data_2CNK
# 
_entry.id   2CNK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.280 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2CNK         
PDBE  EBI-28845    
WWPDB D_1290028845 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1CP3 unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF APOPAIN WITH THE TETRAPEPTIDE INHIBITOR ACE-DVAD- FMC' 
PDB 1GFW unspecified 
'THE 2.8 ANGSTROM CRYSTAL STRUCTURE OF CASPASE-3 (APOPAIN ORCPP32)IN COMPLEX WITH AN ISATIN SULFONAMIDE INHIBITOR.' 
PDB 1I3O unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF XIAP- BIR2 AND CASPASE 3' 
PDB 1NME unspecified 'STRUCTURE OF CASP-3 WITH TETHERED SALICYLATE' 
PDB 1NMQ unspecified 'EXTENDEND TETHERING: IN SITU ASSEMBLY OF INHIBITORS' 
PDB 1NMS unspecified 'CASPASE-3 TETHERED TO IRREVERSIBLE INHIBITOR' 
PDB 1PAU unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF APOPAIN WITH THE TETRAPEPTIDE ALDEHYDE INHIBITOR AC -DEVD-CHO' 
PDB 1QX3 unspecified 'CONFORMATIONAL RESTRICTIONS IN THE ACTIVE SITE OFUNLIGANDED HUMAN CASPASE-3' 
PDB 1RE1 unspecified 'CRYSTAL STRUCTURE OF CASPASE-3 WITH A NICOTINIC ACIDALDEHYDE INHIBITOR' 
PDB 1RHJ unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH APRYAZINONE INHIBITOR' 
PDB 1RHK unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH A PHENYL-PROPYL-KETONE INHIBITOR' 
PDB 1RHM unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH ANICOTINIC ACID ALDEHYDE INHIBITOR' 
PDB 1RHQ unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH ABROMOMETHOXYPHENYL INHIBITOR' 
PDB 1RHR unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH ACINNAMIC ACID METHYL ESTER INHIBITOR' 
PDB 1RHU unspecified 'CRYSTAL STRUCTURE OF THE COMPLEX OF CASPASE -3 WITH A 5,6, 7TRICYCLIC PEPTIDOMIMETIC INHIBITOR' 
PDB 2C1E unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE MICHAEL ACCEPTOR INHIBITORS.' 
PDB 2C2K unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE MICHAEL ACCEPTOR INHIBITORS.' 
PDB 2C2M unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE MICHAEL ACCEPTOR INHIBITORS.' 
PDB 2C2O unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE MICHAEL ACCEPTOR INHIBITORS.' 
PDB 2CDR unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE EPOXIDE INHIBITORS.' 
PDB 2CJX unspecified 'EXTENDED SUBSTRATE RECOGNITION IN CASPASE-3 REVEALED BY HIGH RESOLUTION X-RAY STRUCTURE ANALYSIS' 
PDB 2CJY unspecified 'EXTENDED SUBSTRATE RECOGNITION IN CASPASE-3 REVEALED BY HIGH RESOLUTION X-RAY STRUCTURE ANALYSIS' 
PDB 2CNL unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE EPOXIDE INHIBITORS.' 
PDB 2CNN unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE EPOXIDE INHIBITORS.' 
PDB 2CNO unspecified 'CRYSTAL STRUCTURES OF CASPASE-3 IN COMPLEX WITH AZA-PEPTIDE EPOXIDE INHIBITORS.' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2CNK 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2006-05-22 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ganesan, R.'    1 
'Jelakovic, S.'  2 
'Campbell, A.J.' 3 
'Li, Z.Z.'       4 
'Asgian, J.L.'   5 
'Powers, J.C.'   6 
'Grutter, M.G.'  7 
# 
_citation.id                        primary 
_citation.title                     
'Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            45 
_citation.page_first                9059 
_citation.page_last                 ? 
_citation.year                      2006 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16866351 
_citation.pdbx_database_id_DOI      10.1021/BI060364P 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ganesan, R.'    1 
primary 'Jelakovic, S.'  2 
primary 'Campbell, A.J.' 3 
primary 'Li, Z.Z.'       4 
primary 'Asgian, J.L.'   5 
primary 'Powers, J.C.'   6 
primary 'Grutter, M.G.'  7 
# 
_cell.entry_id           2CNK 
_cell.length_a           66.784 
_cell.length_b           83.786 
_cell.length_c           96.453 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2CNK 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CASPASE-3 P17 SUBUNIT' 16639.902 1   3.4.22.- ? 'ALPHA SUBUNIT, RESIDUES 29-175'  ? 
2 polymer man 'CASPASE-3 P12 SUBUNIT' 11981.682 1   ?        ? 'BETA SUBUNIT, RESIDUES 176-277'  ? 
3 polymer syn 'AZA-PEPTIDE EXPOXIDE'  792.186   1   ?        ? CBZ-ASP-GLU-VAL-AASP-EP-COO-CH2PH ? 
4 water   nat water                   18.015    403 ?        ? ?                                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CASPASE-3 SUBUNIT P17' 
2 'CASPASE-3 SUBUNIT P12' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
;SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDH
SKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
;
A ? 
2 'polypeptide(L)' no no  
;ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDA
TFHAKKQIPCIVSMLTKELYFYH
;
;ASGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDA
TFHAKKQIPCIVSMLTKELYFYH
;
B ? 
3 'polypeptide(L)' no yes '(PHQ)DEV(MY2)' XDEVX I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLY n 
1 3   ILE n 
1 4   SER n 
1 5   LEU n 
1 6   ASP n 
1 7   ASN n 
1 8   SER n 
1 9   TYR n 
1 10  LYS n 
1 11  MET n 
1 12  ASP n 
1 13  TYR n 
1 14  PRO n 
1 15  GLU n 
1 16  MET n 
1 17  GLY n 
1 18  LEU n 
1 19  CYS n 
1 20  ILE n 
1 21  ILE n 
1 22  ILE n 
1 23  ASN n 
1 24  ASN n 
1 25  LYS n 
1 26  ASN n 
1 27  PHE n 
1 28  HIS n 
1 29  LYS n 
1 30  SER n 
1 31  THR n 
1 32  GLY n 
1 33  MET n 
1 34  THR n 
1 35  SER n 
1 36  ARG n 
1 37  SER n 
1 38  GLY n 
1 39  THR n 
1 40  ASP n 
1 41  VAL n 
1 42  ASP n 
1 43  ALA n 
1 44  ALA n 
1 45  ASN n 
1 46  LEU n 
1 47  ARG n 
1 48  GLU n 
1 49  THR n 
1 50  PHE n 
1 51  ARG n 
1 52  ASN n 
1 53  LEU n 
1 54  LYS n 
1 55  TYR n 
1 56  GLU n 
1 57  VAL n 
1 58  ARG n 
1 59  ASN n 
1 60  LYS n 
1 61  ASN n 
1 62  ASP n 
1 63  LEU n 
1 64  THR n 
1 65  ARG n 
1 66  GLU n 
1 67  GLU n 
1 68  ILE n 
1 69  VAL n 
1 70  GLU n 
1 71  LEU n 
1 72  MET n 
1 73  ARG n 
1 74  ASP n 
1 75  VAL n 
1 76  SER n 
1 77  LYS n 
1 78  GLU n 
1 79  ASP n 
1 80  HIS n 
1 81  SER n 
1 82  LYS n 
1 83  ARG n 
1 84  SER n 
1 85  SER n 
1 86  PHE n 
1 87  VAL n 
1 88  CYS n 
1 89  VAL n 
1 90  LEU n 
1 91  LEU n 
1 92  SER n 
1 93  HIS n 
1 94  GLY n 
1 95  GLU n 
1 96  GLU n 
1 97  GLY n 
1 98  ILE n 
1 99  ILE n 
1 100 PHE n 
1 101 GLY n 
1 102 THR n 
1 103 ASN n 
1 104 GLY n 
1 105 PRO n 
1 106 VAL n 
1 107 ASP n 
1 108 LEU n 
1 109 LYS n 
1 110 LYS n 
1 111 ILE n 
1 112 THR n 
1 113 ASN n 
1 114 PHE n 
1 115 PHE n 
1 116 ARG n 
1 117 GLY n 
1 118 ASP n 
1 119 ARG n 
1 120 CYS n 
1 121 ARG n 
1 122 SER n 
1 123 LEU n 
1 124 THR n 
1 125 GLY n 
1 126 LYS n 
1 127 PRO n 
1 128 LYS n 
1 129 LEU n 
1 130 PHE n 
1 131 ILE n 
1 132 ILE n 
1 133 GLN n 
1 134 ALA n 
1 135 CYS n 
1 136 ARG n 
1 137 GLY n 
1 138 THR n 
1 139 GLU n 
1 140 LEU n 
1 141 ASP n 
1 142 CYS n 
1 143 GLY n 
1 144 ILE n 
1 145 GLU n 
1 146 THR n 
1 147 ASP n 
2 1   ALA n 
2 2   SER n 
2 3   GLY n 
2 4   VAL n 
2 5   ASP n 
2 6   ASP n 
2 7   ASP n 
2 8   MET n 
2 9   ALA n 
2 10  CYS n 
2 11  HIS n 
2 12  LYS n 
2 13  ILE n 
2 14  PRO n 
2 15  VAL n 
2 16  GLU n 
2 17  ALA n 
2 18  ASP n 
2 19  PHE n 
2 20  LEU n 
2 21  TYR n 
2 22  ALA n 
2 23  TYR n 
2 24  SER n 
2 25  THR n 
2 26  ALA n 
2 27  PRO n 
2 28  GLY n 
2 29  TYR n 
2 30  TYR n 
2 31  SER n 
2 32  TRP n 
2 33  ARG n 
2 34  ASN n 
2 35  SER n 
2 36  LYS n 
2 37  ASP n 
2 38  GLY n 
2 39  SER n 
2 40  TRP n 
2 41  PHE n 
2 42  ILE n 
2 43  GLN n 
2 44  SER n 
2 45  LEU n 
2 46  CYS n 
2 47  ALA n 
2 48  MET n 
2 49  LEU n 
2 50  LYS n 
2 51  GLN n 
2 52  TYR n 
2 53  ALA n 
2 54  ASP n 
2 55  LYS n 
2 56  LEU n 
2 57  GLU n 
2 58  PHE n 
2 59  MET n 
2 60  HIS n 
2 61  ILE n 
2 62  LEU n 
2 63  THR n 
2 64  ARG n 
2 65  VAL n 
2 66  ASN n 
2 67  ARG n 
2 68  LYS n 
2 69  VAL n 
2 70  ALA n 
2 71  THR n 
2 72  GLU n 
2 73  PHE n 
2 74  GLU n 
2 75  SER n 
2 76  PHE n 
2 77  SER n 
2 78  PHE n 
2 79  ASP n 
2 80  ALA n 
2 81  THR n 
2 82  PHE n 
2 83  HIS n 
2 84  ALA n 
2 85  LYS n 
2 86  LYS n 
2 87  GLN n 
2 88  ILE n 
2 89  PRO n 
2 90  CYS n 
2 91  ILE n 
2 92  VAL n 
2 93  SER n 
2 94  MET n 
2 95  LEU n 
2 96  THR n 
2 97  LYS n 
2 98  GLU n 
2 99  LEU n 
2 100 TYR n 
2 101 PHE n 
2 102 TYR n 
2 103 HIS n 
3 1   PHQ n 
3 2   ASP n 
3 3   GLU n 
3 4   VAL n 
3 5   MY2 n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 
'BL21(DE3) (STRATAGENE)' ? ? ? ? ? ? ? PLASMID ? ? ? 'PET11D (NOVAGEN)' ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 562    ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ?                  ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'SYNTHETIC CONSTRUCT' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP CASP3_HUMAN 1 ? ? P42574 ? 
2 PDB 2CNK        2 ? ? 2CNK   ? 
3 UNP CASP3_HUMAN 2 ? ? P42574 ? 
4 PDB 2CNK        3 ? ? 2CNK   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2CNK A 1 ? 147 ? P42574 29  ? 175 ? 29  175 
2 2 2CNK B 1 ? 1   ? 2CNK   175 ? 175 ? 175 175 
3 3 2CNK B 2 ? 103 ? P42574 176 ? 277 ? 176 277 
4 4 2CNK I 1 ? 5   ? 2CNK   901 ? 905 ? 901 905 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                               ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                             ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                        ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                               ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                              ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                        ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                              ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                  ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                             ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                 ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                             ? 'C5 H11 N O2 S'  149.211 
MY2 non-polymer         . '{1-[(3S)-4-(BENZYLOXY)-3-HYDROXY-4-OXOBUTANOYL]HYDRAZINO}ACETIC ACID' ? 'C13 H16 N2 O6'  296.276 
PHE 'L-peptide linking' y PHENYLALANINE                                                          ? 'C9 H11 N O2'    165.189 
PHQ non-polymer         . 'benzyl chlorocarbonate'                                               ? 'C8 H7 Cl O2'    170.593 
PRO 'L-peptide linking' y PROLINE                                                                ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                 ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                              ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                             ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                               ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                 ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2CNK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   44.60 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.75 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PEG6000, 100 MM SODIUM CITRATE PH 4.75' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-01-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'ENRAF-NONIUS FR591' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     2CNK 
_reflns.observed_criterion_sigma_I   5.500 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            1.750 
_reflns.number_obs                   27485 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.06000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.0000 
_reflns.B_iso_Wilson_estimate        13.90 
_reflns.pdbx_redundancy              3.800 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.84 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.25000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.500 
_reflns_shell.pdbx_redundancy        3.60 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 2CNK 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     27485 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               1780530.440 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.65 
_refine.ls_d_res_high                            1.75 
_refine.ls_percent_reflns_obs                    99.3 
_refine.ls_R_factor_obs                          0.165 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.165 
_refine.ls_R_factor_R_free                       0.193 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.000 
_refine.ls_number_reflns_R_free                  2748 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               17.00 
_refine.aniso_B[1][1]                            0.65000 
_refine.aniso_B[2][2]                            1.38000 
_refine.aniso_B[3][3]                            -2.02000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.36 
_refine.solvent_model_param_bsol                 77.14 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'ADDITIONAL AMINO ACID, CHAIN B, ALA 175 CLONING ARTIFACT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          OTHER 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        2CNK 
_refine_analyze.Luzzati_coordinate_error_obs    0.16 
_refine_analyze.Luzzati_sigma_a_obs             0.11 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.19 
_refine_analyze.Luzzati_sigma_a_free            0.15 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2049 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             403 
_refine_hist.number_atoms_total               2452 
_refine_hist.d_res_high                       1.75 
_refine_hist.d_res_low                        19.65 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.005 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.30  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      23.10 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.66  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.030 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.540 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.060 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            2.950 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.75 
_refine_ls_shell.d_res_low                        1.86 
_refine_ls_shell.number_reflns_R_work             4095 
_refine_ls_shell.R_factor_R_work                  0.2330 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.2610 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            9.80 
_refine_ls_shell.number_reflns_R_free             443 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       PROTEIN_REP.PARAM 
_pdbx_xplor_file.topol_file       PROTEIN.TOP 
# 
_struct.entry_id                  2CNK 
_struct.title                     'Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.' 
_struct.pdbx_descriptor           'CASPASE-3 P17 SUBUNIT (E.C.3.4.22.-), CASPASE-3 P12 SUBUNIT, AZA-PEPTIDE EXPOXIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2CNK 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
;THIOL PROTEASE, PHOSPHORYLATION, CYSTEINE-PROTEASE, COMPLEX (PROTEASE-INHIBITOR), PROTEASE, EPOXIDES, TETRAMER, APOPTOSIS, HYDROLASE, AZA-PEPTIDE, EPOXYSUCCINYL, ICE, YAMA, CPP32, CLAN CD, AZA-ASP, ZYMOGEN, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS A 28  ? GLY A 32  ? HIS A 56  GLY A 60  5 ? 5  
HELX_P HELX_P2 2 GLY A 38  ? ASN A 52  ? GLY A 66  ASN A 80  1 ? 15 
HELX_P HELX_P3 3 THR A 64  ? LYS A 77  ? THR A 92  LYS A 105 1 ? 14 
HELX_P HELX_P4 4 LEU A 108 ? PHE A 114 ? LEU A 136 PHE A 142 1 ? 7  
HELX_P HELX_P5 5 CYS A 120 ? THR A 124 ? CYS A 148 THR A 152 5 ? 5  
HELX_P HELX_P6 6 TRP B 40  ? ALA B 53  ? TRP B 214 ALA B 227 1 ? 14 
HELX_P HELX_P7 7 GLU B 57  ? PHE B 73  ? GLU B 231 PHE B 247 1 ? 17 
HELX_P HELX_P8 8 ASP B 79  ? HIS B 83  ? ASP B 253 HIS B 257 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C PHQ 1 C1 ? ? ? 1_555 C ASP 2   N   ? ? I PHQ 901 I ASP 902 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale2 covale ? ? C VAL 4 C  ? ? ? 1_555 C MY2 5   N16 ? ? I VAL 904 I MY2 905 1_555 ? ? ? ? ? ? ? 1.310 ? 
covale3 covale ? ? C MY2 5 C2 ? ? ? 1_555 A CYS 135 SG  ? ? I MY2 905 A CYS 163 1_555 ? ? ? ? ? ? ? 1.816 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 3 ? 
BA ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLU A 56  ? ASN A 61  ? GLU A 84  ASN A 89  
AA 2 GLU A 15  ? ASN A 23  ? GLU A 43  ASN A 51  
AA 3 ARG A 83  ? LEU A 91  ? ARG A 111 LEU A 119 
AA 4 LYS A 128 ? GLN A 133 ? LYS A 156 GLN A 161 
AA 5 PHE B 19  ? TYR B 23  ? PHE B 193 TYR B 197 
AA 6 CYS B 90  ? SER B 93  ? CYS B 264 SER B 267 
AB 1 GLY A 94  ? GLU A 95  ? GLY A 122 GLU A 123 
AB 2 ILE A 98  ? GLY A 101 ? ILE A 126 GLY A 129 
AB 3 GLY A 104 ? ASP A 107 ? GLY A 132 ASP A 135 
BA 1 ARG B 33  ? ASN B 34  ? ARG B 207 ASN B 208 
BA 2 GLY B 38  ? SER B 39  ? GLY B 212 SER B 213 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 56  ? N GLU A 84  O GLY A 17  ? O GLY A 45  
AA 2 3 O GLU A 15  ? O GLU A 43  N SER A 84  ? N SER A 112 
AA 3 4 N CYS A 88  ? N CYS A 116 O LEU A 129 ? O LEU A 157 
AA 4 5 N PHE A 130 ? N PHE A 158 O LEU B 20  ? O LEU B 194 
AA 5 6 N TYR B 23  ? N TYR B 197 O CYS B 90  ? O CYS B 264 
AB 1 2 N GLU A 95  ? N GLU A 123 O ILE A 98  ? O ILE A 126 
AB 2 3 N GLY A 101 ? N GLY A 129 O GLY A 104 ? O GLY A 132 
BA 1 2 N ASN B 34  ? N ASN B 208 O GLY B 38  ? O GLY B 212 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    31 
_struct_site.details              'BINDING SITE FOR CHAIN I OF AZA-PEPTIDE EXPOXIDE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 31 SER A 35  ? SER A 63   . ? 1_555 ? 
2  AC1 31 ARG A 36  ? ARG A 64   . ? 1_555 ? 
3  AC1 31 SER A 37  ? SER A 65   . ? 1_555 ? 
4  AC1 31 GLU A 56  ? GLU A 84   . ? 8_555 ? 
5  AC1 31 HIS A 93  ? HIS A 121  . ? 1_555 ? 
6  AC1 31 GLY A 94  ? GLY A 122  . ? 1_555 ? 
7  AC1 31 GLU A 95  ? GLU A 123  . ? 2_665 ? 
8  AC1 31 GLU A 95  ? GLU A 123  . ? 1_555 ? 
9  AC1 31 PHE A 100 ? PHE A 128  . ? 2_665 ? 
10 AC1 31 GLN A 133 ? GLN A 161  . ? 1_555 ? 
11 AC1 31 ALA A 134 ? ALA A 162  . ? 1_555 ? 
12 AC1 31 CYS A 135 ? CYS A 163  . ? 1_555 ? 
13 AC1 31 GLY A 137 ? GLY A 165  . ? 1_555 ? 
14 AC1 31 THR A 138 ? THR A 166  . ? 1_555 ? 
15 AC1 31 HOH D .   ? HOH A 2063 . ? 2_665 ? 
16 AC1 31 HOH D .   ? HOH A 2074 . ? 1_555 ? 
17 AC1 31 ASP B 5   ? ASP B 179  . ? 3_656 ? 
18 AC1 31 SER B 31  ? SER B 205  . ? 1_555 ? 
19 AC1 31 TRP B 32  ? TRP B 206  . ? 1_555 ? 
20 AC1 31 ARG B 33  ? ARG B 207  . ? 1_555 ? 
21 AC1 31 ASN B 34  ? ASN B 208  . ? 1_555 ? 
22 AC1 31 SER B 35  ? SER B 209  . ? 1_555 ? 
23 AC1 31 TRP B 40  ? TRP B 214  . ? 1_555 ? 
24 AC1 31 SER B 75  ? SER B 249  . ? 1_555 ? 
25 AC1 31 PHE B 76  ? PHE B 250  . ? 1_555 ? 
26 AC1 31 PHE B 78  ? PHE B 252  . ? 1_555 ? 
27 AC1 31 HOH E .   ? HOH B 2121 . ? 1_555 ? 
28 AC1 31 HOH F .   ? HOH I 2003 . ? 1_555 ? 
29 AC1 31 HOH F .   ? HOH I 2004 . ? 1_555 ? 
30 AC1 31 HOH F .   ? HOH I 2005 . ? 1_555 ? 
31 AC1 31 HOH F .   ? HOH I 2006 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2CNK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2CNK 
_atom_sites.fract_transf_matrix[1][1]   0.014974 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011935 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010368 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 1   ? 12.232 -5.159 59.728 1.00 28.25 ? 29   SER A N   1 
ATOM   2    C CA  . SER A 1 1   ? 13.272 -5.680 58.794 1.00 27.50 ? 29   SER A CA  1 
ATOM   3    C C   . SER A 1 1   ? 14.657 -5.592 59.425 1.00 26.00 ? 29   SER A C   1 
ATOM   4    O O   . SER A 1 1   ? 14.790 -5.338 60.623 1.00 26.25 ? 29   SER A O   1 
ATOM   5    C CB  . SER A 1 1   ? 13.250 -4.882 57.488 1.00 28.72 ? 29   SER A CB  1 
ATOM   6    O OG  . SER A 1 1   ? 13.473 -3.503 57.732 1.00 32.70 ? 29   SER A OG  1 
ATOM   7    N N   . GLY A 1 2   ? 15.686 -5.798 58.611 1.00 23.52 ? 30   GLY A N   1 
ATOM   8    C CA  . GLY A 1 2   ? 17.046 -5.742 59.112 1.00 20.79 ? 30   GLY A CA  1 
ATOM   9    C C   . GLY A 1 2   ? 17.550 -4.331 59.335 1.00 20.45 ? 30   GLY A C   1 
ATOM   10   O O   . GLY A 1 2   ? 16.807 -3.358 59.198 1.00 19.44 ? 30   GLY A O   1 
ATOM   11   N N   . ILE A 1 3   ? 18.829 -4.228 59.676 1.00 20.20 ? 31   ILE A N   1 
ATOM   12   C CA  . ILE A 1 3   ? 19.478 -2.950 59.936 1.00 21.14 ? 31   ILE A CA  1 
ATOM   13   C C   . ILE A 1 3   ? 19.406 -1.999 58.738 1.00 21.92 ? 31   ILE A C   1 
ATOM   14   O O   . ILE A 1 3   ? 19.754 -2.369 57.616 1.00 19.27 ? 31   ILE A O   1 
ATOM   15   C CB  . ILE A 1 3   ? 20.961 -3.177 60.321 1.00 22.30 ? 31   ILE A CB  1 
ATOM   16   C CG1 . ILE A 1 3   ? 21.033 -4.027 61.595 1.00 21.98 ? 31   ILE A CG1 1 
ATOM   17   C CG2 . ILE A 1 3   ? 21.673 -1.843 60.508 1.00 21.93 ? 31   ILE A CG2 1 
ATOM   18   C CD1 . ILE A 1 3   ? 22.442 -4.437 61.986 1.00 23.24 ? 31   ILE A CD1 1 
ATOM   19   N N   . SER A 1 4   ? 18.944 -0.777 58.991 1.00 21.85 ? 32   SER A N   1 
ATOM   20   C CA  . SER A 1 4   ? 18.830 0.253  57.956 1.00 23.36 ? 32   SER A CA  1 
ATOM   21   C C   . SER A 1 4   ? 19.821 1.366  58.306 1.00 24.06 ? 32   SER A C   1 
ATOM   22   O O   . SER A 1 4   ? 19.834 1.849  59.437 1.00 23.05 ? 32   SER A O   1 
ATOM   23   C CB  . SER A 1 4   ? 17.400 0.804  57.924 1.00 24.40 ? 32   SER A CB  1 
ATOM   24   O OG  . SER A 1 4   ? 17.244 1.770  56.903 1.00 25.82 ? 32   SER A OG  1 
ATOM   25   N N   . LEU A 1 5   ? 20.645 1.779  57.343 1.00 24.12 ? 33   LEU A N   1 
ATOM   26   C CA  . LEU A 1 5   ? 21.653 2.807  57.608 1.00 25.73 ? 33   LEU A CA  1 
ATOM   27   C C   . LEU A 1 5   ? 21.395 4.220  57.075 1.00 26.56 ? 33   LEU A C   1 
ATOM   28   O O   . LEU A 1 5   ? 21.839 5.198  57.681 1.00 28.40 ? 33   LEU A O   1 
ATOM   29   C CB  . LEU A 1 5   ? 23.019 2.319  57.116 1.00 25.48 ? 33   LEU A CB  1 
ATOM   30   C CG  . LEU A 1 5   ? 23.516 1.027  57.775 1.00 26.97 ? 33   LEU A CG  1 
ATOM   31   C CD1 . LEU A 1 5   ? 24.878 0.652  57.215 1.00 26.25 ? 33   LEU A CD1 1 
ATOM   32   C CD2 . LEU A 1 5   ? 23.593 1.219  59.287 1.00 27.00 ? 33   LEU A CD2 1 
ATOM   33   N N   . ASP A 1 6   ? 20.699 4.335  55.949 1.00 25.64 ? 34   ASP A N   1 
ATOM   34   C CA  . ASP A 1 6   ? 20.401 5.647  55.367 1.00 25.16 ? 34   ASP A CA  1 
ATOM   35   C C   . ASP A 1 6   ? 21.627 6.533  55.138 1.00 22.18 ? 34   ASP A C   1 
ATOM   36   O O   . ASP A 1 6   ? 21.621 7.713  55.494 1.00 21.82 ? 34   ASP A O   1 
ATOM   37   C CB  . ASP A 1 6   ? 19.407 6.410  56.251 1.00 29.94 ? 34   ASP A CB  1 
ATOM   38   C CG  . ASP A 1 6   ? 17.982 5.918  56.093 1.00 34.27 ? 34   ASP A CG  1 
ATOM   39   O OD1 . ASP A 1 6   ? 17.711 4.742  56.415 1.00 37.37 ? 34   ASP A OD1 1 
ATOM   40   O OD2 . ASP A 1 6   ? 17.129 6.715  55.646 1.00 37.92 ? 34   ASP A OD2 1 
ATOM   41   N N   . ASN A 1 7   ? 22.674 5.979  54.540 1.00 18.45 ? 35   ASN A N   1 
ATOM   42   C CA  . ASN A 1 7   ? 23.875 6.766  54.277 1.00 16.36 ? 35   ASN A CA  1 
ATOM   43   C C   . ASN A 1 7   ? 23.871 7.358  52.869 1.00 14.49 ? 35   ASN A C   1 
ATOM   44   O O   . ASN A 1 7   ? 24.726 8.177  52.533 1.00 11.41 ? 35   ASN A O   1 
ATOM   45   C CB  . ASN A 1 7   ? 25.132 5.915  54.470 1.00 17.68 ? 35   ASN A CB  1 
ATOM   46   C CG  . ASN A 1 7   ? 25.337 5.496  55.913 1.00 19.77 ? 35   ASN A CG  1 
ATOM   47   O OD1 . ASN A 1 7   ? 25.240 6.313  56.829 1.00 19.16 ? 35   ASN A OD1 1 
ATOM   48   N ND2 . ASN A 1 7   ? 25.632 4.217  56.121 1.00 20.58 ? 35   ASN A ND2 1 
ATOM   49   N N   . SER A 1 8   ? 22.913 6.941  52.046 1.00 14.08 ? 36   SER A N   1 
ATOM   50   C CA  . SER A 1 8   ? 22.821 7.454  50.681 1.00 13.39 ? 36   SER A CA  1 
ATOM   51   C C   . SER A 1 8   ? 21.421 7.978  50.378 1.00 12.06 ? 36   SER A C   1 
ATOM   52   O O   . SER A 1 8   ? 20.428 7.472  50.900 1.00 11.46 ? 36   SER A O   1 
ATOM   53   C CB  . SER A 1 8   ? 23.191 6.360  49.675 1.00 15.88 ? 36   SER A CB  1 
ATOM   54   O OG  . SER A 1 8   ? 22.251 5.303  49.710 1.00 23.55 ? 36   SER A OG  1 
ATOM   55   N N   . TYR A 1 9   ? 21.348 9.004  49.538 1.00 9.85  ? 37   TYR A N   1 
ATOM   56   C CA  . TYR A 1 9   ? 20.070 9.592  49.162 1.00 9.43  ? 37   TYR A CA  1 
ATOM   57   C C   . TYR A 1 9   ? 19.193 8.573  48.449 1.00 8.94  ? 37   TYR A C   1 
ATOM   58   O O   . TYR A 1 9   ? 19.686 7.753  47.678 1.00 9.03  ? 37   TYR A O   1 
ATOM   59   C CB  . TYR A 1 9   ? 20.280 10.776 48.218 1.00 8.83  ? 37   TYR A CB  1 
ATOM   60   C CG  . TYR A 1 9   ? 20.801 12.034 48.871 1.00 8.63  ? 37   TYR A CG  1 
ATOM   61   C CD1 . TYR A 1 9   ? 20.009 12.759 49.761 1.00 8.49  ? 37   TYR A CD1 1 
ATOM   62   C CD2 . TYR A 1 9   ? 22.071 12.524 48.565 1.00 7.64  ? 37   TYR A CD2 1 
ATOM   63   C CE1 . TYR A 1 9   ? 20.468 13.951 50.326 1.00 9.17  ? 37   TYR A CE1 1 
ATOM   64   C CE2 . TYR A 1 9   ? 22.540 13.710 49.126 1.00 9.78  ? 37   TYR A CE2 1 
ATOM   65   C CZ  . TYR A 1 9   ? 21.735 14.419 50.002 1.00 8.94  ? 37   TYR A CZ  1 
ATOM   66   O OH  . TYR A 1 9   ? 22.197 15.599 50.540 1.00 7.37  ? 37   TYR A OH  1 
ATOM   67   N N   . LYS A 1 10  ? 17.892 8.637  48.709 1.00 9.67  ? 38   LYS A N   1 
ATOM   68   C CA  . LYS A 1 10  ? 16.940 7.750  48.054 1.00 10.20 ? 38   LYS A CA  1 
ATOM   69   C C   . LYS A 1 10  ? 16.857 8.219  46.602 1.00 9.86  ? 38   LYS A C   1 
ATOM   70   O O   . LYS A 1 10  ? 16.350 9.304  46.325 1.00 11.62 ? 38   LYS A O   1 
ATOM   71   C CB  . LYS A 1 10  ? 15.569 7.869  48.727 1.00 12.56 ? 38   LYS A CB  1 
ATOM   72   C CG  . LYS A 1 10  ? 14.454 7.073  48.058 1.00 15.32 ? 38   LYS A CG  1 
ATOM   73   C CD  . LYS A 1 10  ? 13.118 7.319  48.758 1.00 16.87 ? 38   LYS A CD  1 
ATOM   74   C CE  . LYS A 1 10  ? 11.949 6.712  47.992 1.00 18.54 ? 38   LYS A CE  1 
ATOM   75   N NZ  . LYS A 1 10  ? 12.088 5.241  47.813 1.00 19.43 ? 38   LYS A NZ  1 
ATOM   76   N N   . MET A 1 11  ? 17.362 7.409  45.677 1.00 10.49 ? 39   MET A N   1 
ATOM   77   C CA  . MET A 1 11  ? 17.346 7.782  44.267 1.00 11.20 ? 39   MET A CA  1 
ATOM   78   C C   . MET A 1 11  ? 16.467 6.867  43.423 1.00 12.43 ? 39   MET A C   1 
ATOM   79   O O   . MET A 1 11  ? 16.647 6.772  42.206 1.00 12.27 ? 39   MET A O   1 
ATOM   80   C CB  . MET A 1 11  ? 18.773 7.784  43.708 1.00 11.66 ? 39   MET A CB  1 
ATOM   81   C CG  . MET A 1 11  ? 19.696 8.815  44.345 1.00 11.14 ? 39   MET A CG  1 
ATOM   82   S SD  . MET A 1 11  ? 19.158 10.519 44.074 1.00 12.28 ? 39   MET A SD  1 
ATOM   83   C CE  . MET A 1 11  ? 19.661 10.736 42.376 1.00 11.58 ? 39   MET A CE  1 
ATOM   84   N N   . ASP A 1 12  ? 15.512 6.201  44.064 1.00 12.42 ? 40   ASP A N   1 
ATOM   85   C CA  . ASP A 1 12  ? 14.624 5.307  43.340 1.00 14.39 ? 40   ASP A CA  1 
ATOM   86   C C   . ASP A 1 12  ? 13.193 5.820  43.237 1.00 13.97 ? 40   ASP A C   1 
ATOM   87   O O   . ASP A 1 12  ? 12.250 5.035  43.126 1.00 14.87 ? 40   ASP A O   1 
ATOM   88   C CB  . ASP A 1 12  ? 14.642 3.901  43.956 1.00 15.64 ? 40   ASP A CB  1 
ATOM   89   C CG  . ASP A 1 12  ? 14.169 3.879  45.392 1.00 18.11 ? 40   ASP A CG  1 
ATOM   90   O OD1 . ASP A 1 12  ? 14.017 2.766  45.939 1.00 21.96 ? 40   ASP A OD1 1 
ATOM   91   O OD2 . ASP A 1 12  ? 13.953 4.960  45.977 1.00 17.89 ? 40   ASP A OD2 1 
ATOM   92   N N   . TYR A 1 13  ? 13.027 7.139  43.286 1.00 12.73 ? 41   TYR A N   1 
ATOM   93   C CA  . TYR A 1 13  ? 11.700 7.720  43.124 1.00 11.67 ? 41   TYR A CA  1 
ATOM   94   C C   . TYR A 1 13  ? 11.331 7.427  41.671 1.00 10.69 ? 41   TYR A C   1 
ATOM   95   O O   . TYR A 1 13  ? 12.188 7.048  40.874 1.00 11.50 ? 41   TYR A O   1 
ATOM   96   C CB  . TYR A 1 13  ? 11.720 9.239  43.339 1.00 11.06 ? 41   TYR A CB  1 
ATOM   97   C CG  . TYR A 1 13  ? 11.719 9.677  44.787 1.00 11.66 ? 41   TYR A CG  1 
ATOM   98   C CD1 . TYR A 1 13  ? 12.908 9.797  45.506 1.00 11.20 ? 41   TYR A CD1 1 
ATOM   99   C CD2 . TYR A 1 13  ? 10.521 9.965  45.441 1.00 12.91 ? 41   TYR A CD2 1 
ATOM   100  C CE1 . TYR A 1 13  ? 12.902 10.195 46.843 1.00 12.77 ? 41   TYR A CE1 1 
ATOM   101  C CE2 . TYR A 1 13  ? 10.504 10.361 46.773 1.00 13.75 ? 41   TYR A CE2 1 
ATOM   102  C CZ  . TYR A 1 13  ? 11.697 10.474 47.467 1.00 13.29 ? 41   TYR A CZ  1 
ATOM   103  O OH  . TYR A 1 13  ? 11.678 10.854 48.788 1.00 14.24 ? 41   TYR A OH  1 
ATOM   104  N N   . PRO A 1 14  ? 10.051 7.592  41.307 1.00 10.52 ? 42   PRO A N   1 
ATOM   105  C CA  . PRO A 1 14  ? 9.615  7.334  39.930 1.00 11.61 ? 42   PRO A CA  1 
ATOM   106  C C   . PRO A 1 14  ? 10.441 8.079  38.881 1.00 10.78 ? 42   PRO A C   1 
ATOM   107  O O   . PRO A 1 14  ? 10.690 7.562  37.789 1.00 10.79 ? 42   PRO A O   1 
ATOM   108  C CB  . PRO A 1 14  ? 8.160  7.784  39.948 1.00 11.74 ? 42   PRO A CB  1 
ATOM   109  C CG  . PRO A 1 14  ? 7.732  7.426  41.339 1.00 13.72 ? 42   PRO A CG  1 
ATOM   110  C CD  . PRO A 1 14  ? 8.901  7.916  42.168 1.00 11.70 ? 42   PRO A CD  1 
ATOM   111  N N   . GLU A 1 15  ? 10.862 9.293  39.223 1.00 9.93  ? 43   GLU A N   1 
ATOM   112  C CA  . GLU A 1 15  ? 11.654 10.129 38.323 1.00 10.49 ? 43   GLU A CA  1 
ATOM   113  C C   . GLU A 1 15  ? 12.974 10.529 38.974 1.00 9.67  ? 43   GLU A C   1 
ATOM   114  O O   . GLU A 1 15  ? 13.026 10.782 40.177 1.00 8.89  ? 43   GLU A O   1 
ATOM   115  C CB  . GLU A 1 15  ? 10.883 11.405 37.975 1.00 10.99 ? 43   GLU A CB  1 
ATOM   116  C CG  . GLU A 1 15  ? 9.589  11.195 37.208 1.00 14.34 ? 43   GLU A CG  1 
ATOM   117  C CD  . GLU A 1 15  ? 8.722  12.440 37.196 1.00 18.60 ? 43   GLU A CD  1 
ATOM   118  O OE1 . GLU A 1 15  ? 9.262  13.545 36.970 1.00 18.08 ? 43   GLU A OE1 1 
ATOM   119  O OE2 . GLU A 1 15  ? 7.496  12.315 37.405 1.00 22.59 ? 43   GLU A OE2 1 
ATOM   120  N N   . MET A 1 16  ? 14.038 10.586 38.181 1.00 9.94  ? 44   MET A N   1 
ATOM   121  C CA  . MET A 1 16  ? 15.331 11.001 38.711 1.00 9.31  ? 44   MET A CA  1 
ATOM   122  C C   . MET A 1 16  ? 15.219 12.491 39.020 1.00 9.54  ? 44   MET A C   1 
ATOM   123  O O   . MET A 1 16  ? 15.798 12.984 39.990 1.00 8.15  ? 44   MET A O   1 
ATOM   124  C CB  . MET A 1 16  ? 16.444 10.770 37.682 1.00 8.40  ? 44   MET A CB  1 
ATOM   125  C CG  . MET A 1 16  ? 16.971 9.337  37.629 1.00 9.92  ? 44   MET A CG  1 
ATOM   126  S SD  . MET A 1 16  ? 17.815 8.850  39.159 1.00 11.33 ? 44   MET A SD  1 
ATOM   127  C CE  . MET A 1 16  ? 19.478 9.479  38.863 1.00 11.49 ? 44   MET A CE  1 
ATOM   128  N N   . GLY A 1 17  ? 14.463 13.200 38.186 1.00 8.12  ? 45   GLY A N   1 
ATOM   129  C CA  . GLY A 1 17  ? 14.282 14.626 38.386 1.00 7.05  ? 45   GLY A CA  1 
ATOM   130  C C   . GLY A 1 17  ? 14.623 15.449 37.158 1.00 7.33  ? 45   GLY A C   1 
ATOM   131  O O   . GLY A 1 17  ? 14.956 14.910 36.105 1.00 8.09  ? 45   GLY A O   1 
ATOM   132  N N   . LEU A 1 18  ? 14.550 16.766 37.298 1.00 7.99  ? 46   LEU A N   1 
ATOM   133  C CA  . LEU A 1 18  ? 14.843 17.657 36.190 1.00 7.58  ? 46   LEU A CA  1 
ATOM   134  C C   . LEU A 1 18  ? 16.321 17.996 36.095 1.00 7.17  ? 46   LEU A C   1 
ATOM   135  O O   . LEU A 1 18  ? 17.046 17.964 37.088 1.00 8.62  ? 46   LEU A O   1 
ATOM   136  C CB  . LEU A 1 18  ? 14.074 18.971 36.342 1.00 9.25  ? 46   LEU A CB  1 
ATOM   137  C CG  . LEU A 1 18  ? 12.579 18.933 36.656 1.00 8.85  ? 46   LEU A CG  1 
ATOM   138  C CD1 . LEU A 1 18  ? 12.066 20.361 36.743 1.00 9.00  ? 46   LEU A CD1 1 
ATOM   139  C CD2 . LEU A 1 18  ? 11.832 18.156 35.575 1.00 9.77  ? 46   LEU A CD2 1 
ATOM   140  N N   . CYS A 1 19  ? 16.750 18.309 34.879 1.00 7.36  ? 47   CYS A N   1 
ATOM   141  C CA  . CYS A 1 19  ? 18.113 18.748 34.615 1.00 7.66  ? 47   CYS A CA  1 
ATOM   142  C C   . CYS A 1 19  ? 17.899 19.960 33.729 1.00 8.19  ? 47   CYS A C   1 
ATOM   143  O O   . CYS A 1 19  ? 17.663 19.827 32.525 1.00 8.45  ? 47   CYS A O   1 
ATOM   144  C CB  . CYS A 1 19  ? 18.930 17.703 33.855 1.00 9.55  ? 47   CYS A CB  1 
ATOM   145  S SG  . CYS A 1 19  ? 20.561 18.333 33.330 1.00 9.78  ? 47   CYS A SG  1 
ATOM   146  N N   . ILE A 1 20  ? 17.946 21.138 34.339 1.00 7.11  ? 48   ILE A N   1 
ATOM   147  C CA  . ILE A 1 20  ? 17.742 22.386 33.613 1.00 7.95  ? 48   ILE A CA  1 
ATOM   148  C C   . ILE A 1 20  ? 19.079 22.929 33.136 1.00 7.52  ? 48   ILE A C   1 
ATOM   149  O O   . ILE A 1 20  ? 19.971 23.197 33.939 1.00 10.12 ? 48   ILE A O   1 
ATOM   150  C CB  . ILE A 1 20  ? 17.075 23.452 34.509 1.00 8.46  ? 48   ILE A CB  1 
ATOM   151  C CG1 . ILE A 1 20  ? 15.771 22.902 35.103 1.00 9.33  ? 48   ILE A CG1 1 
ATOM   152  C CG2 . ILE A 1 20  ? 16.812 24.724 33.702 1.00 8.31  ? 48   ILE A CG2 1 
ATOM   153  C CD1 . ILE A 1 20  ? 14.723 22.497 34.072 1.00 9.73  ? 48   ILE A CD1 1 
ATOM   154  N N   . ILE A 1 21  ? 19.218 23.084 31.825 1.00 8.20  ? 49   ILE A N   1 
ATOM   155  C CA  . ILE A 1 21  ? 20.453 23.603 31.258 1.00 7.34  ? 49   ILE A CA  1 
ATOM   156  C C   . ILE A 1 21  ? 20.222 24.991 30.678 1.00 7.19  ? 49   ILE A C   1 
ATOM   157  O O   . ILE A 1 21  ? 19.399 25.166 29.780 1.00 9.16  ? 49   ILE A O   1 
ATOM   158  C CB  . ILE A 1 21  ? 20.985 22.692 30.127 1.00 7.94  ? 49   ILE A CB  1 
ATOM   159  C CG1 . ILE A 1 21  ? 21.225 21.276 30.661 1.00 7.77  ? 49   ILE A CG1 1 
ATOM   160  C CG2 . ILE A 1 21  ? 22.276 23.274 29.554 1.00 8.31  ? 49   ILE A CG2 1 
ATOM   161  C CD1 . ILE A 1 21  ? 21.632 20.267 29.584 1.00 9.14  ? 49   ILE A CD1 1 
ATOM   162  N N   . ILE A 1 22  ? 20.934 25.980 31.210 1.00 7.45  ? 50   ILE A N   1 
ATOM   163  C CA  . ILE A 1 22  ? 20.829 27.340 30.703 1.00 7.46  ? 50   ILE A CA  1 
ATOM   164  C C   . ILE A 1 22  ? 22.105 27.565 29.907 1.00 9.07  ? 50   ILE A C   1 
ATOM   165  O O   . ILE A 1 22  ? 23.203 27.640 30.466 1.00 9.44  ? 50   ILE A O   1 
ATOM   166  C CB  . ILE A 1 22  ? 20.710 28.370 31.839 1.00 8.08  ? 50   ILE A CB  1 
ATOM   167  C CG1 . ILE A 1 22  ? 19.435 28.091 32.645 1.00 8.98  ? 50   ILE A CG1 1 
ATOM   168  C CG2 . ILE A 1 22  ? 20.677 29.781 31.256 1.00 9.53  ? 50   ILE A CG2 1 
ATOM   169  C CD1 . ILE A 1 22  ? 19.187 29.056 33.794 1.00 9.42  ? 50   ILE A CD1 1 
ATOM   170  N N   . ASN A 1 23  ? 21.944 27.650 28.593 1.00 8.61  ? 51   ASN A N   1 
ATOM   171  C CA  . ASN A 1 23  ? 23.061 27.811 27.676 1.00 10.22 ? 51   ASN A CA  1 
ATOM   172  C C   . ASN A 1 23  ? 23.106 29.198 27.044 1.00 10.61 ? 51   ASN A C   1 
ATOM   173  O O   . ASN A 1 23  ? 22.416 29.461 26.060 1.00 11.19 ? 51   ASN A O   1 
ATOM   174  C CB  . ASN A 1 23  ? 22.956 26.737 26.588 1.00 10.95 ? 51   ASN A CB  1 
ATOM   175  C CG  . ASN A 1 23  ? 24.074 26.817 25.571 1.00 11.43 ? 51   ASN A CG  1 
ATOM   176  O OD1 . ASN A 1 23  ? 25.247 26.881 25.928 1.00 12.09 ? 51   ASN A OD1 1 
ATOM   177  N ND2 . ASN A 1 23  ? 23.713 26.802 24.292 1.00 13.98 ? 51   ASN A ND2 1 
ATOM   178  N N   . ASN A 1 24  ? 23.923 30.082 27.609 1.00 10.23 ? 52   ASN A N   1 
ATOM   179  C CA  . ASN A 1 24  ? 24.043 31.432 27.077 1.00 10.06 ? 52   ASN A CA  1 
ATOM   180  C C   . ASN A 1 24  ? 25.276 31.576 26.200 1.00 11.47 ? 52   ASN A C   1 
ATOM   181  O O   . ASN A 1 24  ? 26.408 31.595 26.687 1.00 10.83 ? 52   ASN A O   1 
ATOM   182  C CB  . ASN A 1 24  ? 24.060 32.456 28.216 1.00 10.72 ? 52   ASN A CB  1 
ATOM   183  C CG  . ASN A 1 24  ? 22.671 32.721 28.768 1.00 11.45 ? 52   ASN A CG  1 
ATOM   184  O OD1 . ASN A 1 24  ? 21.684 32.181 28.266 1.00 11.13 ? 52   ASN A OD1 1 
ATOM   185  N ND2 . ASN A 1 24  ? 22.585 33.557 29.797 1.00 13.25 ? 52   ASN A ND2 1 
ATOM   186  N N   . LYS A 1 25  ? 25.033 31.674 24.896 1.00 11.73 ? 53   LYS A N   1 
ATOM   187  C CA  . LYS A 1 25  ? 26.096 31.797 23.908 1.00 11.48 ? 53   LYS A CA  1 
ATOM   188  C C   . LYS A 1 25  ? 26.225 33.216 23.364 1.00 12.63 ? 53   LYS A C   1 
ATOM   189  O O   . LYS A 1 25  ? 27.331 33.738 23.241 1.00 12.16 ? 53   LYS A O   1 
ATOM   190  C CB  . LYS A 1 25  ? 25.836 30.832 22.748 1.00 13.11 ? 53   LYS A CB  1 
ATOM   191  C CG  . LYS A 1 25  ? 26.914 30.844 21.674 1.00 15.15 ? 53   LYS A CG  1 
ATOM   192  C CD  . LYS A 1 25  ? 26.642 29.814 20.583 1.00 16.98 ? 53   LYS A CD  1 
ATOM   193  C CE  . LYS A 1 25  ? 25.380 30.147 19.797 1.00 20.50 ? 53   LYS A CE  1 
ATOM   194  N NZ  . LYS A 1 25  ? 25.117 29.163 18.704 1.00 23.20 ? 53   LYS A NZ  1 
ATOM   195  N N   . ASN A 1 26  ? 25.091 33.828 23.035 1.00 12.81 ? 54   ASN A N   1 
ATOM   196  C CA  . ASN A 1 26  ? 25.073 35.181 22.483 1.00 14.19 ? 54   ASN A CA  1 
ATOM   197  C C   . ASN A 1 26  ? 24.538 36.194 23.479 1.00 12.86 ? 54   ASN A C   1 
ATOM   198  O O   . ASN A 1 26  ? 23.480 35.996 24.078 1.00 13.71 ? 54   ASN A O   1 
ATOM   199  C CB  . ASN A 1 26  ? 24.217 35.218 21.218 1.00 16.15 ? 54   ASN A CB  1 
ATOM   200  C CG  . ASN A 1 26  ? 24.688 34.236 20.171 1.00 19.18 ? 54   ASN A CG  1 
ATOM   201  O OD1 . ASN A 1 26  ? 25.798 34.349 19.653 1.00 21.33 ? 54   ASN A OD1 1 
ATOM   202  N ND2 . ASN A 1 26  ? 23.849 33.255 19.860 1.00 22.05 ? 54   ASN A ND2 1 
ATOM   203  N N   . PHE A 1 27  ? 25.266 37.292 23.638 1.00 11.78 ? 55   PHE A N   1 
ATOM   204  C CA  . PHE A 1 27  ? 24.869 38.332 24.571 1.00 12.12 ? 55   PHE A CA  1 
ATOM   205  C C   . PHE A 1 27  ? 24.532 39.625 23.846 1.00 13.27 ? 55   PHE A C   1 
ATOM   206  O O   . PHE A 1 27  ? 25.023 39.877 22.747 1.00 15.05 ? 55   PHE A O   1 
ATOM   207  C CB  . PHE A 1 27  ? 25.985 38.566 25.590 1.00 11.81 ? 55   PHE A CB  1 
ATOM   208  C CG  . PHE A 1 27  ? 26.324 37.341 26.391 1.00 11.39 ? 55   PHE A CG  1 
ATOM   209  C CD1 . PHE A 1 27  ? 27.019 36.286 25.809 1.00 9.95  ? 55   PHE A CD1 1 
ATOM   210  C CD2 . PHE A 1 27  ? 25.887 37.214 27.705 1.00 10.83 ? 55   PHE A CD2 1 
ATOM   211  C CE1 . PHE A 1 27  ? 27.271 35.116 26.523 1.00 9.17  ? 55   PHE A CE1 1 
ATOM   212  C CE2 . PHE A 1 27  ? 26.133 36.050 28.430 1.00 11.51 ? 55   PHE A CE2 1 
ATOM   213  C CZ  . PHE A 1 27  ? 26.827 34.996 27.834 1.00 9.94  ? 55   PHE A CZ  1 
ATOM   214  N N   . HIS A 1 28  ? 23.680 40.435 24.462 1.00 14.60 ? 56   HIS A N   1 
ATOM   215  C CA  . HIS A 1 28  ? 23.284 41.701 23.865 1.00 15.67 ? 56   HIS A CA  1 
ATOM   216  C C   . HIS A 1 28  ? 24.497 42.594 23.653 1.00 16.99 ? 56   HIS A C   1 
ATOM   217  O O   . HIS A 1 28  ? 25.362 42.703 24.522 1.00 16.46 ? 56   HIS A O   1 
ATOM   218  C CB  . HIS A 1 28  ? 22.260 42.406 24.756 1.00 16.16 ? 56   HIS A CB  1 
ATOM   219  C CG  . HIS A 1 28  ? 20.955 41.680 24.866 1.00 16.58 ? 56   HIS A CG  1 
ATOM   220  N ND1 . HIS A 1 28  ? 19.861 42.209 25.515 1.00 15.00 ? 56   HIS A ND1 1 
ATOM   221  C CD2 . HIS A 1 28  ? 20.569 40.463 24.412 1.00 17.96 ? 56   HIS A CD2 1 
ATOM   222  C CE1 . HIS A 1 28  ? 18.858 41.352 25.457 1.00 16.62 ? 56   HIS A CE1 1 
ATOM   223  N NE2 . HIS A 1 28  ? 19.261 40.284 24.793 1.00 17.37 ? 56   HIS A NE2 1 
ATOM   224  N N   . LYS A 1 29  ? 24.555 43.227 22.485 1.00 18.45 ? 57   LYS A N   1 
ATOM   225  C CA  . LYS A 1 29  ? 25.656 44.116 22.138 1.00 18.90 ? 57   LYS A CA  1 
ATOM   226  C C   . LYS A 1 29  ? 25.854 45.167 23.224 1.00 18.42 ? 57   LYS A C   1 
ATOM   227  O O   . LYS A 1 29  ? 26.978 45.582 23.510 1.00 17.89 ? 57   LYS A O   1 
ATOM   228  C CB  . LYS A 1 29  ? 25.365 44.801 20.801 1.00 21.52 ? 57   LYS A CB  1 
ATOM   229  C CG  . LYS A 1 29  ? 26.418 45.805 20.367 1.00 26.20 ? 57   LYS A CG  1 
ATOM   230  C CD  . LYS A 1 29  ? 25.981 46.555 19.116 1.00 30.16 ? 57   LYS A CD  1 
ATOM   231  C CE  . LYS A 1 29  ? 26.982 47.642 18.744 1.00 32.62 ? 57   LYS A CE  1 
ATOM   232  N NZ  . LYS A 1 29  ? 26.530 48.441 17.568 1.00 35.22 ? 57   LYS A NZ  1 
ATOM   233  N N   . SER A 1 30  ? 24.748 45.585 23.828 1.00 17.56 ? 58   SER A N   1 
ATOM   234  C CA  . SER A 1 30  ? 24.760 46.590 24.882 1.00 17.97 ? 58   SER A CA  1 
ATOM   235  C C   . SER A 1 30  ? 25.636 46.222 26.082 1.00 17.97 ? 58   SER A C   1 
ATOM   236  O O   . SER A 1 30  ? 26.133 47.105 26.784 1.00 18.10 ? 58   SER A O   1 
ATOM   237  C CB  . SER A 1 30  ? 23.328 46.844 25.358 1.00 18.80 ? 58   SER A CB  1 
ATOM   238  O OG  . SER A 1 30  ? 22.727 45.636 25.796 1.00 21.03 ? 58   SER A OG  1 
ATOM   239  N N   . THR A 1 31  ? 25.821 44.926 26.321 1.00 17.84 ? 59   THR A N   1 
ATOM   240  C CA  . THR A 1 31  ? 26.629 44.471 27.453 1.00 16.41 ? 59   THR A CA  1 
ATOM   241  C C   . THR A 1 31  ? 28.118 44.416 27.137 1.00 17.55 ? 59   THR A C   1 
ATOM   242  O O   . THR A 1 31  ? 28.949 44.432 28.044 1.00 17.21 ? 59   THR A O   1 
ATOM   243  C CB  . THR A 1 31  ? 26.219 43.059 27.922 1.00 16.16 ? 59   THR A CB  1 
ATOM   244  O OG1 . THR A 1 31  ? 26.620 42.098 26.939 1.00 15.53 ? 59   THR A OG1 1 
ATOM   245  C CG2 . THR A 1 31  ? 24.711 42.974 28.131 1.00 16.21 ? 59   THR A CG2 1 
ATOM   246  N N   . GLY A 1 32  ? 28.450 44.327 25.854 1.00 16.72 ? 60   GLY A N   1 
ATOM   247  C CA  . GLY A 1 32  ? 29.845 44.256 25.459 1.00 18.13 ? 60   GLY A CA  1 
ATOM   248  C C   . GLY A 1 32  ? 30.462 42.888 25.701 1.00 19.30 ? 60   GLY A C   1 
ATOM   249  O O   . GLY A 1 32  ? 31.676 42.722 25.580 1.00 19.85 ? 60   GLY A O   1 
ATOM   250  N N   . MET A 1 33  ? 29.638 41.901 26.045 1.00 18.51 ? 61   MET A N   1 
ATOM   251  C CA  . MET A 1 33  ? 30.144 40.556 26.293 1.00 18.71 ? 61   MET A CA  1 
ATOM   252  C C   . MET A 1 33  ? 30.256 39.769 24.992 1.00 19.48 ? 61   MET A C   1 
ATOM   253  O O   . MET A 1 33  ? 29.369 39.825 24.138 1.00 19.74 ? 61   MET A O   1 
ATOM   254  C CB  . MET A 1 33  ? 29.245 39.817 27.290 1.00 18.02 ? 61   MET A CB  1 
ATOM   255  C CG  . MET A 1 33  ? 29.290 40.410 28.693 1.00 19.09 ? 61   MET A CG  1 
ATOM   256  S SD  . MET A 1 33  ? 28.472 39.398 29.940 1.00 21.10 ? 61   MET A SD  1 
ATOM   257  C CE  . MET A 1 33  ? 26.789 40.019 29.829 1.00 21.47 ? 61   MET A CE  1 
ATOM   258  N N   . THR A 1 34  ? 31.357 39.039 24.849 1.00 19.75 ? 62   THR A N   1 
ATOM   259  C CA  . THR A 1 34  ? 31.615 38.252 23.649 1.00 19.43 ? 62   THR A CA  1 
ATOM   260  C C   . THR A 1 34  ? 30.823 36.952 23.613 1.00 18.45 ? 62   THR A C   1 
ATOM   261  O O   . THR A 1 34  ? 30.402 36.438 24.650 1.00 18.12 ? 62   THR A O   1 
ATOM   262  C CB  . THR A 1 34  ? 33.110 37.902 23.534 1.00 21.26 ? 62   THR A CB  1 
ATOM   263  O OG1 . THR A 1 34  ? 33.512 37.153 24.688 1.00 25.19 ? 62   THR A OG1 1 
ATOM   264  C CG2 . THR A 1 34  ? 33.947 39.165 23.443 1.00 22.76 ? 62   THR A CG2 1 
ATOM   265  N N   . SER A 1 35  ? 30.624 36.426 22.409 1.00 16.24 ? 63   SER A N   1 
ATOM   266  C CA  . SER A 1 35  ? 29.901 35.174 22.240 1.00 16.31 ? 63   SER A CA  1 
ATOM   267  C C   . SER A 1 35  ? 30.767 34.051 22.802 1.00 16.31 ? 63   SER A C   1 
ATOM   268  O O   . SER A 1 35  ? 31.996 34.116 22.744 1.00 16.11 ? 63   SER A O   1 
ATOM   269  C CB  . SER A 1 35  ? 29.599 34.931 20.758 1.00 18.39 ? 63   SER A CB  1 
ATOM   270  O OG  . SER A 1 35  ? 30.784 34.951 19.981 1.00 23.87 ? 63   SER A OG  1 
ATOM   271  N N   . ARG A 1 36  ? 30.127 33.026 23.351 1.00 13.80 ? 64   ARG A N   1 
ATOM   272  C CA  . ARG A 1 36  ? 30.856 31.912 23.942 1.00 12.05 ? 64   ARG A CA  1 
ATOM   273  C C   . ARG A 1 36  ? 30.923 30.708 23.007 1.00 12.68 ? 64   ARG A C   1 
ATOM   274  O O   . ARG A 1 36  ? 30.214 29.717 23.183 1.00 12.99 ? 64   ARG A O   1 
ATOM   275  C CB  . ARG A 1 36  ? 30.210 31.540 25.282 1.00 11.38 ? 64   ARG A CB  1 
ATOM   276  C CG  . ARG A 1 36  ? 30.211 32.705 26.277 1.00 8.96  ? 64   ARG A CG  1 
ATOM   277  C CD  . ARG A 1 36  ? 29.530 32.370 27.605 1.00 10.69 ? 64   ARG A CD  1 
ATOM   278  N NE  . ARG A 1 36  ? 30.120 31.194 28.239 1.00 9.89  ? 64   ARG A NE  1 
ATOM   279  C CZ  . ARG A 1 36  ? 29.605 29.971 28.172 1.00 9.36  ? 64   ARG A CZ  1 
ATOM   280  N NH1 . ARG A 1 36  ? 28.476 29.757 27.506 1.00 7.46  ? 64   ARG A NH1 1 
ATOM   281  N NH2 . ARG A 1 36  ? 30.234 28.954 28.748 1.00 9.21  ? 64   ARG A NH2 1 
ATOM   282  N N   . SER A 1 37  ? 31.791 30.805 22.005 1.00 13.47 ? 65   SER A N   1 
ATOM   283  C CA  . SER A 1 37  ? 31.955 29.734 21.035 1.00 14.19 ? 65   SER A CA  1 
ATOM   284  C C   . SER A 1 37  ? 32.256 28.413 21.727 1.00 13.09 ? 65   SER A C   1 
ATOM   285  O O   . SER A 1 37  ? 33.029 28.362 22.687 1.00 12.75 ? 65   SER A O   1 
ATOM   286  C CB  . SER A 1 37  ? 33.082 30.078 20.056 1.00 17.86 ? 65   SER A CB  1 
ATOM   287  O OG  . SER A 1 37  ? 34.267 30.408 20.756 1.00 26.13 ? 65   SER A OG  1 
ATOM   288  N N   . GLY A 1 38  ? 31.628 27.348 21.238 1.00 11.99 ? 66   GLY A N   1 
ATOM   289  C CA  . GLY A 1 38  ? 31.837 26.031 21.808 1.00 12.62 ? 66   GLY A CA  1 
ATOM   290  C C   . GLY A 1 38  ? 30.850 25.643 22.895 1.00 11.73 ? 66   GLY A C   1 
ATOM   291  O O   . GLY A 1 38  ? 30.778 24.475 23.278 1.00 12.03 ? 66   GLY A O   1 
ATOM   292  N N   . THR A 1 39  ? 30.079 26.602 23.397 1.00 10.43 ? 67   THR A N   1 
ATOM   293  C CA  . THR A 1 39  ? 29.131 26.286 24.460 1.00 10.71 ? 67   THR A CA  1 
ATOM   294  C C   . THR A 1 39  ? 28.015 25.343 24.000 1.00 11.37 ? 67   THR A C   1 
ATOM   295  O O   . THR A 1 39  ? 27.453 24.598 24.809 1.00 10.60 ? 67   THR A O   1 
ATOM   296  C CB  . THR A 1 39  ? 28.514 27.568 25.071 1.00 10.88 ? 67   THR A CB  1 
ATOM   297  O OG1 . THR A 1 39  ? 27.793 27.222 26.261 1.00 12.41 ? 67   THR A OG1 1 
ATOM   298  C CG2 . THR A 1 39  ? 27.570 28.243 24.087 1.00 11.05 ? 67   THR A CG2 1 
ATOM   299  N N   . ASP A 1 40  ? 27.693 25.363 22.708 1.00 10.62 ? 68   ASP A N   1 
ATOM   300  C CA  . ASP A 1 40  ? 26.649 24.475 22.199 1.00 11.80 ? 68   ASP A CA  1 
ATOM   301  C C   . ASP A 1 40  ? 27.110 23.029 22.303 1.00 10.65 ? 68   ASP A C   1 
ATOM   302  O O   . ASP A 1 40  ? 26.300 22.123 22.493 1.00 11.07 ? 68   ASP A O   1 
ATOM   303  C CB  . ASP A 1 40  ? 26.303 24.800 20.744 1.00 12.96 ? 68   ASP A CB  1 
ATOM   304  C CG  . ASP A 1 40  ? 25.632 26.149 20.594 1.00 14.31 ? 68   ASP A CG  1 
ATOM   305  O OD1 . ASP A 1 40  ? 25.186 26.710 21.618 1.00 13.45 ? 68   ASP A OD1 1 
ATOM   306  O OD2 . ASP A 1 40  ? 25.543 26.643 19.452 1.00 13.93 ? 68   ASP A OD2 1 
ATOM   307  N N   . VAL A 1 41  ? 28.415 22.816 22.167 1.00 10.68 ? 69   VAL A N   1 
ATOM   308  C CA  . VAL A 1 41  ? 28.977 21.476 22.277 1.00 10.96 ? 69   VAL A CA  1 
ATOM   309  C C   . VAL A 1 41  ? 28.770 21.001 23.716 1.00 10.49 ? 69   VAL A C   1 
ATOM   310  O O   . VAL A 1 41  ? 28.420 19.842 23.954 1.00 9.82  ? 69   VAL A O   1 
ATOM   311  C CB  . VAL A 1 41  ? 30.487 21.472 21.933 1.00 12.43 ? 69   VAL A CB  1 
ATOM   312  C CG1 . VAL A 1 41  ? 31.048 20.065 22.060 1.00 15.03 ? 69   VAL A CG1 1 
ATOM   313  C CG2 . VAL A 1 41  ? 30.696 21.995 20.515 1.00 14.51 ? 69   VAL A CG2 1 
ATOM   314  N N   . ASP A 1 42  ? 28.985 21.903 24.671 1.00 9.88  ? 70   ASP A N   1 
ATOM   315  C CA  . ASP A 1 42  ? 28.795 21.587 26.088 1.00 8.59  ? 70   ASP A CA  1 
ATOM   316  C C   . ASP A 1 42  ? 27.329 21.249 26.359 1.00 8.70  ? 70   ASP A C   1 
ATOM   317  O O   . ASP A 1 42  ? 27.022 20.254 27.012 1.00 8.59  ? 70   ASP A O   1 
ATOM   318  C CB  . ASP A 1 42  ? 29.168 22.779 26.975 1.00 7.76  ? 70   ASP A CB  1 
ATOM   319  C CG  . ASP A 1 42  ? 30.659 22.889 27.236 1.00 7.92  ? 70   ASP A CG  1 
ATOM   320  O OD1 . ASP A 1 42  ? 31.431 22.039 26.748 1.00 8.65  ? 70   ASP A OD1 1 
ATOM   321  O OD2 . ASP A 1 42  ? 31.052 23.839 27.944 1.00 10.05 ? 70   ASP A OD2 1 
ATOM   322  N N   . ALA A 1 43  ? 26.429 22.096 25.867 1.00 7.82  ? 71   ALA A N   1 
ATOM   323  C CA  . ALA A 1 43  ? 25.002 21.887 26.082 1.00 8.98  ? 71   ALA A CA  1 
ATOM   324  C C   . ALA A 1 43  ? 24.516 20.550 25.533 1.00 8.46  ? 71   ALA A C   1 
ATOM   325  O O   . ALA A 1 43  ? 23.741 19.849 26.186 1.00 8.38  ? 71   ALA A O   1 
ATOM   326  C CB  . ALA A 1 43  ? 24.204 23.032 25.463 1.00 9.28  ? 71   ALA A CB  1 
ATOM   327  N N   . ALA A 1 44  ? 24.970 20.195 24.335 1.00 8.36  ? 72   ALA A N   1 
ATOM   328  C CA  . ALA A 1 44  ? 24.566 18.938 23.715 1.00 10.04 ? 72   ALA A CA  1 
ATOM   329  C C   . ALA A 1 44  ? 25.121 17.746 24.487 1.00 10.50 ? 72   ALA A C   1 
ATOM   330  O O   . ALA A 1 44  ? 24.425 16.749 24.704 1.00 9.63  ? 72   ALA A O   1 
ATOM   331  C CB  . ALA A 1 44  ? 25.042 18.895 22.262 1.00 10.98 ? 72   ALA A CB  1 
ATOM   332  N N   . ASN A 1 45  ? 26.379 17.854 24.901 1.00 9.60  ? 73   ASN A N   1 
ATOM   333  C CA  . ASN A 1 45  ? 27.033 16.789 25.651 1.00 9.23  ? 73   ASN A CA  1 
ATOM   334  C C   . ASN A 1 45  ? 26.269 16.548 26.957 1.00 10.03 ? 73   ASN A C   1 
ATOM   335  O O   . ASN A 1 45  ? 26.006 15.405 27.343 1.00 8.70  ? 73   ASN A O   1 
ATOM   336  C CB  . ASN A 1 45  ? 28.480 17.190 25.949 1.00 9.14  ? 73   ASN A CB  1 
ATOM   337  C CG  . ASN A 1 45  ? 29.363 16.002 26.271 1.00 10.38 ? 73   ASN A CG  1 
ATOM   338  O OD1 . ASN A 1 45  ? 28.885 14.877 26.417 1.00 12.52 ? 73   ASN A OD1 1 
ATOM   339  N ND2 . ASN A 1 45  ? 30.663 16.249 26.387 1.00 11.32 ? 73   ASN A ND2 1 
ATOM   340  N N   . LEU A 1 46  ? 25.910 17.633 27.634 1.00 8.73  ? 74   LEU A N   1 
ATOM   341  C CA  . LEU A 1 46  ? 25.171 17.534 28.888 1.00 7.34  ? 74   LEU A CA  1 
ATOM   342  C C   . LEU A 1 46  ? 23.795 16.910 28.682 1.00 8.42  ? 74   LEU A C   1 
ATOM   343  O O   . LEU A 1 46  ? 23.350 16.095 29.487 1.00 8.28  ? 74   LEU A O   1 
ATOM   344  C CB  . LEU A 1 46  ? 25.016 18.917 29.520 1.00 9.05  ? 74   LEU A CB  1 
ATOM   345  C CG  . LEU A 1 46  ? 26.295 19.526 30.093 1.00 7.47  ? 74   LEU A CG  1 
ATOM   346  C CD1 . LEU A 1 46  ? 26.117 21.027 30.265 1.00 8.55  ? 74   LEU A CD1 1 
ATOM   347  C CD2 . LEU A 1 46  ? 26.630 18.858 31.421 1.00 9.27  ? 74   LEU A CD2 1 
ATOM   348  N N   . ARG A 1 47  ? 23.118 17.296 27.606 1.00 8.06  ? 75   ARG A N   1 
ATOM   349  C CA  . ARG A 1 47  ? 21.794 16.750 27.327 1.00 8.73  ? 75   ARG A CA  1 
ATOM   350  C C   . ARG A 1 47  ? 21.870 15.232 27.171 1.00 8.70  ? 75   ARG A C   1 
ATOM   351  O O   . ARG A 1 47  ? 21.069 14.503 27.754 1.00 8.55  ? 75   ARG A O   1 
ATOM   352  C CB  . ARG A 1 47  ? 21.210 17.386 26.055 1.00 10.23 ? 75   ARG A CB  1 
ATOM   353  C CG  . ARG A 1 47  ? 19.787 16.942 25.712 1.00 13.62 ? 75   ARG A CG  1 
ATOM   354  C CD  . ARG A 1 47  ? 19.145 17.904 24.706 1.00 16.54 ? 75   ARG A CD  1 
ATOM   355  N NE  . ARG A 1 47  ? 17.741 17.601 24.424 1.00 17.87 ? 75   ARG A NE  1 
ATOM   356  C CZ  . ARG A 1 47  ? 17.312 16.945 23.349 1.00 21.73 ? 75   ARG A CZ  1 
ATOM   357  N NH1 . ARG A 1 47  ? 18.176 16.515 22.440 1.00 22.76 ? 75   ARG A NH1 1 
ATOM   358  N NH2 . ARG A 1 47  ? 16.013 16.727 23.177 1.00 20.75 ? 75   ARG A NH2 1 
ATOM   359  N N   . GLU A 1 48  ? 22.844 14.759 26.398 1.00 8.02  ? 76   GLU A N   1 
ATOM   360  C CA  . GLU A 1 48  ? 23.016 13.325 26.174 1.00 9.76  ? 76   GLU A CA  1 
ATOM   361  C C   . GLU A 1 48  ? 23.440 12.586 27.443 1.00 10.14 ? 76   GLU A C   1 
ATOM   362  O O   . GLU A 1 48  ? 22.922 11.511 27.751 1.00 10.25 ? 76   GLU A O   1 
ATOM   363  C CB  . GLU A 1 48  ? 24.059 13.083 25.079 1.00 10.63 ? 76   GLU A CB  1 
ATOM   364  C CG  . GLU A 1 48  ? 24.379 11.613 24.838 1.00 13.75 ? 76   GLU A CG  1 
ATOM   365  C CD  . GLU A 1 48  ? 23.193 10.828 24.300 1.00 15.91 ? 76   GLU A CD  1 
ATOM   366  O OE1 . GLU A 1 48  ? 23.269 9.579  24.274 1.00 16.56 ? 76   GLU A OE1 1 
ATOM   367  O OE2 . GLU A 1 48  ? 22.190 11.459 23.895 1.00 12.98 ? 76   GLU A OE2 1 
ATOM   368  N N   . THR A 1 49  ? 24.387 13.166 28.173 1.00 9.34  ? 77   THR A N   1 
ATOM   369  C CA  . THR A 1 49  ? 24.890 12.555 29.396 1.00 10.00 ? 77   THR A CA  1 
ATOM   370  C C   . THR A 1 49  ? 23.801 12.375 30.442 1.00 9.40  ? 77   THR A C   1 
ATOM   371  O O   . THR A 1 49  ? 23.623 11.281 30.985 1.00 9.26  ? 77   THR A O   1 
ATOM   372  C CB  . THR A 1 49  ? 26.035 13.393 29.994 1.00 9.06  ? 77   THR A CB  1 
ATOM   373  O OG1 . THR A 1 49  ? 27.097 13.481 29.038 1.00 8.66  ? 77   THR A OG1 1 
ATOM   374  C CG2 . THR A 1 49  ? 26.568 12.753 31.273 1.00 10.10 ? 77   THR A CG2 1 
ATOM   375  N N   . PHE A 1 50  ? 23.065 13.443 30.729 1.00 8.20  ? 78   PHE A N   1 
ATOM   376  C CA  . PHE A 1 50  ? 22.007 13.355 31.720 1.00 7.47  ? 78   PHE A CA  1 
ATOM   377  C C   . PHE A 1 50  ? 20.785 12.596 31.222 1.00 7.81  ? 78   PHE A C   1 
ATOM   378  O O   . PHE A 1 50  ? 20.013 12.077 32.025 1.00 9.22  ? 78   PHE A O   1 
ATOM   379  C CB  . PHE A 1 50  ? 21.647 14.753 32.225 1.00 7.01  ? 78   PHE A CB  1 
ATOM   380  C CG  . PHE A 1 50  ? 22.610 15.269 33.261 1.00 6.12  ? 78   PHE A CG  1 
ATOM   381  C CD1 . PHE A 1 50  ? 22.492 14.878 34.593 1.00 8.08  ? 78   PHE A CD1 1 
ATOM   382  C CD2 . PHE A 1 50  ? 23.674 16.089 32.895 1.00 8.40  ? 78   PHE A CD2 1 
ATOM   383  C CE1 . PHE A 1 50  ? 23.421 15.292 35.546 1.00 7.93  ? 78   PHE A CE1 1 
ATOM   384  C CE2 . PHE A 1 50  ? 24.611 16.510 33.840 1.00 8.75  ? 78   PHE A CE2 1 
ATOM   385  C CZ  . PHE A 1 50  ? 24.483 16.109 35.169 1.00 7.32  ? 78   PHE A CZ  1 
ATOM   386  N N   . ARG A 1 51  ? 20.614 12.519 29.904 1.00 7.82  ? 79   ARG A N   1 
ATOM   387  C CA  . ARG A 1 51  ? 19.500 11.761 29.338 1.00 8.67  ? 79   ARG A CA  1 
ATOM   388  C C   . ARG A 1 51  ? 19.724 10.291 29.695 1.00 9.91  ? 79   ARG A C   1 
ATOM   389  O O   . ARG A 1 51  ? 18.789 9.581  30.069 1.00 10.41 ? 79   ARG A O   1 
ATOM   390  C CB  . ARG A 1 51  ? 19.459 11.897 27.811 1.00 8.59  ? 79   ARG A CB  1 
ATOM   391  C CG  . ARG A 1 51  ? 18.425 10.991 27.132 1.00 10.38 ? 79   ARG A CG  1 
ATOM   392  C CD  . ARG A 1 51  ? 18.509 11.071 25.608 1.00 9.77  ? 79   ARG A CD  1 
ATOM   393  N NE  . ARG A 1 51  ? 19.604 10.277 25.050 1.00 10.56 ? 79   ARG A NE  1 
ATOM   394  C CZ  . ARG A 1 51  ? 19.555 8.963  24.852 1.00 13.18 ? 79   ARG A CZ  1 
ATOM   395  N NH1 . ARG A 1 51  ? 18.461 8.282  25.165 1.00 11.10 ? 79   ARG A NH1 1 
ATOM   396  N NH2 . ARG A 1 51  ? 20.597 8.326  24.332 1.00 13.24 ? 79   ARG A NH2 1 
ATOM   397  N N   . ASN A 1 52  ? 20.970 9.840  29.577 1.00 11.10 ? 80   ASN A N   1 
ATOM   398  C CA  . ASN A 1 52  ? 21.297 8.452  29.883 1.00 11.48 ? 80   ASN A CA  1 
ATOM   399  C C   . ASN A 1 52  ? 21.257 8.139  31.376 1.00 12.19 ? 80   ASN A C   1 
ATOM   400  O O   . ASN A 1 52  ? 21.300 6.970  31.769 1.00 11.59 ? 80   ASN A O   1 
ATOM   401  C CB  . ASN A 1 52  ? 22.659 8.076  29.290 1.00 14.14 ? 80   ASN A CB  1 
ATOM   402  C CG  . ASN A 1 52  ? 22.609 7.924  27.775 1.00 18.20 ? 80   ASN A CG  1 
ATOM   403  O OD1 . ASN A 1 52  ? 21.663 7.352  27.233 1.00 21.43 ? 80   ASN A OD1 1 
ATOM   404  N ND2 . ASN A 1 52  ? 23.630 8.424  27.090 1.00 19.27 ? 80   ASN A ND2 1 
ATOM   405  N N   . LEU A 1 53  ? 21.176 9.178  32.206 1.00 9.21  ? 81   LEU A N   1 
ATOM   406  C CA  . LEU A 1 53  ? 21.083 8.985  33.651 1.00 9.65  ? 81   LEU A CA  1 
ATOM   407  C C   . LEU A 1 53  ? 19.607 9.039  34.033 1.00 10.32 ? 81   LEU A C   1 
ATOM   408  O O   . LEU A 1 53  ? 19.246 8.967  35.210 1.00 10.76 ? 81   LEU A O   1 
ATOM   409  C CB  . LEU A 1 53  ? 21.863 10.067 34.399 1.00 10.60 ? 81   LEU A CB  1 
ATOM   410  C CG  . LEU A 1 53  ? 23.382 9.982  34.251 1.00 11.70 ? 81   LEU A CG  1 
ATOM   411  C CD1 . LEU A 1 53  ? 24.046 11.074 35.076 1.00 12.10 ? 81   LEU A CD1 1 
ATOM   412  C CD2 . LEU A 1 53  ? 23.854 8.601  34.699 1.00 14.25 ? 81   LEU A CD2 1 
ATOM   413  N N   . LYS A 1 54  ? 18.768 9.177  33.008 1.00 9.24  ? 82   LYS A N   1 
ATOM   414  C CA  . LYS A 1 54  ? 17.314 9.223  33.141 1.00 9.26  ? 82   LYS A CA  1 
ATOM   415  C C   . LYS A 1 54  ? 16.732 10.526 33.679 1.00 8.93  ? 82   LYS A C   1 
ATOM   416  O O   . LYS A 1 54  ? 15.652 10.535 34.267 1.00 9.85  ? 82   LYS A O   1 
ATOM   417  C CB  . LYS A 1 54  ? 16.822 8.041  33.986 1.00 9.81  ? 82   LYS A CB  1 
ATOM   418  C CG  . LYS A 1 54  ? 17.431 6.703  33.581 1.00 11.53 ? 82   LYS A CG  1 
ATOM   419  C CD  . LYS A 1 54  ? 17.215 6.394  32.104 1.00 13.88 ? 82   LYS A CD  1 
ATOM   420  C CE  . LYS A 1 54  ? 17.936 5.112  31.704 1.00 16.90 ? 82   LYS A CE  1 
ATOM   421  N NZ  . LYS A 1 54  ? 17.737 4.775  30.266 1.00 19.25 ? 82   LYS A NZ  1 
ATOM   422  N N   . TYR A 1 55  ? 17.442 11.631 33.478 1.00 8.95  ? 83   TYR A N   1 
ATOM   423  C CA  . TYR A 1 55  ? 16.930 12.922 33.917 1.00 9.66  ? 83   TYR A CA  1 
ATOM   424  C C   . TYR A 1 55  ? 16.049 13.520 32.834 1.00 9.13  ? 83   TYR A C   1 
ATOM   425  O O   . TYR A 1 55  ? 16.217 13.219 31.649 1.00 8.75  ? 83   TYR A O   1 
ATOM   426  C CB  . TYR A 1 55  ? 18.066 13.907 34.206 1.00 9.23  ? 83   TYR A CB  1 
ATOM   427  C CG  . TYR A 1 55  ? 18.661 13.748 35.575 1.00 9.27  ? 83   TYR A CG  1 
ATOM   428  C CD1 . TYR A 1 55  ? 19.633 12.782 35.824 1.00 9.94  ? 83   TYR A CD1 1 
ATOM   429  C CD2 . TYR A 1 55  ? 18.211 14.529 36.641 1.00 7.09  ? 83   TYR A CD2 1 
ATOM   430  C CE1 . TYR A 1 55  ? 20.142 12.593 37.105 1.00 8.55  ? 83   TYR A CE1 1 
ATOM   431  C CE2 . TYR A 1 55  ? 18.713 14.344 37.932 1.00 6.26  ? 83   TYR A CE2 1 
ATOM   432  C CZ  . TYR A 1 55  ? 19.677 13.374 38.152 1.00 9.06  ? 83   TYR A CZ  1 
ATOM   433  O OH  . TYR A 1 55  ? 20.175 13.182 39.419 1.00 8.09  ? 83   TYR A OH  1 
ATOM   434  N N   . GLU A 1 56  ? 15.103 14.356 33.252 1.00 8.96  ? 84   GLU A N   1 
ATOM   435  C CA  . GLU A 1 56  ? 14.219 15.054 32.326 1.00 8.98  ? 84   GLU A CA  1 
ATOM   436  C C   . GLU A 1 56  ? 14.996 16.320 31.976 1.00 8.88  ? 84   GLU A C   1 
ATOM   437  O O   . GLU A 1 56  ? 14.961 17.300 32.718 1.00 8.78  ? 84   GLU A O   1 
ATOM   438  C CB  . GLU A 1 56  ? 12.909 15.427 33.021 1.00 8.82  ? 84   GLU A CB  1 
ATOM   439  C CG  . GLU A 1 56  ? 11.915 16.170 32.137 1.00 9.41  ? 84   GLU A CG  1 
ATOM   440  C CD  . GLU A 1 56  ? 10.672 16.597 32.895 1.00 12.05 ? 84   GLU A CD  1 
ATOM   441  O OE1 . GLU A 1 56  ? 10.251 15.858 33.810 1.00 11.89 ? 84   GLU A OE1 1 
ATOM   442  O OE2 . GLU A 1 56  ? 10.109 17.665 32.574 1.00 12.97 ? 84   GLU A OE2 1 
ATOM   443  N N   . VAL A 1 57  ? 15.710 16.293 30.857 1.00 9.29  ? 85   VAL A N   1 
ATOM   444  C CA  . VAL A 1 57  ? 16.520 17.436 30.453 1.00 8.53  ? 85   VAL A CA  1 
ATOM   445  C C   . VAL A 1 57  ? 15.716 18.501 29.719 1.00 9.62  ? 85   VAL A C   1 
ATOM   446  O O   . VAL A 1 57  ? 14.981 18.200 28.778 1.00 8.13  ? 85   VAL A O   1 
ATOM   447  C CB  . VAL A 1 57  ? 17.699 16.997 29.542 1.00 9.85  ? 85   VAL A CB  1 
ATOM   448  C CG1 . VAL A 1 57  ? 18.548 18.212 29.164 1.00 9.75  ? 85   VAL A CG1 1 
ATOM   449  C CG2 . VAL A 1 57  ? 18.551 15.950 30.252 1.00 10.26 ? 85   VAL A CG2 1 
ATOM   450  N N   . ARG A 1 58  ? 15.861 19.743 30.169 1.00 8.28  ? 86   ARG A N   1 
ATOM   451  C CA  . ARG A 1 58  ? 15.188 20.883 29.554 1.00 9.11  ? 86   ARG A CA  1 
ATOM   452  C C   . ARG A 1 58  ? 16.256 21.927 29.276 1.00 9.24  ? 86   ARG A C   1 
ATOM   453  O O   . ARG A 1 58  ? 16.917 22.407 30.199 1.00 9.84  ? 86   ARG A O   1 
ATOM   454  C CB  . ARG A 1 58  ? 14.148 21.490 30.493 1.00 8.54  ? 86   ARG A CB  1 
ATOM   455  C CG  . ARG A 1 58  ? 13.048 20.549 30.940 1.00 8.93  ? 86   ARG A CG  1 
ATOM   456  C CD  . ARG A 1 58  ? 12.003 21.327 31.723 1.00 8.13  ? 86   ARG A CD  1 
ATOM   457  N NE  . ARG A 1 58  ? 11.076 20.458 32.441 1.00 9.09  ? 86   ARG A NE  1 
ATOM   458  C CZ  . ARG A 1 58  ? 10.263 20.879 33.403 1.00 8.96  ? 86   ARG A CZ  1 
ATOM   459  N NH1 . ARG A 1 58  ? 10.261 22.157 33.757 1.00 8.70  ? 86   ARG A NH1 1 
ATOM   460  N NH2 . ARG A 1 58  ? 9.464  20.022 34.021 1.00 11.73 ? 86   ARG A NH2 1 
ATOM   461  N N   . ASN A 1 59  ? 16.421 22.283 28.007 1.00 9.84  ? 87   ASN A N   1 
ATOM   462  C CA  . ASN A 1 59  ? 17.420 23.269 27.628 1.00 10.17 ? 87   ASN A CA  1 
ATOM   463  C C   . ASN A 1 59  ? 16.802 24.627 27.304 1.00 10.99 ? 87   ASN A C   1 
ATOM   464  O O   . ASN A 1 59  ? 15.678 24.712 26.813 1.00 10.28 ? 87   ASN A O   1 
ATOM   465  C CB  . ASN A 1 59  ? 18.202 22.781 26.407 1.00 12.08 ? 87   ASN A CB  1 
ATOM   466  C CG  . ASN A 1 59  ? 19.362 23.698 26.053 1.00 14.52 ? 87   ASN A CG  1 
ATOM   467  O OD1 . ASN A 1 59  ? 20.411 23.668 26.699 1.00 15.41 ? 87   ASN A OD1 1 
ATOM   468  N ND2 . ASN A 1 59  ? 19.176 24.526 25.028 1.00 14.69 ? 87   ASN A ND2 1 
ATOM   469  N N   . LYS A 1 60  ? 17.549 25.683 27.602 1.00 10.38 ? 88   LYS A N   1 
ATOM   470  C CA  . LYS A 1 60  ? 17.133 27.050 27.313 1.00 12.69 ? 88   LYS A CA  1 
ATOM   471  C C   . LYS A 1 60  ? 18.371 27.775 26.804 1.00 13.37 ? 88   LYS A C   1 
ATOM   472  O O   . LYS A 1 60  ? 19.443 27.672 27.400 1.00 13.95 ? 88   LYS A O   1 
ATOM   473  C CB  . LYS A 1 60  ? 16.604 27.749 28.571 1.00 14.46 ? 88   LYS A CB  1 
ATOM   474  C CG  . LYS A 1 60  ? 15.213 27.309 28.997 1.00 17.35 ? 88   LYS A CG  1 
ATOM   475  C CD  . LYS A 1 60  ? 14.185 27.638 27.928 1.00 20.22 ? 88   LYS A CD  1 
ATOM   476  C CE  . LYS A 1 60  ? 12.782 27.262 28.373 1.00 23.15 ? 88   LYS A CE  1 
ATOM   477  N NZ  . LYS A 1 60  ? 11.777 27.516 27.302 1.00 24.29 ? 88   LYS A NZ  1 
ATOM   478  N N   . ASN A 1 61  ? 18.230 28.497 25.698 1.00 11.91 ? 89   ASN A N   1 
ATOM   479  C CA  . ASN A 1 61  ? 19.357 29.226 25.131 1.00 12.75 ? 89   ASN A CA  1 
ATOM   480  C C   . ASN A 1 61  ? 19.188 30.731 25.234 1.00 12.02 ? 89   ASN A C   1 
ATOM   481  O O   . ASN A 1 61  ? 18.071 31.247 25.146 1.00 10.79 ? 89   ASN A O   1 
ATOM   482  C CB  . ASN A 1 61  ? 19.543 28.875 23.654 1.00 14.96 ? 89   ASN A CB  1 
ATOM   483  C CG  . ASN A 1 61  ? 19.830 27.412 23.431 1.00 16.52 ? 89   ASN A CG  1 
ATOM   484  O OD1 . ASN A 1 61  ? 20.766 26.856 24.004 1.00 16.22 ? 89   ASN A OD1 1 
ATOM   485  N ND2 . ASN A 1 61  ? 19.029 26.777 22.584 1.00 19.27 ? 89   ASN A ND2 1 
ATOM   486  N N   . ASP A 1 62  ? 20.312 31.418 25.421 1.00 11.44 ? 90   ASP A N   1 
ATOM   487  C CA  . ASP A 1 62  ? 20.361 32.875 25.486 1.00 11.68 ? 90   ASP A CA  1 
ATOM   488  C C   . ASP A 1 62  ? 19.233 33.531 26.280 1.00 11.19 ? 90   ASP A C   1 
ATOM   489  O O   . ASP A 1 62  ? 18.387 34.229 25.716 1.00 11.81 ? 90   ASP A O   1 
ATOM   490  C CB  . ASP A 1 62  ? 20.372 33.435 24.060 1.00 12.50 ? 90   ASP A CB  1 
ATOM   491  C CG  . ASP A 1 62  ? 21.569 32.957 23.251 1.00 13.89 ? 90   ASP A CG  1 
ATOM   492  O OD1 . ASP A 1 62  ? 21.548 33.107 22.013 1.00 13.91 ? 90   ASP A OD1 1 
ATOM   493  O OD2 . ASP A 1 62  ? 22.539 32.437 23.846 1.00 11.73 ? 90   ASP A OD2 1 
ATOM   494  N N   . LEU A 1 63  ? 19.232 33.323 27.590 1.00 10.37 ? 91   LEU A N   1 
ATOM   495  C CA  . LEU A 1 63  ? 18.205 33.907 28.441 1.00 10.81 ? 91   LEU A CA  1 
ATOM   496  C C   . LEU A 1 63  ? 18.682 35.194 29.099 1.00 10.39 ? 91   LEU A C   1 
ATOM   497  O O   . LEU A 1 63  ? 19.834 35.299 29.520 1.00 10.41 ? 91   LEU A O   1 
ATOM   498  C CB  . LEU A 1 63  ? 17.791 32.924 29.539 1.00 9.21  ? 91   LEU A CB  1 
ATOM   499  C CG  . LEU A 1 63  ? 17.179 31.581 29.139 1.00 9.87  ? 91   LEU A CG  1 
ATOM   500  C CD1 . LEU A 1 63  ? 16.704 30.864 30.397 1.00 11.27 ? 91   LEU A CD1 1 
ATOM   501  C CD2 . LEU A 1 63  ? 16.017 31.796 28.189 1.00 10.84 ? 91   LEU A CD2 1 
ATOM   502  N N   . THR A 1 64  ? 17.786 36.170 29.182 1.00 11.97 ? 92   THR A N   1 
ATOM   503  C CA  . THR A 1 64  ? 18.093 37.438 29.826 1.00 11.61 ? 92   THR A CA  1 
ATOM   504  C C   . THR A 1 64  ? 18.110 37.168 31.325 1.00 11.78 ? 92   THR A C   1 
ATOM   505  O O   . THR A 1 64  ? 17.710 36.090 31.767 1.00 11.71 ? 92   THR A O   1 
ATOM   506  C CB  . THR A 1 64  ? 17.006 38.486 29.551 1.00 11.88 ? 92   THR A CB  1 
ATOM   507  O OG1 . THR A 1 64  ? 15.744 37.996 30.028 1.00 11.51 ? 92   THR A OG1 1 
ATOM   508  C CG2 . THR A 1 64  ? 16.907 38.771 28.064 1.00 11.12 ? 92   THR A CG2 1 
ATOM   509  N N   . ARG A 1 65  ? 18.562 38.140 32.109 1.00 11.93 ? 93   ARG A N   1 
ATOM   510  C CA  . ARG A 1 65  ? 18.590 37.963 33.553 1.00 14.34 ? 93   ARG A CA  1 
ATOM   511  C C   . ARG A 1 65  ? 17.165 37.760 34.072 1.00 14.07 ? 93   ARG A C   1 
ATOM   512  O O   . ARG A 1 65  ? 16.944 36.990 35.005 1.00 14.00 ? 93   ARG A O   1 
ATOM   513  C CB  . ARG A 1 65  ? 19.240 39.176 34.229 1.00 15.99 ? 93   ARG A CB  1 
ATOM   514  C CG  . ARG A 1 65  ? 18.558 40.499 33.928 1.00 21.27 ? 93   ARG A CG  1 
ATOM   515  C CD  . ARG A 1 65  ? 19.376 41.671 34.449 1.00 24.89 ? 93   ARG A CD  1 
ATOM   516  N NE  . ARG A 1 65  ? 19.645 41.556 35.879 1.00 30.63 ? 93   ARG A NE  1 
ATOM   517  C CZ  . ARG A 1 65  ? 20.277 42.479 36.597 1.00 32.88 ? 93   ARG A CZ  1 
ATOM   518  N NH1 . ARG A 1 65  ? 20.707 43.591 36.017 1.00 36.20 ? 93   ARG A NH1 1 
ATOM   519  N NH2 . ARG A 1 65  ? 20.484 42.290 37.893 1.00 33.39 ? 93   ARG A NH2 1 
ATOM   520  N N   . GLU A 1 66  ? 16.197 38.438 33.457 1.00 13.65 ? 94   GLU A N   1 
ATOM   521  C CA  . GLU A 1 66  ? 14.802 38.304 33.875 1.00 13.42 ? 94   GLU A CA  1 
ATOM   522  C C   . GLU A 1 66  ? 14.286 36.892 33.600 1.00 12.81 ? 94   GLU A C   1 
ATOM   523  O O   . GLU A 1 66  ? 13.613 36.288 34.439 1.00 12.05 ? 94   GLU A O   1 
ATOM   524  C CB  . GLU A 1 66  ? 13.903 39.301 33.132 1.00 15.31 ? 94   GLU A CB  1 
ATOM   525  C CG  . GLU A 1 66  ? 14.097 40.768 33.482 1.00 18.16 ? 94   GLU A CG  1 
ATOM   526  C CD  . GLU A 1 66  ? 15.410 41.329 32.980 1.00 20.45 ? 94   GLU A CD  1 
ATOM   527  O OE1 . GLU A 1 66  ? 15.896 40.864 31.930 1.00 17.78 ? 94   GLU A OE1 1 
ATOM   528  O OE2 . GLU A 1 66  ? 15.948 42.250 33.629 1.00 25.51 ? 94   GLU A OE2 1 
ATOM   529  N N   . GLU A 1 67  ? 14.603 36.373 32.419 1.00 11.98 ? 95   GLU A N   1 
ATOM   530  C CA  . GLU A 1 67  ? 14.158 35.042 32.024 1.00 12.44 ? 95   GLU A CA  1 
ATOM   531  C C   . GLU A 1 67  ? 14.790 33.940 32.859 1.00 12.47 ? 95   GLU A C   1 
ATOM   532  O O   . GLU A 1 67  ? 14.171 32.901 33.098 1.00 12.48 ? 95   GLU A O   1 
ATOM   533  C CB  . GLU A 1 67  ? 14.451 34.816 30.541 1.00 13.96 ? 95   GLU A CB  1 
ATOM   534  C CG  . GLU A 1 67  ? 13.690 35.775 29.638 1.00 15.35 ? 95   GLU A CG  1 
ATOM   535  C CD  . GLU A 1 67  ? 14.045 35.609 28.182 1.00 18.95 ? 95   GLU A CD  1 
ATOM   536  O OE1 . GLU A 1 67  ? 15.251 35.554 27.870 1.00 16.35 ? 95   GLU A OE1 1 
ATOM   537  O OE2 . GLU A 1 67  ? 13.117 35.545 27.347 1.00 21.22 ? 95   GLU A OE2 1 
ATOM   538  N N   . ILE A 1 68  ? 16.023 34.165 33.302 1.00 12.20 ? 96   ILE A N   1 
ATOM   539  C CA  . ILE A 1 68  ? 16.713 33.185 34.127 1.00 11.83 ? 96   ILE A CA  1 
ATOM   540  C C   . ILE A 1 68  ? 15.987 33.072 35.461 1.00 12.31 ? 96   ILE A C   1 
ATOM   541  O O   . ILE A 1 68  ? 15.694 31.972 35.927 1.00 10.75 ? 96   ILE A O   1 
ATOM   542  C CB  . ILE A 1 68  ? 18.187 33.595 34.369 1.00 11.56 ? 96   ILE A CB  1 
ATOM   543  C CG1 . ILE A 1 68  ? 18.994 33.370 33.085 1.00 13.10 ? 96   ILE A CG1 1 
ATOM   544  C CG2 . ILE A 1 68  ? 18.777 32.806 35.542 1.00 10.71 ? 96   ILE A CG2 1 
ATOM   545  C CD1 . ILE A 1 68  ? 20.440 33.806 33.180 1.00 13.66 ? 96   ILE A CD1 1 
ATOM   546  N N   . VAL A 1 69  ? 15.684 34.216 36.067 1.00 11.09 ? 97   VAL A N   1 
ATOM   547  C CA  . VAL A 1 69  ? 14.989 34.228 37.346 1.00 12.30 ? 97   VAL A CA  1 
ATOM   548  C C   . VAL A 1 69  ? 13.587 33.634 37.216 1.00 12.81 ? 97   VAL A C   1 
ATOM   549  O O   . VAL A 1 69  ? 13.155 32.859 38.068 1.00 12.72 ? 97   VAL A O   1 
ATOM   550  C CB  . VAL A 1 69  ? 14.891 35.667 37.911 1.00 13.68 ? 97   VAL A CB  1 
ATOM   551  C CG1 . VAL A 1 69  ? 14.085 35.674 39.201 1.00 14.62 ? 97   VAL A CG1 1 
ATOM   552  C CG2 . VAL A 1 69  ? 16.289 36.213 38.165 1.00 13.61 ? 97   VAL A CG2 1 
ATOM   553  N N   . GLU A 1 70  ? 12.883 33.997 36.147 1.00 13.10 ? 98   GLU A N   1 
ATOM   554  C CA  . GLU A 1 70  ? 11.532 33.492 35.909 1.00 15.11 ? 98   GLU A CA  1 
ATOM   555  C C   . GLU A 1 70  ? 11.552 31.974 35.745 1.00 14.27 ? 98   GLU A C   1 
ATOM   556  O O   . GLU A 1 70  ? 10.694 31.268 36.275 1.00 12.91 ? 98   GLU A O   1 
ATOM   557  C CB  . GLU A 1 70  ? 10.948 34.128 34.644 1.00 18.95 ? 98   GLU A CB  1 
ATOM   558  C CG  . GLU A 1 70  ? 9.500  33.749 34.363 1.00 25.15 ? 98   GLU A CG  1 
ATOM   559  C CD  . GLU A 1 70  ? 9.068  34.092 32.947 1.00 29.62 ? 98   GLU A CD  1 
ATOM   560  O OE1 . GLU A 1 70  ? 7.860  33.981 32.649 1.00 32.29 ? 98   GLU A OE1 1 
ATOM   561  O OE2 . GLU A 1 70  ? 9.938  34.465 32.128 1.00 32.72 ? 98   GLU A OE2 1 
ATOM   562  N N   . LEU A 1 71  ? 12.536 31.482 34.998 1.00 13.57 ? 99   LEU A N   1 
ATOM   563  C CA  . LEU A 1 71  ? 12.678 30.052 34.760 1.00 12.30 ? 99   LEU A CA  1 
ATOM   564  C C   . LEU A 1 71  ? 12.896 29.306 36.068 1.00 11.84 ? 99   LEU A C   1 
ATOM   565  O O   . LEU A 1 71  ? 12.216 28.318 36.353 1.00 11.81 ? 99   LEU A O   1 
ATOM   566  C CB  . LEU A 1 71  ? 13.859 29.784 33.821 1.00 11.88 ? 99   LEU A CB  1 
ATOM   567  C CG  . LEU A 1 71  ? 14.220 28.311 33.598 1.00 10.58 ? 99   LEU A CG  1 
ATOM   568  C CD1 . LEU A 1 71  ? 13.072 27.601 32.889 1.00 12.93 ? 99   LEU A CD1 1 
ATOM   569  C CD2 . LEU A 1 71  ? 15.500 28.208 32.781 1.00 8.80  ? 99   LEU A CD2 1 
ATOM   570  N N   . MET A 1 72  ? 13.852 29.782 36.860 1.00 12.74 ? 100  MET A N   1 
ATOM   571  C CA  . MET A 1 72  ? 14.166 29.155 38.136 1.00 12.35 ? 100  MET A CA  1 
ATOM   572  C C   . MET A 1 72  ? 12.975 29.202 39.082 1.00 12.52 ? 100  MET A C   1 
ATOM   573  O O   . MET A 1 72  ? 12.676 28.223 39.761 1.00 11.95 ? 100  MET A O   1 
ATOM   574  C CB  . MET A 1 72  ? 15.369 29.844 38.787 1.00 15.45 ? 100  MET A CB  1 
ATOM   575  C CG  . MET A 1 72  ? 16.676 29.648 38.044 1.00 16.16 ? 100  MET A CG  1 
ATOM   576  S SD  . MET A 1 72  ? 17.218 27.933 38.043 1.00 23.95 ? 100  MET A SD  1 
ATOM   577  C CE  . MET A 1 72  ? 16.635 27.426 36.506 1.00 5.49  ? 100  MET A CE  1 
ATOM   578  N N   . ARG A 1 73  ? 12.293 30.342 39.129 1.00 13.72 ? 101  ARG A N   1 
ATOM   579  C CA  . ARG A 1 73  ? 11.133 30.479 39.998 1.00 14.14 ? 101  ARG A CA  1 
ATOM   580  C C   . ARG A 1 73  ? 10.061 29.466 39.605 1.00 12.99 ? 101  ARG A C   1 
ATOM   581  O O   . ARG A 1 73  ? 9.548  28.737 40.451 1.00 13.10 ? 101  ARG A O   1 
ATOM   582  C CB  . ARG A 1 73  ? 10.561 31.896 39.906 1.00 17.07 ? 101  ARG A CB  1 
ATOM   583  C CG  . ARG A 1 73  ? 9.364  32.147 40.816 1.00 22.66 ? 101  ARG A CG  1 
ATOM   584  C CD  . ARG A 1 73  ? 8.822  33.552 40.614 1.00 26.91 ? 101  ARG A CD  1 
ATOM   585  N NE  . ARG A 1 73  ? 9.879  34.550 40.760 1.00 33.17 ? 101  ARG A NE  1 
ATOM   586  C CZ  . ARG A 1 73  ? 9.720  35.852 40.546 1.00 35.16 ? 101  ARG A CZ  1 
ATOM   587  N NH1 . ARG A 1 73  ? 8.538  36.327 40.175 1.00 38.01 ? 101  ARG A NH1 1 
ATOM   588  N NH2 . ARG A 1 73  ? 10.747 36.678 40.697 1.00 35.17 ? 101  ARG A NH2 1 
ATOM   589  N N   . ASP A 1 74  ? 9.732  29.424 38.316 1.00 12.04 ? 102  ASP A N   1 
ATOM   590  C CA  . ASP A 1 74  ? 8.719  28.504 37.806 1.00 12.59 ? 102  ASP A CA  1 
ATOM   591  C C   . ASP A 1 74  ? 9.060  27.046 38.114 1.00 12.18 ? 102  ASP A C   1 
ATOM   592  O O   . ASP A 1 74  ? 8.218  26.289 38.600 1.00 11.65 ? 102  ASP A O   1 
ATOM   593  C CB  . ASP A 1 74  ? 8.563  28.674 36.291 1.00 11.43 ? 102  ASP A CB  1 
ATOM   594  C CG  . ASP A 1 74  ? 7.869  29.973 35.911 1.00 15.57 ? 102  ASP A CG  1 
ATOM   595  O OD1 . ASP A 1 74  ? 7.806  30.277 34.701 1.00 14.90 ? 102  ASP A OD1 1 
ATOM   596  O OD2 . ASP A 1 74  ? 7.381  30.684 36.813 1.00 14.67 ? 102  ASP A OD2 1 
ATOM   597  N N   . VAL A 1 75  ? 10.295 26.656 37.825 1.00 11.41 ? 103  VAL A N   1 
ATOM   598  C CA  . VAL A 1 75  ? 10.734 25.290 38.072 1.00 12.30 ? 103  VAL A CA  1 
ATOM   599  C C   . VAL A 1 75  ? 10.670 24.941 39.561 1.00 11.89 ? 103  VAL A C   1 
ATOM   600  O O   . VAL A 1 75  ? 10.267 23.837 39.926 1.00 11.66 ? 103  VAL A O   1 
ATOM   601  C CB  . VAL A 1 75  ? 12.173 25.070 37.545 1.00 12.65 ? 103  VAL A CB  1 
ATOM   602  C CG1 . VAL A 1 75  ? 12.705 23.721 38.002 1.00 14.68 ? 103  VAL A CG1 1 
ATOM   603  C CG2 . VAL A 1 75  ? 12.178 25.147 36.022 1.00 14.46 ? 103  VAL A CG2 1 
ATOM   604  N N   . SER A 1 76  ? 11.049 25.884 40.418 1.00 12.42 ? 104  SER A N   1 
ATOM   605  C CA  . SER A 1 76  ? 11.033 25.638 41.857 1.00 12.22 ? 104  SER A CA  1 
ATOM   606  C C   . SER A 1 76  ? 9.611  25.485 42.389 1.00 12.58 ? 104  SER A C   1 
ATOM   607  O O   . SER A 1 76  ? 9.402  24.893 43.450 1.00 13.84 ? 104  SER A O   1 
ATOM   608  C CB  . SER A 1 76  ? 11.739 26.772 42.613 1.00 12.69 ? 104  SER A CB  1 
ATOM   609  O OG  . SER A 1 76  ? 10.947 27.949 42.661 1.00 11.54 ? 104  SER A OG  1 
ATOM   610  N N   . LYS A 1 77  ? 8.636  26.009 41.651 1.00 13.70 ? 105  LYS A N   1 
ATOM   611  C CA  . LYS A 1 77  ? 7.244  25.924 42.076 1.00 14.60 ? 105  LYS A CA  1 
ATOM   612  C C   . LYS A 1 77  ? 6.517  24.692 41.550 1.00 13.81 ? 105  LYS A C   1 
ATOM   613  O O   . LYS A 1 77  ? 5.334  24.492 41.827 1.00 13.35 ? 105  LYS A O   1 
ATOM   614  C CB  . LYS A 1 77  ? 6.491  27.197 41.683 1.00 16.73 ? 105  LYS A CB  1 
ATOM   615  C CG  . LYS A 1 77  ? 6.901  28.409 42.506 1.00 20.88 ? 105  LYS A CG  1 
ATOM   616  C CD  . LYS A 1 77  ? 6.031  29.617 42.204 1.00 25.71 ? 105  LYS A CD  1 
ATOM   617  C CE  . LYS A 1 77  ? 6.439  30.814 43.049 1.00 27.92 ? 105  LYS A CE  1 
ATOM   618  N NZ  . LYS A 1 77  ? 6.315  30.542 44.510 1.00 31.65 ? 105  LYS A NZ  1 
ATOM   619  N N   . GLU A 1 78  ? 7.225  23.868 40.788 1.00 12.34 ? 106  GLU A N   1 
ATOM   620  C CA  . GLU A 1 78  ? 6.648  22.638 40.269 1.00 10.85 ? 106  GLU A CA  1 
ATOM   621  C C   . GLU A 1 78  ? 6.599  21.628 41.409 1.00 13.04 ? 106  GLU A C   1 
ATOM   622  O O   . GLU A 1 78  ? 7.293  21.789 42.415 1.00 12.75 ? 106  GLU A O   1 
ATOM   623  C CB  . GLU A 1 78  ? 7.511  22.073 39.142 1.00 13.66 ? 106  GLU A CB  1 
ATOM   624  C CG  . GLU A 1 78  ? 7.334  22.764 37.807 1.00 13.29 ? 106  GLU A CG  1 
ATOM   625  C CD  . GLU A 1 78  ? 8.186  22.137 36.724 1.00 15.68 ? 106  GLU A CD  1 
ATOM   626  O OE1 . GLU A 1 78  ? 8.444  20.915 36.799 1.00 15.68 ? 106  GLU A OE1 1 
ATOM   627  O OE2 . GLU A 1 78  ? 8.584  22.860 35.789 1.00 15.90 ? 106  GLU A OE2 1 
ATOM   628  N N   . ASP A 1 79  ? 5.777  20.594 41.258 1.00 11.12 ? 107  ASP A N   1 
ATOM   629  C CA  . ASP A 1 79  ? 5.677  19.560 42.280 1.00 13.48 ? 107  ASP A CA  1 
ATOM   630  C C   . ASP A 1 79  ? 6.754  18.518 41.990 1.00 12.41 ? 107  ASP A C   1 
ATOM   631  O O   . ASP A 1 79  ? 6.641  17.749 41.033 1.00 13.87 ? 107  ASP A O   1 
ATOM   632  C CB  . ASP A 1 79  ? 4.299  18.894 42.239 1.00 16.33 ? 107  ASP A CB  1 
ATOM   633  C CG  . ASP A 1 79  ? 4.090  17.918 43.381 1.00 19.96 ? 107  ASP A CG  1 
ATOM   634  O OD1 . ASP A 1 79  ? 5.087  17.513 44.017 1.00 17.71 ? 107  ASP A OD1 1 
ATOM   635  O OD2 . ASP A 1 79  ? 2.926  17.545 43.639 1.00 20.91 ? 107  ASP A OD2 1 
ATOM   636  N N   . HIS A 1 80  ? 7.799  18.504 42.812 1.00 11.57 ? 108  HIS A N   1 
ATOM   637  C CA  . HIS A 1 80  ? 8.906  17.565 42.648 1.00 10.55 ? 108  HIS A CA  1 
ATOM   638  C C   . HIS A 1 80  ? 8.747  16.327 43.534 1.00 10.50 ? 108  HIS A C   1 
ATOM   639  O O   . HIS A 1 80  ? 9.701  15.577 43.731 1.00 9.06  ? 108  HIS A O   1 
ATOM   640  C CB  . HIS A 1 80  ? 10.233 18.252 43.001 1.00 9.29  ? 108  HIS A CB  1 
ATOM   641  C CG  . HIS A 1 80  ? 10.577 19.414 42.121 1.00 9.34  ? 108  HIS A CG  1 
ATOM   642  N ND1 . HIS A 1 80  ? 11.372 19.291 41.002 1.00 10.17 ? 108  HIS A ND1 1 
ATOM   643  C CD2 . HIS A 1 80  ? 10.245 20.724 42.204 1.00 8.89  ? 108  HIS A CD2 1 
ATOM   644  C CE1 . HIS A 1 80  ? 11.518 20.475 40.435 1.00 10.44 ? 108  HIS A CE1 1 
ATOM   645  N NE2 . HIS A 1 80  ? 10.845 21.363 41.145 1.00 10.05 ? 108  HIS A NE2 1 
ATOM   646  N N   . SER A 1 81  ? 7.546  16.107 44.060 1.00 11.33 ? 109  SER A N   1 
ATOM   647  C CA  . SER A 1 81  ? 7.295  14.968 44.945 1.00 12.93 ? 109  SER A CA  1 
ATOM   648  C C   . SER A 1 81  ? 7.774  13.600 44.451 1.00 12.99 ? 109  SER A C   1 
ATOM   649  O O   . SER A 1 81  ? 8.303  12.804 45.231 1.00 13.73 ? 109  SER A O   1 
ATOM   650  C CB  . SER A 1 81  ? 5.802  14.882 45.281 1.00 13.74 ? 109  SER A CB  1 
ATOM   651  O OG  . SER A 1 81  ? 5.405  15.965 46.104 1.00 17.53 ? 109  SER A OG  1 
ATOM   652  N N   . LYS A 1 82  ? 7.593  13.323 43.165 1.00 13.32 ? 110  LYS A N   1 
ATOM   653  C CA  . LYS A 1 82  ? 7.995  12.038 42.605 1.00 13.61 ? 110  LYS A CA  1 
ATOM   654  C C   . LYS A 1 82  ? 9.385  12.049 41.971 1.00 11.85 ? 110  LYS A C   1 
ATOM   655  O O   . LYS A 1 82  ? 9.763  11.104 41.282 1.00 10.30 ? 110  LYS A O   1 
ATOM   656  C CB  . LYS A 1 82  ? 6.964  11.579 41.568 1.00 16.95 ? 110  LYS A CB  1 
ATOM   657  C CG  . LYS A 1 82  ? 5.562  11.405 42.136 1.00 21.82 ? 110  LYS A CG  1 
ATOM   658  C CD  . LYS A 1 82  ? 4.566  10.984 41.061 1.00 26.42 ? 110  LYS A CD  1 
ATOM   659  C CE  . LYS A 1 82  ? 4.433  12.044 39.975 1.00 30.01 ? 110  LYS A CE  1 
ATOM   660  N NZ  . LYS A 1 82  ? 3.421  11.670 38.946 1.00 32.83 ? 110  LYS A NZ  1 
ATOM   661  N N   . ARG A 1 83  ? 10.144 13.115 42.209 1.00 10.79 ? 111  ARG A N   1 
ATOM   662  C CA  . ARG A 1 83  ? 11.489 13.237 41.650 1.00 9.17  ? 111  ARG A CA  1 
ATOM   663  C C   . ARG A 1 83  ? 12.544 13.045 42.740 1.00 9.24  ? 111  ARG A C   1 
ATOM   664  O O   . ARG A 1 83  ? 12.402 13.563 43.847 1.00 9.21  ? 111  ARG A O   1 
ATOM   665  C CB  . ARG A 1 83  ? 11.642 14.608 40.989 1.00 9.70  ? 111  ARG A CB  1 
ATOM   666  C CG  . ARG A 1 83  ? 10.659 14.827 39.838 1.00 10.85 ? 111  ARG A CG  1 
ATOM   667  C CD  . ARG A 1 83  ? 10.568 16.289 39.425 1.00 10.83 ? 111  ARG A CD  1 
ATOM   668  N NE  . ARG A 1 83  ? 9.588  16.476 38.355 1.00 12.88 ? 111  ARG A NE  1 
ATOM   669  C CZ  . ARG A 1 83  ? 9.133  17.656 37.947 1.00 12.88 ? 111  ARG A CZ  1 
ATOM   670  N NH1 . ARG A 1 83  ? 9.563  18.771 38.519 1.00 11.29 ? 111  ARG A NH1 1 
ATOM   671  N NH2 . ARG A 1 83  ? 8.253  17.720 36.957 1.00 13.30 ? 111  ARG A NH2 1 
ATOM   672  N N   . SER A 1 84  ? 13.598 12.297 42.421 1.00 8.28  ? 112  SER A N   1 
ATOM   673  C CA  . SER A 1 84  ? 14.659 12.009 43.384 1.00 9.26  ? 112  SER A CA  1 
ATOM   674  C C   . SER A 1 84  ? 15.603 13.167 43.660 1.00 9.00  ? 112  SER A C   1 
ATOM   675  O O   . SER A 1 84  ? 16.149 13.280 44.759 1.00 8.80  ? 112  SER A O   1 
ATOM   676  C CB  . SER A 1 84  ? 15.502 10.822 42.906 1.00 9.36  ? 112  SER A CB  1 
ATOM   677  O OG  . SER A 1 84  ? 14.718 9.661  42.717 1.00 9.13  ? 112  SER A OG  1 
ATOM   678  N N   . SER A 1 85  ? 15.795 14.024 42.665 1.00 8.67  ? 113  SER A N   1 
ATOM   679  C CA  . SER A 1 85  ? 16.734 15.128 42.805 1.00 8.22  ? 113  SER A CA  1 
ATOM   680  C C   . SER A 1 85  ? 16.446 16.259 41.835 1.00 9.22  ? 113  SER A C   1 
ATOM   681  O O   . SER A 1 85  ? 15.450 16.244 41.117 1.00 8.62  ? 113  SER A O   1 
ATOM   682  C CB  . SER A 1 85  ? 18.146 14.609 42.535 1.00 7.97  ? 113  SER A CB  1 
ATOM   683  O OG  . SER A 1 85  ? 18.222 14.073 41.217 1.00 8.18  ? 113  SER A OG  1 
ATOM   684  N N   . PHE A 1 86  ? 17.341 17.241 41.827 1.00 8.58  ? 114  PHE A N   1 
ATOM   685  C CA  . PHE A 1 86  ? 17.228 18.377 40.927 1.00 7.67  ? 114  PHE A CA  1 
ATOM   686  C C   . PHE A 1 86  ? 18.614 18.775 40.445 1.00 7.95  ? 114  PHE A C   1 
ATOM   687  O O   . PHE A 1 86  ? 19.561 18.845 41.231 1.00 8.06  ? 114  PHE A O   1 
ATOM   688  C CB  . PHE A 1 86  ? 16.582 19.577 41.617 1.00 7.57  ? 114  PHE A CB  1 
ATOM   689  C CG  . PHE A 1 86  ? 16.524 20.797 40.746 1.00 7.31  ? 114  PHE A CG  1 
ATOM   690  C CD1 . PHE A 1 86  ? 15.683 20.833 39.640 1.00 6.67  ? 114  PHE A CD1 1 
ATOM   691  C CD2 . PHE A 1 86  ? 17.349 21.889 40.999 1.00 8.66  ? 114  PHE A CD2 1 
ATOM   692  C CE1 . PHE A 1 86  ? 15.664 21.933 38.794 1.00 6.13  ? 114  PHE A CE1 1 
ATOM   693  C CE2 . PHE A 1 86  ? 17.339 22.996 40.159 1.00 7.95  ? 114  PHE A CE2 1 
ATOM   694  C CZ  . PHE A 1 86  ? 16.496 23.020 39.053 1.00 7.49  ? 114  PHE A CZ  1 
ATOM   695  N N   . VAL A 1 87  ? 18.732 19.033 39.149 1.00 7.48  ? 115  VAL A N   1 
ATOM   696  C CA  . VAL A 1 87  ? 20.010 19.431 38.578 1.00 6.98  ? 115  VAL A CA  1 
ATOM   697  C C   . VAL A 1 87  ? 19.841 20.662 37.705 1.00 8.21  ? 115  VAL A C   1 
ATOM   698  O O   . VAL A 1 87  ? 18.900 20.754 36.913 1.00 7.95  ? 115  VAL A O   1 
ATOM   699  C CB  . VAL A 1 87  ? 20.628 18.303 37.712 1.00 6.45  ? 115  VAL A CB  1 
ATOM   700  C CG1 . VAL A 1 87  ? 21.954 18.769 37.119 1.00 8.25  ? 115  VAL A CG1 1 
ATOM   701  C CG2 . VAL A 1 87  ? 20.848 17.055 38.557 1.00 5.94  ? 115  VAL A CG2 1 
ATOM   702  N N   . CYS A 1 88  ? 20.754 21.613 37.866 1.00 7.75  ? 116  CYS A N   1 
ATOM   703  C CA  . CYS A 1 88  ? 20.742 22.832 37.070 1.00 7.35  ? 116  CYS A CA  1 
ATOM   704  C C   . CYS A 1 88  ? 22.161 23.089 36.599 1.00 7.37  ? 116  CYS A C   1 
ATOM   705  O O   . CYS A 1 88  ? 23.092 23.102 37.400 1.00 8.44  ? 116  CYS A O   1 
ATOM   706  C CB  . CYS A 1 88  ? 20.262 24.033 37.894 1.00 8.68  ? 116  CYS A CB  1 
ATOM   707  S SG  . CYS A 1 88  ? 20.337 25.621 36.997 1.00 11.27 ? 116  CYS A SG  1 
ATOM   708  N N   . VAL A 1 89  ? 22.324 23.283 35.296 1.00 6.22  ? 117  VAL A N   1 
ATOM   709  C CA  . VAL A 1 89  ? 23.637 23.565 34.735 1.00 6.63  ? 117  VAL A CA  1 
ATOM   710  C C   . VAL A 1 89  ? 23.604 24.976 34.161 1.00 8.08  ? 117  VAL A C   1 
ATOM   711  O O   . VAL A 1 89  ? 22.704 25.318 33.392 1.00 8.99  ? 117  VAL A O   1 
ATOM   712  C CB  . VAL A 1 89  ? 23.996 22.578 33.608 1.00 6.80  ? 117  VAL A CB  1 
ATOM   713  C CG1 . VAL A 1 89  ? 25.428 22.824 33.144 1.00 8.13  ? 117  VAL A CG1 1 
ATOM   714  C CG2 . VAL A 1 89  ? 23.828 21.147 34.094 1.00 7.56  ? 117  VAL A CG2 1 
ATOM   715  N N   . LEU A 1 90  ? 24.575 25.795 34.554 1.00 8.79  ? 118  LEU A N   1 
ATOM   716  C CA  . LEU A 1 90  ? 24.662 27.171 34.079 1.00 7.78  ? 118  LEU A CA  1 
ATOM   717  C C   . LEU A 1 90  ? 25.913 27.335 33.223 1.00 7.25  ? 118  LEU A C   1 
ATOM   718  O O   . LEU A 1 90  ? 27.025 27.117 33.696 1.00 7.39  ? 118  LEU A O   1 
ATOM   719  C CB  . LEU A 1 90  ? 24.714 28.131 35.272 1.00 9.22  ? 118  LEU A CB  1 
ATOM   720  C CG  . LEU A 1 90  ? 23.529 28.025 36.234 1.00 10.19 ? 118  LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 90  ? 23.796 28.841 37.490 1.00 13.04 ? 118  LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 90  ? 22.265 28.499 35.531 1.00 10.17 ? 118  LEU A CD2 1 
ATOM   723  N N   . LEU A 1 91  ? 25.721 27.704 31.959 1.00 7.56  ? 119  LEU A N   1 
ATOM   724  C CA  . LEU A 1 91  ? 26.830 27.900 31.027 1.00 7.72  ? 119  LEU A CA  1 
ATOM   725  C C   . LEU A 1 91  ? 26.790 29.355 30.574 1.00 9.01  ? 119  LEU A C   1 
ATOM   726  O O   . LEU A 1 91  ? 25.913 29.744 29.806 1.00 9.67  ? 119  LEU A O   1 
ATOM   727  C CB  . LEU A 1 91  ? 26.669 26.975 29.811 1.00 7.46  ? 119  LEU A CB  1 
ATOM   728  C CG  . LEU A 1 91  ? 26.387 25.488 30.068 1.00 8.85  ? 119  LEU A CG  1 
ATOM   729  C CD1 . LEU A 1 91  ? 26.130 24.788 28.738 1.00 8.63  ? 119  LEU A CD1 1 
ATOM   730  C CD2 . LEU A 1 91  ? 27.562 24.837 30.794 1.00 6.46  ? 119  LEU A CD2 1 
ATOM   731  N N   . SER A 1 92  ? 27.733 30.164 31.046 1.00 8.48  ? 120  SER A N   1 
ATOM   732  C CA  . SER A 1 92  ? 27.734 31.574 30.674 1.00 8.84  ? 120  SER A CA  1 
ATOM   733  C C   . SER A 1 92  ? 28.970 32.296 31.189 1.00 9.71  ? 120  SER A C   1 
ATOM   734  O O   . SER A 1 92  ? 29.873 31.683 31.756 1.00 10.19 ? 120  SER A O   1 
ATOM   735  C CB  . SER A 1 92  ? 26.490 32.250 31.259 1.00 9.98  ? 120  SER A CB  1 
ATOM   736  O OG  . SER A 1 92  ? 26.311 33.552 30.734 1.00 11.46 ? 120  SER A OG  1 
ATOM   737  N N   . HIS A 1 93  ? 29.012 33.605 30.967 1.00 10.68 ? 121  HIS A N   1 
ATOM   738  C CA  . HIS A 1 93  ? 30.110 34.410 31.477 1.00 11.42 ? 121  HIS A CA  1 
ATOM   739  C C   . HIS A 1 93  ? 29.750 34.567 32.948 1.00 11.46 ? 121  HIS A C   1 
ATOM   740  O O   . HIS A 1 93  ? 28.594 34.377 33.330 1.00 10.50 ? 121  HIS A O   1 
ATOM   741  C CB  . HIS A 1 93  ? 30.138 35.793 30.814 1.00 11.96 ? 121  HIS A CB  1 
ATOM   742  C CG  . HIS A 1 93  ? 30.639 35.785 29.403 1.00 12.98 ? 121  HIS A CG  1 
ATOM   743  N ND1 . HIS A 1 93  ? 31.909 35.370 29.067 1.00 14.40 ? 121  HIS A ND1 1 
ATOM   744  C CD2 . HIS A 1 93  ? 30.046 36.157 28.244 1.00 13.59 ? 121  HIS A CD2 1 
ATOM   745  C CE1 . HIS A 1 93  ? 32.077 35.486 27.761 1.00 15.05 ? 121  HIS A CE1 1 
ATOM   746  N NE2 . HIS A 1 93  ? 30.960 35.961 27.239 1.00 13.93 ? 121  HIS A NE2 1 
ATOM   747  N N   . GLY A 1 94  ? 30.724 34.905 33.779 1.00 11.11 ? 122  GLY A N   1 
ATOM   748  C CA  . GLY A 1 94  ? 30.422 35.082 35.182 1.00 11.27 ? 122  GLY A CA  1 
ATOM   749  C C   . GLY A 1 94  ? 31.592 35.619 35.969 1.00 12.19 ? 122  GLY A C   1 
ATOM   750  O O   . GLY A 1 94  ? 32.676 35.818 35.431 1.00 11.90 ? 122  GLY A O   1 
ATOM   751  N N   . GLU A 1 95  ? 31.345 35.879 37.246 1.00 12.83 ? 123  GLU A N   1 
ATOM   752  C CA  . GLU A 1 95  ? 32.365 36.363 38.162 1.00 14.37 ? 123  GLU A CA  1 
ATOM   753  C C   . GLU A 1 95  ? 32.022 35.684 39.471 1.00 13.96 ? 123  GLU A C   1 
ATOM   754  O O   . GLU A 1 95  ? 31.035 34.955 39.544 1.00 13.62 ? 123  GLU A O   1 
ATOM   755  C CB  . GLU A 1 95  ? 32.287 37.879 38.331 1.00 17.29 ? 123  GLU A CB  1 
ATOM   756  C CG  . GLU A 1 95  ? 32.240 38.649 37.032 1.00 23.42 ? 123  GLU A CG  1 
ATOM   757  C CD  . GLU A 1 95  ? 32.560 40.109 37.234 1.00 27.26 ? 123  GLU A CD  1 
ATOM   758  O OE1 . GLU A 1 95  ? 32.212 40.644 38.308 1.00 27.78 ? 123  GLU A OE1 1 
ATOM   759  O OE2 . GLU A 1 95  ? 33.151 40.723 36.321 1.00 30.92 ? 123  GLU A OE2 1 
ATOM   760  N N   . GLU A 1 96  ? 32.813 35.917 40.509 1.00 13.17 ? 124  GLU A N   1 
ATOM   761  C CA  . GLU A 1 96  ? 32.530 35.274 41.783 1.00 13.87 ? 124  GLU A CA  1 
ATOM   762  C C   . GLU A 1 96  ? 31.099 35.555 42.248 1.00 14.84 ? 124  GLU A C   1 
ATOM   763  O O   . GLU A 1 96  ? 30.711 36.710 42.434 1.00 13.87 ? 124  GLU A O   1 
ATOM   764  C CB  . GLU A 1 96  ? 33.523 35.737 42.850 1.00 15.09 ? 124  GLU A CB  1 
ATOM   765  C CG  . GLU A 1 96  ? 33.452 34.918 44.126 1.00 15.45 ? 124  GLU A CG  1 
ATOM   766  C CD  . GLU A 1 96  ? 33.880 33.477 43.915 1.00 19.03 ? 124  GLU A CD  1 
ATOM   767  O OE1 . GLU A 1 96  ? 35.092 33.234 43.721 1.00 17.11 ? 124  GLU A OE1 1 
ATOM   768  O OE2 . GLU A 1 96  ? 33.005 32.588 43.938 1.00 19.27 ? 124  GLU A OE2 1 
ATOM   769  N N   . GLY A 1 97  ? 30.325 34.486 42.419 1.00 13.64 ? 125  GLY A N   1 
ATOM   770  C CA  . GLY A 1 97  ? 28.950 34.595 42.878 1.00 13.87 ? 125  GLY A CA  1 
ATOM   771  C C   . GLY A 1 97  ? 27.939 35.121 41.873 1.00 13.80 ? 125  GLY A C   1 
ATOM   772  O O   . GLY A 1 97  ? 26.776 35.342 42.214 1.00 13.88 ? 125  GLY A O   1 
ATOM   773  N N   . ILE A 1 98  ? 28.366 35.301 40.629 1.00 13.38 ? 126  ILE A N   1 
ATOM   774  C CA  . ILE A 1 98  ? 27.482 35.832 39.601 1.00 13.93 ? 126  ILE A CA  1 
ATOM   775  C C   . ILE A 1 98  ? 27.487 35.036 38.303 1.00 12.69 ? 126  ILE A C   1 
ATOM   776  O O   . ILE A 1 98  ? 28.509 34.490 37.902 1.00 13.74 ? 126  ILE A O   1 
ATOM   777  C CB  . ILE A 1 98  ? 27.873 37.293 39.261 1.00 15.07 ? 126  ILE A CB  1 
ATOM   778  C CG1 . ILE A 1 98  ? 27.640 38.192 40.477 1.00 16.72 ? 126  ILE A CG1 1 
ATOM   779  C CG2 . ILE A 1 98  ? 27.088 37.782 38.052 1.00 17.66 ? 126  ILE A CG2 1 
ATOM   780  C CD1 . ILE A 1 98  ? 28.153 39.607 40.290 1.00 20.36 ? 126  ILE A CD1 1 
ATOM   781  N N   . ILE A 1 99  ? 26.326 34.978 37.659 1.00 12.65 ? 127  ILE A N   1 
ATOM   782  C CA  . ILE A 1 99  ? 26.175 34.302 36.377 1.00 13.94 ? 127  ILE A CA  1 
ATOM   783  C C   . ILE A 1 99  ? 25.499 35.333 35.472 1.00 12.91 ? 127  ILE A C   1 
ATOM   784  O O   . ILE A 1 99  ? 24.550 36.002 35.882 1.00 13.87 ? 127  ILE A O   1 
ATOM   785  C CB  . ILE A 1 99  ? 25.296 33.029 36.499 1.00 14.69 ? 127  ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 99  ? 25.371 32.221 35.201 1.00 15.99 ? 127  ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 99  ? 23.855 33.400 36.811 1.00 15.59 ? 127  ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 99  ? 26.746 31.625 34.923 1.00 16.42 ? 127  ILE A CD1 1 
ATOM   789  N N   . PHE A 1 100 ? 25.983 35.480 34.246 1.00 12.30 ? 128  PHE A N   1 
ATOM   790  C CA  . PHE A 1 100 ? 25.399 36.480 33.366 1.00 12.73 ? 128  PHE A CA  1 
ATOM   791  C C   . PHE A 1 100 ? 24.269 36.064 32.452 1.00 12.54 ? 128  PHE A C   1 
ATOM   792  O O   . PHE A 1 100 ? 24.355 35.063 31.742 1.00 11.05 ? 128  PHE A O   1 
ATOM   793  C CB  . PHE A 1 100 ? 26.475 37.136 32.501 1.00 13.71 ? 128  PHE A CB  1 
ATOM   794  C CG  . PHE A 1 100 ? 27.321 38.125 33.236 1.00 16.35 ? 128  PHE A CG  1 
ATOM   795  C CD1 . PHE A 1 100 ? 28.471 37.719 33.903 1.00 17.82 ? 128  PHE A CD1 1 
ATOM   796  C CD2 . PHE A 1 100 ? 26.958 39.468 33.277 1.00 17.60 ? 128  PHE A CD2 1 
ATOM   797  C CE1 . PHE A 1 100 ? 29.253 38.638 34.601 1.00 18.42 ? 128  PHE A CE1 1 
ATOM   798  C CE2 . PHE A 1 100 ? 27.732 40.395 33.973 1.00 19.25 ? 128  PHE A CE2 1 
ATOM   799  C CZ  . PHE A 1 100 ? 28.881 39.978 34.636 1.00 19.02 ? 128  PHE A CZ  1 
ATOM   800  N N   . GLY A 1 101 ? 23.202 36.856 32.486 1.00 11.86 ? 129  GLY A N   1 
ATOM   801  C CA  . GLY A 1 101 ? 22.089 36.631 31.592 1.00 12.20 ? 129  GLY A CA  1 
ATOM   802  C C   . GLY A 1 101 ? 22.585 37.349 30.348 1.00 13.29 ? 129  GLY A C   1 
ATOM   803  O O   . GLY A 1 101 ? 23.668 37.933 30.377 1.00 13.01 ? 129  GLY A O   1 
ATOM   804  N N   . THR A 1 102 ? 21.820 37.328 29.266 1.00 12.41 ? 130  THR A N   1 
ATOM   805  C CA  . THR A 1 102 ? 22.248 37.983 28.035 1.00 12.76 ? 130  THR A CA  1 
ATOM   806  C C   . THR A 1 102 ? 22.248 39.510 28.108 1.00 13.31 ? 130  THR A C   1 
ATOM   807  O O   . THR A 1 102 ? 22.831 40.173 27.252 1.00 13.84 ? 130  THR A O   1 
ATOM   808  C CB  . THR A 1 102 ? 21.356 37.560 26.859 1.00 11.59 ? 130  THR A CB  1 
ATOM   809  O OG1 . THR A 1 102 ? 19.993 37.885 27.156 1.00 13.00 ? 130  THR A OG1 1 
ATOM   810  C CG2 . THR A 1 102 ? 21.474 36.060 26.616 1.00 12.37 ? 130  THR A CG2 1 
ATOM   811  N N   . ASN A 1 103 ? 21.608 40.062 29.134 1.00 13.63 ? 131  ASN A N   1 
ATOM   812  C CA  . ASN A 1 103 ? 21.513 41.512 29.282 1.00 14.15 ? 131  ASN A CA  1 
ATOM   813  C C   . ASN A 1 103 ? 21.983 42.009 30.647 1.00 14.95 ? 131  ASN A C   1 
ATOM   814  O O   . ASN A 1 103 ? 21.760 43.165 31.007 1.00 14.38 ? 131  ASN A O   1 
ATOM   815  C CB  . ASN A 1 103 ? 20.061 41.940 29.069 1.00 14.41 ? 131  ASN A CB  1 
ATOM   816  C CG  . ASN A 1 103 ? 19.143 41.414 30.156 1.00 15.70 ? 131  ASN A CG  1 
ATOM   817  O OD1 . ASN A 1 103 ? 19.402 40.362 30.746 1.00 15.67 ? 131  ASN A OD1 1 
ATOM   818  N ND2 . ASN A 1 103 ? 18.063 42.136 30.423 1.00 14.26 ? 131  ASN A ND2 1 
ATOM   819  N N   . GLY A 1 104 ? 22.629 41.142 31.415 1.00 15.40 ? 132  GLY A N   1 
ATOM   820  C CA  . GLY A 1 104 ? 23.083 41.562 32.725 1.00 16.32 ? 132  GLY A CA  1 
ATOM   821  C C   . GLY A 1 104 ? 23.298 40.403 33.672 1.00 16.12 ? 132  GLY A C   1 
ATOM   822  O O   . GLY A 1 104 ? 22.926 39.271 33.366 1.00 15.12 ? 132  GLY A O   1 
ATOM   823  N N   . PRO A 1 105 ? 23.893 40.664 34.844 1.00 17.35 ? 133  PRO A N   1 
ATOM   824  C CA  . PRO A 1 105 ? 24.175 39.646 35.857 1.00 16.33 ? 133  PRO A CA  1 
ATOM   825  C C   . PRO A 1 105 ? 23.001 39.194 36.718 1.00 15.95 ? 133  PRO A C   1 
ATOM   826  O O   . PRO A 1 105 ? 22.009 39.905 36.886 1.00 15.09 ? 133  PRO A O   1 
ATOM   827  C CB  . PRO A 1 105 ? 25.265 40.302 36.694 1.00 17.69 ? 133  PRO A CB  1 
ATOM   828  C CG  . PRO A 1 105 ? 24.829 41.732 36.699 1.00 18.67 ? 133  PRO A CG  1 
ATOM   829  C CD  . PRO A 1 105 ? 24.464 41.965 35.243 1.00 17.80 ? 133  PRO A CD  1 
ATOM   830  N N   . VAL A 1 106 ? 23.144 37.988 37.255 1.00 14.02 ? 134  VAL A N   1 
ATOM   831  C CA  . VAL A 1 106 ? 22.163 37.384 38.140 1.00 14.66 ? 134  VAL A CA  1 
ATOM   832  C C   . VAL A 1 106 ? 22.958 36.781 39.290 1.00 14.48 ? 134  VAL A C   1 
ATOM   833  O O   . VAL A 1 106 ? 23.882 36.000 39.064 1.00 14.71 ? 134  VAL A O   1 
ATOM   834  C CB  . VAL A 1 106 ? 21.382 36.237 37.453 1.00 16.13 ? 134  VAL A CB  1 
ATOM   835  C CG1 . VAL A 1 106 ? 20.400 35.619 38.438 1.00 18.05 ? 134  VAL A CG1 1 
ATOM   836  C CG2 . VAL A 1 106 ? 20.646 36.758 36.230 1.00 16.27 ? 134  VAL A CG2 1 
ATOM   837  N N   . ASP A 1 107 ? 22.618 37.155 40.517 1.00 15.37 ? 135  ASP A N   1 
ATOM   838  C CA  . ASP A 1 107 ? 23.308 36.608 41.678 1.00 15.47 ? 135  ASP A CA  1 
ATOM   839  C C   . ASP A 1 107 ? 22.975 35.126 41.784 1.00 14.54 ? 135  ASP A C   1 
ATOM   840  O O   . ASP A 1 107 ? 21.808 34.745 41.720 1.00 13.20 ? 135  ASP A O   1 
ATOM   841  C CB  . ASP A 1 107 ? 22.856 37.317 42.954 1.00 18.28 ? 135  ASP A CB  1 
ATOM   842  C CG  . ASP A 1 107 ? 23.556 38.642 43.166 1.00 21.27 ? 135  ASP A CG  1 
ATOM   843  O OD1 . ASP A 1 107 ? 23.176 39.358 44.114 1.00 25.15 ? 135  ASP A OD1 1 
ATOM   844  O OD2 . ASP A 1 107 ? 24.487 38.966 42.398 1.00 23.37 ? 135  ASP A OD2 1 
ATOM   845  N N   . LEU A 1 108 ? 23.997 34.290 41.943 1.00 13.16 ? 136  LEU A N   1 
ATOM   846  C CA  . LEU A 1 108 ? 23.769 32.857 42.064 1.00 13.72 ? 136  LEU A CA  1 
ATOM   847  C C   . LEU A 1 108 ? 22.855 32.575 43.248 1.00 14.21 ? 136  LEU A C   1 
ATOM   848  O O   . LEU A 1 108 ? 22.010 31.681 43.196 1.00 15.03 ? 136  LEU A O   1 
ATOM   849  C CB  . LEU A 1 108 ? 25.098 32.116 42.234 1.00 15.78 ? 136  LEU A CB  1 
ATOM   850  C CG  . LEU A 1 108 ? 25.972 32.107 40.975 1.00 17.92 ? 136  LEU A CG  1 
ATOM   851  C CD1 . LEU A 1 108 ? 27.324 31.474 41.273 1.00 19.48 ? 136  LEU A CD1 1 
ATOM   852  C CD2 . LEU A 1 108 ? 25.250 31.343 39.869 1.00 19.59 ? 136  LEU A CD2 1 
ATOM   853  N N   . LYS A 1 109 ? 23.016 33.355 44.311 1.00 13.86 ? 137  LYS A N   1 
ATOM   854  C CA  . LYS A 1 109 ? 22.203 33.184 45.506 1.00 14.88 ? 137  LYS A CA  1 
ATOM   855  C C   . LYS A 1 109 ? 20.715 33.352 45.196 1.00 14.51 ? 137  LYS A C   1 
ATOM   856  O O   . LYS A 1 109 ? 19.874 32.647 45.753 1.00 14.07 ? 137  LYS A O   1 
ATOM   857  C CB  . LYS A 1 109 ? 22.626 34.194 46.577 1.00 17.18 ? 137  LYS A CB  1 
ATOM   858  C CG  . LYS A 1 109 ? 22.303 33.758 47.995 1.00 21.97 ? 137  LYS A CG  1 
ATOM   859  C CD  . LYS A 1 109 ? 23.092 32.509 48.366 1.00 23.60 ? 137  LYS A CD  1 
ATOM   860  C CE  . LYS A 1 109 ? 22.714 32.006 49.747 1.00 24.96 ? 137  LYS A CE  1 
ATOM   861  N NZ  . LYS A 1 109 ? 23.427 30.747 50.084 1.00 25.96 ? 137  LYS A NZ  1 
ATOM   862  N N   . LYS A 1 110 ? 20.390 34.284 44.306 1.00 14.39 ? 138  LYS A N   1 
ATOM   863  C CA  . LYS A 1 110 ? 18.996 34.520 43.944 1.00 16.42 ? 138  LYS A CA  1 
ATOM   864  C C   . LYS A 1 110 ? 18.412 33.294 43.248 1.00 16.02 ? 138  LYS A C   1 
ATOM   865  O O   . LYS A 1 110 ? 17.241 32.957 43.431 1.00 18.13 ? 138  LYS A O   1 
ATOM   866  C CB  . LYS A 1 110 ? 18.882 35.742 43.029 1.00 18.74 ? 138  LYS A CB  1 
ATOM   867  C CG  . LYS A 1 110 ? 17.445 36.152 42.754 1.00 22.19 ? 138  LYS A CG  1 
ATOM   868  C CD  . LYS A 1 110 ? 17.366 37.490 42.044 1.00 25.06 ? 138  LYS A CD  1 
ATOM   869  C CE  . LYS A 1 110 ? 15.923 37.956 41.925 1.00 27.37 ? 138  LYS A CE  1 
ATOM   870  N NZ  . LYS A 1 110 ? 15.820 39.288 41.266 1.00 29.50 ? 138  LYS A NZ  1 
ATOM   871  N N   . ILE A 1 111 ? 19.240 32.626 42.455 1.00 15.20 ? 139  ILE A N   1 
ATOM   872  C CA  . ILE A 1 111 ? 18.819 31.431 41.735 1.00 14.42 ? 139  ILE A CA  1 
ATOM   873  C C   . ILE A 1 111 ? 18.639 30.246 42.683 1.00 14.08 ? 139  ILE A C   1 
ATOM   874  O O   . ILE A 1 111 ? 17.606 29.579 42.665 1.00 14.60 ? 139  ILE A O   1 
ATOM   875  C CB  . ILE A 1 111 ? 19.856 31.047 40.652 1.00 15.02 ? 139  ILE A CB  1 
ATOM   876  C CG1 . ILE A 1 111 ? 19.877 32.113 39.555 1.00 16.97 ? 139  ILE A CG1 1 
ATOM   877  C CG2 . ILE A 1 111 ? 19.532 29.671 40.073 1.00 16.99 ? 139  ILE A CG2 1 
ATOM   878  C CD1 . ILE A 1 111 ? 20.916 31.873 38.482 1.00 15.64 ? 139  ILE A CD1 1 
ATOM   879  N N   . THR A 1 112 ? 19.640 29.993 43.519 1.00 13.16 ? 140  THR A N   1 
ATOM   880  C CA  . THR A 1 112 ? 19.579 28.868 44.444 1.00 13.30 ? 140  THR A CA  1 
ATOM   881  C C   . THR A 1 112 ? 18.573 29.024 45.583 1.00 13.28 ? 140  THR A C   1 
ATOM   882  O O   . THR A 1 112 ? 18.058 28.028 46.095 1.00 12.72 ? 140  THR A O   1 
ATOM   883  C CB  . THR A 1 112 ? 20.976 28.563 45.043 1.00 14.56 ? 140  THR A CB  1 
ATOM   884  O OG1 . THR A 1 112 ? 21.467 29.711 45.745 1.00 15.75 ? 140  THR A OG1 1 
ATOM   885  C CG2 . THR A 1 112 ? 21.955 28.191 43.934 1.00 15.20 ? 140  THR A CG2 1 
ATOM   886  N N   . ASN A 1 113 ? 18.282 30.261 45.981 1.00 13.12 ? 141  ASN A N   1 
ATOM   887  C CA  . ASN A 1 113 ? 17.332 30.483 47.071 1.00 14.03 ? 141  ASN A CA  1 
ATOM   888  C C   . ASN A 1 113 ? 15.957 29.895 46.794 1.00 12.51 ? 141  ASN A C   1 
ATOM   889  O O   . ASN A 1 113 ? 15.260 29.476 47.719 1.00 11.98 ? 141  ASN A O   1 
ATOM   890  C CB  . ASN A 1 113 ? 17.184 31.977 47.385 1.00 15.52 ? 141  ASN A CB  1 
ATOM   891  C CG  . ASN A 1 113 ? 18.284 32.495 48.295 1.00 18.51 ? 141  ASN A CG  1 
ATOM   892  O OD1 . ASN A 1 113 ? 18.914 31.729 49.023 1.00 19.40 ? 141  ASN A OD1 1 
ATOM   893  N ND2 . ASN A 1 113 ? 18.504 33.804 48.273 1.00 19.56 ? 141  ASN A ND2 1 
ATOM   894  N N   . PHE A 1 114 ? 15.564 29.858 45.524 1.00 11.72 ? 142  PHE A N   1 
ATOM   895  C CA  . PHE A 1 114 ? 14.263 29.309 45.159 1.00 11.52 ? 142  PHE A CA  1 
ATOM   896  C C   . PHE A 1 114 ? 14.147 27.849 45.575 1.00 11.63 ? 142  PHE A C   1 
ATOM   897  O O   . PHE A 1 114 ? 13.044 27.339 45.786 1.00 12.70 ? 142  PHE A O   1 
ATOM   898  C CB  . PHE A 1 114 ? 14.044 29.395 43.646 1.00 13.14 ? 142  PHE A CB  1 
ATOM   899  C CG  . PHE A 1 114 ? 13.819 30.789 43.135 1.00 12.59 ? 142  PHE A CG  1 
ATOM   900  C CD1 . PHE A 1 114 ? 12.719 31.530 43.558 1.00 14.67 ? 142  PHE A CD1 1 
ATOM   901  C CD2 . PHE A 1 114 ? 14.688 31.348 42.204 1.00 13.60 ? 142  PHE A CD2 1 
ATOM   902  C CE1 . PHE A 1 114 ? 12.486 32.811 43.059 1.00 15.58 ? 142  PHE A CE1 1 
ATOM   903  C CE2 . PHE A 1 114 ? 14.465 32.631 41.698 1.00 15.12 ? 142  PHE A CE2 1 
ATOM   904  C CZ  . PHE A 1 114 ? 13.362 33.363 42.126 1.00 14.34 ? 142  PHE A CZ  1 
ATOM   905  N N   . PHE A 1 115 ? 15.292 27.187 45.698 1.00 9.65  ? 143  PHE A N   1 
ATOM   906  C CA  . PHE A 1 115 ? 15.332 25.772 46.038 1.00 9.89  ? 143  PHE A CA  1 
ATOM   907  C C   . PHE A 1 115 ? 15.687 25.456 47.486 1.00 10.16 ? 143  PHE A C   1 
ATOM   908  O O   . PHE A 1 115 ? 15.906 24.294 47.833 1.00 12.67 ? 143  PHE A O   1 
ATOM   909  C CB  . PHE A 1 115 ? 16.292 25.067 45.078 1.00 9.71  ? 143  PHE A CB  1 
ATOM   910  C CG  . PHE A 1 115 ? 15.899 25.211 43.635 1.00 10.84 ? 143  PHE A CG  1 
ATOM   911  C CD1 . PHE A 1 115 ? 14.979 24.338 43.060 1.00 11.56 ? 143  PHE A CD1 1 
ATOM   912  C CD2 . PHE A 1 115 ? 16.397 26.260 42.867 1.00 11.71 ? 143  PHE A CD2 1 
ATOM   913  C CE1 . PHE A 1 115 ? 14.557 24.512 41.735 1.00 11.15 ? 143  PHE A CE1 1 
ATOM   914  C CE2 . PHE A 1 115 ? 15.984 26.444 41.546 1.00 10.23 ? 143  PHE A CE2 1 
ATOM   915  C CZ  . PHE A 1 115 ? 15.060 25.568 40.979 1.00 11.99 ? 143  PHE A CZ  1 
ATOM   916  N N   . ARG A 1 116 ? 15.735 26.484 48.330 1.00 10.88 ? 144  ARG A N   1 
ATOM   917  C CA  . ARG A 1 116 ? 16.032 26.298 49.748 1.00 13.07 ? 144  ARG A CA  1 
ATOM   918  C C   . ARG A 1 116 ? 15.083 25.264 50.348 1.00 13.75 ? 144  ARG A C   1 
ATOM   919  O O   . ARG A 1 116 ? 13.959 25.093 49.874 1.00 14.00 ? 144  ARG A O   1 
ATOM   920  C CB  . ARG A 1 116 ? 15.877 27.621 50.503 1.00 13.87 ? 144  ARG A CB  1 
ATOM   921  C CG  . ARG A 1 116 ? 17.109 28.501 50.473 1.00 18.05 ? 144  ARG A CG  1 
ATOM   922  C CD  . ARG A 1 116 ? 16.823 29.892 51.019 1.00 19.11 ? 144  ARG A CD  1 
ATOM   923  N NE  . ARG A 1 116 ? 16.028 29.871 52.246 1.00 21.68 ? 144  ARG A NE  1 
ATOM   924  C CZ  . ARG A 1 116 ? 15.994 30.870 53.124 1.00 24.00 ? 144  ARG A CZ  1 
ATOM   925  N NH1 . ARG A 1 116 ? 16.717 31.963 52.912 1.00 23.54 ? 144  ARG A NH1 1 
ATOM   926  N NH2 . ARG A 1 116 ? 15.236 30.782 54.208 1.00 25.08 ? 144  ARG A NH2 1 
ATOM   927  N N   . GLY A 1 117 ? 15.539 24.584 51.396 1.00 12.47 ? 145  GLY A N   1 
ATOM   928  C CA  . GLY A 1 117 ? 14.723 23.567 52.033 1.00 12.82 ? 145  GLY A CA  1 
ATOM   929  C C   . GLY A 1 117 ? 13.361 24.046 52.496 1.00 13.81 ? 145  GLY A C   1 
ATOM   930  O O   . GLY A 1 117 ? 12.423 23.253 52.587 1.00 14.83 ? 145  GLY A O   1 
ATOM   931  N N   . ASP A 1 118 ? 13.245 25.339 52.787 1.00 14.64 ? 146  ASP A N   1 
ATOM   932  C CA  . ASP A 1 118 ? 11.980 25.893 53.258 1.00 16.58 ? 146  ASP A CA  1 
ATOM   933  C C   . ASP A 1 118 ? 11.150 26.561 52.164 1.00 16.83 ? 146  ASP A C   1 
ATOM   934  O O   . ASP A 1 118 ? 9.992  26.912 52.392 1.00 18.14 ? 146  ASP A O   1 
ATOM   935  C CB  . ASP A 1 118 ? 12.238 26.886 54.401 1.00 16.45 ? 146  ASP A CB  1 
ATOM   936  C CG  . ASP A 1 118 ? 13.024 28.111 53.953 1.00 16.61 ? 146  ASP A CG  1 
ATOM   937  O OD1 . ASP A 1 118 ? 13.871 27.985 53.041 1.00 14.75 ? 146  ASP A OD1 1 
ATOM   938  O OD2 . ASP A 1 118 ? 12.808 29.201 54.527 1.00 18.03 ? 146  ASP A OD2 1 
ATOM   939  N N   . ARG A 1 119 ? 11.727 26.722 50.975 1.00 17.08 ? 147  ARG A N   1 
ATOM   940  C CA  . ARG A 1 119 ? 11.009 27.365 49.876 1.00 16.90 ? 147  ARG A CA  1 
ATOM   941  C C   . ARG A 1 119 ? 10.549 26.414 48.768 1.00 16.48 ? 147  ARG A C   1 
ATOM   942  O O   . ARG A 1 119 ? 9.684  26.761 47.967 1.00 17.46 ? 147  ARG A O   1 
ATOM   943  C CB  . ARG A 1 119 ? 11.856 28.503 49.304 1.00 17.22 ? 147  ARG A CB  1 
ATOM   944  C CG  . ARG A 1 119 ? 12.113 29.593 50.337 1.00 17.62 ? 147  ARG A CG  1 
ATOM   945  C CD  . ARG A 1 119 ? 12.870 30.786 49.783 1.00 19.38 ? 147  ARG A CD  1 
ATOM   946  N NE  . ARG A 1 119 ? 13.147 31.757 50.843 1.00 19.72 ? 147  ARG A NE  1 
ATOM   947  C CZ  . ARG A 1 119 ? 13.836 32.881 50.674 1.00 21.12 ? 147  ARG A CZ  1 
ATOM   948  N NH1 . ARG A 1 119 ? 14.329 33.189 49.483 1.00 23.50 ? 147  ARG A NH1 1 
ATOM   949  N NH2 . ARG A 1 119 ? 14.032 33.700 51.699 1.00 23.21 ? 147  ARG A NH2 1 
ATOM   950  N N   . CYS A 1 120 ? 11.138 25.224 48.717 1.00 15.14 ? 148  CYS A N   1 
ATOM   951  C CA  . CYS A 1 120 ? 10.745 24.208 47.742 1.00 13.67 ? 148  CYS A CA  1 
ATOM   952  C C   . CYS A 1 120 ? 10.619 22.929 48.556 1.00 13.63 ? 148  CYS A C   1 
ATOM   953  O O   . CYS A 1 120 ? 11.538 22.115 48.607 1.00 10.69 ? 148  CYS A O   1 
ATOM   954  C CB  . CYS A 1 120 ? 11.805 24.035 46.651 1.00 13.70 ? 148  CYS A CB  1 
ATOM   955  S SG  . CYS A 1 120 ? 11.313 22.858 45.357 1.00 12.94 ? 148  CYS A SG  1 
ATOM   956  N N   . ARG A 1 121 ? 9.470  22.766 49.204 1.00 12.68 ? 149  ARG A N   1 
ATOM   957  C CA  . ARG A 1 121 ? 9.237  21.614 50.065 1.00 14.24 ? 149  ARG A CA  1 
ATOM   958  C C   . ARG A 1 121 ? 9.303  20.246 49.401 1.00 12.28 ? 149  ARG A C   1 
ATOM   959  O O   . ARG A 1 121 ? 9.679  19.271 50.048 1.00 13.27 ? 149  ARG A O   1 
ATOM   960  C CB  . ARG A 1 121 ? 7.898  21.774 50.793 1.00 16.07 ? 149  ARG A CB  1 
ATOM   961  C CG  . ARG A 1 121 ? 7.810  23.040 51.630 1.00 20.37 ? 149  ARG A CG  1 
ATOM   962  C CD  . ARG A 1 121 ? 8.847  23.077 52.755 1.00 24.89 ? 149  ARG A CD  1 
ATOM   963  N NE  . ARG A 1 121 ? 8.515  22.195 53.875 1.00 29.14 ? 149  ARG A NE  1 
ATOM   964  C CZ  . ARG A 1 121 ? 8.815  20.900 53.942 1.00 32.02 ? 149  ARG A CZ  1 
ATOM   965  N NH1 . ARG A 1 121 ? 9.465  20.305 52.951 1.00 32.21 ? 149  ARG A NH1 1 
ATOM   966  N NH2 . ARG A 1 121 ? 8.461  20.195 55.009 1.00 34.77 ? 149  ARG A NH2 1 
ATOM   967  N N   . SER A 1 122 ? 8.942  20.159 48.123 1.00 12.20 ? 150  SER A N   1 
ATOM   968  C CA  . SER A 1 122 ? 8.987  18.870 47.440 1.00 9.81  ? 150  SER A CA  1 
ATOM   969  C C   . SER A 1 122 ? 10.420 18.437 47.125 1.00 10.16 ? 150  SER A C   1 
ATOM   970  O O   . SER A 1 122 ? 10.641 17.346 46.609 1.00 10.43 ? 150  SER A O   1 
ATOM   971  C CB  . SER A 1 122 ? 8.139  18.894 46.159 1.00 9.76  ? 150  SER A CB  1 
ATOM   972  O OG  . SER A 1 122 ? 8.515  19.948 45.300 1.00 10.23 ? 150  SER A OG  1 
ATOM   973  N N   . LEU A 1 123 ? 11.389 19.294 47.438 1.00 9.49  ? 151  LEU A N   1 
ATOM   974  C CA  . LEU A 1 123 ? 12.794 18.954 47.227 1.00 9.36  ? 151  LEU A CA  1 
ATOM   975  C C   . LEU A 1 123 ? 13.545 18.917 48.559 1.00 9.40  ? 151  LEU A C   1 
ATOM   976  O O   . LEU A 1 123 ? 14.741 18.633 48.603 1.00 9.90  ? 151  LEU A O   1 
ATOM   977  C CB  . LEU A 1 123 ? 13.469 19.944 46.267 1.00 8.20  ? 151  LEU A CB  1 
ATOM   978  C CG  . LEU A 1 123 ? 13.194 19.729 44.772 1.00 8.45  ? 151  LEU A CG  1 
ATOM   979  C CD1 . LEU A 1 123 ? 13.960 20.767 43.958 1.00 7.66  ? 151  LEU A CD1 1 
ATOM   980  C CD2 . LEU A 1 123 ? 13.616 18.317 44.361 1.00 9.37  ? 151  LEU A CD2 1 
ATOM   981  N N   . THR A 1 124 ? 12.840 19.195 49.651 1.00 9.49  ? 152  THR A N   1 
ATOM   982  C CA  . THR A 1 124 ? 13.467 19.166 50.968 1.00 9.92  ? 152  THR A CA  1 
ATOM   983  C C   . THR A 1 124 ? 14.022 17.763 51.211 1.00 10.28 ? 152  THR A C   1 
ATOM   984  O O   . THR A 1 124 ? 13.330 16.768 50.986 1.00 11.53 ? 152  THR A O   1 
ATOM   985  C CB  . THR A 1 124 ? 12.451 19.497 52.088 1.00 10.32 ? 152  THR A CB  1 
ATOM   986  O OG1 . THR A 1 124 ? 11.825 20.756 51.813 1.00 11.01 ? 152  THR A OG1 1 
ATOM   987  C CG2 . THR A 1 124 ? 13.156 19.574 53.441 1.00 10.72 ? 152  THR A CG2 1 
ATOM   988  N N   . GLY A 1 125 ? 15.273 17.685 51.657 1.00 8.99  ? 153  GLY A N   1 
ATOM   989  C CA  . GLY A 1 125 ? 15.888 16.395 51.918 1.00 8.37  ? 153  GLY A CA  1 
ATOM   990  C C   . GLY A 1 125 ? 16.430 15.695 50.680 1.00 8.50  ? 153  GLY A C   1 
ATOM   991  O O   . GLY A 1 125 ? 16.995 14.608 50.773 1.00 9.94  ? 153  GLY A O   1 
ATOM   992  N N   . LYS A 1 126 ? 16.263 16.316 49.518 1.00 8.63  ? 154  LYS A N   1 
ATOM   993  C CA  . LYS A 1 126 ? 16.736 15.742 48.261 1.00 8.82  ? 154  LYS A CA  1 
ATOM   994  C C   . LYS A 1 126 ? 17.917 16.546 47.736 1.00 7.45  ? 154  LYS A C   1 
ATOM   995  O O   . LYS A 1 126 ? 17.985 17.760 47.936 1.00 7.17  ? 154  LYS A O   1 
ATOM   996  C CB  . LYS A 1 126 ? 15.607 15.744 47.226 1.00 7.37  ? 154  LYS A CB  1 
ATOM   997  C CG  . LYS A 1 126 ? 14.427 14.861 47.602 1.00 9.50  ? 154  LYS A CG  1 
ATOM   998  C CD  . LYS A 1 126 ? 13.253 15.079 46.661 1.00 9.53  ? 154  LYS A CD  1 
ATOM   999  C CE  . LYS A 1 126 ? 12.106 14.124 46.974 1.00 10.86 ? 154  LYS A CE  1 
ATOM   1000 N NZ  . LYS A 1 126 ? 10.914 14.405 46.123 1.00 10.26 ? 154  LYS A NZ  1 
ATOM   1001 N N   . PRO A 1 127 ? 18.864 15.882 47.049 1.00 7.78  ? 155  PRO A N   1 
ATOM   1002 C CA  . PRO A 1 127 ? 20.027 16.605 46.523 1.00 7.64  ? 155  PRO A CA  1 
ATOM   1003 C C   . PRO A 1 127 ? 19.691 17.586 45.406 1.00 7.82  ? 155  PRO A C   1 
ATOM   1004 O O   . PRO A 1 127 ? 18.980 17.254 44.455 1.00 7.83  ? 155  PRO A O   1 
ATOM   1005 C CB  . PRO A 1 127 ? 20.958 15.482 46.072 1.00 7.69  ? 155  PRO A CB  1 
ATOM   1006 C CG  . PRO A 1 127 ? 20.005 14.406 45.661 1.00 9.47  ? 155  PRO A CG  1 
ATOM   1007 C CD  . PRO A 1 127 ? 18.957 14.442 46.751 1.00 7.93  ? 155  PRO A CD  1 
ATOM   1008 N N   . LYS A 1 128 ? 20.202 18.804 45.555 1.00 6.57  ? 156  LYS A N   1 
ATOM   1009 C CA  . LYS A 1 128 ? 19.997 19.883 44.601 1.00 7.24  ? 156  LYS A CA  1 
ATOM   1010 C C   . LYS A 1 128 ? 21.383 20.228 44.075 1.00 7.27  ? 156  LYS A C   1 
ATOM   1011 O O   . LYS A 1 128 ? 22.210 20.795 44.790 1.00 7.21  ? 156  LYS A O   1 
ATOM   1012 C CB  . LYS A 1 128 ? 19.348 21.073 45.315 1.00 6.09  ? 156  LYS A CB  1 
ATOM   1013 C CG  . LYS A 1 128 ? 17.929 20.767 45.807 1.00 8.69  ? 156  LYS A CG  1 
ATOM   1014 C CD  . LYS A 1 128 ? 17.416 21.817 46.785 1.00 9.03  ? 156  LYS A CD  1 
ATOM   1015 C CE  . LYS A 1 128 ? 17.808 21.498 48.225 1.00 9.11  ? 156  LYS A CE  1 
ATOM   1016 N NZ  . LYS A 1 128 ? 17.061 20.322 48.776 1.00 9.50  ? 156  LYS A NZ  1 
ATOM   1017 N N   . LEU A 1 129 ? 21.626 19.876 42.819 1.00 5.86  ? 157  LEU A N   1 
ATOM   1018 C CA  . LEU A 1 129 ? 22.930 20.071 42.203 1.00 6.89  ? 157  LEU A CA  1 
ATOM   1019 C C   . LEU A 1 129 ? 23.016 21.227 41.222 1.00 8.19  ? 157  LEU A C   1 
ATOM   1020 O O   . LEU A 1 129 ? 22.218 21.324 40.289 1.00 9.13  ? 157  LEU A O   1 
ATOM   1021 C CB  . LEU A 1 129 ? 23.341 18.783 41.481 1.00 8.26  ? 157  LEU A CB  1 
ATOM   1022 C CG  . LEU A 1 129 ? 22.993 17.456 42.171 1.00 12.74 ? 157  LEU A CG  1 
ATOM   1023 C CD1 . LEU A 1 129 ? 23.470 16.299 41.298 1.00 12.38 ? 157  LEU A CD1 1 
ATOM   1024 C CD2 . LEU A 1 129 ? 23.630 17.386 43.549 1.00 13.78 ? 157  LEU A CD2 1 
ATOM   1025 N N   . PHE A 1 130 ? 23.999 22.094 41.433 1.00 5.62  ? 158  PHE A N   1 
ATOM   1026 C CA  . PHE A 1 130 ? 24.217 23.218 40.538 1.00 5.73  ? 158  PHE A CA  1 
ATOM   1027 C C   . PHE A 1 130 ? 25.613 23.095 39.947 1.00 6.98  ? 158  PHE A C   1 
ATOM   1028 O O   . PHE A 1 130 ? 26.616 23.120 40.666 1.00 6.99  ? 158  PHE A O   1 
ATOM   1029 C CB  . PHE A 1 130 ? 24.032 24.544 41.279 1.00 7.85  ? 158  PHE A CB  1 
ATOM   1030 C CG  . PHE A 1 130 ? 22.606 24.807 41.677 1.00 7.24  ? 158  PHE A CG  1 
ATOM   1031 C CD1 . PHE A 1 130 ? 22.058 24.192 42.800 1.00 7.52  ? 158  PHE A CD1 1 
ATOM   1032 C CD2 . PHE A 1 130 ? 21.791 25.618 40.891 1.00 9.09  ? 158  PHE A CD2 1 
ATOM   1033 C CE1 . PHE A 1 130 ? 20.715 24.377 43.134 1.00 8.00  ? 158  PHE A CE1 1 
ATOM   1034 C CE2 . PHE A 1 130 ? 20.444 25.810 41.216 1.00 8.89  ? 158  PHE A CE2 1 
ATOM   1035 C CZ  . PHE A 1 130 ? 19.907 25.188 42.338 1.00 7.88  ? 158  PHE A CZ  1 
ATOM   1036 N N   . ILE A 1 131 ? 25.652 22.926 38.628 1.00 6.00  ? 159  ILE A N   1 
ATOM   1037 C CA  . ILE A 1 131 ? 26.894 22.763 37.876 1.00 6.68  ? 159  ILE A CA  1 
ATOM   1038 C C   . ILE A 1 131 ? 27.148 24.074 37.148 1.00 7.72  ? 159  ILE A C   1 
ATOM   1039 O O   . ILE A 1 131 ? 26.367 24.480 36.292 1.00 7.99  ? 159  ILE A O   1 
ATOM   1040 C CB  . ILE A 1 131 ? 26.752 21.590 36.891 1.00 7.77  ? 159  ILE A CB  1 
ATOM   1041 C CG1 . ILE A 1 131 ? 26.422 20.318 37.684 1.00 8.36  ? 159  ILE A CG1 1 
ATOM   1042 C CG2 . ILE A 1 131 ? 28.037 21.405 36.101 1.00 8.64  ? 159  ILE A CG2 1 
ATOM   1043 C CD1 . ILE A 1 131 ? 26.019 19.124 36.843 1.00 9.54  ? 159  ILE A CD1 1 
ATOM   1044 N N   . ILE A 1 132 ? 28.255 24.725 37.488 1.00 7.43  ? 160  ILE A N   1 
ATOM   1045 C CA  . ILE A 1 132 ? 28.548 26.040 36.939 1.00 7.62  ? 160  ILE A CA  1 
ATOM   1046 C C   . ILE A 1 132 ? 29.829 26.223 36.138 1.00 8.24  ? 160  ILE A C   1 
ATOM   1047 O O   . ILE A 1 132 ? 30.931 26.101 36.671 1.00 8.07  ? 160  ILE A O   1 
ATOM   1048 C CB  . ILE A 1 132 ? 28.547 27.069 38.084 1.00 9.65  ? 160  ILE A CB  1 
ATOM   1049 C CG1 . ILE A 1 132 ? 27.256 26.917 38.898 1.00 10.59 ? 160  ILE A CG1 1 
ATOM   1050 C CG2 . ILE A 1 132 ? 28.670 28.484 37.528 1.00 9.58  ? 160  ILE A CG2 1 
ATOM   1051 C CD1 . ILE A 1 132 ? 27.270 27.631 40.227 1.00 14.74 ? 160  ILE A CD1 1 
ATOM   1052 N N   . GLN A 1 133 ? 29.661 26.528 34.854 1.00 8.23  ? 161  GLN A N   1 
ATOM   1053 C CA  . GLN A 1 133 ? 30.779 26.790 33.955 1.00 9.43  ? 161  GLN A CA  1 
ATOM   1054 C C   . GLN A 1 133 ? 30.766 28.299 33.745 1.00 9.67  ? 161  GLN A C   1 
ATOM   1055 O O   . GLN A 1 133 ? 29.943 28.824 32.992 1.00 10.19 ? 161  GLN A O   1 
ATOM   1056 C CB  . GLN A 1 133 ? 30.584 26.060 32.621 1.00 10.15 ? 161  GLN A CB  1 
ATOM   1057 C CG  . GLN A 1 133 ? 31.535 26.487 31.500 1.00 10.28 ? 161  GLN A CG  1 
ATOM   1058 C CD  . GLN A 1 133 ? 32.997 26.454 31.912 1.00 10.63 ? 161  GLN A CD  1 
ATOM   1059 O OE1 . GLN A 1 133 ? 33.443 25.527 32.584 1.00 9.65  ? 161  GLN A OE1 1 
ATOM   1060 N NE2 . GLN A 1 133 ? 33.752 27.463 31.496 1.00 10.91 ? 161  GLN A NE2 1 
ATOM   1061 N N   . ALA A 1 134 ? 31.670 28.984 34.437 1.00 8.96  ? 162  ALA A N   1 
ATOM   1062 C CA  . ALA A 1 134 ? 31.788 30.438 34.366 1.00 10.55 ? 162  ALA A CA  1 
ATOM   1063 C C   . ALA A 1 134 ? 33.000 30.886 35.170 1.00 11.23 ? 162  ALA A C   1 
ATOM   1064 O O   . ALA A 1 134 ? 33.480 30.157 36.037 1.00 11.47 ? 162  ALA A O   1 
ATOM   1065 C CB  . ALA A 1 134 ? 30.531 31.092 34.929 1.00 10.27 ? 162  ALA A CB  1 
ATOM   1066 N N   . CYS A 1 135 ? 33.492 32.088 34.887 1.00 13.20 ? 163  CYS A N   1 
ATOM   1067 C CA  . CYS A 1 135 ? 34.640 32.624 35.612 1.00 13.49 ? 163  CYS A CA  1 
ATOM   1068 C C   . CYS A 1 135 ? 34.234 32.948 37.039 1.00 12.57 ? 163  CYS A C   1 
ATOM   1069 O O   . CYS A 1 135 ? 33.054 33.146 37.331 1.00 13.94 ? 163  CYS A O   1 
ATOM   1070 C CB  . CYS A 1 135 ? 35.168 33.900 34.946 1.00 14.74 ? 163  CYS A CB  1 
ATOM   1071 S SG  . CYS A 1 135 ? 36.074 33.622 33.412 1.00 16.95 ? 163  CYS A SG  1 
ATOM   1072 N N   . ARG A 1 136 ? 35.219 32.992 37.928 1.00 10.88 ? 164  ARG A N   1 
ATOM   1073 C CA  . ARG A 1 136 ? 34.971 33.313 39.328 1.00 11.56 ? 164  ARG A CA  1 
ATOM   1074 C C   . ARG A 1 136 ? 35.972 34.380 39.748 1.00 11.13 ? 164  ARG A C   1 
ATOM   1075 O O   . ARG A 1 136 ? 36.183 34.626 40.934 1.00 12.03 ? 164  ARG A O   1 
ATOM   1076 C CB  . ARG A 1 136 ? 35.131 32.064 40.199 1.00 11.33 ? 164  ARG A CB  1 
ATOM   1077 C CG  . ARG A 1 136 ? 34.187 30.928 39.821 1.00 12.37 ? 164  ARG A CG  1 
ATOM   1078 C CD  . ARG A 1 136 ? 34.334 29.751 40.768 1.00 11.17 ? 164  ARG A CD  1 
ATOM   1079 N NE  . ARG A 1 136 ? 33.912 30.086 42.125 1.00 12.02 ? 164  ARG A NE  1 
ATOM   1080 C CZ  . ARG A 1 136 ? 34.091 29.295 43.179 1.00 11.45 ? 164  ARG A CZ  1 
ATOM   1081 N NH1 . ARG A 1 136 ? 34.687 28.119 43.035 1.00 11.88 ? 164  ARG A NH1 1 
ATOM   1082 N NH2 . ARG A 1 136 ? 33.670 29.678 44.379 1.00 12.67 ? 164  ARG A NH2 1 
ATOM   1083 N N   . GLY A 1 137 ? 36.582 35.015 38.753 1.00 11.14 ? 165  GLY A N   1 
ATOM   1084 C CA  . GLY A 1 137 ? 37.568 36.044 39.019 1.00 11.97 ? 165  GLY A CA  1 
ATOM   1085 C C   . GLY A 1 137 ? 38.521 36.221 37.850 1.00 12.67 ? 165  GLY A C   1 
ATOM   1086 O O   . GLY A 1 137 ? 38.276 35.704 36.759 1.00 12.08 ? 165  GLY A O   1 
ATOM   1087 N N   . THR A 1 138 ? 39.611 36.949 38.080 1.00 12.61 ? 166  THR A N   1 
ATOM   1088 C CA  . THR A 1 138 ? 40.601 37.206 37.039 1.00 13.61 ? 166  THR A CA  1 
ATOM   1089 C C   . THR A 1 138 ? 41.976 36.623 37.327 1.00 13.63 ? 166  THR A C   1 
ATOM   1090 O O   . THR A 1 138 ? 42.962 37.025 36.712 1.00 14.39 ? 166  THR A O   1 
ATOM   1091 C CB  . THR A 1 138 ? 40.797 38.712 36.811 1.00 13.96 ? 166  THR A CB  1 
ATOM   1092 O OG1 . THR A 1 138 ? 41.082 39.352 38.059 1.00 13.79 ? 166  THR A OG1 1 
ATOM   1093 C CG2 . THR A 1 138 ? 39.569 39.317 36.205 1.00 15.27 ? 166  THR A CG2 1 
ATOM   1094 N N   . GLU A 1 139 ? 42.063 35.688 38.261 1.00 12.85 ? 167  GLU A N   1 
ATOM   1095 C CA  . GLU A 1 139 ? 43.361 35.102 38.556 1.00 12.82 ? 167  GLU A CA  1 
ATOM   1096 C C   . GLU A 1 139 ? 43.690 34.008 37.551 1.00 11.63 ? 167  GLU A C   1 
ATOM   1097 O O   . GLU A 1 139 ? 42.798 33.339 37.028 1.00 10.16 ? 167  GLU A O   1 
ATOM   1098 C CB  . GLU A 1 139 ? 43.388 34.539 39.975 1.00 13.90 ? 167  GLU A CB  1 
ATOM   1099 C CG  . GLU A 1 139 ? 43.247 35.604 41.046 1.00 17.46 ? 167  GLU A CG  1 
ATOM   1100 C CD  . GLU A 1 139 ? 43.442 35.050 42.441 1.00 20.29 ? 167  GLU A CD  1 
ATOM   1101 O OE1 . GLU A 1 139 ? 44.541 34.530 42.721 1.00 20.68 ? 167  GLU A OE1 1 
ATOM   1102 O OE2 . GLU A 1 139 ? 42.499 35.137 43.254 1.00 23.92 ? 167  GLU A OE2 1 
ATOM   1103 N N   . LEU A 1 140 ? 44.979 33.850 37.275 1.00 11.80 ? 168  LEU A N   1 
ATOM   1104 C CA  . LEU A 1 140 ? 45.446 32.839 36.336 1.00 13.69 ? 168  LEU A CA  1 
ATOM   1105 C C   . LEU A 1 140 ? 46.388 31.896 37.068 1.00 12.37 ? 168  LEU A C   1 
ATOM   1106 O O   . LEU A 1 140 ? 47.207 32.327 37.878 1.00 15.76 ? 168  LEU A O   1 
ATOM   1107 C CB  . LEU A 1 140 ? 46.167 33.504 35.157 1.00 15.95 ? 168  LEU A CB  1 
ATOM   1108 C CG  . LEU A 1 140 ? 45.279 34.296 34.187 1.00 17.51 ? 168  LEU A CG  1 
ATOM   1109 C CD1 . LEU A 1 140 ? 46.133 35.219 33.332 1.00 20.39 ? 168  LEU A CD1 1 
ATOM   1110 C CD2 . LEU A 1 140 ? 44.484 33.337 33.314 1.00 17.61 ? 168  LEU A CD2 1 
ATOM   1111 N N   . ASP A 1 141 ? 46.259 30.605 36.786 1.00 11.96 ? 169  ASP A N   1 
ATOM   1112 C CA  . ASP A 1 141 ? 47.086 29.590 37.425 1.00 10.69 ? 169  ASP A CA  1 
ATOM   1113 C C   . ASP A 1 141 ? 48.222 29.200 36.478 1.00 11.77 ? 169  ASP A C   1 
ATOM   1114 O O   . ASP A 1 141 ? 47.991 28.566 35.446 1.00 11.80 ? 169  ASP A O   1 
ATOM   1115 C CB  . ASP A 1 141 ? 46.228 28.364 37.748 1.00 9.70  ? 169  ASP A CB  1 
ATOM   1116 C CG  . ASP A 1 141 ? 46.895 27.423 38.728 1.00 11.14 ? 169  ASP A CG  1 
ATOM   1117 O OD1 . ASP A 1 141 ? 48.094 27.129 38.547 1.00 11.22 ? 169  ASP A OD1 1 
ATOM   1118 O OD2 . ASP A 1 141 ? 46.212 26.972 39.674 1.00 10.53 ? 169  ASP A OD2 1 
ATOM   1119 N N   . CYS A 1 142 ? 49.448 29.579 36.827 1.00 11.75 ? 170  CYS A N   1 
ATOM   1120 C CA  . CYS A 1 142 ? 50.598 29.272 35.981 1.00 13.27 ? 170  CYS A CA  1 
ATOM   1121 C C   . CYS A 1 142 ? 51.028 27.815 36.076 1.00 12.60 ? 170  CYS A C   1 
ATOM   1122 O O   . CYS A 1 142 ? 51.856 27.351 35.288 1.00 12.49 ? 170  CYS A O   1 
ATOM   1123 C CB  . CYS A 1 142 ? 51.767 30.190 36.334 1.00 17.88 ? 170  CYS A CB  1 
ATOM   1124 S SG  . CYS A 1 142 ? 51.452 31.926 35.935 1.00 28.13 ? 170  CYS A SG  1 
ATOM   1125 N N   . GLY A 1 143 ? 50.461 27.098 37.040 1.00 11.16 ? 171  GLY A N   1 
ATOM   1126 C CA  . GLY A 1 143 ? 50.782 25.694 37.217 1.00 10.53 ? 171  GLY A CA  1 
ATOM   1127 C C   . GLY A 1 143 ? 52.197 25.428 37.699 1.00 12.78 ? 171  GLY A C   1 
ATOM   1128 O O   . GLY A 1 143 ? 52.990 26.351 37.880 1.00 13.34 ? 171  GLY A O   1 
ATOM   1129 N N   . ILE A 1 144 ? 52.503 24.154 37.921 1.00 12.42 ? 172  ILE A N   1 
ATOM   1130 C CA  . ILE A 1 144 ? 53.829 23.741 38.361 1.00 14.31 ? 172  ILE A CA  1 
ATOM   1131 C C   . ILE A 1 144 ? 54.152 22.398 37.721 1.00 16.38 ? 172  ILE A C   1 
ATOM   1132 O O   . ILE A 1 144 ? 53.314 21.495 37.698 1.00 15.19 ? 172  ILE A O   1 
ATOM   1133 C CB  . ILE A 1 144 ? 53.908 23.617 39.909 1.00 14.64 ? 172  ILE A CB  1 
ATOM   1134 C CG1 . ILE A 1 144 ? 55.311 23.165 40.329 1.00 15.57 ? 172  ILE A CG1 1 
ATOM   1135 C CG2 . ILE A 1 144 ? 52.857 22.641 40.416 1.00 14.88 ? 172  ILE A CG2 1 
ATOM   1136 C CD1 . ILE A 1 144 ? 56.406 24.154 39.964 1.00 17.20 ? 172  ILE A CD1 1 
ATOM   1137 N N   . GLU A 1 145 ? 55.362 22.278 37.180 1.00 19.95 ? 173  GLU A N   1 
ATOM   1138 C CA  . GLU A 1 145 ? 55.798 21.043 36.537 1.00 26.04 ? 173  GLU A CA  1 
ATOM   1139 C C   . GLU A 1 145 ? 55.844 19.907 37.550 1.00 28.08 ? 173  GLU A C   1 
ATOM   1140 O O   . GLU A 1 145 ? 56.342 20.076 38.662 1.00 28.79 ? 173  GLU A O   1 
ATOM   1141 C CB  . GLU A 1 145 ? 57.186 21.225 35.916 1.00 29.19 ? 173  GLU A CB  1 
ATOM   1142 C CG  . GLU A 1 145 ? 57.255 22.290 34.837 1.00 35.57 ? 173  GLU A CG  1 
ATOM   1143 C CD  . GLU A 1 145 ? 58.638 22.402 34.220 1.00 39.43 ? 173  GLU A CD  1 
ATOM   1144 O OE1 . GLU A 1 145 ? 59.604 22.680 34.964 1.00 41.42 ? 173  GLU A OE1 1 
ATOM   1145 O OE2 . GLU A 1 145 ? 58.760 22.212 32.990 1.00 41.60 ? 173  GLU A OE2 1 
ATOM   1146 N N   . THR A 1 146 ? 55.324 18.748 37.157 1.00 30.53 ? 174  THR A N   1 
ATOM   1147 C CA  . THR A 1 146 ? 55.302 17.585 38.036 1.00 33.31 ? 174  THR A CA  1 
ATOM   1148 C C   . THR A 1 146 ? 56.292 16.526 37.575 1.00 34.49 ? 174  THR A C   1 
ATOM   1149 O O   . THR A 1 146 ? 56.887 16.712 36.493 1.00 35.71 ? 174  THR A O   1 
ATOM   1150 C CB  . THR A 1 146 ? 53.904 16.951 38.075 1.00 34.13 ? 174  THR A CB  1 
ATOM   1151 O OG1 . THR A 1 146 ? 53.540 16.516 36.758 1.00 35.11 ? 174  THR A OG1 1 
ATOM   1152 C CG2 . THR A 1 146 ? 52.881 17.958 38.573 1.00 34.08 ? 174  THR A CG2 1 
ATOM   1153 N N   . ALA B 2 1   ? 25.430 12.716 78.719 1.00 24.59 ? 175  ALA B N   1 
ATOM   1154 C CA  . ALA B 2 1   ? 25.653 14.175 78.500 1.00 24.27 ? 175  ALA B CA  1 
ATOM   1155 C C   . ALA B 2 1   ? 24.365 14.856 78.055 1.00 23.42 ? 175  ALA B C   1 
ATOM   1156 O O   . ALA B 2 1   ? 23.467 14.214 77.508 1.00 23.26 ? 175  ALA B O   1 
ATOM   1157 C CB  . ALA B 2 1   ? 26.739 14.383 77.451 1.00 26.09 ? 175  ALA B CB  1 
ATOM   1158 N N   . SER B 2 2   ? 24.282 16.160 78.299 1.00 21.69 ? 176  SER B N   1 
ATOM   1159 C CA  . SER B 2 2   ? 23.115 16.947 77.923 1.00 20.17 ? 176  SER B CA  1 
ATOM   1160 C C   . SER B 2 2   ? 23.541 18.386 77.664 1.00 19.63 ? 176  SER B C   1 
ATOM   1161 O O   . SER B 2 2   ? 24.536 18.856 78.219 1.00 19.61 ? 176  SER B O   1 
ATOM   1162 C CB  . SER B 2 2   ? 22.055 16.906 79.031 1.00 19.63 ? 176  SER B CB  1 
ATOM   1163 O OG  . SER B 2 2   ? 22.554 17.418 80.257 1.00 16.99 ? 176  SER B OG  1 
ATOM   1164 N N   . GLY B 2 3   ? 22.786 19.081 76.819 1.00 17.86 ? 177  GLY B N   1 
ATOM   1165 C CA  . GLY B 2 3   ? 23.115 20.456 76.502 1.00 17.27 ? 177  GLY B CA  1 
ATOM   1166 C C   . GLY B 2 3   ? 21.930 21.226 75.957 1.00 16.25 ? 177  GLY B C   1 
ATOM   1167 O O   . GLY B 2 3   ? 20.846 20.674 75.768 1.00 16.75 ? 177  GLY B O   1 
ATOM   1168 N N   . VAL B 2 4   ? 22.149 22.505 75.679 1.00 16.23 ? 178  VAL B N   1 
ATOM   1169 C CA  . VAL B 2 4   ? 21.099 23.379 75.174 1.00 15.37 ? 178  VAL B CA  1 
ATOM   1170 C C   . VAL B 2 4   ? 20.915 23.369 73.660 1.00 15.12 ? 178  VAL B C   1 
ATOM   1171 O O   . VAL B 2 4   ? 19.908 23.864 73.161 1.00 15.86 ? 178  VAL B O   1 
ATOM   1172 C CB  . VAL B 2 4   ? 21.365 24.843 75.583 1.00 15.02 ? 178  VAL B CB  1 
ATOM   1173 C CG1 . VAL B 2 4   ? 21.476 24.956 77.092 1.00 13.02 ? 178  VAL B CG1 1 
ATOM   1174 C CG2 . VAL B 2 4   ? 22.646 25.342 74.917 1.00 14.62 ? 178  VAL B CG2 1 
ATOM   1175 N N   . ASP B 2 5   ? 21.868 22.799 72.928 1.00 16.06 ? 179  ASP B N   1 
ATOM   1176 C CA  . ASP B 2 5   ? 21.785 22.814 71.471 1.00 15.58 ? 179  ASP B CA  1 
ATOM   1177 C C   . ASP B 2 5   ? 21.722 21.488 70.721 1.00 16.20 ? 179  ASP B C   1 
ATOM   1178 O O   . ASP B 2 5   ? 22.066 21.436 69.541 1.00 14.20 ? 179  ASP B O   1 
ATOM   1179 C CB  . ASP B 2 5   ? 22.952 23.629 70.910 1.00 14.06 ? 179  ASP B CB  1 
ATOM   1180 C CG  . ASP B 2 5   ? 24.294 23.159 71.437 1.00 14.97 ? 179  ASP B CG  1 
ATOM   1181 O OD1 . ASP B 2 5   ? 24.434 21.951 71.714 1.00 15.42 ? 179  ASP B OD1 1 
ATOM   1182 O OD2 . ASP B 2 5   ? 25.213 23.995 71.560 1.00 13.99 ? 179  ASP B OD2 1 
ATOM   1183 N N   . ASP B 2 6   ? 21.278 20.423 71.377 1.00 17.79 ? 180  ASP B N   1 
ATOM   1184 C CA  . ASP B 2 6   ? 21.198 19.133 70.703 1.00 19.73 ? 180  ASP B CA  1 
ATOM   1185 C C   . ASP B 2 6   ? 19.921 18.381 71.058 1.00 20.34 ? 180  ASP B C   1 
ATOM   1186 O O   . ASP B 2 6   ? 19.243 18.707 72.033 1.00 19.61 ? 180  ASP B O   1 
ATOM   1187 C CB  . ASP B 2 6   ? 22.394 18.262 71.084 1.00 21.26 ? 180  ASP B CB  1 
ATOM   1188 C CG  . ASP B 2 6   ? 22.264 17.692 72.481 1.00 21.99 ? 180  ASP B CG  1 
ATOM   1189 O OD1 . ASP B 2 6   ? 22.274 18.479 73.448 1.00 23.89 ? 180  ASP B OD1 1 
ATOM   1190 O OD2 . ASP B 2 6   ? 22.136 16.458 72.612 1.00 26.45 ? 180  ASP B OD2 1 
ATOM   1191 N N   . ASP B 2 7   ? 19.608 17.373 70.251 1.00 20.33 ? 181  ASP B N   1 
ATOM   1192 C CA  . ASP B 2 7   ? 18.442 16.524 70.463 1.00 20.44 ? 181  ASP B CA  1 
ATOM   1193 C C   . ASP B 2 7   ? 17.126 17.287 70.625 1.00 20.67 ? 181  ASP B C   1 
ATOM   1194 O O   . ASP B 2 7   ? 16.422 17.126 71.624 1.00 19.37 ? 181  ASP B O   1 
ATOM   1195 C CB  . ASP B 2 7   ? 18.694 15.635 71.685 1.00 22.28 ? 181  ASP B CB  1 
ATOM   1196 C CG  . ASP B 2 7   ? 17.788 14.421 71.724 1.00 23.79 ? 181  ASP B CG  1 
ATOM   1197 O OD1 . ASP B 2 7   ? 17.336 13.981 70.644 1.00 24.51 ? 181  ASP B OD1 1 
ATOM   1198 O OD2 . ASP B 2 7   ? 17.546 13.896 72.830 1.00 24.62 ? 181  ASP B OD2 1 
ATOM   1199 N N   . MET B 2 8   ? 16.794 18.109 69.635 1.00 19.85 ? 182  MET B N   1 
ATOM   1200 C CA  . MET B 2 8   ? 15.556 18.887 69.663 1.00 20.99 ? 182  MET B CA  1 
ATOM   1201 C C   . MET B 2 8   ? 14.358 17.970 69.467 1.00 20.82 ? 182  MET B C   1 
ATOM   1202 O O   . MET B 2 8   ? 14.442 16.981 68.740 1.00 20.73 ? 182  MET B O   1 
ATOM   1203 C CB  . MET B 2 8   ? 15.559 19.940 68.549 1.00 22.56 ? 182  MET B CB  1 
ATOM   1204 C CG  . MET B 2 8   ? 16.551 21.071 68.747 1.00 24.17 ? 182  MET B CG  1 
ATOM   1205 S SD  . MET B 2 8   ? 16.178 22.049 70.209 1.00 27.79 ? 182  MET B SD  1 
ATOM   1206 C CE  . MET B 2 8   ? 17.360 21.367 71.372 1.00 26.42 ? 182  MET B CE  1 
ATOM   1207 N N   . ALA B 2 9   ? 13.243 18.301 70.112 1.00 20.19 ? 183  ALA B N   1 
ATOM   1208 C CA  . ALA B 2 9   ? 12.029 17.500 69.988 1.00 20.76 ? 183  ALA B CA  1 
ATOM   1209 C C   . ALA B 2 9   ? 11.531 17.544 68.547 1.00 21.71 ? 183  ALA B C   1 
ATOM   1210 O O   . ALA B 2 9   ? 11.169 16.519 67.969 1.00 21.02 ? 183  ALA B O   1 
ATOM   1211 C CB  . ALA B 2 9   ? 10.954 18.030 70.929 1.00 21.79 ? 183  ALA B CB  1 
ATOM   1212 N N   . CYS B 2 10  ? 11.512 18.742 67.974 1.00 21.72 ? 184  CYS B N   1 
ATOM   1213 C CA  . CYS B 2 10  ? 11.073 18.926 66.599 1.00 23.18 ? 184  CYS B CA  1 
ATOM   1214 C C   . CYS B 2 10  ? 12.306 18.920 65.706 1.00 23.48 ? 184  CYS B C   1 
ATOM   1215 O O   . CYS B 2 10  ? 13.150 19.810 65.792 1.00 22.80 ? 184  CYS B O   1 
ATOM   1216 C CB  . CYS B 2 10  ? 10.327 20.253 66.460 1.00 24.76 ? 184  CYS B CB  1 
ATOM   1217 S SG  . CYS B 2 10  ? 8.913  20.406 67.573 1.00 30.45 ? 184  CYS B SG  1 
ATOM   1218 N N   . HIS B 2 11  ? 12.411 17.906 64.855 1.00 23.35 ? 185  HIS B N   1 
ATOM   1219 C CA  . HIS B 2 11  ? 13.556 17.782 63.964 1.00 24.76 ? 185  HIS B CA  1 
ATOM   1220 C C   . HIS B 2 11  ? 13.516 18.763 62.801 1.00 22.50 ? 185  HIS B C   1 
ATOM   1221 O O   . HIS B 2 11  ? 12.499 18.907 62.123 1.00 22.22 ? 185  HIS B O   1 
ATOM   1222 C CB  . HIS B 2 11  ? 13.648 16.355 63.421 1.00 28.39 ? 185  HIS B CB  1 
ATOM   1223 C CG  . HIS B 2 11  ? 13.730 15.309 64.488 1.00 33.29 ? 185  HIS B CG  1 
ATOM   1224 N ND1 . HIS B 2 11  ? 14.664 15.350 65.501 1.00 35.25 ? 185  HIS B ND1 1 
ATOM   1225 C CD2 . HIS B 2 11  ? 12.999 14.188 64.696 1.00 35.57 ? 185  HIS B CD2 1 
ATOM   1226 C CE1 . HIS B 2 11  ? 14.506 14.300 66.286 1.00 35.93 ? 185  HIS B CE1 1 
ATOM   1227 N NE2 . HIS B 2 11  ? 13.502 13.579 65.820 1.00 36.72 ? 185  HIS B NE2 1 
ATOM   1228 N N   . LYS B 2 12  ? 14.635 19.444 62.585 1.00 20.01 ? 186  LYS B N   1 
ATOM   1229 C CA  . LYS B 2 12  ? 14.756 20.399 61.495 1.00 17.55 ? 186  LYS B CA  1 
ATOM   1230 C C   . LYS B 2 12  ? 16.113 20.218 60.835 1.00 15.41 ? 186  LYS B C   1 
ATOM   1231 O O   . LYS B 2 12  ? 17.027 19.638 61.420 1.00 13.15 ? 186  LYS B O   1 
ATOM   1232 C CB  . LYS B 2 12  ? 14.667 21.839 62.003 1.00 19.23 ? 186  LYS B CB  1 
ATOM   1233 C CG  . LYS B 2 12  ? 13.401 22.197 62.758 1.00 24.00 ? 186  LYS B CG  1 
ATOM   1234 C CD  . LYS B 2 12  ? 13.326 23.704 62.988 1.00 25.71 ? 186  LYS B CD  1 
ATOM   1235 C CE  . LYS B 2 12  ? 14.591 24.231 63.656 1.00 28.80 ? 186  LYS B CE  1 
ATOM   1236 N NZ  . LYS B 2 12  ? 14.585 25.715 63.790 1.00 30.70 ? 186  LYS B NZ  1 
ATOM   1237 N N   . ILE B 2 13  ? 16.228 20.708 59.607 1.00 14.22 ? 187  ILE B N   1 
ATOM   1238 C CA  . ILE B 2 13  ? 17.487 20.657 58.879 1.00 12.88 ? 187  ILE B CA  1 
ATOM   1239 C C   . ILE B 2 13  ? 17.730 22.070 58.372 1.00 11.06 ? 187  ILE B C   1 
ATOM   1240 O O   . ILE B 2 13  ? 16.797 22.865 58.259 1.00 10.63 ? 187  ILE B O   1 
ATOM   1241 C CB  . ILE B 2 13  ? 17.442 19.695 57.669 1.00 13.43 ? 187  ILE B CB  1 
ATOM   1242 C CG1 . ILE B 2 13  ? 16.344 20.121 56.691 1.00 11.65 ? 187  ILE B CG1 1 
ATOM   1243 C CG2 . ILE B 2 13  ? 17.227 18.267 58.151 1.00 13.27 ? 187  ILE B CG2 1 
ATOM   1244 C CD1 . ILE B 2 13  ? 16.420 19.410 55.350 1.00 15.32 ? 187  ILE B CD1 1 
ATOM   1245 N N   . PRO B 2 14  ? 18.992 22.415 58.091 1.00 10.36 ? 188  PRO B N   1 
ATOM   1246 C CA  . PRO B 2 14  ? 19.313 23.755 57.593 1.00 8.89  ? 188  PRO B CA  1 
ATOM   1247 C C   . PRO B 2 14  ? 18.647 23.957 56.236 1.00 9.28  ? 188  PRO B C   1 
ATOM   1248 O O   . PRO B 2 14  ? 18.523 23.008 55.464 1.00 10.36 ? 188  PRO B O   1 
ATOM   1249 C CB  . PRO B 2 14  ? 20.836 23.723 57.476 1.00 9.36  ? 188  PRO B CB  1 
ATOM   1250 C CG  . PRO B 2 14  ? 21.243 22.706 58.519 1.00 10.39 ? 188  PRO B CG  1 
ATOM   1251 C CD  . PRO B 2 14  ? 20.214 21.628 58.317 1.00 8.50  ? 188  PRO B CD  1 
ATOM   1252 N N   . VAL B 2 15  ? 18.216 25.179 55.943 1.00 9.83  ? 189  VAL B N   1 
ATOM   1253 C CA  . VAL B 2 15  ? 17.583 25.445 54.655 1.00 10.23 ? 189  VAL B CA  1 
ATOM   1254 C C   . VAL B 2 15  ? 18.636 25.404 53.550 1.00 10.71 ? 189  VAL B C   1 
ATOM   1255 O O   . VAL B 2 15  ? 18.306 25.296 52.369 1.00 9.94  ? 189  VAL B O   1 
ATOM   1256 C CB  . VAL B 2 15  ? 16.880 26.825 54.629 1.00 11.13 ? 189  VAL B CB  1 
ATOM   1257 C CG1 . VAL B 2 15  ? 15.825 26.890 55.721 1.00 11.26 ? 189  VAL B CG1 1 
ATOM   1258 C CG2 . VAL B 2 15  ? 17.897 27.939 54.793 1.00 12.49 ? 189  VAL B CG2 1 
ATOM   1259 N N   . GLU B 2 16  ? 19.906 25.483 53.942 1.00 9.15  ? 190  GLU B N   1 
ATOM   1260 C CA  . GLU B 2 16  ? 21.010 25.457 52.985 1.00 9.66  ? 190  GLU B CA  1 
ATOM   1261 C C   . GLU B 2 16  ? 21.568 24.047 52.799 1.00 8.79  ? 190  GLU B C   1 
ATOM   1262 O O   . GLU B 2 16  ? 22.495 23.830 52.018 1.00 7.66  ? 190  GLU B O   1 
ATOM   1263 C CB  . GLU B 2 16  ? 22.127 26.393 53.458 1.00 12.46 ? 190  GLU B CB  1 
ATOM   1264 C CG  . GLU B 2 16  ? 21.701 27.849 53.567 1.00 16.02 ? 190  GLU B CG  1 
ATOM   1265 C CD  . GLU B 2 16  ? 21.346 28.456 52.221 1.00 22.00 ? 190  GLU B CD  1 
ATOM   1266 O OE1 . GLU B 2 16  ? 22.267 28.699 51.416 1.00 24.15 ? 190  GLU B OE1 1 
ATOM   1267 O OE2 . GLU B 2 16  ? 20.145 28.683 51.964 1.00 24.18 ? 190  GLU B OE2 1 
ATOM   1268 N N   . ALA B 2 17  ? 21.003 23.086 53.518 1.00 9.60  ? 191  ALA B N   1 
ATOM   1269 C CA  . ALA B 2 17  ? 21.469 21.709 53.419 1.00 9.42  ? 191  ALA B CA  1 
ATOM   1270 C C   . ALA B 2 17  ? 21.026 21.034 52.124 1.00 9.45  ? 191  ALA B C   1 
ATOM   1271 O O   . ALA B 2 17  ? 20.037 21.432 51.502 1.00 9.55  ? 191  ALA B O   1 
ATOM   1272 C CB  . ALA B 2 17  ? 20.974 20.903 54.619 1.00 10.05 ? 191  ALA B CB  1 
ATOM   1273 N N   . ASP B 2 18  ? 21.783 20.014 51.732 1.00 7.98  ? 192  ASP B N   1 
ATOM   1274 C CA  . ASP B 2 18  ? 21.514 19.213 50.543 1.00 8.11  ? 192  ASP B CA  1 
ATOM   1275 C C   . ASP B 2 18  ? 21.740 19.898 49.202 1.00 7.96  ? 192  ASP B C   1 
ATOM   1276 O O   . ASP B 2 18  ? 21.088 19.573 48.208 1.00 7.97  ? 192  ASP B O   1 
ATOM   1277 C CB  . ASP B 2 18  ? 20.100 18.629 50.615 1.00 8.33  ? 192  ASP B CB  1 
ATOM   1278 C CG  . ASP B 2 18  ? 19.886 17.799 51.870 1.00 10.16 ? 192  ASP B CG  1 
ATOM   1279 O OD1 . ASP B 2 18  ? 20.702 16.887 52.125 1.00 9.93  ? 192  ASP B OD1 1 
ATOM   1280 O OD2 . ASP B 2 18  ? 18.910 18.061 52.604 1.00 10.36 ? 192  ASP B OD2 1 
ATOM   1281 N N   . PHE B 2 19  ? 22.677 20.839 49.181 1.00 6.15  ? 193  PHE B N   1 
ATOM   1282 C CA  . PHE B 2 19  ? 23.046 21.540 47.958 1.00 6.63  ? 193  PHE B CA  1 
ATOM   1283 C C   . PHE B 2 19  ? 24.470 21.124 47.618 1.00 6.82  ? 193  PHE B C   1 
ATOM   1284 O O   . PHE B 2 19  ? 25.278 20.879 48.512 1.00 7.31  ? 193  PHE B O   1 
ATOM   1285 C CB  . PHE B 2 19  ? 23.053 23.058 48.165 1.00 8.59  ? 193  PHE B CB  1 
ATOM   1286 C CG  . PHE B 2 19  ? 21.712 23.712 48.015 1.00 7.98  ? 193  PHE B CG  1 
ATOM   1287 C CD1 . PHE B 2 19  ? 21.331 24.272 46.799 1.00 9.59  ? 193  PHE B CD1 1 
ATOM   1288 C CD2 . PHE B 2 19  ? 20.846 23.806 49.100 1.00 8.67  ? 193  PHE B CD2 1 
ATOM   1289 C CE1 . PHE B 2 19  ? 20.103 24.922 46.668 1.00 10.05 ? 193  PHE B CE1 1 
ATOM   1290 C CE2 . PHE B 2 19  ? 19.620 24.452 48.979 1.00 9.58  ? 193  PHE B CE2 1 
ATOM   1291 C CZ  . PHE B 2 19  ? 19.248 25.012 47.762 1.00 11.10 ? 193  PHE B CZ  1 
ATOM   1292 N N   . LEU B 2 20  ? 24.764 21.026 46.328 1.00 7.25  ? 194  LEU B N   1 
ATOM   1293 C CA  . LEU B 2 20  ? 26.115 20.722 45.881 1.00 7.71  ? 194  LEU B CA  1 
ATOM   1294 C C   . LEU B 2 20  ? 26.371 21.633 44.699 1.00 8.23  ? 194  LEU B C   1 
ATOM   1295 O O   . LEU B 2 20  ? 25.551 21.724 43.787 1.00 7.19  ? 194  LEU B O   1 
ATOM   1296 C CB  . LEU B 2 20  ? 26.284 19.257 45.454 1.00 8.55  ? 194  LEU B CB  1 
ATOM   1297 C CG  . LEU B 2 20  ? 27.724 18.971 44.985 1.00 10.87 ? 194  LEU B CG  1 
ATOM   1298 C CD1 . LEU B 2 20  ? 28.157 17.580 45.391 1.00 14.30 ? 194  LEU B CD1 1 
ATOM   1299 C CD2 . LEU B 2 20  ? 27.818 19.161 43.472 1.00 11.12 ? 194  LEU B CD2 1 
ATOM   1300 N N   . TYR B 2 21  ? 27.495 22.338 44.741 1.00 5.80  ? 195  TYR B N   1 
ATOM   1301 C CA  . TYR B 2 21  ? 27.868 23.229 43.663 1.00 6.89  ? 195  TYR B CA  1 
ATOM   1302 C C   . TYR B 2 21  ? 29.136 22.679 43.032 1.00 6.52  ? 195  TYR B C   1 
ATOM   1303 O O   . TYR B 2 21  ? 30.166 22.555 43.697 1.00 8.03  ? 195  TYR B O   1 
ATOM   1304 C CB  . TYR B 2 21  ? 28.137 24.646 44.190 1.00 7.83  ? 195  TYR B CB  1 
ATOM   1305 C CG  . TYR B 2 21  ? 27.022 25.213 45.039 1.00 10.70 ? 195  TYR B CG  1 
ATOM   1306 C CD1 . TYR B 2 21  ? 26.839 24.791 46.355 1.00 12.53 ? 195  TYR B CD1 1 
ATOM   1307 C CD2 . TYR B 2 21  ? 26.135 26.157 44.521 1.00 15.69 ? 195  TYR B CD2 1 
ATOM   1308 C CE1 . TYR B 2 21  ? 25.798 25.294 47.138 1.00 17.39 ? 195  TYR B CE1 1 
ATOM   1309 C CE2 . TYR B 2 21  ? 25.087 26.666 45.297 1.00 17.49 ? 195  TYR B CE2 1 
ATOM   1310 C CZ  . TYR B 2 21  ? 24.927 26.228 46.602 1.00 18.48 ? 195  TYR B CZ  1 
ATOM   1311 O OH  . TYR B 2 21  ? 23.896 26.718 47.377 1.00 23.91 ? 195  TYR B OH  1 
ATOM   1312 N N   . ALA B 2 22  ? 29.051 22.325 41.757 1.00 6.42  ? 196  ALA B N   1 
ATOM   1313 C CA  . ALA B 2 22  ? 30.211 21.816 41.047 1.00 6.30  ? 196  ALA B CA  1 
ATOM   1314 C C   . ALA B 2 22  ? 30.721 22.966 40.190 1.00 7.07  ? 196  ALA B C   1 
ATOM   1315 O O   . ALA B 2 22  ? 30.214 23.204 39.096 1.00 7.84  ? 196  ALA B O   1 
ATOM   1316 C CB  . ALA B 2 22  ? 29.821 20.625 40.170 1.00 6.05  ? 196  ALA B CB  1 
ATOM   1317 N N   . TYR B 2 23  ? 31.701 23.694 40.721 1.00 8.15  ? 197  TYR B N   1 
ATOM   1318 C CA  . TYR B 2 23  ? 32.304 24.830 40.027 1.00 7.83  ? 197  TYR B CA  1 
ATOM   1319 C C   . TYR B 2 23  ? 33.402 24.362 39.083 1.00 8.34  ? 197  TYR B C   1 
ATOM   1320 O O   . TYR B 2 23  ? 34.160 23.447 39.396 1.00 7.76  ? 197  TYR B O   1 
ATOM   1321 C CB  . TYR B 2 23  ? 32.904 25.810 41.035 1.00 7.19  ? 197  TYR B CB  1 
ATOM   1322 C CG  . TYR B 2 23  ? 31.889 26.588 41.839 1.00 8.56  ? 197  TYR B CG  1 
ATOM   1323 C CD1 . TYR B 2 23  ? 31.232 27.688 41.292 1.00 8.78  ? 197  TYR B CD1 1 
ATOM   1324 C CD2 . TYR B 2 23  ? 31.610 26.242 43.159 1.00 8.83  ? 197  TYR B CD2 1 
ATOM   1325 C CE1 . TYR B 2 23  ? 30.324 28.432 42.051 1.00 10.52 ? 197  TYR B CE1 1 
ATOM   1326 C CE2 . TYR B 2 23  ? 30.708 26.974 43.920 1.00 9.95  ? 197  TYR B CE2 1 
ATOM   1327 C CZ  . TYR B 2 23  ? 30.071 28.068 43.363 1.00 10.34 ? 197  TYR B CZ  1 
ATOM   1328 O OH  . TYR B 2 23  ? 29.197 28.799 44.133 1.00 13.87 ? 197  TYR B OH  1 
ATOM   1329 N N   . SER B 2 24  ? 33.497 25.012 37.930 1.00 6.96  ? 198  SER B N   1 
ATOM   1330 C CA  . SER B 2 24  ? 34.497 24.649 36.938 1.00 6.93  ? 198  SER B CA  1 
ATOM   1331 C C   . SER B 2 24  ? 35.906 25.063 37.334 1.00 7.65  ? 198  SER B C   1 
ATOM   1332 O O   . SER B 2 24  ? 36.880 24.479 36.861 1.00 7.82  ? 198  SER B O   1 
ATOM   1333 C CB  . SER B 2 24  ? 34.168 25.314 35.606 1.00 7.42  ? 198  SER B CB  1 
ATOM   1334 O OG  . SER B 2 24  ? 34.314 26.722 35.718 1.00 8.50  ? 198  SER B OG  1 
ATOM   1335 N N   . THR B 2 25  ? 36.017 26.059 38.206 1.00 7.16  ? 199  THR B N   1 
ATOM   1336 C CA  . THR B 2 25  ? 37.327 26.572 38.578 1.00 9.10  ? 199  THR B CA  1 
ATOM   1337 C C   . THR B 2 25  ? 37.385 27.017 40.036 1.00 9.26  ? 199  THR B C   1 
ATOM   1338 O O   . THR B 2 25  ? 36.355 27.164 40.692 1.00 9.39  ? 199  THR B O   1 
ATOM   1339 C CB  . THR B 2 25  ? 37.684 27.769 37.655 1.00 8.43  ? 199  THR B CB  1 
ATOM   1340 O OG1 . THR B 2 25  ? 39.069 28.110 37.794 1.00 10.30 ? 199  THR B OG1 1 
ATOM   1341 C CG2 . THR B 2 25  ? 36.820 28.979 37.998 1.00 9.77  ? 199  THR B CG2 1 
ATOM   1342 N N   . ALA B 2 26  ? 38.602 27.236 40.527 1.00 9.91  ? 200  ALA B N   1 
ATOM   1343 C CA  . ALA B 2 26  ? 38.815 27.664 41.902 1.00 11.11 ? 200  ALA B CA  1 
ATOM   1344 C C   . ALA B 2 26  ? 38.312 29.086 42.130 1.00 12.04 ? 200  ALA B C   1 
ATOM   1345 O O   . ALA B 2 26  ? 38.225 29.883 41.198 1.00 10.39 ? 200  ALA B O   1 
ATOM   1346 C CB  . ALA B 2 26  ? 40.297 27.579 42.244 1.00 11.16 ? 200  ALA B CB  1 
ATOM   1347 N N   . PRO B 2 27  ? 37.967 29.420 43.381 1.00 11.33 ? 201  PRO B N   1 
ATOM   1348 C CA  . PRO B 2 27  ? 37.480 30.768 43.687 1.00 11.83 ? 201  PRO B CA  1 
ATOM   1349 C C   . PRO B 2 27  ? 38.482 31.836 43.234 1.00 10.56 ? 201  PRO B C   1 
ATOM   1350 O O   . PRO B 2 27  ? 39.679 31.723 43.501 1.00 10.24 ? 201  PRO B O   1 
ATOM   1351 C CB  . PRO B 2 27  ? 37.324 30.737 45.206 1.00 12.62 ? 201  PRO B CB  1 
ATOM   1352 C CG  . PRO B 2 27  ? 36.964 29.298 45.474 1.00 12.96 ? 201  PRO B CG  1 
ATOM   1353 C CD  . PRO B 2 27  ? 37.923 28.557 44.576 1.00 12.86 ? 201  PRO B CD  1 
ATOM   1354 N N   . GLY B 2 28  ? 37.983 32.857 42.542 1.00 9.74  ? 202  GLY B N   1 
ATOM   1355 C CA  . GLY B 2 28  ? 38.830 33.944 42.079 1.00 9.91  ? 202  GLY B CA  1 
ATOM   1356 C C   . GLY B 2 28  ? 39.552 33.741 40.758 1.00 11.27 ? 202  GLY B C   1 
ATOM   1357 O O   . GLY B 2 28  ? 40.231 34.654 40.280 1.00 10.96 ? 202  GLY B O   1 
ATOM   1358 N N   . TYR B 2 29  ? 39.410 32.563 40.156 1.00 10.14 ? 203  TYR B N   1 
ATOM   1359 C CA  . TYR B 2 29  ? 40.094 32.273 38.898 1.00 9.82  ? 203  TYR B CA  1 
ATOM   1360 C C   . TYR B 2 29  ? 39.232 32.264 37.646 1.00 10.01 ? 203  TYR B C   1 
ATOM   1361 O O   . TYR B 2 29  ? 38.015 32.099 37.711 1.00 9.95  ? 203  TYR B O   1 
ATOM   1362 C CB  . TYR B 2 29  ? 40.806 30.916 38.978 1.00 8.34  ? 203  TYR B CB  1 
ATOM   1363 C CG  . TYR B 2 29  ? 42.050 30.919 39.830 1.00 8.03  ? 203  TYR B CG  1 
ATOM   1364 C CD1 . TYR B 2 29  ? 41.968 30.919 41.222 1.00 9.93  ? 203  TYR B CD1 1 
ATOM   1365 C CD2 . TYR B 2 29  ? 43.313 30.952 39.242 1.00 9.74  ? 203  TYR B CD2 1 
ATOM   1366 C CE1 . TYR B 2 29  ? 43.121 30.954 42.012 1.00 11.32 ? 203  TYR B CE1 1 
ATOM   1367 C CE2 . TYR B 2 29  ? 44.469 30.988 40.019 1.00 9.23  ? 203  TYR B CE2 1 
ATOM   1368 C CZ  . TYR B 2 29  ? 44.367 30.989 41.400 1.00 11.05 ? 203  TYR B CZ  1 
ATOM   1369 O OH  . TYR B 2 29  ? 45.511 31.032 42.166 1.00 11.78 ? 203  TYR B OH  1 
ATOM   1370 N N   . TYR B 2 30  ? 39.890 32.438 36.501 1.00 11.27 ? 204  TYR B N   1 
ATOM   1371 C CA  . TYR B 2 30  ? 39.212 32.389 35.214 1.00 9.53  ? 204  TYR B CA  1 
ATOM   1372 C C   . TYR B 2 30  ? 38.850 30.927 34.993 1.00 8.29  ? 204  TYR B C   1 
ATOM   1373 O O   . TYR B 2 30  ? 39.402 30.042 35.646 1.00 8.79  ? 204  TYR B O   1 
ATOM   1374 C CB  . TYR B 2 30  ? 40.144 32.785 34.065 1.00 12.33 ? 204  TYR B CB  1 
ATOM   1375 C CG  . TYR B 2 30  ? 40.430 34.257 33.887 1.00 12.38 ? 204  TYR B CG  1 
ATOM   1376 C CD1 . TYR B 2 30  ? 41.628 34.810 34.334 1.00 15.04 ? 204  TYR B CD1 1 
ATOM   1377 C CD2 . TYR B 2 30  ? 39.543 35.078 33.193 1.00 16.31 ? 204  TYR B CD2 1 
ATOM   1378 C CE1 . TYR B 2 30  ? 41.943 36.143 34.081 1.00 16.26 ? 204  TYR B CE1 1 
ATOM   1379 C CE2 . TYR B 2 30  ? 39.847 36.415 32.938 1.00 17.18 ? 204  TYR B CE2 1 
ATOM   1380 C CZ  . TYR B 2 30  ? 41.051 36.937 33.383 1.00 17.21 ? 204  TYR B CZ  1 
ATOM   1381 O OH  . TYR B 2 30  ? 41.368 38.252 33.121 1.00 18.16 ? 204  TYR B OH  1 
ATOM   1382 N N   . SER B 2 31  ? 37.937 30.684 34.060 1.00 8.79  ? 205  SER B N   1 
ATOM   1383 C CA  . SER B 2 31  ? 37.525 29.332 33.700 1.00 8.73  ? 205  SER B CA  1 
ATOM   1384 C C   . SER B 2 31  ? 37.792 29.248 32.203 1.00 9.78  ? 205  SER B C   1 
ATOM   1385 O O   . SER B 2 31  ? 37.481 30.189 31.471 1.00 10.88 ? 205  SER B O   1 
ATOM   1386 C CB  . SER B 2 31  ? 36.038 29.123 33.983 1.00 9.57  ? 205  SER B CB  1 
ATOM   1387 O OG  . SER B 2 31  ? 35.652 27.795 33.664 1.00 11.22 ? 205  SER B OG  1 
ATOM   1388 N N   . TRP B 2 32  ? 38.364 28.135 31.748 1.00 8.70  ? 206  TRP B N   1 
ATOM   1389 C CA  . TRP B 2 32  ? 38.702 27.979 30.335 1.00 9.82  ? 206  TRP B CA  1 
ATOM   1390 C C   . TRP B 2 32  ? 37.732 27.195 29.465 1.00 10.74 ? 206  TRP B C   1 
ATOM   1391 O O   . TRP B 2 32  ? 37.148 26.196 29.886 1.00 10.70 ? 206  TRP B O   1 
ATOM   1392 C CB  . TRP B 2 32  ? 40.097 27.367 30.198 1.00 10.32 ? 206  TRP B CB  1 
ATOM   1393 C CG  . TRP B 2 32  ? 41.175 28.264 30.707 1.00 12.06 ? 206  TRP B CG  1 
ATOM   1394 C CD1 . TRP B 2 32  ? 41.704 28.279 31.963 1.00 12.20 ? 206  TRP B CD1 1 
ATOM   1395 C CD2 . TRP B 2 32  ? 41.831 29.312 29.981 1.00 12.76 ? 206  TRP B CD2 1 
ATOM   1396 N NE1 . TRP B 2 32  ? 42.653 29.272 32.066 1.00 13.97 ? 206  TRP B NE1 1 
ATOM   1397 C CE2 . TRP B 2 32  ? 42.749 29.921 30.864 1.00 13.74 ? 206  TRP B CE2 1 
ATOM   1398 C CE3 . TRP B 2 32  ? 41.730 29.795 28.669 1.00 13.56 ? 206  TRP B CE3 1 
ATOM   1399 C CZ2 . TRP B 2 32  ? 43.566 30.992 30.478 1.00 14.42 ? 206  TRP B CZ2 1 
ATOM   1400 C CZ3 . TRP B 2 32  ? 42.542 30.861 28.285 1.00 14.09 ? 206  TRP B CZ3 1 
ATOM   1401 C CH2 . TRP B 2 32  ? 43.447 31.447 29.188 1.00 14.71 ? 206  TRP B CH2 1 
ATOM   1402 N N   . ARG B 2 33  ? 37.599 27.651 28.224 1.00 10.99 ? 207  ARG B N   1 
ATOM   1403 C CA  . ARG B 2 33  ? 36.706 27.031 27.257 1.00 11.86 ? 207  ARG B CA  1 
ATOM   1404 C C   . ARG B 2 33  ? 37.350 26.980 25.876 1.00 12.05 ? 207  ARG B C   1 
ATOM   1405 O O   . ARG B 2 33  ? 37.850 27.990 25.379 1.00 12.58 ? 207  ARG B O   1 
ATOM   1406 C CB  . ARG B 2 33  ? 35.396 27.828 27.202 1.00 10.78 ? 207  ARG B CB  1 
ATOM   1407 C CG  . ARG B 2 33  ? 34.482 27.512 26.028 1.00 13.29 ? 207  ARG B CG  1 
ATOM   1408 C CD  . ARG B 2 33  ? 33.125 28.192 26.208 1.00 11.37 ? 207  ARG B CD  1 
ATOM   1409 N NE  . ARG B 2 33  ? 33.263 29.595 26.596 1.00 13.76 ? 207  ARG B NE  1 
ATOM   1410 C CZ  . ARG B 2 33  ? 33.656 30.569 25.782 1.00 12.20 ? 207  ARG B CZ  1 
ATOM   1411 N NH1 . ARG B 2 33  ? 33.947 30.309 24.515 1.00 11.88 ? 207  ARG B NH1 1 
ATOM   1412 N NH2 . ARG B 2 33  ? 33.779 31.806 26.244 1.00 14.03 ? 207  ARG B NH2 1 
ATOM   1413 N N   . ASN B 2 34  ? 37.356 25.798 25.266 1.00 12.40 ? 208  ASN B N   1 
ATOM   1414 C CA  . ASN B 2 34  ? 37.920 25.650 23.929 1.00 14.03 ? 208  ASN B CA  1 
ATOM   1415 C C   . ASN B 2 34  ? 36.817 26.039 22.948 1.00 16.59 ? 208  ASN B C   1 
ATOM   1416 O O   . ASN B 2 34  ? 35.736 25.447 22.942 1.00 15.19 ? 208  ASN B O   1 
ATOM   1417 C CB  . ASN B 2 34  ? 38.378 24.207 23.698 1.00 13.50 ? 208  ASN B CB  1 
ATOM   1418 C CG  . ASN B 2 34  ? 39.036 24.013 22.343 1.00 14.23 ? 208  ASN B CG  1 
ATOM   1419 O OD1 . ASN B 2 34  ? 38.364 23.981 21.314 1.00 15.81 ? 208  ASN B OD1 1 
ATOM   1420 N ND2 . ASN B 2 34  ? 40.360 23.895 22.339 1.00 14.03 ? 208  ASN B ND2 1 
ATOM   1421 N N   . SER B 2 35  ? 37.091 27.050 22.131 1.00 18.89 ? 209  SER B N   1 
ATOM   1422 C CA  . SER B 2 35  ? 36.113 27.552 21.173 1.00 19.80 ? 209  SER B CA  1 
ATOM   1423 C C   . SER B 2 35  ? 35.524 26.493 20.249 1.00 20.77 ? 209  SER B C   1 
ATOM   1424 O O   . SER B 2 35  ? 34.505 26.732 19.601 1.00 21.61 ? 209  SER B O   1 
ATOM   1425 C CB  . SER B 2 35  ? 36.732 28.676 20.338 1.00 20.75 ? 209  SER B CB  1 
ATOM   1426 O OG  . SER B 2 35  ? 37.886 28.225 19.655 1.00 25.03 ? 209  SER B OG  1 
ATOM   1427 N N   . LYS B 2 36  ? 36.155 25.325 20.193 1.00 21.57 ? 210  LYS B N   1 
ATOM   1428 C CA  . LYS B 2 36  ? 35.681 24.247 19.333 1.00 21.86 ? 210  LYS B CA  1 
ATOM   1429 C C   . LYS B 2 36  ? 35.123 23.032 20.073 1.00 21.72 ? 210  LYS B C   1 
ATOM   1430 O O   . LYS B 2 36  ? 34.051 22.531 19.727 1.00 21.84 ? 210  LYS B O   1 
ATOM   1431 C CB  . LYS B 2 36  ? 36.809 23.779 18.412 1.00 25.12 ? 210  LYS B CB  1 
ATOM   1432 C CG  . LYS B 2 36  ? 36.464 22.533 17.613 1.00 28.58 ? 210  LYS B CG  1 
ATOM   1433 C CD  . LYS B 2 36  ? 37.714 21.805 17.144 1.00 32.74 ? 210  LYS B CD  1 
ATOM   1434 C CE  . LYS B 2 36  ? 37.360 20.451 16.551 1.00 35.53 ? 210  LYS B CE  1 
ATOM   1435 N NZ  . LYS B 2 36  ? 38.567 19.620 16.283 1.00 38.34 ? 210  LYS B NZ  1 
ATOM   1436 N N   . ASP B 2 37  ? 35.847 22.561 21.085 1.00 18.81 ? 211  ASP B N   1 
ATOM   1437 C CA  . ASP B 2 37  ? 35.439 21.373 21.833 1.00 18.13 ? 211  ASP B CA  1 
ATOM   1438 C C   . ASP B 2 37  ? 34.599 21.621 23.085 1.00 16.10 ? 211  ASP B C   1 
ATOM   1439 O O   . ASP B 2 37  ? 34.099 20.673 23.691 1.00 16.46 ? 211  ASP B O   1 
ATOM   1440 C CB  . ASP B 2 37  ? 36.675 20.561 22.232 1.00 20.89 ? 211  ASP B CB  1 
ATOM   1441 C CG  . ASP B 2 37  ? 37.622 20.325 21.073 1.00 24.82 ? 211  ASP B CG  1 
ATOM   1442 O OD1 . ASP B 2 37  ? 37.182 19.784 20.036 1.00 25.15 ? 211  ASP B OD1 1 
ATOM   1443 O OD2 . ASP B 2 37  ? 38.814 20.678 21.205 1.00 26.83 ? 211  ASP B OD2 1 
ATOM   1444 N N   . GLY B 2 38  ? 34.445 22.880 23.474 1.00 13.33 ? 212  GLY B N   1 
ATOM   1445 C CA  . GLY B 2 38  ? 33.674 23.184 24.667 1.00 11.41 ? 212  GLY B CA  1 
ATOM   1446 C C   . GLY B 2 38  ? 34.578 23.428 25.861 1.00 10.56 ? 212  GLY B C   1 
ATOM   1447 O O   . GLY B 2 38  ? 35.804 23.341 25.743 1.00 8.97  ? 212  GLY B O   1 
ATOM   1448 N N   . SER B 2 39  ? 33.984 23.730 27.013 1.00 8.70  ? 213  SER B N   1 
ATOM   1449 C CA  . SER B 2 39  ? 34.762 23.997 28.222 1.00 8.49  ? 213  SER B CA  1 
ATOM   1450 C C   . SER B 2 39  ? 35.469 22.749 28.735 1.00 8.01  ? 213  SER B C   1 
ATOM   1451 O O   . SER B 2 39  ? 34.961 21.634 28.602 1.00 8.47  ? 213  SER B O   1 
ATOM   1452 C CB  . SER B 2 39  ? 33.859 24.567 29.325 1.00 10.09 ? 213  SER B CB  1 
ATOM   1453 O OG  . SER B 2 39  ? 32.894 23.619 29.752 1.00 8.95  ? 213  SER B OG  1 
ATOM   1454 N N   . TRP B 2 40  ? 36.646 22.937 29.324 1.00 7.41  ? 214  TRP B N   1 
ATOM   1455 C CA  . TRP B 2 40  ? 37.405 21.811 29.853 1.00 7.29  ? 214  TRP B CA  1 
ATOM   1456 C C   . TRP B 2 40  ? 36.587 21.080 30.909 1.00 6.90  ? 214  TRP B C   1 
ATOM   1457 O O   . TRP B 2 40  ? 36.541 19.850 30.938 1.00 6.82  ? 214  TRP B O   1 
ATOM   1458 C CB  . TRP B 2 40  ? 38.706 22.289 30.497 1.00 8.44  ? 214  TRP B CB  1 
ATOM   1459 C CG  . TRP B 2 40  ? 39.604 23.082 29.606 1.00 7.86  ? 214  TRP B CG  1 
ATOM   1460 C CD1 . TRP B 2 40  ? 39.518 23.218 28.247 1.00 7.64  ? 214  TRP B CD1 1 
ATOM   1461 C CD2 . TRP B 2 40  ? 40.768 23.809 30.011 1.00 7.22  ? 214  TRP B CD2 1 
ATOM   1462 N NE1 . TRP B 2 40  ? 40.565 23.986 27.782 1.00 7.19  ? 214  TRP B NE1 1 
ATOM   1463 C CE2 . TRP B 2 40  ? 41.346 24.360 28.845 1.00 6.61  ? 214  TRP B CE2 1 
ATOM   1464 C CE3 . TRP B 2 40  ? 41.383 24.047 31.250 1.00 8.54  ? 214  TRP B CE3 1 
ATOM   1465 C CZ2 . TRP B 2 40  ? 42.512 25.133 28.880 1.00 8.16  ? 214  TRP B CZ2 1 
ATOM   1466 C CZ3 . TRP B 2 40  ? 42.543 24.816 31.286 1.00 10.02 ? 214  TRP B CZ3 1 
ATOM   1467 C CH2 . TRP B 2 40  ? 43.095 25.350 30.105 1.00 9.69  ? 214  TRP B CH2 1 
ATOM   1468 N N   . PHE B 2 41  ? 35.943 21.854 31.773 1.00 7.02  ? 215  PHE B N   1 
ATOM   1469 C CA  . PHE B 2 41  ? 35.137 21.302 32.854 1.00 7.90  ? 215  PHE B CA  1 
ATOM   1470 C C   . PHE B 2 41  ? 33.953 20.460 32.388 1.00 8.88  ? 215  PHE B C   1 
ATOM   1471 O O   . PHE B 2 41  ? 33.796 19.319 32.818 1.00 8.11  ? 215  PHE B O   1 
ATOM   1472 C CB  . PHE B 2 41  ? 34.643 22.434 33.758 1.00 7.69  ? 215  PHE B CB  1 
ATOM   1473 C CG  . PHE B 2 41  ? 33.800 21.969 34.918 1.00 8.36  ? 215  PHE B CG  1 
ATOM   1474 C CD1 . PHE B 2 41  ? 34.303 21.056 35.843 1.00 7.99  ? 215  PHE B CD1 1 
ATOM   1475 C CD2 . PHE B 2 41  ? 32.514 22.467 35.097 1.00 8.48  ? 215  PHE B CD2 1 
ATOM   1476 C CE1 . PHE B 2 41  ? 33.532 20.647 36.937 1.00 6.89  ? 215  PHE B CE1 1 
ATOM   1477 C CE2 . PHE B 2 41  ? 31.737 22.067 36.184 1.00 9.55  ? 215  PHE B CE2 1 
ATOM   1478 C CZ  . PHE B 2 41  ? 32.247 21.156 37.106 1.00 7.06  ? 215  PHE B CZ  1 
ATOM   1479 N N   . ILE B 2 42  ? 33.115 21.013 31.518 1.00 8.51  ? 216  ILE B N   1 
ATOM   1480 C CA  . ILE B 2 42  ? 31.961 20.260 31.051 1.00 8.71  ? 216  ILE B CA  1 
ATOM   1481 C C   . ILE B 2 42  ? 32.399 19.053 30.225 1.00 8.02  ? 216  ILE B C   1 
ATOM   1482 O O   . ILE B 2 42  ? 31.814 17.980 30.347 1.00 7.49  ? 216  ILE B O   1 
ATOM   1483 C CB  . ILE B 2 42  ? 30.994 21.149 30.238 1.00 8.29  ? 216  ILE B CB  1 
ATOM   1484 C CG1 . ILE B 2 42  ? 30.475 22.289 31.124 1.00 8.99  ? 216  ILE B CG1 1 
ATOM   1485 C CG2 . ILE B 2 42  ? 29.828 20.312 29.708 1.00 8.81  ? 216  ILE B CG2 1 
ATOM   1486 C CD1 . ILE B 2 42  ? 29.759 21.828 32.399 1.00 9.20  ? 216  ILE B CD1 1 
ATOM   1487 N N   . GLN B 2 43  ? 33.429 19.223 29.395 1.00 8.83  ? 217  GLN B N   1 
ATOM   1488 C CA  . GLN B 2 43  ? 33.948 18.114 28.593 1.00 10.87 ? 217  GLN B CA  1 
ATOM   1489 C C   . GLN B 2 43  ? 34.272 16.958 29.538 1.00 10.79 ? 217  GLN B C   1 
ATOM   1490 O O   . GLN B 2 43  ? 33.840 15.819 29.342 1.00 9.79  ? 217  GLN B O   1 
ATOM   1491 C CB  . GLN B 2 43  ? 35.264 18.484 27.896 1.00 13.42 ? 217  GLN B CB  1 
ATOM   1492 C CG  . GLN B 2 43  ? 35.199 19.399 26.685 1.00 17.39 ? 217  GLN B CG  1 
ATOM   1493 C CD  . GLN B 2 43  ? 36.573 19.558 26.036 1.00 18.52 ? 217  GLN B CD  1 
ATOM   1494 O OE1 . GLN B 2 43  ? 37.190 18.571 25.617 1.00 16.16 ? 217  GLN B OE1 1 
ATOM   1495 N NE2 . GLN B 2 43  ? 37.063 20.796 25.961 1.00 13.98 ? 217  GLN B NE2 1 
ATOM   1496 N N   . SER B 2 44  ? 35.055 17.277 30.563 1.00 9.04  ? 218  SER B N   1 
ATOM   1497 C CA  . SER B 2 44  ? 35.504 16.295 31.541 1.00 8.81  ? 218  SER B CA  1 
ATOM   1498 C C   . SER B 2 44  ? 34.393 15.724 32.408 1.00 7.59  ? 218  SER B C   1 
ATOM   1499 O O   . SER B 2 44  ? 34.376 14.527 32.686 1.00 9.01  ? 218  SER B O   1 
ATOM   1500 C CB  . SER B 2 44  ? 36.593 16.912 32.418 1.00 7.87  ? 218  SER B CB  1 
ATOM   1501 O OG  . SER B 2 44  ? 37.700 17.307 31.620 1.00 10.45 ? 218  SER B OG  1 
ATOM   1502 N N   . LEU B 2 45  ? 33.469 16.576 32.835 1.00 8.17  ? 219  LEU B N   1 
ATOM   1503 C CA  . LEU B 2 45  ? 32.356 16.122 33.659 1.00 7.94  ? 219  LEU B CA  1 
ATOM   1504 C C   . LEU B 2 45  ? 31.536 15.078 32.905 1.00 8.03  ? 219  LEU B C   1 
ATOM   1505 O O   . LEU B 2 45  ? 31.238 14.015 33.439 1.00 7.28  ? 219  LEU B O   1 
ATOM   1506 C CB  . LEU B 2 45  ? 31.462 17.304 34.052 1.00 7.86  ? 219  LEU B CB  1 
ATOM   1507 C CG  . LEU B 2 45  ? 30.175 16.964 34.814 1.00 8.56  ? 219  LEU B CG  1 
ATOM   1508 C CD1 . LEU B 2 45  ? 30.497 16.250 36.125 1.00 9.03  ? 219  LEU B CD1 1 
ATOM   1509 C CD2 . LEU B 2 45  ? 29.406 18.246 35.087 1.00 9.42  ? 219  LEU B CD2 1 
ATOM   1510 N N   . CYS B 2 46  ? 31.175 15.375 31.660 1.00 7.77  ? 220  CYS B N   1 
ATOM   1511 C CA  . CYS B 2 46  ? 30.392 14.422 30.883 1.00 8.06  ? 220  CYS B CA  1 
ATOM   1512 C C   . CYS B 2 46  ? 31.141 13.111 30.664 1.00 8.70  ? 220  CYS B C   1 
ATOM   1513 O O   . CYS B 2 46  ? 30.549 12.035 30.732 1.00 9.82  ? 220  CYS B O   1 
ATOM   1514 C CB  . CYS B 2 46  ? 29.988 15.033 29.542 1.00 8.22  ? 220  CYS B CB  1 
ATOM   1515 S SG  . CYS B 2 46  ? 28.771 16.360 29.719 1.00 9.19  ? 220  CYS B SG  1 
ATOM   1516 N N   . ALA B 2 47  ? 32.443 13.196 30.403 1.00 7.64  ? 221  ALA B N   1 
ATOM   1517 C CA  . ALA B 2 47  ? 33.234 11.990 30.188 1.00 8.27  ? 221  ALA B CA  1 
ATOM   1518 C C   . ALA B 2 47  ? 33.254 11.115 31.441 1.00 8.11  ? 221  ALA B C   1 
ATOM   1519 O O   . ALA B 2 47  ? 33.085 9.900  31.359 1.00 8.41  ? 221  ALA B O   1 
ATOM   1520 C CB  . ALA B 2 47  ? 34.659 12.356 29.786 1.00 8.21  ? 221  ALA B CB  1 
ATOM   1521 N N   . MET B 2 48  ? 33.451 11.728 32.605 1.00 8.62  ? 222  MET B N   1 
ATOM   1522 C CA  . MET B 2 48  ? 33.497 10.958 33.845 1.00 8.13  ? 222  MET B CA  1 
ATOM   1523 C C   . MET B 2 48  ? 32.127 10.403 34.242 1.00 8.34  ? 222  MET B C   1 
ATOM   1524 O O   . MET B 2 48  ? 32.035 9.303  34.783 1.00 8.08  ? 222  MET B O   1 
ATOM   1525 C CB  . MET B 2 48  ? 34.102 11.801 34.974 1.00 7.39  ? 222  MET B CB  1 
ATOM   1526 C CG  . MET B 2 48  ? 35.554 12.213 34.704 1.00 10.75 ? 222  MET B CG  1 
ATOM   1527 S SD  . MET B 2 48  ? 36.702 10.812 34.484 1.00 10.71 ? 222  MET B SD  1 
ATOM   1528 C CE  . MET B 2 48  ? 36.675 10.585 32.685 1.00 10.37 ? 222  MET B CE  1 
ATOM   1529 N N   . LEU B 2 49  ? 31.060 11.151 33.971 1.00 8.21  ? 223  LEU B N   1 
ATOM   1530 C CA  . LEU B 2 49  ? 29.720 10.662 34.281 1.00 8.75  ? 223  LEU B CA  1 
ATOM   1531 C C   . LEU B 2 49  ? 29.407 9.474  33.370 1.00 9.66  ? 223  LEU B C   1 
ATOM   1532 O O   . LEU B 2 49  ? 28.863 8.461  33.805 1.00 9.73  ? 223  LEU B O   1 
ATOM   1533 C CB  . LEU B 2 49  ? 28.679 11.767 34.069 1.00 8.21  ? 223  LEU B CB  1 
ATOM   1534 C CG  . LEU B 2 49  ? 28.546 12.808 35.185 1.00 9.43  ? 223  LEU B CG  1 
ATOM   1535 C CD1 . LEU B 2 49  ? 27.629 13.941 34.747 1.00 7.40  ? 223  LEU B CD1 1 
ATOM   1536 C CD2 . LEU B 2 49  ? 27.995 12.144 36.435 1.00 7.17  ? 223  LEU B CD2 1 
ATOM   1537 N N   . LYS B 2 50  ? 29.764 9.601  32.099 1.00 11.00 ? 224  LYS B N   1 
ATOM   1538 C CA  . LYS B 2 50  ? 29.512 8.537  31.136 1.00 11.90 ? 224  LYS B CA  1 
ATOM   1539 C C   . LYS B 2 50  ? 30.251 7.254  31.515 1.00 12.17 ? 224  LYS B C   1 
ATOM   1540 O O   . LYS B 2 50  ? 29.742 6.147  31.326 1.00 12.73 ? 224  LYS B O   1 
ATOM   1541 C CB  . LYS B 2 50  ? 29.953 8.993  29.745 1.00 14.21 ? 224  LYS B CB  1 
ATOM   1542 C CG  . LYS B 2 50  ? 29.358 8.198  28.600 1.00 20.63 ? 224  LYS B CG  1 
ATOM   1543 C CD  . LYS B 2 50  ? 29.879 8.707  27.258 1.00 23.78 ? 224  LYS B CD  1 
ATOM   1544 C CE  . LYS B 2 50  ? 29.749 10.225 27.132 1.00 26.44 ? 224  LYS B CE  1 
ATOM   1545 N NZ  . LYS B 2 50  ? 28.350 10.728 27.273 1.00 29.73 ? 224  LYS B NZ  1 
ATOM   1546 N N   . GLN B 2 51  ? 31.447 7.403  32.067 1.00 11.43 ? 225  GLN B N   1 
ATOM   1547 C CA  . GLN B 2 51  ? 32.251 6.246  32.438 1.00 12.16 ? 225  GLN B CA  1 
ATOM   1548 C C   . GLN B 2 51  ? 32.052 5.710  33.853 1.00 12.55 ? 225  GLN B C   1 
ATOM   1549 O O   . GLN B 2 51  ? 32.214 4.510  34.086 1.00 13.51 ? 225  GLN B O   1 
ATOM   1550 C CB  . GLN B 2 51  ? 33.735 6.570  32.213 1.00 14.11 ? 225  GLN B CB  1 
ATOM   1551 C CG  . GLN B 2 51  ? 34.711 5.617  32.887 1.00 15.93 ? 225  GLN B CG  1 
ATOM   1552 C CD  . GLN B 2 51  ? 36.146 5.857  32.459 1.00 19.15 ? 225  GLN B CD  1 
ATOM   1553 O OE1 . GLN B 2 51  ? 36.555 6.996  32.219 1.00 17.37 ? 225  GLN B OE1 1 
ATOM   1554 N NE2 . GLN B 2 51  ? 36.926 4.782  32.373 1.00 19.58 ? 225  GLN B NE2 1 
ATOM   1555 N N   . TYR B 2 52  ? 31.671 6.572  34.791 1.00 10.81 ? 226  TYR B N   1 
ATOM   1556 C CA  . TYR B 2 52  ? 31.532 6.130  36.177 1.00 11.08 ? 226  TYR B CA  1 
ATOM   1557 C C   . TYR B 2 52  ? 30.198 6.312  36.899 1.00 11.51 ? 226  TYR B C   1 
ATOM   1558 O O   . TYR B 2 52  ? 30.078 5.911  38.059 1.00 11.65 ? 226  TYR B O   1 
ATOM   1559 C CB  . TYR B 2 52  ? 32.619 6.796  37.024 1.00 11.69 ? 226  TYR B CB  1 
ATOM   1560 C CG  . TYR B 2 52  ? 34.028 6.476  36.591 1.00 14.30 ? 226  TYR B CG  1 
ATOM   1561 C CD1 . TYR B 2 52  ? 34.550 5.192  36.742 1.00 13.63 ? 226  TYR B CD1 1 
ATOM   1562 C CD2 . TYR B 2 52  ? 34.842 7.459  36.027 1.00 13.78 ? 226  TYR B CD2 1 
ATOM   1563 C CE1 . TYR B 2 52  ? 35.848 4.894  36.342 1.00 16.44 ? 226  TYR B CE1 1 
ATOM   1564 C CE2 . TYR B 2 52  ? 36.140 7.172  35.624 1.00 17.33 ? 226  TYR B CE2 1 
ATOM   1565 C CZ  . TYR B 2 52  ? 36.636 5.889  35.784 1.00 16.78 ? 226  TYR B CZ  1 
ATOM   1566 O OH  . TYR B 2 52  ? 37.921 5.602  35.386 1.00 21.79 ? 226  TYR B OH  1 
ATOM   1567 N N   . ALA B 2 53  ? 29.202 6.901  36.246 1.00 11.15 ? 227  ALA B N   1 
ATOM   1568 C CA  . ALA B 2 53  ? 27.915 7.123  36.908 1.00 10.43 ? 227  ALA B CA  1 
ATOM   1569 C C   . ALA B 2 53  ? 27.250 5.852  37.440 1.00 11.85 ? 227  ALA B C   1 
ATOM   1570 O O   . ALA B 2 53  ? 26.481 5.908  38.399 1.00 11.30 ? 227  ALA B O   1 
ATOM   1571 C CB  . ALA B 2 53  ? 26.961 7.859  35.973 1.00 10.33 ? 227  ALA B CB  1 
ATOM   1572 N N   . ASP B 2 54  ? 27.536 4.708  36.830 1.00 12.29 ? 228  ASP B N   1 
ATOM   1573 C CA  . ASP B 2 54  ? 26.935 3.461  37.293 1.00 14.21 ? 228  ASP B CA  1 
ATOM   1574 C C   . ASP B 2 54  ? 27.918 2.656  38.131 1.00 15.93 ? 228  ASP B C   1 
ATOM   1575 O O   . ASP B 2 54  ? 27.712 1.464  38.361 1.00 16.50 ? 228  ASP B O   1 
ATOM   1576 C CB  . ASP B 2 54  ? 26.460 2.620  36.099 1.00 15.93 ? 228  ASP B CB  1 
ATOM   1577 C CG  . ASP B 2 54  ? 27.604 2.157  35.211 1.00 18.35 ? 228  ASP B CG  1 
ATOM   1578 O OD1 . ASP B 2 54  ? 28.751 2.598  35.426 1.00 19.83 ? 228  ASP B OD1 1 
ATOM   1579 O OD2 . ASP B 2 54  ? 27.352 1.351  34.288 1.00 21.59 ? 228  ASP B OD2 1 
ATOM   1580 N N   . LYS B 2 55  ? 28.973 3.314  38.610 1.00 16.44 ? 229  LYS B N   1 
ATOM   1581 C CA  . LYS B 2 55  ? 30.001 2.633  39.393 1.00 18.15 ? 229  LYS B CA  1 
ATOM   1582 C C   . LYS B 2 55  ? 30.481 3.368  40.646 1.00 17.60 ? 229  LYS B C   1 
ATOM   1583 O O   . LYS B 2 55  ? 30.803 2.732  41.650 1.00 19.49 ? 229  LYS B O   1 
ATOM   1584 C CB  . LYS B 2 55  ? 31.229 2.369  38.515 1.00 20.49 ? 229  LYS B CB  1 
ATOM   1585 C CG  . LYS B 2 55  ? 30.946 1.721  37.171 1.00 23.42 ? 229  LYS B CG  1 
ATOM   1586 C CD  . LYS B 2 55  ? 32.226 1.624  36.347 1.00 23.89 ? 229  LYS B CD  1 
ATOM   1587 C CE  . LYS B 2 55  ? 31.978 1.005  34.979 1.00 25.98 ? 229  LYS B CE  1 
ATOM   1588 N NZ  . LYS B 2 55  ? 31.088 1.843  34.126 1.00 25.39 ? 229  LYS B NZ  1 
ATOM   1589 N N   . LEU B 2 56  ? 30.544 4.695  40.588 1.00 13.75 ? 230  LEU B N   1 
ATOM   1590 C CA  . LEU B 2 56  ? 31.049 5.477  41.716 1.00 12.74 ? 230  LEU B CA  1 
ATOM   1591 C C   . LEU B 2 56  ? 30.088 6.491  42.318 1.00 11.23 ? 230  LEU B C   1 
ATOM   1592 O O   . LEU B 2 56  ? 29.175 6.970  41.655 1.00 11.52 ? 230  LEU B O   1 
ATOM   1593 C CB  . LEU B 2 56  ? 32.314 6.231  41.296 1.00 14.36 ? 230  LEU B CB  1 
ATOM   1594 C CG  . LEU B 2 56  ? 33.482 5.455  40.689 1.00 16.58 ? 230  LEU B CG  1 
ATOM   1595 C CD1 . LEU B 2 56  ? 34.583 6.437  40.297 1.00 16.81 ? 230  LEU B CD1 1 
ATOM   1596 C CD2 . LEU B 2 56  ? 34.000 4.430  41.692 1.00 17.89 ? 230  LEU B CD2 1 
ATOM   1597 N N   . GLU B 2 57  ? 30.326 6.821  43.586 1.00 9.83  ? 231  GLU B N   1 
ATOM   1598 C CA  . GLU B 2 57  ? 29.531 7.812  44.305 1.00 8.10  ? 231  GLU B CA  1 
ATOM   1599 C C   . GLU B 2 57  ? 29.886 9.154  43.655 1.00 8.96  ? 231  GLU B C   1 
ATOM   1600 O O   . GLU B 2 57  ? 31.003 9.332  43.168 1.00 6.91  ? 231  GLU B O   1 
ATOM   1601 C CB  . GLU B 2 57  ? 29.904 7.785  45.794 1.00 8.95  ? 231  GLU B CB  1 
ATOM   1602 C CG  . GLU B 2 57  ? 28.964 8.548  46.726 1.00 8.60  ? 231  GLU B CG  1 
ATOM   1603 C CD  . GLU B 2 57  ? 29.265 10.035 46.790 1.00 9.46  ? 231  GLU B CD  1 
ATOM   1604 O OE1 . GLU B 2 57  ? 30.458 10.397 46.744 1.00 10.85 ? 231  GLU B OE1 1 
ATOM   1605 O OE2 . GLU B 2 57  ? 28.314 10.839 46.906 1.00 8.95  ? 231  GLU B OE2 1 
ATOM   1606 N N   . PHE B 2 58  ? 28.942 10.091 43.647 1.00 9.02  ? 232  PHE B N   1 
ATOM   1607 C CA  . PHE B 2 58  ? 29.141 11.387 42.992 1.00 8.71  ? 232  PHE B CA  1 
ATOM   1608 C C   . PHE B 2 58  ? 30.397 12.181 43.353 1.00 8.20  ? 232  PHE B C   1 
ATOM   1609 O O   . PHE B 2 58  ? 31.060 12.716 42.465 1.00 8.59  ? 232  PHE B O   1 
ATOM   1610 C CB  . PHE B 2 58  ? 27.893 12.259 43.188 1.00 8.73  ? 232  PHE B CB  1 
ATOM   1611 C CG  . PHE B 2 58  ? 27.840 13.467 42.289 1.00 9.65  ? 232  PHE B CG  1 
ATOM   1612 C CD1 . PHE B 2 58  ? 28.289 13.397 40.971 1.00 8.99  ? 232  PHE B CD1 1 
ATOM   1613 C CD2 . PHE B 2 58  ? 27.296 14.665 42.748 1.00 8.44  ? 232  PHE B CD2 1 
ATOM   1614 C CE1 . PHE B 2 58  ? 28.195 14.501 40.119 1.00 9.14  ? 232  PHE B CE1 1 
ATOM   1615 C CE2 . PHE B 2 58  ? 27.196 15.777 41.905 1.00 10.39 ? 232  PHE B CE2 1 
ATOM   1616 C CZ  . PHE B 2 58  ? 27.645 15.694 40.589 1.00 7.43  ? 232  PHE B CZ  1 
ATOM   1617 N N   . MET B 2 59  ? 30.732 12.276 44.637 1.00 8.05  ? 233  MET B N   1 
ATOM   1618 C CA  . MET B 2 59  ? 31.926 13.026 45.019 1.00 8.28  ? 233  MET B CA  1 
ATOM   1619 C C   . MET B 2 59  ? 33.177 12.404 44.402 1.00 7.73  ? 233  MET B C   1 
ATOM   1620 O O   . MET B 2 59  ? 34.113 13.111 44.025 1.00 7.88  ? 233  MET B O   1 
ATOM   1621 C CB  . MET B 2 59  ? 32.068 13.082 46.544 1.00 7.32  ? 233  MET B CB  1 
ATOM   1622 C CG  . MET B 2 59  ? 30.965 13.865 47.237 1.00 10.47 ? 233  MET B CG  1 
ATOM   1623 S SD  . MET B 2 59  ? 30.921 15.592 46.712 1.00 14.99 ? 233  MET B SD  1 
ATOM   1624 C CE  . MET B 2 59  ? 32.304 16.240 47.628 1.00 18.79 ? 233  MET B CE  1 
ATOM   1625 N N   . HIS B 2 60  ? 33.190 11.081 44.286 1.00 7.56  ? 234  HIS B N   1 
ATOM   1626 C CA  . HIS B 2 60  ? 34.338 10.404 43.711 1.00 7.71  ? 234  HIS B CA  1 
ATOM   1627 C C   . HIS B 2 60  ? 34.387 10.626 42.205 1.00 7.80  ? 234  HIS B C   1 
ATOM   1628 O O   . HIS B 2 60  ? 35.463 10.666 41.615 1.00 8.57  ? 234  HIS B O   1 
ATOM   1629 C CB  . HIS B 2 60  ? 34.299 8.915  44.072 1.00 9.33  ? 234  HIS B CB  1 
ATOM   1630 C CG  . HIS B 2 60  ? 34.532 8.658  45.530 1.00 11.73 ? 234  HIS B CG  1 
ATOM   1631 N ND1 . HIS B 2 60  ? 34.396 7.413  46.104 1.00 14.85 ? 234  HIS B ND1 1 
ATOM   1632 C CD2 . HIS B 2 60  ? 34.909 9.493  46.528 1.00 12.18 ? 234  HIS B CD2 1 
ATOM   1633 C CE1 . HIS B 2 60  ? 34.679 7.490  47.392 1.00 14.60 ? 234  HIS B CE1 1 
ATOM   1634 N NE2 . HIS B 2 60  ? 34.994 8.742  47.675 1.00 12.38 ? 234  HIS B NE2 1 
ATOM   1635 N N   . ILE B 2 61  ? 33.221 10.788 41.587 1.00 7.06  ? 235  ILE B N   1 
ATOM   1636 C CA  . ILE B 2 61  ? 33.177 11.051 40.153 1.00 6.26  ? 235  ILE B CA  1 
ATOM   1637 C C   . ILE B 2 61  ? 33.744 12.447 39.933 1.00 6.12  ? 235  ILE B C   1 
ATOM   1638 O O   . ILE B 2 61  ? 34.582 12.653 39.057 1.00 7.40  ? 235  ILE B O   1 
ATOM   1639 C CB  . ILE B 2 61  ? 31.731 11.018 39.606 1.00 6.23  ? 235  ILE B CB  1 
ATOM   1640 C CG1 . ILE B 2 61  ? 31.167 9.599  39.722 1.00 7.68  ? 235  ILE B CG1 1 
ATOM   1641 C CG2 . ILE B 2 61  ? 31.713 11.488 38.146 1.00 7.68  ? 235  ILE B CG2 1 
ATOM   1642 C CD1 . ILE B 2 61  ? 29.725 9.466  39.269 1.00 6.56  ? 235  ILE B CD1 1 
ATOM   1643 N N   . LEU B 2 62  ? 33.291 13.401 40.743 1.00 5.83  ? 236  LEU B N   1 
ATOM   1644 C CA  . LEU B 2 62  ? 33.752 14.780 40.623 1.00 6.36  ? 236  LEU B CA  1 
ATOM   1645 C C   . LEU B 2 62  ? 35.248 14.904 40.908 1.00 6.74  ? 236  LEU B C   1 
ATOM   1646 O O   . LEU B 2 62  ? 35.917 15.780 40.366 1.00 6.53  ? 236  LEU B O   1 
ATOM   1647 C CB  . LEU B 2 62  ? 32.957 15.690 41.563 1.00 6.59  ? 236  LEU B CB  1 
ATOM   1648 C CG  . LEU B 2 62  ? 31.487 15.923 41.190 1.00 7.05  ? 236  LEU B CG  1 
ATOM   1649 C CD1 . LEU B 2 62  ? 30.828 16.805 42.248 1.00 8.98  ? 236  LEU B CD1 1 
ATOM   1650 C CD2 . LEU B 2 62  ? 31.399 16.580 39.811 1.00 7.65  ? 236  LEU B CD2 1 
ATOM   1651 N N   . THR B 2 63  ? 35.774 14.025 41.755 1.00 6.49  ? 237  THR B N   1 
ATOM   1652 C CA  . THR B 2 63  ? 37.199 14.053 42.061 1.00 6.35  ? 237  THR B CA  1 
ATOM   1653 C C   . THR B 2 63  ? 37.972 13.630 40.809 1.00 6.42  ? 237  THR B C   1 
ATOM   1654 O O   . THR B 2 63  ? 39.055 14.152 40.533 1.00 7.46  ? 237  THR B O   1 
ATOM   1655 C CB  . THR B 2 63  ? 37.539 13.114 43.235 1.00 6.25  ? 237  THR B CB  1 
ATOM   1656 O OG1 . THR B 2 63  ? 36.870 13.580 44.415 1.00 7.16  ? 237  THR B OG1 1 
ATOM   1657 C CG2 . THR B 2 63  ? 39.045 13.096 43.495 1.00 6.80  ? 237  THR B CG2 1 
ATOM   1658 N N   . ARG B 2 64  ? 37.416 12.685 40.051 1.00 7.46  ? 238  ARG B N   1 
ATOM   1659 C CA  . ARG B 2 64  ? 38.056 12.241 38.814 1.00 6.45  ? 238  ARG B CA  1 
ATOM   1660 C C   . ARG B 2 64  ? 38.021 13.394 37.815 1.00 7.88  ? 238  ARG B C   1 
ATOM   1661 O O   . ARG B 2 64  ? 38.945 13.559 37.019 1.00 7.29  ? 238  ARG B O   1 
ATOM   1662 C CB  . ARG B 2 64  ? 37.328 11.041 38.197 1.00 10.79 ? 238  ARG B CB  1 
ATOM   1663 C CG  . ARG B 2 64  ? 37.263 9.788  39.051 1.00 15.41 ? 238  ARG B CG  1 
ATOM   1664 C CD  . ARG B 2 64  ? 38.624 9.180  39.307 1.00 20.43 ? 238  ARG B CD  1 
ATOM   1665 N NE  . ARG B 2 64  ? 38.504 7.870  39.946 1.00 23.78 ? 238  ARG B NE  1 
ATOM   1666 C CZ  . ARG B 2 64  ? 38.456 6.713  39.289 1.00 26.21 ? 238  ARG B CZ  1 
ATOM   1667 N NH1 . ARG B 2 64  ? 38.523 6.693  37.964 1.00 26.05 ? 238  ARG B NH1 1 
ATOM   1668 N NH2 . ARG B 2 64  ? 38.333 5.575  39.957 1.00 26.13 ? 238  ARG B NH2 1 
ATOM   1669 N N   . VAL B 2 65  ? 36.941 14.176 37.842 1.00 7.12  ? 239  VAL B N   1 
ATOM   1670 C CA  . VAL B 2 65  ? 36.820 15.324 36.944 1.00 6.45  ? 239  VAL B CA  1 
ATOM   1671 C C   . VAL B 2 65  ? 37.908 16.326 37.324 1.00 7.24  ? 239  VAL B C   1 
ATOM   1672 O O   . VAL B 2 65  ? 38.558 16.911 36.457 1.00 8.55  ? 239  VAL B O   1 
ATOM   1673 C CB  . VAL B 2 65  ? 35.440 16.011 37.067 1.00 6.03  ? 239  VAL B CB  1 
ATOM   1674 C CG1 . VAL B 2 65  ? 35.398 17.272 36.195 1.00 5.15  ? 239  VAL B CG1 1 
ATOM   1675 C CG2 . VAL B 2 65  ? 34.342 15.047 36.646 1.00 5.17  ? 239  VAL B CG2 1 
ATOM   1676 N N   . ASN B 2 66  ? 38.108 16.521 38.626 1.00 7.37  ? 240  ASN B N   1 
ATOM   1677 C CA  . ASN B 2 66  ? 39.143 17.439 39.096 1.00 6.83  ? 240  ASN B CA  1 
ATOM   1678 C C   . ASN B 2 66  ? 40.502 17.020 38.540 1.00 7.29  ? 240  ASN B C   1 
ATOM   1679 O O   . ASN B 2 66  ? 41.253 17.844 38.017 1.00 6.66  ? 240  ASN B O   1 
ATOM   1680 C CB  . ASN B 2 66  ? 39.216 17.441 40.626 1.00 7.09  ? 240  ASN B CB  1 
ATOM   1681 C CG  . ASN B 2 66  ? 38.210 18.380 41.266 1.00 6.75  ? 240  ASN B CG  1 
ATOM   1682 O OD1 . ASN B 2 66  ? 37.366 18.967 40.592 1.00 7.19  ? 240  ASN B OD1 1 
ATOM   1683 N ND2 . ASN B 2 66  ? 38.300 18.523 42.588 1.00 5.61  ? 240  ASN B ND2 1 
ATOM   1684 N N   . ARG B 2 67  ? 40.820 15.733 38.650 1.00 6.14  ? 241  ARG B N   1 
ATOM   1685 C CA  . ARG B 2 67  ? 42.108 15.251 38.161 1.00 7.95  ? 241  ARG B CA  1 
ATOM   1686 C C   . ARG B 2 67  ? 42.259 15.376 36.646 1.00 7.17  ? 241  ARG B C   1 
ATOM   1687 O O   . ARG B 2 67  ? 43.327 15.746 36.156 1.00 7.49  ? 241  ARG B O   1 
ATOM   1688 C CB  . ARG B 2 67  ? 42.341 13.795 38.584 1.00 9.03  ? 241  ARG B CB  1 
ATOM   1689 C CG  . ARG B 2 67  ? 43.753 13.314 38.258 1.00 11.54 ? 241  ARG B CG  1 
ATOM   1690 C CD  . ARG B 2 67  ? 44.144 12.060 39.021 1.00 15.02 ? 241  ARG B CD  1 
ATOM   1691 N NE  . ARG B 2 67  ? 43.468 10.856 38.546 1.00 16.26 ? 241  ARG B NE  1 
ATOM   1692 C CZ  . ARG B 2 67  ? 42.501 10.225 39.207 1.00 18.71 ? 241  ARG B CZ  1 
ATOM   1693 N NH1 . ARG B 2 67  ? 42.076 10.683 40.379 1.00 18.38 ? 241  ARG B NH1 1 
ATOM   1694 N NH2 . ARG B 2 67  ? 41.977 9.114  38.710 1.00 15.74 ? 241  ARG B NH2 1 
ATOM   1695 N N   . LYS B 2 68  ? 41.194 15.075 35.910 1.00 7.06  ? 242  LYS B N   1 
ATOM   1696 C CA  . LYS B 2 68  ? 41.235 15.154 34.451 1.00 6.38  ? 242  LYS B CA  1 
ATOM   1697 C C   . LYS B 2 68  ? 41.527 16.581 33.982 1.00 7.08  ? 242  LYS B C   1 
ATOM   1698 O O   . LYS B 2 68  ? 42.418 16.811 33.158 1.00 7.48  ? 242  LYS B O   1 
ATOM   1699 C CB  . LYS B 2 68  ? 39.908 14.662 33.863 1.00 7.73  ? 242  LYS B CB  1 
ATOM   1700 C CG  . LYS B 2 68  ? 39.890 14.556 32.343 1.00 11.17 ? 242  LYS B CG  1 
ATOM   1701 C CD  . LYS B 2 68  ? 38.579 13.941 31.854 1.00 13.70 ? 242  LYS B CD  1 
ATOM   1702 C CE  . LYS B 2 68  ? 38.479 13.963 30.332 1.00 17.17 ? 242  LYS B CE  1 
ATOM   1703 N NZ  . LYS B 2 68  ? 39.597 13.226 29.673 1.00 17.74 ? 242  LYS B NZ  1 
ATOM   1704 N N   . VAL B 2 69  ? 40.782 17.544 34.512 1.00 5.48  ? 243  VAL B N   1 
ATOM   1705 C CA  . VAL B 2 69  ? 40.984 18.936 34.132 1.00 6.00  ? 243  VAL B CA  1 
ATOM   1706 C C   . VAL B 2 69  ? 42.373 19.429 34.540 1.00 6.78  ? 243  VAL B C   1 
ATOM   1707 O O   . VAL B 2 69  ? 43.084 20.052 33.749 1.00 5.70  ? 243  VAL B O   1 
ATOM   1708 C CB  . VAL B 2 69  ? 39.916 19.845 34.779 1.00 5.71  ? 243  VAL B CB  1 
ATOM   1709 C CG1 . VAL B 2 69  ? 40.210 21.307 34.475 1.00 6.18  ? 243  VAL B CG1 1 
ATOM   1710 C CG2 . VAL B 2 69  ? 38.537 19.464 34.256 1.00 7.37  ? 243  VAL B CG2 1 
ATOM   1711 N N   . ALA B 2 70  ? 42.761 19.135 35.774 1.00 6.15  ? 244  ALA B N   1 
ATOM   1712 C CA  . ALA B 2 70  ? 44.052 19.570 36.295 1.00 8.08  ? 244  ALA B CA  1 
ATOM   1713 C C   . ALA B 2 70  ? 45.270 19.024 35.556 1.00 9.29  ? 244  ALA B C   1 
ATOM   1714 O O   . ALA B 2 70  ? 46.261 19.731 35.379 1.00 10.31 ? 244  ALA B O   1 
ATOM   1715 C CB  . ALA B 2 70  ? 44.157 19.206 37.778 1.00 9.43  ? 244  ALA B CB  1 
ATOM   1716 N N   . THR B 2 71  ? 45.203 17.773 35.121 1.00 9.25  ? 245  THR B N   1 
ATOM   1717 C CA  . THR B 2 71  ? 46.345 17.164 34.451 1.00 11.92 ? 245  THR B CA  1 
ATOM   1718 C C   . THR B 2 71  ? 46.386 17.234 32.927 1.00 12.63 ? 245  THR B C   1 
ATOM   1719 O O   . THR B 2 71  ? 47.446 17.444 32.339 1.00 13.83 ? 245  THR B O   1 
ATOM   1720 C CB  . THR B 2 71  ? 46.478 15.678 34.855 1.00 13.63 ? 245  THR B CB  1 
ATOM   1721 O OG1 . THR B 2 71  ? 45.308 14.961 34.441 1.00 14.66 ? 245  THR B OG1 1 
ATOM   1722 C CG2 . THR B 2 71  ? 46.632 15.547 36.362 1.00 13.70 ? 245  THR B CG2 1 
ATOM   1723 N N   . GLU B 2 72  ? 45.236 17.080 32.287 1.00 12.20 ? 246  GLU B N   1 
ATOM   1724 C CA  . GLU B 2 72  ? 45.184 17.056 30.832 1.00 12.99 ? 246  GLU B CA  1 
ATOM   1725 C C   . GLU B 2 72  ? 45.099 18.369 30.065 1.00 13.76 ? 246  GLU B C   1 
ATOM   1726 O O   . GLU B 2 72  ? 45.486 18.424 28.896 1.00 15.64 ? 246  GLU B O   1 
ATOM   1727 C CB  . GLU B 2 72  ? 44.035 16.143 30.398 1.00 14.95 ? 246  GLU B CB  1 
ATOM   1728 C CG  . GLU B 2 72  ? 44.290 14.670 30.701 1.00 19.15 ? 246  GLU B CG  1 
ATOM   1729 C CD  . GLU B 2 72  ? 43.048 13.808 30.570 1.00 20.22 ? 246  GLU B CD  1 
ATOM   1730 O OE1 . GLU B 2 72  ? 42.203 14.100 29.698 1.00 21.21 ? 246  GLU B OE1 1 
ATOM   1731 O OE2 . GLU B 2 72  ? 42.925 12.826 31.334 1.00 23.24 ? 246  GLU B OE2 1 
ATOM   1732 N N   . PHE B 2 73  ? 44.618 19.425 30.708 1.00 10.52 ? 247  PHE B N   1 
ATOM   1733 C CA  . PHE B 2 73  ? 44.453 20.700 30.020 1.00 10.51 ? 247  PHE B CA  1 
ATOM   1734 C C   . PHE B 2 73  ? 45.416 21.821 30.386 1.00 10.21 ? 247  PHE B C   1 
ATOM   1735 O O   . PHE B 2 73  ? 45.812 21.975 31.536 1.00 9.88  ? 247  PHE B O   1 
ATOM   1736 C CB  . PHE B 2 73  ? 43.023 21.201 30.231 1.00 9.24  ? 247  PHE B CB  1 
ATOM   1737 C CG  . PHE B 2 73  ? 41.971 20.304 29.647 1.00 10.60 ? 247  PHE B CG  1 
ATOM   1738 C CD1 . PHE B 2 73  ? 41.561 20.460 28.327 1.00 11.59 ? 247  PHE B CD1 1 
ATOM   1739 C CD2 . PHE B 2 73  ? 41.382 19.306 30.418 1.00 11.99 ? 247  PHE B CD2 1 
ATOM   1740 C CE1 . PHE B 2 73  ? 40.574 19.633 27.781 1.00 10.76 ? 247  PHE B CE1 1 
ATOM   1741 C CE2 . PHE B 2 73  ? 40.396 18.476 29.881 1.00 13.02 ? 247  PHE B CE2 1 
ATOM   1742 C CZ  . PHE B 2 73  ? 39.992 18.642 28.561 1.00 13.46 ? 247  PHE B CZ  1 
ATOM   1743 N N   . GLU B 2 74  ? 45.780 22.605 29.377 1.00 10.14 ? 248  GLU B N   1 
ATOM   1744 C CA  . GLU B 2 74  ? 46.647 23.762 29.549 1.00 10.23 ? 248  GLU B CA  1 
ATOM   1745 C C   . GLU B 2 74  ? 46.277 24.712 28.417 1.00 10.30 ? 248  GLU B C   1 
ATOM   1746 O O   . GLU B 2 74  ? 46.188 24.299 27.262 1.00 10.10 ? 248  GLU B O   1 
ATOM   1747 C CB  . GLU B 2 74  ? 48.124 23.375 29.468 1.00 11.84 ? 248  GLU B CB  1 
ATOM   1748 C CG  . GLU B 2 74  ? 49.048 24.573 29.577 1.00 12.91 ? 248  GLU B CG  1 
ATOM   1749 C CD  . GLU B 2 74  ? 50.506 24.190 29.658 1.00 16.76 ? 248  GLU B CD  1 
ATOM   1750 O OE1 . GLU B 2 74  ? 51.333 24.939 29.102 1.00 16.33 ? 248  GLU B OE1 1 
ATOM   1751 O OE2 . GLU B 2 74  ? 50.828 23.156 30.286 1.00 16.01 ? 248  GLU B OE2 1 
ATOM   1752 N N   . SER B 2 75  ? 46.059 25.980 28.744 1.00 9.33  ? 249  SER B N   1 
ATOM   1753 C CA  . SER B 2 75  ? 45.642 26.946 27.734 1.00 9.44  ? 249  SER B CA  1 
ATOM   1754 C C   . SER B 2 75  ? 46.680 27.277 26.674 1.00 9.87  ? 249  SER B C   1 
ATOM   1755 O O   . SER B 2 75  ? 47.887 27.150 26.889 1.00 8.84  ? 249  SER B O   1 
ATOM   1756 C CB  . SER B 2 75  ? 45.188 28.250 28.397 1.00 9.43  ? 249  SER B CB  1 
ATOM   1757 O OG  . SER B 2 75  ? 46.298 29.016 28.841 1.00 10.91 ? 249  SER B OG  1 
ATOM   1758 N N   . PHE B 2 76  ? 46.174 27.690 25.517 1.00 9.52  ? 250  PHE B N   1 
ATOM   1759 C CA  . PHE B 2 76  ? 46.993 28.116 24.395 1.00 9.43  ? 250  PHE B CA  1 
ATOM   1760 C C   . PHE B 2 76  ? 46.456 29.489 24.015 1.00 10.32 ? 250  PHE B C   1 
ATOM   1761 O O   . PHE B 2 76  ? 45.245 29.660 23.834 1.00 10.16 ? 250  PHE B O   1 
ATOM   1762 C CB  . PHE B 2 76  ? 46.834 27.183 23.196 1.00 12.14 ? 250  PHE B CB  1 
ATOM   1763 C CG  . PHE B 2 76  ? 47.645 27.604 22.001 1.00 11.74 ? 250  PHE B CG  1 
ATOM   1764 C CD1 . PHE B 2 76  ? 48.992 27.271 21.908 1.00 13.36 ? 250  PHE B CD1 1 
ATOM   1765 C CD2 . PHE B 2 76  ? 47.074 28.373 20.992 1.00 14.12 ? 250  PHE B CD2 1 
ATOM   1766 C CE1 . PHE B 2 76  ? 49.762 27.699 20.826 1.00 14.31 ? 250  PHE B CE1 1 
ATOM   1767 C CE2 . PHE B 2 76  ? 47.836 28.809 19.905 1.00 14.51 ? 250  PHE B CE2 1 
ATOM   1768 C CZ  . PHE B 2 76  ? 49.181 28.471 19.824 1.00 12.40 ? 250  PHE B CZ  1 
ATOM   1769 N N   . SER B 2 77  ? 47.344 30.469 23.905 1.00 9.18  ? 251  SER B N   1 
ATOM   1770 C CA  . SER B 2 77  ? 46.923 31.812 23.534 1.00 10.87 ? 251  SER B CA  1 
ATOM   1771 C C   . SER B 2 77  ? 48.054 32.576 22.879 1.00 10.69 ? 251  SER B C   1 
ATOM   1772 O O   . SER B 2 77  ? 49.215 32.432 23.260 1.00 11.88 ? 251  SER B O   1 
ATOM   1773 C CB  . SER B 2 77  ? 46.452 32.587 24.766 1.00 10.78 ? 251  SER B CB  1 
ATOM   1774 O OG  . SER B 2 77  ? 46.028 33.892 24.407 1.00 13.35 ? 251  SER B OG  1 
ATOM   1775 N N   . PHE B 2 78  ? 47.711 33.385 21.884 1.00 11.64 ? 252  PHE B N   1 
ATOM   1776 C CA  . PHE B 2 78  ? 48.706 34.200 21.205 1.00 11.97 ? 252  PHE B CA  1 
ATOM   1777 C C   . PHE B 2 78  ? 49.129 35.314 22.160 1.00 12.70 ? 252  PHE B C   1 
ATOM   1778 O O   . PHE B 2 78  ? 50.175 35.938 21.985 1.00 12.31 ? 252  PHE B O   1 
ATOM   1779 C CB  . PHE B 2 78  ? 48.117 34.765 19.912 1.00 11.96 ? 252  PHE B CB  1 
ATOM   1780 C CG  . PHE B 2 78  ? 47.888 33.724 18.850 1.00 12.51 ? 252  PHE B CG  1 
ATOM   1781 C CD1 . PHE B 2 78  ? 46.825 33.839 17.959 1.00 14.95 ? 252  PHE B CD1 1 
ATOM   1782 C CD2 . PHE B 2 78  ? 48.742 32.629 18.736 1.00 12.66 ? 252  PHE B CD2 1 
ATOM   1783 C CE1 . PHE B 2 78  ? 46.614 32.879 16.971 1.00 16.19 ? 252  PHE B CE1 1 
ATOM   1784 C CE2 . PHE B 2 78  ? 48.541 31.662 17.752 1.00 11.58 ? 252  PHE B CE2 1 
ATOM   1785 C CZ  . PHE B 2 78  ? 47.475 31.787 16.868 1.00 13.71 ? 252  PHE B CZ  1 
ATOM   1786 N N   . ASP B 2 79  ? 48.304 35.551 23.178 1.00 12.83 ? 253  ASP B N   1 
ATOM   1787 C CA  . ASP B 2 79  ? 48.596 36.556 24.197 1.00 12.45 ? 253  ASP B CA  1 
ATOM   1788 C C   . ASP B 2 79  ? 49.334 35.832 25.322 1.00 12.31 ? 253  ASP B C   1 
ATOM   1789 O O   . ASP B 2 79  ? 48.759 34.981 26.003 1.00 12.77 ? 253  ASP B O   1 
ATOM   1790 C CB  . ASP B 2 79  ? 47.298 37.162 24.741 1.00 14.53 ? 253  ASP B CB  1 
ATOM   1791 C CG  . ASP B 2 79  ? 47.546 38.281 25.739 1.00 15.64 ? 253  ASP B CG  1 
ATOM   1792 O OD1 . ASP B 2 79  ? 48.683 38.407 26.245 1.00 15.26 ? 253  ASP B OD1 1 
ATOM   1793 O OD2 . ASP B 2 79  ? 46.594 39.034 26.026 1.00 17.62 ? 253  ASP B OD2 1 
ATOM   1794 N N   . ALA B 2 80  ? 50.607 36.163 25.511 1.00 11.99 ? 254  ALA B N   1 
ATOM   1795 C CA  . ALA B 2 80  ? 51.423 35.524 26.541 1.00 12.52 ? 254  ALA B CA  1 
ATOM   1796 C C   . ALA B 2 80  ? 50.741 35.508 27.907 1.00 13.01 ? 254  ALA B C   1 
ATOM   1797 O O   . ALA B 2 80  ? 50.872 34.549 28.668 1.00 12.09 ? 254  ALA B O   1 
ATOM   1798 C CB  . ALA B 2 80  ? 52.778 36.227 26.641 1.00 14.41 ? 254  ALA B CB  1 
ATOM   1799 N N   . THR B 2 81  ? 50.010 36.573 28.211 1.00 13.25 ? 255  THR B N   1 
ATOM   1800 C CA  . THR B 2 81  ? 49.320 36.686 29.490 1.00 14.20 ? 255  THR B CA  1 
ATOM   1801 C C   . THR B 2 81  ? 48.362 35.538 29.774 1.00 14.04 ? 255  THR B C   1 
ATOM   1802 O O   . THR B 2 81  ? 48.250 35.088 30.916 1.00 14.44 ? 255  THR B O   1 
ATOM   1803 C CB  . THR B 2 81  ? 48.533 38.007 29.570 1.00 15.56 ? 255  THR B CB  1 
ATOM   1804 O OG1 . THR B 2 81  ? 49.450 39.103 29.527 1.00 17.51 ? 255  THR B OG1 1 
ATOM   1805 C CG2 . THR B 2 81  ? 47.720 38.077 30.858 1.00 16.29 ? 255  THR B CG2 1 
ATOM   1806 N N   . PHE B 2 82  ? 47.676 35.063 28.738 1.00 12.27 ? 256  PHE B N   1 
ATOM   1807 C CA  . PHE B 2 82  ? 46.705 33.986 28.895 1.00 12.27 ? 256  PHE B CA  1 
ATOM   1808 C C   . PHE B 2 82  ? 47.177 32.631 28.384 1.00 11.58 ? 256  PHE B C   1 
ATOM   1809 O O   . PHE B 2 82  ? 46.384 31.691 28.283 1.00 11.92 ? 256  PHE B O   1 
ATOM   1810 C CB  . PHE B 2 82  ? 45.402 34.353 28.182 1.00 12.04 ? 256  PHE B CB  1 
ATOM   1811 C CG  . PHE B 2 82  ? 44.680 35.517 28.797 1.00 14.83 ? 256  PHE B CG  1 
ATOM   1812 C CD1 . PHE B 2 82  ? 45.149 36.816 28.625 1.00 16.29 ? 256  PHE B CD1 1 
ATOM   1813 C CD2 . PHE B 2 82  ? 43.533 35.313 29.558 1.00 16.87 ? 256  PHE B CD2 1 
ATOM   1814 C CE1 . PHE B 2 82  ? 44.484 37.896 29.204 1.00 15.09 ? 256  PHE B CE1 1 
ATOM   1815 C CE2 . PHE B 2 82  ? 42.862 36.386 30.141 1.00 15.79 ? 256  PHE B CE2 1 
ATOM   1816 C CZ  . PHE B 2 82  ? 43.341 37.679 29.962 1.00 16.48 ? 256  PHE B CZ  1 
ATOM   1817 N N   . HIS B 2 83  ? 48.462 32.528 28.067 1.00 8.85  ? 257  HIS B N   1 
ATOM   1818 C CA  . HIS B 2 83  ? 49.011 31.286 27.546 1.00 9.31  ? 257  HIS B CA  1 
ATOM   1819 C C   . HIS B 2 83  ? 49.594 30.372 28.620 1.00 9.41  ? 257  HIS B C   1 
ATOM   1820 O O   . HIS B 2 83  ? 50.114 30.839 29.630 1.00 9.93  ? 257  HIS B O   1 
ATOM   1821 C CB  . HIS B 2 83  ? 50.093 31.601 26.508 1.00 9.83  ? 257  HIS B CB  1 
ATOM   1822 C CG  . HIS B 2 83  ? 50.756 30.386 25.941 1.00 9.31  ? 257  HIS B CG  1 
ATOM   1823 N ND1 . HIS B 2 83  ? 50.088 29.475 25.151 1.00 8.85  ? 257  HIS B ND1 1 
ATOM   1824 C CD2 . HIS B 2 83  ? 52.020 29.920 26.068 1.00 8.54  ? 257  HIS B CD2 1 
ATOM   1825 C CE1 . HIS B 2 83  ? 50.913 28.499 24.816 1.00 7.37  ? 257  HIS B CE1 1 
ATOM   1826 N NE2 . HIS B 2 83  ? 52.092 28.745 25.359 1.00 9.35  ? 257  HIS B NE2 1 
ATOM   1827 N N   . ALA B 2 84  ? 49.492 29.066 28.383 1.00 8.89  ? 258  ALA B N   1 
ATOM   1828 C CA  . ALA B 2 84  ? 50.032 28.045 29.277 1.00 9.12  ? 258  ALA B CA  1 
ATOM   1829 C C   . ALA B 2 84  ? 49.468 28.074 30.691 1.00 10.67 ? 258  ALA B C   1 
ATOM   1830 O O   . ALA B 2 84  ? 50.193 27.823 31.657 1.00 11.50 ? 258  ALA B O   1 
ATOM   1831 C CB  . ALA B 2 84  ? 51.552 28.162 29.327 1.00 9.44  ? 258  ALA B CB  1 
ATOM   1832 N N   . LYS B 2 85  ? 48.176 28.360 30.813 1.00 9.89  ? 259  LYS B N   1 
ATOM   1833 C CA  . LYS B 2 85  ? 47.543 28.424 32.124 1.00 10.47 ? 259  LYS B CA  1 
ATOM   1834 C C   . LYS B 2 85  ? 46.825 27.128 32.475 1.00 10.23 ? 259  LYS B C   1 
ATOM   1835 O O   . LYS B 2 85  ? 46.433 26.360 31.595 1.00 9.19  ? 259  LYS B O   1 
ATOM   1836 C CB  . LYS B 2 85  ? 46.573 29.603 32.175 1.00 11.38 ? 259  LYS B CB  1 
ATOM   1837 C CG  . LYS B 2 85  ? 47.240 30.944 31.882 1.00 12.72 ? 259  LYS B CG  1 
ATOM   1838 C CD  . LYS B 2 85  ? 48.391 31.227 32.847 1.00 14.06 ? 259  LYS B CD  1 
ATOM   1839 C CE  . LYS B 2 85  ? 49.078 32.545 32.504 1.00 18.04 ? 259  LYS B CE  1 
ATOM   1840 N NZ  . LYS B 2 85  ? 50.223 32.846 33.400 1.00 22.79 ? 259  LYS B NZ  1 
ATOM   1841 N N   . LYS B 2 86  ? 46.651 26.901 33.772 1.00 9.86  ? 260  LYS B N   1 
ATOM   1842 C CA  . LYS B 2 86  ? 46.016 25.690 34.272 1.00 10.20 ? 260  LYS B CA  1 
ATOM   1843 C C   . LYS B 2 86  ? 44.694 25.964 34.979 1.00 9.95  ? 260  LYS B C   1 
ATOM   1844 O O   . LYS B 2 86  ? 44.355 27.114 35.270 1.00 9.07  ? 260  LYS B O   1 
ATOM   1845 C CB  . LYS B 2 86  ? 46.973 24.980 35.230 1.00 9.87  ? 260  LYS B CB  1 
ATOM   1846 C CG  . LYS B 2 86  ? 48.306 24.601 34.596 1.00 10.26 ? 260  LYS B CG  1 
ATOM   1847 C CD  . LYS B 2 86  ? 48.153 23.474 33.584 1.00 9.10  ? 260  LYS B CD  1 
ATOM   1848 C CE  . LYS B 2 86  ? 47.777 22.162 34.265 1.00 8.57  ? 260  LYS B CE  1 
ATOM   1849 N NZ  . LYS B 2 86  ? 47.677 21.039 33.290 1.00 6.77  ? 260  LYS B NZ  1 
ATOM   1850 N N   . GLN B 2 87  ? 43.963 24.892 35.277 1.00 9.01  ? 261  GLN B N   1 
ATOM   1851 C CA  . GLN B 2 87  ? 42.667 25.016 35.935 1.00 7.78  ? 261  GLN B CA  1 
ATOM   1852 C C   . GLN B 2 87  ? 42.353 23.826 36.833 1.00 8.21  ? 261  GLN B C   1 
ATOM   1853 O O   . GLN B 2 87  ? 42.649 22.684 36.486 1.00 7.61  ? 261  GLN B O   1 
ATOM   1854 C CB  . GLN B 2 87  ? 41.570 25.143 34.875 1.00 7.31  ? 261  GLN B CB  1 
ATOM   1855 C CG  . GLN B 2 87  ? 40.160 25.331 35.416 1.00 7.36  ? 261  GLN B CG  1 
ATOM   1856 C CD  . GLN B 2 87  ? 39.160 25.586 34.305 1.00 10.24 ? 261  GLN B CD  1 
ATOM   1857 O OE1 . GLN B 2 87  ? 39.405 26.410 33.424 1.00 12.12 ? 261  GLN B OE1 1 
ATOM   1858 N NE2 . GLN B 2 87  ? 38.028 24.888 34.342 1.00 10.69 ? 261  GLN B NE2 1 
ATOM   1859 N N   . ILE B 2 88  ? 41.763 24.107 37.991 1.00 8.26  ? 262  ILE B N   1 
ATOM   1860 C CA  . ILE B 2 88  ? 41.358 23.058 38.921 1.00 7.31  ? 262  ILE B CA  1 
ATOM   1861 C C   . ILE B 2 88  ? 39.905 23.326 39.310 1.00 6.68  ? 262  ILE B C   1 
ATOM   1862 O O   . ILE B 2 88  ? 39.582 24.398 39.830 1.00 8.84  ? 262  ILE B O   1 
ATOM   1863 C CB  . ILE B 2 88  ? 42.255 23.027 40.203 1.00 7.77  ? 262  ILE B CB  1 
ATOM   1864 C CG1 . ILE B 2 88  ? 41.791 21.907 41.140 1.00 7.01  ? 262  ILE B CG1 1 
ATOM   1865 C CG2 . ILE B 2 88  ? 42.199 24.356 40.943 1.00 8.06  ? 262  ILE B CG2 1 
ATOM   1866 C CD1 . ILE B 2 88  ? 41.918 20.510 40.547 1.00 6.35  ? 262  ILE B CD1 1 
ATOM   1867 N N   . PRO B 2 89  ? 39.000 22.377 39.012 1.00 6.89  ? 263  PRO B N   1 
ATOM   1868 C CA  . PRO B 2 89  ? 37.585 22.554 39.359 1.00 7.49  ? 263  PRO B CA  1 
ATOM   1869 C C   . PRO B 2 89  ? 37.434 22.604 40.881 1.00 8.00  ? 263  PRO B C   1 
ATOM   1870 O O   . PRO B 2 89  ? 38.337 22.202 41.621 1.00 8.82  ? 263  PRO B O   1 
ATOM   1871 C CB  . PRO B 2 89  ? 36.917 21.330 38.740 1.00 6.50  ? 263  PRO B CB  1 
ATOM   1872 C CG  . PRO B 2 89  ? 37.797 21.024 37.558 1.00 6.72  ? 263  PRO B CG  1 
ATOM   1873 C CD  . PRO B 2 89  ? 39.182 21.209 38.135 1.00 6.33  ? 263  PRO B CD  1 
ATOM   1874 N N   . CYS B 2 90  ? 36.285 23.076 41.345 1.00 7.00  ? 264  CYS B N   1 
ATOM   1875 C CA  . CYS B 2 90  ? 36.059 23.229 42.774 1.00 7.12  ? 264  CYS B CA  1 
ATOM   1876 C C   . CYS B 2 90  ? 34.722 22.649 43.229 1.00 7.13  ? 264  CYS B C   1 
ATOM   1877 O O   . CYS B 2 90  ? 33.661 23.198 42.924 1.00 7.41  ? 264  CYS B O   1 
ATOM   1878 C CB  . CYS B 2 90  ? 36.135 24.719 43.108 1.00 6.97  ? 264  CYS B CB  1 
ATOM   1879 S SG  . CYS B 2 90  ? 35.936 25.139 44.835 1.00 9.41  ? 264  CYS B SG  1 
ATOM   1880 N N   . ILE B 2 91  ? 34.788 21.545 43.970 1.00 6.72  ? 265  ILE B N   1 
ATOM   1881 C CA  . ILE B 2 91  ? 33.598 20.870 44.471 1.00 6.54  ? 265  ILE B CA  1 
ATOM   1882 C C   . ILE B 2 91  ? 33.179 21.499 45.792 1.00 7.10  ? 265  ILE B C   1 
ATOM   1883 O O   . ILE B 2 91  ? 33.962 21.529 46.740 1.00 8.42  ? 265  ILE B O   1 
ATOM   1884 C CB  . ILE B 2 91  ? 33.873 19.373 44.742 1.00 6.36  ? 265  ILE B CB  1 
ATOM   1885 C CG1 . ILE B 2 91  ? 34.503 18.718 43.511 1.00 7.56  ? 265  ILE B CG1 1 
ATOM   1886 C CG2 . ILE B 2 91  ? 32.570 18.669 45.119 1.00 5.90  ? 265  ILE B CG2 1 
ATOM   1887 C CD1 . ILE B 2 91  ? 35.072 17.328 43.781 1.00 8.72  ? 265  ILE B CD1 1 
ATOM   1888 N N   . VAL B 2 92  ? 31.951 21.997 45.860 1.00 6.75  ? 266  VAL B N   1 
ATOM   1889 C CA  . VAL B 2 92  ? 31.462 22.602 47.091 1.00 7.07  ? 266  VAL B CA  1 
ATOM   1890 C C   . VAL B 2 92  ? 30.237 21.817 47.535 1.00 6.00  ? 266  VAL B C   1 
ATOM   1891 O O   . VAL B 2 92  ? 29.151 21.960 46.972 1.00 6.14  ? 266  VAL B O   1 
ATOM   1892 C CB  . VAL B 2 92  ? 31.100 24.081 46.877 1.00 7.55  ? 266  VAL B CB  1 
ATOM   1893 C CG1 . VAL B 2 92  ? 30.609 24.690 48.181 1.00 7.36  ? 266  VAL B CG1 1 
ATOM   1894 C CG2 . VAL B 2 92  ? 32.324 24.838 46.365 1.00 5.81  ? 266  VAL B CG2 1 
ATOM   1895 N N   . SER B 2 93  ? 30.415 20.984 48.554 1.00 6.01  ? 267  SER B N   1 
ATOM   1896 C CA  . SER B 2 93  ? 29.321 20.151 49.016 1.00 6.17  ? 267  SER B CA  1 
ATOM   1897 C C   . SER B 2 93  ? 28.708 20.450 50.375 1.00 7.07  ? 267  SER B C   1 
ATOM   1898 O O   . SER B 2 93  ? 29.402 20.507 51.393 1.00 6.65  ? 267  SER B O   1 
ATOM   1899 C CB  . SER B 2 93  ? 29.751 18.680 49.004 1.00 7.29  ? 267  SER B CB  1 
ATOM   1900 O OG  . SER B 2 93  ? 28.706 17.852 49.491 1.00 6.29  ? 267  SER B OG  1 
ATOM   1901 N N   . MET B 2 94  ? 27.393 20.638 50.364 1.00 6.32  ? 268  MET B N   1 
ATOM   1902 C CA  . MET B 2 94  ? 26.612 20.842 51.574 1.00 8.58  ? 268  MET B CA  1 
ATOM   1903 C C   . MET B 2 94  ? 25.637 19.665 51.618 1.00 9.41  ? 268  MET B C   1 
ATOM   1904 O O   . MET B 2 94  ? 24.567 19.743 52.224 1.00 12.04 ? 268  MET B O   1 
ATOM   1905 C CB  . MET B 2 94  ? 25.840 22.165 51.541 1.00 10.56 ? 268  MET B CB  1 
ATOM   1906 C CG  . MET B 2 94  ? 26.694 23.379 51.849 1.00 16.83 ? 268  MET B CG  1 
ATOM   1907 S SD  . MET B 2 94  ? 27.648 23.896 50.424 1.00 23.27 ? 268  MET B SD  1 
ATOM   1908 C CE  . MET B 2 94  ? 27.154 25.599 50.297 1.00 21.48 ? 268  MET B CE  1 
ATOM   1909 N N   . LEU B 2 95  ? 26.015 18.575 50.953 1.00 8.21  ? 269  LEU B N   1 
ATOM   1910 C CA  . LEU B 2 95  ? 25.191 17.370 50.928 1.00 7.51  ? 269  LEU B CA  1 
ATOM   1911 C C   . LEU B 2 95  ? 25.295 16.671 52.277 1.00 8.35  ? 269  LEU B C   1 
ATOM   1912 O O   . LEU B 2 95  ? 26.288 16.824 52.988 1.00 6.68  ? 269  LEU B O   1 
ATOM   1913 C CB  . LEU B 2 95  ? 25.653 16.418 49.821 1.00 7.68  ? 269  LEU B CB  1 
ATOM   1914 C CG  . LEU B 2 95  ? 25.499 16.945 48.388 1.00 5.18  ? 269  LEU B CG  1 
ATOM   1915 C CD1 . LEU B 2 95  ? 25.909 15.861 47.389 1.00 6.76  ? 269  LEU B CD1 1 
ATOM   1916 C CD2 . LEU B 2 95  ? 24.049 17.357 48.156 1.00 6.40  ? 269  LEU B CD2 1 
ATOM   1917 N N   . THR B 2 96  ? 24.271 15.900 52.624 1.00 8.60  ? 270  THR B N   1 
ATOM   1918 C CA  . THR B 2 96  ? 24.255 15.196 53.902 1.00 8.04  ? 270  THR B CA  1 
ATOM   1919 C C   . THR B 2 96  ? 24.281 13.677 53.747 1.00 9.01  ? 270  THR B C   1 
ATOM   1920 O O   . THR B 2 96  ? 24.244 12.942 54.736 1.00 8.82  ? 270  THR B O   1 
ATOM   1921 C CB  . THR B 2 96  ? 23.018 15.590 54.727 1.00 8.10  ? 270  THR B CB  1 
ATOM   1922 O OG1 . THR B 2 96  ? 21.831 15.252 53.998 1.00 8.99  ? 270  THR B OG1 1 
ATOM   1923 C CG2 . THR B 2 96  ? 23.026 17.092 55.010 1.00 8.65  ? 270  THR B CG2 1 
ATOM   1924 N N   . LYS B 2 97  ? 24.336 13.210 52.505 1.00 7.99  ? 271  LYS B N   1 
ATOM   1925 C CA  . LYS B 2 97  ? 24.380 11.778 52.232 1.00 8.23  ? 271  LYS B CA  1 
ATOM   1926 C C   . LYS B 2 97  ? 25.175 11.509 50.970 1.00 8.16  ? 271  LYS B C   1 
ATOM   1927 O O   . LYS B 2 97  ? 25.473 12.425 50.202 1.00 9.89  ? 271  LYS B O   1 
ATOM   1928 C CB  . LYS B 2 97  ? 22.967 11.216 52.043 1.00 7.75  ? 271  LYS B CB  1 
ATOM   1929 C CG  . LYS B 2 97  ? 22.085 11.281 53.273 1.00 9.37  ? 271  LYS B CG  1 
ATOM   1930 C CD  . LYS B 2 97  ? 20.712 10.701 52.983 1.00 9.36  ? 271  LYS B CD  1 
ATOM   1931 C CE  . LYS B 2 97  ? 19.820 10.749 54.211 1.00 10.76 ? 271  LYS B CE  1 
ATOM   1932 N NZ  . LYS B 2 97  ? 18.458 10.232 53.897 1.00 14.18 ? 271  LYS B NZ  1 
ATOM   1933 N N   . GLU B 2 98  ? 25.526 10.245 50.765 1.00 9.16  ? 272  GLU B N   1 
ATOM   1934 C CA  . GLU B 2 98  ? 26.248 9.852  49.568 1.00 8.69  ? 272  GLU B CA  1 
ATOM   1935 C C   . GLU B 2 98  ? 25.224 9.865  48.444 1.00 9.76  ? 272  GLU B C   1 
ATOM   1936 O O   . GLU B 2 98  ? 24.031 9.675  48.685 1.00 8.97  ? 272  GLU B O   1 
ATOM   1937 C CB  . GLU B 2 98  ? 26.856 8.460  49.756 1.00 10.07 ? 272  GLU B CB  1 
ATOM   1938 C CG  . GLU B 2 98  ? 28.156 8.497  50.551 1.00 13.33 ? 272  GLU B CG  1 
ATOM   1939 C CD  . GLU B 2 98  ? 28.610 7.132  51.016 1.00 17.79 ? 272  GLU B CD  1 
ATOM   1940 O OE1 . GLU B 2 98  ? 28.450 6.154  50.253 1.00 18.48 ? 272  GLU B OE1 1 
ATOM   1941 O OE2 . GLU B 2 98  ? 29.139 7.041  52.145 1.00 18.81 ? 272  GLU B OE2 1 
ATOM   1942 N N   . LEU B 2 99  ? 25.684 10.108 47.222 1.00 9.04  ? 273  LEU B N   1 
ATOM   1943 C CA  . LEU B 2 99  ? 24.783 10.172 46.084 1.00 9.68  ? 273  LEU B CA  1 
ATOM   1944 C C   . LEU B 2 99  ? 25.231 9.255  44.959 1.00 8.19  ? 273  LEU B C   1 
ATOM   1945 O O   . LEU B 2 99  ? 26.337 9.388  44.437 1.00 7.77  ? 273  LEU B O   1 
ATOM   1946 C CB  . LEU B 2 99  ? 24.693 11.619 45.575 1.00 10.04 ? 273  LEU B CB  1 
ATOM   1947 C CG  . LEU B 2 99  ? 23.713 11.958 44.445 1.00 12.61 ? 273  LEU B CG  1 
ATOM   1948 C CD1 . LEU B 2 99  ? 22.319 11.460 44.789 1.00 16.23 ? 273  LEU B CD1 1 
ATOM   1949 C CD2 . LEU B 2 99  ? 23.700 13.471 44.228 1.00 12.82 ? 273  LEU B CD2 1 
ATOM   1950 N N   . TYR B 2 100 ? 24.363 8.312  44.609 1.00 8.04  ? 274  TYR B N   1 
ATOM   1951 C CA  . TYR B 2 100 ? 24.622 7.369  43.527 1.00 8.84  ? 274  TYR B CA  1 
ATOM   1952 C C   . TYR B 2 100 ? 23.494 7.568  42.528 1.00 9.48  ? 274  TYR B C   1 
ATOM   1953 O O   . TYR B 2 100 ? 22.329 7.638  42.915 1.00 10.57 ? 274  TYR B O   1 
ATOM   1954 C CB  . TYR B 2 100 ? 24.597 5.930  44.051 1.00 7.18  ? 274  TYR B CB  1 
ATOM   1955 C CG  . TYR B 2 100 ? 25.655 5.648  45.085 1.00 9.99  ? 274  TYR B CG  1 
ATOM   1956 C CD1 . TYR B 2 100 ? 26.944 5.269  44.709 1.00 10.21 ? 274  TYR B CD1 1 
ATOM   1957 C CD2 . TYR B 2 100 ? 25.380 5.804  46.443 1.00 9.87  ? 274  TYR B CD2 1 
ATOM   1958 C CE1 . TYR B 2 100 ? 27.937 5.056  45.664 1.00 11.42 ? 274  TYR B CE1 1 
ATOM   1959 C CE2 . TYR B 2 100 ? 26.361 5.598  47.402 1.00 11.45 ? 274  TYR B CE2 1 
ATOM   1960 C CZ  . TYR B 2 100 ? 27.634 5.228  47.009 1.00 10.74 ? 274  TYR B CZ  1 
ATOM   1961 O OH  . TYR B 2 100 ? 28.608 5.053  47.962 1.00 12.30 ? 274  TYR B OH  1 
ATOM   1962 N N   . PHE B 2 101 ? 23.832 7.666  41.248 1.00 10.29 ? 275  PHE B N   1 
ATOM   1963 C CA  . PHE B 2 101 ? 22.809 7.867  40.232 1.00 11.32 ? 275  PHE B CA  1 
ATOM   1964 C C   . PHE B 2 101 ? 22.046 6.585  39.940 1.00 12.14 ? 275  PHE B C   1 
ATOM   1965 O O   . PHE B 2 101 ? 20.972 6.614  39.339 1.00 14.49 ? 275  PHE B O   1 
ATOM   1966 C CB  . PHE B 2 101 ? 23.447 8.426  38.965 1.00 10.36 ? 275  PHE B CB  1 
ATOM   1967 C CG  . PHE B 2 101 ? 23.965 9.823  39.129 1.00 9.15  ? 275  PHE B CG  1 
ATOM   1968 C CD1 . PHE B 2 101 ? 23.084 10.883 39.302 1.00 9.38  ? 275  PHE B CD1 1 
ATOM   1969 C CD2 . PHE B 2 101 ? 25.335 10.075 39.157 1.00 10.16 ? 275  PHE B CD2 1 
ATOM   1970 C CE1 . PHE B 2 101 ? 23.553 12.178 39.504 1.00 8.51  ? 275  PHE B CE1 1 
ATOM   1971 C CE2 . PHE B 2 101 ? 25.817 11.366 39.359 1.00 9.90  ? 275  PHE B CE2 1 
ATOM   1972 C CZ  . PHE B 2 101 ? 24.926 12.420 39.534 1.00 8.85  ? 275  PHE B CZ  1 
ATOM   1973 N N   . TYR B 2 102 ? 22.599 5.464  40.390 1.00 13.10 ? 276  TYR B N   1 
ATOM   1974 C CA  . TYR B 2 102 ? 21.974 4.163  40.194 1.00 15.22 ? 276  TYR B CA  1 
ATOM   1975 C C   . TYR B 2 102 ? 21.453 3.653  41.534 1.00 17.32 ? 276  TYR B C   1 
ATOM   1976 O O   . TYR B 2 102 ? 21.780 4.203  42.586 1.00 17.16 ? 276  TYR B O   1 
ATOM   1977 C CB  . TYR B 2 102 ? 22.999 3.176  39.631 1.00 14.34 ? 276  TYR B CB  1 
ATOM   1978 C CG  . TYR B 2 102 ? 24.139 2.877  40.580 1.00 15.89 ? 276  TYR B CG  1 
ATOM   1979 C CD1 . TYR B 2 102 ? 24.022 1.880  41.554 1.00 15.80 ? 276  TYR B CD1 1 
ATOM   1980 C CD2 . TYR B 2 102 ? 25.325 3.610  40.528 1.00 15.06 ? 276  TYR B CD2 1 
ATOM   1981 C CE1 . TYR B 2 102 ? 25.055 1.624  42.451 1.00 18.23 ? 276  TYR B CE1 1 
ATOM   1982 C CE2 . TYR B 2 102 ? 26.366 3.361  41.423 1.00 17.79 ? 276  TYR B CE2 1 
ATOM   1983 C CZ  . TYR B 2 102 ? 26.222 2.366  42.381 1.00 17.83 ? 276  TYR B CZ  1 
ATOM   1984 O OH  . TYR B 2 102 ? 27.248 2.110  43.262 1.00 20.69 ? 276  TYR B OH  1 
ATOM   1985 N N   . HIS B 2 103 ? 20.638 2.604  41.493 1.00 18.84 ? 277  HIS B N   1 
ATOM   1986 C CA  . HIS B 2 103 ? 20.104 2.011  42.713 1.00 20.10 ? 277  HIS B CA  1 
ATOM   1987 C C   . HIS B 2 103 ? 19.964 0.501  42.550 1.00 21.90 ? 277  HIS B C   1 
ATOM   1988 O O   . HIS B 2 103 ? 20.326 -0.005 41.467 1.00 23.10 ? 277  HIS B O   1 
ATOM   1989 C CB  . HIS B 2 103 ? 18.745 2.622  43.077 1.00 20.21 ? 277  HIS B CB  1 
ATOM   1990 C CG  . HIS B 2 103 ? 17.656 2.327  42.092 1.00 21.18 ? 277  HIS B CG  1 
ATOM   1991 N ND1 . HIS B 2 103 ? 17.496 3.039  40.923 1.00 22.23 ? 277  HIS B ND1 1 
ATOM   1992 C CD2 . HIS B 2 103 ? 16.667 1.402  42.109 1.00 21.13 ? 277  HIS B CD2 1 
ATOM   1993 C CE1 . HIS B 2 103 ? 16.453 2.566  40.262 1.00 22.79 ? 277  HIS B CE1 1 
ATOM   1994 N NE2 . HIS B 2 103 ? 15.933 1.572  40.960 1.00 22.01 ? 277  HIS B NE2 1 
HETATM 1995 C C1  . PHQ C 3 1   ? 40.877 28.329 21.840 1.00 23.13 ? 901  PHQ I C1  1 
HETATM 1996 O O1  . PHQ C 3 1   ? 39.787 27.799 21.669 1.00 22.96 ? 901  PHQ I O1  1 
HETATM 1997 O O2  . PHQ C 3 1   ? 41.844 28.520 20.900 1.00 24.71 ? 901  PHQ I O2  1 
HETATM 1998 C C2  . PHQ C 3 1   ? 41.556 28.073 19.549 1.00 25.75 ? 901  PHQ I C2  1 
HETATM 1999 C C3  . PHQ C 3 1   ? 42.596 28.540 18.521 1.00 25.46 ? 901  PHQ I C3  1 
HETATM 2000 C C4  . PHQ C 3 1   ? 43.761 29.343 18.880 1.00 27.57 ? 901  PHQ I C4  1 
HETATM 2001 C C5  . PHQ C 3 1   ? 44.708 29.756 17.859 1.00 26.07 ? 901  PHQ I C5  1 
HETATM 2002 C C6  . PHQ C 3 1   ? 44.496 29.373 16.481 1.00 26.26 ? 901  PHQ I C6  1 
HETATM 2003 C C7  . PHQ C 3 1   ? 43.342 28.579 16.124 1.00 25.99 ? 901  PHQ I C7  1 
HETATM 2004 C C8  . PHQ C 3 1   ? 42.397 28.162 17.135 1.00 27.34 ? 901  PHQ I C8  1 
ATOM   2005 N N   . ASP C 3 2   ? 41.467 28.909 22.873 1.00 20.76 ? 902  ASP I N   1 
ATOM   2006 C CA  . ASP C 3 2   ? 40.826 29.012 24.177 1.00 20.14 ? 902  ASP I CA  1 
ATOM   2007 C C   . ASP C 3 2   ? 40.275 30.401 24.474 1.00 19.93 ? 902  ASP I C   1 
ATOM   2008 O O   . ASP C 3 2   ? 40.864 31.411 24.096 1.00 21.13 ? 902  ASP I O   1 
ATOM   2009 C CB  . ASP C 3 2   ? 41.806 28.610 25.276 1.00 20.06 ? 902  ASP I CB  1 
ATOM   2010 C CG  . ASP C 3 2   ? 42.174 27.148 25.206 1.00 19.57 ? 902  ASP I CG  1 
ATOM   2011 O OD1 . ASP C 3 2   ? 41.253 26.322 25.063 1.00 19.14 ? 902  ASP I OD1 1 
ATOM   2012 O OD2 . ASP C 3 2   ? 43.374 26.818 25.296 1.00 19.07 ? 902  ASP I OD2 1 
ATOM   2013 N N   . GLU C 3 3   ? 39.119 30.442 25.127 1.00 17.94 ? 903  GLU I N   1 
ATOM   2014 C CA  . GLU C 3 3   ? 38.502 31.702 25.515 1.00 18.29 ? 903  GLU I CA  1 
ATOM   2015 C C   . GLU C 3 3   ? 38.211 31.552 27.003 1.00 16.42 ? 903  GLU I C   1 
ATOM   2016 O O   . GLU C 3 3   ? 38.195 30.437 27.520 1.00 14.17 ? 903  GLU I O   1 
ATOM   2017 C CB  . GLU C 3 3   ? 37.204 31.949 24.737 1.00 19.10 ? 903  GLU I CB  1 
ATOM   2018 C CG  . GLU C 3 3   ? 37.368 31.900 23.221 1.00 22.55 ? 903  GLU I CG  1 
ATOM   2019 C CD  . GLU C 3 3   ? 36.138 32.386 22.476 1.00 24.43 ? 903  GLU I CD  1 
ATOM   2020 O OE1 . GLU C 3 3   ? 35.014 31.983 22.839 1.00 24.58 ? 903  GLU I OE1 1 
ATOM   2021 O OE2 . GLU C 3 3   ? 36.294 33.168 21.515 1.00 26.89 ? 903  GLU I OE2 1 
ATOM   2022 N N   . VAL C 3 4   ? 37.999 32.659 27.701 1.00 17.40 ? 904  VAL I N   1 
ATOM   2023 C CA  . VAL C 3 4   ? 37.728 32.569 29.128 1.00 17.72 ? 904  VAL I CA  1 
ATOM   2024 C C   . VAL C 3 4   ? 36.264 32.786 29.444 1.00 17.89 ? 904  VAL I C   1 
ATOM   2025 O O   . VAL C 3 4   ? 35.571 33.530 28.749 1.00 17.83 ? 904  VAL I O   1 
ATOM   2026 C CB  . VAL C 3 4   ? 38.565 33.589 29.941 1.00 17.49 ? 904  VAL I CB  1 
ATOM   2027 C CG1 . VAL C 3 4   ? 40.038 33.213 29.884 1.00 17.98 ? 904  VAL I CG1 1 
ATOM   2028 C CG2 . VAL C 3 4   ? 38.349 34.996 29.399 1.00 17.48 ? 904  VAL I CG2 1 
HETATM 2029 C C2  . MY2 C 3 5   ? 35.077 34.526 32.192 1.00 20.06 ? 905  MY2 I C2  1 
HETATM 2030 C C3  . MY2 C 3 5   ? 34.495 35.951 32.072 1.00 23.21 ? 905  MY2 I C3  1 
HETATM 2031 C C4  . MY2 C 3 5   ? 35.606 36.929 32.286 1.00 25.87 ? 905  MY2 I C4  1 
HETATM 2032 O O5  . MY2 C 3 5   ? 36.428 37.144 31.387 1.00 25.40 ? 905  MY2 I O5  1 
HETATM 2033 O O6  . MY2 C 3 5   ? 35.631 37.539 33.518 1.00 28.67 ? 905  MY2 I O6  1 
HETATM 2034 C C7  . MY2 C 3 5   ? 34.105 33.357 32.011 1.00 17.54 ? 905  MY2 I C7  1 
HETATM 2035 O O8  . MY2 C 3 5   ? 33.037 33.414 32.626 1.00 17.99 ? 905  MY2 I O8  1 
HETATM 2036 N N9  . MY2 C 3 5   ? 34.441 32.294 31.209 1.00 17.95 ? 905  MY2 I N9  1 
HETATM 2037 C C10 . MY2 C 3 5   ? 33.477 31.164 31.087 1.00 15.93 ? 905  MY2 I C10 1 
HETATM 2038 C C12 . MY2 C 3 5   ? 36.486 40.574 35.477 1.00 33.78 ? 905  MY2 I C12 1 
HETATM 2039 C C13 . MY2 C 3 5   ? 36.258 41.147 36.800 1.00 34.83 ? 905  MY2 I C13 1 
HETATM 2040 C C14 . MY2 C 3 5   ? 35.949 40.277 37.941 1.00 35.32 ? 905  MY2 I C14 1 
HETATM 2041 C C15 . MY2 C 3 5   ? 35.867 38.822 37.749 1.00 33.30 ? 905  MY2 I C15 1 
HETATM 2042 C C16 . MY2 C 3 5   ? 36.098 38.246 36.418 1.00 33.70 ? 905  MY2 I C16 1 
HETATM 2043 C C17 . MY2 C 3 5   ? 36.408 39.120 35.278 1.00 33.08 ? 905  MY2 I C17 1 
HETATM 2044 C C18 . MY2 C 3 5   ? 33.026 30.787 29.736 1.00 13.35 ? 905  MY2 I C18 1 
HETATM 2045 C C9  . MY2 C 3 5   ? 36.659 38.527 33.888 1.00 31.32 ? 905  MY2 I C9  1 
HETATM 2046 O O19 . MY2 C 3 5   ? 32.807 31.692 28.900 1.00 14.21 ? 905  MY2 I O19 1 
HETATM 2047 N N16 . MY2 C 3 5   ? 35.711 32.263 30.510 1.00 17.65 ? 905  MY2 I N16 1 
HETATM 2048 O O20 . MY2 C 3 5   ? 32.878 29.556 29.516 1.00 12.31 ? 905  MY2 I O20 1 
HETATM 2049 O O57 . MY2 C 3 5   ? 33.957 36.153 30.757 1.00 24.43 ? 905  MY2 I O57 1 
HETATM 2050 O O   . HOH D 4 .   ? 12.986 -2.751 61.954 1.00 57.89 ? 2001 HOH A O   1 
HETATM 2051 O O   . HOH D 4 .   ? 16.125 -3.098 62.599 1.00 37.52 ? 2002 HOH A O   1 
HETATM 2052 O O   . HOH D 4 .   ? 12.425 -6.895 61.747 1.00 38.61 ? 2003 HOH A O   1 
HETATM 2053 O O   . HOH D 4 .   ? 14.814 -1.830 59.882 1.00 38.71 ? 2004 HOH A O   1 
HETATM 2054 O O   . HOH D 4 .   ? 17.848 -0.349 61.745 1.00 49.89 ? 2005 HOH A O   1 
HETATM 2055 O O   . HOH D 4 .   ? 20.810 1.574  62.204 1.00 43.11 ? 2006 HOH A O   1 
HETATM 2056 O O   . HOH D 4 .   ? 24.077 5.592  59.239 1.00 37.66 ? 2007 HOH A O   1 
HETATM 2057 O O   . HOH D 4 .   ? 19.174 2.619  54.530 1.00 38.68 ? 2008 HOH A O   1 
HETATM 2058 O O   . HOH D 4 .   ? 18.259 4.763  52.791 1.00 51.76 ? 2009 HOH A O   1 
HETATM 2059 O O   . HOH D 4 .   ? 26.697 9.350  54.217 1.00 15.02 ? 2010 HOH A O   1 
HETATM 2060 O O   . HOH D 4 .   ? 21.014 4.381  52.492 1.00 43.30 ? 2011 HOH A O   1 
HETATM 2061 O O   . HOH D 4 .   ? 25.713 2.099  54.315 1.00 36.26 ? 2012 HOH A O   1 
HETATM 2062 O O   . HOH D 4 .   ? 27.091 3.644  58.679 1.00 26.41 ? 2013 HOH A O   1 
HETATM 2063 O O   . HOH D 4 .   ? 19.554 4.929  48.810 1.00 27.26 ? 2014 HOH A O   1 
HETATM 2064 O O   . HOH D 4 .   ? 22.174 7.454  46.392 1.00 10.91 ? 2015 HOH A O   1 
HETATM 2065 O O   . HOH D 4 .   ? 11.958 4.278  50.359 1.00 47.20 ? 2016 HOH A O   1 
HETATM 2066 O O   . HOH D 4 .   ? 17.142 10.136 51.073 1.00 10.08 ? 2017 HOH A O   1 
HETATM 2067 O O   . HOH D 4 .   ? 16.601 11.831 47.112 1.00 9.12  ? 2018 HOH A O   1 
HETATM 2068 O O   . HOH D 4 .   ? 10.199 -7.105 63.059 1.00 49.33 ? 2019 HOH A O   1 
HETATM 2069 O O   . HOH D 4 .   ? 18.466 4.839  46.038 1.00 15.76 ? 2020 HOH A O   1 
HETATM 2070 O O   . HOH D 4 .   ? 12.096 2.282  47.697 1.00 52.17 ? 2021 HOH A O   1 
HETATM 2071 O O   . HOH D 4 .   ? 15.366 2.675  48.758 1.00 43.22 ? 2022 HOH A O   1 
HETATM 2072 O O   . HOH D 4 .   ? 17.402 2.604  46.961 1.00 35.59 ? 2023 HOH A O   1 
HETATM 2073 O O   . HOH D 4 .   ? 16.659 4.691  50.179 1.00 50.30 ? 2024 HOH A O   1 
HETATM 2074 O O   . HOH D 4 .   ? 14.771 7.865  40.358 1.00 12.16 ? 2025 HOH A O   1 
HETATM 2075 O O   . HOH D 4 .   ? 13.616 11.746 50.184 1.00 22.91 ? 2026 HOH A O   1 
HETATM 2076 O O   . HOH D 4 .   ? 9.770  9.308  50.334 1.00 50.96 ? 2027 HOH A O   1 
HETATM 2077 O O   . HOH D 4 .   ? 9.382  12.580 49.857 1.00 36.51 ? 2028 HOH A O   1 
HETATM 2078 O O   . HOH D 4 .   ? 9.147  -4.587 61.834 1.00 43.32 ? 2029 HOH A O   1 
HETATM 2079 O O   . HOH D 4 .   ? 7.623  8.295  35.957 1.00 39.14 ? 2030 HOH A O   1 
HETATM 2080 O O   . HOH D 4 .   ? 6.053  10.079 37.410 1.00 37.98 ? 2031 HOH A O   1 
HETATM 2081 O O   . HOH D 4 .   ? 11.490 14.262 35.821 1.00 19.10 ? 2032 HOH A O   1 
HETATM 2082 O O   . HOH D 4 .   ? 6.725  14.551 38.475 1.00 35.51 ? 2033 HOH A O   1 
HETATM 2083 O O   . HOH D 4 .   ? 7.431  10.694 49.168 1.00 40.36 ? 2034 HOH A O   1 
HETATM 2084 O O   . HOH D 4 .   ? 4.722  15.579 37.130 1.00 49.33 ? 2035 HOH A O   1 
HETATM 2085 O O   . HOH D 4 .   ? 11.446 10.370 34.385 1.00 24.99 ? 2036 HOH A O   1 
HETATM 2086 O O   . HOH D 4 .   ? 13.250 12.221 35.491 1.00 14.04 ? 2037 HOH A O   1 
HETATM 2087 O O   . HOH D 4 .   ? 26.870 20.037 18.776 1.00 50.57 ? 2038 HOH A O   1 
HETATM 2088 O O   . HOH D 4 .   ? 20.286 43.656 21.740 1.00 56.32 ? 2039 HOH A O   1 
HETATM 2089 O O   . HOH D 4 .   ? 22.396 47.651 21.059 1.00 47.03 ? 2040 HOH A O   1 
HETATM 2090 O O   . HOH D 4 .   ? 22.532 29.598 23.227 1.00 38.35 ? 2041 HOH A O   1 
HETATM 2091 O O   . HOH D 4 .   ? 2.589  28.296 41.392 1.00 52.51 ? 2042 HOH A O   1 
HETATM 2092 O O   . HOH D 4 .   ? 22.586 30.304 17.924 1.00 48.70 ? 2043 HOH A O   1 
HETATM 2093 O O   . HOH D 4 .   ? 27.126 30.261 17.124 1.00 55.13 ? 2044 HOH A O   1 
HETATM 2094 O O   . HOH D 4 .   ? 27.417 22.701 17.962 1.00 48.07 ? 2045 HOH A O   1 
HETATM 2095 O O   . HOH D 4 .   ? 8.643  6.653  45.907 1.00 39.24 ? 2046 HOH A O   1 
HETATM 2096 O O   . HOH D 4 .   ? 27.426 32.811 18.110 1.00 37.01 ? 2047 HOH A O   1 
HETATM 2097 O O   . HOH D 4 .   ? 21.325 37.404 23.199 1.00 19.63 ? 2048 HOH A O   1 
HETATM 2098 O O   . HOH D 4 .   ? 24.749 15.367 20.398 1.00 44.92 ? 2049 HOH A O   1 
HETATM 2099 O O   . HOH D 4 .   ? 27.732 37.795 22.340 1.00 16.96 ? 2050 HOH A O   1 
HETATM 2100 O O   . HOH D 4 .   ? 22.043 38.933 21.015 1.00 37.89 ? 2051 HOH A O   1 
HETATM 2101 O O   . HOH D 4 .   ? 24.787 38.791 20.352 1.00 48.40 ? 2052 HOH A O   1 
HETATM 2102 O O   . HOH D 4 .   ? 18.145 39.420 21.692 1.00 44.93 ? 2053 HOH A O   1 
HETATM 2103 O O   . HOH D 4 .   ? 16.287 39.426 24.697 1.00 35.21 ? 2054 HOH A O   1 
HETATM 2104 O O   . HOH D 4 .   ? 26.476 6.992  21.787 1.00 52.07 ? 2055 HOH A O   1 
HETATM 2105 O O   . HOH D 4 .   ? 10.747 35.630 44.613 1.00 43.25 ? 2056 HOH A O   1 
HETATM 2106 O O   . HOH D 4 .   ? 32.046 13.733 23.319 1.00 51.06 ? 2057 HOH A O   1 
HETATM 2107 O O   . HOH D 4 .   ? 28.122 48.076 23.651 1.00 50.73 ? 2058 HOH A O   1 
HETATM 2108 O O   . HOH D 4 .   ? 22.433 42.588 20.790 1.00 24.73 ? 2059 HOH A O   1 
HETATM 2109 O O   . HOH D 4 .   ? 15.551 1.607  25.688 1.00 42.20 ? 2060 HOH A O   1 
HETATM 2110 O O   . HOH D 4 .   ? 22.011 45.442 22.480 1.00 20.53 ? 2061 HOH A O   1 
HETATM 2111 O O   . HOH D 4 .   ? 25.179 49.766 26.157 1.00 29.88 ? 2062 HOH A O   1 
HETATM 2112 O O   . HOH D 4 .   ? 28.519 44.383 30.713 1.00 50.27 ? 2063 HOH A O   1 
HETATM 2113 O O   . HOH D 4 .   ? 31.811 43.062 29.683 1.00 39.75 ? 2064 HOH A O   1 
HETATM 2114 O O   . HOH D 4 .   ? 27.870 42.071 23.239 1.00 31.84 ? 2065 HOH A O   1 
HETATM 2115 O O   . HOH D 4 .   ? 11.077 38.701 30.149 1.00 50.59 ? 2066 HOH A O   1 
HETATM 2116 O O   . HOH D 4 .   ? 33.117 38.938 27.161 1.00 25.59 ? 2067 HOH A O   1 
HETATM 2117 O O   . HOH D 4 .   ? 35.337 36.166 26.821 1.00 44.59 ? 2068 HOH A O   1 
HETATM 2118 O O   . HOH D 4 .   ? 13.658 39.481 37.805 1.00 38.43 ? 2069 HOH A O   1 
HETATM 2119 O O   . HOH D 4 .   ? 12.563 42.299 37.047 1.00 38.39 ? 2070 HOH A O   1 
HETATM 2120 O O   . HOH D 4 .   ? 9.955  37.930 34.147 1.00 45.54 ? 2071 HOH A O   1 
HETATM 2121 O O   . HOH D 4 .   ? 12.112 31.969 28.402 1.00 47.69 ? 2072 HOH A O   1 
HETATM 2122 O O   . HOH D 4 .   ? 31.965 32.653 18.860 1.00 49.45 ? 2073 HOH A O   1 
HETATM 2123 O O   . HOH D 4 .   ? 33.791 34.074 20.677 1.00 43.83 ? 2074 HOH A O   1 
HETATM 2124 O O   . HOH D 4 .   ? 31.251 38.031 20.231 1.00 26.84 ? 2075 HOH A O   1 
HETATM 2125 O O   . HOH D 4 .   ? 28.352 36.926 18.164 1.00 55.10 ? 2076 HOH A O   1 
HETATM 2126 O O   . HOH D 4 .   ? 33.729 36.350 19.174 1.00 46.08 ? 2077 HOH A O   1 
HETATM 2127 O O   . HOH D 4 .   ? 29.233 34.707 16.860 1.00 52.93 ? 2078 HOH A O   1 
HETATM 2128 O O   . HOH D 4 .   ? 5.527  26.160 35.543 1.00 27.76 ? 2079 HOH A O   1 
HETATM 2129 O O   . HOH D 4 .   ? 4.271  28.755 39.200 1.00 35.31 ? 2080 HOH A O   1 
HETATM 2130 O O   . HOH D 4 .   ? 5.164  32.701 40.853 1.00 48.33 ? 2081 HOH A O   1 
HETATM 2131 O O   . HOH D 4 .   ? 3.542  24.236 38.611 1.00 35.89 ? 2082 HOH A O   1 
HETATM 2132 O O   . HOH D 4 .   ? 29.587 31.615 19.271 1.00 29.99 ? 2083 HOH A O   1 
HETATM 2133 O O   . HOH D 4 .   ? 29.568 28.796 18.716 1.00 39.23 ? 2084 HOH A O   1 
HETATM 2134 O O   . HOH D 4 .   ? 2.781  13.026 44.101 1.00 53.30 ? 2085 HOH A O   1 
HETATM 2135 O O   . HOH D 4 .   ? 1.585  20.205 40.212 1.00 50.94 ? 2086 HOH A O   1 
HETATM 2136 O O   . HOH D 4 .   ? 4.139  18.074 36.024 1.00 53.23 ? 2087 HOH A O   1 
HETATM 2137 O O   . HOH D 4 .   ? 3.701  14.485 41.744 1.00 39.39 ? 2088 HOH A O   1 
HETATM 2138 O O   . HOH D 4 .   ? 6.992  8.807  44.973 1.00 32.10 ? 2089 HOH A O   1 
HETATM 2139 O O   . HOH D 4 .   ? 4.026  11.885 46.077 1.00 48.59 ? 2090 HOH A O   1 
HETATM 2140 O O   . HOH D 4 .   ? 22.759 27.960 21.075 1.00 21.42 ? 2091 HOH A O   1 
HETATM 2141 O O   . HOH D 4 .   ? 28.853 26.632 20.213 1.00 19.64 ? 2092 HOH A O   1 
HETATM 2142 O O   . HOH D 4 .   ? 26.065 25.133 17.240 1.00 31.01 ? 2093 HOH A O   1 
HETATM 2143 O O   . HOH D 4 .   ? 28.506 17.555 22.230 1.00 17.76 ? 2094 HOH A O   1 
HETATM 2144 O O   . HOH D 4 .   ? 31.767 19.361 25.934 1.00 13.02 ? 2095 HOH A O   1 
HETATM 2145 O O   . HOH D 4 .   ? 29.729 26.185 28.060 1.00 9.37  ? 2096 HOH A O   1 
HETATM 2146 O O   . HOH D 4 .   ? 22.793 15.915 22.709 1.00 20.99 ? 2097 HOH A O   1 
HETATM 2147 O O   . HOH D 4 .   ? 28.437 37.212 45.982 1.00 49.94 ? 2098 HOH A O   1 
HETATM 2148 O O   . HOH D 4 .   ? 36.194 31.304 48.805 1.00 35.80 ? 2099 HOH A O   1 
HETATM 2149 O O   . HOH D 4 .   ? 34.689 34.996 47.847 1.00 42.30 ? 2100 HOH A O   1 
HETATM 2150 O O   . HOH D 4 .   ? 39.313 33.848 46.496 1.00 37.82 ? 2101 HOH A O   1 
HETATM 2151 O O   . HOH D 4 .   ? 30.177 35.188 46.509 1.00 23.69 ? 2102 HOH A O   1 
HETATM 2152 O O   . HOH D 4 .   ? 25.693 36.825 46.463 1.00 38.70 ? 2103 HOH A O   1 
HETATM 2153 O O   . HOH D 4 .   ? 26.902 15.187 22.473 1.00 36.50 ? 2104 HOH A O   1 
HETATM 2154 O O   . HOH D 4 .   ? 32.719 17.307 24.880 1.00 42.14 ? 2105 HOH A O   1 
HETATM 2155 O O   . HOH D 4 .   ? 27.577 13.169 24.529 1.00 26.95 ? 2106 HOH A O   1 
HETATM 2156 O O   . HOH D 4 .   ? 16.203 18.782 26.330 1.00 22.93 ? 2107 HOH A O   1 
HETATM 2157 O O   . HOH D 4 .   ? 26.591 39.312 46.506 1.00 50.01 ? 2108 HOH A O   1 
HETATM 2158 O O   . HOH D 4 .   ? 19.269 37.685 46.188 1.00 51.41 ? 2109 HOH A O   1 
HETATM 2159 O O   . HOH D 4 .   ? 25.837 8.389  24.203 1.00 29.09 ? 2110 HOH A O   1 
HETATM 2160 O O   . HOH D 4 .   ? 21.246 13.875 23.257 1.00 20.36 ? 2111 HOH A O   1 
HETATM 2161 O O   . HOH D 4 .   ? 12.693 42.133 40.898 1.00 53.60 ? 2112 HOH A O   1 
HETATM 2162 O O   . HOH D 4 .   ? 13.567 36.111 44.378 1.00 33.92 ? 2113 HOH A O   1 
HETATM 2163 O O   . HOH D 4 .   ? 25.654 9.375  30.911 1.00 15.33 ? 2114 HOH A O   1 
HETATM 2164 O O   . HOH D 4 .   ? 18.040 35.547 52.240 1.00 59.35 ? 2115 HOH A O   1 
HETATM 2165 O O   . HOH D 4 .   ? 10.890 31.447 46.620 1.00 36.81 ? 2116 HOH A O   1 
HETATM 2166 O O   . HOH D 4 .   ? 19.968 5.589  25.179 1.00 18.06 ? 2117 HOH A O   1 
HETATM 2167 O O   . HOH D 4 .   ? 8.617  29.110 55.283 1.00 57.02 ? 2118 HOH A O   1 
HETATM 2168 O O   . HOH D 4 .   ? 9.317  15.716 52.492 1.00 51.37 ? 2119 HOH A O   1 
HETATM 2169 O O   . HOH D 4 .   ? 4.981  23.831 48.464 1.00 45.18 ? 2120 HOH A O   1 
HETATM 2170 O O   . HOH D 4 .   ? 5.019  20.744 47.939 1.00 33.08 ? 2121 HOH A O   1 
HETATM 2171 O O   . HOH D 4 .   ? 21.378 4.518  30.286 1.00 25.99 ? 2122 HOH A O   1 
HETATM 2172 O O   . HOH D 4 .   ? 26.518 6.355  27.637 1.00 44.85 ? 2123 HOH A O   1 
HETATM 2173 O O   . HOH D 4 .   ? 22.924 5.721  24.452 1.00 36.52 ? 2124 HOH A O   1 
HETATM 2174 O O   . HOH D 4 .   ? 26.095 9.029  28.228 1.00 30.66 ? 2125 HOH A O   1 
HETATM 2175 O O   . HOH D 4 .   ? 15.254 13.222 54.291 1.00 35.52 ? 2126 HOH A O   1 
HETATM 2176 O O   . HOH D 4 .   ? 26.568 32.093 45.428 1.00 22.53 ? 2127 HOH A O   1 
HETATM 2177 O O   . HOH D 4 .   ? 15.071 3.951  30.096 1.00 33.51 ? 2128 HOH A O   1 
HETATM 2178 O O   . HOH D 4 .   ? 19.061 2.210  30.452 1.00 36.18 ? 2129 HOH A O   1 
HETATM 2179 O O   . HOH D 4 .   ? 18.546 6.740  28.385 1.00 17.47 ? 2130 HOH A O   1 
HETATM 2180 O O   . HOH D 4 .   ? 17.827 3.611  27.639 1.00 39.31 ? 2131 HOH A O   1 
HETATM 2181 O O   . HOH D 4 .   ? 13.846 8.957  35.601 1.00 11.97 ? 2132 HOH A O   1 
HETATM 2182 O O   . HOH D 4 .   ? 7.196  17.278 32.877 1.00 42.69 ? 2133 HOH A O   1 
HETATM 2183 O O   . HOH D 4 .   ? 8.144  18.250 30.749 1.00 52.04 ? 2134 HOH A O   1 
HETATM 2184 O O   . HOH D 4 .   ? 7.981  15.613 35.055 1.00 24.84 ? 2135 HOH A O   1 
HETATM 2185 O O   . HOH D 4 .   ? 37.676 40.960 41.442 1.00 51.08 ? 2136 HOH A O   1 
HETATM 2186 O O   . HOH D 4 .   ? 51.978 33.204 39.191 1.00 57.31 ? 2137 HOH A O   1 
HETATM 2187 O O   . HOH D 4 .   ? 57.875 23.950 29.550 1.00 55.23 ? 2138 HOH A O   1 
HETATM 2188 O O   . HOH D 4 .   ? 20.961 21.114 26.085 1.00 14.12 ? 2139 HOH A O   1 
HETATM 2189 O O   . HOH D 4 .   ? 58.250 18.069 33.176 1.00 61.34 ? 2140 HOH A O   1 
HETATM 2190 O O   . HOH D 4 .   ? 12.521 27.916 24.710 1.00 52.83 ? 2141 HOH A O   1 
HETATM 2191 O O   . HOH D 4 .   ? 16.397 33.873 23.982 1.00 45.67 ? 2142 HOH A O   1 
HETATM 2192 O O   . HOH D 4 .   ? 21.466 30.321 20.644 1.00 32.43 ? 2143 HOH A O   1 
HETATM 2193 O O   . HOH D 4 .   ? 19.838 34.495 20.605 1.00 30.70 ? 2144 HOH A O   1 
HETATM 2194 O O   . HOH D 4 .   ? 13.579 39.366 29.259 1.00 18.08 ? 2145 HOH A O   1 
HETATM 2195 O O   . HOH D 4 .   ? 20.716 45.707 38.813 1.00 44.28 ? 2146 HOH A O   1 
HETATM 2196 O O   . HOH D 4 .   ? 18.165 42.009 39.985 1.00 58.25 ? 2147 HOH A O   1 
HETATM 2197 O O   . HOH D 4 .   ? 21.612 45.937 35.667 1.00 39.99 ? 2148 HOH A O   1 
HETATM 2198 O O   . HOH D 4 .   ? 17.081 39.397 37.055 1.00 53.59 ? 2149 HOH A O   1 
HETATM 2199 O O   . HOH D 4 .   ? 22.119 41.300 39.966 1.00 35.29 ? 2150 HOH A O   1 
HETATM 2200 O O   . HOH D 4 .   ? 14.492 43.586 35.653 1.00 49.74 ? 2151 HOH A O   1 
HETATM 2201 O O   . HOH D 4 .   ? 14.469 41.812 29.543 1.00 40.15 ? 2152 HOH A O   1 
HETATM 2202 O O   . HOH D 4 .   ? 18.048 44.958 34.110 1.00 41.06 ? 2153 HOH A O   1 
HETATM 2203 O O   . HOH D 4 .   ? 12.068 37.836 36.241 1.00 27.03 ? 2154 HOH A O   1 
HETATM 2204 O O   . HOH D 4 .   ? 13.486 39.074 26.460 1.00 36.03 ? 2155 HOH A O   1 
HETATM 2205 O O   . HOH D 4 .   ? 15.948 36.230 25.454 1.00 25.37 ? 2156 HOH A O   1 
HETATM 2206 O O   . HOH D 4 .   ? 10.654 34.421 27.834 1.00 37.34 ? 2157 HOH A O   1 
HETATM 2207 O O   . HOH D 4 .   ? 11.852 32.264 31.513 1.00 24.00 ? 2158 HOH A O   1 
HETATM 2208 O O   . HOH D 4 .   ? 11.232 36.810 32.149 1.00 45.82 ? 2159 HOH A O   1 
HETATM 2209 O O   . HOH D 4 .   ? 7.434  36.937 31.245 1.00 45.88 ? 2160 HOH A O   1 
HETATM 2210 O O   . HOH D 4 .   ? 10.463 36.179 37.789 1.00 36.41 ? 2161 HOH A O   1 
HETATM 2211 O O   . HOH D 4 .   ? 5.322  28.282 33.913 1.00 45.84 ? 2162 HOH A O   1 
HETATM 2212 O O   . HOH D 4 .   ? 6.229  30.591 39.270 1.00 40.93 ? 2163 HOH A O   1 
HETATM 2213 O O   . HOH D 4 .   ? 9.409  29.182 32.820 1.00 25.32 ? 2164 HOH A O   1 
HETATM 2214 O O   . HOH D 4 .   ? 5.635  26.317 38.153 1.00 17.65 ? 2165 HOH A O   1 
HETATM 2215 O O   . HOH D 4 .   ? 7.459  33.396 37.377 1.00 42.61 ? 2166 HOH A O   1 
HETATM 2216 O O   . HOH D 4 .   ? 6.393  32.045 33.571 1.00 29.21 ? 2167 HOH A O   1 
HETATM 2217 O O   . HOH D 4 .   ? 3.756  25.765 43.897 1.00 39.40 ? 2168 HOH A O   1 
HETATM 2218 O O   . HOH D 4 .   ? 4.123  22.437 44.110 1.00 41.98 ? 2169 HOH A O   1 
HETATM 2219 O O   . HOH D 4 .   ? 8.028  25.378 35.357 1.00 22.76 ? 2170 HOH A O   1 
HETATM 2220 O O   . HOH D 4 .   ? 6.995  23.588 44.558 1.00 23.46 ? 2171 HOH A O   1 
HETATM 2221 O O   . HOH D 4 .   ? 6.573  15.100 41.059 1.00 18.32 ? 2172 HOH A O   1 
HETATM 2222 O O   . HOH D 4 .   ? 4.915  17.771 38.677 1.00 42.04 ? 2173 HOH A O   1 
HETATM 2223 O O   . HOH D 4 .   ? 0.846  18.646 42.270 1.00 46.45 ? 2174 HOH A O   1 
HETATM 2224 O O   . HOH D 4 .   ? 2.066  15.386 45.307 1.00 49.67 ? 2175 HOH A O   1 
HETATM 2225 O O   . HOH D 4 .   ? 4.198  20.473 39.000 1.00 21.18 ? 2176 HOH A O   1 
HETATM 2226 O O   . HOH D 4 .   ? 6.819  11.011 46.481 1.00 20.98 ? 2177 HOH A O   1 
HETATM 2227 O O   . HOH D 4 .   ? 6.872  16.183 48.593 1.00 24.92 ? 2178 HOH A O   1 
HETATM 2228 O O   . HOH D 4 .   ? 6.294  18.885 34.820 1.00 29.41 ? 2179 HOH A O   1 
HETATM 2229 O O   . HOH D 4 .   ? 13.702 17.842 39.941 1.00 11.44 ? 2180 HOH A O   1 
HETATM 2230 O O   . HOH D 4 .   ? 31.995 41.241 40.821 1.00 54.87 ? 2181 HOH A O   1 
HETATM 2231 O O   . HOH D 4 .   ? 29.168 38.604 43.817 1.00 49.35 ? 2182 HOH A O   1 
HETATM 2232 O O   . HOH D 4 .   ? 30.721 32.714 45.413 1.00 26.96 ? 2183 HOH A O   1 
HETATM 2233 O O   . HOH D 4 .   ? 34.886 37.972 40.780 1.00 13.72 ? 2184 HOH A O   1 
HETATM 2234 O O   . HOH D 4 .   ? 32.308 39.119 42.415 1.00 37.52 ? 2185 HOH A O   1 
HETATM 2235 O O   . HOH D 4 .   ? 36.794 34.780 44.848 1.00 30.10 ? 2186 HOH A O   1 
HETATM 2236 O O   . HOH D 4 .   ? 34.257 32.418 47.172 1.00 42.45 ? 2187 HOH A O   1 
HETATM 2237 O O   . HOH D 4 .   ? 25.743 34.940 44.730 1.00 14.63 ? 2188 HOH A O   1 
HETATM 2238 O O   . HOH D 4 .   ? 30.926 31.954 41.494 1.00 17.54 ? 2189 HOH A O   1 
HETATM 2239 O O   . HOH D 4 .   ? 18.570 37.383 24.915 1.00 20.35 ? 2190 HOH A O   1 
HETATM 2240 O O   . HOH D 4 .   ? 20.524 39.042 40.956 1.00 25.05 ? 2191 HOH A O   1 
HETATM 2241 O O   . HOH D 4 .   ? 26.662 39.578 43.876 1.00 50.39 ? 2192 HOH A O   1 
HETATM 2242 O O   . HOH D 4 .   ? 24.538 40.303 40.105 1.00 27.46 ? 2193 HOH A O   1 
HETATM 2243 O O   . HOH D 4 .   ? 24.262 40.980 46.170 1.00 54.64 ? 2194 HOH A O   1 
HETATM 2244 O O   . HOH D 4 .   ? 23.265 37.933 46.947 1.00 43.60 ? 2195 HOH A O   1 
HETATM 2245 O O   . HOH D 4 .   ? 19.888 39.516 43.738 1.00 41.67 ? 2196 HOH A O   1 
HETATM 2246 O O   . HOH D 4 .   ? 25.485 29.913 51.385 1.00 21.73 ? 2197 HOH A O   1 
HETATM 2247 O O   . HOH D 4 .   ? 17.978 39.314 39.505 1.00 36.71 ? 2198 HOH A O   1 
HETATM 2248 O O   . HOH D 4 .   ? 12.977 39.343 40.614 1.00 44.54 ? 2199 HOH A O   1 
HETATM 2249 O O   . HOH D 4 .   ? 15.187 33.901 45.076 1.00 17.80 ? 2200 HOH A O   1 
HETATM 2250 O O   . HOH D 4 .   ? 24.528 30.335 45.327 1.00 21.35 ? 2201 HOH A O   1 
HETATM 2251 O O   . HOH D 4 .   ? 20.796 29.272 48.364 1.00 37.53 ? 2202 HOH A O   1 
HETATM 2252 O O   . HOH D 4 .   ? 16.534 35.553 46.925 1.00 29.40 ? 2203 HOH A O   1 
HETATM 2253 O O   . HOH D 4 .   ? 19.141 31.708 51.648 1.00 35.32 ? 2204 HOH A O   1 
HETATM 2254 O O   . HOH D 4 .   ? 19.992 35.583 50.141 1.00 36.78 ? 2205 HOH A O   1 
HETATM 2255 O O   . HOH D 4 .   ? 10.626 28.640 45.425 1.00 18.60 ? 2206 HOH A O   1 
HETATM 2256 O O   . HOH D 4 .   ? 14.503 22.054 48.888 1.00 8.46  ? 2207 HOH A O   1 
HETATM 2257 O O   . HOH D 4 .   ? 16.118 34.039 55.108 1.00 41.69 ? 2208 HOH A O   1 
HETATM 2258 O O   . HOH D 4 .   ? 11.914 31.607 53.429 1.00 26.23 ? 2209 HOH A O   1 
HETATM 2259 O O   . HOH D 4 .   ? 7.628  26.664 50.751 1.00 23.84 ? 2210 HOH A O   1 
HETATM 2260 O O   . HOH D 4 .   ? 8.092  26.515 54.653 1.00 42.73 ? 2211 HOH A O   1 
HETATM 2261 O O   . HOH D 4 .   ? 9.083  29.828 52.640 1.00 45.98 ? 2212 HOH A O   1 
HETATM 2262 O O   . HOH D 4 .   ? 13.526 32.466 46.825 1.00 25.84 ? 2213 HOH A O   1 
HETATM 2263 O O   . HOH D 4 .   ? 7.406  25.759 45.948 1.00 33.46 ? 2214 HOH A O   1 
HETATM 2264 O O   . HOH D 4 .   ? 7.749  29.064 49.011 1.00 41.94 ? 2215 HOH A O   1 
HETATM 2265 O O   . HOH D 4 .   ? 13.066 33.631 54.844 1.00 46.34 ? 2216 HOH A O   1 
HETATM 2266 O O   . HOH D 4 .   ? 15.699 35.624 50.585 1.00 49.86 ? 2217 HOH A O   1 
HETATM 2267 O O   . HOH D 4 .   ? 7.037  18.369 52.321 1.00 39.78 ? 2218 HOH A O   1 
HETATM 2268 O O   . HOH D 4 .   ? 7.319  24.771 48.690 1.00 16.67 ? 2219 HOH A O   1 
HETATM 2269 O O   . HOH D 4 .   ? 10.639 16.663 50.121 1.00 15.45 ? 2220 HOH A O   1 
HETATM 2270 O O   . HOH D 4 .   ? 6.911  24.095 54.840 1.00 35.45 ? 2221 HOH A O   1 
HETATM 2271 O O   . HOH D 4 .   ? 7.305  21.915 46.509 1.00 17.93 ? 2222 HOH A O   1 
HETATM 2272 O O   . HOH D 4 .   ? 6.179  18.758 49.726 1.00 37.38 ? 2223 HOH A O   1 
HETATM 2273 O O   . HOH D 4 .   ? 31.369 28.473 47.613 1.00 15.33 ? 2224 HOH A O   1 
HETATM 2274 O O   . HOH D 4 .   ? 12.468 14.131 51.406 1.00 32.56 ? 2225 HOH A O   1 
HETATM 2275 O O   . HOH D 4 .   ? 16.185 12.175 49.647 1.00 13.99 ? 2226 HOH A O   1 
HETATM 2276 O O   . HOH D 4 .   ? 17.719 13.085 52.959 1.00 12.99 ? 2227 HOH A O   1 
HETATM 2277 O O   . HOH D 4 .   ? 9.197  14.879 48.450 1.00 17.21 ? 2228 HOH A O   1 
HETATM 2278 O O   . HOH D 4 .   ? 32.846 28.109 37.690 1.00 10.25 ? 2229 HOH A O   1 
HETATM 2279 O O   . HOH D 4 .   ? 30.545 32.295 38.483 1.00 15.13 ? 2230 HOH A O   1 
HETATM 2280 O O   . HOH D 4 .   ? 37.105 37.480 42.449 1.00 28.91 ? 2231 HOH A O   1 
HETATM 2281 O O   . HOH D 4 .   ? 33.945 27.831 46.456 1.00 14.90 ? 2232 HOH A O   1 
HETATM 2282 O O   . HOH D 4 .   ? 39.710 37.702 40.947 1.00 20.57 ? 2233 HOH A O   1 
HETATM 2283 O O   . HOH D 4 .   ? 39.614 41.142 39.305 1.00 32.82 ? 2234 HOH A O   1 
HETATM 2284 O O   . HOH D 4 .   ? 43.744 39.404 38.700 1.00 26.25 ? 2235 HOH A O   1 
HETATM 2285 O O   . HOH D 4 .   ? 44.008 35.972 45.761 1.00 39.31 ? 2236 HOH A O   1 
HETATM 2286 O O   . HOH D 4 .   ? 41.749 33.100 44.938 1.00 25.51 ? 2237 HOH A O   1 
HETATM 2287 O O   . HOH D 4 .   ? 45.437 32.789 44.266 1.00 49.08 ? 2238 HOH A O   1 
HETATM 2288 O O   . HOH D 4 .   ? 46.934 34.666 41.042 1.00 42.73 ? 2239 HOH A O   1 
HETATM 2289 O O   . HOH D 4 .   ? 40.832 37.012 43.194 1.00 26.28 ? 2240 HOH A O   1 
HETATM 2290 O O   . HOH D 4 .   ? 46.878 35.644 38.471 1.00 22.97 ? 2241 HOH A O   1 
HETATM 2291 O O   . HOH D 4 .   ? 49.389 34.508 38.144 1.00 46.01 ? 2242 HOH A O   1 
HETATM 2292 O O   . HOH D 4 .   ? 43.528 27.682 40.037 1.00 9.00  ? 2243 HOH A O   1 
HETATM 2293 O O   . HOH D 4 .   ? 49.919 30.823 39.361 1.00 23.36 ? 2244 HOH A O   1 
HETATM 2294 O O   . HOH D 4 .   ? 54.819 26.682 35.309 1.00 25.03 ? 2245 HOH A O   1 
HETATM 2295 O O   . HOH D 4 .   ? 58.039 25.467 32.478 1.00 47.95 ? 2246 HOH A O   1 
HETATM 2296 O O   . HOH D 4 .   ? 60.039 24.036 38.003 1.00 45.68 ? 2247 HOH A O   1 
HETATM 2297 O O   . HOH D 4 .   ? 56.909 24.847 36.446 1.00 32.02 ? 2248 HOH A O   1 
HETATM 2298 O O   . HOH D 4 .   ? 59.121 17.893 38.908 1.00 61.19 ? 2249 HOH A O   1 
HETATM 2299 O O   . HOH D 4 .   ? 59.340 17.562 35.753 1.00 60.49 ? 2250 HOH A O   1 
HETATM 2300 O O   . HOH D 4 .   ? 29.454 24.502 18.815 1.00 42.04 ? 2251 HOH A O   1 
HETATM 2301 O O   . HOH D 4 .   ? 31.413 16.467 22.576 1.00 33.49 ? 2252 HOH A O   1 
HETATM 2302 O O   . HOH D 4 .   ? 15.081 6.083  52.355 1.00 43.05 ? 2253 HOH A O   1 
HETATM 2303 O O   . HOH D 4 .   ? 15.438 8.797  52.748 1.00 43.14 ? 2254 HOH A O   1 
HETATM 2304 O O   . HOH E 4 .   ? 16.507 14.562 58.158 1.00 38.02 ? 2001 HOH B O   1 
HETATM 2305 O O   . HOH E 4 .   ? 27.819 31.871 47.894 1.00 27.04 ? 2002 HOH B O   1 
HETATM 2306 O O   . HOH E 4 .   ? 36.074 12.636 23.849 1.00 43.56 ? 2004 HOH B O   1 
HETATM 2307 O O   . HOH E 4 .   ? 32.544 8.401  24.598 1.00 51.07 ? 2005 HOH B O   1 
HETATM 2308 O O   . HOH E 4 .   ? 34.209 0.617  40.658 1.00 55.01 ? 2006 HOH B O   1 
HETATM 2309 O O   . HOH E 4 .   ? 29.980 12.185 77.901 1.00 55.70 ? 2007 HOH B O   1 
HETATM 2310 O O   . HOH E 4 .   ? 20.262 10.239 74.103 1.00 44.13 ? 2008 HOH B O   1 
HETATM 2311 O O   . HOH E 4 .   ? 18.481 14.940 66.650 1.00 37.81 ? 2009 HOH B O   1 
HETATM 2312 O O   . HOH E 4 .   ? 11.665 23.741 68.753 1.00 42.24 ? 2010 HOH B O   1 
HETATM 2313 O O   . HOH E 4 .   ? 15.830 15.662 55.632 1.00 27.14 ? 2011 HOH B O   1 
HETATM 2314 O O   . HOH E 4 .   ? 27.154 29.376 48.158 1.00 29.90 ? 2012 HOH B O   1 
HETATM 2315 O O   . HOH E 4 .   ? 31.387 28.640 16.866 1.00 51.82 ? 2016 HOH B O   1 
HETATM 2316 O O   . HOH E 4 .   ? 31.750 18.101 18.404 1.00 58.40 ? 2018 HOH B O   1 
HETATM 2317 O O   . HOH E 4 .   ? 37.500 15.866 21.780 1.00 37.41 ? 2019 HOH B O   1 
HETATM 2318 O O   . HOH E 4 .   ? 31.833 12.302 26.835 1.00 29.21 ? 2020 HOH B O   1 
HETATM 2319 O O   . HOH E 4 .   ? 34.447 15.259 24.922 1.00 42.29 ? 2021 HOH B O   1 
HETATM 2320 O O   . HOH E 4 .   ? 32.862 5.972  28.622 1.00 29.57 ? 2022 HOH B O   1 
HETATM 2321 O O   . HOH E 4 .   ? 33.523 9.966  26.779 1.00 28.24 ? 2023 HOH B O   1 
HETATM 2322 O O   . HOH E 4 .   ? 25.486 5.135  30.950 1.00 59.03 ? 2024 HOH B O   1 
HETATM 2323 O O   . HOH E 4 .   ? 35.198 2.005  38.567 1.00 38.07 ? 2025 HOH B O   1 
HETATM 2324 O O   . HOH E 4 .   ? 54.988 28.568 28.427 1.00 32.67 ? 2026 HOH B O   1 
HETATM 2325 O O   . HOH E 4 .   ? 52.515 36.902 32.460 1.00 47.65 ? 2027 HOH B O   1 
HETATM 2326 O O   . HOH E 4 .   ? 53.932 37.507 29.679 1.00 47.55 ? 2028 HOH B O   1 
HETATM 2327 O O   . HOH E 4 .   ? 54.511 32.282 34.957 1.00 46.09 ? 2029 HOH B O   1 
HETATM 2328 O O   . HOH E 4 .   ? 18.969 13.171 57.459 1.00 22.57 ? 2030 HOH B O   1 
HETATM 2329 O O   . HOH E 4 .   ? 22.803 2.660  46.026 1.00 36.06 ? 2032 HOH B O   1 
HETATM 2330 O O   . HOH E 4 .   ? 22.592 11.861 78.878 1.00 46.87 ? 2033 HOH B O   1 
HETATM 2331 O O   . HOH E 4 .   ? 24.576 11.476 76.110 1.00 49.75 ? 2034 HOH B O   1 
HETATM 2332 O O   . HOH E 4 .   ? 27.378 10.936 78.844 1.00 35.80 ? 2035 HOH B O   1 
HETATM 2333 O O   . HOH E 4 .   ? 23.980 15.550 81.515 1.00 18.05 ? 2036 HOH B O   1 
HETATM 2334 O O   . HOH E 4 .   ? 18.726 20.531 74.102 1.00 14.42 ? 2037 HOH B O   1 
HETATM 2335 O O   . HOH E 4 .   ? 27.005 21.133 72.099 1.00 16.33 ? 2038 HOH B O   1 
HETATM 2336 O O   . HOH E 4 .   ? 20.637 17.452 75.467 1.00 16.22 ? 2039 HOH B O   1 
HETATM 2337 O O   . HOH E 4 .   ? 22.539 14.663 70.810 1.00 44.58 ? 2040 HOH B O   1 
HETATM 2338 O O   . HOH E 4 .   ? 24.010 16.287 74.753 1.00 32.95 ? 2041 HOH B O   1 
HETATM 2339 O O   . HOH E 4 .   ? 23.994 20.302 73.669 1.00 26.50 ? 2042 HOH B O   1 
HETATM 2340 O O   . HOH E 4 .   ? 20.781 15.225 68.830 1.00 32.58 ? 2043 HOH B O   1 
HETATM 2341 O O   . HOH E 4 .   ? 16.985 11.296 70.220 1.00 50.49 ? 2044 HOH B O   1 
HETATM 2342 O O   . HOH E 4 .   ? 16.476 14.899 68.422 1.00 43.22 ? 2045 HOH B O   1 
HETATM 2343 O O   . HOH E 4 .   ? 18.082 11.258 72.957 1.00 33.11 ? 2046 HOH B O   1 
HETATM 2344 O O   . HOH E 4 .   ? 18.060 18.768 67.049 1.00 34.38 ? 2047 HOH B O   1 
HETATM 2345 O O   . HOH E 4 .   ? 13.595 20.722 71.801 1.00 21.31 ? 2048 HOH B O   1 
HETATM 2346 O O   . HOH E 4 .   ? 11.741 21.215 69.514 1.00 32.32 ? 2049 HOH B O   1 
HETATM 2347 O O   . HOH E 4 .   ? 13.480 22.263 66.515 1.00 23.15 ? 2050 HOH B O   1 
HETATM 2348 O O   . HOH E 4 .   ? 10.251 15.746 64.870 1.00 37.75 ? 2051 HOH B O   1 
HETATM 2349 O O   . HOH E 4 .   ? 14.331 12.031 68.202 1.00 32.51 ? 2052 HOH B O   1 
HETATM 2350 O O   . HOH E 4 .   ? 14.269 28.315 63.580 1.00 41.85 ? 2053 HOH B O   1 
HETATM 2351 O O   . HOH E 4 .   ? 16.859 16.899 61.841 1.00 34.83 ? 2054 HOH B O   1 
HETATM 2352 O O   . HOH E 4 .   ? 17.645 22.247 52.852 1.00 8.65  ? 2055 HOH B O   1 
HETATM 2353 O O   . HOH E 4 .   ? 23.861 25.614 50.326 1.00 13.15 ? 2056 HOH B O   1 
HETATM 2354 O O   . HOH E 4 .   ? 29.898 7.859  24.421 1.00 47.41 ? 2057 HOH B O   1 
HETATM 2355 O O   . HOH E 4 .   ? 18.220 16.295 54.686 1.00 11.08 ? 2058 HOH B O   1 
HETATM 2356 O O   . HOH E 4 .   ? 25.214 28.146 49.513 1.00 43.14 ? 2059 HOH B O   1 
HETATM 2357 O O   . HOH E 4 .   ? 29.049 31.393 43.839 1.00 21.20 ? 2060 HOH B O   1 
HETATM 2358 O O   . HOH E 4 .   ? 28.452 27.825 46.641 1.00 19.43 ? 2061 HOH B O   1 
HETATM 2359 O O   . HOH E 4 .   ? 33.200 20.754 40.601 1.00 7.30  ? 2062 HOH B O   1 
HETATM 2360 O O   . HOH E 4 .   ? 41.392 27.039 38.467 1.00 10.72 ? 2063 HOH B O   1 
HETATM 2361 O O   . HOH E 4 .   ? 47.838 31.952 40.847 1.00 24.44 ? 2064 HOH B O   1 
HETATM 2362 O O   . HOH E 4 .   ? 44.098 38.929 33.286 1.00 22.04 ? 2065 HOH B O   1 
HETATM 2363 O O   . HOH E 4 .   ? 40.350 40.532 32.168 1.00 29.34 ? 2066 HOH B O   1 
HETATM 2364 O O   . HOH E 4 .   ? 42.040 29.159 36.046 1.00 16.46 ? 2067 HOH B O   1 
HETATM 2365 O O   . HOH E 4 .   ? 36.037 24.820 31.987 1.00 8.17  ? 2068 HOH B O   1 
HETATM 2366 O O   . HOH E 4 .   ? 33.946 34.208 25.088 1.00 19.20 ? 2069 HOH B O   1 
HETATM 2367 O O   . HOH E 4 .   ? 41.774 23.141 19.915 1.00 16.28 ? 2070 HOH B O   1 
HETATM 2368 O O   . HOH E 4 .   ? 39.708 25.147 18.899 1.00 22.08 ? 2071 HOH B O   1 
HETATM 2369 O O   . HOH E 4 .   ? 38.701 26.880 17.172 1.00 50.82 ? 2072 HOH B O   1 
HETATM 2370 O O   . HOH E 4 .   ? 39.457 30.628 19.612 1.00 46.72 ? 2073 HOH B O   1 
HETATM 2371 O O   . HOH E 4 .   ? 32.462 26.095 17.584 1.00 43.38 ? 2074 HOH B O   1 
HETATM 2372 O O   . HOH E 4 .   ? 39.973 17.259 16.506 1.00 34.25 ? 2075 HOH B O   1 
HETATM 2373 O O   . HOH E 4 .   ? 32.352 23.019 17.308 1.00 45.42 ? 2076 HOH B O   1 
HETATM 2374 O O   . HOH E 4 .   ? 40.869 20.958 16.755 1.00 40.03 ? 2077 HOH B O   1 
HETATM 2375 O O   . HOH E 4 .   ? 39.808 20.038 14.092 1.00 29.98 ? 2078 HOH B O   1 
HETATM 2376 O O   . HOH E 4 .   ? 33.863 18.253 22.651 1.00 36.63 ? 2079 HOH B O   1 
HETATM 2377 O O   . HOH E 4 .   ? 40.572 20.925 19.354 1.00 32.66 ? 2080 HOH B O   1 
HETATM 2378 O O   . HOH E 4 .   ? 40.887 18.171 21.608 1.00 50.98 ? 2081 HOH B O   1 
HETATM 2379 O O   . HOH E 4 .   ? 39.136 17.883 19.605 1.00 48.71 ? 2082 HOH B O   1 
HETATM 2380 O O   . HOH E 4 .   ? 34.249 18.569 19.556 1.00 45.73 ? 2083 HOH B O   1 
HETATM 2381 O O   . HOH E 4 .   ? 33.083 14.645 27.036 1.00 12.26 ? 2084 HOH B O   1 
HETATM 2382 O O   . HOH E 4 .   ? 39.595 18.099 24.405 1.00 30.29 ? 2085 HOH B O   1 
HETATM 2383 O O   . HOH E 4 .   ? 36.048 16.950 23.757 1.00 51.61 ? 2086 HOH B O   1 
HETATM 2384 O O   . HOH E 4 .   ? 33.735 8.587  29.034 1.00 18.91 ? 2087 HOH B O   1 
HETATM 2385 O O   . HOH E 4 .   ? 26.485 7.405  32.562 1.00 17.92 ? 2088 HOH B O   1 
HETATM 2386 O O   . HOH E 4 .   ? 36.027 1.948  33.739 1.00 41.38 ? 2089 HOH B O   1 
HETATM 2387 O O   . HOH E 4 .   ? 36.375 8.265  29.763 1.00 30.06 ? 2090 HOH B O   1 
HETATM 2388 O O   . HOH E 4 .   ? 38.902 7.860  33.348 1.00 28.35 ? 2091 HOH B O   1 
HETATM 2389 O O   . HOH E 4 .   ? 38.870 2.714  35.381 1.00 47.55 ? 2092 HOH B O   1 
HETATM 2390 O O   . HOH E 4 .   ? 29.046 -1.147 37.085 1.00 47.50 ? 2093 HOH B O   1 
HETATM 2391 O O   . HOH E 4 .   ? 24.584 0.383  33.600 1.00 40.33 ? 2094 HOH B O   1 
HETATM 2392 O O   . HOH E 4 .   ? 27.877 5.104  33.778 1.00 17.90 ? 2095 HOH B O   1 
HETATM 2393 O O   . HOH E 4 .   ? 27.773 -0.381 40.505 1.00 37.17 ? 2096 HOH B O   1 
HETATM 2394 O O   . HOH E 4 .   ? 33.310 1.990  32.005 1.00 41.55 ? 2097 HOH B O   1 
HETATM 2395 O O   . HOH E 4 .   ? 29.983 3.261  31.920 1.00 48.60 ? 2098 HOH B O   1 
HETATM 2396 O O   . HOH E 4 .   ? 30.224 1.621  45.339 1.00 51.09 ? 2099 HOH B O   1 
HETATM 2397 O O   . HOH E 4 .   ? 26.767 7.244  40.693 1.00 11.86 ? 2100 HOH B O   1 
HETATM 2398 O O   . HOH E 4 .   ? 27.806 13.063 48.596 1.00 10.00 ? 2101 HOH B O   1 
HETATM 2399 O O   . HOH E 4 .   ? 32.444 5.285  45.027 1.00 19.19 ? 2102 HOH B O   1 
HETATM 2400 O O   . HOH E 4 .   ? 35.349 4.841  45.383 1.00 42.23 ? 2103 HOH B O   1 
HETATM 2401 O O   . HOH E 4 .   ? 36.892 11.592 46.207 1.00 42.01 ? 2104 HOH B O   1 
HETATM 2402 O O   . HOH E 4 .   ? 37.916 2.634  39.516 1.00 44.67 ? 2105 HOH B O   1 
HETATM 2403 O O   . HOH E 4 .   ? 40.433 11.368 36.063 1.00 21.51 ? 2106 HOH B O   1 
HETATM 2404 O O   . HOH E 4 .   ? 39.762 8.722  35.806 1.00 22.42 ? 2107 HOH B O   1 
HETATM 2405 O O   . HOH E 4 .   ? 34.881 18.499 39.775 1.00 7.90  ? 2108 HOH B O   1 
HETATM 2406 O O   . HOH E 4 .   ? 46.396 9.895  38.409 1.00 39.28 ? 2109 HOH B O   1 
HETATM 2407 O O   . HOH E 4 .   ? 42.762 8.370  35.715 1.00 52.72 ? 2110 HOH B O   1 
HETATM 2408 O O   . HOH E 4 .   ? 38.983 14.667 26.874 1.00 51.32 ? 2111 HOH B O   1 
HETATM 2409 O O   . HOH E 4 .   ? 38.004 10.434 29.258 1.00 36.65 ? 2112 HOH B O   1 
HETATM 2410 O O   . HOH E 4 .   ? 50.038 18.285 31.678 1.00 43.30 ? 2113 HOH B O   1 
HETATM 2411 O O   . HOH E 4 .   ? 40.639 10.830 31.551 1.00 40.38 ? 2114 HOH B O   1 
HETATM 2412 O O   . HOH E 4 .   ? 41.741 15.605 27.410 1.00 46.84 ? 2115 HOH B O   1 
HETATM 2413 O O   . HOH E 4 .   ? 41.970 11.267 28.389 1.00 52.09 ? 2116 HOH B O   1 
HETATM 2414 O O   . HOH E 4 .   ? 42.889 11.965 34.662 1.00 33.08 ? 2117 HOH B O   1 
HETATM 2415 O O   . HOH E 4 .   ? 44.551 22.505 33.841 1.00 6.81  ? 2118 HOH B O   1 
HETATM 2416 O O   . HOH E 4 .   ? 49.878 20.881 31.475 1.00 17.75 ? 2119 HOH B O   1 
HETATM 2417 O O   . HOH E 4 .   ? 53.924 25.449 29.259 1.00 35.83 ? 2120 HOH B O   1 
HETATM 2418 O O   . HOH E 4 .   ? 43.465 31.331 22.424 1.00 22.87 ? 2121 HOH B O   1 
HETATM 2419 O O   . HOH E 4 .   ? 43.363 33.605 24.235 1.00 23.35 ? 2122 HOH B O   1 
HETATM 2420 O O   . HOH E 4 .   ? 44.946 33.174 20.986 1.00 18.83 ? 2123 HOH B O   1 
HETATM 2421 O O   . HOH E 4 .   ? 48.122 38.331 20.744 1.00 47.86 ? 2124 HOH B O   1 
HETATM 2422 O O   . HOH E 4 .   ? 50.092 40.720 27.225 1.00 29.43 ? 2125 HOH B O   1 
HETATM 2423 O O   . HOH E 4 .   ? 51.873 38.294 24.065 1.00 19.90 ? 2126 HOH B O   1 
HETATM 2424 O O   . HOH E 4 .   ? 10.858 17.046 54.720 1.00 36.76 ? 2127 HOH B O   1 
HETATM 2425 O O   . HOH E 4 .   ? 51.373 39.070 31.325 1.00 39.71 ? 2128 HOH B O   1 
HETATM 2426 O O   . HOH E 4 .   ? 49.583 35.955 33.100 1.00 31.67 ? 2129 HOH B O   1 
HETATM 2427 O O   . HOH E 4 .   ? 52.314 30.818 32.378 1.00 28.32 ? 2130 HOH B O   1 
HETATM 2428 O O   . HOH E 4 .   ? 44.418 29.638 34.678 1.00 10.91 ? 2131 HOH B O   1 
HETATM 2429 O O   . HOH E 4 .   ? 29.039 15.203 49.912 1.00 9.01  ? 2132 HOH B O   1 
HETATM 2430 O O   . HOH E 4 .   ? 19.674 13.927 54.915 1.00 18.12 ? 2133 HOH B O   1 
HETATM 2431 O O   . HOH E 4 .   ? 17.299 10.580 56.292 1.00 35.62 ? 2134 HOH B O   1 
HETATM 2432 O O   . HOH E 4 .   ? 17.054 19.780 51.675 1.00 8.66  ? 2135 HOH B O   1 
HETATM 2433 O O   . HOH E 4 .   ? 18.569 7.713  52.934 1.00 26.15 ? 2136 HOH B O   1 
HETATM 2434 O O   . HOH E 4 .   ? 26.362 4.603  51.326 1.00 31.86 ? 2137 HOH B O   1 
HETATM 2435 O O   . HOH E 4 .   ? 29.357 4.937  53.866 1.00 49.13 ? 2138 HOH B O   1 
HETATM 2436 O O   . HOH E 4 .   ? 29.267 8.855  54.063 1.00 19.86 ? 2139 HOH B O   1 
HETATM 2437 O O   . HOH E 4 .   ? 31.596 4.643  47.490 1.00 25.35 ? 2140 HOH B O   1 
HETATM 2438 O O   . HOH E 4 .   ? 20.244 6.748  36.641 1.00 11.75 ? 2141 HOH B O   1 
HETATM 2439 O O   . HOH E 4 .   ? 25.679 1.691  46.441 1.00 56.47 ? 2142 HOH B O   1 
HETATM 2440 O O   . HOH E 4 .   ? 21.209 4.931  45.178 1.00 15.69 ? 2143 HOH B O   1 
HETATM 2441 O O   . HOH E 4 .   ? 13.758 -0.051 39.893 1.00 44.85 ? 2144 HOH B O   1 
HETATM 2442 O O   . HOH E 4 .   ? 18.626 5.483  40.504 1.00 14.42 ? 2145 HOH B O   1 
HETATM 2443 O O   . HOH E 4 .   ? 22.331 -2.181 42.965 1.00 44.43 ? 2146 HOH B O   1 
HETATM 2444 O O   . HOH E 4 .   ? 51.822 34.627 31.364 1.00 26.83 ? 2147 HOH B O   1 
HETATM 2445 O O   . HOH E 4 .   ? 13.344 15.757 54.468 1.00 41.30 ? 2224 HOH B O   1 
HETATM 2446 O O   . HOH F 4 .   ? 43.079 32.929 18.771 1.00 53.65 ? 2001 HOH I O   1 
HETATM 2447 O O   . HOH F 4 .   ? 41.538 31.780 20.723 1.00 45.57 ? 2002 HOH I O   1 
HETATM 2448 O O   . HOH F 4 .   ? 40.703 34.108 22.819 1.00 54.71 ? 2003 HOH I O   1 
HETATM 2449 O O   . HOH F 4 .   ? 35.795 32.181 18.900 1.00 55.53 ? 2004 HOH I O   1 
HETATM 2450 O O   . HOH F 4 .   ? 38.251 35.124 26.136 1.00 29.92 ? 2005 HOH I O   1 
HETATM 2451 O O   . HOH F 4 .   ? 35.384 37.820 28.892 1.00 45.88 ? 2006 HOH I O   1 
HETATM 2452 O O   . HOH F 4 .   ? 32.515 38.991 31.120 1.00 44.15 ? 2007 HOH I O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   29  29  SER SER A . n 
A 1 2   GLY 2   30  30  GLY GLY A . n 
A 1 3   ILE 3   31  31  ILE ILE A . n 
A 1 4   SER 4   32  32  SER SER A . n 
A 1 5   LEU 5   33  33  LEU LEU A . n 
A 1 6   ASP 6   34  34  ASP ASP A . n 
A 1 7   ASN 7   35  35  ASN ASN A . n 
A 1 8   SER 8   36  36  SER SER A . n 
A 1 9   TYR 9   37  37  TYR TYR A . n 
A 1 10  LYS 10  38  38  LYS LYS A . n 
A 1 11  MET 11  39  39  MET MET A . n 
A 1 12  ASP 12  40  40  ASP ASP A . n 
A 1 13  TYR 13  41  41  TYR TYR A . n 
A 1 14  PRO 14  42  42  PRO PRO A . n 
A 1 15  GLU 15  43  43  GLU GLU A . n 
A 1 16  MET 16  44  44  MET MET A . n 
A 1 17  GLY 17  45  45  GLY GLY A . n 
A 1 18  LEU 18  46  46  LEU LEU A . n 
A 1 19  CYS 19  47  47  CYS CYS A . n 
A 1 20  ILE 20  48  48  ILE ILE A . n 
A 1 21  ILE 21  49  49  ILE ILE A . n 
A 1 22  ILE 22  50  50  ILE ILE A . n 
A 1 23  ASN 23  51  51  ASN ASN A . n 
A 1 24  ASN 24  52  52  ASN ASN A . n 
A 1 25  LYS 25  53  53  LYS LYS A . n 
A 1 26  ASN 26  54  54  ASN ASN A . n 
A 1 27  PHE 27  55  55  PHE PHE A . n 
A 1 28  HIS 28  56  56  HIS HIS A . n 
A 1 29  LYS 29  57  57  LYS LYS A . n 
A 1 30  SER 30  58  58  SER SER A . n 
A 1 31  THR 31  59  59  THR THR A . n 
A 1 32  GLY 32  60  60  GLY GLY A . n 
A 1 33  MET 33  61  61  MET MET A . n 
A 1 34  THR 34  62  62  THR THR A . n 
A 1 35  SER 35  63  63  SER SER A . n 
A 1 36  ARG 36  64  64  ARG ARG A . n 
A 1 37  SER 37  65  65  SER SER A . n 
A 1 38  GLY 38  66  66  GLY GLY A . n 
A 1 39  THR 39  67  67  THR THR A . n 
A 1 40  ASP 40  68  68  ASP ASP A . n 
A 1 41  VAL 41  69  69  VAL VAL A . n 
A 1 42  ASP 42  70  70  ASP ASP A . n 
A 1 43  ALA 43  71  71  ALA ALA A . n 
A 1 44  ALA 44  72  72  ALA ALA A . n 
A 1 45  ASN 45  73  73  ASN ASN A . n 
A 1 46  LEU 46  74  74  LEU LEU A . n 
A 1 47  ARG 47  75  75  ARG ARG A . n 
A 1 48  GLU 48  76  76  GLU GLU A . n 
A 1 49  THR 49  77  77  THR THR A . n 
A 1 50  PHE 50  78  78  PHE PHE A . n 
A 1 51  ARG 51  79  79  ARG ARG A . n 
A 1 52  ASN 52  80  80  ASN ASN A . n 
A 1 53  LEU 53  81  81  LEU LEU A . n 
A 1 54  LYS 54  82  82  LYS LYS A . n 
A 1 55  TYR 55  83  83  TYR TYR A . n 
A 1 56  GLU 56  84  84  GLU GLU A . n 
A 1 57  VAL 57  85  85  VAL VAL A . n 
A 1 58  ARG 58  86  86  ARG ARG A . n 
A 1 59  ASN 59  87  87  ASN ASN A . n 
A 1 60  LYS 60  88  88  LYS LYS A . n 
A 1 61  ASN 61  89  89  ASN ASN A . n 
A 1 62  ASP 62  90  90  ASP ASP A . n 
A 1 63  LEU 63  91  91  LEU LEU A . n 
A 1 64  THR 64  92  92  THR THR A . n 
A 1 65  ARG 65  93  93  ARG ARG A . n 
A 1 66  GLU 66  94  94  GLU GLU A . n 
A 1 67  GLU 67  95  95  GLU GLU A . n 
A 1 68  ILE 68  96  96  ILE ILE A . n 
A 1 69  VAL 69  97  97  VAL VAL A . n 
A 1 70  GLU 70  98  98  GLU GLU A . n 
A 1 71  LEU 71  99  99  LEU LEU A . n 
A 1 72  MET 72  100 100 MET MET A . n 
A 1 73  ARG 73  101 101 ARG ARG A . n 
A 1 74  ASP 74  102 102 ASP ASP A . n 
A 1 75  VAL 75  103 103 VAL VAL A . n 
A 1 76  SER 76  104 104 SER SER A . n 
A 1 77  LYS 77  105 105 LYS LYS A . n 
A 1 78  GLU 78  106 106 GLU GLU A . n 
A 1 79  ASP 79  107 107 ASP ASP A . n 
A 1 80  HIS 80  108 108 HIS HIS A . n 
A 1 81  SER 81  109 109 SER SER A . n 
A 1 82  LYS 82  110 110 LYS LYS A . n 
A 1 83  ARG 83  111 111 ARG ARG A . n 
A 1 84  SER 84  112 112 SER SER A . n 
A 1 85  SER 85  113 113 SER SER A . n 
A 1 86  PHE 86  114 114 PHE PHE A . n 
A 1 87  VAL 87  115 115 VAL VAL A . n 
A 1 88  CYS 88  116 116 CYS CYS A . n 
A 1 89  VAL 89  117 117 VAL VAL A . n 
A 1 90  LEU 90  118 118 LEU LEU A . n 
A 1 91  LEU 91  119 119 LEU LEU A . n 
A 1 92  SER 92  120 120 SER SER A . n 
A 1 93  HIS 93  121 121 HIS HIS A . n 
A 1 94  GLY 94  122 122 GLY GLY A . n 
A 1 95  GLU 95  123 123 GLU GLU A . n 
A 1 96  GLU 96  124 124 GLU GLU A . n 
A 1 97  GLY 97  125 125 GLY GLY A . n 
A 1 98  ILE 98  126 126 ILE ILE A . n 
A 1 99  ILE 99  127 127 ILE ILE A . n 
A 1 100 PHE 100 128 128 PHE PHE A . n 
A 1 101 GLY 101 129 129 GLY GLY A . n 
A 1 102 THR 102 130 130 THR THR A . n 
A 1 103 ASN 103 131 131 ASN ASN A . n 
A 1 104 GLY 104 132 132 GLY GLY A . n 
A 1 105 PRO 105 133 133 PRO PRO A . n 
A 1 106 VAL 106 134 134 VAL VAL A . n 
A 1 107 ASP 107 135 135 ASP ASP A . n 
A 1 108 LEU 108 136 136 LEU LEU A . n 
A 1 109 LYS 109 137 137 LYS LYS A . n 
A 1 110 LYS 110 138 138 LYS LYS A . n 
A 1 111 ILE 111 139 139 ILE ILE A . n 
A 1 112 THR 112 140 140 THR THR A . n 
A 1 113 ASN 113 141 141 ASN ASN A . n 
A 1 114 PHE 114 142 142 PHE PHE A . n 
A 1 115 PHE 115 143 143 PHE PHE A . n 
A 1 116 ARG 116 144 144 ARG ARG A . n 
A 1 117 GLY 117 145 145 GLY GLY A . n 
A 1 118 ASP 118 146 146 ASP ASP A . n 
A 1 119 ARG 119 147 147 ARG ARG A . n 
A 1 120 CYS 120 148 148 CYS CYS A . n 
A 1 121 ARG 121 149 149 ARG ARG A . n 
A 1 122 SER 122 150 150 SER SER A . n 
A 1 123 LEU 123 151 151 LEU LEU A . n 
A 1 124 THR 124 152 152 THR THR A . n 
A 1 125 GLY 125 153 153 GLY GLY A . n 
A 1 126 LYS 126 154 154 LYS LYS A . n 
A 1 127 PRO 127 155 155 PRO PRO A . n 
A 1 128 LYS 128 156 156 LYS LYS A . n 
A 1 129 LEU 129 157 157 LEU LEU A . n 
A 1 130 PHE 130 158 158 PHE PHE A . n 
A 1 131 ILE 131 159 159 ILE ILE A . n 
A 1 132 ILE 132 160 160 ILE ILE A . n 
A 1 133 GLN 133 161 161 GLN GLN A . n 
A 1 134 ALA 134 162 162 ALA ALA A . n 
A 1 135 CYS 135 163 163 CYS CYS A . n 
A 1 136 ARG 136 164 164 ARG ARG A . n 
A 1 137 GLY 137 165 165 GLY GLY A . n 
A 1 138 THR 138 166 166 THR THR A . n 
A 1 139 GLU 139 167 167 GLU GLU A . n 
A 1 140 LEU 140 168 168 LEU LEU A . n 
A 1 141 ASP 141 169 169 ASP ASP A . n 
A 1 142 CYS 142 170 170 CYS CYS A . n 
A 1 143 GLY 143 171 171 GLY GLY A . n 
A 1 144 ILE 144 172 172 ILE ILE A . n 
A 1 145 GLU 145 173 173 GLU GLU A . n 
A 1 146 THR 146 174 174 THR THR A . n 
A 1 147 ASP 147 175 ?   ?   ?   A . n 
B 2 1   ALA 1   175 175 ALA ALA B . n 
B 2 2   SER 2   176 176 SER SER B . n 
B 2 3   GLY 3   177 177 GLY GLY B . n 
B 2 4   VAL 4   178 178 VAL VAL B . n 
B 2 5   ASP 5   179 179 ASP ASP B . n 
B 2 6   ASP 6   180 180 ASP ASP B . n 
B 2 7   ASP 7   181 181 ASP ASP B . n 
B 2 8   MET 8   182 182 MET MET B . n 
B 2 9   ALA 9   183 183 ALA ALA B . n 
B 2 10  CYS 10  184 184 CYS CYS B . n 
B 2 11  HIS 11  185 185 HIS HIS B . n 
B 2 12  LYS 12  186 186 LYS LYS B . n 
B 2 13  ILE 13  187 187 ILE ILE B . n 
B 2 14  PRO 14  188 188 PRO PRO B . n 
B 2 15  VAL 15  189 189 VAL VAL B . n 
B 2 16  GLU 16  190 190 GLU GLU B . n 
B 2 17  ALA 17  191 191 ALA ALA B . n 
B 2 18  ASP 18  192 192 ASP ASP B . n 
B 2 19  PHE 19  193 193 PHE PHE B . n 
B 2 20  LEU 20  194 194 LEU LEU B . n 
B 2 21  TYR 21  195 195 TYR TYR B . n 
B 2 22  ALA 22  196 196 ALA ALA B . n 
B 2 23  TYR 23  197 197 TYR TYR B . n 
B 2 24  SER 24  198 198 SER SER B . n 
B 2 25  THR 25  199 199 THR THR B . n 
B 2 26  ALA 26  200 200 ALA ALA B . n 
B 2 27  PRO 27  201 201 PRO PRO B . n 
B 2 28  GLY 28  202 202 GLY GLY B . n 
B 2 29  TYR 29  203 203 TYR TYR B . n 
B 2 30  TYR 30  204 204 TYR TYR B . n 
B 2 31  SER 31  205 205 SER SER B . n 
B 2 32  TRP 32  206 206 TRP TRP B . n 
B 2 33  ARG 33  207 207 ARG ARG B . n 
B 2 34  ASN 34  208 208 ASN ASN B . n 
B 2 35  SER 35  209 209 SER SER B . n 
B 2 36  LYS 36  210 210 LYS LYS B . n 
B 2 37  ASP 37  211 211 ASP ASP B . n 
B 2 38  GLY 38  212 212 GLY GLY B . n 
B 2 39  SER 39  213 213 SER SER B . n 
B 2 40  TRP 40  214 214 TRP TRP B . n 
B 2 41  PHE 41  215 215 PHE PHE B . n 
B 2 42  ILE 42  216 216 ILE ILE B . n 
B 2 43  GLN 43  217 217 GLN GLN B . n 
B 2 44  SER 44  218 218 SER SER B . n 
B 2 45  LEU 45  219 219 LEU LEU B . n 
B 2 46  CYS 46  220 220 CYS CYS B . n 
B 2 47  ALA 47  221 221 ALA ALA B . n 
B 2 48  MET 48  222 222 MET MET B . n 
B 2 49  LEU 49  223 223 LEU LEU B . n 
B 2 50  LYS 50  224 224 LYS LYS B . n 
B 2 51  GLN 51  225 225 GLN GLN B . n 
B 2 52  TYR 52  226 226 TYR TYR B . n 
B 2 53  ALA 53  227 227 ALA ALA B . n 
B 2 54  ASP 54  228 228 ASP ASP B . n 
B 2 55  LYS 55  229 229 LYS LYS B . n 
B 2 56  LEU 56  230 230 LEU LEU B . n 
B 2 57  GLU 57  231 231 GLU GLU B . n 
B 2 58  PHE 58  232 232 PHE PHE B . n 
B 2 59  MET 59  233 233 MET MET B . n 
B 2 60  HIS 60  234 234 HIS HIS B . n 
B 2 61  ILE 61  235 235 ILE ILE B . n 
B 2 62  LEU 62  236 236 LEU LEU B . n 
B 2 63  THR 63  237 237 THR THR B . n 
B 2 64  ARG 64  238 238 ARG ARG B . n 
B 2 65  VAL 65  239 239 VAL VAL B . n 
B 2 66  ASN 66  240 240 ASN ASN B . n 
B 2 67  ARG 67  241 241 ARG ARG B . n 
B 2 68  LYS 68  242 242 LYS LYS B . n 
B 2 69  VAL 69  243 243 VAL VAL B . n 
B 2 70  ALA 70  244 244 ALA ALA B . n 
B 2 71  THR 71  245 245 THR THR B . n 
B 2 72  GLU 72  246 246 GLU GLU B . n 
B 2 73  PHE 73  247 247 PHE PHE B . n 
B 2 74  GLU 74  248 248 GLU GLU B . n 
B 2 75  SER 75  249 249 SER SER B . n 
B 2 76  PHE 76  250 250 PHE PHE B . n 
B 2 77  SER 77  251 251 SER SER B . n 
B 2 78  PHE 78  252 252 PHE PHE B . n 
B 2 79  ASP 79  253 253 ASP ASP B . n 
B 2 80  ALA 80  254 254 ALA ALA B . n 
B 2 81  THR 81  255 255 THR THR B . n 
B 2 82  PHE 82  256 256 PHE PHE B . n 
B 2 83  HIS 83  257 257 HIS HIS B . n 
B 2 84  ALA 84  258 258 ALA ALA B . n 
B 2 85  LYS 85  259 259 LYS LYS B . n 
B 2 86  LYS 86  260 260 LYS LYS B . n 
B 2 87  GLN 87  261 261 GLN GLN B . n 
B 2 88  ILE 88  262 262 ILE ILE B . n 
B 2 89  PRO 89  263 263 PRO PRO B . n 
B 2 90  CYS 90  264 264 CYS CYS B . n 
B 2 91  ILE 91  265 265 ILE ILE B . n 
B 2 92  VAL 92  266 266 VAL VAL B . n 
B 2 93  SER 93  267 267 SER SER B . n 
B 2 94  MET 94  268 268 MET MET B . n 
B 2 95  LEU 95  269 269 LEU LEU B . n 
B 2 96  THR 96  270 270 THR THR B . n 
B 2 97  LYS 97  271 271 LYS LYS B . n 
B 2 98  GLU 98  272 272 GLU GLU B . n 
B 2 99  LEU 99  273 273 LEU LEU B . n 
B 2 100 TYR 100 274 274 TYR TYR B . n 
B 2 101 PHE 101 275 275 PHE PHE B . n 
B 2 102 TYR 102 276 276 TYR TYR B . n 
B 2 103 HIS 103 277 277 HIS HIS B . n 
C 3 1   PHQ 1   901 901 PHQ PHQ I . n 
C 3 2   ASP 2   902 902 ASP ASP I . n 
C 3 3   GLU 3   903 903 GLU GLU I . n 
C 3 4   VAL 4   904 904 VAL VAL I . n 
C 3 5   MY2 5   905 905 MY2 MY2 I . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   2001 2001 HOH HOH A . 
D 4 HOH 2   2002 2002 HOH HOH A . 
D 4 HOH 3   2003 2003 HOH HOH A . 
D 4 HOH 4   2004 2004 HOH HOH A . 
D 4 HOH 5   2005 2005 HOH HOH A . 
D 4 HOH 6   2006 2006 HOH HOH A . 
D 4 HOH 7   2007 2007 HOH HOH A . 
D 4 HOH 8   2008 2008 HOH HOH A . 
D 4 HOH 9   2009 2009 HOH HOH A . 
D 4 HOH 10  2010 2010 HOH HOH A . 
D 4 HOH 11  2011 2011 HOH HOH A . 
D 4 HOH 12  2012 2012 HOH HOH A . 
D 4 HOH 13  2013 2013 HOH HOH A . 
D 4 HOH 14  2014 2014 HOH HOH A . 
D 4 HOH 15  2015 2015 HOH HOH A . 
D 4 HOH 16  2016 2016 HOH HOH A . 
D 4 HOH 17  2017 2017 HOH HOH A . 
D 4 HOH 18  2018 2018 HOH HOH A . 
D 4 HOH 19  2019 2019 HOH HOH A . 
D 4 HOH 20  2020 2020 HOH HOH A . 
D 4 HOH 21  2021 2021 HOH HOH A . 
D 4 HOH 22  2022 2022 HOH HOH A . 
D 4 HOH 23  2023 2023 HOH HOH A . 
D 4 HOH 24  2024 2024 HOH HOH A . 
D 4 HOH 25  2025 2025 HOH HOH A . 
D 4 HOH 26  2026 2026 HOH HOH A . 
D 4 HOH 27  2027 2027 HOH HOH A . 
D 4 HOH 28  2028 2028 HOH HOH A . 
D 4 HOH 29  2029 2029 HOH HOH A . 
D 4 HOH 30  2030 2030 HOH HOH A . 
D 4 HOH 31  2031 2031 HOH HOH A . 
D 4 HOH 32  2032 2032 HOH HOH A . 
D 4 HOH 33  2033 2033 HOH HOH A . 
D 4 HOH 34  2034 2034 HOH HOH A . 
D 4 HOH 35  2035 2035 HOH HOH A . 
D 4 HOH 36  2036 2036 HOH HOH A . 
D 4 HOH 37  2037 2037 HOH HOH A . 
D 4 HOH 38  2038 2038 HOH HOH A . 
D 4 HOH 39  2039 2039 HOH HOH A . 
D 4 HOH 40  2040 2040 HOH HOH A . 
D 4 HOH 41  2041 2041 HOH HOH A . 
D 4 HOH 42  2042 2042 HOH HOH A . 
D 4 HOH 43  2043 2043 HOH HOH A . 
D 4 HOH 44  2044 2044 HOH HOH A . 
D 4 HOH 45  2045 2045 HOH HOH A . 
D 4 HOH 46  2046 2046 HOH HOH A . 
D 4 HOH 47  2047 2047 HOH HOH A . 
D 4 HOH 48  2048 2048 HOH HOH A . 
D 4 HOH 49  2049 2049 HOH HOH A . 
D 4 HOH 50  2050 2050 HOH HOH A . 
D 4 HOH 51  2051 2051 HOH HOH A . 
D 4 HOH 52  2052 2052 HOH HOH A . 
D 4 HOH 53  2053 2053 HOH HOH A . 
D 4 HOH 54  2054 2054 HOH HOH A . 
D 4 HOH 55  2055 2055 HOH HOH A . 
D 4 HOH 56  2056 2056 HOH HOH A . 
D 4 HOH 57  2057 2057 HOH HOH A . 
D 4 HOH 58  2058 2058 HOH HOH A . 
D 4 HOH 59  2059 2059 HOH HOH A . 
D 4 HOH 60  2060 2060 HOH HOH A . 
D 4 HOH 61  2061 2061 HOH HOH A . 
D 4 HOH 62  2062 2062 HOH HOH A . 
D 4 HOH 63  2063 2063 HOH HOH A . 
D 4 HOH 64  2064 2064 HOH HOH A . 
D 4 HOH 65  2065 2065 HOH HOH A . 
D 4 HOH 66  2066 2066 HOH HOH A . 
D 4 HOH 67  2067 2067 HOH HOH A . 
D 4 HOH 68  2068 2068 HOH HOH A . 
D 4 HOH 69  2069 2069 HOH HOH A . 
D 4 HOH 70  2070 2070 HOH HOH A . 
D 4 HOH 71  2071 2071 HOH HOH A . 
D 4 HOH 72  2072 2072 HOH HOH A . 
D 4 HOH 73  2073 2073 HOH HOH A . 
D 4 HOH 74  2074 2074 HOH HOH A . 
D 4 HOH 75  2075 2075 HOH HOH A . 
D 4 HOH 76  2076 2076 HOH HOH A . 
D 4 HOH 77  2077 2077 HOH HOH A . 
D 4 HOH 78  2078 2078 HOH HOH A . 
D 4 HOH 79  2079 2079 HOH HOH A . 
D 4 HOH 80  2080 2080 HOH HOH A . 
D 4 HOH 81  2081 2081 HOH HOH A . 
D 4 HOH 82  2082 2082 HOH HOH A . 
D 4 HOH 83  2083 2083 HOH HOH A . 
D 4 HOH 84  2084 2084 HOH HOH A . 
D 4 HOH 85  2085 2085 HOH HOH A . 
D 4 HOH 86  2086 2086 HOH HOH A . 
D 4 HOH 87  2087 2087 HOH HOH A . 
D 4 HOH 88  2088 2088 HOH HOH A . 
D 4 HOH 89  2089 2089 HOH HOH A . 
D 4 HOH 90  2090 2090 HOH HOH A . 
D 4 HOH 91  2091 2091 HOH HOH A . 
D 4 HOH 92  2092 2092 HOH HOH A . 
D 4 HOH 93  2093 2093 HOH HOH A . 
D 4 HOH 94  2094 2094 HOH HOH A . 
D 4 HOH 95  2095 2095 HOH HOH A . 
D 4 HOH 96  2096 2096 HOH HOH A . 
D 4 HOH 97  2097 2097 HOH HOH A . 
D 4 HOH 98  2098 2098 HOH HOH A . 
D 4 HOH 99  2099 2099 HOH HOH A . 
D 4 HOH 100 2100 2100 HOH HOH A . 
D 4 HOH 101 2101 2101 HOH HOH A . 
D 4 HOH 102 2102 2102 HOH HOH A . 
D 4 HOH 103 2103 2103 HOH HOH A . 
D 4 HOH 104 2104 2104 HOH HOH A . 
D 4 HOH 105 2105 2105 HOH HOH A . 
D 4 HOH 106 2106 2106 HOH HOH A . 
D 4 HOH 107 2107 2107 HOH HOH A . 
D 4 HOH 108 2108 2108 HOH HOH A . 
D 4 HOH 109 2109 2109 HOH HOH A . 
D 4 HOH 110 2110 2110 HOH HOH A . 
D 4 HOH 111 2111 2111 HOH HOH A . 
D 4 HOH 112 2112 2112 HOH HOH A . 
D 4 HOH 113 2113 2113 HOH HOH A . 
D 4 HOH 114 2114 2114 HOH HOH A . 
D 4 HOH 115 2115 2115 HOH HOH A . 
D 4 HOH 116 2116 2116 HOH HOH A . 
D 4 HOH 117 2117 2117 HOH HOH A . 
D 4 HOH 118 2118 2118 HOH HOH A . 
D 4 HOH 119 2119 2119 HOH HOH A . 
D 4 HOH 120 2120 2120 HOH HOH A . 
D 4 HOH 121 2121 2121 HOH HOH A . 
D 4 HOH 122 2122 2122 HOH HOH A . 
D 4 HOH 123 2123 2123 HOH HOH A . 
D 4 HOH 124 2124 2124 HOH HOH A . 
D 4 HOH 125 2125 2125 HOH HOH A . 
D 4 HOH 126 2126 2126 HOH HOH A . 
D 4 HOH 127 2127 2127 HOH HOH A . 
D 4 HOH 128 2128 2128 HOH HOH A . 
D 4 HOH 129 2129 2129 HOH HOH A . 
D 4 HOH 130 2130 2130 HOH HOH A . 
D 4 HOH 131 2131 2131 HOH HOH A . 
D 4 HOH 132 2132 2132 HOH HOH A . 
D 4 HOH 133 2133 2133 HOH HOH A . 
D 4 HOH 134 2134 2134 HOH HOH A . 
D 4 HOH 135 2135 2135 HOH HOH A . 
D 4 HOH 136 2136 2136 HOH HOH A . 
D 4 HOH 137 2137 2137 HOH HOH A . 
D 4 HOH 138 2138 2138 HOH HOH A . 
D 4 HOH 139 2139 2139 HOH HOH A . 
D 4 HOH 140 2140 2140 HOH HOH A . 
D 4 HOH 141 2141 2141 HOH HOH A . 
D 4 HOH 142 2142 2142 HOH HOH A . 
D 4 HOH 143 2143 2143 HOH HOH A . 
D 4 HOH 144 2144 2144 HOH HOH A . 
D 4 HOH 145 2145 2145 HOH HOH A . 
D 4 HOH 146 2146 2146 HOH HOH A . 
D 4 HOH 147 2147 2147 HOH HOH A . 
D 4 HOH 148 2148 2148 HOH HOH A . 
D 4 HOH 149 2149 2149 HOH HOH A . 
D 4 HOH 150 2150 2150 HOH HOH A . 
D 4 HOH 151 2151 2151 HOH HOH A . 
D 4 HOH 152 2152 2152 HOH HOH A . 
D 4 HOH 153 2153 2153 HOH HOH A . 
D 4 HOH 154 2154 2154 HOH HOH A . 
D 4 HOH 155 2155 2155 HOH HOH A . 
D 4 HOH 156 2156 2156 HOH HOH A . 
D 4 HOH 157 2157 2157 HOH HOH A . 
D 4 HOH 158 2158 2158 HOH HOH A . 
D 4 HOH 159 2159 2159 HOH HOH A . 
D 4 HOH 160 2160 2160 HOH HOH A . 
D 4 HOH 161 2161 2161 HOH HOH A . 
D 4 HOH 162 2162 2162 HOH HOH A . 
D 4 HOH 163 2163 2163 HOH HOH A . 
D 4 HOH 164 2164 2164 HOH HOH A . 
D 4 HOH 165 2165 2165 HOH HOH A . 
D 4 HOH 166 2166 2166 HOH HOH A . 
D 4 HOH 167 2167 2167 HOH HOH A . 
D 4 HOH 168 2168 2168 HOH HOH A . 
D 4 HOH 169 2169 2169 HOH HOH A . 
D 4 HOH 170 2170 2170 HOH HOH A . 
D 4 HOH 171 2171 2171 HOH HOH A . 
D 4 HOH 172 2172 2172 HOH HOH A . 
D 4 HOH 173 2173 2173 HOH HOH A . 
D 4 HOH 174 2174 2174 HOH HOH A . 
D 4 HOH 175 2175 2175 HOH HOH A . 
D 4 HOH 176 2176 2176 HOH HOH A . 
D 4 HOH 177 2177 2177 HOH HOH A . 
D 4 HOH 178 2178 2178 HOH HOH A . 
D 4 HOH 179 2179 2179 HOH HOH A . 
D 4 HOH 180 2180 2180 HOH HOH A . 
D 4 HOH 181 2181 2181 HOH HOH A . 
D 4 HOH 182 2182 2182 HOH HOH A . 
D 4 HOH 183 2183 2183 HOH HOH A . 
D 4 HOH 184 2184 2184 HOH HOH A . 
D 4 HOH 185 2185 2185 HOH HOH A . 
D 4 HOH 186 2186 2186 HOH HOH A . 
D 4 HOH 187 2187 2187 HOH HOH A . 
D 4 HOH 188 2188 2188 HOH HOH A . 
D 4 HOH 189 2189 2189 HOH HOH A . 
D 4 HOH 190 2190 2190 HOH HOH A . 
D 4 HOH 191 2191 2191 HOH HOH A . 
D 4 HOH 192 2192 2192 HOH HOH A . 
D 4 HOH 193 2193 2193 HOH HOH A . 
D 4 HOH 194 2194 2194 HOH HOH A . 
D 4 HOH 195 2195 2195 HOH HOH A . 
D 4 HOH 196 2196 2196 HOH HOH A . 
D 4 HOH 197 2197 2197 HOH HOH A . 
D 4 HOH 198 2198 2198 HOH HOH A . 
D 4 HOH 199 2199 2199 HOH HOH A . 
D 4 HOH 200 2200 2200 HOH HOH A . 
D 4 HOH 201 2201 2201 HOH HOH A . 
D 4 HOH 202 2202 2202 HOH HOH A . 
D 4 HOH 203 2203 2203 HOH HOH A . 
D 4 HOH 204 2204 2204 HOH HOH A . 
D 4 HOH 205 2205 2205 HOH HOH A . 
D 4 HOH 206 2206 2206 HOH HOH A . 
D 4 HOH 207 2207 2207 HOH HOH A . 
D 4 HOH 208 2208 2208 HOH HOH A . 
D 4 HOH 209 2209 2209 HOH HOH A . 
D 4 HOH 210 2210 2210 HOH HOH A . 
D 4 HOH 211 2211 2211 HOH HOH A . 
D 4 HOH 212 2212 2212 HOH HOH A . 
D 4 HOH 213 2213 2213 HOH HOH A . 
D 4 HOH 214 2214 2214 HOH HOH A . 
D 4 HOH 215 2215 2215 HOH HOH A . 
D 4 HOH 216 2216 2216 HOH HOH A . 
D 4 HOH 217 2217 2217 HOH HOH A . 
D 4 HOH 218 2218 2218 HOH HOH A . 
D 4 HOH 219 2219 2219 HOH HOH A . 
D 4 HOH 220 2220 2220 HOH HOH A . 
D 4 HOH 221 2221 2221 HOH HOH A . 
D 4 HOH 222 2222 2222 HOH HOH A . 
D 4 HOH 223 2223 2223 HOH HOH A . 
D 4 HOH 224 2224 2224 HOH HOH A . 
D 4 HOH 225 2225 2225 HOH HOH A . 
D 4 HOH 226 2226 2226 HOH HOH A . 
D 4 HOH 227 2227 2227 HOH HOH A . 
D 4 HOH 228 2228 2228 HOH HOH A . 
D 4 HOH 229 2229 2229 HOH HOH A . 
D 4 HOH 230 2230 2230 HOH HOH A . 
D 4 HOH 231 2231 2231 HOH HOH A . 
D 4 HOH 232 2232 2232 HOH HOH A . 
D 4 HOH 233 2233 2233 HOH HOH A . 
D 4 HOH 234 2234 2234 HOH HOH A . 
D 4 HOH 235 2235 2235 HOH HOH A . 
D 4 HOH 236 2236 2236 HOH HOH A . 
D 4 HOH 237 2237 2237 HOH HOH A . 
D 4 HOH 238 2238 2238 HOH HOH A . 
D 4 HOH 239 2239 2239 HOH HOH A . 
D 4 HOH 240 2240 2240 HOH HOH A . 
D 4 HOH 241 2241 2241 HOH HOH A . 
D 4 HOH 242 2242 2242 HOH HOH A . 
D 4 HOH 243 2243 2243 HOH HOH A . 
D 4 HOH 244 2244 2244 HOH HOH A . 
D 4 HOH 245 2245 2245 HOH HOH A . 
D 4 HOH 246 2246 2246 HOH HOH A . 
D 4 HOH 247 2247 2247 HOH HOH A . 
D 4 HOH 248 2248 2248 HOH HOH A . 
D 4 HOH 249 2249 2249 HOH HOH A . 
D 4 HOH 250 2250 2250 HOH HOH A . 
D 4 HOH 251 2251 2251 HOH HOH A . 
D 4 HOH 252 2252 2252 HOH HOH A . 
D 4 HOH 253 2253 2253 HOH HOH A . 
D 4 HOH 254 2254 2254 HOH HOH A . 
E 4 HOH 1   2001 2001 HOH HOH B . 
E 4 HOH 2   2002 2002 HOH HOH B . 
E 4 HOH 3   2004 2004 HOH HOH B . 
E 4 HOH 4   2005 2005 HOH HOH B . 
E 4 HOH 5   2006 2006 HOH HOH B . 
E 4 HOH 6   2007 2007 HOH HOH B . 
E 4 HOH 7   2008 2008 HOH HOH B . 
E 4 HOH 8   2009 2009 HOH HOH B . 
E 4 HOH 9   2010 2010 HOH HOH B . 
E 4 HOH 10  2011 2011 HOH HOH B . 
E 4 HOH 11  2012 2012 HOH HOH B . 
E 4 HOH 12  2016 2016 HOH HOH B . 
E 4 HOH 13  2018 2018 HOH HOH B . 
E 4 HOH 14  2019 2019 HOH HOH B . 
E 4 HOH 15  2020 2020 HOH HOH B . 
E 4 HOH 16  2021 2021 HOH HOH B . 
E 4 HOH 17  2022 2022 HOH HOH B . 
E 4 HOH 18  2023 2023 HOH HOH B . 
E 4 HOH 19  2024 2024 HOH HOH B . 
E 4 HOH 20  2025 2025 HOH HOH B . 
E 4 HOH 21  2026 2026 HOH HOH B . 
E 4 HOH 22  2027 2027 HOH HOH B . 
E 4 HOH 23  2028 2028 HOH HOH B . 
E 4 HOH 24  2029 2029 HOH HOH B . 
E 4 HOH 25  2030 2030 HOH HOH B . 
E 4 HOH 26  2032 2032 HOH HOH B . 
E 4 HOH 27  2033 2033 HOH HOH B . 
E 4 HOH 28  2034 2034 HOH HOH B . 
E 4 HOH 29  2035 2035 HOH HOH B . 
E 4 HOH 30  2036 2036 HOH HOH B . 
E 4 HOH 31  2037 2037 HOH HOH B . 
E 4 HOH 32  2038 2038 HOH HOH B . 
E 4 HOH 33  2039 2039 HOH HOH B . 
E 4 HOH 34  2040 2040 HOH HOH B . 
E 4 HOH 35  2041 2041 HOH HOH B . 
E 4 HOH 36  2042 2042 HOH HOH B . 
E 4 HOH 37  2043 2043 HOH HOH B . 
E 4 HOH 38  2044 2044 HOH HOH B . 
E 4 HOH 39  2045 2045 HOH HOH B . 
E 4 HOH 40  2046 2046 HOH HOH B . 
E 4 HOH 41  2047 2047 HOH HOH B . 
E 4 HOH 42  2048 2048 HOH HOH B . 
E 4 HOH 43  2049 2049 HOH HOH B . 
E 4 HOH 44  2050 2050 HOH HOH B . 
E 4 HOH 45  2051 2051 HOH HOH B . 
E 4 HOH 46  2052 2052 HOH HOH B . 
E 4 HOH 47  2053 2053 HOH HOH B . 
E 4 HOH 48  2054 2054 HOH HOH B . 
E 4 HOH 49  2055 2055 HOH HOH B . 
E 4 HOH 50  2056 2056 HOH HOH B . 
E 4 HOH 51  2057 2057 HOH HOH B . 
E 4 HOH 52  2058 2058 HOH HOH B . 
E 4 HOH 53  2059 2059 HOH HOH B . 
E 4 HOH 54  2060 2060 HOH HOH B . 
E 4 HOH 55  2061 2061 HOH HOH B . 
E 4 HOH 56  2062 2062 HOH HOH B . 
E 4 HOH 57  2063 2063 HOH HOH B . 
E 4 HOH 58  2064 2064 HOH HOH B . 
E 4 HOH 59  2065 2065 HOH HOH B . 
E 4 HOH 60  2066 2066 HOH HOH B . 
E 4 HOH 61  2067 2067 HOH HOH B . 
E 4 HOH 62  2068 2068 HOH HOH B . 
E 4 HOH 63  2069 2069 HOH HOH B . 
E 4 HOH 64  2070 2070 HOH HOH B . 
E 4 HOH 65  2071 2071 HOH HOH B . 
E 4 HOH 66  2072 2072 HOH HOH B . 
E 4 HOH 67  2073 2073 HOH HOH B . 
E 4 HOH 68  2074 2074 HOH HOH B . 
E 4 HOH 69  2075 2075 HOH HOH B . 
E 4 HOH 70  2076 2076 HOH HOH B . 
E 4 HOH 71  2077 2077 HOH HOH B . 
E 4 HOH 72  2078 2078 HOH HOH B . 
E 4 HOH 73  2079 2079 HOH HOH B . 
E 4 HOH 74  2080 2080 HOH HOH B . 
E 4 HOH 75  2081 2081 HOH HOH B . 
E 4 HOH 76  2082 2082 HOH HOH B . 
E 4 HOH 77  2083 2083 HOH HOH B . 
E 4 HOH 78  2084 2084 HOH HOH B . 
E 4 HOH 79  2085 2085 HOH HOH B . 
E 4 HOH 80  2086 2086 HOH HOH B . 
E 4 HOH 81  2087 2087 HOH HOH B . 
E 4 HOH 82  2088 2088 HOH HOH B . 
E 4 HOH 83  2089 2089 HOH HOH B . 
E 4 HOH 84  2090 2090 HOH HOH B . 
E 4 HOH 85  2091 2091 HOH HOH B . 
E 4 HOH 86  2092 2092 HOH HOH B . 
E 4 HOH 87  2093 2093 HOH HOH B . 
E 4 HOH 88  2094 2094 HOH HOH B . 
E 4 HOH 89  2095 2095 HOH HOH B . 
E 4 HOH 90  2096 2096 HOH HOH B . 
E 4 HOH 91  2097 2097 HOH HOH B . 
E 4 HOH 92  2098 2098 HOH HOH B . 
E 4 HOH 93  2099 2099 HOH HOH B . 
E 4 HOH 94  2100 2100 HOH HOH B . 
E 4 HOH 95  2101 2101 HOH HOH B . 
E 4 HOH 96  2102 2102 HOH HOH B . 
E 4 HOH 97  2103 2103 HOH HOH B . 
E 4 HOH 98  2104 2104 HOH HOH B . 
E 4 HOH 99  2105 2105 HOH HOH B . 
E 4 HOH 100 2106 2106 HOH HOH B . 
E 4 HOH 101 2107 2107 HOH HOH B . 
E 4 HOH 102 2108 2108 HOH HOH B . 
E 4 HOH 103 2109 2109 HOH HOH B . 
E 4 HOH 104 2110 2110 HOH HOH B . 
E 4 HOH 105 2111 2111 HOH HOH B . 
E 4 HOH 106 2112 2112 HOH HOH B . 
E 4 HOH 107 2113 2113 HOH HOH B . 
E 4 HOH 108 2114 2114 HOH HOH B . 
E 4 HOH 109 2115 2115 HOH HOH B . 
E 4 HOH 110 2116 2116 HOH HOH B . 
E 4 HOH 111 2117 2117 HOH HOH B . 
E 4 HOH 112 2118 2118 HOH HOH B . 
E 4 HOH 113 2119 2119 HOH HOH B . 
E 4 HOH 114 2120 2120 HOH HOH B . 
E 4 HOH 115 2121 2121 HOH HOH B . 
E 4 HOH 116 2122 2122 HOH HOH B . 
E 4 HOH 117 2123 2123 HOH HOH B . 
E 4 HOH 118 2124 2124 HOH HOH B . 
E 4 HOH 119 2125 2125 HOH HOH B . 
E 4 HOH 120 2126 2126 HOH HOH B . 
E 4 HOH 121 2127 2127 HOH HOH B . 
E 4 HOH 122 2128 2128 HOH HOH B . 
E 4 HOH 123 2129 2129 HOH HOH B . 
E 4 HOH 124 2130 2130 HOH HOH B . 
E 4 HOH 125 2131 2131 HOH HOH B . 
E 4 HOH 126 2132 2132 HOH HOH B . 
E 4 HOH 127 2133 2133 HOH HOH B . 
E 4 HOH 128 2134 2134 HOH HOH B . 
E 4 HOH 129 2135 2135 HOH HOH B . 
E 4 HOH 130 2136 2136 HOH HOH B . 
E 4 HOH 131 2137 2137 HOH HOH B . 
E 4 HOH 132 2138 2138 HOH HOH B . 
E 4 HOH 133 2139 2139 HOH HOH B . 
E 4 HOH 134 2140 2140 HOH HOH B . 
E 4 HOH 135 2141 2141 HOH HOH B . 
E 4 HOH 136 2142 2142 HOH HOH B . 
E 4 HOH 137 2143 2143 HOH HOH B . 
E 4 HOH 138 2144 2144 HOH HOH B . 
E 4 HOH 139 2145 2145 HOH HOH B . 
E 4 HOH 140 2146 2146 HOH HOH B . 
E 4 HOH 141 2147 2147 HOH HOH B . 
E 4 HOH 142 2224 2224 HOH HOH B . 
F 4 HOH 1   2001 2001 HOH HOH I . 
F 4 HOH 2   2002 2002 HOH HOH I . 
F 4 HOH 3   2003 2003 HOH HOH I . 
F 4 HOH 4   2004 2004 HOH HOH I . 
F 4 HOH 5   2005 2005 HOH HOH I . 
F 4 HOH 6   2006 2006 HOH HOH I . 
F 4 HOH 7   2007 2007 HOH HOH I . 
# 
_pdbx_molecule_features.prd_id    PRD_000673 
_pdbx_molecule_features.name      CBZ-ASP-GLU-VAL-azaASP-EP-COO-CH2PH 
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     'Enzyme inhibitor' 
_pdbx_molecule_features.details   ? 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_000673 
_pdbx_molecule.asym_id       C 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PQS 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 3_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 66.7840000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 96.4530000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-05-22 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-11-30 
4 'Structure model' 1 3 2017-02-08 
5 'Structure model' 1 4 2017-06-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Atomic model'              
2 2 'Structure model' 'Database references'       
3 2 'Structure model' 'Derived calculations'      
4 2 'Structure model' 'Non-polymer description'   
5 2 'Structure model' 'Structure summary'         
6 2 'Structure model' 'Version format compliance' 
7 3 'Structure model' Other                       
8 4 'Structure model' 'Source and taxonomy'       
9 5 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    5 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS    refinement       1.1 ? 1 
MOSFLM 'data reduction' .   ? 2 
SCALA  'data scaling'   .   ? 3 
# 
_pdbx_entry_details.entry_id             2CNK 
_pdbx_entry_details.compound_details     
;THE STARTING INHIBITOR COMPOUND AZA-PEPTIDE EPOXIDE CBZ-DEV-AZAASP-
EPCOOCH2PH BINDS TO ACTIVE SITE CYSTEINE CYS 163 RESULTING IN A
COVALENT THIOETHER BOND AND OXIRANE RING OPENING. THE INHIBITOR IS
INVOLVED IN THE ACTIVATION CASCADE OF CASPASES RESPONSIBLE FOR
APOPTOSIS EXECUTION.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2006 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2006 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_655 
_pdbx_validate_symm_contact.dist              2.05 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 64  ? ? -100.16 76.28   
2 1 SER A 120 ? ? -173.79 -175.94 
3 1 LYS B 229 ? ? -136.05 -35.00  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 2060 ? 5.98 . 
2 1 O ? B HOH 2001 ? 6.06 . 
3 1 O ? B HOH 2004 ? 6.29 . 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     ASP 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      175 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    ASP 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     147 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#