86  LYS H CG  1 
ATOM   2380 C CD  . LYS B 2 89  ? 63.282 -5.820  3.215   1.00 45.03 ? 86  LYS H CD  1 
ATOM   2381 C CE  . LYS B 2 89  ? 61.873 -5.233  3.187   1.00 47.97 ? 86  LYS H CE  1 
ATOM   2382 N NZ  . LYS B 2 89  ? 61.823 -3.829  3.695   1.00 46.63 ? 86  LYS H NZ  1 
ATOM   2383 N N   . THR B 2 90  ? 64.668 -1.574  -0.295  1.00 44.59 ? 87  THR H N   1 
ATOM   2384 C CA  . THR B 2 90  ? 64.650 -0.160  -0.661  1.00 48.24 ? 87  THR H CA  1 
ATOM   2385 C C   . THR B 2 90  ? 64.371 0.732   0.548   1.00 47.40 ? 87  THR H C   1 
ATOM   2386 O O   . THR B 2 90  ? 64.929 1.820   0.669   1.00 48.95 ? 87  THR H O   1 
ATOM   2387 C CB  . THR B 2 90  ? 63.599 0.114   -1.761  1.00 51.21 ? 87  THR H CB  1 
ATOM   2388 O OG1 . THR B 2 90  ? 63.710 -0.889  -2.779  1.00 60.32 ? 87  THR H OG1 1 
ATOM   2389 C CG2 . THR B 2 90  ? 63.834 1.472   -2.400  1.00 51.93 ? 87  THR H CG2 1 
ATOM   2390 N N   . GLU B 2 91  ? 63.564 0.224   1.472   1.00 43.36 ? 88  GLU H N   1 
ATOM   2391 C CA  . GLU B 2 91  ? 63.185 0.952   2.680   1.00 42.27 ? 88  GLU H CA  1 
ATOM   2392 C C   . GLU B 2 91  ? 64.398 1.358   3.503   1.00 38.68 ? 88  GLU H C   1 
ATOM   2393 O O   . GLU B 2 91  ? 64.358 2.350   4.227   1.00 44.18 ? 88  GLU H O   1 
ATOM   2394 C CB  . GLU B 2 91  ? 62.269 0.093   3.552   1.00 48.66 ? 88  GLU H CB  1 
ATOM   2395 C CG  . GLU B 2 91  ? 60.931 -0.260  2.918   1.00 60.55 ? 88  GLU H CG  1 
ATOM   2396 C CD  . GLU B 2 91  ? 61.064 -1.035  1.612   1.00 64.99 ? 88  GLU H CD  1 
ATOM   2397 O OE1 . GLU B 2 91  ? 61.859 -1.998  1.553   1.00 64.78 ? 88  GLU H OE1 1 
ATOM   2398 O OE2 . GLU B 2 91  ? 60.377 -0.670  0.636   1.00 72.94 ? 88  GLU H OE2 1 
ATOM   2399 N N   . ASP B 2 92  ? 65.480 0.596   3.375   1.00 33.36 ? 89  ASP H N   1 
ATOM   2400 C CA  . ASP B 2 92  ? 66.710 0.854   4.115   1.00 27.78 ? 89  ASP H CA  1 
ATOM   2401 C C   . ASP B 2 92  ? 67.562 1.969   3.549   1.00 25.33 ? 89  ASP H C   1 
ATOM   2402 O O   . ASP B 2 92  ? 68.688 2.160   3.978   1.00 26.77 ? 89  ASP H O   1 
ATOM   2403 C CB  . ASP B 2 92  ? 67.558 -0.407  4.194   1.00 28.46 ? 89  ASP H CB  1 
ATOM   2404 C CG  . ASP B 2 92  ? 66.782 -1.598  4.692   1.00 29.46 ? 89  ASP H CG  1 
ATOM   2405 O OD1 . ASP B 2 92  ? 65.945 -1.448  5.609   1.00 29.23 ? 89  ASP H OD1 1 
ATOM   2406 O OD2 . ASP B 2 92  ? 67.013 -2.688  4.147   1.00 26.40 ? 89  ASP H OD2 1 
ATOM   2407 N N   . THR B 2 93  ? 67.051 2.680   2.561   1.00 22.06 ? 90  THR H N   1 
ATOM   2408 C CA  . THR B 2 93  ? 67.804 3.770   1.983   1.00 26.78 ? 90  THR H CA  1 
ATOM   2409 C C   . THR B 2 93  ? 67.734 4.926   2.963   1.00 25.28 ? 90  THR H C   1 
ATOM   2410 O O   . THR B 2 93  ? 66.681 5.176   3.550   1.00 28.31 ? 90  THR H O   1 
ATOM   2411 C CB  . THR B 2 93  ? 67.201 4.189   0.616   1.00 33.05 ? 90  THR H CB  1 
ATOM   2412 O OG1 . THR B 2 93  ? 67.413 3.139   -0.341  1.00 39.10 ? 90  THR H OG1 1 
ATOM   2413 C CG2 . THR B 2 93  ? 67.825 5.479   0.105   1.00 32.83 ? 90  THR H CG2 1 
ATOM   2414 N N   . GLY B 2 94  ? 68.861 5.596   3.170   1.00 23.47 ? 91  GLY H N   1 
ATOM   2415 C CA  . GLY B 2 94  ? 68.898 6.732   4.071   1.00 21.31 ? 91  GLY H CA  1 
ATOM   2416 C C   . GLY B 2 94  ? 70.281 6.959   4.649   1.00 22.06 ? 91  GLY H C   1 
ATOM   2417 O O   . GLY B 2 94  ? 71.248 6.324   4.214   1.00 18.54 ? 91  GLY H O   1 
ATOM   2418 N N   . ILE B 2 95  ? 70.388 7.902   5.586   1.00 25.98 ? 92  ILE H N   1 
ATOM   2419 C CA  . ILE B 2 95  ? 71.657 8.174   6.255   1.00 24.43 ? 92  ILE H CA  1 
ATOM   2420 C C   . ILE B 2 95  ? 71.637 7.380   7.558   1.00 22.27 ? 92  ILE H C   1 
ATOM   2421 O O   . ILE B 2 95  ? 70.598 7.266   8.213   1.00 23.63 ? 92  ILE H O   1 
ATOM   2422 C CB  . ILE B 2 95  ? 71.871 9.668   6.608   1.00 21.25 ? 92  ILE H CB  1 
ATOM   2423 C CG1 . ILE B 2 95  ? 71.775 10.556  5.369   1.00 22.59 ? 92  ILE H CG1 1 
ATOM   2424 C CG2 . ILE B 2 95  ? 73.263 9.849   7.159   1.00 24.88 ? 92  ILE H CG2 1 
ATOM   2425 C CD1 . ILE B 2 95  ? 70.363 10.847  4.926   1.00 37.68 ? 92  ILE H CD1 1 
ATOM   2426 N N   . TYR B 2 96  ? 72.772 6.790   7.899   1.00 22.82 ? 93  TYR H N   1 
ATOM   2427 C CA  . TYR B 2 96  ? 72.896 6.002   9.107   1.00 19.80 ? 93  TYR H CA  1 
ATOM   2428 C C   . TYR B 2 96  ? 73.832 6.709   10.048  1.00 26.28 ? 93  TYR H C   1 
ATOM   2429 O O   . TYR B 2 96  ? 74.972 7.033   9.691   1.00 29.13 ? 93  TYR H O   1 
ATOM   2430 C CB  . TYR B 2 96  ? 73.406 4.603   8.788   1.00 20.33 ? 93  TYR H CB  1 
ATOM   2431 C CG  . TYR B 2 96  ? 72.343 3.720   8.169   1.00 25.22 ? 93  TYR H CG  1 
ATOM   2432 C CD1 . TYR B 2 96  ? 71.906 3.923   6.860   1.00 23.92 ? 93  TYR H CD1 1 
ATOM   2433 C CD2 . TYR B 2 96  ? 71.738 2.713   8.911   1.00 26.27 ? 93  TYR H CD2 1 
ATOM   2434 C CE1 . TYR B 2 96  ? 70.882 3.142   6.312   1.00 21.51 ? 93  TYR H CE1 1 
ATOM   2435 C CE2 . TYR B 2 96  ? 70.718 1.929   8.374   1.00 25.46 ? 93  TYR H CE2 1 
ATOM   2436 C CZ  . TYR B 2 96  ? 70.295 2.150   7.076   1.00 21.31 ? 93  TYR H CZ  1 
ATOM   2437 O OH  . TYR B 2 96  ? 69.285 1.375   6.565   1.00 20.21 ? 93  TYR H OH  1 
ATOM   2438 N N   . TYR B 2 97  ? 73.299 7.033   11.218  1.00 26.99 ? 94  TYR H N   1 
ATOM   2439 C CA  . TYR B 2 97  ? 74.032 7.728   12.263  1.00 23.01 ? 94  TYR H CA  1 
ATOM   2440 C C   . TYR B 2 97  ? 74.545 6.763   13.300  1.00 20.02 ? 94  TYR H C   1 
ATOM   2441 O O   . TYR B 2 97  ? 73.888 5.777   13.634  1.00 22.25 ? 94  TYR H O   1 
ATOM   2442 C CB  . TYR B 2 97  ? 73.123 8.729   12.953  1.00 17.41 ? 94  TYR H CB  1 
ATOM   2443 C CG  . TYR B 2 97  ? 72.604 9.821   12.052  1.00 14.66 ? 94  TYR H CG  1 
ATOM   2444 C CD1 . TYR B 2 97  ? 71.261 9.868   11.687  1.00 14.95 ? 94  TYR H CD1 1 
ATOM   2445 C CD2 . TYR B 2 97  ? 73.444 10.831  11.605  1.00 10.00 ? 94  TYR H CD2 1 
ATOM   2446 C CE1 . TYR B 2 97  ? 70.769 10.899  10.911  1.00 13.09 ? 94  TYR H CE1 1 
ATOM   2447 C CE2 . TYR B 2 97  ? 72.961 11.862  10.825  1.00 12.25 ? 94  TYR H CE2 1 
ATOM   2448 C CZ  . TYR B 2 97  ? 71.630 11.891  10.488  1.00 13.46 ? 94  TYR H CZ  1 
ATOM   2449 O OH  . TYR B 2 97  ? 71.152 12.923  9.733   1.00 27.39 ? 94  TYR H OH  1 
ATOM   2450 N N   . CYS B 2 98  ? 75.734 7.059   13.799  1.00 24.46 ? 95  CYS H N   1 
ATOM   2451 C CA  . CYS B 2 98  ? 76.378 6.269   14.839  1.00 25.05 ? 95  CYS H CA  1 
ATOM   2452 C C   . CYS B 2 98  ? 76.165 7.117   16.102  1.00 23.68 ? 95  CYS H C   1 
ATOM   2453 O O   . CYS B 2 98  ? 76.659 8.248   16.194  1.00 23.72 ? 95  CYS H O   1 
ATOM   2454 C CB  . CYS B 2 98  ? 77.864 6.125   14.516  1.00 27.10 ? 95  CYS H CB  1 
ATOM   2455 S SG  . CYS B 2 98  ? 78.778 5.133   15.725  1.00 35.64 ? 95  CYS H SG  1 
ATOM   2456 N N   . VAL B 2 99  ? 75.387 6.592   17.042  1.00 21.35 ? 96  VAL H N   1 
ATOM   2457 C CA  . VAL B 2 99  ? 75.043 7.311   18.267  1.00 21.75 ? 96  VAL H CA  1 
ATOM   2458 C C   . VAL B 2 99  ? 75.554 6.694   19.574  1.00 23.86 ? 96  VAL H C   1 
ATOM   2459 O O   . VAL B 2 99  ? 75.323 5.508   19.837  1.00 27.71 ? 96  VAL H O   1 
ATOM   2460 C CB  . VAL B 2 99  ? 73.500 7.413   18.377  1.00 24.57 ? 96  VAL H CB  1 
ATOM   2461 C CG1 . VAL B 2 99  ? 73.093 8.315   19.512  1.00 21.21 ? 96  VAL H CG1 1 
ATOM   2462 C CG2 . VAL B 2 99  ? 72.915 7.910   17.073  1.00 24.87 ? 96  VAL H CG2 1 
ATOM   2463 N N   . ARG B 2 100 ? 76.240 7.490   20.392  1.00 22.20 ? 97  ARG H N   1 
ATOM   2464 C CA  . ARG B 2 100 ? 76.714 7.027   21.703  1.00 27.52 ? 97  ARG H CA  1 
ATOM   2465 C C   . ARG B 2 100 ? 75.505 7.197   22.635  1.00 27.67 ? 97  ARG H C   1 
ATOM   2466 O O   . ARG B 2 100 ? 75.018 8.315   22.810  1.00 29.27 ? 97  ARG H O   1 
ATOM   2467 C CB  . ARG B 2 100 ? 77.862 7.897   22.197  1.00 25.88 ? 97  ARG H CB  1 
ATOM   2468 C CG  . ARG B 2 100 ? 78.393 7.470   23.548  1.00 38.90 ? 97  ARG H CG  1 
ATOM   2469 C CD  . ARG B 2 100 ? 79.258 8.552   24.175  1.00 47.58 ? 97  ARG H CD  1 
ATOM   2470 N NE  . ARG B 2 100 ? 79.682 8.181   25.526  1.00 55.49 ? 97  ARG H NE  1 
ATOM   2471 C CZ  . ARG B 2 100 ? 79.843 9.035   26.534  1.00 52.96 ? 97  ARG H CZ  1 
ATOM   2472 N NH1 . ARG B 2 100 ? 79.621 10.332  26.368  1.00 49.34 ? 97  ARG H NH1 1 
ATOM   2473 N NH2 . ARG B 2 100 ? 80.215 8.581   27.723  1.00 57.32 ? 97  ARG H NH2 1 
ATOM   2474 N N   . GLY B 2 101 ? 74.999 6.114   23.214  1.00 31.27 ? 98  GLY H N   1 
ATOM   2475 C CA  . GLY B 2 101 ? 73.819 6.246   24.060  1.00 44.50 ? 98  GLY H CA  1 
ATOM   2476 C C   . GLY B 2 101 ? 73.880 5.625   25.443  1.00 54.58 ? 98  GLY H C   1 
ATOM   2477 O O   . GLY B 2 101 ? 73.496 4.466   25.627  1.00 56.46 ? 98  GLY H O   1 
ATOM   2478 N N   . ARG B 2 102 ? 74.319 6.413   26.424  1.00 64.70 ? 99  ARG H N   1 
ATOM   2479 C CA  . ARG B 2 102 ? 74.436 5.967   27.817  1.00 70.80 ? 99  ARG H CA  1 
ATOM   2480 C C   . ARG B 2 102 ? 73.126 5.369   28.342  1.00 73.09 ? 99  ARG H C   1 
ATOM   2481 O O   . ARG B 2 102 ? 72.084 6.033   28.354  1.00 74.87 ? 99  ARG H O   1 
ATOM   2482 C CB  . ARG B 2 102 ? 74.866 7.138   28.709  1.00 70.59 ? 99  ARG H CB  1 
ATOM   2483 C CG  . ARG B 2 102 ? 76.309 7.586   28.518  1.00 73.33 ? 99  ARG H CG  1 
ATOM   2484 C CD  . ARG B 2 102 ? 76.574 8.899   29.247  1.00 76.52 ? 99  ARG H CD  1 
ATOM   2485 N NE  . ARG B 2 102 ? 77.996 9.126   29.510  1.00 81.69 ? 99  ARG H NE  1 
ATOM   2486 C CZ  . ARG B 2 102 ? 78.512 10.277  29.943  1.00 82.16 ? 99  ARG H CZ  1 
ATOM   2487 N NH1 . ARG B 2 102 ? 77.731 11.328  30.161  1.00 82.23 ? 99  ARG H NH1 1 
ATOM   2488 N NH2 . ARG B 2 102 ? 79.813 10.370  30.186  1.00 81.62 ? 99  ARG H NH2 1 
ATOM   2489 N N   . ASP B 2 103 ? 73.188 4.113   28.771  1.00 74.75 ? 100 ASP H N   1 
ATOM   2490 C CA  . ASP B 2 103 ? 72.017 3.410   29.293  1.00 77.01 ? 100 ASP H CA  1 
ATOM   2491 C C   . ASP B 2 103 ? 71.496 3.984   30.614  1.00 73.31 ? 100 ASP H C   1 
ATOM   2492 O O   . ASP B 2 103 ? 72.119 3.837   31.668  1.00 69.04 ? 100 ASP H O   1 
ATOM   2493 C CB  . ASP B 2 103 ? 72.307 1.912   29.421  1.00 80.55 ? 100 ASP H CB  1 
ATOM   2494 C CG  . ASP B 2 103 ? 73.590 1.625   30.169  1.00 84.21 ? 100 ASP H CG  1 
ATOM   2495 O OD1 . ASP B 2 103 ? 74.677 1.955   29.640  1.00 81.57 ? 100 ASP H OD1 1 
ATOM   2496 O OD2 . ASP B 2 103 ? 73.508 1.065   31.283  1.00 86.87 ? 100 ASP H OD2 1 
ATOM   2497 N N   . GLY B 2 104 ? 70.351 4.654   30.526  1.00 74.89 ? 101 GLY H N   1 
ATOM   2498 C CA  . GLY B 2 104 ? 69.732 5.277   31.683  1.00 74.86 ? 101 GLY H CA  1 
ATOM   2499 C C   . GLY B 2 104 ? 69.434 6.746   31.419  1.00 73.93 ? 101 GLY H C   1 
ATOM   2500 O O   . GLY B 2 104 ? 68.437 7.286   31.916  1.00 69.32 ? 101 GLY H O   1 
ATOM   2501 N N   . GLU B 2 105 ? 70.285 7.373   30.603  1.00 72.53 ? 102 GLU H N   1 
ATOM   2502 C CA  . GLU B 2 105 ? 70.167 8.787   30.252  1.00 71.72 ? 102 GLU H CA  1 
ATOM   2503 C C   . GLU B 2 105 ? 69.532 9.016   28.872  1.00 72.02 ? 102 GLU H C   1 
ATOM   2504 O O   . GLU B 2 105 ? 68.311 8.863   28.717  1.00 71.28 ? 102 GLU H O   1 
ATOM   2505 C CB  . GLU B 2 105 ? 71.542 9.451   30.329  1.00 73.27 ? 102 GLU H CB  1 
ATOM   2506 C CG  . GLU B 2 105 ? 72.206 9.329   31.689  1.00 78.83 ? 102 GLU H CG  1 
ATOM   2507 C CD  . GLU B 2 105 ? 73.627 9.857   31.700  1.00 83.17 ? 102 GLU H CD  1 
ATOM   2508 O OE1 . GLU B 2 105 ? 73.846 11.006  31.253  1.00 86.19 ? 102 GLU H OE1 1 
ATOM   2509 O OE2 . GLU B 2 105 ? 74.527 9.121   32.162  1.00 84.71 ? 102 GLU H OE2 1 
ATOM   2510 N N   . ALA B 2 106 ? 70.353 9.387   27.882  1.00 69.50 ? 103 ALA H N   1 
ATOM   2511 C CA  . ALA B 2 106 ? 69.891 9.645   26.512  1.00 61.82 ? 103 ALA H CA  1 
ATOM   2512 C C   . ALA B 2 106 ? 71.019 9.524   25.472  1.00 57.18 ? 103 ALA H C   1 
ATOM   2513 O O   . ALA B 2 106 ? 72.183 9.276   25.818  1.00 55.11 ? 103 ALA H O   1 
ATOM   2514 C CB  . ALA B 2 106 ? 69.237 11.026  26.425  1.00 61.33 ? 103 ALA H CB  1 
ATOM   2515 N N   . MET B 2 107 ? 70.665 9.707   24.200  1.00 52.14 ? 104 MET H N   1 
ATOM   2516 C CA  . MET B 2 107 ? 71.624 9.613   23.102  1.00 47.76 ? 104 MET H CA  1 
ATOM   2517 C C   . MET B 2 107 ? 72.492 10.860  22.987  1.00 44.26 ? 104 MET H C   1 
ATOM   2518 O O   . MET B 2 107 ? 72.148 11.854  22.337  1.00 32.94 ? 104 MET H O   1 
ATOM   2519 C CB  . MET B 2 107 ? 70.918 9.260   21.793  1.00 48.61 ? 104 MET H CB  1 
ATOM   2520 C CG  . MET B 2 107 ? 70.386 7.820   21.803  1.00 50.64 ? 104 MET H CG  1 
ATOM   2521 S SD  . MET B 2 107 ? 69.563 7.262   20.295  1.00 47.34 ? 104 MET H SD  1 
ATOM   2522 C CE  . MET B 2 107 ? 68.244 8.394   20.233  1.00 44.92 ? 104 MET H CE  1 
ATOM   2523 N N   . ASP B 2 108 ? 73.638 10.742  23.647  1.00 44.51 ? 105 ASP H N   1 
ATOM   2524 C CA  . ASP B 2 108 ? 74.661 11.762  23.772  1.00 44.08 ? 105 ASP H CA  1 
ATOM   2525 C C   . ASP B 2 108 ? 75.204 12.365  22.482  1.00 41.89 ? 105 ASP H C   1 
ATOM   2526 O O   . ASP B 2 108 ? 74.873 13.495  22.129  1.00 44.24 ? 105 ASP H O   1 
ATOM   2527 C CB  . ASP B 2 108 ? 75.818 11.180  24.591  1.00 48.24 ? 105 ASP H CB  1 
ATOM   2528 C CG  . ASP B 2 108 ? 76.277 12.097  25.698  1.00 55.95 ? 105 ASP H CG  1 
ATOM   2529 O OD1 . ASP B 2 108 ? 77.041 11.625  26.568  1.00 63.95 ? 105 ASP H OD1 1 
ATOM   2530 O OD2 . ASP B 2 108 ? 75.888 13.284  25.708  1.00 64.87 ? 105 ASP H OD2 1 
ATOM   2531 N N   . TYR B 2 109 ? 76.080 11.630  21.809  1.00 38.95 ? 106 TYR H N   1 
ATOM   2532 C CA  . TYR B 2 109 ? 76.698 12.116  20.584  1.00 37.54 ? 106 TYR H CA  1 
ATOM   2533 C C   . TYR B 2 109 ? 76.370 11.268  19.372  1.00 31.10 ? 106 TYR H C   1 
ATOM   2534 O O   . TYR B 2 109 ? 76.349 10.037  19.451  1.00 24.01 ? 106 TYR H O   1 
ATOM   2535 C CB  . TYR B 2 109 ? 78.211 12.179  20.757  1.00 45.95 ? 106 TYR H CB  1 
ATOM   2536 C CG  . TYR B 2 109 ? 78.634 12.973  21.962  1.00 55.15 ? 106 TYR H CG  1 
ATOM   2537 C CD1 . TYR B 2 109 ? 79.010 12.332  23.136  1.00 57.20 ? 106 TYR H CD1 1 
ATOM   2538 C CD2 . TYR B 2 109 ? 78.650 14.365  21.933  1.00 57.18 ? 106 TYR H CD2 1 
ATOM   2539 C CE1 . TYR B 2 109 ? 79.391 13.051  24.251  1.00 61.10 ? 106 TYR H CE1 1 
ATOM   2540 C CE2 . TYR B 2 109 ? 79.029 15.094  23.043  1.00 62.27 ? 106 TYR H CE2 1 
ATOM   2541 C CZ  . TYR B 2 109 ? 79.400 14.430  24.201  1.00 62.60 ? 106 TYR H CZ  1 
ATOM   2542 O OH  . TYR B 2 109 ? 79.788 15.141  25.314  1.00 72.34 ? 106 TYR H OH  1 
ATOM   2543 N N   . TRP B 2 110 ? 76.122 11.941  18.253  1.00 26.71 ? 107 TRP H N   1 
ATOM   2544 C CA  . TRP B 2 110 ? 75.803 11.280  16.996  1.00 26.33 ? 107 TRP H CA  1 
ATOM   2545 C C   . TRP B 2 110 ? 76.932 11.550  16.022  1.00 25.03 ? 107 TRP H C   1 
ATOM   2546 O O   . TRP B 2 110 ? 77.593 12.580  16.102  1.00 29.65 ? 107 TRP H O   1 
ATOM   2547 C CB  . TRP B 2 110 ? 74.521 11.850  16.403  1.00 25.84 ? 107 TRP H CB  1 
ATOM   2548 C CG  . TRP B 2 110 ? 73.301 11.735  17.257  1.00 25.89 ? 107 TRP H CG  1 
ATOM   2549 C CD1 . TRP B 2 110 ? 73.151 12.164  18.548  1.00 28.38 ? 107 TRP H CD1 1 
ATOM   2550 C CD2 . TRP B 2 110 ? 72.030 11.221  16.856  1.00 21.64 ? 107 TRP H CD2 1 
ATOM   2551 N NE1 . TRP B 2 110 ? 71.860 11.954  18.970  1.00 26.39 ? 107 TRP H NE1 1 
ATOM   2552 C CE2 . TRP B 2 110 ? 71.151 11.376  17.949  1.00 26.76 ? 107 TRP H CE2 1 
ATOM   2553 C CE3 . TRP B 2 110 ? 71.546 10.650  15.677  1.00 18.50 ? 107 TRP H CE3 1 
ATOM   2554 C CZ2 . TRP B 2 110 ? 69.811 10.980  17.894  1.00 28.45 ? 107 TRP H CZ2 1 
ATOM   2555 C CZ3 . TRP B 2 110 ? 70.221 10.256  15.622  1.00 23.57 ? 107 TRP H CZ3 1 
ATOM   2556 C CH2 . TRP B 2 110 ? 69.366 10.424  16.724  1.00 28.73 ? 107 TRP H CH2 1 
ATOM   2557 N N   . GLY B 2 111 ? 77.156 10.638  15.092  1.00 30.51 ? 108 GLY H N   1 
ATOM   2558 C CA  . GLY B 2 111 ? 78.205 10.862  14.112  1.00 31.03 ? 108 GLY H CA  1 
ATOM   2559 C C   . GLY B 2 111 ? 77.697 11.795  13.024  1.00 33.88 ? 108 GLY H C   1 
ATOM   2560 O O   . GLY B 2 111 ? 76.611 12.370  13.144  1.00 30.41 ? 108 GLY H O   1 
ATOM   2561 N N   . GLN B 2 112 ? 78.470 11.944  11.951  1.00 36.55 ? 109 GLN H N   1 
ATOM   2562 C CA  . GLN B 2 112 ? 78.058 12.798  10.841  1.00 36.61 ? 109 GLN H CA  1 
ATOM   2563 C C   . GLN B 2 112 ? 77.177 12.031  9.859   1.00 33.85 ? 109 GLN H C   1 
ATOM   2564 O O   . GLN B 2 112 ? 76.504 12.632  9.033   1.00 33.61 ? 109 GLN H O   1 
ATOM   2565 C CB  . GLN B 2 112 ? 79.272 13.403  10.137  1.00 43.87 ? 109 GLN H CB  1 
ATOM   2566 C CG  . GLN B 2 112 ? 80.116 14.310  11.052  1.00 64.96 ? 109 GLN H CG  1 
ATOM   2567 C CD  . GLN B 2 112 ? 79.319 15.474  11.675  1.00 71.92 ? 109 GLN H CD  1 
ATOM   2568 O OE1 . GLN B 2 112 ? 78.718 16.282  10.962  1.00 76.18 ? 109 GLN H OE1 1 
ATOM   2569 N NE2 . GLN B 2 112 ? 79.340 15.572  13.007  1.00 63.89 ? 109 GLN H NE2 1 
ATOM   2570 N N   . GLY B 2 113 ? 77.157 10.707  9.983   1.00 30.98 ? 110 GLY H N   1 
ATOM   2571 C CA  . GLY B 2 113 ? 76.334 9.882   9.112   1.00 28.70 ? 110 GLY H CA  1 
ATOM   2572 C C   . GLY B 2 113 ? 77.019 9.364   7.856   1.00 27.70 ? 110 GLY H C   1 
ATOM   2573 O O   . GLY B 2 113 ? 78.084 9.844   7.459   1.00 27.07 ? 110 GLY H O   1 
ATOM   2574 N N   . THR B 2 114 ? 76.431 8.336   7.257   1.00 28.83 ? 111 THR H N   1 
ATOM   2575 C CA  . THR B 2 114 ? 76.957 7.750   6.026   1.00 27.26 ? 111 THR H CA  1 
ATOM   2576 C C   . THR B 2 114 ? 75.744 7.337   5.205   1.00 26.50 ? 111 THR H C   1 
ATOM   2577 O O   . THR B 2 114 ? 74.848 6.669   5.718   1.00 22.15 ? 111 THR H O   1 
ATOM   2578 C CB  . THR B 2 114 ? 77.897 6.547   6.318   1.00 24.40 ? 111 THR H CB  1 
ATOM   2579 O OG1 . THR B 2 114 ? 78.508 6.095   5.104   1.00 27.87 ? 111 THR H OG1 1 
ATOM   2580 C CG2 . THR B 2 114 ? 77.147 5.400   6.963   1.00 20.41 ? 111 THR H CG2 1 
ATOM   2581 N N   . THR B 2 115 ? 75.679 7.802   3.958   1.00 34.21 ? 112 THR H N   1 
ATOM   2582 C CA  . THR B 2 115 ? 74.539 7.504   3.082   1.00 35.79 ? 112 THR H CA  1 
ATOM   2583 C C   . THR B 2 115 ? 74.533 6.097   2.513   1.00 31.73 ? 112 THR H C   1 
ATOM   2584 O O   . THR B 2 115 ? 75.575 5.550   2.155   1.00 31.40 ? 112 THR H O   1 
ATOM   2585 C CB  . THR B 2 115 ? 74.430 8.484   1.891   1.00 36.54 ? 112 THR H CB  1 
ATOM   2586 O OG1 . THR B 2 115 ? 74.719 9.818   2.327   1.00 50.45 ? 112 THR H OG1 1 
ATOM   2587 C CG2 . THR B 2 115 ? 73.023 8.457   1.329   1.00 40.01 ? 112 THR H CG2 1 
ATOM   2588 N N   . LEU B 2 116 ? 73.340 5.528   2.423   1.00 24.73 ? 113 LEU H N   1 
ATOM   2589 C CA  . LEU B 2 116 ? 73.162 4.203   1.889   1.00 27.69 ? 113 LEU H CA  1 
ATOM   2590 C C   . LEU B 2 116 ? 71.948 4.250   0.973   1.00 29.50 ? 113 LEU H C   1 
ATOM   2591 O O   . LEU B 2 116 ? 70.867 4.679   1.378   1.00 27.87 ? 113 LEU H O   1 
ATOM   2592 C CB  . LEU B 2 116 ? 72.984 3.189   3.028   1.00 28.22 ? 113 LEU H CB  1 
ATOM   2593 C CG  . LEU B 2 116 ? 72.506 1.760   2.737   1.00 39.07 ? 113 LEU H CG  1 
ATOM   2594 C CD1 . LEU B 2 116 ? 71.009 1.738   2.545   1.00 42.22 ? 113 LEU H CD1 1 
ATOM   2595 C CD2 . LEU B 2 116 ? 73.203 1.156   1.519   1.00 45.17 ? 113 LEU H CD2 1 
ATOM   2596 N N   . THR B 2 117 ? 72.152 3.867   -0.285  1.00 33.45 ? 114 THR H N   1 
ATOM   2597 C CA  . THR B 2 117 ? 71.083 3.856   -1.274  1.00 29.33 ? 114 THR H CA  1 
ATOM   2598 C C   . THR B 2 117 ? 70.891 2.427   -1.743  1.00 24.81 ? 114 THR H C   1 
ATOM   2599 O O   . THR B 2 117 ? 71.864 1.732   -2.057  1.00 21.70 ? 114 THR H O   1 
ATOM   2600 C CB  . THR B 2 117 ? 71.421 4.744   -2.498  1.00 29.08 ? 114 THR H CB  1 
ATOM   2601 O OG1 . THR B 2 117 ? 71.731 6.079   -2.067  1.00 31.81 ? 114 THR H OG1 1 
ATOM   2602 C CG2 . THR B 2 117 ? 70.241 4.797   -3.440  1.00 26.98 ? 114 THR H CG2 1 
ATOM   2603 N N   . VAL B 2 118 ? 69.646 1.970   -1.722  1.00 25.07 ? 115 VAL H N   1 
ATOM   2604 C CA  . VAL B 2 118 ? 69.331 0.624   -2.171  1.00 28.60 ? 115 VAL H CA  1 
ATOM   2605 C C   . VAL B 2 118 ? 68.511 0.757   -3.438  1.00 32.40 ? 115 VAL H C   1 
ATOM   2606 O O   . VAL B 2 118 ? 67.352 1.190   -3.386  1.00 28.73 ? 115 VAL H O   1 
ATOM   2607 C CB  . VAL B 2 118 ? 68.545 -0.174  -1.115  1.00 28.13 ? 115 VAL H CB  1 
ATOM   2608 C CG1 . VAL B 2 118 ? 68.181 -1.552  -1.654  1.00 26.80 ? 115 VAL H CG1 1 
ATOM   2609 C CG2 . VAL B 2 118 ? 69.376 -0.320  0.146   1.00 28.41 ? 115 VAL H CG2 1 
ATOM   2610 N N   . SER B 2 119 ? 69.155 0.445   -4.570  1.00 37.66 ? 116 SER H N   1 
ATOM   2611 C CA  . SER B 2 119 ? 68.548 0.511   -5.904  1.00 38.48 ? 116 SER H CA  1 
ATOM   2612 C C   . SER B 2 119 ? 69.315 -0.343  -6.890  1.00 37.62 ? 116 SER H C   1 
ATOM   2613 O O   . SER B 2 119 ? 70.502 -0.613  -6.703  1.00 36.47 ? 116 SER H O   1 
ATOM   2614 C CB  . SER B 2 119 ? 68.551 1.942   -6.444  1.00 40.35 ? 116 SER H CB  1 
ATOM   2615 O OG  . SER B 2 119 ? 69.869 2.408   -6.684  1.00 42.03 ? 116 SER H OG  1 
ATOM   2616 N N   . SER B 2 120 ? 68.636 -0.727  -7.965  1.00 42.26 ? 117 SER H N   1 
ATOM   2617 C CA  . SER B 2 120 ? 69.240 -1.535  -9.019  1.00 41.93 ? 117 SER H CA  1 
ATOM   2618 C C   . SER B 2 120 ? 69.906 -0.630  -10.063 1.00 41.58 ? 117 SER H C   1 
ATOM   2619 O O   . SER B 2 120 ? 70.676 -1.102  -10.904 1.00 44.39 ? 117 SER H O   1 
ATOM   2620 C CB  . SER B 2 120 ? 68.185 -2.429  -9.667  1.00 41.03 ? 117 SER H CB  1 
ATOM   2621 O OG  . SER B 2 120 ? 66.971 -1.714  -9.852  1.00 48.49 ? 117 SER H OG  1 
ATOM   2622 N N   . ALA B 2 121 ? 69.599 0.668   -10.001 1.00 33.97 ? 118 ALA H N   1 
ATOM   2623 C CA  . ALA B 2 121 ? 70.181 1.648   -10.907 1.00 28.52 ? 118 ALA H CA  1 
ATOM   2624 C C   . ALA B 2 121 ? 71.707 1.582   -10.807 1.00 33.55 ? 118 ALA H C   1 
ATOM   2625 O O   . ALA B 2 121 ? 72.250 0.880   -9.949  1.00 33.67 ? 118 ALA H O   1 
ATOM   2626 C CB  . ALA B 2 121 ? 69.686 3.034   -10.561 1.00 25.88 ? 118 ALA H CB  1 
ATOM   2627 N N   . LYS B 2 122 ? 72.402 2.340   -11.652 1.00 37.39 ? 119 LYS H N   1 
ATOM   2628 C CA  . LYS B 2 122 ? 73.865 2.307   -11.661 1.00 35.91 ? 119 LYS H CA  1 
ATOM   2629 C C   . LYS B 2 122 ? 74.530 3.655   -11.441 1.00 35.13 ? 119 LYS H C   1 
ATOM   2630 O O   . LYS B 2 122 ? 73.958 4.714   -11.722 1.00 35.60 ? 119 LYS H O   1 
ATOM   2631 C CB  . LYS B 2 122 ? 74.383 1.704   -12.977 1.00 38.74 ? 119 LYS H CB  1 
ATOM   2632 C CG  . LYS B 2 122 ? 74.109 2.562   -14.204 1.00 40.28 ? 119 LYS H CG  1 
ATOM   2633 C CD  . LYS B 2 122 ? 74.944 2.125   -15.386 1.00 46.24 ? 119 LYS H CD  1 
ATOM   2634 C CE  . LYS B 2 122 ? 75.317 3.320   -16.252 1.00 47.56 ? 119 LYS H CE  1 
ATOM   2635 N NZ  . LYS B 2 122 ? 74.130 4.045   -16.783 1.00 52.49 ? 119 LYS H NZ  1 
ATOM   2636 N N   . THR B 2 123 ? 75.769 3.597   -10.980 1.00 29.78 ? 120 THR H N   1 
ATOM   2637 C CA  . THR B 2 123 ? 76.530 4.793   -10.721 1.00 35.97 ? 120 THR H CA  1 
ATOM   2638 C C   . THR B 2 123 ? 76.781 5.551   -12.019 1.00 38.24 ? 120 THR H C   1 
ATOM   2639 O O   . THR B 2 123 ? 77.290 5.006   -12.997 1.00 43.12 ? 120 THR H O   1 
ATOM   2640 C CB  . THR B 2 123 ? 77.845 4.452   -10.027 1.00 35.81 ? 120 THR H CB  1 
ATOM   2641 O OG1 . THR B 2 123 ? 77.576 3.552   -8.943  1.00 29.84 ? 120 THR H OG1 1 
ATOM   2642 C CG2 . THR B 2 123 ? 78.486 5.712   -9.480  1.00 38.33 ? 120 THR H CG2 1 
ATOM   2643 N N   . THR B 2 124 ? 76.394 6.815   -12.015 1.00 37.09 ? 121 THR H N   1 
ATOM   2644 C CA  . THR B 2 124 ? 76.536 7.674   -13.166 1.00 34.36 ? 121 THR H CA  1 
ATOM   2645 C C   . THR B 2 124 ? 77.226 8.956   -12.736 1.00 34.99 ? 121 THR H C   1 
ATOM   2646 O O   . THR B 2 124 ? 76.776 9.629   -11.809 1.00 39.93 ? 121 THR H O   1 
ATOM   2647 C CB  . THR B 2 124 ? 75.155 8.014   -13.706 1.00 33.66 ? 121 THR H CB  1 
ATOM   2648 O OG1 . THR B 2 124 ? 74.482 6.800   -14.068 1.00 33.44 ? 121 THR H OG1 1 
ATOM   2649 C CG2 . THR B 2 124 ? 75.255 8.948   -14.892 1.00 32.43 ? 121 THR H CG2 1 
ATOM   2650 N N   . PRO B 2 125 ? 78.361 9.281   -13.362 1.00 33.53 ? 122 PRO H N   1 
ATOM   2651 C CA  . PRO B 2 125 ? 79.113 10.494  -13.036 1.00 35.65 ? 122 PRO H CA  1 
ATOM   2652 C C   . PRO B 2 125 ? 78.304 11.758  -13.341 1.00 38.94 ? 122 PRO H C   1 
ATOM   2653 O O   . PRO B 2 125 ? 77.435 11.752  -14.208 1.00 42.19 ? 122 PRO H O   1 
ATOM   2654 C CB  . PRO B 2 125 ? 80.333 10.383  -13.948 1.00 36.61 ? 122 PRO H CB  1 
ATOM   2655 C CG  . PRO B 2 125 ? 80.514 8.909   -14.090 1.00 32.81 ? 122 PRO H CG  1 
ATOM   2656 C CD  . PRO B 2 125 ? 79.107 8.446   -14.316 1.00 31.67 ? 122 PRO H CD  1 
ATOM   2657 N N   . PRO B 2 126 ? 78.536 12.837  -12.581 1.00 40.32 ? 123 PRO H N   1 
ATOM   2658 C CA  . PRO B 2 126 ? 77.813 14.088  -12.803 1.00 39.24 ? 123 PRO H CA  1 
ATOM   2659 C C   . PRO B 2 126 ? 78.501 14.945  -13.852 1.00 41.53 ? 123 PRO H C   1 
ATOM   2660 O O   . PRO B 2 126 ? 79.730 14.917  -13.991 1.00 39.52 ? 123 PRO H O   1 
ATOM   2661 C CB  . PRO B 2 126 ? 77.890 14.758  -11.441 1.00 34.25 ? 123 PRO H CB  1 
ATOM   2662 C CG  . PRO B 2 126 ? 79.258 14.391  -10.993 1.00 35.68 ? 123 PRO H CG  1 
ATOM   2663 C CD  . PRO B 2 126 ? 79.364 12.923  -11.365 1.00 40.61 ? 123 PRO H CD  1 
ATOM   2664 N N   . SER B 2 127 ? 77.702 15.732  -14.559 1.00 40.80 ? 124 SER H N   1 
ATOM   2665 C CA  . SER B 2 127 ? 78.205 16.630  -15.579 1.00 37.67 ? 124 SER H CA  1 
ATOM   2666 C C   . SER B 2 127 ? 78.173 18.034  -14.993 1.00 33.28 ? 124 SER H C   1 
ATOM   2667 O O   . SER B 2 127 ? 77.108 18.553  -14.645 1.00 32.93 ? 124 SER H O   1 
ATOM   2668 C CB  . SER B 2 127 ? 77.329 16.537  -16.833 1.00 44.42 ? 124 SER H CB  1 
ATOM   2669 O OG  . SER B 2 127 ? 77.354 15.221  -17.372 1.00 45.83 ? 124 SER H OG  1 
ATOM   2670 N N   . VAL B 2 128 ? 79.346 18.633  -14.843 1.00 30.07 ? 125 VAL H N   1 
ATOM   2671 C CA  . VAL B 2 128 ? 79.439 19.968  -14.278 1.00 27.85 ? 125 VAL H CA  1 
ATOM   2672 C C   . VAL B 2 128 ? 79.530 21.024  -15.367 1.00 33.13 ? 125 VAL H C   1 
ATOM   2673 O O   . VAL B 2 128 ? 80.489 21.033  -16.145 1.00 37.57 ? 125 VAL H O   1 
ATOM   2674 C CB  . VAL B 2 128 ? 80.661 20.099  -13.357 1.00 20.94 ? 125 VAL H CB  1 
ATOM   2675 C CG1 . VAL B 2 128 ? 80.610 21.420  -12.621 1.00 20.48 ? 125 VAL H CG1 1 
ATOM   2676 C CG2 . VAL B 2 128 ? 80.712 18.938  -12.379 1.00 14.37 ? 125 VAL H CG2 1 
ATOM   2677 N N   . TYR B 2 129 ? 78.531 21.905  -15.411 1.00 33.20 ? 126 TYR H N   1 
ATOM   2678 C CA  . TYR B 2 129 ? 78.453 22.989  -16.390 1.00 32.71 ? 126 TYR H CA  1 
ATOM   2679 C C   . TYR B 2 129 ? 78.628 24.328  -15.689 1.00 34.79 ? 126 TYR H C   1 
ATOM   2680 O O   . TYR B 2 129 ? 77.953 24.615  -14.710 1.00 32.60 ? 126 TYR H O   1 
ATOM   2681 C CB  . TYR B 2 129 ? 77.105 22.952  -17.112 1.00 27.51 ? 126 TYR H CB  1 
ATOM   2682 C CG  . TYR B 2 129 ? 76.886 21.670  -17.876 1.00 27.80 ? 126 TYR H CG  1 
ATOM   2683 C CD1 . TYR B 2 129 ? 75.794 20.856  -17.611 1.00 25.50 ? 126 TYR H CD1 1 
ATOM   2684 C CD2 . TYR B 2 129 ? 77.787 21.265  -18.860 1.00 28.10 ? 126 TYR H CD2 1 
ATOM   2685 C CE1 . TYR B 2 129 ? 75.604 19.675  -18.306 1.00 31.29 ? 126 TYR H CE1 1 
ATOM   2686 C CE2 . TYR B 2 129 ? 77.609 20.085  -19.558 1.00 22.95 ? 126 TYR H CE2 1 
ATOM   2687 C CZ  . TYR B 2 129 ? 76.518 19.295  -19.279 1.00 27.83 ? 126 TYR H CZ  1 
ATOM   2688 O OH  . TYR B 2 129 ? 76.333 18.120  -19.968 1.00 34.13 ? 126 TYR H OH  1 
ATOM   2689 N N   . PRO B 2 130 ? 79.530 25.173  -16.195 1.00 39.43 ? 127 PRO H N   1 
ATOM   2690 C CA  . PRO B 2 130 ? 79.795 26.487  -15.609 1.00 42.71 ? 127 PRO H CA  1 
ATOM   2691 C C   . PRO B 2 130 ? 78.757 27.529  -16.017 1.00 45.72 ? 127 PRO H C   1 
ATOM   2692 O O   . PRO B 2 130 ? 78.704 27.936  -17.179 1.00 52.76 ? 127 PRO H O   1 
ATOM   2693 C CB  . PRO B 2 130 ? 81.171 26.851  -16.181 1.00 43.49 ? 127 PRO H CB  1 
ATOM   2694 C CG  . PRO B 2 130 ? 81.648 25.594  -16.899 1.00 45.42 ? 127 PRO H CG  1 
ATOM   2695 C CD  . PRO B 2 130 ? 80.398 24.943  -17.354 1.00 40.82 ? 127 PRO H CD  1 
ATOM   2696 N N   . LEU B 2 131 ? 77.956 27.981  -15.060 1.00 43.51 ? 128 LEU H N   1 
ATOM   2697 C CA  . LEU B 2 131 ? 76.940 28.986  -15.331 1.00 42.63 ? 128 LEU H CA  1 
ATOM   2698 C C   . LEU B 2 131 ? 77.546 30.370  -15.159 1.00 43.52 ? 128 LEU H C   1 
ATOM   2699 O O   . LEU B 2 131 ? 77.716 30.853  -14.039 1.00 42.27 ? 128 LEU H O   1 
ATOM   2700 C CB  . LEU B 2 131 ? 75.742 28.807  -14.392 1.00 44.92 ? 128 LEU H CB  1 
ATOM   2701 C CG  . LEU B 2 131 ? 74.564 27.908  -14.802 1.00 46.12 ? 128 LEU H CG  1 
ATOM   2702 C CD1 . LEU B 2 131 ? 74.999 26.740  -15.684 1.00 44.39 ? 128 LEU H CD1 1 
ATOM   2703 C CD2 . LEU B 2 131 ? 73.865 27.411  -13.543 1.00 45.32 ? 128 LEU H CD2 1 
ATOM   2704 N N   . ALA B 2 132 ? 77.909 30.987  -16.277 1.00 47.22 ? 129 ALA H N   1 
ATOM   2705 C CA  . ALA B 2 132 ? 78.500 32.322  -16.269 1.00 49.55 ? 129 ALA H CA  1 
ATOM   2706 C C   . ALA B 2 132 ? 77.445 33.322  -16.731 1.00 49.50 ? 129 ALA H C   1 
ATOM   2707 O O   . ALA B 2 132 ? 76.572 32.979  -17.529 1.00 49.92 ? 129 ALA H O   1 
ATOM   2708 C CB  . ALA B 2 132 ? 79.722 32.363  -17.188 1.00 50.83 ? 129 ALA H CB  1 
ATOM   2709 N N   . PRO B 2 133 ? 77.516 34.572  -16.243 1.00 51.04 ? 130 PRO H N   1 
ATOM   2710 C CA  . PRO B 2 133 ? 76.559 35.625  -16.607 1.00 54.65 ? 130 PRO H CA  1 
ATOM   2711 C C   . PRO B 2 133 ? 76.375 35.791  -18.120 1.00 57.87 ? 130 PRO H C   1 
ATOM   2712 O O   . PRO B 2 133 ? 77.240 36.345  -18.808 1.00 61.61 ? 130 PRO H O   1 
ATOM   2713 C CB  . PRO B 2 133 ? 77.181 36.875  -15.981 1.00 53.91 ? 130 PRO H CB  1 
ATOM   2714 C CG  . PRO B 2 133 ? 77.877 36.332  -14.781 1.00 51.40 ? 130 PRO H CG  1 
ATOM   2715 C CD  . PRO B 2 133 ? 78.550 35.105  -15.340 1.00 50.26 ? 130 PRO H CD  1 
ATOM   2716 N N   . MET B 2 142 ? 78.765 43.183  -7.099  1.00 68.71 ? 139 MET H N   1 
ATOM   2717 C CA  . MET B 2 142 ? 78.112 41.926  -6.755  1.00 68.07 ? 139 MET H CA  1 
ATOM   2718 C C   . MET B 2 142 ? 77.518 41.236  -7.977  1.00 65.08 ? 139 MET H C   1 
ATOM   2719 O O   . MET B 2 142 ? 76.492 41.670  -8.502  1.00 67.18 ? 139 MET H O   1 
ATOM   2720 C CB  . MET B 2 142 ? 77.006 42.168  -5.725  1.00 72.48 ? 139 MET H CB  1 
ATOM   2721 C CG  . MET B 2 142 ? 77.501 42.677  -4.386  1.00 80.64 ? 139 MET H CG  1 
ATOM   2722 S SD  . MET B 2 142 ? 78.478 41.448  -3.505  1.00 89.64 ? 139 MET H SD  1 
ATOM   2723 C CE  . MET B 2 142 ? 77.227 40.769  -2.379  1.00 88.63 ? 139 MET H CE  1 
ATOM   2724 N N   . VAL B 2 143 ? 78.174 40.177  -8.439  1.00 60.56 ? 140 VAL H N   1 
ATOM   2725 C CA  . VAL B 2 143 ? 77.692 39.413  -9.585  1.00 56.68 ? 140 VAL H CA  1 
ATOM   2726 C C   . VAL B 2 143 ? 77.581 37.940  -9.222  1.00 51.77 ? 140 VAL H C   1 
ATOM   2727 O O   . VAL B 2 143 ? 78.504 37.358  -8.650  1.00 51.41 ? 140 VAL H O   1 
ATOM   2728 C CB  . VAL B 2 143 ? 78.593 39.575  -10.837 1.00 58.47 ? 140 VAL H CB  1 
ATOM   2729 C CG1 . VAL B 2 143 ? 78.277 40.889  -11.541 1.00 60.42 ? 140 VAL H CG1 1 
ATOM   2730 C CG2 . VAL B 2 143 ? 80.068 39.515  -10.455 1.00 57.37 ? 140 VAL H CG2 1 
ATOM   2731 N N   . THR B 2 144 ? 76.427 37.361  -9.519  1.00 46.90 ? 141 THR H N   1 
ATOM   2732 C CA  . THR B 2 144 ? 76.164 35.960  -9.231  1.00 44.63 ? 141 THR H CA  1 
ATOM   2733 C C   . THR B 2 144 ? 76.686 35.047  -10.333 1.00 42.40 ? 141 THR H C   1 
ATOM   2734 O O   . THR B 2 144 ? 76.572 35.351  -11.521 1.00 44.82 ? 141 THR H O   1 
ATOM   2735 C CB  . THR B 2 144 ? 74.653 35.713  -9.065  1.00 46.56 ? 141 THR H CB  1 
ATOM   2736 O OG1 . THR B 2 144 ? 74.139 36.595  -8.062  1.00 51.35 ? 141 THR H OG1 1 
ATOM   2737 C CG2 . THR B 2 144 ? 74.368 34.262  -8.673  1.00 38.94 ? 141 THR H CG2 1 
ATOM   2738 N N   . LEU B 2 145 ? 77.289 33.944  -9.922  1.00 36.07 ? 142 LEU H N   1 
ATOM   2739 C CA  . LEU B 2 145 ? 77.812 32.951  -10.841 1.00 37.18 ? 142 LEU H CA  1 
ATOM   2740 C C   . LEU B 2 145 ? 77.206 31.666  -10.298 1.00 38.13 ? 142 LEU H C   1 
ATOM   2741 O O   . LEU B 2 145 ? 76.895 31.577  -9.106  1.00 40.71 ? 142 LEU H O   1 
ATOM   2742 C CB  . LEU B 2 145 ? 79.342 32.873  -10.754 1.00 39.50 ? 142 LEU H CB  1 
ATOM   2743 C CG  . LEU B 2 145 ? 80.189 34.144  -10.600 1.00 43.51 ? 142 LEU H CG  1 
ATOM   2744 C CD1 . LEU B 2 145 ? 81.637 33.751  -10.399 1.00 39.68 ? 142 LEU H CD1 1 
ATOM   2745 C CD2 . LEU B 2 145 ? 80.050 35.058  -11.804 1.00 44.01 ? 142 LEU H CD2 1 
ATOM   2746 N N   . GLY B 2 146 ? 77.041 30.668  -11.151 1.00 37.03 ? 143 GLY H N   1 
ATOM   2747 C CA  . GLY B 2 146 ? 76.467 29.421  -10.692 1.00 32.68 ? 143 GLY H CA  1 
ATOM   2748 C C   . GLY B 2 146 ? 77.237 28.237  -11.215 1.00 30.78 ? 143 GLY H C   1 
ATOM   2749 O O   . GLY B 2 146 ? 78.230 28.397  -11.926 1.00 29.96 ? 143 GLY H O   1 
ATOM   2750 N N   . CYS B 2 147 ? 76.791 27.046  -10.845 1.00 30.50 ? 144 CYS H N   1 
ATOM   2751 C CA  . CYS B 2 147 ? 77.429 25.820  -11.297 1.00 32.34 ? 144 CYS H CA  1 
ATOM   2752 C C   . CYS B 2 147 ? 76.333 24.776  -11.380 1.00 31.61 ? 144 CYS H C   1 
ATOM   2753 O O   . CYS B 2 147 ? 75.555 24.605  -10.441 1.00 30.70 ? 144 CYS H O   1 
ATOM   2754 C CB  . CYS B 2 147 ? 78.497 25.388  -10.306 1.00 39.52 ? 144 CYS H CB  1 
ATOM   2755 S SG  . CYS B 2 147 ? 79.746 24.281  -11.015 1.00 48.33 ? 144 CYS H SG  1 
ATOM   2756 N N   . LEU B 2 148 ? 76.220 24.135  -12.532 1.00 29.10 ? 145 LEU H N   1 
ATOM   2757 C CA  . LEU B 2 148 ? 75.192 23.133  -12.739 1.00 31.65 ? 145 LEU H CA  1 
ATOM   2758 C C   . LEU B 2 148 ? 75.778 21.732  -12.682 1.00 33.71 ? 145 LEU H C   1 
ATOM   2759 O O   . LEU B 2 148 ? 76.585 21.342  -13.529 1.00 37.53 ? 145 LEU H O   1 
ATOM   2760 C CB  . LEU B 2 148 ? 74.482 23.370  -14.076 1.00 29.15 ? 145 LEU H CB  1 
ATOM   2761 C CG  . LEU B 2 148 ? 73.296 22.472  -14.441 1.00 30.30 ? 145 LEU H CG  1 
ATOM   2762 C CD1 . LEU B 2 148 ? 72.172 22.645  -13.453 1.00 24.20 ? 145 LEU H CD1 1 
ATOM   2763 C CD2 . LEU B 2 148 ? 72.807 22.839  -15.824 1.00 33.78 ? 145 LEU H CD2 1 
ATOM   2764 N N   . VAL B 2 149 ? 75.382 20.991  -11.658 1.00 30.38 ? 146 VAL H N   1 
ATOM   2765 C CA  . VAL B 2 149 ? 75.836 19.629  -11.454 1.00 28.30 ? 146 VAL H CA  1 
ATOM   2766 C C   . VAL B 2 149 ? 74.621 18.802  -11.793 1.00 32.53 ? 146 VAL H C   1 
ATOM   2767 O O   . VAL B 2 149 ? 73.708 18.699  -10.975 1.00 39.10 ? 146 VAL H O   1 
ATOM   2768 C CB  . VAL B 2 149 ? 76.181 19.395  -9.967  1.00 23.88 ? 146 VAL H CB  1 
ATOM   2769 C CG1 . VAL B 2 149 ? 76.814 18.021  -9.772  1.00 23.30 ? 146 VAL H CG1 1 
ATOM   2770 C CG2 . VAL B 2 149 ? 77.082 20.513  -9.451  1.00 15.40 ? 146 VAL H CG2 1 
ATOM   2771 N N   . LYS B 2 150 ? 74.572 18.221  -12.986 1.00 34.96 ? 147 LYS H N   1 
ATOM   2772 C CA  . LYS B 2 150 ? 73.390 17.446  -13.341 1.00 34.45 ? 147 LYS H CA  1 
ATOM   2773 C C   . LYS B 2 150 ? 73.651 16.079  -13.922 1.00 31.68 ? 147 LYS H C   1 
ATOM   2774 O O   . LYS B 2 150 ? 74.730 15.810  -14.428 1.00 34.85 ? 147 LYS H O   1 
ATOM   2775 C CB  . LYS B 2 150 ? 72.494 18.251  -14.285 1.00 40.65 ? 147 LYS H CB  1 
ATOM   2776 C CG  . LYS B 2 150 ? 73.086 18.523  -15.658 1.00 46.81 ? 147 LYS H CG  1 
ATOM   2777 C CD  . LYS B 2 150 ? 72.487 17.606  -16.721 1.00 53.81 ? 147 LYS H CD  1 
ATOM   2778 C CE  . LYS B 2 150 ? 71.120 18.101  -17.225 1.00 59.84 ? 147 LYS H CE  1 
ATOM   2779 N NZ  . LYS B 2 150 ? 70.033 18.108  -16.200 1.00 61.68 ? 147 LYS H NZ  1 
ATOM   2780 N N   . GLY B 2 151 ? 72.667 15.203  -13.766 1.00 32.94 ? 148 GLY H N   1 
ATOM   2781 C CA  . GLY B 2 151 ? 72.740 13.863  -14.313 1.00 33.26 ? 148 GLY H CA  1 
ATOM   2782 C C   . GLY B 2 151 ? 73.605 12.837  -13.630 1.00 34.61 ? 148 GLY H C   1 
ATOM   2783 O O   . GLY B 2 151 ? 74.158 11.967  -14.298 1.00 37.50 ? 148 GLY H O   1 
ATOM   2784 N N   . TYR B 2 152 ? 73.674 12.882  -12.306 1.00 36.77 ? 149 TYR H N   1 
ATOM   2785 C CA  . TYR B 2 152 ? 74.489 11.921  -11.572 1.00 34.44 ? 149 TYR H CA  1 
ATOM   2786 C C   . TYR B 2 152 ? 73.642 10.959  -10.749 1.00 33.90 ? 149 TYR H C   1 
ATOM   2787 O O   . TYR B 2 152 ? 72.423 11.133  -10.623 1.00 35.39 ? 149 TYR H O   1 
ATOM   2788 C CB  . TYR B 2 152 ? 75.462 12.646  -10.648 1.00 30.02 ? 149 TYR H CB  1 
ATOM   2789 C CG  . TYR B 2 152 ? 74.794 13.435  -9.545  1.00 32.63 ? 149 TYR H CG  1 
ATOM   2790 C CD1 . TYR B 2 152 ? 74.426 14.766  -9.736  1.00 30.76 ? 149 TYR H CD1 1 
ATOM   2791 C CD2 . TYR B 2 152 ? 74.554 12.856  -8.295  1.00 32.91 ? 149 TYR H CD2 1 
ATOM   2792 C CE1 . TYR B 2 152 ? 73.841 15.498  -8.713  1.00 29.49 ? 149 TYR H CE1 1 
ATOM   2793 C CE2 . TYR B 2 152 ? 73.972 13.580  -7.271  1.00 27.87 ? 149 TYR H CE2 1 
ATOM   2794 C CZ  . TYR B 2 152 ? 73.622 14.896  -7.484  1.00 27.57 ? 149 TYR H CZ  1 
ATOM   2795 O OH  . TYR B 2 152 ? 73.068 15.619  -6.459  1.00 34.01 ? 149 TYR H OH  1 
ATOM   2796 N N   . PHE B 2 153 ? 74.300 9.947   -10.191 1.00 30.33 ? 150 PHE H N   1 
ATOM   2797 C CA  . PHE B 2 153 ? 73.642 8.961   -9.348  1.00 28.71 ? 150 PHE H CA  1 
ATOM   2798 C C   . PHE B 2 153 ? 74.705 8.049   -8.791  1.00 30.83 ? 150 PHE H C   1 
ATOM   2799 O O   . PHE B 2 153 ? 75.692 7.782   -9.464  1.00 32.18 ? 150 PHE H O   1 
ATOM   2800 C CB  . PHE B 2 153 ? 72.628 8.146   -10.136 1.00 23.94 ? 150 PHE H CB  1 
ATOM   2801 C CG  . PHE B 2 153 ? 71.779 7.243   -9.283  1.00 25.71 ? 150 PHE H CG  1 
ATOM   2802 C CD1 . PHE B 2 153 ? 70.582 7.701   -8.740  1.00 24.60 ? 150 PHE H CD1 1 
ATOM   2803 C CD2 . PHE B 2 153 ? 72.151 5.915   -9.059  1.00 28.42 ? 150 PHE H CD2 1 
ATOM   2804 C CE1 . PHE B 2 153 ? 69.765 6.852   -7.991  1.00 21.08 ? 150 PHE H CE1 1 
ATOM   2805 C CE2 . PHE B 2 153 ? 71.338 5.055   -8.311  1.00 22.86 ? 150 PHE H CE2 1 
ATOM   2806 C CZ  . PHE B 2 153 ? 70.146 5.524   -7.779  1.00 18.58 ? 150 PHE H CZ  1 
ATOM   2807 N N   . PRO B 2 154 ? 74.596 7.685   -7.501  1.00 35.64 ? 151 PRO H N   1 
ATOM   2808 C CA  . PRO B 2 154 ? 73.525 8.112   -6.594  1.00 32.11 ? 151 PRO H CA  1 
ATOM   2809 C C   . PRO B 2 154 ? 73.931 9.361   -5.829  1.00 31.88 ? 151 PRO H C   1 
ATOM   2810 O O   . PRO B 2 154 ? 74.988 9.953   -6.080  1.00 30.68 ? 151 PRO H O   1 
ATOM   2811 C CB  . PRO B 2 154 ? 73.428 6.935   -5.632  1.00 34.79 ? 151 PRO H CB  1 
ATOM   2812 C CG  . PRO B 2 154 ? 74.869 6.597   -5.427  1.00 31.89 ? 151 PRO H CG  1 
ATOM   2813 C CD  . PRO B 2 154 ? 75.438 6.658   -6.852  1.00 34.98 ? 151 PRO H CD  1 
ATOM   2814 N N   . GLU B 2 155 ? 73.064 9.770   -4.916  1.00 34.26 ? 152 GLU H N   1 
ATOM   2815 C CA  . GLU B 2 155 ? 73.324 10.908  -4.055  1.00 36.30 ? 152 GLU H CA  1 
ATOM   2816 C C   . GLU B 2 155 ? 74.312 10.351  -3.014  1.00 37.64 ? 152 GLU H C   1 
ATOM   2817 O O   . GLU B 2 155 ? 74.309 9.140   -2.739  1.00 39.82 ? 152 GLU H O   1 
ATOM   2818 C CB  . GLU B 2 155 ? 72.018 11.301  -3.378  1.00 36.89 ? 152 GLU H CB  1 
ATOM   2819 C CG  . GLU B 2 155 ? 72.115 12.492  -2.475  1.00 41.19 ? 152 GLU H CG  1 
ATOM   2820 C CD  . GLU B 2 155 ? 72.014 13.789  -3.217  1.00 42.17 ? 152 GLU H CD  1 
ATOM   2821 O OE1 . GLU B 2 155 ? 73.063 14.367  -3.573  1.00 44.88 ? 152 GLU H OE1 1 
ATOM   2822 O OE2 . GLU B 2 155 ? 70.869 14.231  -3.432  1.00 50.13 ? 152 GLU H OE2 1 
ATOM   2823 N N   . PRO B 2 156 ? 75.134 11.209  -2.387  1.00 34.00 ? 153 PRO H N   1 
ATOM   2824 C CA  . PRO B 2 156 ? 75.264 12.654  -2.522  1.00 31.82 ? 153 PRO H CA  1 
ATOM   2825 C C   . PRO B 2 156 ? 76.427 13.120  -3.385  1.00 32.64 ? 153 PRO H C   1 
ATOM   2826 O O   . PRO B 2 156 ? 77.235 12.318  -3.867  1.00 32.86 ? 153 PRO H O   1 
ATOM   2827 C CB  . PRO B 2 156 ? 75.480 13.077  -1.084  1.00 36.90 ? 153 PRO H CB  1 
ATOM   2828 C CG  . PRO B 2 156 ? 76.439 12.036  -0.621  1.00 33.80 ? 153 PRO H CG  1 
ATOM   2829 C CD  . PRO B 2 156 ? 75.853 10.751  -1.183  1.00 34.99 ? 153 PRO H CD  1 
ATOM   2830 N N   . VAL B 2 157 ? 76.527 14.440  -3.497  1.00 30.86 ? 154 VAL H N   1 
ATOM   2831 C CA  . VAL B 2 157 ? 77.562 15.126  -4.256  1.00 32.42 ? 154 VAL H CA  1 
ATOM   2832 C C   . VAL B 2 157 ? 78.011 16.264  -3.349  1.00 34.73 ? 154 VAL H C   1 
ATOM   2833 O O   . VAL B 2 157 ? 77.209 16.819  -2.595  1.00 36.25 ? 154 VAL H O   1 
ATOM   2834 C CB  . VAL B 2 157 ? 77.000 15.677  -5.619  1.00 35.09 ? 154 VAL H CB  1 
ATOM   2835 C CG1 . VAL B 2 157 ? 77.732 16.943  -6.055  1.00 30.52 ? 154 VAL H CG1 1 
ATOM   2836 C CG2 . VAL B 2 157 ? 77.144 14.617  -6.711  1.00 28.99 ? 154 VAL H CG2 1 
ATOM   2837 N N   . THR B 2 158 ? 79.291 16.589  -3.395  1.00 32.85 ? 155 THR H N   1 
ATOM   2838 C CA  . THR B 2 158 ? 79.823 17.640  -2.558  1.00 38.41 ? 155 THR H CA  1 
ATOM   2839 C C   . THR B 2 158 ? 80.262 18.809  -3.420  1.00 36.59 ? 155 THR H C   1 
ATOM   2840 O O   . THR B 2 158 ? 81.151 18.660  -4.256  1.00 41.82 ? 155 THR H O   1 
ATOM   2841 C CB  . THR B 2 158 ? 81.023 17.110  -1.756  1.00 44.53 ? 155 THR H CB  1 
ATOM   2842 O OG1 . THR B 2 158 ? 80.606 15.977  -0.980  1.00 52.27 ? 155 THR H OG1 1 
ATOM   2843 C CG2 . THR B 2 158 ? 81.589 18.188  -0.841  1.00 46.44 ? 155 THR H CG2 1 
ATOM   2844 N N   . VAL B 2 159 ? 79.649 19.967  -3.206  1.00 31.24 ? 156 VAL H N   1 
ATOM   2845 C CA  . VAL B 2 159 ? 79.983 21.159  -3.971  1.00 31.61 ? 156 VAL H CA  1 
ATOM   2846 C C   . VAL B 2 159 ? 80.609 22.227  -3.079  1.00 33.05 ? 156 VAL H C   1 
ATOM   2847 O O   . VAL B 2 159 ? 80.079 22.529  -2.013  1.00 32.87 ? 156 VAL H O   1 
ATOM   2848 C CB  . VAL B 2 159 ? 78.722 21.761  -4.660  1.00 31.75 ? 156 VAL H CB  1 
ATOM   2849 C CG1 . VAL B 2 159 ? 79.064 23.069  -5.378  1.00 30.34 ? 156 VAL H CG1 1 
ATOM   2850 C CG2 . VAL B 2 159 ? 78.138 20.769  -5.641  1.00 34.15 ? 156 VAL H CG2 1 
ATOM   2851 N N   . THR B 2 160 ? 81.735 22.787  -3.516  1.00 34.16 ? 157 THR H N   1 
ATOM   2852 C CA  . THR B 2 160 ? 82.423 23.846  -2.782  1.00 37.77 ? 157 THR H CA  1 
ATOM   2853 C C   . THR B 2 160 ? 82.938 24.865  -3.789  1.00 38.16 ? 157 THR H C   1 
ATOM   2854 O O   . THR B 2 160 ? 83.065 24.559  -4.971  1.00 34.47 ? 157 THR H O   1 
ATOM   2855 C CB  . THR B 2 160 ? 83.627 23.314  -1.953  1.00 41.12 ? 157 THR H CB  1 
ATOM   2856 O OG1 . THR B 2 160 ? 84.479 22.514  -2.785  1.00 47.87 ? 157 THR H OG1 1 
ATOM   2857 C CG2 . THR B 2 160 ? 83.151 22.496  -0.753  1.00 41.03 ? 157 THR H CG2 1 
ATOM   2858 N N   . TRP B 2 161 ? 83.194 26.084  -3.332  1.00 39.98 ? 158 TRP H N   1 
ATOM   2859 C CA  . TRP B 2 161 ? 83.708 27.126  -4.211  1.00 43.74 ? 158 TRP H CA  1 
ATOM   2860 C C   . TRP B 2 161 ? 85.108 27.537  -3.758  1.00 46.55 ? 158 TRP H C   1 
ATOM   2861 O O   . TRP B 2 161 ? 85.323 27.840  -2.578  1.00 50.80 ? 158 TRP H O   1 
ATOM   2862 C CB  . TRP B 2 161 ? 82.767 28.333  -4.224  1.00 41.30 ? 158 TRP H CB  1 
ATOM   2863 C CG  . TRP B 2 161 ? 81.484 28.084  -4.955  1.00 46.70 ? 158 TRP H CG  1 
ATOM   2864 C CD1 . TRP B 2 161 ? 80.324 27.587  -4.431  1.00 48.43 ? 158 TRP H CD1 1 
ATOM   2865 C CD2 . TRP B 2 161 ? 81.226 28.320  -6.346  1.00 45.26 ? 158 TRP H CD2 1 
ATOM   2866 N NE1 . TRP B 2 161 ? 79.362 27.497  -5.409  1.00 47.17 ? 158 TRP H NE1 1 
ATOM   2867 C CE2 . TRP B 2 161 ? 79.886 27.942  -6.593  1.00 45.72 ? 158 TRP H CE2 1 
ATOM   2868 C CE3 . TRP B 2 161 ? 81.995 28.815  -7.407  1.00 42.79 ? 158 TRP H CE3 1 
ATOM   2869 C CZ2 . TRP B 2 161 ? 79.299 28.045  -7.858  1.00 40.35 ? 158 TRP H CZ2 1 
ATOM   2870 C CZ3 . TRP B 2 161 ? 81.410 28.917  -8.664  1.00 37.48 ? 158 TRP H CZ3 1 
ATOM   2871 C CH2 . TRP B 2 161 ? 80.075 28.533  -8.876  1.00 39.45 ? 158 TRP H CH2 1 
ATOM   2872 N N   . ASN B 2 162 ? 86.060 27.520  -4.691  1.00 46.77 ? 159 ASN H N   1 
ATOM   2873 C CA  . ASN B 2 162 ? 87.453 27.874  -4.408  1.00 46.39 ? 159 ASN H CA  1 
ATOM   2874 C C   . ASN B 2 162 ? 88.045 26.998  -3.315  1.00 46.74 ? 159 ASN H C   1 
ATOM   2875 O O   . ASN B 2 162 ? 88.761 27.476  -2.434  1.00 44.48 ? 159 ASN H O   1 
ATOM   2876 C CB  . ASN B 2 162 ? 87.583 29.348  -4.027  1.00 43.96 ? 159 ASN H CB  1 
ATOM   2877 C CG  . ASN B 2 162 ? 87.637 30.260  -5.234  1.00 46.08 ? 159 ASN H CG  1 
ATOM   2878 O OD1 . ASN B 2 162 ? 87.596 29.804  -6.378  1.00 43.32 ? 159 ASN H OD1 1 
ATOM   2879 N ND2 . ASN B 2 162 ? 87.731 31.558  -4.986  1.00 42.35 ? 159 ASN H ND2 1 
ATOM   2880 N N   . SER B 2 163 ? 87.678 25.721  -3.343  1.00 50.88 ? 160 SER H N   1 
ATOM   2881 C CA  . SER B 2 163 ? 88.160 24.741  -2.376  1.00 54.22 ? 160 SER H CA  1 
ATOM   2882 C C   . SER B 2 163 ? 87.695 25.005  -0.945  1.00 55.84 ? 160 SER H C   1 
ATOM   2883 O O   . SER B 2 163 ? 87.848 24.146  -0.076  1.00 59.13 ? 160 SER H O   1 
ATOM   2884 C CB  . SER B 2 163 ? 89.689 24.650  -2.432  1.00 54.31 ? 160 SER H CB  1 
ATOM   2885 O OG  . SER B 2 163 ? 90.133 24.258  -3.724  1.00 51.46 ? 160 SER H OG  1 
ATOM   2886 N N   . GLY B 2 164 ? 87.114 26.178  -0.703  1.00 58.02 ? 161 GLY H N   1 
ATOM   2887 C CA  . GLY B 2 164 ? 86.637 26.509  0.626   1.00 58.45 ? 161 GLY H CA  1 
ATOM   2888 C C   . GLY B 2 164 ? 86.672 27.989  0.958   1.00 58.75 ? 161 GLY H C   1 
ATOM   2889 O O   . GLY B 2 164 ? 85.929 28.444  1.831   1.00 57.43 ? 161 GLY H O   1 
ATOM   2890 N N   . SER B 2 165 ? 87.514 28.752  0.265   1.00 58.12 ? 162 SER H N   1 
ATOM   2891 C CA  . SER B 2 165 ? 87.607 30.182  0.540   1.00 62.73 ? 162 SER H CA  1 
ATOM   2892 C C   . SER B 2 165 ? 86.266 30.890  0.342   1.00 62.42 ? 162 SER H C   1 
ATOM   2893 O O   . SER B 2 165 ? 85.991 31.915  0.972   1.00 65.47 ? 162 SER H O   1 
ATOM   2894 C CB  . SER B 2 165 ? 88.712 30.840  -0.304  1.00 65.35 ? 162 SER H CB  1 
ATOM   2895 O OG  . SER B 2 165 ? 88.436 30.791  -1.692  1.00 71.80 ? 162 SER H OG  1 
ATOM   2896 N N   . LEU B 2 166 ? 85.428 30.333  -0.525  1.00 63.12 ? 163 LEU H N   1 
ATOM   2897 C CA  . LEU B 2 166 ? 84.116 30.902  -0.787  1.00 60.66 ? 163 LEU H CA  1 
ATOM   2898 C C   . LEU B 2 166 ? 83.040 30.079  -0.106  1.00 60.95 ? 163 LEU H C   1 
ATOM   2899 O O   . LEU B 2 166 ? 82.638 29.026  -0.614  1.00 59.85 ? 163 LEU H O   1 
ATOM   2900 C CB  . LEU B 2 166 ? 83.838 30.967  -2.288  1.00 57.77 ? 163 LEU H CB  1 
ATOM   2901 C CG  . LEU B 2 166 ? 84.551 32.051  -3.084  1.00 54.45 ? 163 LEU H CG  1 
ATOM   2902 C CD1 . LEU B 2 166 ? 84.121 31.975  -4.548  1.00 50.35 ? 163 LEU H CD1 1 
ATOM   2903 C CD2 . LEU B 2 166 ? 84.203 33.407  -2.487  1.00 53.66 ? 163 LEU H CD2 1 
ATOM   2904 N N   . SER B 2 167 ? 82.617 30.543  1.065   1.00 60.95 ? 164 SER H N   1 
ATOM   2905 C CA  . SER B 2 167 ? 81.572 29.877  1.837   1.00 65.58 ? 164 SER H CA  1 
ATOM   2906 C C   . SER B 2 167 ? 80.376 30.811  2.018   1.00 66.68 ? 164 SER H C   1 
ATOM   2907 O O   . SER B 2 167 ? 79.237 30.360  2.140   1.00 67.32 ? 164 SER H O   1 
ATOM   2908 C CB  . SER B 2 167 ? 82.105 29.430  3.204   1.00 68.60 ? 164 SER H CB  1 
ATOM   2909 O OG  . SER B 2 167 ? 83.099 28.418  3.080   1.00 73.35 ? 164 SER H OG  1 
ATOM   2910 N N   . SER B 2 168 ? 80.639 32.114  2.038   1.00 66.82 ? 165 SER H N   1 
ATOM   2911 C CA  . SER B 2 168 ? 79.580 33.103  2.189   1.00 69.38 ? 165 SER H CA  1 
ATOM   2912 C C   . SER B 2 168 ? 79.026 33.480  0.819   1.00 66.55 ? 165 SER H C   1 
ATOM   2913 O O   . SER B 2 168 ? 79.767 33.531  -0.162  1.00 70.12 ? 165 SER H O   1 
ATOM   2914 C CB  . SER B 2 168 ? 80.106 34.349  2.905   1.00 73.88 ? 165 SER H CB  1 
ATOM   2915 O OG  . SER B 2 168 ? 80.481 34.045  4.239   1.00 83.31 ? 165 SER H OG  1 
ATOM   2916 N N   . GLY B 2 169 ? 77.719 33.716  0.752   1.00 61.20 ? 166 GLY H N   1 
ATOM   2917 C CA  . GLY B 2 169 ? 77.094 34.082  -0.507  1.00 54.90 ? 166 GLY H CA  1 
ATOM   2918 C C   . GLY B 2 169 ? 76.803 32.877  -1.381  1.00 49.53 ? 166 GLY H C   1 
ATOM   2919 O O   . GLY B 2 169 ? 76.306 33.013  -2.503  1.00 52.92 ? 166 GLY H O   1 
ATOM   2920 N N   . VAL B 2 170 ? 77.094 31.695  -0.853  1.00 40.13 ? 167 VAL H N   1 
ATOM   2921 C CA  . VAL B 2 170 ? 76.874 30.451  -1.563  1.00 34.38 ? 167 VAL H CA  1 
ATOM   2922 C C   . VAL B 2 170 ? 75.517 29.865  -1.178  1.00 36.92 ? 167 VAL H C   1 
ATOM   2923 O O   . VAL B 2 170 ? 75.046 30.071  -0.062  1.00 43.15 ? 167 VAL H O   1 
ATOM   2924 C CB  . VAL B 2 170 ? 78.001 29.450  -1.233  1.00 30.97 ? 167 VAL H CB  1 
ATOM   2925 C CG1 . VAL B 2 170 ? 77.680 28.066  -1.772  1.00 29.79 ? 167 VAL H CG1 1 
ATOM   2926 C CG2 . VAL B 2 170 ? 79.311 29.947  -1.807  1.00 24.04 ? 167 VAL H CG2 1 
ATOM   2927 N N   . HIS B 2 171 ? 74.853 29.221  -2.135  1.00 37.70 ? 168 HIS H N   1 
ATOM   2928 C CA  . HIS B 2 171 ? 73.559 28.571  -1.920  1.00 30.74 ? 168 HIS H CA  1 
ATOM   2929 C C   . HIS B 2 171 ? 73.595 27.298  -2.734  1.00 32.30 ? 168 HIS H C   1 
ATOM   2930 O O   . HIS B 2 171 ? 73.681 27.354  -3.958  1.00 39.91 ? 168 HIS H O   1 
ATOM   2931 C CB  . HIS B 2 171 ? 72.395 29.396  -2.474  1.00 35.22 ? 168 HIS H CB  1 
ATOM   2932 C CG  . HIS B 2 171 ? 72.092 30.640  -1.706  1.00 40.35 ? 168 HIS H CG  1 
ATOM   2933 N ND1 . HIS B 2 171 ? 72.356 31.897  -2.201  1.00 45.27 ? 168 HIS H ND1 1 
ATOM   2934 C CD2 . HIS B 2 171 ? 71.489 30.826  -0.507  1.00 42.46 ? 168 HIS H CD2 1 
ATOM   2935 C CE1 . HIS B 2 171 ? 71.927 32.805  -1.344  1.00 45.37 ? 168 HIS H CE1 1 
ATOM   2936 N NE2 . HIS B 2 171 ? 71.396 32.181  -0.308  1.00 42.48 ? 168 HIS H NE2 1 
ATOM   2937 N N   . THR B 2 172 ? 73.587 26.154  -2.074  1.00 27.75 ? 169 THR H N   1 
ATOM   2938 C CA  . THR B 2 172 ? 73.571 24.895  -2.788  1.00 24.09 ? 169 THR H CA  1 
ATOM   2939 C C   . THR B 2 172 ? 72.172 24.334  -2.583  1.00 29.19 ? 169 THR H C   1 
ATOM   2940 O O   . THR B 2 172 ? 71.770 24.023  -1.462  1.00 36.89 ? 169 THR H O   1 
ATOM   2941 C CB  . THR B 2 172 ? 74.627 23.948  -2.258  1.00 21.20 ? 169 THR H CB  1 
ATOM   2942 O OG1 . THR B 2 172 ? 75.926 24.505  -2.517  1.00 25.07 ? 169 THR H OG1 1 
ATOM   2943 C CG2 . THR B 2 172 ? 74.501 22.592  -2.926  1.00 21.83 ? 169 THR H CG2 1 
ATOM   2944 N N   . PHE B 2 173 ? 71.409 24.270  -3.664  1.00 24.29 ? 170 PHE H N   1 
ATOM   2945 C CA  . PHE B 2 173 ? 70.036 23.798  -3.601  1.00 27.36 ? 170 PHE H CA  1 
ATOM   2946 C C   . PHE B 2 173 ? 69.984 22.284  -3.549  1.00 28.76 ? 170 PHE H C   1 
ATOM   2947 O O   . PHE B 2 173 ? 70.797 21.599  -4.173  1.00 33.48 ? 170 PHE H O   1 
ATOM   2948 C CB  . PHE B 2 173 ? 69.247 24.329  -4.810  1.00 24.40 ? 170 PHE H CB  1 
ATOM   2949 C CG  . PHE B 2 173 ? 69.432 25.809  -5.039  1.00 22.76 ? 170 PHE H CG  1 
ATOM   2950 C CD1 . PHE B 2 173 ? 68.462 26.716  -4.637  1.00 17.41 ? 170 PHE H CD1 1 
ATOM   2951 C CD2 . PHE B 2 173 ? 70.620 26.299  -5.593  1.00 22.26 ? 170 PHE H CD2 1 
ATOM   2952 C CE1 . PHE B 2 173 ? 68.679 28.091  -4.775  1.00 14.21 ? 170 PHE H CE1 1 
ATOM   2953 C CE2 . PHE B 2 173 ? 70.841 27.663  -5.734  1.00 17.88 ? 170 PHE H CE2 1 
ATOM   2954 C CZ  . PHE B 2 173 ? 69.870 28.559  -5.322  1.00 19.60 ? 170 PHE H CZ  1 
ATOM   2955 N N   . PRO B 2 174 ? 69.074 21.735  -2.740  1.00 25.96 ? 171 PRO H N   1 
ATOM   2956 C CA  . PRO B 2 174 ? 68.955 20.279  -2.642  1.00 26.05 ? 171 PRO H CA  1 
ATOM   2957 C C   . PRO B 2 174 ? 68.761 19.664  -4.023  1.00 29.93 ? 171 PRO H C   1 
ATOM   2958 O O   . PRO B 2 174 ? 68.105 20.248  -4.882  1.00 31.20 ? 171 PRO H O   1 
ATOM   2959 C CB  . PRO B 2 174 ? 67.699 20.094  -1.793  1.00 22.78 ? 171 PRO H CB  1 
ATOM   2960 C CG  . PRO B 2 174 ? 66.945 21.369  -1.981  1.00 21.25 ? 171 PRO H CG  1 
ATOM   2961 C CD  . PRO B 2 174 ? 68.047 22.398  -1.934  1.00 16.27 ? 171 PRO H CD  1 
ATOM   2962 N N   . ALA B 2 175 ? 69.370 18.504  -4.239  1.00 32.55 ? 172 ALA H N   1 
ATOM   2963 C CA  . ALA B 2 175 ? 69.258 17.807  -5.506  1.00 30.20 ? 172 ALA H CA  1 
ATOM   2964 C C   . ALA B 2 175 ? 67.807 17.398  -5.722  1.00 33.84 ? 172 ALA H C   1 
ATOM   2965 O O   . ALA B 2 175 ? 67.057 17.260  -4.762  1.00 36.26 ? 172 ALA H O   1 
ATOM   2966 C CB  . ALA B 2 175 ? 70.144 16.592  -5.500  1.00 28.00 ? 172 ALA H CB  1 
ATOM   2967 N N   . VAL B 2 176 ? 67.407 17.266  -6.986  1.00 36.71 ? 173 VAL H N   1 
ATOM   2968 C CA  . VAL B 2 176 ? 66.050 16.858  -7.352  1.00 33.07 ? 173 VAL H CA  1 
ATOM   2969 C C   . VAL B 2 176 ? 66.174 15.631  -8.252  1.00 36.72 ? 173 VAL H C   1 
ATOM   2970 O O   . VAL B 2 176 ? 66.973 15.637  -9.191  1.00 35.12 ? 173 VAL H O   1 
ATOM   2971 C CB  . VAL B 2 176 ? 65.323 17.956  -8.144  1.00 30.68 ? 173 VAL H CB  1 
ATOM   2972 C CG1 . VAL B 2 176 ? 63.967 17.460  -8.594  1.00 40.45 ? 173 VAL H CG1 1 
ATOM   2973 C CG2 . VAL B 2 176 ? 65.163 19.203  -7.312  1.00 29.34 ? 173 VAL H CG2 1 
ATOM   2974 N N   . LEU B 2 177 ? 65.417 14.579  -7.950  1.00 38.30 ? 174 LEU H N   1 
ATOM   2975 C CA  . LEU B 2 177 ? 65.461 13.351  -8.741  1.00 40.39 ? 174 LEU H CA  1 
ATOM   2976 C C   . LEU B 2 177 ? 64.582 13.514  -9.973  1.00 44.55 ? 174 LEU H C   1 
ATOM   2977 O O   . LEU B 2 177 ? 63.477 14.042  -9.894  1.00 45.25 ? 174 LEU H O   1 
ATOM   2978 C CB  . LEU B 2 177 ? 64.994 12.156  -7.911  1.00 38.17 ? 174 LEU H CB  1 
ATOM   2979 C CG  . LEU B 2 177 ? 65.217 10.761  -8.510  1.00 38.85 ? 174 LEU H CG  1 
ATOM   2980 C CD1 . LEU B 2 177 ? 66.700 10.458  -8.659  1.00 28.76 ? 174 LEU H CD1 1 
ATOM   2981 C CD2 . LEU B 2 177 ? 64.567 9.723   -7.611  1.00 43.33 ? 174 LEU H CD2 1 
ATOM   2982 N N   . GLN B 2 178 ? 65.080 13.075  -11.119 1.00 50.49 ? 175 GLN H N   1 
ATOM   2983 C CA  . GLN B 2 178 ? 64.334 13.202  -12.356 1.00 57.15 ? 175 GLN H CA  1 
ATOM   2984 C C   . GLN B 2 178 ? 64.818 12.176  -13.360 1.00 60.81 ? 175 GLN H C   1 
ATOM   2985 O O   . GLN B 2 178 ? 65.993 12.161  -13.729 1.00 65.16 ? 175 GLN H O   1 
ATOM   2986 C CB  . GLN B 2 178 ? 64.512 14.611  -12.929 1.00 59.04 ? 175 GLN H CB  1 
ATOM   2987 C CG  . GLN B 2 178 ? 63.706 14.885  -14.191 1.00 65.84 ? 175 GLN H CG  1 
ATOM   2988 C CD  . GLN B 2 178 ? 62.210 14.713  -13.984 1.00 69.72 ? 175 GLN H CD  1 
ATOM   2989 O OE1 . GLN B 2 178 ? 61.528 14.107  -14.808 1.00 72.21 ? 175 GLN H OE1 1 
ATOM   2990 N NE2 . GLN B 2 178 ? 61.694 15.241  -12.877 1.00 66.94 ? 175 GLN H NE2 1 
ATOM   2991 N N   . SER B 2 179 ? 63.913 11.287  -13.757 1.00 62.86 ? 176 SER H N   1 
ATOM   2992 C CA  . SER B 2 179 ? 64.214 10.246  -14.729 1.00 61.71 ? 176 SER H CA  1 
ATOM   2993 C C   . SER B 2 179 ? 65.468 9.475   -14.340 1.00 61.15 ? 176 SER H C   1 
ATOM   2994 O O   . SER B 2 179 ? 66.454 9.480   -15.073 1.00 65.48 ? 176 SER H O   1 
ATOM   2995 C CB  . SER B 2 179 ? 64.390 10.878  -16.113 1.00 63.49 ? 176 SER H CB  1 
ATOM   2996 O OG  . SER B 2 179 ? 63.332 11.783  -16.391 1.00 66.39 ? 176 SER H OG  1 
ATOM   2997 N N   . ASP B 2 180 ? 65.443 8.867   -13.157 1.00 60.94 ? 177 ASP H N   1 
ATOM   2998 C CA  . ASP B 2 180 ? 66.571 8.077   -12.650 1.00 60.25 ? 177 ASP H CA  1 
ATOM   2999 C C   . ASP B 2 180 ? 67.867 8.849   -12.342 1.00 55.10 ? 177 ASP H C   1 
ATOM   3000 O O   . ASP B 2 180 ? 68.813 8.265   -11.811 1.00 56.20 ? 177 ASP H O   1 
ATOM   3001 C CB  . ASP B 2 180 ? 66.895 6.916   -13.608 1.00 69.29 ? 177 ASP H CB  1 
ATOM   3002 C CG  . ASP B 2 180 ? 65.777 5.889   -13.696 1.00 77.37 ? 177 ASP H CG  1 
ATOM   3003 O OD1 . ASP B 2 180 ? 64.802 6.120   -14.448 1.00 82.59 ? 177 ASP H OD1 1 
ATOM   3004 O OD2 . ASP B 2 180 ? 65.884 4.840   -13.023 1.00 80.38 ? 177 ASP H OD2 1 
ATOM   3005 N N   . LEU B 2 181 ? 67.932 10.133  -12.684 1.00 46.75 ? 178 LEU H N   1 
ATOM   3006 C CA  . LEU B 2 181 ? 69.137 10.916  -12.417 1.00 44.61 ? 178 LEU H CA  1 
ATOM   3007 C C   . LEU B 2 181 ? 68.873 12.168  -11.567 1.00 42.94 ? 178 LEU H C   1 
ATOM   3008 O O   . LEU B 2 181 ? 67.774 12.725  -11.584 1.00 39.91 ? 178 LEU H O   1 
ATOM   3009 C CB  . LEU B 2 181 ? 69.812 11.337  -13.732 1.00 47.74 ? 178 LEU H CB  1 
ATOM   3010 C CG  . LEU B 2 181 ? 70.494 10.344  -14.683 1.00 43.70 ? 178 LEU H CG  1 
ATOM   3011 C CD1 . LEU B 2 181 ? 71.587 9.573   -13.973 1.00 42.85 ? 178 LEU H CD1 1 
ATOM   3012 C CD2 . LEU B 2 181 ? 69.481 9.407   -15.274 1.00 45.13 ? 178 LEU H CD2 1 
ATOM   3013 N N   . TYR B 2 182 ? 69.894 12.606  -10.834 1.00 39.71 ? 179 TYR H N   1 
ATOM   3014 C CA  . TYR B 2 182 ? 69.808 13.800  -9.986  1.00 36.19 ? 179 TYR H CA  1 
ATOM   3015 C C   . TYR B 2 182 ? 70.383 15.030  -10.666 1.00 34.42 ? 179 TYR H C   1 
ATOM   3016 O O   . TYR B 2 182 ? 71.332 14.939  -11.449 1.00 39.02 ? 179 TYR H O   1 
ATOM   3017 C CB  . TYR B 2 182 ? 70.590 13.607  -8.684  1.00 35.01 ? 179 TYR H CB  1 
ATOM   3018 C CG  . TYR B 2 182 ? 69.867 12.821  -7.643  1.00 30.44 ? 179 TYR H CG  1 
ATOM   3019 C CD1 . TYR B 2 182 ? 68.795 13.378  -6.959  1.00 27.37 ? 179 TYR H CD1 1 
ATOM   3020 C CD2 . TYR B 2 182 ? 70.237 11.510  -7.352  1.00 27.98 ? 179 TYR H CD2 1 
ATOM   3021 C CE1 . TYR B 2 182 ? 68.103 12.653  -6.012  1.00 33.35 ? 179 TYR H CE1 1 
ATOM   3022 C CE2 . TYR B 2 182 ? 69.551 10.775  -6.406  1.00 34.33 ? 179 TYR H CE2 1 
ATOM   3023 C CZ  . TYR B 2 182 ? 68.482 11.352  -5.739  1.00 35.37 ? 179 TYR H CZ  1 
ATOM   3024 O OH  . TYR B 2 182 ? 67.784 10.627  -4.802  1.00 46.13 ? 179 TYR H OH  1 
ATOM   3025 N N   . THR B 2 183 ? 69.847 16.187  -10.311 1.00 30.77 ? 180 THR H N   1 
ATOM   3026 C CA  . THR B 2 183 ? 70.318 17.451  -10.849 1.00 33.50 ? 180 THR H CA  1 
ATOM   3027 C C   . THR B 2 183 ? 70.385 18.376  -9.654  1.00 30.65 ? 180 THR H C   1 
ATOM   3028 O O   . THR B 2 183 ? 69.466 18.394  -8.832  1.00 29.93 ? 180 THR H O   1 
ATOM   3029 C CB  . THR B 2 183 ? 69.359 18.020  -11.923 1.00 32.46 ? 180 THR H CB  1 
ATOM   3030 O OG1 . THR B 2 183 ? 69.330 17.137  -13.055 1.00 36.90 ? 180 THR H OG1 1 
ATOM   3031 C CG2 . THR B 2 183 ? 69.813 19.398  -12.373 1.00 32.42 ? 180 THR H CG2 1 
ATOM   3032 N N   . LEU B 2 184 ? 71.479 19.126  -9.570  1.00 32.33 ? 181 LEU H N   1 
ATOM   3033 C CA  . LEU B 2 184 ? 71.741 20.045  -8.471  1.00 32.22 ? 181 LEU H CA  1 
ATOM   3034 C C   . LEU B 2 184 ? 72.449 21.300  -8.983  1.00 29.03 ? 181 LEU H C   1 
ATOM   3035 O O   . LEU B 2 184 ? 73.212 21.243  -9.943  1.00 27.60 ? 181 LEU H O   1 
ATOM   3036 C CB  . LEU B 2 184 ? 72.610 19.326  -7.416  1.00 32.83 ? 181 LEU H CB  1 
ATOM   3037 C CG  . LEU B 2 184 ? 73.208 20.058  -6.207  1.00 29.72 ? 181 LEU H CG  1 
ATOM   3038 C CD1 . LEU B 2 184 ? 73.130 19.167  -4.987  1.00 34.17 ? 181 LEU H CD1 1 
ATOM   3039 C CD2 . LEU B 2 184 ? 74.646 20.444  -6.474  1.00 22.96 ? 181 LEU H CD2 1 
ATOM   3040 N N   . SER B 2 185 ? 72.192 22.428  -8.336  1.00 26.17 ? 182 SER H N   1 
ATOM   3041 C CA  . SER B 2 185 ? 72.816 23.687  -8.707  1.00 27.57 ? 182 SER H CA  1 
ATOM   3042 C C   . SER B 2 185 ? 73.382 24.344  -7.463  1.00 25.15 ? 182 SER H C   1 
ATOM   3043 O O   . SER B 2 185 ? 72.935 24.065  -6.357  1.00 26.94 ? 182 SER H O   1 
ATOM   3044 C CB  . SER B 2 185 ? 71.796 24.620  -9.364  1.00 28.27 ? 182 SER H CB  1 
ATOM   3045 O OG  . SER B 2 185 ? 70.607 24.720  -8.595  1.00 37.99 ? 182 SER H OG  1 
ATOM   3046 N N   . SER B 2 186 ? 74.374 25.203  -7.658  1.00 29.03 ? 183 SER H N   1 
ATOM   3047 C CA  . SER B 2 186 ? 75.029 25.936  -6.581  1.00 31.91 ? 183 SER H CA  1 
ATOM   3048 C C   . SER B 2 186 ? 75.366 27.333  -7.118  1.00 34.48 ? 183 SER H C   1 
ATOM   3049 O O   . SER B 2 186 ? 75.932 27.466  -8.210  1.00 38.29 ? 183 SER H O   1 
ATOM   3050 C CB  . SER B 2 186 ? 76.312 25.212  -6.159  1.00 32.20 ? 183 SER H CB  1 
ATOM   3051 O OG  . SER B 2 186 ? 76.973 25.895  -5.106  1.00 37.23 ? 183 SER H OG  1 
ATOM   3052 N N   . SER B 2 187 ? 74.994 28.364  -6.370  1.00 33.84 ? 184 SER H N   1 
ATOM   3053 C CA  . SER B 2 187 ? 75.245 29.737  -6.781  1.00 35.80 ? 184 SER H CA  1 
ATOM   3054 C C   . SER B 2 187 ? 76.169 30.442  -5.803  1.00 37.93 ? 184 SER H C   1 
ATOM   3055 O O   . SER B 2 187 ? 76.149 30.157  -4.602  1.00 41.07 ? 184 SER H O   1 
ATOM   3056 C CB  . SER B 2 187 ? 73.923 30.507  -6.852  1.00 40.56 ? 184 SER H CB  1 
ATOM   3057 O OG  . SER B 2 187 ? 73.355 30.697  -5.562  1.00 47.23 ? 184 SER H OG  1 
ATOM   3058 N N   . VAL B 2 188 ? 76.944 31.392  -6.306  1.00 36.02 ? 185 VAL H N   1 
ATOM   3059 C CA  . VAL B 2 188 ? 77.851 32.145  -5.463  1.00 39.87 ? 185 VAL H CA  1 
ATOM   3060 C C   . VAL B 2 188 ? 77.799 33.611  -5.866  1.00 42.47 ? 185 VAL H C   1 
ATOM   3061 O O   . VAL B 2 188 ? 77.705 33.926  -7.048  1.00 46.39 ? 185 VAL H O   1 
ATOM   3062 C CB  . VAL B 2 188 ? 79.293 31.606  -5.570  1.00 42.54 ? 185 VAL H CB  1 
ATOM   3063 C CG1 . VAL B 2 188 ? 79.891 31.921  -6.934  1.00 45.18 ? 185 VAL H CG1 1 
ATOM   3064 C CG2 . VAL B 2 188 ? 80.151 32.176  -4.455  1.00 48.10 ? 185 VAL H CG2 1 
ATOM   3065 N N   . THR B 2 189 ? 77.802 34.503  -4.881  1.00 48.06 ? 186 THR H N   1 
ATOM   3066 C CA  . THR B 2 189 ? 77.766 35.934  -5.148  1.00 49.54 ? 186 THR H CA  1 
ATOM   3067 C C   . THR B 2 189 ? 79.031 36.591  -4.628  1.00 53.29 ? 186 THR H C   1 
ATOM   3068 O O   . THR B 2 189 ? 79.310 36.573  -3.431  1.00 58.68 ? 186 THR H O   1 
ATOM   3069 C CB  . THR B 2 189 ? 76.561 36.608  -4.488  1.00 51.73 ? 186 THR H CB  1 
ATOM   3070 O OG1 . THR B 2 189 ? 75.379 35.837  -4.744  1.00 55.94 ? 186 THR H OG1 1 
ATOM   3071 C CG2 . THR B 2 189 ? 76.368 38.002  -5.064  1.00 51.71 ? 186 THR H CG2 1 
ATOM   3072 N N   . VAL B 2 190 ? 79.797 37.169  -5.542  1.00 58.16 ? 187 VAL H N   1 
ATOM   3073 C CA  . VAL B 2 190 ? 81.044 37.837  -5.207  1.00 60.13 ? 187 VAL H CA  1 
ATOM   3074 C C   . VAL B 2 190 ? 80.994 39.275  -5.730  1.00 63.45 ? 187 VAL H C   1 
ATOM   3075 O O   . VAL B 2 190 ? 80.253 39.572  -6.671  1.00 62.75 ? 187 VAL H O   1 
ATOM   3076 C CB  . VAL B 2 190 ? 82.251 37.071  -5.815  1.00 61.17 ? 187 VAL H CB  1 
ATOM   3077 C CG1 . VAL B 2 190 ? 82.443 35.745  -5.092  1.00 59.25 ? 187 VAL H CG1 1 
ATOM   3078 C CG2 . VAL B 2 190 ? 82.022 36.806  -7.307  1.00 59.70 ? 187 VAL H CG2 1 
ATOM   3079 N N   . PRO B 2 191 ? 81.735 40.200  -5.092  1.00 65.35 ? 188 PRO H N   1 
ATOM   3080 C CA  . PRO B 2 191 ? 81.744 41.601  -5.528  1.00 66.97 ? 188 PRO H CA  1 
ATOM   3081 C C   . PRO B 2 191 ? 82.208 41.735  -6.969  1.00 67.47 ? 188 PRO H C   1 
ATOM   3082 O O   . PRO B 2 191 ? 83.046 40.964  -7.425  1.00 65.41 ? 188 PRO H O   1 
ATOM   3083 C CB  . PRO B 2 191 ? 82.725 42.252  -4.556  1.00 66.51 ? 188 PRO H CB  1 
ATOM   3084 C CG  . PRO B 2 191 ? 82.532 41.448  -3.305  1.00 66.72 ? 188 PRO H CG  1 
ATOM   3085 C CD  . PRO B 2 191 ? 82.516 40.038  -3.854  1.00 67.94 ? 188 PRO H CD  1 
ATOM   3086 N N   . SER B 2 192 ? 81.668 42.724  -7.670  1.00 71.18 ? 189 SER H N   1 
ATOM   3087 C CA  . SER B 2 192 ? 82.002 42.960  -9.071  1.00 77.46 ? 189 SER H CA  1 
ATOM   3088 C C   . SER B 2 192 ? 83.501 43.032  -9.343  1.00 79.93 ? 189 SER H C   1 
ATOM   3089 O O   . SER B 2 192 ? 83.953 42.703  -10.438 1.00 81.00 ? 189 SER H O   1 
ATOM   3090 C CB  . SER B 2 192 ? 81.338 44.248  -9.564  1.00 81.14 ? 189 SER H CB  1 
ATOM   3091 O OG  . SER B 2 192 ? 79.938 44.237  -9.323  1.00 88.57 ? 189 SER H OG  1 
ATOM   3092 N N   . SER B 2 193 ? 84.268 43.466  -8.348  1.00 80.89 ? 190 SER H N   1 
ATOM   3093 C CA  . SER B 2 193 ? 85.711 43.588  -8.505  1.00 81.38 ? 190 SER H CA  1 
ATOM   3094 C C   . SER B 2 193 ? 86.452 42.257  -8.700  1.00 82.22 ? 190 SER H C   1 
ATOM   3095 O O   . SER B 2 193 ? 87.084 42.057  -9.740  1.00 83.78 ? 190 SER H O   1 
ATOM   3096 C CB  . SER B 2 193 ? 86.311 44.383  -7.341  1.00 80.94 ? 190 SER H CB  1 
ATOM   3097 O OG  . SER B 2 193 ? 85.567 45.564  -7.104  1.00 83.65 ? 190 SER H OG  1 
ATOM   3098 N N   . PRO B 2 194 ? 86.374 41.326  -7.721  1.00 80.20 ? 191 PRO H N   1 
ATOM   3099 C CA  . PRO B 2 194 ? 87.051 40.027  -7.814  1.00 76.51 ? 191 PRO H CA  1 
ATOM   3100 C C   . PRO B 2 194 ? 86.552 39.025  -8.854  1.00 74.76 ? 191 PRO H C   1 
ATOM   3101 O O   . PRO B 2 194 ? 86.539 37.823  -8.599  1.00 74.62 ? 191 PRO H O   1 
ATOM   3102 C CB  . PRO B 2 194 ? 86.905 39.473  -6.400  1.00 78.81 ? 191 PRO H CB  1 
ATOM   3103 C CG  . PRO B 2 194 ? 85.599 40.016  -5.974  1.00 79.68 ? 191 PRO H CG  1 
ATOM   3104 C CD  . PRO B 2 194 ? 85.713 41.450  -6.410  1.00 80.02 ? 191 PRO H CD  1 
ATOM   3105 N N   . ARG B 2 195 ? 86.161 39.520  -10.023 1.00 73.14 ? 192 ARG H N   1 
ATOM   3106 C CA  . ARG B 2 195 ? 85.693 38.681  -11.123 1.00 69.72 ? 192 ARG H CA  1 
ATOM   3107 C C   . ARG B 2 195 ? 85.507 39.585  -12.333 1.00 69.65 ? 192 ARG H C   1 
ATOM   3108 O O   . ARG B 2 195 ? 84.800 40.585  -12.251 1.00 71.92 ? 192 ARG H O   1 
ATOM   3109 C CB  . ARG B 2 195 ? 84.365 37.995  -10.783 1.00 64.06 ? 192 ARG H CB  1 
ATOM   3110 C CG  . ARG B 2 195 ? 84.432 36.470  -10.784 1.00 55.85 ? 192 ARG H CG  1 
ATOM   3111 C CD  . ARG B 2 195 ? 85.066 35.916  -12.058 1.00 52.71 ? 192 ARG H CD  1 
ATOM   3112 N NE  . ARG B 2 195 ? 84.115 35.379  -13.033 1.00 50.09 ? 192 ARG H NE  1 
ATOM   3113 C CZ  . ARG B 2 195 ? 83.250 36.099  -13.748 1.00 53.26 ? 192 ARG H CZ  1 
ATOM   3114 N NH1 . ARG B 2 195 ? 83.173 37.412  -13.563 1.00 50.61 ? 192 ARG H NH1 1 
ATOM   3115 N NH2 . ARG B 2 195 ? 82.472 35.523  -14.657 1.00 53.86 ? 192 ARG H NH2 1 
ATOM   3116 N N   . PRO B 2 196 ? 86.125 39.238  -13.478 1.00 68.26 ? 193 PRO H N   1 
ATOM   3117 C CA  . PRO B 2 196 ? 86.975 38.061  -13.698 1.00 68.22 ? 193 PRO H CA  1 
ATOM   3118 C C   . PRO B 2 196 ? 88.434 38.230  -13.257 1.00 68.47 ? 193 PRO H C   1 
ATOM   3119 O O   . PRO B 2 196 ? 89.289 37.427  -13.632 1.00 67.04 ? 193 PRO H O   1 
ATOM   3120 C CB  . PRO B 2 196 ? 86.889 37.854  -15.220 1.00 67.67 ? 193 PRO H CB  1 
ATOM   3121 C CG  . PRO B 2 196 ? 85.687 38.685  -15.655 1.00 65.33 ? 193 PRO H CG  1 
ATOM   3122 C CD  . PRO B 2 196 ? 85.801 39.875  -14.764 1.00 66.37 ? 193 PRO H CD  1 
ATOM   3123 N N   . SER B 2 197 ? 88.713 39.263  -12.466 1.00 68.72 ? 194 SER H N   1 
ATOM   3124 C CA  . SER B 2 197 ? 90.074 39.526  -12.003 1.00 68.38 ? 194 SER H CA  1 
ATOM   3125 C C   . SER B 2 197 ? 90.600 38.436  -11.081 1.00 68.08 ? 194 SER H C   1 
ATOM   3126 O O   . SER B 2 197 ? 91.762 38.043  -11.181 1.00 68.96 ? 194 SER H O   1 
ATOM   3127 C CB  . SER B 2 197 ? 90.141 40.882  -11.309 1.00 67.23 ? 194 SER H CB  1 
ATOM   3128 O OG  . SER B 2 197 ? 89.173 40.952  -10.285 1.00 70.05 ? 194 SER H OG  1 
ATOM   3129 N N   . GLU B 2 198 ? 89.765 37.990  -10.148 1.00 67.94 ? 195 GLU H N   1 
ATOM   3130 C CA  . GLU B 2 198 ? 90.155 36.929  -9.228  1.00 70.37 ? 195 GLU H CA  1 
ATOM   3131 C C   . GLU B 2 198 ? 89.433 35.650  -9.638  1.00 67.85 ? 195 GLU H C   1 
ATOM   3132 O O   . GLU B 2 198 ? 88.223 35.655  -9.846  1.00 72.14 ? 195 GLU H O   1 
ATOM   3133 C CB  . GLU B 2 198 ? 89.820 37.311  -7.786  1.00 77.08 ? 195 GLU H CB  1 
ATOM   3134 C CG  . GLU B 2 198 ? 90.866 38.200  -7.097  1.00 86.29 ? 195 GLU H CG  1 
ATOM   3135 C CD  . GLU B 2 198 ? 91.042 39.566  -7.753  1.00 92.48 ? 195 GLU H CD  1 
ATOM   3136 O OE1 . GLU B 2 198 ? 92.028 39.744  -8.502  1.00 95.48 ? 195 GLU H OE1 1 
ATOM   3137 O OE2 . GLU B 2 198 ? 90.212 40.470  -7.504  1.00 94.75 ? 195 GLU H OE2 1 
ATOM   3138 N N   . THR B 2 199 ? 90.187 34.569  -9.796  1.00 64.77 ? 196 THR H N   1 
ATOM   3139 C CA  . THR B 2 199 ? 89.628 33.285  -10.212 1.00 60.75 ? 196 THR H CA  1 
ATOM   3140 C C   . THR B 2 199 ? 88.586 32.713  -9.264  1.00 57.94 ? 196 THR H C   1 
ATOM   3141 O O   . THR B 2 199 ? 88.788 32.689  -8.051  1.00 61.54 ? 196 THR H O   1 
ATOM   3142 C CB  . THR B 2 199 ? 90.738 32.224  -10.381 1.00 60.33 ? 196 THR H CB  1 
ATOM   3143 O OG1 . THR B 2 199 ? 91.618 32.611  -11.444 1.00 64.11 ? 196 THR H OG1 1 
ATOM   3144 C CG2 . THR B 2 199 ? 90.143 30.861  -10.691 1.00 57.13 ? 196 THR H CG2 1 
ATOM   3145 N N   . VAL B 2 200 ? 87.484 32.240  -9.835  1.00 52.21 ? 197 VAL H N   1 
ATOM   3146 C CA  . VAL B 2 200 ? 86.411 31.616  -9.076  1.00 47.49 ? 197 VAL H CA  1 
ATOM   3147 C C   . VAL B 2 200 ? 86.259 30.219  -9.668  1.00 50.89 ? 197 VAL H C   1 
ATOM   3148 O O   . VAL B 2 200 ? 86.066 30.075  -10.879 1.00 51.78 ? 197 VAL H O   1 
ATOM   3149 C CB  . VAL B 2 200 ? 85.075 32.381  -9.223  1.00 45.78 ? 197 VAL H CB  1 
ATOM   3150 C CG1 . VAL B 2 200 ? 83.937 31.577  -8.610  1.00 40.14 ? 197 VAL H CG1 1 
ATOM   3151 C CG2 . VAL B 2 200 ? 85.167 33.744  -8.556  1.00 37.32 ? 197 VAL H CG2 1 
ATOM   3152 N N   . THR B 2 201 ? 86.396 29.194  -8.830  1.00 50.27 ? 198 THR H N   1 
ATOM   3153 C CA  . THR B 2 201 ? 86.277 27.812  -9.286  1.00 47.14 ? 198 THR H CA  1 
ATOM   3154 C C   . THR B 2 201 ? 85.167 27.077  -8.551  1.00 46.23 ? 198 THR H C   1 
ATOM   3155 O O   . THR B 2 201 ? 84.887 27.346  -7.382  1.00 49.55 ? 198 THR H O   1 
ATOM   3156 C CB  . THR B 2 201 ? 87.605 27.023  -9.101  1.00 46.74 ? 198 THR H CB  1 
ATOM   3157 O OG1 . THR B 2 201 ? 88.654 27.667  -9.835  1.00 50.22 ? 198 THR H OG1 1 
ATOM   3158 C CG2 . THR B 2 201 ? 87.462 25.585  -9.594  1.00 37.66 ? 198 THR H CG2 1 
ATOM   3159 N N   . CYS B 2 202 ? 84.525 26.170  -9.270  1.00 41.22 ? 199 CYS H N   1 
ATOM   3160 C CA  . CYS B 2 202 ? 83.456 25.349  -8.743  1.00 41.26 ? 199 CYS H CA  1 
ATOM   3161 C C   . CYS B 2 202 ? 84.093 23.978  -8.554  1.00 39.90 ? 199 CYS H C   1 
ATOM   3162 O O   . CYS B 2 202 ? 84.610 23.398  -9.505  1.00 39.99 ? 199 CYS H O   1 
ATOM   3163 C CB  . CYS B 2 202 ? 82.316 25.289  -9.767  1.00 44.62 ? 199 CYS H CB  1 
ATOM   3164 S SG  . CYS B 2 202 ? 81.064 24.000  -9.498  1.00 45.90 ? 199 CYS H SG  1 
ATOM   3165 N N   . ASN B 2 203 ? 84.140 23.504  -7.314  1.00 38.82 ? 200 ASN H N   1 
ATOM   3166 C CA  . ASN B 2 203 ? 84.737 22.205  -7.001  1.00 32.47 ? 200 ASN H CA  1 
ATOM   3167 C C   . ASN B 2 203 ? 83.604 21.235  -6.731  1.00 30.37 ? 200 ASN H C   1 
ATOM   3168 O O   . ASN B 2 203 ? 82.762 21.487  -5.876  1.00 29.25 ? 200 ASN H O   1 
ATOM   3169 C CB  . ASN B 2 203 ? 85.633 22.322  -5.767  1.00 35.86 ? 200 ASN H CB  1 
ATOM   3170 C CG  . ASN B 2 203 ? 86.585 23.518  -5.838  1.00 38.35 ? 200 ASN H CG  1 
ATOM   3171 O OD1 . ASN B 2 203 ? 86.213 24.649  -5.526  1.00 37.95 ? 200 ASN H OD1 1 
ATOM   3172 N ND2 . ASN B 2 203 ? 87.819 23.266  -6.239  1.00 45.64 ? 200 ASN H ND2 1 
ATOM   3173 N N   . VAL B 2 204 ? 83.572 20.137  -7.477  1.00 34.46 ? 201 VAL H N   1 
ATOM   3174 C CA  . VAL B 2 204 ? 82.520 19.129  -7.341  1.00 33.59 ? 201 VAL H CA  1 
ATOM   3175 C C   . VAL B 2 204 ? 83.135 17.747  -7.127  1.00 35.40 ? 201 VAL H C   1 
ATOM   3176 O O   . VAL B 2 204 ? 84.137 17.403  -7.758  1.00 41.38 ? 201 VAL H O   1 
ATOM   3177 C CB  . VAL B 2 204 ? 81.594 19.112  -8.605  1.00 31.57 ? 201 VAL H CB  1 
ATOM   3178 C CG1 . VAL B 2 204 ? 80.539 18.014  -8.497  1.00 28.33 ? 201 VAL H CG1 1 
ATOM   3179 C CG2 . VAL B 2 204 ? 80.922 20.474  -8.793  1.00 18.62 ? 201 VAL H CG2 1 
ATOM   3180 N N   . ALA B 2 205 ? 82.538 16.965  -6.233  1.00 35.80 ? 202 ALA H N   1 
ATOM   3181 C CA  . ALA B 2 205 ? 83.027 15.623  -5.928  1.00 34.30 ? 202 ALA H CA  1 
ATOM   3182 C C   . ALA B 2 205 ? 81.865 14.655  -5.782  1.00 34.07 ? 202 ALA H C   1 
ATOM   3183 O O   . ALA B 2 205 ? 80.894 14.938  -5.074  1.00 36.02 ? 202 ALA H O   1 
ATOM   3184 C CB  . ALA B 2 205 ? 83.840 15.647  -4.657  1.00 34.71 ? 202 ALA H CB  1 
ATOM   3185 N N   . HIS B 2 206 ? 81.948 13.534  -6.489  1.00 33.93 ? 203 HIS H N   1 
ATOM   3186 C CA  . HIS B 2 206 ? 80.908 12.508  -6.455  1.00 35.23 ? 203 HIS H CA  1 
ATOM   3187 C C   . HIS B 2 206 ? 81.611 11.227  -6.029  1.00 41.08 ? 203 HIS H C   1 
ATOM   3188 O O   . HIS B 2 206 ? 82.093 10.460  -6.860  1.00 42.67 ? 203 HIS H O   1 
ATOM   3189 C CB  . HIS B 2 206 ? 80.270 12.346  -7.840  1.00 31.52 ? 203 HIS H CB  1 
ATOM   3190 C CG  . HIS B 2 206 ? 79.109 11.396  -7.876  1.00 24.05 ? 203 HIS H CG  1 
ATOM   3191 N ND1 . HIS B 2 206 ? 79.168 10.172  -8.507  1.00 24.94 ? 203 HIS H ND1 1 
ATOM   3192 C CD2 . HIS B 2 206 ? 77.854 11.499  -7.383  1.00 25.66 ? 203 HIS H CD2 1 
ATOM   3193 C CE1 . HIS B 2 206 ? 78.002 9.562   -8.400  1.00 23.83 ? 203 HIS H CE1 1 
ATOM   3194 N NE2 . HIS B 2 206 ? 77.186 10.346  -7.723  1.00 20.97 ? 203 HIS H NE2 1 
ATOM   3195 N N   . PRO B 2 207 ? 81.655 10.969  -4.717  1.00 46.06 ? 204 PRO H N   1 
ATOM   3196 C CA  . PRO B 2 207 ? 82.303 9.783   -4.153  1.00 47.25 ? 204 PRO H CA  1 
ATOM   3197 C C   . PRO B 2 207 ? 81.971 8.459   -4.852  1.00 46.47 ? 204 PRO H C   1 
ATOM   3198 O O   . PRO B 2 207 ? 82.875 7.709   -5.221  1.00 46.04 ? 204 PRO H O   1 
ATOM   3199 C CB  . PRO B 2 207 ? 81.846 9.810   -2.686  1.00 49.66 ? 204 PRO H CB  1 
ATOM   3200 C CG  . PRO B 2 207 ? 80.553 10.586  -2.729  1.00 48.29 ? 204 PRO H CG  1 
ATOM   3201 C CD  . PRO B 2 207 ? 80.890 11.688  -3.683  1.00 46.81 ? 204 PRO H CD  1 
ATOM   3202 N N   . ALA B 2 208 ? 80.688 8.219   -5.104  1.00 44.33 ? 205 ALA H N   1 
ATOM   3203 C CA  . ALA B 2 208 ? 80.229 6.986   -5.744  1.00 46.18 ? 205 ALA H CA  1 
ATOM   3204 C C   . ALA B 2 208 ? 80.924 6.604   -7.052  1.00 46.68 ? 205 ALA H C   1 
ATOM   3205 O O   . ALA B 2 208 ? 80.751 5.489   -7.543  1.00 46.30 ? 205 ALA H O   1 
ATOM   3206 C CB  . ALA B 2 208 ? 78.725 7.038   -5.950  1.00 48.27 ? 205 ALA H CB  1 
ATOM   3207 N N   . SER B 2 209 ? 81.689 7.525   -7.622  1.00 46.73 ? 206 SER H N   1 
ATOM   3208 C CA  . SER B 2 209 ? 82.398 7.258   -8.864  1.00 48.16 ? 206 SER H CA  1 
ATOM   3209 C C   . SER B 2 209 ? 83.765 7.939   -8.838  1.00 52.15 ? 206 SER H C   1 
ATOM   3210 O O   . SER B 2 209 ? 84.312 8.288   -9.888  1.00 56.42 ? 206 SER H O   1 
ATOM   3211 C CB  . SER B 2 209 ? 81.575 7.754   -10.064 1.00 45.29 ? 206 SER H CB  1 
ATOM   3212 O OG  . SER B 2 209 ? 81.364 9.159   -10.029 1.00 34.30 ? 206 SER H OG  1 
ATOM   3213 N N   . SER B 2 210 ? 84.296 8.145   -7.634  1.00 52.48 ? 207 SER H N   1 
ATOM   3214 C CA  . SER B 2 210 ? 85.592 8.796   -7.443  1.00 52.57 ? 207 SER H CA  1 
ATOM   3215 C C   . SER B 2 210 ? 85.837 9.962   -8.415  1.00 49.76 ? 207 SER H C   1 
ATOM   3216 O O   . SER B 2 210 ? 86.910 10.084  -9.005  1.00 53.18 ? 207 SER H O   1 
ATOM   3217 C CB  . SER B 2 210 ? 86.707 7.758   -7.539  1.00 55.87 ? 207 SER H CB  1 
ATOM   3218 O OG  . SER B 2 210 ? 86.462 6.856   -8.606  1.00 66.95 ? 207 SER H OG  1 
ATOM   3219 N N   . THR B 2 211 ? 84.829 10.814  -8.562  1.00 44.89 ? 208 THR H N   1 
ATOM   3220 C CA  . THR B 2 211 ? 84.878 11.967  -9.448  1.00 43.01 ? 208 THR H CA  1 
ATOM   3221 C C   . THR B 2 211 ? 85.217 13.257  -8.695  1.00 43.60 ? 208 THR H C   1 
ATOM   3222 O O   . THR B 2 211 ? 84.791 13.452  -7.558  1.00 48.01 ? 208 THR H O   1 
ATOM   3223 C CB  . THR B 2 211 ? 83.502 12.155  -10.124 1.00 44.07 ? 208 THR H CB  1 
ATOM   3224 O OG1 . THR B 2 211 ? 83.116 10.934  -10.769 1.00 41.62 ? 208 THR H OG1 1 
ATOM   3225 C CG2 . THR B 2 211 ? 83.527 13.294  -11.138 1.00 45.87 ? 208 THR H CG2 1 
ATOM   3226 N N   . LYS B 2 212 ? 85.987 14.128  -9.337  1.00 45.05 ? 209 LYS H N   1 
ATOM   3227 C CA  . LYS B 2 212 ? 86.356 15.426  -8.774  1.00 49.85 ? 209 LYS H CA  1 
ATOM   3228 C C   . LYS B 2 212 ? 86.677 16.368  -9.937  1.00 51.86 ? 209 LYS H C   1 
ATOM   3229 O O   . LYS B 2 212 ? 87.583 16.103  -10.728 1.00 54.24 ? 209 LYS H O   1 
ATOM   3230 C CB  . LYS B 2 212 ? 87.560 15.316  -7.838  1.00 49.20 ? 209 LYS H CB  1 
ATOM   3231 C CG  . LYS B 2 212 ? 88.061 16.671  -7.338  1.00 50.36 ? 209 LYS H CG  1 
ATOM   3232 C CD  . LYS B 2 212 ? 87.008 17.371  -6.497  1.00 51.55 ? 209 LYS H CD  1 
ATOM   3233 C CE  . LYS B 2 212 ? 87.478 18.739  -6.025  1.00 55.68 ? 209 LYS H CE  1 
ATOM   3234 N NZ  . LYS B 2 212 ? 87.520 19.745  -7.120  1.00 55.32 ? 209 LYS H NZ  1 
ATOM   3235 N N   . VAL B 2 213 ? 85.918 17.454  -10.050 1.00 51.05 ? 210 VAL H N   1 
ATOM   3236 C CA  . VAL B 2 213 ? 86.116 18.402  -11.135 1.00 50.38 ? 210 VAL H CA  1 
ATOM   3237 C C   . VAL B 2 213 ? 86.215 19.831  -10.613 1.00 52.45 ? 210 VAL H C   1 
ATOM   3238 O O   . VAL B 2 213 ? 85.388 20.259  -9.806  1.00 52.24 ? 210 VAL H O   1 
ATOM   3239 C CB  . VAL B 2 213 ? 84.929 18.368  -12.137 1.00 52.26 ? 210 VAL H CB  1 
ATOM   3240 C CG1 . VAL B 2 213 ? 85.332 19.031  -13.444 1.00 53.09 ? 210 VAL H CG1 1 
ATOM   3241 C CG2 . VAL B 2 213 ? 84.432 16.945  -12.365 1.00 47.61 ? 210 VAL H CG2 1 
ATOM   3242 N N   . ASP B 2 214 ? 87.232 20.558  -11.066 1.00 52.88 ? 211 ASP H N   1 
ATOM   3243 C CA  . ASP B 2 214 ? 87.419 21.953  -10.685 1.00 55.04 ? 211 ASP H CA  1 
ATOM   3244 C C   . ASP B 2 214 ? 86.994 22.758  -11.901 1.00 58.10 ? 211 ASP H C   1 
ATOM   3245 O O   . ASP B 2 214 ? 87.756 22.893  -12.859 1.00 65.12 ? 211 ASP H O   1 
ATOM   3246 C CB  . ASP B 2 214 ? 88.886 22.262  -10.397 1.00 56.94 ? 211 ASP H CB  1 
ATOM   3247 C CG  . ASP B 2 214 ? 89.475 21.374  -9.338  1.00 58.31 ? 211 ASP H CG  1 
ATOM   3248 O OD1 . ASP B 2 214 ? 89.140 21.565  -8.154  1.00 60.80 ? 211 ASP H OD1 1 
ATOM   3249 O OD2 . ASP B 2 214 ? 90.286 20.494  -9.692  1.00 62.71 ? 211 ASP H OD2 1 
ATOM   3250 N N   . LYS B 2 215 ? 85.765 23.251  -11.889 1.00 57.48 ? 212 LYS H N   1 
ATOM   3251 C CA  . LYS B 2 215 ? 85.251 24.025  -13.005 1.00 53.89 ? 212 LYS H CA  1 
ATOM   3252 C C   . LYS B 2 215 ? 85.369 25.534  -12.764 1.00 52.86 ? 212 LYS H C   1 
ATOM   3253 O O   . LYS B 2 215 ? 84.574 26.126  -12.037 1.00 51.45 ? 212 LYS H O   1 
ATOM   3254 C CB  . LYS B 2 215 ? 83.797 23.620  -13.269 1.00 55.28 ? 212 LYS H CB  1 
ATOM   3255 C CG  . LYS B 2 215 ? 83.299 23.913  -14.668 1.00 54.02 ? 212 LYS H CG  1 
ATOM   3256 C CD  . LYS B 2 215 ? 84.138 23.205  -15.716 1.00 56.05 ? 212 LYS H CD  1 
ATOM   3257 C CE  . LYS B 2 215 ? 84.036 21.696  -15.603 1.00 57.11 ? 212 LYS H CE  1 
ATOM   3258 N NZ  . LYS B 2 215 ? 85.107 21.026  -16.393 1.00 57.87 ? 212 LYS H NZ  1 
ATOM   3259 N N   . LYS B 2 216 ? 86.394 26.144  -13.347 1.00 54.51 ? 213 LYS H N   1 
ATOM   3260 C CA  . LYS B 2 216 ? 86.611 27.581  -13.214 1.00 54.77 ? 213 LYS H CA  1 
ATOM   3261 C C   . LYS B 2 216 ? 85.550 28.334  -14.011 1.00 57.04 ? 213 LYS H C   1 
ATOM   3262 O O   . LYS B 2 216 ? 85.405 28.125  -15.223 1.00 56.53 ? 213 LYS H O   1 
ATOM   3263 C CB  . LYS B 2 216 ? 87.996 27.967  -13.743 1.00 54.54 ? 213 LYS H CB  1 
ATOM   3264 C CG  . LYS B 2 216 ? 88.225 29.473  -13.810 1.00 59.82 ? 213 LYS H CG  1 
ATOM   3265 C CD  . LYS B 2 216 ? 89.420 29.843  -14.673 1.00 60.58 ? 213 LYS H CD  1 
ATOM   3266 C CE  . LYS B 2 216 ? 89.190 29.452  -16.123 1.00 66.78 ? 213 LYS H CE  1 
ATOM   3267 N NZ  . LYS B 2 216 ? 90.252 29.965  -17.036 1.00 71.59 ? 213 LYS H NZ  1 
ATOM   3268 N N   . ILE B 2 217 ? 84.798 29.195  -13.334 1.00 58.44 ? 214 ILE H N   1 
ATOM   3269 C CA  . ILE B 2 217 ? 83.769 29.981  -14.004 1.00 58.43 ? 214 ILE H CA  1 
ATOM   3270 C C   . ILE B 2 217 ? 84.518 31.089  -14.728 1.00 61.79 ? 214 ILE H C   1 
ATOM   3271 O O   . ILE B 2 217 ? 84.879 32.103  -14.126 1.00 65.30 ? 214 ILE H O   1 
ATOM   3272 C CB  . ILE B 2 217 ? 82.770 30.621  -13.005 1.00 56.42 ? 214 ILE H CB  1 
ATOM   3273 C CG1 . ILE B 2 217 ? 82.200 29.562  -12.053 1.00 51.62 ? 214 ILE H CG1 1 
ATOM   3274 C CG2 . ILE B 2 217 ? 81.663 31.356  -13.762 1.00 52.62 ? 214 ILE H CG2 1 
ATOM   3275 C CD1 . ILE B 2 217 ? 81.596 28.351  -12.731 1.00 48.00 ? 214 ILE H CD1 1 
ATOM   3276 N N   . VAL B 2 218 ? 84.820 30.856  -16.000 1.00 62.62 ? 215 VAL H N   1 
ATOM   3277 C CA  . VAL B 2 218 ? 85.542 31.832  -16.804 1.00 61.27 ? 215 VAL H CA  1 
ATOM   3278 C C   . VAL B 2 218 ? 84.611 32.510  -17.800 1.00 61.29 ? 215 VAL H C   1 
ATOM   3279 O O   . VAL B 2 218 ? 83.684 31.882  -18.315 1.00 60.17 ? 215 VAL H O   1 
ATOM   3280 C CB  . VAL B 2 218 ? 86.731 31.173  -17.554 1.00 60.35 ? 215 VAL H CB  1 
ATOM   3281 C CG1 . VAL B 2 218 ? 86.248 30.019  -18.428 1.00 57.73 ? 215 VAL H CG1 1 
ATOM   3282 C CG2 . VAL B 2 218 ? 87.482 32.205  -18.384 1.00 61.65 ? 215 VAL H CG2 1 
ATOM   3283 N N   . ASN B 2 219 ? 84.853 33.800  -18.017 1.00 62.03 ? 216 ASN H N   1 
ATOM   3284 C CA  . ASN B 2 219 ? 84.106 34.647  -18.946 1.00 66.13 ? 216 ASN H CA  1 
ATOM   3285 C C   . ASN B 2 219 ? 84.306 36.067  -18.422 1.00 67.72 ? 216 ASN H C   1 
ATOM   3286 O O   . ASN B 2 219 ? 83.312 36.793  -18.204 1.00 70.55 ? 216 ASN H O   1 
ATOM   3287 C CB  . ASN B 2 219 ? 82.612 34.290  -18.981 1.00 69.38 ? 216 ASN H CB  1 
ATOM   3288 C CG  . ASN B 2 219 ? 81.910 34.811  -20.229 1.00 71.67 ? 216 ASN H CG  1 
ATOM   3289 O OD1 . ASN B 2 219 ? 81.732 34.083  -21.208 1.00 72.28 ? 216 ASN H OD1 1 
ATOM   3290 N ND2 . ASN B 2 219 ? 81.491 36.067  -20.192 1.00 76.54 ? 216 ASN H ND2 1 
ATOM   3291 O OXT . ASN B 2 219 ? 85.479 36.415  -18.179 1.00 69.57 ? 216 ASN H OXT 1 
ATOM   3292 N N   . CYS C 3 1   ? 70.001 -6.893  34.144  1.00 53.54 ? 1   CYS P N   1 
ATOM   3293 C CA  . CYS C 3 1   ? 70.711 -6.469  32.944  1.00 51.95 ? 1   CYS P CA  1 
ATOM   3294 C C   . CYS C 3 1   ? 70.103 -7.128  31.709  1.00 55.68 ? 1   CYS P C   1 
ATOM   3295 O O   . CYS C 3 1   ? 70.716 -7.159  30.634  1.00 56.91 ? 1   CYS P O   1 
ATOM   3296 C CB  . CYS C 3 1   ? 72.194 -6.820  33.067  1.00 48.67 ? 1   CYS P CB  1 
ATOM   3297 S SG  . CYS C 3 1   ? 72.510 -8.547  33.546  1.00 33.67 ? 1   CYS P SG  1 
ATOM   3298 N N   . LYS C 3 2   ? 68.907 -7.684  31.885  1.00 56.93 ? 2   LYS P N   1 
ATOM   3299 C CA  . LYS C 3 2   ? 68.190 -8.348  30.801  1.00 58.85 ? 2   LYS P CA  1 
ATOM   3300 C C   . LYS C 3 2   ? 67.174 -7.366  30.221  1.00 57.94 ? 2   LYS P C   1 
ATOM   3301 O O   . LYS C 3 2   ? 66.857 -7.400  29.028  1.00 55.78 ? 2   LYS P O   1 
ATOM   3302 C CB  . LYS C 3 2   ? 67.436 -9.581  31.324  1.00 61.34 ? 2   LYS P CB  1 
ATOM   3303 C CG  . LYS C 3 2   ? 68.241 -10.524 32.204  1.00 66.37 ? 2   LYS P CG  1 
ATOM   3304 C CD  . LYS C 3 2   ? 69.387 -11.170 31.444  1.00 73.44 ? 2   LYS P CD  1 
ATOM   3305 C CE  . LYS C 3 2   ? 70.245 -12.030 32.368  1.00 75.15 ? 2   LYS P CE  1 
ATOM   3306 N NZ  . LYS C 3 2   ? 71.457 -12.550 31.675  1.00 78.27 ? 2   LYS P NZ  1 
ATOM   3307 N N   . GLU C 3 3   ? 66.667 -6.494  31.083  1.00 55.32 ? 3   GLU P N   1 
ATOM   3308 C CA  . GLU C 3 3   ? 65.667 -5.524  30.687  1.00 54.34 ? 3   GLU P CA  1 
ATOM   3309 C C   . GLU C 3 3   ? 66.267 -4.265  30.062  1.00 50.73 ? 3   GLU P C   1 
ATOM   3310 O O   . GLU C 3 3   ? 67.306 -3.771  30.489  1.00 43.60 ? 3   GLU P O   1 
ATOM   3311 C CB  . GLU C 3 3   ? 64.783 -5.169  31.890  1.00 60.61 ? 3   GLU P CB  1 
ATOM   3312 C CG  . GLU C 3 3   ? 63.562 -4.319  31.552  1.00 73.89 ? 3   GLU P CG  1 
ATOM   3313 C CD  . GLU C 3 3   ? 62.740 -3.939  32.779  1.00 80.05 ? 3   GLU P CD  1 
ATOM   3314 O OE1 . GLU C 3 3   ? 61.571 -4.377  32.867  1.00 81.67 ? 3   GLU P OE1 1 
ATOM   3315 O OE2 . GLU C 3 3   ? 63.257 -3.193  33.646  1.00 82.03 ? 3   GLU P OE2 1 
ATOM   3316 N N   . TRP C 3 4   ? 65.575 -3.759  29.046  1.00 50.00 ? 4   TRP P N   1 
ATOM   3317 C CA  . TRP C 3 4   ? 65.952 -2.552  28.311  1.00 48.20 ? 4   TRP P CA  1 
ATOM   3318 C C   . TRP C 3 4   ? 66.266 -1.387  29.259  1.00 47.25 ? 4   TRP P C   1 
ATOM   3319 O O   . TRP C 3 4   ? 67.220 -0.633  29.054  1.00 41.67 ? 4   TRP P O   1 
ATOM   3320 C CB  . TRP C 3 4   ? 64.785 -2.168  27.382  1.00 45.30 ? 4   TRP P CB  1 
ATOM   3321 C CG  . TRP C 3 4   ? 64.896 -0.812  26.755  1.00 42.94 ? 4   TRP P CG  1 
ATOM   3322 C CD1 . TRP C 3 4   ? 64.338 0.354   27.203  1.00 45.40 ? 4   TRP P CD1 1 
ATOM   3323 C CD2 . TRP C 3 4   ? 65.621 -0.480  25.572  1.00 42.28 ? 4   TRP P CD2 1 
ATOM   3324 N NE1 . TRP C 3 4   ? 64.677 1.393   26.369  1.00 39.40 ? 4   TRP P NE1 1 
ATOM   3325 C CE2 . TRP C 3 4   ? 65.465 0.909   25.361  1.00 40.79 ? 4   TRP P CE2 1 
ATOM   3326 C CE3 . TRP C 3 4   ? 66.388 -1.222  24.666  1.00 43.56 ? 4   TRP P CE3 1 
ATOM   3327 C CZ2 . TRP C 3 4   ? 66.050 1.569   24.283  1.00 40.48 ? 4   TRP P CZ2 1 
ATOM   3328 C CZ3 . TRP C 3 4   ? 66.967 -0.565  23.593  1.00 44.99 ? 4   TRP P CZ3 1 
ATOM   3329 C CH2 . TRP C 3 4   ? 66.796 0.818   23.411  1.00 39.10 ? 4   TRP P CH2 1 
ATOM   3330 N N   . LEU C 3 5   ? 65.429 -1.243  30.282  1.00 46.90 ? 5   LEU P N   1 
ATOM   3331 C CA  . LEU C 3 5   ? 65.563 -0.180  31.261  1.00 46.40 ? 5   LEU P CA  1 
ATOM   3332 C C   . LEU C 3 5   ? 66.668 -0.391  32.300  1.00 49.18 ? 5   LEU P C   1 
ATOM   3333 O O   . LEU C 3 5   ? 66.929 0.500   33.113  1.00 50.65 ? 5   LEU P O   1 
ATOM   3334 C CB  . LEU C 3 5   ? 64.215 0.047   31.946  1.00 45.33 ? 5   LEU P CB  1 
ATOM   3335 C CG  . LEU C 3 5   ? 63.126 0.744   31.121  1.00 43.70 ? 5   LEU P CG  1 
ATOM   3336 C CD1 . LEU C 3 5   ? 61.761 0.504   31.738  1.00 38.63 ? 5   LEU P CD1 1 
ATOM   3337 C CD2 . LEU C 3 5   ? 63.414 2.246   31.017  1.00 42.60 ? 5   LEU P CD2 1 
ATOM   3338 N N   . SER C 3 6   ? 67.326 -1.549  32.269  1.00 50.43 ? 6   SER P N   1 
ATOM   3339 C CA  . SER C 3 6   ? 68.402 -1.843  33.217  1.00 53.17 ? 6   SER P CA  1 
ATOM   3340 C C   . SER C 3 6   ? 69.451 -0.738  33.239  1.00 53.09 ? 6   SER P C   1 
ATOM   3341 O O   . SER C 3 6   ? 69.603 0.012   32.275  1.00 51.65 ? 6   SER P O   1 
ATOM   3342 C CB  . SER C 3 6   ? 69.089 -3.178  32.890  1.00 52.00 ? 6   SER P CB  1 
ATOM   3343 O OG  . SER C 3 6   ? 68.235 -4.287  33.130  1.00 57.20 ? 6   SER P OG  1 
ATOM   3344 N N   . THR C 3 7   ? 70.146 -0.627  34.364  1.00 56.67 ? 7   THR P N   1 
ATOM   3345 C CA  . THR C 3 7   ? 71.195 0.371   34.530  1.00 57.62 ? 7   THR P CA  1 
ATOM   3346 C C   . THR C 3 7   ? 72.244 -0.175  35.493  1.00 56.36 ? 7   THR P C   1 
ATOM   3347 O O   . THR C 3 7   ? 73.370 0.314   35.551  1.00 58.47 ? 7   THR P O   1 
ATOM   3348 C CB  . THR C 3 7   ? 70.634 1.714   35.042  1.00 59.01 ? 7   THR P CB  1 
ATOM   3349 O OG1 . THR C 3 7   ? 71.637 2.728   34.916  1.00 64.02 ? 7   THR P OG1 1 
ATOM   3350 C CG2 . THR C 3 7   ? 70.208 1.604   36.503  1.00 62.74 ? 7   THR P CG2 1 
ATOM   3351 N N   . ALA C 3 8   ? 71.857 -1.204  36.240  1.00 54.28 ? 8   ALA P N   1 
ATOM   3352 C CA  . ALA C 3 8   ? 72.750 -1.858  37.179  1.00 54.53 ? 8   ALA P CA  1 
ATOM   3353 C C   . ALA C 3 8   ? 73.402 -2.990  36.386  1.00 54.76 ? 8   ALA P C   1 
ATOM   3354 O O   . ALA C 3 8   ? 72.701 -3.845  35.846  1.00 56.11 ? 8   ALA P O   1 
ATOM   3355 C CB  . ALA C 3 8   ? 71.949 -2.417  38.350  1.00 57.13 ? 8   ALA P CB  1 
ATOM   3356 N N   . PRO C 3 9   ? 74.742 -2.976  36.258  1.00 54.13 ? 9   PRO P N   1 
ATOM   3357 C CA  . PRO C 3 9   ? 75.500 -3.993  35.522  1.00 54.35 ? 9   PRO P CA  1 
ATOM   3358 C C   . PRO C 3 9   ? 75.303 -5.411  36.038  1.00 56.82 ? 9   PRO P C   1 
ATOM   3359 O O   . PRO C 3 9   ? 74.412 -5.675  36.844  1.00 56.81 ? 9   PRO P O   1 
ATOM   3360 C CB  . PRO C 3 9   ? 76.947 -3.542  35.710  1.00 52.41 ? 9   PRO P CB  1 
ATOM   3361 C CG  . PRO C 3 9   ? 76.824 -2.073  35.835  1.00 53.42 ? 9   PRO P CG  1 
ATOM   3362 C CD  . PRO C 3 9   ? 75.649 -1.934  36.765  1.00 54.44 ? 9   PRO P CD  1 
ATOM   3363 N N   . CYS C 3 10  ? 76.152 -6.315  35.561  1.00 61.63 ? 10  CYS P N   1 
ATOM   3364 C CA  . CYS C 3 10  ? 76.114 -7.721  35.940  1.00 64.68 ? 10  CYS P CA  1 
ATOM   3365 C C   . CYS C 3 10  ? 77.281 -8.454  35.273  1.00 73.31 ? 10  CYS P C   1 
ATOM   3366 O O   . CYS C 3 10  ? 78.368 -7.885  35.104  1.00 76.92 ? 10  CYS P O   1 
ATOM   3367 C CB  . CYS C 3 10  ? 74.780 -8.358  35.521  1.00 59.42 ? 10  CYS P CB  1 
ATOM   3368 S SG  . CYS C 3 10  ? 74.527 -8.611  33.731  1.00 46.00 ? 10  CYS P SG  1 
ATOM   3369 N N   . GLY C 3 11  ? 77.050 -9.712  34.907  1.00 77.49 ? 11  GLY P N   1 
ATOM   3370 C CA  . GLY C 3 11  ? 78.065 -10.518 34.260  1.00 80.51 ? 11  GLY P CA  1 
ATOM   3371 C C   . GLY C 3 11  ? 77.609 -11.965 34.228  1.00 82.47 ? 11  GLY P C   1 
ATOM   3372 O O   . GLY C 3 11  ? 76.747 -12.334 35.051  1.00 87.32 ? 11  GLY P O   1 
ATOM   3373 O OXT . GLY C 3 11  ? 78.098 -12.736 33.382  1.00 81.56 ? 11  GLY P OXT 1 
HETATM 3374 O O   . HOH D 4 .   ? 56.706 18.667  18.738  1.00 17.53 ? 211 HOH L O   1 
HETATM 3375 O O   . HOH D 4 .   ? 56.632 28.239  -9.256  1.00 30.80 ? 212 HOH L O   1 
HETATM 3376 O O   . HOH D 4 .   ? 64.104 15.516  34.974  1.00 29.39 ? 213 HOH L O   1 
HETATM 3377 O O   . HOH D 4 .   ? 66.927 23.676  -10.241 1.00 33.92 ? 214 HOH L O   1 
HETATM 3378 O O   . HOH D 4 .   ? 73.069 26.780  -17.981 1.00 39.15 ? 215 HOH L O   1 
HETATM 3379 O O   . HOH D 4 .   ? 74.718 24.517  -18.974 1.00 32.73 ? 216 HOH L O   1 
HETATM 3380 O O   . HOH D 4 .   ? 59.137 17.258  28.241  1.00 31.83 ? 217 HOH L O   1 
HETATM 3381 O O   . HOH D 4 .   ? 63.814 22.061  31.419  1.00 20.69 ? 218 HOH L O   1 
HETATM 3382 O O   . HOH D 4 .   ? 72.678 32.045  -26.057 1.00 40.67 ? 219 HOH L O   1 
HETATM 3383 O O   . HOH D 4 .   ? 60.730 16.437  35.060  1.00 56.59 ? 220 HOH L O   1 
HETATM 3384 O O   . HOH D 4 .   ? 63.734 13.972  37.190  1.00 25.56 ? 221 HOH L O   1 
HETATM 3385 O O   . HOH D 4 .   ? 61.639 12.697  34.644  1.00 27.11 ? 222 HOH L O   1 
HETATM 3386 O O   . HOH D 4 .   ? 57.407 32.448  4.905   1.00 36.42 ? 223 HOH L O   1 
HETATM 3387 O O   . HOH D 4 .   ? 59.187 20.309  34.730  1.00 53.47 ? 224 HOH L O   1 
HETATM 3388 O O   . HOH D 4 .   ? 71.350 32.067  24.146  1.00 55.86 ? 225 HOH L O   1 
HETATM 3389 O O   . HOH D 4 .   ? 63.249 16.626  37.282  1.00 16.88 ? 226 HOH L O   1 
HETATM 3390 O O   . HOH D 4 .   ? 60.894 22.173  33.527  1.00 38.31 ? 227 HOH L O   1 
HETATM 3391 O O   . HOH D 4 .   ? 71.899 27.270  12.965  1.00 31.67 ? 228 HOH L O   1 
HETATM 3392 O O   . HOH D 4 .   ? 57.972 17.613  34.132  1.00 42.55 ? 229 HOH L O   1 
HETATM 3393 O O   . HOH D 4 .   ? 55.917 24.289  -14.141 1.00 45.81 ? 230 HOH L O   1 
HETATM 3394 O O   . HOH D 4 .   ? 58.783 31.420  7.362   1.00 45.85 ? 231 HOH L O   1 
HETATM 3395 O O   . HOH D 4 .   ? 65.206 10.294  28.951  1.00 37.09 ? 232 HOH L O   1 
HETATM 3396 O O   . HOH D 4 .   ? 60.788 10.516  13.126  1.00 39.56 ? 233 HOH L O   1 
HETATM 3397 O O   . HOH D 4 .   ? 60.641 28.946  29.669  1.00 59.34 ? 234 HOH L O   1 
HETATM 3398 O O   . HOH D 4 .   ? 51.353 33.684  -17.928 1.00 49.76 ? 235 HOH L O   1 
HETATM 3399 O O   . HOH D 4 .   ? 57.668 27.115  -12.446 1.00 36.49 ? 236 HOH L O   1 
HETATM 3400 O O   . HOH D 4 .   ? 61.707 20.524  36.158  1.00 35.00 ? 237 HOH L O   1 
HETATM 3401 O O   . HOH E 4 .   ? 63.269 -1.513  6.696   1.00 45.19 ? 217 HOH H O   1 
HETATM 3402 O O   . HOH E 4 .   ? 68.532 21.552  -7.809  1.00 39.23 ? 218 HOH H O   1 
HETATM 3403 O O   . HOH E 4 .   ? 80.997 9.597   7.578   1.00 27.02 ? 219 HOH H O   1 
HETATM 3404 O O   . HOH E 4 .   ? 71.419 3.230   24.619  1.00 37.39 ? 220 HOH H O   1 
HETATM 3405 O O   . HOH E 4 .   ? 62.454 4.879   15.714  1.00 24.99 ? 221 HOH H O   1 
HETATM 3406 O O   . HOH E 4 .   ? 70.940 8.003   -3.941  1.00 56.65 ? 222 HOH H O   1 
HETATM 3407 O O   . HOH E 4 .   ? 74.202 6.868   -1.365  1.00 19.98 ? 223 HOH H O   1 
HETATM 3408 O O   . HOH E 4 .   ? 78.242 -6.534  12.781  1.00 21.99 ? 224 HOH H O   1 
HETATM 3409 O O   . HOH E 4 .   ? 79.492 2.731   -7.038  1.00 51.66 ? 225 HOH H O   1 
HETATM 3410 O O   . HOH E 4 .   ? 84.484 -6.304  21.811  1.00 32.53 ? 226 HOH H O   1 
HETATM 3411 O O   . HOH E 4 .   ? 83.232 -8.268  20.327  1.00 41.76 ? 227 HOH H O   1 
HETATM 3412 O O   . HOH E 4 .   ? 86.878 -12.533 32.726  1.00 60.32 ? 228 HOH H O   1 
HETATM 3413 O O   . HOH E 4 .   ? 81.803 -2.920  26.307  1.00 21.74 ? 229 HOH H O   1 
HETATM 3414 O O   . HOH E 4 .   ? 89.608 7.509   28.096  1.00 55.78 ? 230 HOH H O   1 
HETATM 3415 O O   . HOH E 4 .   ? 65.288 4.433   5.946   1.00 33.33 ? 231 HOH H O   1 
HETATM 3416 O O   . HOH E 4 .   ? 79.000 -8.783  19.570  1.00 54.67 ? 232 HOH H O   1 
HETATM 3417 O O   . HOH E 4 .   ? 72.428 11.698  28.169  1.00 51.84 ? 233 HOH H O   1 
HETATM 3418 O O   . HOH E 4 .   ? 75.501 -0.566  28.726  1.00 30.39 ? 234 HOH H O   1 
HETATM 3419 O O   . HOH E 4 .   ? 69.727 -5.187  28.957  1.00 39.27 ? 235 HOH H O   1 
HETATM 3420 O O   . HOH F 4 .   ? 72.537 -8.644  29.546  1.00 20.23 ? 12  HOH P O   1 
HETATM 3421 O O   . HOH F 4 .   ? 68.775 1.657   29.888  1.00 42.62 ? 13  HOH P O   1 
HETATM 3422 O O   . HOH F 4 .   ? 69.228 -8.440  27.647  1.00 29.62 ? 14  HOH P O   1 
HETATM 3423 O O   . HOH F 4 .   ? 70.970 -10.504 27.872  1.00 23.65 ? 15  HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP L . n 
A 1 2   ILE 2   2   2   ILE ILE L . n 
A 1 3   GLN 3   3   3   GLN GLN L . n 
A 1 4   LEU 4   4   4   LEU LEU L . n 
A 1 5   THR 5   5   5   THR THR L . n 
A 1 6   GLN 6   6   6   GLN GLN L . n 
A 1 7   SER 7   7   7   SER SER L . n 
A 1 8   PRO 8   8   8   PRO PRO L . n 
A 1 9   SER 9   9   9   SER SER L . n 
A 1 10  SER 10  10  10  SER SER L . n 
A 1 11  LEU 11  11  11  LEU LEU L . n 
A 1 12  ALA 12  12  12  ALA ALA L . n 
A 1 13  VAL 13  13  13  VAL VAL L . n 
A 1 14  SER 14  14  14  SER SER L . n 
A 1 15  ALA 15  15  15  ALA ALA L . n 
A 1 16  GLY 16  16  16  GLY GLY L . n 
A 1 17  GLU 17  17  17  GLU GLU L . n 
A 1 18  LYS 18  18  18  LYS LYS L . n 
A 1 19  VAL 19  19  19  VAL VAL L . n 
A 1 20  THR 20  20  20  THR THR L . n 
A 1 21  MET 21  21  21  MET MET L . n 
A 1 22  ASN 22  22  22  ASN ASN L . n 
A 1 23  CYS 23  23  23  CYS CYS L . n 
A 1 24  LYS 24  24  24  LYS LYS L . n 
A 1 25  SER 25  25  25  SER SER L . n 
A 1 26  SER 26  26  26  SER SER L . n 
A 1 27  GLN 27  27  27  GLN GLN L . n 
A 1 28  ASN 28  28  28  ASN ASN L . n 
A 1 29  LEU 29  29  29  LEU LEU L . n 
A 1 30  LEU 30  30  30  LEU LEU L . n 
A 1 31  HIS 31  31  31  HIS HIS L . n 
A 1 32  SER 32  31  31  SER SER L A n 
A 1 33  ILE 33  31  31  ILE ILE L B n 
A 1 34  THR 34  31  31  THR THR L C n 
A 1 35  ARG 35  31  31  ARG ARG L D n 
A 1 36  LYS 36  31  31  LYS LYS L E n 
A 1 37  ASN 37  31  31  ASN ASN L F n 
A 1 38  TYR 38  32  32  TYR TYR L . n 
A 1 39  LEU 39  33  33  LEU LEU L . n 
A 1 40  ALA 40  34  34  ALA ALA L . n 
A 1 41  TRP 41  35  35  TRP TRP L . n 
A 1 42  TYR 42  36  36  TYR TYR L . n 
A 1 43  ARG 43  37  37  ARG ARG L . n 
A 1 44  GLN 44  38  38  GLN GLN L . n 
A 1 45  LYS 45  39  39  LYS LYS L . n 
A 1 46  PRO 46  40  40  PRO PRO L . n 
A 1 47  GLY 47  41  41  GLY GLY L . n 
A 1 48  GLN 48  42  42  GLN GLN L . n 
A 1 49  SER 49  43  43  SER SER L . n 
A 1 50  PRO 50  44  44  PRO PRO L . n 
A 1 51  LYS 51  45  45  LYS LYS L . n 
A 1 52  LEU 52  46  46  LEU LEU L . n 
A 1 53  LEU 53  47  47  LEU LEU L . n 
A 1 54  ILE 54  48  48  ILE ILE L . n 
A 1 55  TYR 55  49  49  TYR TYR L . n 
A 1 56  TRP 56  50  50  TRP TRP L . n 
A 1 57  ALA 57  51  51  ALA ALA L . n 
A 1 58  SER 58  52  52  SER SER L . n 
A 1 59  THR 59  53  53  THR THR L . n 
A 1 60  ARG 60  54  54  ARG ARG L . n 
A 1 61  GLY 61  55  55  GLY GLY L . n 
A 1 62  SER 62  56  56  SER SER L . n 
A 1 63  GLY 63  57  57  GLY GLY L . n 
A 1 64  VAL 64  58  58  VAL VAL L . n 
A 1 65  PRO 65  59  59  PRO PRO L . n 
A 1 66  ASP 66  60  60  ASP ASP L . n 
A 1 67  ARG 67  61  61  ARG ARG L . n 
A 1 68  PHE 68  62  62  PHE PHE L . n 
A 1 69  THR 69  63  63  THR THR L . n 
A 1 70  GLY 70  64  64  GLY GLY L . n 
A 1 71  SER 71  65  65  SER SER L . n 
A 1 72  GLY 72  66  66  GLY GLY L . n 
A 1 73  SER 73  67  67  SER SER L . n 
A 1 74  GLY 74  68  68  GLY GLY L . n 
A 1 75  THR 75  69  69  THR THR L . n 
A 1 76  ASP 76  70  70  ASP ASP L . n 
A 1 77  PHE 77  71  71  PHE PHE L . n 
A 1 78  THR 78  72  72  THR THR L . n 
A 1 79  LEU 79  73  73  LEU LEU L . n 
A 1 80  THR 80  74  74  THR THR L . n 
A 1 81  ILE 81  75  75  ILE ILE L . n 
A 1 82  SER 82  76  76  SER SER L . n 
A 1 83  SER 83  77  77  SER SER L . n 
A 1 84  VAL 84  78  78  VAL VAL L . n 
A 1 85  GLN 85  79  79  GLN GLN L . n 
A 1 86  ALA 86  80  80  ALA ALA L . n 
A 1 87  GLU 87  81  81  GLU GLU L . n 
A 1 88  ASP 88  82  82  ASP ASP L . n 
A 1 89  LEU 89  83  83  LEU LEU L . n 
A 1 90  ALA 90  84  84  ALA ALA L . n 
A 1 91  VAL 91  85  85  VAL VAL L . n 
A 1 92  TYR 92  86  86  TYR TYR L . n 
A 1 93  TYR 93  87  87  TYR TYR L . n 
A 1 94  CYS 94  88  88  CYS CYS L . n 
A 1 95  LYS 95  89  89  LYS LYS L . n 
A 1 96  GLN 96  90  90  GLN GLN L . n 
A 1 97  SER 97  91  91  SER SER L . n 
A 1 98  TYR 98  92  92  TYR TYR L . n 
A 1 99  ASN 99  93  93  ASN ASN L . n 
A 1 100 LEU 100 94  94  LEU LEU L . n 
A 1 101 TYR 101 95  95  TYR TYR L . n 
A 1 102 THR 102 96  96  THR THR L . n 
A 1 103 PHE 103 97  97  PHE PHE L . n 
A 1 104 GLY 104 98  98  GLY GLY L . n 
A 1 105 GLY 105 99  99  GLY GLY L . n 
A 1 106 GLY 106 100 100 GLY GLY L . n 
A 1 107 THR 107 101 101 THR THR L . n 
A 1 108 LYS 108 102 102 LYS LYS L . n 
A 1 109 LEU 109 103 103 LEU LEU L . n 
A 1 110 GLU 110 104 104 GLU GLU L . n 
A 1 111 ILE 111 105 105 ILE ILE L . n 
A 1 112 LYS 112 106 106 LYS LYS L . n 
A 1 113 ARG 113 107 107 ARG ARG L . n 
A 1 114 ALA 114 108 108 ALA ALA L . n 
A 1 115 ASP 115 109 109 ASP ASP L . n 
A 1 116 ALA 116 110 110 ALA ALA L . n 
A 1 117 ALA 117 111 111 ALA ALA L . n 
A 1 118 PRO 118 112 112 PRO PRO L . n 
A 1 119 THR 119 113 113 THR THR L . n 
A 1 120 VAL 120 114 114 VAL VAL L . n 
A 1 121 SER 121 115 115 SER SER L . n 
A 1 122 ILE 122 116 116 ILE ILE L . n 
A 1 123 PHE 123 117 117 PHE PHE L . n 
A 1 124 PRO 124 118 118 PRO PRO L . n 
A 1 125 PRO 125 119 119 PRO PRO L . n 
A 1 126 SER 126 120 120 SER SER L . n 
A 1 127 SER 127 121 121 SER SER L . n 
A 1 128 GLU 128 122 122 GLU GLU L . n 
A 1 129 GLN 129 123 123 GLN GLN L . n 
A 1 130 LEU 130 124 124 LEU LEU L . n 
A 1 131 THR 131 125 125 THR THR L . n 
A 1 132 SER 132 126 126 SER SER L . n 
A 1 133 GLY 133 127 127 GLY GLY L . n 
A 1 134 GLY 134 128 128 GLY GLY L . n 
A 1 135 ALA 135 129 129 ALA ALA L . n 
A 1 136 SER 136 130 130 SER SER L . n 
A 1 137 VAL 137 131 131 VAL VAL L . n 
A 1 138 VAL 138 132 132 VAL VAL L . n 
A 1 139 CYS 139 133 133 CYS CYS L . n 
A 1 140 PHE 140 134 134 PHE PHE L . n 
A 1 141 LEU 141 135 135 LEU LEU L . n 
A 1 142 ASN 142 136 136 ASN ASN L . n 
A 1 143 ASN 143 137 137 ASN ASN L . n 
A 1 144 PHE 144 138 138 PHE PHE L . n 
A 1 145 TYR 145 139 139 TYR TYR L . n 
A 1 146 PRO 146 140 140 PRO PRO L . n 
A 1 147 LYS 147 141 141 LYS LYS L . n 
A 1 148 ASP 148 142 142 ASP ASP L . n 
A 1 149 ILE 149 143 143 ILE ILE L . n 
A 1 150 ASN 150 144 144 ASN ASN L . n 
A 1 151 VAL 151 145 145 VAL VAL L . n 
A 1 152 LYS 152 146 146 LYS LYS L . n 
A 1 153 TRP 153 147 147 TRP TRP L . n 
A 1 154 LYS 154 148 148 LYS LYS L . n 
A 1 155 ILE 155 149 149 ILE ILE L . n 
A 1 156 ASP 156 150 150 ASP ASP L . n 
A 1 157 GLY 157 151 151 GLY GLY L . n 
A 1 158 SER 158 152 152 SER SER L . n 
A 1 159 GLU 159 153 153 GLU GLU L . n 
A 1 160 ARG 160 154 154 ARG ARG L . n 
A 1 161 GLN 161 155 155 GLN GLN L . n 
A 1 162 ASN 162 156 156 ASN ASN L . n 
A 1 163 GLY 163 157 157 GLY GLY L . n 
A 1 164 VAL 164 158 158 VAL VAL L . n 
A 1 165 LEU 165 159 159 LEU LEU L . n 
A 1 166 ASN 166 160 160 ASN ASN L . n 
A 1 167 SER 167 161 161 SER SER L . n 
A 1 168 TRP 168 162 162 TRP TRP L . n 
A 1 169 THR 169 163 163 THR THR L . n 
A 1 170 ASP 170 164 164 ASP ASP L . n 
A 1 171 GLN 171 165 165 GLN GLN L . n 
A 1 172 ASP 172 166 166 ASP ASP L . n 
A 1 173 SER 173 167 167 SER SER L . n 
A 1 174 LYS 174 168 168 LYS LYS L . n 
A 1 175 ASP 175 169 169 ASP ASP L . n 
A 1 176 SER 176 170 170 SER SER L . n 
A 1 177 THR 177 171 171 THR THR L . n 
A 1 178 TYR 178 172 172 TYR TYR L . n 
A 1 179 SER 179 173 173 SER SER L . n 
A 1 180 MET 180 174 174 MET MET L . n 
A 1 181 SER 181 175 175 SER SER L . n 
A 1 182 SER 182 176 176 SER SER L . n 
A 1 183 THR 183 177 177 THR THR L . n 
A 1 184 LEU 184 178 178 LEU LEU L . n 
A 1 185 THR 185 179 179 THR THR L . n 
A 1 186 LEU 186 180 180 LEU LEU L . n 
A 1 187 THR 187 181 181 THR THR L . n 
A 1 188 LYS 188 182 182 LYS LYS L . n 
A 1 189 ASP 189 183 183 ASP ASP L . n 
A 1 190 GLU 190 184 184 GLU GLU L . n 
A 1 191 TYR 191 185 185 TYR TYR L . n 
A 1 192 GLU 192 186 186 GLU GLU L . n 
A 1 193 ARG 193 187 187 ARG ARG L . n 
A 1 194 HIS 194 188 188 HIS HIS L . n 
A 1 195 ASN 195 189 189 ASN ASN L . n 
A 1 196 SER 196 190 190 SER SER L . n 
A 1 197 TYR 197 191 191 TYR TYR L . n 
A 1 198 THR 198 192 192 THR THR L . n 
A 1 199 CYS 199 193 193 CYS CYS L . n 
A 1 200 GLU 200 194 194 GLU GLU L . n 
A 1 201 ALA 201 195 195 ALA ALA L . n 
A 1 202 THR 202 196 196 THR THR L . n 
A 1 203 HIS 203 197 197 HIS HIS L . n 
A 1 204 LYS 204 198 198 LYS LYS L . n 
A 1 205 THR 205 199 199 THR THR L . n 
A 1 206 SER 206 200 200 SER SER L . n 
A 1 207 THR 207 201 201 THR THR L . n 
A 1 208 SER 208 202 202 SER SER L . n 
A 1 209 PRO 209 203 203 PRO PRO L . n 
A 1 210 ILE 210 204 204 ILE ILE L . n 
A 1 211 VAL 211 205 205 VAL VAL L . n 
A 1 212 LYS 212 206 206 LYS LYS L . n 
A 1 213 SER 213 207 207 SER SER L . n 
A 1 214 PHE 214 208 208 PHE PHE L . n 
A 1 215 ASN 215 209 209 ASN ASN L . n 
A 1 216 ARG 216 210 210 ARG ARG L . n 
B 2 1   GLN 1   1   1   GLN GLN H . n 
B 2 2   VAL 2   2   2   VAL VAL H . n 
B 2 3   GLN 3   3   3   GLN GLN H . n 
B 2 4   LEU 4   4   4   LEU LEU H . n 
B 2 5   GLN 5   5   5   GLN GLN H . n 
B 2 6   GLU 6   6   6   GLU GLU H . n 
B 2 7   SER 7   7   7   SER SER H . n 
B 2 8   GLY 8   8   8   GLY GLY H . n 
B 2 9   GLY 9   9   9   GLY GLY H . n 
B 2 10  GLY 10  10  10  GLY GLY H . n 
B 2 11  LEU 11  11  11  LEU LEU H . n 
B 2 12  VAL 12  12  12  VAL VAL H . n 
B 2 13  GLN 13  13  13  GLN GLN H . n 
B 2 14  PRO 14  14  14  PRO PRO H . n 
B 2 15  ARG 15  15  15  ARG ARG H . n 
B 2 16  GLY 16  16  16  GLY GLY H . n 
B 2 17  SER 17  17  17  SER SER H . n 
B 2 18  LEU 18  18  18  LEU LEU H . n 
B 2 19  LYS 19  19  19  LYS LYS H . n 
B 2 20  LEU 20  20  20  LEU LEU H . n 
B 2 21  SER 21  21  21  SER SER H . n 
B 2 22  CYS 22  22  22  CYS CYS H . n 
B 2 23  ALA 23  23  23  ALA ALA H . n 
B 2 24  ALA 24  24  24  ALA ALA H . n 
B 2 25  SER 25  25  25  SER SER H . n 
B 2 26  GLY 26  26  26  GLY GLY H . n 
B 2 27  PHE 27  27  27  PHE PHE H . n 
B 2 28  THR 28  28  28  THR THR H . n 
B 2 29  PHE 29  29  29  PHE PHE H . n 
B 2 30  ASN 30  30  30  ASN ASN H . n 
B 2 31  THR 31  31  31  THR THR H . n 
B 2 32  ASP 32  32  32  ASP ASP H . n 
B 2 33  ALA 33  33  33  ALA ALA H . n 
B 2 34  MET 34  34  34  MET MET H . n 
B 2 35  ASN 35  35  35  ASN ASN H . n 
B 2 36  TRP 36  36  36  TRP TRP H . n 
B 2 37  VAL 37  37  37  VAL VAL H . n 
B 2 38  ARG 38  38  38  ARG ARG H . n 
B 2 39  GLN 39  39  39  GLN GLN H . n 
B 2 40  ALA 40  40  40  ALA ALA H . n 
B 2 41  PRO 41  41  41  PRO PRO H . n 
B 2 42  GLY 42  42  42  GLY GLY H . n 
B 2 43  LYS 43  43  43  LYS LYS H . n 
B 2 44  GLY 44  44  44  GLY GLY H . n 
B 2 45  LEU 45  45  45  LEU LEU H . n 
B 2 46  GLU 46  46  46  GLU GLU H . n 
B 2 47  TRP 47  47  47  TRP TRP H . n 
B 2 48  VAL 48  48  48  VAL VAL H . n 
B 2 49  ALA 49  49  49  ALA ALA H . n 
B 2 50  ARG 50  50  50  ARG ARG H . n 
B 2 51  ILE 51  51  51  ILE ILE H . n 
B 2 52  ARG 52  52  52  ARG ARG H . n 
B 2 53  SER 53  52  52  SER SER H A n 
B 2 54  LYS 54  52  52  LYS LYS H B n 
B 2 55  GLY 55  52  52  GLY GLY H C n 
B 2 56  PHE 56  53  53  PHE PHE H . n 
B 2 57  ASN 57  54  54  ASN ASN H . n 
B 2 58  PHE 58  55  55  PHE PHE H . n 
B 2 59  ALA 59  56  56  ALA ALA H . n 
B 2 60  THR 60  57  57  THR THR H . n 
B 2 61  TYR 61  58  58  TYR TYR H . n 
B 2 62  TYR 62  59  59  TYR TYR H . n 
B 2 63  ALA 63  60  60  ALA ALA H . n 
B 2 64  ASP 64  61  61  ASP ASP H . n 
B 2 65  SER 65  62  62  SER SER H . n 
B 2 66  VAL 66  63  63  VAL VAL H . n 
B 2 67  ARG 67  64  64  ARG ARG H . n 
B 2 68  ASP 68  65  65  ASP ASP H . n 
B 2 69  ARG 69  66  66  ARG ARG H . n 
B 2 70  PHE 70  67  67  PHE PHE H . n 
B 2 71  THR 71  68  68  THR THR H . n 
B 2 72  ILE 72  69  69  ILE ILE H . n 
B 2 73  SER 73  70  70  SER SER H . n 
B 2 74  ARG 74  71  71  ARG ARG H . n 
B 2 75  ASP 75  72  72  ASP ASP H . n 
B 2 76  ASP 76  73  73  ASP ASP H . n 
B 2 77  SER 77  74  74  SER SER H . n 
B 2 78  GLN 78  75  75  GLN GLN H . n 
B 2 79  SER 79  76  76  SER SER H . n 
B 2 80  MET 80  77  77  MET MET H . n 
B 2 81  LEU 81  78  78  LEU LEU H . n 
B 2 82  TYR 82  79  79  TYR TYR H . n 
B 2 83  LEU 83  80  80  LEU LEU H . n 
B 2 84  GLN 84  81  81  GLN GLN H . n 
B 2 85  MET 85  82  82  MET MET H . n 
B 2 86  ASN 86  83  83  ASN ASN H . n 
B 2 87  ASN 87  84  84  ASN ASN H . n 
B 2 88  LEU 88  85  85  LEU LEU H . n 
B 2 89  LYS 89  86  86  LYS LYS H . n 
B 2 90  THR 90  87  87  THR THR H . n 
B 2 91  GLU 91  88  88  GLU GLU H . n 
B 2 92  ASP 92  89  89  ASP ASP H . n 
B 2 93  THR 93  90  90  THR THR H . n 
B 2 94  GLY 94  91  91  GLY GLY H . n 
B 2 95  ILE 95  92  92  ILE ILE H . n 
B 2 96  TYR 96  93  93  TYR TYR H . n 
B 2 97  TYR 97  94  94  TYR TYR H . n 
B 2 98  CYS 98  95  95  CYS CYS H . n 
B 2 99  VAL 99  96  96  VAL VAL H . n 
B 2 100 ARG 100 97  97  ARG ARG H . n 
B 2 101 GLY 101 98  98  GLY GLY H . n 
B 2 102 ARG 102 99  99  ARG ARG H . n 
B 2 103 ASP 103 100 100 ASP ASP H . n 
B 2 104 GLY 104 101 101 GLY GLY H . n 
B 2 105 GLU 105 102 102 GLU GLU H . n 
B 2 106 ALA 106 103 103 ALA ALA H . n 
B 2 107 MET 107 104 104 MET MET H . n 
B 2 108 ASP 108 105 105 ASP ASP H . n 
B 2 109 TYR 109 106 106 TYR TYR H . n 
B 2 110 TRP 110 107 107 TRP TRP H . n 
B 2 111 GLY 111 108 108 GLY GLY H . n 
B 2 112 GLN 112 109 109 GLN GLN H . n 
B 2 113 GLY 113 110 110 GLY GLY H . n 
B 2 114 THR 114 111 111 THR THR H . n 
B 2 115 THR 115 112 112 THR THR H . n 
B 2 116 LEU 116 113 113 LEU LEU H . n 
B 2 117 THR 117 114 114 THR THR H . n 
B 2 118 VAL 118 115 115 VAL VAL H . n 
B 2 119 SER 119 116 116 SER SER H . n 
B 2 120 SER 120 117 117 SER SER H . n 
B 2 121 ALA 121 118 118 ALA ALA H . n 
B 2 122 LYS 122 119 119 LYS LYS H . n 
B 2 123 THR 123 120 120 THR THR H . n 
B 2 124 THR 124 121 121 THR THR H . n 
B 2 125 PRO 125 122 122 PRO PRO H . n 
B 2 126 PRO 126 123 123 PRO PRO H . n 
B 2 127 SER 127 124 124 SER SER H . n 
B 2 128 VAL 128 125 125 VAL VAL H . n 
B 2 129 TYR 129 126 126 TYR TYR H . n 
B 2 130 PRO 130 127 127 PRO PRO H . n 
B 2 131 LEU 131 128 128 LEU LEU H . n 
B 2 132 ALA 132 129 129 ALA ALA H . n 
B 2 133 PRO 133 130 130 PRO PRO H . n 
B 2 134 GLY 134 131 ?   ?   ?   H . n 
B 2 135 SER 135 132 ?   ?   ?   H . n 
B 2 136 ALA 136 133 ?   ?   ?   H . n 
B 2 137 ALA 137 134 ?   ?   ?   H . n 
B 2 138 GLN 138 135 ?   ?   ?   H . n 
B 2 139 THR 139 136 ?   ?   ?   H . n 
B 2 140 ASN 140 137 ?   ?   ?   H . n 
B 2 141 SER 141 138 ?   ?   ?   H . n 
B 2 142 MET 142 139 139 MET MET H . n 
B 2 143 VAL 143 140 140 VAL VAL H . n 
B 2 144 THR 144 141 141 THR THR H . n 
B 2 145 LEU 145 142 142 LEU LEU H . n 
B 2 146 GLY 146 143 143 GLY GLY H . n 
B 2 147 CYS 147 144 144 CYS CYS H . n 
B 2 148 LEU 148 145 145 LEU LEU H . n 
B 2 149 VAL 149 146 146 VAL VAL H . n 
B 2 150 LYS 150 147 147 LYS LYS H . n 
B 2 151 GLY 151 148 148 GLY GLY H . n 
B 2 152 TYR 152 149 149 TYR TYR H . n 
B 2 153 PHE 153 150 150 PHE PHE H . n 
B 2 154 PRO 154 151 151 PRO PRO H . n 
B 2 155 GLU 155 152 152 GLU GLU H . n 
B 2 156 PRO 156 153 153 PRO PRO H . n 
B 2 157 VAL 157 154 154 VAL VAL H . n 
B 2 158 THR 158 155 155 THR THR H . n 
B 2 159 VAL 159 156 156 VAL VAL H . n 
B 2 160 THR 160 157 157 THR THR H . n 
B 2 161 TRP 161 158 158 TRP TRP H . n 
B 2 162 ASN 162 159 159 ASN ASN H . n 
B 2 163 SER 163 160 160 SER SER H . n 
B 2 164 GLY 164 161 161 GLY GLY H . n 
B 2 165 SER 165 162 162 SER SER H . n 
B 2 166 LEU 166 163 163 LEU LEU H . n 
B 2 167 SER 167 164 164 SER SER H . n 
B 2 168 SER 168 165 165 SER SER H . n 
B 2 169 GLY 169 166 166 GLY GLY H . n 
B 2 170 VAL 170 167 167 VAL VAL H . n 
B 2 171 HIS 171 168 168 HIS HIS H . n 
B 2 172 THR 172 169 169 THR THR H . n 
B 2 173 PHE 173 170 170 PHE PHE H . n 
B 2 174 PRO 174 171 171 PRO PRO H . n 
B 2 175 ALA 175 172 172 ALA ALA H . n 
B 2 176 VAL 176 173 173 VAL VAL H . n 
B 2 177 LEU 177 174 174 LEU LEU H . n 
B 2 178 GLN 178 175 175 GLN GLN H . n 
B 2 179 SER 179 176 176 SER SER H . n 
B 2 180 ASP 180 177 177 ASP ASP H . n 
B 2 181 LEU 181 178 178 LEU LEU H . n 
B 2 182 TYR 182 179 179 TYR TYR H . n 
B 2 183 THR 183 180 180 THR THR H . n 
B 2 184 LEU 184 181 181 LEU LEU H . n 
B 2 185 SER 185 182 182 SER SER H . n 
B 2 186 SER 186 183 183 SER SER H . n 
B 2 187 SER 187 184 184 SER SER H . n 
B 2 188 VAL 188 185 185 VAL VAL H . n 
B 2 189 THR 189 186 186 THR THR H . n 
B 2 190 VAL 190 187 187 VAL VAL H . n 
B 2 191 PRO 191 188 188 PRO PRO H . n 
B 2 192 SER 192 189 189 SER SER H . n 
B 2 193 SER 193 190 190 SER SER H . n 
B 2 194 PRO 194 191 191 PRO PRO H . n 
B 2 195 ARG 195 192 192 ARG ARG H . n 
B 2 196 PRO 196 193 193 PRO PRO H . n 
B 2 197 SER 197 194 194 SER SER H . n 
B 2 198 GLU 198 195 195 GLU GLU H . n 
B 2 199 THR 199 196 196 THR THR H . n 
B 2 200 VAL 200 197 197 VAL VAL H . n 
B 2 201 THR 201 198 198 THR THR H . n 
B 2 202 CYS 202 199 199 CYS CYS H . n 
B 2 203 ASN 203 200 200 ASN ASN H . n 
B 2 204 VAL 204 201 201 VAL VAL H . n 
B 2 205 ALA 205 202 202 ALA ALA H . n 
B 2 206 HIS 206 203 203 HIS HIS H . n 
B 2 207 PRO 207 204 204 PRO PRO H . n 
B 2 208 ALA 208 205 205 ALA ALA H . n 
B 2 209 SER 209 206 206 SER SER H . n 
B 2 210 SER 210 207 207 SER SER H . n 
B 2 211 THR 211 208 208 THR THR H . n 
B 2 212 LYS 212 209 209 LYS LYS H . n 
B 2 213 VAL 213 210 210 VAL VAL H . n 
B 2 214 ASP 214 211 211 ASP ASP H . n 
B 2 215 LYS 215 212 212 LYS LYS H . n 
B 2 216 LYS 216 213 213 LYS LYS H . n 
B 2 217 ILE 217 214 214 ILE ILE H . n 
B 2 218 VAL 218 215 215 VAL VAL H . n 
B 2 219 ASN 219 216 216 ASN ASN H . n 
C 3 1   CYS 1   1   1   CYS CYS P . n 
C 3 2   LYS 2   2   2   LYS LYS P . n 
C 3 3   GLU 3   3   3   GLU GLU P . n 
C 3 4   TRP 4   4   4   TRP TRP P . n 
C 3 5   LEU 5   5   5   LEU LEU P . n 
C 3 6   SER 6   6   6   SER SER P . n 
C 3 7   THR 7   7   7   THR THR P . n 
C 3 8   ALA 8   8   8   ALA ALA P . n 
C 3 9   PRO 9   9   9   PRO PRO P . n 
C 3 10  CYS 10  10  10  CYS CYS P . n 
C 3 11  GLY 11  11  11  GLY GLY P . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4150  ? 
1 MORE         -28   ? 
1 'SSA (A^2)'  19420 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-08-05 
2 'Structure model' 1 1 2008-04-26 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
X-PLOR    refinement       3.8 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 SG H CYS 22  ? ? SG H CYS 95  ? ? 2.02 
2 1 SG L CYS 133 ? ? SG L CYS 193 ? ? 2.03 
3 1 SG L CYS 23  ? ? SG L CYS 88  ? ? 2.03 
4 1 SG H CYS 144 ? ? SG H CYS 199 ? ? 2.03 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA L 51  ? ? 68.40   -17.93  
2  1 SER L 52  ? ? -143.12 -26.74  
3  1 ASP L 60  ? ? -68.62  0.73    
4  1 ALA L 84  ? ? -179.14 -170.23 
5  1 LEU L 94  ? ? 59.12   -159.40 
6  1 ASP L 150 ? ? 71.46   -2.32   
7  1 LYS L 168 ? ? -94.89  -65.72  
8  1 ASP L 183 ? ? -53.10  -70.36  
9  1 ASN L 189 ? ? -107.02 -79.86  
10 1 PRO H 41  ? ? -41.94  106.15  
11 1 VAL H 48  ? ? -104.44 -60.53  
12 1 ASP H 65  ? ? 63.65   -4.27   
13 1 GLU H 102 ? ? -100.45 -105.44 
14 1 ASP H 105 ? ? -54.48  -77.60  
15 1 ALA H 118 ? ? -56.27  174.70  
16 1 PHE H 150 ? ? -174.78 138.75  
17 1 SER H 160 ? ? 65.42   -10.81  
18 1 ASP H 177 ? ? 65.93   -7.07   
19 1 PRO H 191 ? ? -68.21  37.62   
20 1 ARG H 192 ? ? -173.02 126.54  
21 1 SER H 206 ? ? -143.05 26.45   
22 1 SER H 207 ? ? 38.53   46.02   
23 1 THR P 7   ? ? -149.98 -17.45  
24 1 PRO P 9   ? ? -58.39  -168.17 
25 1 CYS P 10  ? ? -176.56 -145.75 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 H GLY 131 ? B GLY 134 
2 1 Y 1 H SER 132 ? B SER 135 
3 1 Y 1 H ALA 133 ? B ALA 136 
4 1 Y 1 H ALA 134 ? B ALA 137 
5 1 Y 1 H GLN 135 ? B GLN 138 
6 1 Y 1 H THR 136 ? B THR 139 
7 1 Y 1 H ASN 137 ? B ASN 140 
8 1 Y 1 H SER 138 ? B SER 141 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1  211 1  HOH HOH L . 
D 4 HOH 2  212 2  HOH HOH L . 
D 4 HOH 3  213 4  HOH HOH L . 
D 4 HOH 4  214 6  HOH HOH L . 
D 4 HOH 5  215 8  HOH HOH L . 
D 4 HOH 6  216 9  HOH HOH L . 
D 4 HOH 7  217 15 HOH HOH L . 
D 4 HOH 8  218 17 HOH HOH L . 
D 4 HOH 9  219 18 HOH HOH L . 
D 4 HOH 10 220 20 HOH HOH L . 
D 4 HOH 11 221 22 HOH HOH L . 
D 4 HOH 12 222 24 HOH HOH L . 
D 4 HOH 13 223 26 HOH HOH L . 
D 4 HOH 14 224 27 HOH HOH L . 
D 4 HOH 15 225 28 HOH HOH L . 
D 4 HOH 16 226 32 HOH HOH L . 
D 4 HOH 17 227 33 HOH HOH L . 
D 4 HOH 18 228 34 HOH HOH L . 
D 4 HOH 19 229 35 HOH HOH L . 
D 4 HOH 20 230 36 HOH HOH L . 
D 4 HOH 21 231 38 HOH HOH L . 
D 4 HOH 22 232 40 HOH HOH L . 
D 4 HOH 23 233 41 HOH HOH L . 
D 4 HOH 24 234 42 HOH HOH L . 
D 4 HOH 25 235 43 HOH HOH L . 
D 4 HOH 26 236 44 HOH HOH L . 
D 4 HOH 27 237 46 HOH HOH L . 
E 4 HOH 1  217 3  HOH HOH H . 
E 4 HOH 2  218 5  HOH HOH H . 
E 4 HOH 3  219 10 HOH HOH H . 
E 4 HOH 4  220 11 HOH HOH H . 
E 4 HOH 5  221 12 HOH HOH H . 
E 4 HOH 6  222 13 HOH HOH H . 
E 4 HOH 7  223 14 HOH HOH H . 
E 4 HOH 8  224 16 HOH HOH H . 
E 4 HOH 9  225 19 HOH HOH H . 
E 4 HOH 10 226 23 HOH HOH H . 
E 4 HOH 11 227 29 HOH HOH H . 
E 4 HOH 12 228 30 HOH HOH H . 
E 4 HOH 13 229 37 HOH HOH H . 
E 4 HOH 14 230 39 HOH HOH H . 
E 4 HOH 15 231 45 HOH HOH H . 
E 4 HOH 16 232 47 HOH HOH H . 
E 4 HOH 17 233 48 HOH HOH H . 
E 4 HOH 18 234 49 HOH HOH H . 
E 4 HOH 19 235 50 HOH HOH H . 
F 4 HOH 1  12  7  HOH HOH P . 
F 4 HOH 2  13  21 HOH HOH P . 
F 4 HOH 3  14  25 HOH HOH P . 
F 4 HOH 4  15  31 HOH HOH P . 
#