data_2COB
# 
_entry.id   2COB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2COB         
RCSB  RCSB024443   
WWPDB D_1000024443 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          hsk002001763.1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2COB 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-17 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nameki, N.'                                             1 
'Umehara, T.'                                            2 
'Sato, M.'                                               3 
'Koshiba, S.'                                            4 
'Inoue, M.'                                              5 
'Tanaka, A.'                                             6 
'Kigawa, T.'                                             7 
'Yokoyama, S.'                                           8 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 
# 
_citation.id                        primary 
_citation.title                     'Solution structures of the HTH domain of human LCoR protein' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nameki, N.'   1 
primary 'Umehara, T.'  2 
primary 'Sato, M.'     3 
primary 'Koshiba, S.'  4 
primary 'Inoue, M.'    5 
primary 'Tanaka, A.'   6 
primary 'Kigawa, T.'   7 
primary 'Yokoyama, S.' 8 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'LCoR protein' 
_entity.formula_weight             7820.126 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'HTH domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'novel protein, likely ortholog of mouse transcription factor MLR2, MLR2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSSGSSGRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMR 
_entity_poly.pdbx_seq_one_letter_code_can   GSSGSSGRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMR 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         hsk002001763.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  ARG n 
1 9  GLY n 
1 10 ARG n 
1 11 TYR n 
1 12 ARG n 
1 13 GLN n 
1 14 TYR n 
1 15 ASN n 
1 16 SER n 
1 17 GLU n 
1 18 ILE n 
1 19 LEU n 
1 20 GLU n 
1 21 GLU n 
1 22 ALA n 
1 23 ILE n 
1 24 SER n 
1 25 VAL n 
1 26 VAL n 
1 27 MET n 
1 28 SER n 
1 29 GLY n 
1 30 LYS n 
1 31 MET n 
1 32 SER n 
1 33 VAL n 
1 34 SER n 
1 35 LYS n 
1 36 ALA n 
1 37 GLN n 
1 38 SER n 
1 39 ILE n 
1 40 TYR n 
1 41 GLY n 
1 42 ILE n 
1 43 PRO n 
1 44 HIS n 
1 45 SER n 
1 46 THR n 
1 47 LEU n 
1 48 GLU n 
1 49 TYR n 
1 50 LYS n 
1 51 VAL n 
1 52 LYS n 
1 53 GLU n 
1 54 ARG n 
1 55 LEU n 
1 56 GLY n 
1 57 THR n 
1 58 LEU n 
1 59 LYS n 
1 60 ASN n 
1 61 PRO n 
1 62 PRO n 
1 63 LYS n 
1 64 LYS n 
1 65 LYS n 
1 66 MET n 
1 67 LYS n 
1 68 LEU n 
1 69 MET n 
1 70 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 MLR2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       P040816-15 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'cell-free protein synthesis' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q5VW16_HUMAN 
_struct_ref.pdbx_db_accession          Q5VW16 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMR 
_struct_ref.pdbx_align_begin           343 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2COB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 8 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 70 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q5VW16 
_struct_ref_seq.db_align_beg                  343 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  405 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       8 
_struct_ref_seq.pdbx_auth_seq_align_end       70 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2COB GLY A 1 ? UNP Q5VW16 ? ? 'CLONING ARTIFACT' 1 1 
1 2COB SER A 2 ? UNP Q5VW16 ? ? 'CLONING ARTIFACT' 2 2 
1 2COB SER A 3 ? UNP Q5VW16 ? ? 'CLONING ARTIFACT' 3 3 
1 2COB GLY A 4 ? UNP Q5VW16 ? ? 'CLONING ARTIFACT' 4 4 
1 2COB SER A 5 ? UNP Q5VW16 ? ? 'CLONING ARTIFACT' 5 5 
1 2COB SER A 6 ? UNP Q5VW16 ? ? 'CLONING ARTIFACT' 6 6 
1 2COB GLY A 7 ? UNP Q5VW16 ? ? 'CLONING ARTIFACT' 7 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_15N-separated_NOESY 1 
2 1 3D_13C-separated_NOESY 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         296 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      120mM 
_pdbx_nmr_exptl_sample_conditions.pressure_units      . 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
'1.0mM HTH domain U-15N,13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 10% D2O' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2COB 
_pdbx_nmr_refine.method             'torsion angle dynamics, restrained molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2COB 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'target function,structures with the lowest energy,structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2COB 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XWINNMR 2.6      Bruker                                1 
processing           NMRPipe 20030801 'Delaglio, F.'                        2 
'data analysis'      NMRView 5.0.4    'Johnson, B.A.'                       3 
'data analysis'      Kujira  0.9295   'Kobayashi, N.'                       4 
'structure solution' CYANA   1.0.7    'Guntert, P.'                         5 
refinement           OPALp   1.2      'Koradi, R.,Billeter, M.,Guntert, P.' 6 
# 
_exptl.entry_id          2COB 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2COB 
_struct.title                     'Solution structures of the HTH domain of human LCoR protein' 
_struct.pdbx_descriptor           'LCoR protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2COB 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            
;MLR2, KIAA1795, helix-turn-helix, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 15 ? SER A 28 ? ASN A 15 SER A 28 1 ? 14 
HELX_P HELX_P2 2 SER A 32 ? GLY A 41 ? SER A 32 GLY A 41 1 ? 10 
HELX_P HELX_P3 3 PRO A 43 ? LEU A 55 ? PRO A 43 LEU A 55 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          2COB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2COB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? -21.708 -8.697  -19.659 1.00 0.00 ? 1  GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? -21.428 -7.542  -18.801 1.00 0.00 ? 1  GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? -21.184 -7.974  -17.368 1.00 0.00 ? 1  GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? -21.266 -9.161  -17.042 1.00 0.00 ? 1  GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? -22.453 -9.286  -19.345 1.00 0.00 ? 1  GLY A H1   1  
ATOM 6     H HA2  . GLY A 1 1  ? -20.550 -7.021  -19.179 1.00 0.00 ? 1  GLY A HA2  1  
ATOM 7     H HA3  . GLY A 1 1  ? -22.289 -6.876  -18.823 1.00 0.00 ? 1  GLY A HA3  1  
ATOM 8     N N    . SER A 1 2  ? -20.920 -6.996  -16.498 1.00 0.00 ? 2  SER A N    1  
ATOM 9     C CA   . SER A 1 2  ? -20.583 -7.213  -15.097 1.00 0.00 ? 2  SER A CA   1  
ATOM 10    C C    . SER A 1 2  ? -19.441 -8.232  -14.940 1.00 0.00 ? 2  SER A C    1  
ATOM 11    O O    . SER A 1 2  ? -18.510 -8.204  -15.752 1.00 0.00 ? 2  SER A O    1  
ATOM 12    C CB   . SER A 1 2  ? -21.868 -7.531  -14.318 1.00 0.00 ? 2  SER A CB   1  
ATOM 13    O OG   . SER A 1 2  ? -22.730 -6.408  -14.309 1.00 0.00 ? 2  SER A OG   1  
ATOM 14    H H    . SER A 1 2  ? -20.976 -6.036  -16.812 1.00 0.00 ? 2  SER A H    1  
ATOM 15    H HA   . SER A 1 2  ? -20.189 -6.275  -14.713 1.00 0.00 ? 2  SER A HA   1  
ATOM 16    H HB2  . SER A 1 2  ? -22.365 -8.387  -14.762 1.00 0.00 ? 2  SER A HB2  1  
ATOM 17    H HB3  . SER A 1 2  ? -21.634 -7.782  -13.289 1.00 0.00 ? 2  SER A HB3  1  
ATOM 18    H HG   . SER A 1 2  ? -22.282 -5.744  -13.749 1.00 0.00 ? 2  SER A HG   1  
ATOM 19    N N    . SER A 1 3  ? -19.482 -9.022  -13.862 1.00 0.00 ? 3  SER A N    1  
ATOM 20    C CA   . SER A 1 3  ? -18.485 -9.909  -13.272 1.00 0.00 ? 3  SER A CA   1  
ATOM 21    C C    . SER A 1 3  ? -17.850 -9.203  -12.071 1.00 0.00 ? 3  SER A C    1  
ATOM 22    O O    . SER A 1 3  ? -17.742 -7.971  -12.039 1.00 0.00 ? 3  SER A O    1  
ATOM 23    C CB   . SER A 1 3  ? -17.420 -10.415 -14.256 1.00 0.00 ? 3  SER A CB   1  
ATOM 24    O OG   . SER A 1 3  ? -18.030 -11.141 -15.310 1.00 0.00 ? 3  SER A OG   1  
ATOM 25    H H    . SER A 1 3  ? -20.300 -8.955  -13.272 1.00 0.00 ? 3  SER A H    1  
ATOM 26    H HA   . SER A 1 3  ? -19.027 -10.774 -12.895 1.00 0.00 ? 3  SER A HA   1  
ATOM 27    H HB2  . SER A 1 3  ? -16.848 -9.579  -14.653 1.00 0.00 ? 3  SER A HB2  1  
ATOM 28    H HB3  . SER A 1 3  ? -16.734 -11.077 -13.726 1.00 0.00 ? 3  SER A HB3  1  
ATOM 29    H HG   . SER A 1 3  ? -18.428 -11.940 -14.901 1.00 0.00 ? 3  SER A HG   1  
ATOM 30    N N    . GLY A 1 4  ? -17.442 -10.005 -11.090 1.00 0.00 ? 4  GLY A N    1  
ATOM 31    C CA   . GLY A 1 4  ? -17.004 -9.587  -9.771  1.00 0.00 ? 4  GLY A CA   1  
ATOM 32    C C    . GLY A 1 4  ? -17.870 -10.267 -8.711  1.00 0.00 ? 4  GLY A C    1  
ATOM 33    O O    . GLY A 1 4  ? -18.975 -10.737 -8.996  1.00 0.00 ? 4  GLY A O    1  
ATOM 34    H H    . GLY A 1 4  ? -17.618 -11.001 -11.190 1.00 0.00 ? 4  GLY A H    1  
ATOM 35    H HA2  . GLY A 1 4  ? -15.958 -9.855  -9.634  1.00 0.00 ? 4  GLY A HA2  1  
ATOM 36    H HA3  . GLY A 1 4  ? -17.110 -8.507  -9.673  1.00 0.00 ? 4  GLY A HA3  1  
ATOM 37    N N    . SER A 1 5  ? -17.384 -10.321 -7.474  1.00 0.00 ? 5  SER A N    1  
ATOM 38    C CA   . SER A 1 5  ? -18.139 -10.633 -6.268  1.00 0.00 ? 5  SER A CA   1  
ATOM 39    C C    . SER A 1 5  ? -17.243 -10.227 -5.102  1.00 0.00 ? 5  SER A C    1  
ATOM 40    O O    . SER A 1 5  ? -16.453 -11.047 -4.628  1.00 0.00 ? 5  SER A O    1  
ATOM 41    C CB   . SER A 1 5  ? -18.492 -12.130 -6.164  1.00 0.00 ? 5  SER A CB   1  
ATOM 42    O OG   . SER A 1 5  ? -19.539 -12.496 -7.048  1.00 0.00 ? 5  SER A OG   1  
ATOM 43    H H    . SER A 1 5  ? -16.446 -9.970  -7.323  1.00 0.00 ? 5  SER A H    1  
ATOM 44    H HA   . SER A 1 5  ? -19.057 -10.043 -6.245  1.00 0.00 ? 5  SER A HA   1  
ATOM 45    H HB2  . SER A 1 5  ? -17.607 -12.728 -6.377  1.00 0.00 ? 5  SER A HB2  1  
ATOM 46    H HB3  . SER A 1 5  ? -18.809 -12.342 -5.141  1.00 0.00 ? 5  SER A HB3  1  
ATOM 47    H HG   . SER A 1 5  ? -19.344 -12.032 -7.887  1.00 0.00 ? 5  SER A HG   1  
ATOM 48    N N    . SER A 1 6  ? -17.326 -8.977  -4.647  1.00 0.00 ? 6  SER A N    1  
ATOM 49    C CA   . SER A 1 6  ? -16.587 -8.517  -3.475  1.00 0.00 ? 6  SER A CA   1  
ATOM 50    C C    . SER A 1 6  ? -17.530 -7.865  -2.463  1.00 0.00 ? 6  SER A C    1  
ATOM 51    O O    . SER A 1 6  ? -18.656 -7.497  -2.805  1.00 0.00 ? 6  SER A O    1  
ATOM 52    C CB   . SER A 1 6  ? -15.408 -7.625  -3.895  1.00 0.00 ? 6  SER A CB   1  
ATOM 53    O OG   . SER A 1 6  ? -15.798 -6.556  -4.741  1.00 0.00 ? 6  SER A OG   1  
ATOM 54    H H    . SER A 1 6  ? -17.973 -8.314  -5.061  1.00 0.00 ? 6  SER A H    1  
ATOM 55    H HA   . SER A 1 6  ? -16.157 -9.379  -2.981  1.00 0.00 ? 6  SER A HA   1  
ATOM 56    H HB2  . SER A 1 6  ? -14.929 -7.217  -3.002  1.00 0.00 ? 6  SER A HB2  1  
ATOM 57    H HB3  . SER A 1 6  ? -14.684 -8.240  -4.434  1.00 0.00 ? 6  SER A HB3  1  
ATOM 58    H HG   . SER A 1 6  ? -16.092 -6.934  -5.591  1.00 0.00 ? 6  SER A HG   1  
ATOM 59    N N    . GLY A 1 7  ? -17.080 -7.737  -1.216  1.00 0.00 ? 7  GLY A N    1  
ATOM 60    C CA   . GLY A 1 7  ? -17.738 -6.959  -0.177  1.00 0.00 ? 7  GLY A CA   1  
ATOM 61    C C    . GLY A 1 7  ? -17.924 -7.760  1.106   1.00 0.00 ? 7  GLY A C    1  
ATOM 62    O O    . GLY A 1 7  ? -18.023 -8.988  1.075   1.00 0.00 ? 7  GLY A O    1  
ATOM 63    H H    . GLY A 1 7  ? -16.212 -8.200  -0.960  1.00 0.00 ? 7  GLY A H    1  
ATOM 64    H HA2  . GLY A 1 7  ? -17.131 -6.079  0.023   1.00 0.00 ? 7  GLY A HA2  1  
ATOM 65    H HA3  . GLY A 1 7  ? -18.720 -6.630  -0.518  1.00 0.00 ? 7  GLY A HA3  1  
ATOM 66    N N    . ARG A 1 8  ? -18.068 -7.036  2.222   1.00 0.00 ? 8  ARG A N    1  
ATOM 67    C CA   . ARG A 1 8  ? -18.195 -7.534  3.592   1.00 0.00 ? 8  ARG A CA   1  
ATOM 68    C C    . ARG A 1 8  ? -17.142 -8.601  3.900   1.00 0.00 ? 8  ARG A C    1  
ATOM 69    O O    . ARG A 1 8  ? -17.442 -9.798  3.991   1.00 0.00 ? 8  ARG A O    1  
ATOM 70    C CB   . ARG A 1 8  ? -19.650 -7.949  3.888   1.00 0.00 ? 8  ARG A CB   1  
ATOM 71    C CG   . ARG A 1 8  ? -19.966 -8.144  5.383   1.00 0.00 ? 8  ARG A CG   1  
ATOM 72    C CD   . ARG A 1 8  ? -20.288 -6.843  6.141   1.00 0.00 ? 8  ARG A CD   1  
ATOM 73    N NE   . ARG A 1 8  ? -19.143 -5.923  6.229   1.00 0.00 ? 8  ARG A NE   1  
ATOM 74    C CZ   . ARG A 1 8  ? -18.128 -5.973  7.097   1.00 0.00 ? 8  ARG A CZ   1  
ATOM 75    N NH1  . ARG A 1 8  ? -18.124 -6.814  8.122   1.00 0.00 ? 8  ARG A NH1  1  
ATOM 76    N NH2  . ARG A 1 8  ? -17.082 -5.185  6.915   1.00 0.00 ? 8  ARG A NH2  1  
ATOM 77    H H    . ARG A 1 8  ? -17.960 -6.035  2.129   1.00 0.00 ? 8  ARG A H    1  
ATOM 78    H HA   . ARG A 1 8  ? -17.956 -6.683  4.221   1.00 0.00 ? 8  ARG A HA   1  
ATOM 79    H HB2  . ARG A 1 8  ? -20.332 -7.202  3.486   1.00 0.00 ? 8  ARG A HB2  1  
ATOM 80    H HB3  . ARG A 1 8  ? -19.857 -8.880  3.364   1.00 0.00 ? 8  ARG A HB3  1  
ATOM 81    H HG2  . ARG A 1 8  ? -20.847 -8.781  5.455   1.00 0.00 ? 8  ARG A HG2  1  
ATOM 82    H HG3  . ARG A 1 8  ? -19.145 -8.667  5.874   1.00 0.00 ? 8  ARG A HG3  1  
ATOM 83    H HD2  . ARG A 1 8  ? -21.110 -6.333  5.639   1.00 0.00 ? 8  ARG A HD2  1  
ATOM 84    H HD3  . ARG A 1 8  ? -20.624 -7.099  7.145   1.00 0.00 ? 8  ARG A HD3  1  
ATOM 85    H HE   . ARG A 1 8  ? -19.107 -5.198  5.522   1.00 0.00 ? 8  ARG A HE   1  
ATOM 86    H HH11 . ARG A 1 8  ? -18.894 -7.458  8.295   1.00 0.00 ? 8  ARG A HH11 1  
ATOM 87    H HH12 . ARG A 1 8  ? -17.327 -6.810  8.757   1.00 0.00 ? 8  ARG A HH12 1  
ATOM 88    H HH21 . ARG A 1 8  ? -17.031 -4.557  6.112   1.00 0.00 ? 8  ARG A HH21 1  
ATOM 89    H HH22 . ARG A 1 8  ? -16.277 -5.263  7.536   1.00 0.00 ? 8  ARG A HH22 1  
ATOM 90    N N    . GLY A 1 9  ? -15.907 -8.129  4.079   1.00 0.00 ? 9  GLY A N    1  
ATOM 91    C CA   . GLY A 1 9  ? -14.706 -8.944  4.115   1.00 0.00 ? 9  GLY A CA   1  
ATOM 92    C C    . GLY A 1 9  ? -14.725 -9.866  2.908   1.00 0.00 ? 9  GLY A C    1  
ATOM 93    O O    . GLY A 1 9  ? -14.746 -9.376  1.783   1.00 0.00 ? 9  GLY A O    1  
ATOM 94    H H    . GLY A 1 9  ? -15.763 -7.129  3.980   1.00 0.00 ? 9  GLY A H    1  
ATOM 95    H HA2  . GLY A 1 9  ? -13.828 -8.300  4.062   1.00 0.00 ? 9  GLY A HA2  1  
ATOM 96    H HA3  . GLY A 1 9  ? -14.675 -9.519  5.038   1.00 0.00 ? 9  GLY A HA3  1  
ATOM 97    N N    . ARG A 1 10 ? -14.815 -11.173 3.169   1.00 0.00 ? 10 ARG A N    1  
ATOM 98    C CA   . ARG A 1 10 ? -14.906 -12.261 2.202   1.00 0.00 ? 10 ARG A CA   1  
ATOM 99    C C    . ARG A 1 10 ? -13.684 -12.287 1.300   1.00 0.00 ? 10 ARG A C    1  
ATOM 100   O O    . ARG A 1 10 ? -13.580 -11.506 0.357   1.00 0.00 ? 10 ARG A O    1  
ATOM 101   C CB   . ARG A 1 10 ? -16.231 -12.222 1.426   1.00 0.00 ? 10 ARG A CB   1  
ATOM 102   C CG   . ARG A 1 10 ? -16.587 -13.624 0.905   1.00 0.00 ? 10 ARG A CG   1  
ATOM 103   C CD   . ARG A 1 10 ? -18.103 -13.810 0.833   1.00 0.00 ? 10 ARG A CD   1  
ATOM 104   N NE   . ARG A 1 10 ? -18.466 -15.235 0.752   1.00 0.00 ? 10 ARG A NE   1  
ATOM 105   C CZ   . ARG A 1 10 ? -18.743 -16.021 1.801   1.00 0.00 ? 10 ARG A CZ   1  
ATOM 106   N NH1  . ARG A 1 10 ? -18.661 -15.546 3.043   1.00 0.00 ? 10 ARG A NH1  1  
ATOM 107   N NH2  . ARG A 1 10 ? -19.108 -17.285 1.606   1.00 0.00 ? 10 ARG A NH2  1  
ATOM 108   H H    . ARG A 1 10 ? -14.762 -11.444 4.144   1.00 0.00 ? 10 ARG A H    1  
ATOM 109   H HA   . ARG A 1 10 ? -14.904 -13.173 2.796   1.00 0.00 ? 10 ARG A HA   1  
ATOM 110   H HB2  . ARG A 1 10 ? -17.013 -11.870 2.093   1.00 0.00 ? 10 ARG A HB2  1  
ATOM 111   H HB3  . ARG A 1 10 ? -16.173 -11.519 0.595   1.00 0.00 ? 10 ARG A HB3  1  
ATOM 112   H HG2  . ARG A 1 10 ? -16.137 -13.784 -0.075  1.00 0.00 ? 10 ARG A HG2  1  
ATOM 113   H HG3  . ARG A 1 10 ? -16.191 -14.378 1.582   1.00 0.00 ? 10 ARG A HG3  1  
ATOM 114   H HD2  . ARG A 1 10 ? -18.571 -13.380 1.716   1.00 0.00 ? 10 ARG A HD2  1  
ATOM 115   H HD3  . ARG A 1 10 ? -18.491 -13.266 -0.023  1.00 0.00 ? 10 ARG A HD3  1  
ATOM 116   H HE   . ARG A 1 10 ? -18.489 -15.636 -0.187  1.00 0.00 ? 10 ARG A HE   1  
ATOM 117   H HH11 . ARG A 1 10 ? -18.334 -14.601 3.240   1.00 0.00 ? 10 ARG A HH11 1  
ATOM 118   H HH12 . ARG A 1 10 ? -18.788 -16.160 3.843   1.00 0.00 ? 10 ARG A HH12 1  
ATOM 119   H HH21 . ARG A 1 10 ? -19.112 -17.683 0.671   1.00 0.00 ? 10 ARG A HH21 1  
ATOM 120   H HH22 . ARG A 1 10 ? -19.430 -17.898 2.355   1.00 0.00 ? 10 ARG A HH22 1  
ATOM 121   N N    . TYR A 1 11 ? -12.753 -13.177 1.635   1.00 0.00 ? 11 TYR A N    1  
ATOM 122   C CA   . TYR A 1 11 ? -11.356 -13.140 1.221   1.00 0.00 ? 11 TYR A CA   1  
ATOM 123   C C    . TYR A 1 11 ? -10.698 -11.885 1.820   1.00 0.00 ? 11 TYR A C    1  
ATOM 124   O O    . TYR A 1 11 ? -11.378 -10.938 2.231   1.00 0.00 ? 11 TYR A O    1  
ATOM 125   C CB   . TYR A 1 11 ? -11.215 -13.287 -0.307  1.00 0.00 ? 11 TYR A CB   1  
ATOM 126   C CG   . TYR A 1 11 ? -12.224 -14.218 -0.963  1.00 0.00 ? 11 TYR A CG   1  
ATOM 127   C CD1  . TYR A 1 11 ? -12.193 -15.605 -0.717  1.00 0.00 ? 11 TYR A CD1  1  
ATOM 128   C CD2  . TYR A 1 11 ? -13.229 -13.681 -1.789  1.00 0.00 ? 11 TYR A CD2  1  
ATOM 129   C CE1  . TYR A 1 11 ? -13.146 -16.452 -1.316  1.00 0.00 ? 11 TYR A CE1  1  
ATOM 130   C CE2  . TYR A 1 11 ? -14.187 -14.515 -2.383  1.00 0.00 ? 11 TYR A CE2  1  
ATOM 131   C CZ   . TYR A 1 11 ? -14.147 -15.905 -2.152  1.00 0.00 ? 11 TYR A CZ   1  
ATOM 132   O OH   . TYR A 1 11 ? -15.080 -16.710 -2.726  1.00 0.00 ? 11 TYR A OH   1  
ATOM 133   H H    . TYR A 1 11 ? -12.940 -13.760 2.438   1.00 0.00 ? 11 TYR A H    1  
ATOM 134   H HA   . TYR A 1 11 ? -10.880 -14.012 1.670   1.00 0.00 ? 11 TYR A HA   1  
ATOM 135   H HB2  . TYR A 1 11 ? -11.298 -12.298 -0.763  1.00 0.00 ? 11 TYR A HB2  1  
ATOM 136   H HB3  . TYR A 1 11 ? -10.219 -13.662 -0.531  1.00 0.00 ? 11 TYR A HB3  1  
ATOM 137   H HD1  . TYR A 1 11 ? -11.441 -16.016 -0.056  1.00 0.00 ? 11 TYR A HD1  1  
ATOM 138   H HD2  . TYR A 1 11 ? -13.281 -12.614 -1.963  1.00 0.00 ? 11 TYR A HD2  1  
ATOM 139   H HE1  . TYR A 1 11 ? -13.127 -17.516 -1.125  1.00 0.00 ? 11 TYR A HE1  1  
ATOM 140   H HE2  . TYR A 1 11 ? -14.949 -14.074 -3.008  1.00 0.00 ? 11 TYR A HE2  1  
ATOM 141   H HH   . TYR A 1 11 ? -15.692 -16.186 -3.285  1.00 0.00 ? 11 TYR A HH   1  
ATOM 142   N N    . ARG A 1 12 ? -9.376  -11.899 2.004   1.00 0.00 ? 12 ARG A N    1  
ATOM 143   C CA   . ARG A 1 12 ? -8.667  -10.873 2.777   1.00 0.00 ? 12 ARG A CA   1  
ATOM 144   C C    . ARG A 1 12 ? -7.279  -10.688 2.180   1.00 0.00 ? 12 ARG A C    1  
ATOM 145   O O    . ARG A 1 12 ? -6.298  -11.175 2.745   1.00 0.00 ? 12 ARG A O    1  
ATOM 146   C CB   . ARG A 1 12 ? -8.617  -11.252 4.275   1.00 0.00 ? 12 ARG A CB   1  
ATOM 147   C CG   . ARG A 1 12 ? -9.966  -11.086 4.992   1.00 0.00 ? 12 ARG A CG   1  
ATOM 148   C CD   . ARG A 1 12 ? -9.860  -11.417 6.483   1.00 0.00 ? 12 ARG A CD   1  
ATOM 149   N NE   . ARG A 1 12 ? -11.076 -11.011 7.200   1.00 0.00 ? 12 ARG A NE   1  
ATOM 150   C CZ   . ARG A 1 12 ? -11.586 -11.544 8.315   1.00 0.00 ? 12 ARG A CZ   1  
ATOM 151   N NH1  . ARG A 1 12 ? -11.010 -12.581 8.920   1.00 0.00 ? 12 ARG A NH1  1  
ATOM 152   N NH2  . ARG A 1 12 ? -12.689 -11.023 8.836   1.00 0.00 ? 12 ARG A NH2  1  
ATOM 153   H H    . ARG A 1 12 ? -8.834  -12.651 1.597   1.00 0.00 ? 12 ARG A H    1  
ATOM 154   H HA   . ARG A 1 12 ? -9.184  -9.916  2.682   1.00 0.00 ? 12 ARG A HA   1  
ATOM 155   H HB2  . ARG A 1 12 ? -8.275  -12.283 4.377   1.00 0.00 ? 12 ARG A HB2  1  
ATOM 156   H HB3  . ARG A 1 12 ? -7.896  -10.601 4.773   1.00 0.00 ? 12 ARG A HB3  1  
ATOM 157   H HG2  . ARG A 1 12 ? -10.301 -10.054 4.874   1.00 0.00 ? 12 ARG A HG2  1  
ATOM 158   H HG3  . ARG A 1 12 ? -10.707 -11.755 4.554   1.00 0.00 ? 12 ARG A HG3  1  
ATOM 159   H HD2  . ARG A 1 12 ? -9.707  -12.488 6.593   1.00 0.00 ? 12 ARG A HD2  1  
ATOM 160   H HD3  . ARG A 1 12 ? -9.012  -10.885 6.909   1.00 0.00 ? 12 ARG A HD3  1  
ATOM 161   H HE   . ARG A 1 12 ? -11.535 -10.186 6.816   1.00 0.00 ? 12 ARG A HE   1  
ATOM 162   H HH11 . ARG A 1 12 ? -10.133 -12.978 8.591   1.00 0.00 ? 12 ARG A HH11 1  
ATOM 163   H HH12 . ARG A 1 12 ? -11.385 -13.002 9.767   1.00 0.00 ? 12 ARG A HH12 1  
ATOM 164   H HH21 . ARG A 1 12 ? -13.104 -10.156 8.498   1.00 0.00 ? 12 ARG A HH21 1  
ATOM 165   H HH22 . ARG A 1 12 ? -13.188 -11.514 9.576   1.00 0.00 ? 12 ARG A HH22 1  
ATOM 166   N N    . GLN A 1 13 ? -7.190  -10.054 1.015   1.00 0.00 ? 13 GLN A N    1  
ATOM 167   C CA   . GLN A 1 13 ? -5.938  -9.776  0.326   1.00 0.00 ? 13 GLN A CA   1  
ATOM 168   C C    . GLN A 1 13 ? -6.152  -8.640  -0.674  1.00 0.00 ? 13 GLN A C    1  
ATOM 169   O O    . GLN A 1 13 ? -7.255  -8.461  -1.200  1.00 0.00 ? 13 GLN A O    1  
ATOM 170   C CB   . GLN A 1 13 ? -5.392  -11.039 -0.370  1.00 0.00 ? 13 GLN A CB   1  
ATOM 171   C CG   . GLN A 1 13 ? -6.256  -11.628 -1.496  1.00 0.00 ? 13 GLN A CG   1  
ATOM 172   C CD   . GLN A 1 13 ? -7.561  -12.225 -0.983  1.00 0.00 ? 13 GLN A CD   1  
ATOM 173   O OE1  . GLN A 1 13 ? -8.622  -11.628 -1.130  1.00 0.00 ? 13 GLN A OE1  1  
ATOM 174   N NE2  . GLN A 1 13 ? -7.500  -13.386 -0.355  1.00 0.00 ? 13 GLN A NE2  1  
ATOM 175   H H    . GLN A 1 13 ? -8.029  -9.673  0.583   1.00 0.00 ? 13 GLN A H    1  
ATOM 176   H HA   . GLN A 1 13 ? -5.207  -9.458  1.068   1.00 0.00 ? 13 GLN A HA   1  
ATOM 177   H HB2  . GLN A 1 13 ? -4.430  -10.778 -0.797  1.00 0.00 ? 13 GLN A HB2  1  
ATOM 178   H HB3  . GLN A 1 13 ? -5.209  -11.812 0.376   1.00 0.00 ? 13 GLN A HB3  1  
ATOM 179   H HG2  . GLN A 1 13 ? -6.470  -10.855 -2.233  1.00 0.00 ? 13 GLN A HG2  1  
ATOM 180   H HG3  . GLN A 1 13 ? -5.692  -12.410 -2.003  1.00 0.00 ? 13 GLN A HG3  1  
ATOM 181   H HE21 . GLN A 1 13 ? -6.611  -13.879 -0.402  1.00 0.00 ? 13 GLN A HE21 1  
ATOM 182   H HE22 . GLN A 1 13 ? -8.322  -13.922 -0.102  1.00 0.00 ? 13 GLN A HE22 1  
ATOM 183   N N    . TYR A 1 14 ? -5.089  -7.903  -0.992  1.00 0.00 ? 14 TYR A N    1  
ATOM 184   C CA   . TYR A 1 14 ? -5.120  -6.770  -1.909  1.00 0.00 ? 14 TYR A CA   1  
ATOM 185   C C    . TYR A 1 14 ? -4.115  -7.025  -3.028  1.00 0.00 ? 14 TYR A C    1  
ATOM 186   O O    . TYR A 1 14 ? -3.051  -7.614  -2.802  1.00 0.00 ? 14 TYR A O    1  
ATOM 187   C CB   . TYR A 1 14 ? -4.805  -5.478  -1.143  1.00 0.00 ? 14 TYR A CB   1  
ATOM 188   C CG   . TYR A 1 14 ? -3.399  -5.427  -0.573  1.00 0.00 ? 14 TYR A CG   1  
ATOM 189   C CD1  . TYR A 1 14 ? -2.349  -4.954  -1.374  1.00 0.00 ? 14 TYR A CD1  1  
ATOM 190   C CD2  . TYR A 1 14 ? -3.119  -5.913  0.717   1.00 0.00 ? 14 TYR A CD2  1  
ATOM 191   C CE1  . TYR A 1 14 ? -1.017  -5.055  -0.959  1.00 0.00 ? 14 TYR A CE1  1  
ATOM 192   C CE2  . TYR A 1 14 ? -1.786  -6.004  1.157   1.00 0.00 ? 14 TYR A CE2  1  
ATOM 193   C CZ   . TYR A 1 14 ? -0.728  -5.612  0.301   1.00 0.00 ? 14 TYR A CZ   1  
ATOM 194   O OH   . TYR A 1 14 ? 0.571   -5.765  0.670   1.00 0.00 ? 14 TYR A OH   1  
ATOM 195   H H    . TYR A 1 14 ? -4.180  -8.139  -0.618  1.00 0.00 ? 14 TYR A H    1  
ATOM 196   H HA   . TYR A 1 14 ? -6.116  -6.659  -2.347  1.00 0.00 ? 14 TYR A HA   1  
ATOM 197   H HB2  . TYR A 1 14 ? -4.949  -4.640  -1.827  1.00 0.00 ? 14 TYR A HB2  1  
ATOM 198   H HB3  . TYR A 1 14 ? -5.520  -5.365  -0.331  1.00 0.00 ? 14 TYR A HB3  1  
ATOM 199   H HD1  . TYR A 1 14 ? -2.554  -4.526  -2.336  1.00 0.00 ? 14 TYR A HD1  1  
ATOM 200   H HD2  . TYR A 1 14 ? -3.930  -6.227  1.358   1.00 0.00 ? 14 TYR A HD2  1  
ATOM 201   H HE1  . TYR A 1 14 ? -0.236  -4.707  -1.622  1.00 0.00 ? 14 TYR A HE1  1  
ATOM 202   H HE2  . TYR A 1 14 ? -1.582  -6.387  2.142   1.00 0.00 ? 14 TYR A HE2  1  
ATOM 203   H HH   . TYR A 1 14 ? 0.668   -6.165  1.555   1.00 0.00 ? 14 TYR A HH   1  
ATOM 204   N N    . ASN A 1 15 ? -4.452  -6.592  -4.239  1.00 0.00 ? 15 ASN A N    1  
ATOM 205   C CA   . ASN A 1 15 ? -3.534  -6.619  -5.373  1.00 0.00 ? 15 ASN A CA   1  
ATOM 206   C C    . ASN A 1 15 ? -2.552  -5.463  -5.204  1.00 0.00 ? 15 ASN A C    1  
ATOM 207   O O    . ASN A 1 15 ? -2.922  -4.438  -4.637  1.00 0.00 ? 15 ASN A O    1  
ATOM 208   C CB   . ASN A 1 15 ? -4.312  -6.465  -6.694  1.00 0.00 ? 15 ASN A CB   1  
ATOM 209   C CG   . ASN A 1 15 ? -5.465  -7.457  -6.788  1.00 0.00 ? 15 ASN A CG   1  
ATOM 210   O OD1  . ASN A 1 15 ? -5.269  -8.666  -6.670  1.00 0.00 ? 15 ASN A OD1  1  
ATOM 211   N ND2  . ASN A 1 15 ? -6.686  -6.970  -6.910  1.00 0.00 ? 15 ASN A ND2  1  
ATOM 212   H H    . ASN A 1 15 ? -5.336  -6.118  -4.348  1.00 0.00 ? 15 ASN A H    1  
ATOM 213   H HA   . ASN A 1 15 ? -2.997  -7.570  -5.376  1.00 0.00 ? 15 ASN A HA   1  
ATOM 214   H HB2  . ASN A 1 15 ? -4.691  -5.445  -6.777  1.00 0.00 ? 15 ASN A HB2  1  
ATOM 215   H HB3  . ASN A 1 15 ? -3.637  -6.640  -7.531  1.00 0.00 ? 15 ASN A HB3  1  
ATOM 216   H HD21 . ASN A 1 15 ? -6.853  -5.998  -7.117  1.00 0.00 ? 15 ASN A HD21 1  
ATOM 217   H HD22 . ASN A 1 15 ? -7.472  -7.611  -6.901  1.00 0.00 ? 15 ASN A HD22 1  
ATOM 218   N N    . SER A 1 16 ? -1.354  -5.551  -5.772  1.00 0.00 ? 16 SER A N    1  
ATOM 219   C CA   . SER A 1 16 ? -0.354  -4.481  -5.744  1.00 0.00 ? 16 SER A CA   1  
ATOM 220   C C    . SER A 1 16 ? -0.869  -3.174  -6.372  1.00 0.00 ? 16 SER A C    1  
ATOM 221   O O    . SER A 1 16 ? -0.338  -2.100  -6.094  1.00 0.00 ? 16 SER A O    1  
ATOM 222   C CB   . SER A 1 16 ? 0.909   -4.992  -6.444  1.00 0.00 ? 16 SER A CB   1  
ATOM 223   O OG   . SER A 1 16 ? 1.296   -6.226  -5.859  1.00 0.00 ? 16 SER A OG   1  
ATOM 224   H H    . SER A 1 16 ? -1.076  -6.413  -6.229  1.00 0.00 ? 16 SER A H    1  
ATOM 225   H HA   . SER A 1 16 ? -0.111  -4.274  -4.705  1.00 0.00 ? 16 SER A HA   1  
ATOM 226   H HB2  . SER A 1 16 ? 0.699   -5.141  -7.504  1.00 0.00 ? 16 SER A HB2  1  
ATOM 227   H HB3  . SER A 1 16 ? 1.713   -4.261  -6.342  1.00 0.00 ? 16 SER A HB3  1  
ATOM 228   H HG   . SER A 1 16 ? 1.650   -6.818  -6.548  1.00 0.00 ? 16 SER A HG   1  
ATOM 229   N N    . GLU A 1 17 ? -1.922  -3.290  -7.182  1.00 0.00 ? 17 GLU A N    1  
ATOM 230   C CA   . GLU A 1 17 ? -2.710  -2.234  -7.794  1.00 0.00 ? 17 GLU A CA   1  
ATOM 231   C C    . GLU A 1 17 ? -3.574  -1.548  -6.730  1.00 0.00 ? 17 GLU A C    1  
ATOM 232   O O    . GLU A 1 17 ? -3.491  -0.334  -6.573  1.00 0.00 ? 17 GLU A O    1  
ATOM 233   C CB   . GLU A 1 17 ? -3.594  -2.877  -8.879  1.00 0.00 ? 17 GLU A CB   1  
ATOM 234   C CG   . GLU A 1 17 ? -2.765  -3.543  -9.990  1.00 0.00 ? 17 GLU A CG   1  
ATOM 235   C CD   . GLU A 1 17 ? -3.590  -4.444  -10.907 1.00 0.00 ? 17 GLU A CD   1  
ATOM 236   O OE1  . GLU A 1 17 ? -4.838  -4.446  -10.862 1.00 0.00 ? 17 GLU A OE1  1  
ATOM 237   O OE2  . GLU A 1 17 ? -2.972  -5.284  -11.604 1.00 0.00 ? 17 GLU A OE2  1  
ATOM 238   H H    . GLU A 1 17 ? -2.234  -4.229  -7.360  1.00 0.00 ? 17 GLU A H    1  
ATOM 239   H HA   . GLU A 1 17 ? -2.048  -1.495  -8.250  1.00 0.00 ? 17 GLU A HA   1  
ATOM 240   H HB2  . GLU A 1 17 ? -4.226  -3.633  -8.410  1.00 0.00 ? 17 GLU A HB2  1  
ATOM 241   H HB3  . GLU A 1 17 ? -4.239  -2.120  -9.323  1.00 0.00 ? 17 GLU A HB3  1  
ATOM 242   H HG2  . GLU A 1 17 ? -2.275  -2.774  -10.581 1.00 0.00 ? 17 GLU A HG2  1  
ATOM 243   H HG3  . GLU A 1 17 ? -1.987  -4.171  -9.549  1.00 0.00 ? 17 GLU A HG3  1  
ATOM 244   N N    . ILE A 1 18 ? -4.374  -2.319  -5.982  1.00 0.00 ? 18 ILE A N    1  
ATOM 245   C CA   . ILE A 1 18 ? -5.264  -1.855  -4.910  1.00 0.00 ? 18 ILE A CA   1  
ATOM 246   C C    . ILE A 1 18 ? -4.475  -1.067  -3.867  1.00 0.00 ? 18 ILE A C    1  
ATOM 247   O O    . ILE A 1 18 ? -4.974  -0.103  -3.289  1.00 0.00 ? 18 ILE A O    1  
ATOM 248   C CB   . ILE A 1 18 ? -5.960  -3.079  -4.260  1.00 0.00 ? 18 ILE A CB   1  
ATOM 249   C CG1  . ILE A 1 18 ? -7.005  -3.710  -5.195  1.00 0.00 ? 18 ILE A CG1  1  
ATOM 250   C CG2  . ILE A 1 18 ? -6.571  -2.793  -2.874  1.00 0.00 ? 18 ILE A CG2  1  
ATOM 251   C CD1  . ILE A 1 18 ? -8.341  -2.978  -5.101  1.00 0.00 ? 18 ILE A CD1  1  
ATOM 252   H H    . ILE A 1 18 ? -4.296  -3.314  -6.112  1.00 0.00 ? 18 ILE A H    1  
ATOM 253   H HA   . ILE A 1 18 ? -6.014  -1.190  -5.338  1.00 0.00 ? 18 ILE A HA   1  
ATOM 254   H HB   . ILE A 1 18 ? -5.203  -3.837  -4.091  1.00 0.00 ? 18 ILE A HB   1  
ATOM 255   H HG12 . ILE A 1 18 ? -6.652  -3.692  -6.227  1.00 0.00 ? 18 ILE A HG12 1  
ATOM 256   H HG13 . ILE A 1 18 ? -7.158  -4.749  -4.904  1.00 0.00 ? 18 ILE A HG13 1  
ATOM 257   H HG21 . ILE A 1 18 ? -7.143  -3.651  -2.518  1.00 0.00 ? 18 ILE A HG21 1  
ATOM 258   H HG22 . ILE A 1 18 ? -5.778  -2.608  -2.165  1.00 0.00 ? 18 ILE A HG22 1  
ATOM 259   H HG23 . ILE A 1 18 ? -7.203  -1.906  -2.904  1.00 0.00 ? 18 ILE A HG23 1  
ATOM 260   H HD11 . ILE A 1 18 ? -9.003  -3.311  -5.896  1.00 0.00 ? 18 ILE A HD11 1  
ATOM 261   H HD12 . ILE A 1 18 ? -8.787  -3.195  -4.129  1.00 0.00 ? 18 ILE A HD12 1  
ATOM 262   H HD13 . ILE A 1 18 ? -8.164  -1.904  -5.174  1.00 0.00 ? 18 ILE A HD13 1  
ATOM 263   N N    . LEU A 1 19 ? -3.250  -1.507  -3.594  1.00 0.00 ? 19 LEU A N    1  
ATOM 264   C CA   . LEU A 1 19 ? -2.394  -0.845  -2.634  1.00 0.00 ? 19 LEU A CA   1  
ATOM 265   C C    . LEU A 1 19 ? -2.125  0.604   -3.042  1.00 0.00 ? 19 LEU A C    1  
ATOM 266   O O    . LEU A 1 19 ? -2.153  1.479   -2.182  1.00 0.00 ? 19 LEU A O    1  
ATOM 267   C CB   . LEU A 1 19 ? -1.118  -1.675  -2.473  1.00 0.00 ? 19 LEU A CB   1  
ATOM 268   C CG   . LEU A 1 19 ? -0.064  -1.036  -1.565  1.00 0.00 ? 19 LEU A CG   1  
ATOM 269   C CD1  . LEU A 1 19 ? -0.615  -0.786  -0.155  1.00 0.00 ? 19 LEU A CD1  1  
ATOM 270   C CD2  . LEU A 1 19 ? 1.132   -1.986  -1.478  1.00 0.00 ? 19 LEU A CD2  1  
ATOM 271   H H    . LEU A 1 19 ? -2.929  -2.328  -4.090  1.00 0.00 ? 19 LEU A H    1  
ATOM 272   H HA   . LEU A 1 19 ? -2.922  -0.820  -1.681  1.00 0.00 ? 19 LEU A HA   1  
ATOM 273   H HB2  . LEU A 1 19 ? -1.400  -2.626  -2.045  1.00 0.00 ? 19 LEU A HB2  1  
ATOM 274   H HB3  . LEU A 1 19 ? -0.674  -1.872  -3.448  1.00 0.00 ? 19 LEU A HB3  1  
ATOM 275   H HG   . LEU A 1 19 ? 0.262   -0.098  -2.011  1.00 0.00 ? 19 LEU A HG   1  
ATOM 276   H HD11 . LEU A 1 19 ? -1.050  -1.704  0.240   1.00 0.00 ? 19 LEU A HD11 1  
ATOM 277   H HD12 . LEU A 1 19 ? 0.175   -0.437  0.503   1.00 0.00 ? 19 LEU A HD12 1  
ATOM 278   H HD13 . LEU A 1 19 ? -1.375  -0.005  -0.196  1.00 0.00 ? 19 LEU A HD13 1  
ATOM 279   H HD21 . LEU A 1 19 ? 0.901   -2.832  -0.831  1.00 0.00 ? 19 LEU A HD21 1  
ATOM 280   H HD22 . LEU A 1 19 ? 1.380   -2.358  -2.473  1.00 0.00 ? 19 LEU A HD22 1  
ATOM 281   H HD23 . LEU A 1 19 ? 1.992   -1.443  -1.099  1.00 0.00 ? 19 LEU A HD23 1  
ATOM 282   N N    . GLU A 1 20 ? -1.888  0.865   -4.329  1.00 0.00 ? 20 GLU A N    1  
ATOM 283   C CA   . GLU A 1 20 ? -1.569  2.204   -4.812  1.00 0.00 ? 20 GLU A CA   1  
ATOM 284   C C    . GLU A 1 20 ? -2.751  3.146   -4.613  1.00 0.00 ? 20 GLU A C    1  
ATOM 285   O O    . GLU A 1 20 ? -2.564  4.301   -4.241  1.00 0.00 ? 20 GLU A O    1  
ATOM 286   C CB   . GLU A 1 20 ? -1.232  2.172   -6.307  1.00 0.00 ? 20 GLU A CB   1  
ATOM 287   C CG   . GLU A 1 20 ? 0.023   1.370   -6.642  1.00 0.00 ? 20 GLU A CG   1  
ATOM 288   C CD   . GLU A 1 20 ? 1.282   2.214   -6.475  1.00 0.00 ? 20 GLU A CD   1  
ATOM 289   O OE1  . GLU A 1 20 ? 1.611   2.615   -5.337  1.00 0.00 ? 20 GLU A OE1  1  
ATOM 290   O OE2  . GLU A 1 20 ? 1.982   2.413   -7.498  1.00 0.00 ? 20 GLU A OE2  1  
ATOM 291   H H    . GLU A 1 20 ? -1.983  0.126   -5.014  1.00 0.00 ? 20 GLU A H    1  
ATOM 292   H HA   . GLU A 1 20 ? -0.721  2.581   -4.238  1.00 0.00 ? 20 GLU A HA   1  
ATOM 293   H HB2  . GLU A 1 20 ? -2.073  1.752   -6.857  1.00 0.00 ? 20 GLU A HB2  1  
ATOM 294   H HB3  . GLU A 1 20 ? -1.095  3.196   -6.656  1.00 0.00 ? 20 GLU A HB3  1  
ATOM 295   H HG2  . GLU A 1 20 ? 0.090   0.482   -6.017  1.00 0.00 ? 20 GLU A HG2  1  
ATOM 296   H HG3  . GLU A 1 20 ? -0.049  1.038   -7.679  1.00 0.00 ? 20 GLU A HG3  1  
ATOM 297   N N    . GLU A 1 21 ? -3.961  2.642   -4.846  1.00 0.00 ? 21 GLU A N    1  
ATOM 298   C CA   . GLU A 1 21 ? -5.221  3.322   -4.632  1.00 0.00 ? 21 GLU A CA   1  
ATOM 299   C C    . GLU A 1 21 ? -5.285  3.832   -3.203  1.00 0.00 ? 21 GLU A C    1  
ATOM 300   O O    . GLU A 1 21 ? -5.347  5.039   -2.975  1.00 0.00 ? 21 GLU A O    1  
ATOM 301   C CB   . GLU A 1 21 ? -6.371  2.374   -4.909  1.00 0.00 ? 21 GLU A CB   1  
ATOM 302   C CG   . GLU A 1 21 ? -6.394  1.628   -6.244  1.00 0.00 ? 21 GLU A CG   1  
ATOM 303   C CD   . GLU A 1 21 ? -6.965  2.440   -7.399  1.00 0.00 ? 21 GLU A CD   1  
ATOM 304   O OE1  . GLU A 1 21 ? -6.520  3.579   -7.655  1.00 0.00 ? 21 GLU A OE1  1  
ATOM 305   O OE2  . GLU A 1 21 ? -7.885  1.923   -8.074  1.00 0.00 ? 21 GLU A OE2  1  
ATOM 306   H H    . GLU A 1 21 ? -4.034  1.685   -5.154  1.00 0.00 ? 21 GLU A H    1  
ATOM 307   H HA   . GLU A 1 21 ? -5.368  4.163   -5.295  1.00 0.00 ? 21 GLU A HA   1  
ATOM 308   H HB2  . GLU A 1 21 ? -6.442  1.630   -4.123  1.00 0.00 ? 21 GLU A HB2  1  
ATOM 309   H HB3  . GLU A 1 21 ? -7.221  3.022   -4.835  1.00 0.00 ? 21 GLU A HB3  1  
ATOM 310   H HG2  . GLU A 1 21 ? -5.398  1.282   -6.501  1.00 0.00 ? 21 GLU A HG2  1  
ATOM 311   H HG3  . GLU A 1 21 ? -7.023  0.747   -6.105  1.00 0.00 ? 21 GLU A HG3  1  
ATOM 312   N N    . ALA A 1 22 ? -5.216  2.900   -2.250  1.00 0.00 ? 22 ALA A N    1  
ATOM 313   C CA   . ALA A 1 22 ? -5.342  3.154   -0.822  1.00 0.00 ? 22 ALA A CA   1  
ATOM 314   C C    . ALA A 1 22 ? -4.223  4.046   -0.295  1.00 0.00 ? 22 ALA A C    1  
ATOM 315   O O    . ALA A 1 22 ? -4.341  4.603   0.798   1.00 0.00 ? 22 ALA A O    1  
ATOM 316   C CB   . ALA A 1 22 ? -5.305  1.811   -0.101  1.00 0.00 ? 22 ALA A CB   1  
ATOM 317   H H    . ALA A 1 22 ? -5.097  1.938   -2.564  1.00 0.00 ? 22 ALA A H    1  
ATOM 318   H HA   . ALA A 1 22 ? -6.298  3.652   -0.623  1.00 0.00 ? 22 ALA A HA   1  
ATOM 319   H HB1  . ALA A 1 22 ? -4.277  1.455   -0.038  1.00 0.00 ? 22 ALA A HB1  1  
ATOM 320   H HB2  . ALA A 1 22 ? -5.730  1.929   0.896   1.00 0.00 ? 22 ALA A HB2  1  
ATOM 321   H HB3  . ALA A 1 22 ? -5.886  1.089   -0.669  1.00 0.00 ? 22 ALA A HB3  1  
ATOM 322   N N    . ILE A 1 23 ? -3.144  4.189   -1.056  1.00 0.00 ? 23 ILE A N    1  
ATOM 323   C CA   . ILE A 1 23 ? -2.076  5.125   -0.742  1.00 0.00 ? 23 ILE A CA   1  
ATOM 324   C C    . ILE A 1 23 ? -2.476  6.498   -1.274  1.00 0.00 ? 23 ILE A C    1  
ATOM 325   O O    . ILE A 1 23 ? -2.502  7.459   -0.506  1.00 0.00 ? 23 ILE A O    1  
ATOM 326   C CB   . ILE A 1 23 ? -0.758  4.571   -1.306  1.00 0.00 ? 23 ILE A CB   1  
ATOM 327   C CG1  . ILE A 1 23 ? -0.291  3.427   -0.387  1.00 0.00 ? 23 ILE A CG1  1  
ATOM 328   C CG2  . ILE A 1 23 ? 0.349   5.629   -1.421  1.00 0.00 ? 23 ILE A CG2  1  
ATOM 329   C CD1  . ILE A 1 23 ? 0.686   2.515   -1.117  1.00 0.00 ? 23 ILE A CD1  1  
ATOM 330   H H    . ILE A 1 23 ? -3.149  3.690   -1.951  1.00 0.00 ? 23 ILE A H    1  
ATOM 331   H HA   . ILE A 1 23 ? -1.974  5.208   0.340   1.00 0.00 ? 23 ILE A HA   1  
ATOM 332   H HB   . ILE A 1 23 ? -0.965  4.169   -2.298  1.00 0.00 ? 23 ILE A HB   1  
ATOM 333   H HG12 . ILE A 1 23 ? 0.183   3.826   0.509   1.00 0.00 ? 23 ILE A HG12 1  
ATOM 334   H HG13 . ILE A 1 23 ? -1.145  2.825   -0.069  1.00 0.00 ? 23 ILE A HG13 1  
ATOM 335   H HG21 . ILE A 1 23 ? 0.067   6.367   -2.170  1.00 0.00 ? 23 ILE A HG21 1  
ATOM 336   H HG22 . ILE A 1 23 ? 0.503   6.119   -0.460  1.00 0.00 ? 23 ILE A HG22 1  
ATOM 337   H HG23 . ILE A 1 23 ? 1.280   5.175   -1.755  1.00 0.00 ? 23 ILE A HG23 1  
ATOM 338   H HD11 . ILE A 1 23 ? 0.306   2.284   -2.112  1.00 0.00 ? 23 ILE A HD11 1  
ATOM 339   H HD12 . ILE A 1 23 ? 1.661   2.991   -1.197  1.00 0.00 ? 23 ILE A HD12 1  
ATOM 340   H HD13 . ILE A 1 23 ? 0.777   1.597   -0.547  1.00 0.00 ? 23 ILE A HD13 1  
ATOM 341   N N    . SER A 1 24 ? -2.824  6.599   -2.555  1.00 0.00 ? 24 SER A N    1  
ATOM 342   C CA   . SER A 1 24 ? -3.220  7.834   -3.206  1.00 0.00 ? 24 SER A CA   1  
ATOM 343   C C    . SER A 1 24 ? -4.354  8.556   -2.473  1.00 0.00 ? 24 SER A C    1  
ATOM 344   O O    . SER A 1 24 ? -4.225  9.761   -2.259  1.00 0.00 ? 24 SER A O    1  
ATOM 345   C CB   . SER A 1 24 ? -3.566  7.530   -4.661  1.00 0.00 ? 24 SER A CB   1  
ATOM 346   O OG   . SER A 1 24 ? -2.362  7.395   -5.393  1.00 0.00 ? 24 SER A OG   1  
ATOM 347   H H    . SER A 1 24 ? -2.820  5.768   -3.143  1.00 0.00 ? 24 SER A H    1  
ATOM 348   H HA   . SER A 1 24 ? -2.362  8.507   -3.197  1.00 0.00 ? 24 SER A HA   1  
ATOM 349   H HB2  . SER A 1 24 ? -4.152  6.609   -4.732  1.00 0.00 ? 24 SER A HB2  1  
ATOM 350   H HB3  . SER A 1 24 ? -4.138  8.359   -5.070  1.00 0.00 ? 24 SER A HB3  1  
ATOM 351   H HG   . SER A 1 24 ? -2.127  8.288   -5.710  1.00 0.00 ? 24 SER A HG   1  
ATOM 352   N N    . VAL A 1 25 ? -5.411  7.866   -2.024  1.00 0.00 ? 25 VAL A N    1  
ATOM 353   C CA   . VAL A 1 25 ? -6.446  8.473   -1.183  1.00 0.00 ? 25 VAL A CA   1  
ATOM 354   C C    . VAL A 1 25 ? -5.812  9.171   0.027   1.00 0.00 ? 25 VAL A C    1  
ATOM 355   O O    . VAL A 1 25 ? -5.999  10.368  0.222   1.00 0.00 ? 25 VAL A O    1  
ATOM 356   C CB   . VAL A 1 25 ? -7.531  7.441   -0.776  1.00 0.00 ? 25 VAL A CB   1  
ATOM 357   C CG1  . VAL A 1 25 ? -8.716  7.489   -1.741  1.00 0.00 ? 25 VAL A CG1  1  
ATOM 358   C CG2  . VAL A 1 25 ? -7.052  6.023   -0.587  1.00 0.00 ? 25 VAL A CG2  1  
ATOM 359   H H    . VAL A 1 25 ? -5.482  6.874   -2.243  1.00 0.00 ? 25 VAL A H    1  
ATOM 360   H HA   . VAL A 1 25 ? -6.926  9.259   -1.770  1.00 0.00 ? 25 VAL A HA   1  
ATOM 361   H HB   . VAL A 1 25 ? -7.900  7.642   0.216   1.00 0.00 ? 25 VAL A HB   1  
ATOM 362   H HG11 . VAL A 1 25 ? -9.526  6.870   -1.358  1.00 0.00 ? 25 VAL A HG11 1  
ATOM 363   H HG12 . VAL A 1 25 ? -9.088  8.502   -1.834  1.00 0.00 ? 25 VAL A HG12 1  
ATOM 364   H HG13 . VAL A 1 25 ? -8.410  7.129   -2.724  1.00 0.00 ? 25 VAL A HG13 1  
ATOM 365   H HG21 . VAL A 1 25 ? -7.665  5.543   0.171   1.00 0.00 ? 25 VAL A HG21 1  
ATOM 366   H HG22 . VAL A 1 25 ? -7.158  5.478   -1.517  1.00 0.00 ? 25 VAL A HG22 1  
ATOM 367   H HG23 . VAL A 1 25 ? -6.026  6.024   -0.245  1.00 0.00 ? 25 VAL A HG23 1  
ATOM 368   N N    . VAL A 1 26 ? -5.063  8.442   0.844   1.00 0.00 ? 26 VAL A N    1  
ATOM 369   C CA   . VAL A 1 26 ? -4.394  8.913   2.051   1.00 0.00 ? 26 VAL A CA   1  
ATOM 370   C C    . VAL A 1 26 ? -3.491  10.109  1.742   1.00 0.00 ? 26 VAL A C    1  
ATOM 371   O O    . VAL A 1 26 ? -3.590  11.128  2.430   1.00 0.00 ? 26 VAL A O    1  
ATOM 372   C CB   . VAL A 1 26 ? -3.650  7.735   2.721   1.00 0.00 ? 26 VAL A CB   1  
ATOM 373   C CG1  . VAL A 1 26 ? -2.805  8.155   3.932   1.00 0.00 ? 26 VAL A CG1  1  
ATOM 374   C CG2  . VAL A 1 26 ? -4.671  6.697   3.200   1.00 0.00 ? 26 VAL A CG2  1  
ATOM 375   H H    . VAL A 1 26 ? -4.931  7.486   0.575   1.00 0.00 ? 26 VAL A H    1  
ATOM 376   H HA   . VAL A 1 26 ? -5.161  9.263   2.737   1.00 0.00 ? 26 VAL A HA   1  
ATOM 377   H HB   . VAL A 1 26 ? -2.988  7.260   2.000   1.00 0.00 ? 26 VAL A HB   1  
ATOM 378   H HG11 . VAL A 1 26 ? -1.974  8.782   3.606   1.00 0.00 ? 26 VAL A HG11 1  
ATOM 379   H HG12 . VAL A 1 26 ? -3.414  8.714   4.641   1.00 0.00 ? 26 VAL A HG12 1  
ATOM 380   H HG13 . VAL A 1 26 ? -2.390  7.274   4.421   1.00 0.00 ? 26 VAL A HG13 1  
ATOM 381   H HG21 . VAL A 1 26 ? -4.151  5.838   3.625   1.00 0.00 ? 26 VAL A HG21 1  
ATOM 382   H HG22 . VAL A 1 26 ? -5.335  7.139   3.939   1.00 0.00 ? 26 VAL A HG22 1  
ATOM 383   H HG23 . VAL A 1 26 ? -5.268  6.338   2.364   1.00 0.00 ? 26 VAL A HG23 1  
ATOM 384   N N    . MET A 1 27 ? -2.645  10.023  0.715   1.00 0.00 ? 27 MET A N    1  
ATOM 385   C CA   . MET A 1 27 ? -1.734  11.093  0.321   1.00 0.00 ? 27 MET A CA   1  
ATOM 386   C C    . MET A 1 27 ? -2.516  12.359  -0.016  1.00 0.00 ? 27 MET A C    1  
ATOM 387   O O    . MET A 1 27 ? -2.280  13.402  0.597   1.00 0.00 ? 27 MET A O    1  
ATOM 388   C CB   . MET A 1 27 ? -0.881  10.649  -0.868  1.00 0.00 ? 27 MET A CB   1  
ATOM 389   C CG   . MET A 1 27 ? 0.140   9.593   -0.457  1.00 0.00 ? 27 MET A CG   1  
ATOM 390   S SD   . MET A 1 27 ? 1.099   9.001   -1.866  1.00 0.00 ? 27 MET A SD   1  
ATOM 391   C CE   . MET A 1 27 ? 2.571   8.484   -0.963  1.00 0.00 ? 27 MET A CE   1  
ATOM 392   H H    . MET A 1 27 ? -2.632  9.165   0.169   1.00 0.00 ? 27 MET A H    1  
ATOM 393   H HA   . MET A 1 27 ? -1.072  11.318  1.159   1.00 0.00 ? 27 MET A HA   1  
ATOM 394   H HB2  . MET A 1 27 ? -1.518  10.255  -1.660  1.00 0.00 ? 27 MET A HB2  1  
ATOM 395   H HB3  . MET A 1 27 ? -0.334  11.513  -1.250  1.00 0.00 ? 27 MET A HB3  1  
ATOM 396   H HG2  . MET A 1 27 ? 0.813   10.041  0.273   1.00 0.00 ? 27 MET A HG2  1  
ATOM 397   H HG3  . MET A 1 27 ? -0.344  8.744   0.020   1.00 0.00 ? 27 MET A HG3  1  
ATOM 398   H HE1  . MET A 1 27 ? 2.940   9.309   -0.359  1.00 0.00 ? 27 MET A HE1  1  
ATOM 399   H HE2  . MET A 1 27 ? 2.338   7.645   -0.309  1.00 0.00 ? 27 MET A HE2  1  
ATOM 400   H HE3  . MET A 1 27 ? 3.334   8.213   -1.685  1.00 0.00 ? 27 MET A HE3  1  
ATOM 401   N N    . SER A 1 28 ? -3.501  12.255  -0.910  1.00 0.00 ? 28 SER A N    1  
ATOM 402   C CA   . SER A 1 28 ? -4.409  13.323  -1.288  1.00 0.00 ? 28 SER A CA   1  
ATOM 403   C C    . SER A 1 28 ? -5.266  13.839  -0.124  1.00 0.00 ? 28 SER A C    1  
ATOM 404   O O    . SER A 1 28 ? -5.985  14.830  -0.297  1.00 0.00 ? 28 SER A O    1  
ATOM 405   C CB   . SER A 1 28 ? -5.314  12.772  -2.389  1.00 0.00 ? 28 SER A CB   1  
ATOM 406   O OG   . SER A 1 28 ? -4.563  12.394  -3.526  1.00 0.00 ? 28 SER A OG   1  
ATOM 407   H H    . SER A 1 28 ? -3.679  11.379  -1.395  1.00 0.00 ? 28 SER A H    1  
ATOM 408   H HA   . SER A 1 28 ? -3.823  14.155  -1.681  1.00 0.00 ? 28 SER A HA   1  
ATOM 409   H HB2  . SER A 1 28 ? -5.854  11.903  -2.012  1.00 0.00 ? 28 SER A HB2  1  
ATOM 410   H HB3  . SER A 1 28 ? -6.036  13.526  -2.676  1.00 0.00 ? 28 SER A HB3  1  
ATOM 411   H HG   . SER A 1 28 ? -5.005  11.603  -3.893  1.00 0.00 ? 28 SER A HG   1  
ATOM 412   N N    . GLY A 1 29 ? -5.228  13.203  1.047   1.00 0.00 ? 29 GLY A N    1  
ATOM 413   C CA   . GLY A 1 29 ? -5.980  13.632  2.206   1.00 0.00 ? 29 GLY A CA   1  
ATOM 414   C C    . GLY A 1 29 ? -7.422  13.146  2.173   1.00 0.00 ? 29 GLY A C    1  
ATOM 415   O O    . GLY A 1 29 ? -8.267  13.714  2.860   1.00 0.00 ? 29 GLY A O    1  
ATOM 416   H H    . GLY A 1 29 ? -4.622  12.397  1.159   1.00 0.00 ? 29 GLY A H    1  
ATOM 417   H HA2  . GLY A 1 29 ? -5.486  13.246  3.094   1.00 0.00 ? 29 GLY A HA2  1  
ATOM 418   H HA3  . GLY A 1 29 ? -5.986  14.719  2.246   1.00 0.00 ? 29 GLY A HA3  1  
ATOM 419   N N    . LYS A 1 30 ? -7.754  12.125  1.377   1.00 0.00 ? 30 LYS A N    1  
ATOM 420   C CA   . LYS A 1 30 ? -9.117  11.597  1.345   1.00 0.00 ? 30 LYS A CA   1  
ATOM 421   C C    . LYS A 1 30 ? -9.433  10.897  2.656   1.00 0.00 ? 30 LYS A C    1  
ATOM 422   O O    . LYS A 1 30 ? -10.574 10.918  3.113   1.00 0.00 ? 30 LYS A O    1  
ATOM 423   C CB   . LYS A 1 30 ? -9.291  10.646  0.150   1.00 0.00 ? 30 LYS A CB   1  
ATOM 424   C CG   . LYS A 1 30 ? -9.095  11.339  -1.211  1.00 0.00 ? 30 LYS A CG   1  
ATOM 425   C CD   . LYS A 1 30 ? -9.978  12.579  -1.339  1.00 0.00 ? 30 LYS A CD   1  
ATOM 426   C CE   . LYS A 1 30 ? -10.085 13.037  -2.791  1.00 0.00 ? 30 LYS A CE   1  
ATOM 427   N NZ   . LYS A 1 30 ? -11.195 13.991  -2.955  1.00 0.00 ? 30 LYS A NZ   1  
ATOM 428   H H    . LYS A 1 30 ? -7.014  11.584  0.923   1.00 0.00 ? 30 LYS A H    1  
ATOM 429   H HA   . LYS A 1 30 ? -9.818  12.427  1.266   1.00 0.00 ? 30 LYS A HA   1  
ATOM 430   H HB2  . LYS A 1 30 ? -8.576  9.836   0.245   1.00 0.00 ? 30 LYS A HB2  1  
ATOM 431   H HB3  . LYS A 1 30 ? -10.282 10.188  0.183   1.00 0.00 ? 30 LYS A HB3  1  
ATOM 432   H HG2  . LYS A 1 30 ? -8.052  11.623  -1.343  1.00 0.00 ? 30 LYS A HG2  1  
ATOM 433   H HG3  . LYS A 1 30 ? -9.358  10.643  -2.005  1.00 0.00 ? 30 LYS A HG3  1  
ATOM 434   H HD2  . LYS A 1 30 ? -10.973 12.331  -0.968  1.00 0.00 ? 30 LYS A HD2  1  
ATOM 435   H HD3  . LYS A 1 30 ? -9.549  13.382  -0.736  1.00 0.00 ? 30 LYS A HD3  1  
ATOM 436   H HE2  . LYS A 1 30 ? -9.146  13.501  -3.098  1.00 0.00 ? 30 LYS A HE2  1  
ATOM 437   H HE3  . LYS A 1 30 ? -10.271 12.171  -3.428  1.00 0.00 ? 30 LYS A HE3  1  
ATOM 438   H HZ1  . LYS A 1 30 ? -12.083 13.524  -2.788  1.00 0.00 ? 30 LYS A HZ1  1  
ATOM 439   H HZ2  . LYS A 1 30 ? -11.116 14.759  -2.298  1.00 0.00 ? 30 LYS A HZ2  1  
ATOM 440   H HZ3  . LYS A 1 30 ? -11.212 14.349  -3.906  1.00 0.00 ? 30 LYS A HZ3  1  
ATOM 441   N N    . MET A 1 31 ? -8.425  10.297  3.277   1.00 0.00 ? 31 MET A N    1  
ATOM 442   C CA   . MET A 1 31 ? -8.510  9.713   4.599   1.00 0.00 ? 31 MET A CA   1  
ATOM 443   C C    . MET A 1 31 ? -7.104  9.634   5.195   1.00 0.00 ? 31 MET A C    1  
ATOM 444   O O    . MET A 1 31 ? -6.191  10.296  4.697   1.00 0.00 ? 31 MET A O    1  
ATOM 445   C CB   . MET A 1 31 ? -9.223  8.366   4.507   1.00 0.00 ? 31 MET A CB   1  
ATOM 446   C CG   . MET A 1 31 ? -8.547  7.318   3.643   1.00 0.00 ? 31 MET A CG   1  
ATOM 447   S SD   . MET A 1 31 ? -9.722  6.059   3.101   1.00 0.00 ? 31 MET A SD   1  
ATOM 448   C CE   . MET A 1 31 ? -10.491 6.895   1.729   1.00 0.00 ? 31 MET A CE   1  
ATOM 449   H H    . MET A 1 31 ? -7.497  10.349  2.881   1.00 0.00 ? 31 MET A H    1  
ATOM 450   H HA   . MET A 1 31 ? -9.107  10.363  5.239   1.00 0.00 ? 31 MET A HA   1  
ATOM 451   H HB2  . MET A 1 31 ? -9.285  7.967   5.500   1.00 0.00 ? 31 MET A HB2  1  
ATOM 452   H HB3  . MET A 1 31 ? -10.245 8.495   4.164   1.00 0.00 ? 31 MET A HB3  1  
ATOM 453   H HG2  . MET A 1 31 ? -8.080  7.765   2.765   1.00 0.00 ? 31 MET A HG2  1  
ATOM 454   H HG3  . MET A 1 31 ? -7.785  6.845   4.258   1.00 0.00 ? 31 MET A HG3  1  
ATOM 455   H HE1  . MET A 1 31 ? -10.828 7.873   2.058   1.00 0.00 ? 31 MET A HE1  1  
ATOM 456   H HE2  . MET A 1 31 ? -9.756  6.989   0.943   1.00 0.00 ? 31 MET A HE2  1  
ATOM 457   H HE3  . MET A 1 31 ? -11.327 6.291   1.385   1.00 0.00 ? 31 MET A HE3  1  
ATOM 458   N N    . SER A 1 32 ? -6.932  8.854   6.258   1.00 0.00 ? 32 SER A N    1  
ATOM 459   C CA   . SER A 1 32 ? -5.650  8.546   6.874   1.00 0.00 ? 32 SER A CA   1  
ATOM 460   C C    . SER A 1 32 ? -5.390  7.046   6.745   1.00 0.00 ? 32 SER A C    1  
ATOM 461   O O    . SER A 1 32 ? -6.260  6.311   6.261   1.00 0.00 ? 32 SER A O    1  
ATOM 462   C CB   . SER A 1 32 ? -5.665  9.027   8.326   1.00 0.00 ? 32 SER A CB   1  
ATOM 463   O OG   . SER A 1 32 ? -6.763  8.471   9.026   1.00 0.00 ? 32 SER A OG   1  
ATOM 464   H H    . SER A 1 32 ? -7.719  8.333   6.628   1.00 0.00 ? 32 SER A H    1  
ATOM 465   H HA   . SER A 1 32 ? -4.847  9.070   6.358   1.00 0.00 ? 32 SER A HA   1  
ATOM 466   H HB2  . SER A 1 32 ? -4.736  8.743   8.820   1.00 0.00 ? 32 SER A HB2  1  
ATOM 467   H HB3  . SER A 1 32 ? -5.744  10.115  8.343   1.00 0.00 ? 32 SER A HB3  1  
ATOM 468   H HG   . SER A 1 32 ? -6.675  8.799   9.947   1.00 0.00 ? 32 SER A HG   1  
ATOM 469   N N    . VAL A 1 33 ? -4.208  6.602   7.181   1.00 0.00 ? 33 VAL A N    1  
ATOM 470   C CA   . VAL A 1 33 ? -3.766  5.216   7.114   1.00 0.00 ? 33 VAL A CA   1  
ATOM 471   C C    . VAL A 1 33 ? -4.837  4.315   7.727   1.00 0.00 ? 33 VAL A C    1  
ATOM 472   O O    . VAL A 1 33 ? -5.342  3.430   7.043   1.00 0.00 ? 33 VAL A O    1  
ATOM 473   C CB   . VAL A 1 33 ? -2.380  5.075   7.793   1.00 0.00 ? 33 VAL A CB   1  
ATOM 474   C CG1  . VAL A 1 33 ? -1.846  3.636   7.857   1.00 0.00 ? 33 VAL A CG1  1  
ATOM 475   C CG2  . VAL A 1 33 ? -1.329  5.929   7.065   1.00 0.00 ? 33 VAL A CG2  1  
ATOM 476   H H    . VAL A 1 33 ? -3.561  7.254   7.603   1.00 0.00 ? 33 VAL A H    1  
ATOM 477   H HA   . VAL A 1 33 ? -3.683  4.956   6.061   1.00 0.00 ? 33 VAL A HA   1  
ATOM 478   H HB   . VAL A 1 33 ? -2.458  5.434   8.818   1.00 0.00 ? 33 VAL A HB   1  
ATOM 479   H HG11 . VAL A 1 33 ? -1.616  3.270   6.859   1.00 0.00 ? 33 VAL A HG11 1  
ATOM 480   H HG12 . VAL A 1 33 ? -0.936  3.627   8.458   1.00 0.00 ? 33 VAL A HG12 1  
ATOM 481   H HG13 . VAL A 1 33 ? -2.563  2.967   8.338   1.00 0.00 ? 33 VAL A HG13 1  
ATOM 482   H HG21 . VAL A 1 33 ? -1.224  5.594   6.034   1.00 0.00 ? 33 VAL A HG21 1  
ATOM 483   H HG22 . VAL A 1 33 ? -1.608  6.983   7.066   1.00 0.00 ? 33 VAL A HG22 1  
ATOM 484   H HG23 . VAL A 1 33 ? -0.367  5.842   7.570   1.00 0.00 ? 33 VAL A HG23 1  
ATOM 485   N N    . SER A 1 34 ? -5.226  4.564   8.978   1.00 0.00 ? 34 SER A N    1  
ATOM 486   C CA   . SER A 1 34 ? -6.168  3.710   9.696   1.00 0.00 ? 34 SER A CA   1  
ATOM 487   C C    . SER A 1 34 ? -7.490  3.544   8.938   1.00 0.00 ? 34 SER A C    1  
ATOM 488   O O    . SER A 1 34 ? -8.014  2.437   8.810   1.00 0.00 ? 34 SER A O    1  
ATOM 489   C CB   . SER A 1 34 ? -6.389  4.310   11.087  1.00 0.00 ? 34 SER A CB   1  
ATOM 490   O OG   . SER A 1 34 ? -6.479  3.298   12.066  1.00 0.00 ? 34 SER A OG   1  
ATOM 491   H H    . SER A 1 34 ? -4.798  5.349   9.462   1.00 0.00 ? 34 SER A H    1  
ATOM 492   H HA   . SER A 1 34 ? -5.724  2.721   9.792   1.00 0.00 ? 34 SER A HA   1  
ATOM 493   H HB2  . SER A 1 34 ? -5.552  4.959   11.347  1.00 0.00 ? 34 SER A HB2  1  
ATOM 494   H HB3  . SER A 1 34 ? -7.291  4.916   11.087  1.00 0.00 ? 34 SER A HB3  1  
ATOM 495   H HG   . SER A 1 34 ? -7.357  3.395   12.498  1.00 0.00 ? 34 SER A HG   1  
ATOM 496   N N    . LYS A 1 35 ? -8.010  4.650   8.404   1.00 0.00 ? 35 LYS A N    1  
ATOM 497   C CA   . LYS A 1 35 ? -9.249  4.665   7.652   1.00 0.00 ? 35 LYS A CA   1  
ATOM 498   C C    . LYS A 1 35 ? -9.107  3.800   6.389   1.00 0.00 ? 35 LYS A C    1  
ATOM 499   O O    . LYS A 1 35 ? -9.748  2.748   6.324   1.00 0.00 ? 35 LYS A O    1  
ATOM 500   C CB   . LYS A 1 35 ? -9.690  6.105   7.463   1.00 0.00 ? 35 LYS A CB   1  
ATOM 501   C CG   . LYS A 1 35 ? -10.943 6.157   6.586   1.00 0.00 ? 35 LYS A CG   1  
ATOM 502   C CD   . LYS A 1 35 ? -11.779 7.404   6.821   1.00 0.00 ? 35 LYS A CD   1  
ATOM 503   C CE   . LYS A 1 35 ? -12.702 7.606   5.611   1.00 0.00 ? 35 LYS A CE   1  
ATOM 504   N NZ   . LYS A 1 35 ? -13.407 8.903   5.601   1.00 0.00 ? 35 LYS A NZ   1  
ATOM 505   H H    . LYS A 1 35 ? -7.473  5.502   8.471   1.00 0.00 ? 35 LYS A H    1  
ATOM 506   H HA   . LYS A 1 35 ? -10.038 4.244   8.266   1.00 0.00 ? 35 LYS A HA   1  
ATOM 507   H HB2  . LYS A 1 35 ? -9.921  6.522   8.446   1.00 0.00 ? 35 LYS A HB2  1  
ATOM 508   H HB3  . LYS A 1 35 ? -8.872  6.674   7.035   1.00 0.00 ? 35 LYS A HB3  1  
ATOM 509   H HG2  . LYS A 1 35 ? -10.647 6.120   5.554   1.00 0.00 ? 35 LYS A HG2  1  
ATOM 510   H HG3  . LYS A 1 35 ? -11.555 5.291   6.755   1.00 0.00 ? 35 LYS A HG3  1  
ATOM 511   H HD2  . LYS A 1 35 ? -12.359 7.276   7.731   1.00 0.00 ? 35 LYS A HD2  1  
ATOM 512   H HD3  . LYS A 1 35 ? -11.088 8.226   6.955   1.00 0.00 ? 35 LYS A HD3  1  
ATOM 513   H HE2  . LYS A 1 35 ? -12.118 7.527   4.691   1.00 0.00 ? 35 LYS A HE2  1  
ATOM 514   H HE3  . LYS A 1 35 ? -13.448 6.807   5.602   1.00 0.00 ? 35 LYS A HE3  1  
ATOM 515   H HZ1  . LYS A 1 35 ? -13.946 9.053   6.449   1.00 0.00 ? 35 LYS A HZ1  1  
ATOM 516   H HZ2  . LYS A 1 35 ? -12.780 9.695   5.481   1.00 0.00 ? 35 LYS A HZ2  1  
ATOM 517   H HZ3  . LYS A 1 35 ? -14.068 8.896   4.829   1.00 0.00 ? 35 LYS A HZ3  1  
ATOM 518   N N    . ALA A 1 36 ? -8.306  4.207   5.392   1.00 0.00 ? 36 ALA A N    1  
ATOM 519   C CA   . ALA A 1 36 ? -8.118  3.470   4.143   1.00 0.00 ? 36 ALA A CA   1  
ATOM 520   C C    . ALA A 1 36 ? -7.698  2.024   4.323   1.00 0.00 ? 36 ALA A C    1  
ATOM 521   O O    . ALA A 1 36 ? -8.146  1.203   3.529   1.00 0.00 ? 36 ALA A O    1  
ATOM 522   C CB   . ALA A 1 36 ? -7.030  4.147   3.295   1.00 0.00 ? 36 ALA A CB   1  
ATOM 523   H H    . ALA A 1 36 ? -7.907  5.138   5.395   1.00 0.00 ? 36 ALA A H    1  
ATOM 524   H HA   . ALA A 1 36 ? -9.086  3.436   3.623   1.00 0.00 ? 36 ALA A HA   1  
ATOM 525   H HB1  . ALA A 1 36 ? -7.281  5.172   3.054   1.00 0.00 ? 36 ALA A HB1  1  
ATOM 526   H HB2  . ALA A 1 36 ? -6.095  4.156   3.852   1.00 0.00 ? 36 ALA A HB2  1  
ATOM 527   H HB3  . ALA A 1 36 ? -6.886  3.600   2.364   1.00 0.00 ? 36 ALA A HB3  1  
ATOM 528   N N    . GLN A 1 37 ? -6.881  1.691   5.324   1.00 0.00 ? 37 GLN A N    1  
ATOM 529   C CA   . GLN A 1 37 ? -6.532  0.316   5.639   1.00 0.00 ? 37 GLN A CA   1  
ATOM 530   C C    . GLN A 1 37 ? -7.801  -0.531  5.597   1.00 0.00 ? 37 GLN A C    1  
ATOM 531   O O    . GLN A 1 37 ? -7.854  -1.519  4.865   1.00 0.00 ? 37 GLN A O    1  
ATOM 532   C CB   . GLN A 1 37 ? -5.796  0.298   6.992   1.00 0.00 ? 37 GLN A CB   1  
ATOM 533   C CG   . GLN A 1 37 ? -5.974  -0.982  7.834   1.00 0.00 ? 37 GLN A CG   1  
ATOM 534   C CD   . GLN A 1 37 ? -6.509  -0.755  9.245   1.00 0.00 ? 37 GLN A CD   1  
ATOM 535   O OE1  . GLN A 1 37 ? -6.061  0.114   9.989   1.00 0.00 ? 37 GLN A OE1  1  
ATOM 536   N NE2  . GLN A 1 37 ? -7.436  -1.593  9.678   1.00 0.00 ? 37 GLN A NE2  1  
ATOM 537   H H    . GLN A 1 37 ? -6.478  2.403   5.924   1.00 0.00 ? 37 GLN A H    1  
ATOM 538   H HA   . GLN A 1 37 ? -5.855  -0.063  4.875   1.00 0.00 ? 37 GLN A HA   1  
ATOM 539   H HB2  . GLN A 1 37 ? -4.735  0.472   6.778   1.00 0.00 ? 37 GLN A HB2  1  
ATOM 540   H HB3  . GLN A 1 37 ? -6.158  1.127   7.595   1.00 0.00 ? 37 GLN A HB3  1  
ATOM 541   H HG2  . GLN A 1 37 ? -6.638  -1.674  7.341   1.00 0.00 ? 37 GLN A HG2  1  
ATOM 542   H HG3  . GLN A 1 37 ? -5.041  -1.509  7.899   1.00 0.00 ? 37 GLN A HG3  1  
ATOM 543   H HE21 . GLN A 1 37 ? -7.678  -2.380  9.087   1.00 0.00 ? 37 GLN A HE21 1  
ATOM 544   H HE22 . GLN A 1 37 ? -7.878  -1.456  10.576  1.00 0.00 ? 37 GLN A HE22 1  
ATOM 545   N N    . SER A 1 38 ? -8.812  -0.136  6.370   1.00 0.00 ? 38 SER A N    1  
ATOM 546   C CA   . SER A 1 38 ? -10.020 -0.915  6.499   1.00 0.00 ? 38 SER A CA   1  
ATOM 547   C C    . SER A 1 38 ? -10.838 -0.864  5.196   1.00 0.00 ? 38 SER A C    1  
ATOM 548   O O    . SER A 1 38 ? -11.406 -1.879  4.787   1.00 0.00 ? 38 SER A O    1  
ATOM 549   C CB   . SER A 1 38 ? -10.789 -0.366  7.704   1.00 0.00 ? 38 SER A CB   1  
ATOM 550   O OG   . SER A 1 38 ? -12.071 -0.942  7.841   1.00 0.00 ? 38 SER A OG   1  
ATOM 551   H H    . SER A 1 38 ? -8.748  0.751   6.861   1.00 0.00 ? 38 SER A H    1  
ATOM 552   H HA   . SER A 1 38 ? -9.696  -1.938  6.703   1.00 0.00 ? 38 SER A HA   1  
ATOM 553   H HB2  . SER A 1 38 ? -10.203 -0.541  8.609   1.00 0.00 ? 38 SER A HB2  1  
ATOM 554   H HB3  . SER A 1 38 ? -10.916 0.708   7.575   1.00 0.00 ? 38 SER A HB3  1  
ATOM 555   H HG   . SER A 1 38 ? -11.984 -1.858  8.181   1.00 0.00 ? 38 SER A HG   1  
ATOM 556   N N    . ILE A 1 39 ? -10.903 0.302   4.534   1.00 0.00 ? 39 ILE A N    1  
ATOM 557   C CA   . ILE A 1 39 ? -11.711 0.492   3.325   1.00 0.00 ? 39 ILE A CA   1  
ATOM 558   C C    . ILE A 1 39 ? -11.214 -0.433  2.204   1.00 0.00 ? 39 ILE A C    1  
ATOM 559   O O    . ILE A 1 39 ? -12.012 -1.084  1.524   1.00 0.00 ? 39 ILE A O    1  
ATOM 560   C CB   . ILE A 1 39 ? -11.779 1.982   2.908   1.00 0.00 ? 39 ILE A CB   1  
ATOM 561   C CG1  . ILE A 1 39 ? -12.414 2.785   4.066   1.00 0.00 ? 39 ILE A CG1  1  
ATOM 562   C CG2  . ILE A 1 39 ? -12.572 2.172   1.599   1.00 0.00 ? 39 ILE A CG2  1  
ATOM 563   C CD1  . ILE A 1 39 ? -12.856 4.207   3.732   1.00 0.00 ? 39 ILE A CD1  1  
ATOM 564   H H    . ILE A 1 39 ? -10.398 1.094   4.911   1.00 0.00 ? 39 ILE A H    1  
ATOM 565   H HA   . ILE A 1 39 ? -12.725 0.209   3.573   1.00 0.00 ? 39 ILE A HA   1  
ATOM 566   H HB   . ILE A 1 39 ? -10.772 2.355   2.738   1.00 0.00 ? 39 ILE A HB   1  
ATOM 567   H HG12 . ILE A 1 39 ? -13.281 2.250   4.438   1.00 0.00 ? 39 ILE A HG12 1  
ATOM 568   H HG13 . ILE A 1 39 ? -11.699 2.849   4.878   1.00 0.00 ? 39 ILE A HG13 1  
ATOM 569   H HG21 . ILE A 1 39 ? -12.129 1.589   0.791   1.00 0.00 ? 39 ILE A HG21 1  
ATOM 570   H HG22 . ILE A 1 39 ? -13.612 1.873   1.740   1.00 0.00 ? 39 ILE A HG22 1  
ATOM 571   H HG23 . ILE A 1 39 ? -12.538 3.213   1.280   1.00 0.00 ? 39 ILE A HG23 1  
ATOM 572   H HD11 . ILE A 1 39 ? -12.068 4.711   3.183   1.00 0.00 ? 39 ILE A HD11 1  
ATOM 573   H HD12 . ILE A 1 39 ? -13.758 4.173   3.122   1.00 0.00 ? 39 ILE A HD12 1  
ATOM 574   H HD13 . ILE A 1 39 ? -13.067 4.743   4.656   1.00 0.00 ? 39 ILE A HD13 1  
ATOM 575   N N    . TYR A 1 40 ? -9.899  -0.475  2.004   1.00 0.00 ? 40 TYR A N    1  
ATOM 576   C CA   . TYR A 1 40 ? -9.257  -1.148  0.885   1.00 0.00 ? 40 TYR A CA   1  
ATOM 577   C C    . TYR A 1 40 ? -8.862  -2.590  1.239   1.00 0.00 ? 40 TYR A C    1  
ATOM 578   O O    . TYR A 1 40 ? -8.663  -3.414  0.339   1.00 0.00 ? 40 TYR A O    1  
ATOM 579   C CB   . TYR A 1 40 ? -8.059  -0.291  0.455   1.00 0.00 ? 40 TYR A CB   1  
ATOM 580   C CG   . TYR A 1 40 ? -8.443  1.000   -0.265  1.00 0.00 ? 40 TYR A CG   1  
ATOM 581   C CD1  . TYR A 1 40 ? -8.853  2.141   0.459   1.00 0.00 ? 40 TYR A CD1  1  
ATOM 582   C CD2  . TYR A 1 40 ? -8.295  1.102   -1.660  1.00 0.00 ? 40 TYR A CD2  1  
ATOM 583   C CE1  . TYR A 1 40 ? -9.183  3.343   -0.191  1.00 0.00 ? 40 TYR A CE1  1  
ATOM 584   C CE2  . TYR A 1 40 ? -8.613  2.299   -2.317  1.00 0.00 ? 40 TYR A CE2  1  
ATOM 585   C CZ   . TYR A 1 40 ? -9.115  3.397   -1.597  1.00 0.00 ? 40 TYR A CZ   1  
ATOM 586   O OH   . TYR A 1 40 ? -9.551  4.508   -2.239  1.00 0.00 ? 40 TYR A OH   1  
ATOM 587   H H    . TYR A 1 40 ? -9.302  0.079   2.610   1.00 0.00 ? 40 TYR A H    1  
ATOM 588   H HA   . TYR A 1 40 ? -9.954  -1.193  0.049   1.00 0.00 ? 40 TYR A HA   1  
ATOM 589   H HB2  . TYR A 1 40 ? -7.486  -0.017  1.339   1.00 0.00 ? 40 TYR A HB2  1  
ATOM 590   H HB3  . TYR A 1 40 ? -7.390  -0.895  -0.167  1.00 0.00 ? 40 TYR A HB3  1  
ATOM 591   H HD1  . TYR A 1 40 ? -8.903  2.113   1.527   1.00 0.00 ? 40 TYR A HD1  1  
ATOM 592   H HD2  . TYR A 1 40 ? -7.901  0.281   -2.241  1.00 0.00 ? 40 TYR A HD2  1  
ATOM 593   H HE1  . TYR A 1 40 ? -9.443  4.239   0.365   1.00 0.00 ? 40 TYR A HE1  1  
ATOM 594   H HE2  . TYR A 1 40 ? -8.437  2.383   -3.373  1.00 0.00 ? 40 TYR A HE2  1  
ATOM 595   H HH   . TYR A 1 40 ? -9.409  4.488   -3.210  1.00 0.00 ? 40 TYR A HH   1  
ATOM 596   N N    . GLY A 1 41 ? -8.791  -2.927  2.531   1.00 0.00 ? 41 GLY A N    1  
ATOM 597   C CA   . GLY A 1 41 ? -8.463  -4.258  3.038   1.00 0.00 ? 41 GLY A CA   1  
ATOM 598   C C    . GLY A 1 41 ? -6.950  -4.476  3.129   1.00 0.00 ? 41 GLY A C    1  
ATOM 599   O O    . GLY A 1 41 ? -6.472  -5.610  3.061   1.00 0.00 ? 41 GLY A O    1  
ATOM 600   H H    . GLY A 1 41 ? -8.896  -2.195  3.224   1.00 0.00 ? 41 GLY A H    1  
ATOM 601   H HA2  . GLY A 1 41 ? -8.887  -4.363  4.036   1.00 0.00 ? 41 GLY A HA2  1  
ATOM 602   H HA3  . GLY A 1 41 ? -8.912  -5.021  2.404   1.00 0.00 ? 41 GLY A HA3  1  
ATOM 603   N N    . ILE A 1 42 ? -6.188  -3.395  3.289   1.00 0.00 ? 42 ILE A N    1  
ATOM 604   C CA   . ILE A 1 42 ? -4.733  -3.405  3.364   1.00 0.00 ? 42 ILE A CA   1  
ATOM 605   C C    . ILE A 1 42 ? -4.379  -3.558  4.853   1.00 0.00 ? 42 ILE A C    1  
ATOM 606   O O    . ILE A 1 42 ? -5.067  -2.971  5.690   1.00 0.00 ? 42 ILE A O    1  
ATOM 607   C CB   . ILE A 1 42 ? -4.176  -2.060  2.834   1.00 0.00 ? 42 ILE A CB   1  
ATOM 608   C CG1  . ILE A 1 42 ? -4.811  -1.505  1.551   1.00 0.00 ? 42 ILE A CG1  1  
ATOM 609   C CG2  . ILE A 1 42 ? -2.646  -2.140  2.690   1.00 0.00 ? 42 ILE A CG2  1  
ATOM 610   C CD1  . ILE A 1 42 ? -4.538  -2.268  0.266   1.00 0.00 ? 42 ILE A CD1  1  
ATOM 611   H H    . ILE A 1 42 ? -6.672  -2.529  3.497   1.00 0.00 ? 42 ILE A H    1  
ATOM 612   H HA   . ILE A 1 42 ? -4.339  -4.234  2.772   1.00 0.00 ? 42 ILE A HA   1  
ATOM 613   H HB   . ILE A 1 42 ? -4.428  -1.293  3.561   1.00 0.00 ? 42 ILE A HB   1  
ATOM 614   H HG12 . ILE A 1 42 ? -5.885  -1.446  1.687   1.00 0.00 ? 42 ILE A HG12 1  
ATOM 615   H HG13 . ILE A 1 42 ? -4.468  -0.483  1.418   1.00 0.00 ? 42 ILE A HG13 1  
ATOM 616   H HG21 . ILE A 1 42 ? -2.182  -2.277  3.665   1.00 0.00 ? 42 ILE A HG21 1  
ATOM 617   H HG22 . ILE A 1 42 ? -2.375  -2.986  2.053   1.00 0.00 ? 42 ILE A HG22 1  
ATOM 618   H HG23 . ILE A 1 42 ? -2.268  -1.217  2.253   1.00 0.00 ? 42 ILE A HG23 1  
ATOM 619   H HD11 . ILE A 1 42 ? -3.476  -2.457  0.130   1.00 0.00 ? 42 ILE A HD11 1  
ATOM 620   H HD12 . ILE A 1 42 ? -5.094  -3.202  0.285   1.00 0.00 ? 42 ILE A HD12 1  
ATOM 621   H HD13 . ILE A 1 42 ? -4.877  -1.641  -0.555  1.00 0.00 ? 42 ILE A HD13 1  
ATOM 622   N N    . PRO A 1 43 ? -3.323  -4.299  5.233   1.00 0.00 ? 43 PRO A N    1  
ATOM 623   C CA   . PRO A 1 43 ? -2.807  -4.246  6.593   1.00 0.00 ? 43 PRO A CA   1  
ATOM 624   C C    . PRO A 1 43 ? -2.320  -2.839  6.921   1.00 0.00 ? 43 PRO A C    1  
ATOM 625   O O    . PRO A 1 43 ? -1.655  -2.214  6.092   1.00 0.00 ? 43 PRO A O    1  
ATOM 626   C CB   . PRO A 1 43 ? -1.622  -5.211  6.649   1.00 0.00 ? 43 PRO A CB   1  
ATOM 627   C CG   . PRO A 1 43 ? -1.567  -5.916  5.296   1.00 0.00 ? 43 PRO A CG   1  
ATOM 628   C CD   . PRO A 1 43 ? -2.514  -5.148  4.383   1.00 0.00 ? 43 PRO A CD   1  
ATOM 629   H HA   . PRO A 1 43 ? -3.592  -4.546  7.293   1.00 0.00 ? 43 PRO A HA   1  
ATOM 630   H HB2  . PRO A 1 43 ? -0.687  -4.672  6.815   1.00 0.00 ? 43 PRO A HB2  1  
ATOM 631   H HB3  . PRO A 1 43 ? -1.771  -5.926  7.448   1.00 0.00 ? 43 PRO A HB3  1  
ATOM 632   H HG2  . PRO A 1 43 ? -0.558  -5.911  4.896   1.00 0.00 ? 43 PRO A HG2  1  
ATOM 633   H HG3  . PRO A 1 43 ? -1.899  -6.944  5.394   1.00 0.00 ? 43 PRO A HG3  1  
ATOM 634   H HD2  . PRO A 1 43 ? -1.930  -4.538  3.698   1.00 0.00 ? 43 PRO A HD2  1  
ATOM 635   H HD3  . PRO A 1 43 ? -3.143  -5.845  3.830   1.00 0.00 ? 43 PRO A HD3  1  
ATOM 636   N N    . HIS A 1 44 ? -2.560  -2.380  8.149   1.00 0.00 ? 44 HIS A N    1  
ATOM 637   C CA   . HIS A 1 44 ? -2.110  -1.067  8.590   1.00 0.00 ? 44 HIS A CA   1  
ATOM 638   C C    . HIS A 1 44 ? -0.589  -0.965  8.489   1.00 0.00 ? 44 HIS A C    1  
ATOM 639   O O    . HIS A 1 44 ? -0.104  -0.016  7.889   1.00 0.00 ? 44 HIS A O    1  
ATOM 640   C CB   . HIS A 1 44 ? -2.614  -0.809  10.009  1.00 0.00 ? 44 HIS A CB   1  
ATOM 641   C CG   . HIS A 1 44 ? -2.539  0.621   10.474  1.00 0.00 ? 44 HIS A CG   1  
ATOM 642   N ND1  . HIS A 1 44 ? -3.627  1.417   10.743  1.00 0.00 ? 44 HIS A ND1  1  
ATOM 643   C CD2  . HIS A 1 44 ? -1.414  1.333   10.791  1.00 0.00 ? 44 HIS A CD2  1  
ATOM 644   C CE1  . HIS A 1 44 ? -3.173  2.582   11.229  1.00 0.00 ? 44 HIS A CE1  1  
ATOM 645   N NE2  . HIS A 1 44 ? -1.830  2.579   11.283  1.00 0.00 ? 44 HIS A NE2  1  
ATOM 646   H H    . HIS A 1 44 ? -3.114  -2.941  8.786   1.00 0.00 ? 44 HIS A H    1  
ATOM 647   H HA   . HIS A 1 44 ? -2.548  -0.316  7.930   1.00 0.00 ? 44 HIS A HA   1  
ATOM 648   H HB2  . HIS A 1 44 ? -3.662  -1.088  10.034  1.00 0.00 ? 44 HIS A HB2  1  
ATOM 649   H HB3  . HIS A 1 44 ? -2.066  -1.438  10.708  1.00 0.00 ? 44 HIS A HB3  1  
ATOM 650   H HD1  . HIS A 1 44 ? -4.603  1.167   10.590  1.00 0.00 ? 44 HIS A HD1  1  
ATOM 651   H HD2  . HIS A 1 44 ? -0.395  0.979   10.708  1.00 0.00 ? 44 HIS A HD2  1  
ATOM 652   H HE1  . HIS A 1 44 ? -3.798  3.409   11.536  1.00 0.00 ? 44 HIS A HE1  1  
ATOM 653   N N    . SER A 1 45 ? 0.162   -1.940  9.014   1.00 0.00 ? 45 SER A N    1  
ATOM 654   C CA   . SER A 1 45 ? 1.626   -1.890  9.028   1.00 0.00 ? 45 SER A CA   1  
ATOM 655   C C    . SER A 1 45 ? 2.202   -1.802  7.610   1.00 0.00 ? 45 SER A C    1  
ATOM 656   O O    . SER A 1 45 ? 3.226   -1.149  7.399   1.00 0.00 ? 45 SER A O    1  
ATOM 657   C CB   . SER A 1 45 ? 2.206   -3.111  9.758   1.00 0.00 ? 45 SER A CB   1  
ATOM 658   O OG   . SER A 1 45 ? 1.481   -3.408  10.939  1.00 0.00 ? 45 SER A OG   1  
ATOM 659   H H    . SER A 1 45 ? -0.284  -2.709  9.496   1.00 0.00 ? 45 SER A H    1  
ATOM 660   H HA   . SER A 1 45 ? 1.927   -0.993  9.571   1.00 0.00 ? 45 SER A HA   1  
ATOM 661   H HB2  . SER A 1 45 ? 2.163   -3.984  9.105   1.00 0.00 ? 45 SER A HB2  1  
ATOM 662   H HB3  . SER A 1 45 ? 3.250   -2.910  10.007  1.00 0.00 ? 45 SER A HB3  1  
ATOM 663   H HG   . SER A 1 45 ? 2.091   -3.883  11.549  1.00 0.00 ? 45 SER A HG   1  
ATOM 664   N N    . THR A 1 46 ? 1.552   -2.438  6.628   1.00 0.00 ? 46 THR A N    1  
ATOM 665   C CA   . THR A 1 46 ? 1.890   -2.266  5.227   1.00 0.00 ? 46 THR A CA   1  
ATOM 666   C C    . THR A 1 46 ? 1.551   -0.842  4.798   1.00 0.00 ? 46 THR A C    1  
ATOM 667   O O    . THR A 1 46 ? 2.462   -0.118  4.414   1.00 0.00 ? 46 THR A O    1  
ATOM 668   C CB   . THR A 1 46 ? 1.194   -3.343  4.387   1.00 0.00 ? 46 THR A CB   1  
ATOM 669   O OG1  . THR A 1 46 ? 1.711   -4.609  4.760   1.00 0.00 ? 46 THR A OG1  1  
ATOM 670   C CG2  . THR A 1 46 ? 1.399   -3.153  2.882   1.00 0.00 ? 46 THR A CG2  1  
ATOM 671   H H    . THR A 1 46 ? 0.696   -2.935  6.830   1.00 0.00 ? 46 THR A H    1  
ATOM 672   H HA   . THR A 1 46 ? 2.965   -2.383  5.110   1.00 0.00 ? 46 THR A HA   1  
ATOM 673   H HB   . THR A 1 46 ? 0.123   -3.328  4.592   1.00 0.00 ? 46 THR A HB   1  
ATOM 674   H HG1  . THR A 1 46 ? 2.690   -4.543  4.729   1.00 0.00 ? 46 THR A HG1  1  
ATOM 675   H HG21 . THR A 1 46 ? 0.872   -3.935  2.346   1.00 0.00 ? 46 THR A HG21 1  
ATOM 676   H HG22 . THR A 1 46 ? 0.978   -2.200  2.560   1.00 0.00 ? 46 THR A HG22 1  
ATOM 677   H HG23 . THR A 1 46 ? 2.458   -3.186  2.627   1.00 0.00 ? 46 THR A HG23 1  
ATOM 678   N N    . LEU A 1 47 ? 0.279   -0.439  4.844   1.00 0.00 ? 47 LEU A N    1  
ATOM 679   C CA   . LEU A 1 47 ? -0.176  0.837   4.307   1.00 0.00 ? 47 LEU A CA   1  
ATOM 680   C C    . LEU A 1 47 ? 0.663   1.988   4.849   1.00 0.00 ? 47 LEU A C    1  
ATOM 681   O O    . LEU A 1 47 ? 1.122   2.814   4.074   1.00 0.00 ? 47 LEU A O    1  
ATOM 682   C CB   . LEU A 1 47 ? -1.655  1.051   4.647   1.00 0.00 ? 47 LEU A CB   1  
ATOM 683   C CG   . LEU A 1 47 ? -2.221  2.301   3.942   1.00 0.00 ? 47 LEU A CG   1  
ATOM 684   C CD1  . LEU A 1 47 ? -2.473  2.025   2.466   1.00 0.00 ? 47 LEU A CD1  1  
ATOM 685   C CD2  . LEU A 1 47 ? -3.585  2.630   4.526   1.00 0.00 ? 47 LEU A CD2  1  
ATOM 686   H H    . LEU A 1 47 ? -0.422  -1.050  5.243   1.00 0.00 ? 47 LEU A H    1  
ATOM 687   H HA   . LEU A 1 47 ? -0.053  0.805   3.226   1.00 0.00 ? 47 LEU A HA   1  
ATOM 688   H HB2  . LEU A 1 47 ? -2.235  0.175   4.359   1.00 0.00 ? 47 LEU A HB2  1  
ATOM 689   H HB3  . LEU A 1 47 ? -1.748  1.163   5.728   1.00 0.00 ? 47 LEU A HB3  1  
ATOM 690   H HG   . LEU A 1 47 ? -1.568  3.175   4.061   1.00 0.00 ? 47 LEU A HG   1  
ATOM 691   H HD11 . LEU A 1 47 ? -3.196  1.215   2.374   1.00 0.00 ? 47 LEU A HD11 1  
ATOM 692   H HD12 . LEU A 1 47 ? -2.881  2.923   2.005   1.00 0.00 ? 47 LEU A HD12 1  
ATOM 693   H HD13 . LEU A 1 47 ? -1.550  1.760   1.957   1.00 0.00 ? 47 LEU A HD13 1  
ATOM 694   H HD21 . LEU A 1 47 ? -3.493  2.731   5.600   1.00 0.00 ? 47 LEU A HD21 1  
ATOM 695   H HD22 . LEU A 1 47 ? -3.936  3.562   4.087   1.00 0.00 ? 47 LEU A HD22 1  
ATOM 696   H HD23 . LEU A 1 47 ? -4.294  1.835   4.304   1.00 0.00 ? 47 LEU A HD23 1  
ATOM 697   N N    . GLU A 1 48 ? 0.887   2.013   6.160   1.00 0.00 ? 48 GLU A N    1  
ATOM 698   C CA   . GLU A 1 48 ? 1.675   2.985   6.883   1.00 0.00 ? 48 GLU A CA   1  
ATOM 699   C C    . GLU A 1 48 ? 3.049   3.131   6.218   1.00 0.00 ? 48 GLU A C    1  
ATOM 700   O O    . GLU A 1 48 ? 3.335   4.171   5.624   1.00 0.00 ? 48 GLU A O    1  
ATOM 701   C CB   . GLU A 1 48 ? 1.730   2.479   8.334   1.00 0.00 ? 48 GLU A CB   1  
ATOM 702   C CG   . GLU A 1 48 ? 2.229   3.520   9.317   1.00 0.00 ? 48 GLU A CG   1  
ATOM 703   C CD   . GLU A 1 48 ? 2.574   2.870   10.656  1.00 0.00 ? 48 GLU A CD   1  
ATOM 704   O OE1  . GLU A 1 48 ? 1.732   2.155   11.241  1.00 0.00 ? 48 GLU A OE1  1  
ATOM 705   O OE2  . GLU A 1 48 ? 3.713   3.062   11.144  1.00 0.00 ? 48 GLU A OE2  1  
ATOM 706   H H    . GLU A 1 48 ? 0.514   1.274   6.745   1.00 0.00 ? 48 GLU A H    1  
ATOM 707   H HA   . GLU A 1 48 ? 1.171   3.953   6.843   1.00 0.00 ? 48 GLU A HA   1  
ATOM 708   H HB2  . GLU A 1 48 ? 0.732   2.192   8.660   1.00 0.00 ? 48 GLU A HB2  1  
ATOM 709   H HB3  . GLU A 1 48 ? 2.366   1.594   8.389   1.00 0.00 ? 48 GLU A HB3  1  
ATOM 710   H HG2  . GLU A 1 48 ? 3.112   3.971   8.889   1.00 0.00 ? 48 GLU A HG2  1  
ATOM 711   H HG3  . GLU A 1 48 ? 1.471   4.291   9.455   1.00 0.00 ? 48 GLU A HG3  1  
ATOM 712   N N    . TYR A 1 49 ? 3.856   2.065   6.240   1.00 0.00 ? 49 TYR A N    1  
ATOM 713   C CA   . TYR A 1 49 ? 5.150   1.985   5.569   1.00 0.00 ? 49 TYR A CA   1  
ATOM 714   C C    . TYR A 1 49 ? 5.046   2.471   4.126   1.00 0.00 ? 49 TYR A C    1  
ATOM 715   O O    . TYR A 1 49 ? 5.844   3.292   3.694   1.00 0.00 ? 49 TYR A O    1  
ATOM 716   C CB   . TYR A 1 49 ? 5.627   0.521   5.599   1.00 0.00 ? 49 TYR A CB   1  
ATOM 717   C CG   . TYR A 1 49 ? 6.720   0.131   4.616   1.00 0.00 ? 49 TYR A CG   1  
ATOM 718   C CD1  . TYR A 1 49 ? 6.329   -0.341  3.356   1.00 0.00 ? 49 TYR A CD1  1  
ATOM 719   C CD2  . TYR A 1 49 ? 8.089   0.193   4.936   1.00 0.00 ? 49 TYR A CD2  1  
ATOM 720   C CE1  . TYR A 1 49 ? 7.269   -0.750  2.404   1.00 0.00 ? 49 TYR A CE1  1  
ATOM 721   C CE2  . TYR A 1 49 ? 9.050   -0.227  3.993   1.00 0.00 ? 49 TYR A CE2  1  
ATOM 722   C CZ   . TYR A 1 49 ? 8.641   -0.700  2.723   1.00 0.00 ? 49 TYR A CZ   1  
ATOM 723   O OH   . TYR A 1 49 ? 9.546   -1.115  1.797   1.00 0.00 ? 49 TYR A OH   1  
ATOM 724   H H    . TYR A 1 49 ? 3.505   1.220   6.671   1.00 0.00 ? 49 TYR A H    1  
ATOM 725   H HA   . TYR A 1 49 ? 5.864   2.627   6.095   1.00 0.00 ? 49 TYR A HA   1  
ATOM 726   H HB2  . TYR A 1 49 ? 5.925   0.251   6.598   1.00 0.00 ? 49 TYR A HB2  1  
ATOM 727   H HB3  . TYR A 1 49 ? 4.773   -0.115  5.379   1.00 0.00 ? 49 TYR A HB3  1  
ATOM 728   H HD1  . TYR A 1 49 ? 5.282   -0.365  3.130   1.00 0.00 ? 49 TYR A HD1  1  
ATOM 729   H HD2  . TYR A 1 49 ? 8.406   0.562   5.901   1.00 0.00 ? 49 TYR A HD2  1  
ATOM 730   H HE1  . TYR A 1 49 ? 6.932   -1.099  1.435   1.00 0.00 ? 49 TYR A HE1  1  
ATOM 731   H HE2  . TYR A 1 49 ? 10.103  -0.183  4.231   1.00 0.00 ? 49 TYR A HE2  1  
ATOM 732   H HH   . TYR A 1 49 ? 9.107   -1.142  0.930   1.00 0.00 ? 49 TYR A HH   1  
ATOM 733   N N    . LYS A 1 50 ? 4.086   1.956   3.359   1.00 0.00 ? 50 LYS A N    1  
ATOM 734   C CA   . LYS A 1 50 ? 3.986   2.176   1.934   1.00 0.00 ? 50 LYS A CA   1  
ATOM 735   C C    . LYS A 1 50 ? 3.698   3.639   1.617   1.00 0.00 ? 50 LYS A C    1  
ATOM 736   O O    . LYS A 1 50 ? 4.315   4.169   0.700   1.00 0.00 ? 50 LYS A O    1  
ATOM 737   C CB   . LYS A 1 50 ? 2.901   1.245   1.390   1.00 0.00 ? 50 LYS A CB   1  
ATOM 738   C CG   . LYS A 1 50 ? 3.259   -0.240  1.334   1.00 0.00 ? 50 LYS A CG   1  
ATOM 739   C CD   . LYS A 1 50 ? 4.393   -0.520  0.348   1.00 0.00 ? 50 LYS A CD   1  
ATOM 740   C CE   . LYS A 1 50 ? 4.575   -2.029  0.200   1.00 0.00 ? 50 LYS A CE   1  
ATOM 741   N NZ   . LYS A 1 50 ? 5.301   -2.378  -1.034  1.00 0.00 ? 50 LYS A NZ   1  
ATOM 742   H H    . LYS A 1 50 ? 3.409   1.315   3.756   1.00 0.00 ? 50 LYS A H    1  
ATOM 743   H HA   . LYS A 1 50 ? 4.947   1.944   1.478   1.00 0.00 ? 50 LYS A HA   1  
ATOM 744   H HB2  . LYS A 1 50 ? 2.024   1.321   2.031   1.00 0.00 ? 50 LYS A HB2  1  
ATOM 745   H HB3  . LYS A 1 50 ? 2.673   1.572   0.383   1.00 0.00 ? 50 LYS A HB3  1  
ATOM 746   H HG2  . LYS A 1 50 ? 3.515   -0.608  2.326   1.00 0.00 ? 50 LYS A HG2  1  
ATOM 747   H HG3  . LYS A 1 50 ? 2.373   -0.783  1.018   1.00 0.00 ? 50 LYS A HG3  1  
ATOM 748   H HD2  . LYS A 1 50 ? 4.163   -0.080  -0.608  1.00 0.00 ? 50 LYS A HD2  1  
ATOM 749   H HD3  . LYS A 1 50 ? 5.309   -0.047  0.681   1.00 0.00 ? 50 LYS A HD3  1  
ATOM 750   H HE2  . LYS A 1 50 ? 5.118   -2.407  1.068   1.00 0.00 ? 50 LYS A HE2  1  
ATOM 751   H HE3  . LYS A 1 50 ? 3.595   -2.508  0.169   1.00 0.00 ? 50 LYS A HE3  1  
ATOM 752   H HZ1  . LYS A 1 50 ? 5.622   -3.336  -1.003  1.00 0.00 ? 50 LYS A HZ1  1  
ATOM 753   H HZ2  . LYS A 1 50 ? 4.695   -2.278  -1.850  1.00 0.00 ? 50 LYS A HZ2  1  
ATOM 754   H HZ3  . LYS A 1 50 ? 6.100   -1.774  -1.183  1.00 0.00 ? 50 LYS A HZ3  1  
ATOM 755   N N    . VAL A 1 51 ? 2.846   4.318   2.380   1.00 0.00 ? 51 VAL A N    1  
ATOM 756   C CA   . VAL A 1 51 ? 2.661   5.763   2.290   1.00 0.00 ? 51 VAL A CA   1  
ATOM 757   C C    . VAL A 1 51 ? 4.014   6.450   2.546   1.00 0.00 ? 51 VAL A C    1  
ATOM 758   O O    . VAL A 1 51 ? 4.464   7.264   1.740   1.00 0.00 ? 51 VAL A O    1  
ATOM 759   C CB   . VAL A 1 51 ? 1.555   6.175   3.289   1.00 0.00 ? 51 VAL A CB   1  
ATOM 760   C CG1  . VAL A 1 51 ? 1.361   7.686   3.410   1.00 0.00 ? 51 VAL A CG1  1  
ATOM 761   C CG2  . VAL A 1 51 ? 0.175   5.617   2.908   1.00 0.00 ? 51 VAL A CG2  1  
ATOM 762   H H    . VAL A 1 51 ? 2.375   3.835   3.141   1.00 0.00 ? 51 VAL A H    1  
ATOM 763   H HA   . VAL A 1 51 ? 2.342   6.017   1.279   1.00 0.00 ? 51 VAL A HA   1  
ATOM 764   H HB   . VAL A 1 51 ? 1.811   5.794   4.277   1.00 0.00 ? 51 VAL A HB   1  
ATOM 765   H HG11 . VAL A 1 51 ? 0.526   7.873   4.088   1.00 0.00 ? 51 VAL A HG11 1  
ATOM 766   H HG12 . VAL A 1 51 ? 2.255   8.143   3.829   1.00 0.00 ? 51 VAL A HG12 1  
ATOM 767   H HG13 . VAL A 1 51 ? 1.153   8.117   2.429   1.00 0.00 ? 51 VAL A HG13 1  
ATOM 768   H HG21 . VAL A 1 51 ? 0.234   4.558   2.686   1.00 0.00 ? 51 VAL A HG21 1  
ATOM 769   H HG22 . VAL A 1 51 ? -0.497  5.745   3.756   1.00 0.00 ? 51 VAL A HG22 1  
ATOM 770   H HG23 . VAL A 1 51 ? -0.221  6.134   2.035   1.00 0.00 ? 51 VAL A HG23 1  
ATOM 771   N N    . LYS A 1 52 ? 4.676   6.099   3.652   1.00 0.00 ? 52 LYS A N    1  
ATOM 772   C CA   . LYS A 1 52 ? 5.921   6.696   4.169   1.00 0.00 ? 52 LYS A CA   1  
ATOM 773   C C    . LYS A 1 52 ? 7.141   6.377   3.313   1.00 0.00 ? 52 LYS A C    1  
ATOM 774   O O    . LYS A 1 52 ? 8.223   6.914   3.532   1.00 0.00 ? 52 LYS A O    1  
ATOM 775   C CB   . LYS A 1 52 ? 6.083   6.210   5.619   1.00 0.00 ? 52 LYS A CB   1  
ATOM 776   C CG   . LYS A 1 52 ? 4.995   6.884   6.476   1.00 0.00 ? 52 LYS A CG   1  
ATOM 777   C CD   . LYS A 1 52 ? 4.485   6.041   7.650   1.00 0.00 ? 52 LYS A CD   1  
ATOM 778   C CE   . LYS A 1 52 ? 4.836   6.574   9.043   1.00 0.00 ? 52 LYS A CE   1  
ATOM 779   N NZ   . LYS A 1 52 ? 6.289   6.640   9.304   1.00 0.00 ? 52 LYS A NZ   1  
ATOM 780   H H    . LYS A 1 52 ? 4.248   5.396   4.250   1.00 0.00 ? 52 LYS A H    1  
ATOM 781   H HA   . LYS A 1 52 ? 5.833   7.782   4.175   1.00 0.00 ? 52 LYS A HA   1  
ATOM 782   H HB2  . LYS A 1 52 ? 5.978   5.125   5.637   1.00 0.00 ? 52 LYS A HB2  1  
ATOM 783   H HB3  . LYS A 1 52 ? 7.068   6.452   6.011   1.00 0.00 ? 52 LYS A HB3  1  
ATOM 784   H HG2  . LYS A 1 52 ? 5.353   7.847   6.831   1.00 0.00 ? 52 LYS A HG2  1  
ATOM 785   H HG3  . LYS A 1 52 ? 4.136   7.068   5.832   1.00 0.00 ? 52 LYS A HG3  1  
ATOM 786   H HD2  . LYS A 1 52 ? 3.393   6.007   7.563   1.00 0.00 ? 52 LYS A HD2  1  
ATOM 787   H HD3  . LYS A 1 52 ? 4.844   5.018   7.558   1.00 0.00 ? 52 LYS A HD3  1  
ATOM 788   H HE2  . LYS A 1 52 ? 4.393   7.561   9.167   1.00 0.00 ? 52 LYS A HE2  1  
ATOM 789   H HE3  . LYS A 1 52 ? 4.390   5.901   9.774   1.00 0.00 ? 52 LYS A HE3  1  
ATOM 790   H HZ1  . LYS A 1 52 ? 6.699   5.713   9.193   1.00 0.00 ? 52 LYS A HZ1  1  
ATOM 791   H HZ2  . LYS A 1 52 ? 6.762   7.266   8.659   1.00 0.00 ? 52 LYS A HZ2  1  
ATOM 792   H HZ3  . LYS A 1 52 ? 6.470   6.984   10.236  1.00 0.00 ? 52 LYS A HZ3  1  
ATOM 793   N N    . GLU A 1 53 ? 6.973   5.473   2.366   1.00 0.00 ? 53 GLU A N    1  
ATOM 794   C CA   . GLU A 1 53 ? 7.903   5.085   1.331   1.00 0.00 ? 53 GLU A CA   1  
ATOM 795   C C    . GLU A 1 53 ? 7.585   5.888   0.052   1.00 0.00 ? 53 GLU A C    1  
ATOM 796   O O    . GLU A 1 53 ? 8.413   6.657   -0.445  1.00 0.00 ? 53 GLU A O    1  
ATOM 797   C CB   . GLU A 1 53 ? 7.742   3.562   1.201   1.00 0.00 ? 53 GLU A CB   1  
ATOM 798   C CG   . GLU A 1 53 ? 8.529   2.927   0.072   1.00 0.00 ? 53 GLU A CG   1  
ATOM 799   C CD   . GLU A 1 53 ? 9.886   2.338   0.473   1.00 0.00 ? 53 GLU A CD   1  
ATOM 800   O OE1  . GLU A 1 53 ? 10.662  2.937   1.260   1.00 0.00 ? 53 GLU A OE1  1  
ATOM 801   O OE2  . GLU A 1 53 ? 10.220  1.262   -0.078  1.00 0.00 ? 53 GLU A OE2  1  
ATOM 802   H H    . GLU A 1 53 ? 6.102   4.962   2.429   1.00 0.00 ? 53 GLU A H    1  
ATOM 803   H HA   . GLU A 1 53 ? 8.922   5.303   1.645   1.00 0.00 ? 53 GLU A HA   1  
ATOM 804   H HB2  . GLU A 1 53 ? 8.023   3.082   2.137   1.00 0.00 ? 53 GLU A HB2  1  
ATOM 805   H HB3  . GLU A 1 53 ? 6.693   3.340   1.020   1.00 0.00 ? 53 GLU A HB3  1  
ATOM 806   H HG2  . GLU A 1 53 ? 7.903   2.130   -0.327  1.00 0.00 ? 53 GLU A HG2  1  
ATOM 807   H HG3  . GLU A 1 53 ? 8.657   3.659   -0.710  1.00 0.00 ? 53 GLU A HG3  1  
ATOM 808   N N    . ARG A 1 54 ? 6.367   5.737   -0.488  1.00 0.00 ? 54 ARG A N    1  
ATOM 809   C CA   . ARG A 1 54 ? 5.909   6.374   -1.732  1.00 0.00 ? 54 ARG A CA   1  
ATOM 810   C C    . ARG A 1 54 ? 5.960   7.901   -1.663  1.00 0.00 ? 54 ARG A C    1  
ATOM 811   O O    . ARG A 1 54 ? 6.061   8.556   -2.703  1.00 0.00 ? 54 ARG A O    1  
ATOM 812   C CB   . ARG A 1 54 ? 4.490   5.879   -2.083  1.00 0.00 ? 54 ARG A CB   1  
ATOM 813   C CG   . ARG A 1 54 ? 4.419   4.406   -2.513  1.00 0.00 ? 54 ARG A CG   1  
ATOM 814   C CD   . ARG A 1 54 ? 4.901   4.239   -3.954  1.00 0.00 ? 54 ARG A CD   1  
ATOM 815   N NE   . ARG A 1 54 ? 5.365   2.870   -4.202  1.00 0.00 ? 54 ARG A NE   1  
ATOM 816   C CZ   . ARG A 1 54 ? 6.474   2.545   -4.870  1.00 0.00 ? 54 ARG A CZ   1  
ATOM 817   N NH1  . ARG A 1 54 ? 7.101   3.440   -5.626  1.00 0.00 ? 54 ARG A NH1  1  
ATOM 818   N NH2  . ARG A 1 54 ? 6.981   1.328   -4.761  1.00 0.00 ? 54 ARG A NH2  1  
ATOM 819   H H    . ARG A 1 54 ? 5.697   5.150   0.001   1.00 0.00 ? 54 ARG A H    1  
ATOM 820   H HA   . ARG A 1 54 ? 6.586   6.093   -2.534  1.00 0.00 ? 54 ARG A HA   1  
ATOM 821   H HB2  . ARG A 1 54 ? 3.850   6.011   -1.211  1.00 0.00 ? 54 ARG A HB2  1  
ATOM 822   H HB3  . ARG A 1 54 ? 4.093   6.488   -2.896  1.00 0.00 ? 54 ARG A HB3  1  
ATOM 823   H HG2  . ARG A 1 54 ? 5.026   3.798   -1.842  1.00 0.00 ? 54 ARG A HG2  1  
ATOM 824   H HG3  . ARG A 1 54 ? 3.387   4.061   -2.452  1.00 0.00 ? 54 ARG A HG3  1  
ATOM 825   H HD2  . ARG A 1 54 ? 4.097   4.489   -4.649  1.00 0.00 ? 54 ARG A HD2  1  
ATOM 826   H HD3  . ARG A 1 54 ? 5.727   4.927   -4.110  1.00 0.00 ? 54 ARG A HD3  1  
ATOM 827   H HE   . ARG A 1 54 ? 4.752   2.145   -3.822  1.00 0.00 ? 54 ARG A HE   1  
ATOM 828   H HH11 . ARG A 1 54 ? 6.679   4.365   -5.753  1.00 0.00 ? 54 ARG A HH11 1  
ATOM 829   H HH12 . ARG A 1 54 ? 7.947   3.227   -6.144  1.00 0.00 ? 54 ARG A HH12 1  
ATOM 830   H HH21 . ARG A 1 54 ? 6.586   0.642   -4.125  1.00 0.00 ? 54 ARG A HH21 1  
ATOM 831   H HH22 . ARG A 1 54 ? 7.847   1.081   -5.246  1.00 0.00 ? 54 ARG A HH22 1  
ATOM 832   N N    . LEU A 1 55 ? 5.969   8.472   -0.456  1.00 0.00 ? 55 LEU A N    1  
ATOM 833   C CA   . LEU A 1 55 ? 6.213   9.889   -0.198  1.00 0.00 ? 55 LEU A CA   1  
ATOM 834   C C    . LEU A 1 55 ? 7.508   10.399  -0.858  1.00 0.00 ? 55 LEU A C    1  
ATOM 835   O O    . LEU A 1 55 ? 7.607   11.597  -1.135  1.00 0.00 ? 55 LEU A O    1  
ATOM 836   C CB   . LEU A 1 55 ? 6.181   10.140  1.328   1.00 0.00 ? 55 LEU A CB   1  
ATOM 837   C CG   . LEU A 1 55 ? 4.799   10.628  1.810   1.00 0.00 ? 55 LEU A CG   1  
ATOM 838   C CD1  . LEU A 1 55 ? 4.640   10.484  3.328   1.00 0.00 ? 55 LEU A CD1  1  
ATOM 839   C CD2  . LEU A 1 55 ? 4.588   12.102  1.451   1.00 0.00 ? 55 LEU A CD2  1  
ATOM 840   H H    . LEU A 1 55 ? 5.796   7.875   0.345   1.00 0.00 ? 55 LEU A H    1  
ATOM 841   H HA   . LEU A 1 55 ? 5.396   10.444  -0.660  1.00 0.00 ? 55 LEU A HA   1  
ATOM 842   H HB2  . LEU A 1 55 ? 6.453   9.224   1.854   1.00 0.00 ? 55 LEU A HB2  1  
ATOM 843   H HB3  . LEU A 1 55 ? 6.926   10.885  1.599   1.00 0.00 ? 55 LEU A HB3  1  
ATOM 844   H HG   . LEU A 1 55 ? 4.020   10.029  1.339   1.00 0.00 ? 55 LEU A HG   1  
ATOM 845   H HD11 . LEU A 1 55 ? 3.662   10.847  3.640   1.00 0.00 ? 55 LEU A HD11 1  
ATOM 846   H HD12 . LEU A 1 55 ? 4.685   9.432   3.593   1.00 0.00 ? 55 LEU A HD12 1  
ATOM 847   H HD13 . LEU A 1 55 ? 5.431   11.024  3.851   1.00 0.00 ? 55 LEU A HD13 1  
ATOM 848   H HD21 . LEU A 1 55 ? 3.540   12.364  1.603   1.00 0.00 ? 55 LEU A HD21 1  
ATOM 849   H HD22 . LEU A 1 55 ? 5.236   12.740  2.052   1.00 0.00 ? 55 LEU A HD22 1  
ATOM 850   H HD23 . LEU A 1 55 ? 4.813   12.274  0.399   1.00 0.00 ? 55 LEU A HD23 1  
ATOM 851   N N    . GLY A 1 56 ? 8.450   9.519   -1.218  1.00 0.00 ? 56 GLY A N    1  
ATOM 852   C CA   . GLY A 1 56 ? 9.567   9.839   -2.104  1.00 0.00 ? 56 GLY A CA   1  
ATOM 853   C C    . GLY A 1 56 ? 10.940  9.623   -1.477  1.00 0.00 ? 56 GLY A C    1  
ATOM 854   O O    . GLY A 1 56 ? 11.931  10.201  -1.923  1.00 0.00 ? 56 GLY A O    1  
ATOM 855   H H    . GLY A 1 56 ? 8.320   8.544   -0.965  1.00 0.00 ? 56 GLY A H    1  
ATOM 856   H HA2  . GLY A 1 56 ? 9.482   9.203   -2.982  1.00 0.00 ? 56 GLY A HA2  1  
ATOM 857   H HA3  . GLY A 1 56 ? 9.506   10.873  -2.442  1.00 0.00 ? 56 GLY A HA3  1  
ATOM 858   N N    . THR A 1 57 ? 11.039  8.780   -0.455  1.00 0.00 ? 57 THR A N    1  
ATOM 859   C CA   . THR A 1 57 ? 12.315  8.311   0.082   1.00 0.00 ? 57 THR A CA   1  
ATOM 860   C C    . THR A 1 57 ? 13.021  7.367   -0.903  1.00 0.00 ? 57 THR A C    1  
ATOM 861   O O    . THR A 1 57 ? 14.231  7.160   -0.837  1.00 0.00 ? 57 THR A O    1  
ATOM 862   C CB   . THR A 1 57 ? 12.000  7.584   1.390   1.00 0.00 ? 57 THR A CB   1  
ATOM 863   O OG1  . THR A 1 57 ? 10.957  6.660   1.187   1.00 0.00 ? 57 THR A OG1  1  
ATOM 864   C CG2  . THR A 1 57 ? 11.541  8.575   2.463   1.00 0.00 ? 57 THR A CG2  1  
ATOM 865   H H    . THR A 1 57 ? 10.230  8.290   -0.083  1.00 0.00 ? 57 THR A H    1  
ATOM 866   H HA   . THR A 1 57 ? 12.973  9.156   0.288   1.00 0.00 ? 57 THR A HA   1  
ATOM 867   H HB   . THR A 1 57 ? 12.881  7.040   1.725   1.00 0.00 ? 57 THR A HB   1  
ATOM 868   H HG1  . THR A 1 57 ? 11.043  5.997   1.900   1.00 0.00 ? 57 THR A HG1  1  
ATOM 869   H HG21 . THR A 1 57 ? 11.048  8.037   3.267   1.00 0.00 ? 57 THR A HG21 1  
ATOM 870   H HG22 . THR A 1 57 ? 12.405  9.117   2.848   1.00 0.00 ? 57 THR A HG22 1  
ATOM 871   H HG23 . THR A 1 57 ? 10.817  9.287   2.065   1.00 0.00 ? 57 THR A HG23 1  
ATOM 872   N N    . LEU A 1 58 ? 12.251  6.801   -1.836  1.00 0.00 ? 58 LEU A N    1  
ATOM 873   C CA   . LEU A 1 58 ? 12.647  5.779   -2.792  1.00 0.00 ? 58 LEU A CA   1  
ATOM 874   C C    . LEU A 1 58 ? 13.740  6.253   -3.749  1.00 0.00 ? 58 LEU A C    1  
ATOM 875   O O    . LEU A 1 58 ? 14.463  5.413   -4.294  1.00 0.00 ? 58 LEU A O    1  
ATOM 876   C CB   . LEU A 1 58 ? 11.403  5.396   -3.605  1.00 0.00 ? 58 LEU A CB   1  
ATOM 877   C CG   . LEU A 1 58 ? 10.366  4.600   -2.790  1.00 0.00 ? 58 LEU A CG   1  
ATOM 878   C CD1  . LEU A 1 58 ? 8.961   4.969   -3.275  1.00 0.00 ? 58 LEU A CD1  1  
ATOM 879   C CD2  . LEU A 1 58 ? 10.591  3.093   -2.961  1.00 0.00 ? 58 LEU A CD2  1  
ATOM 880   H H    . LEU A 1 58 ? 11.265  7.006   -1.762  1.00 0.00 ? 58 LEU A H    1  
ATOM 881   H HA   . LEU A 1 58 ? 13.013  4.907   -2.248  1.00 0.00 ? 58 LEU A HA   1  
ATOM 882   H HB2  . LEU A 1 58 ? 10.948  6.312   -3.981  1.00 0.00 ? 58 LEU A HB2  1  
ATOM 883   H HB3  . LEU A 1 58 ? 11.706  4.818   -4.476  1.00 0.00 ? 58 LEU A HB3  1  
ATOM 884   H HG   . LEU A 1 58 ? 10.449  4.858   -1.729  1.00 0.00 ? 58 LEU A HG   1  
ATOM 885   H HD11 . LEU A 1 58 ? 8.209   4.357   -2.778  1.00 0.00 ? 58 LEU A HD11 1  
ATOM 886   H HD12 . LEU A 1 58 ? 8.764   6.015   -3.038  1.00 0.00 ? 58 LEU A HD12 1  
ATOM 887   H HD13 . LEU A 1 58 ? 8.894   4.840   -4.353  1.00 0.00 ? 58 LEU A HD13 1  
ATOM 888   H HD21 . LEU A 1 58 ? 9.881   2.532   -2.360  1.00 0.00 ? 58 LEU A HD21 1  
ATOM 889   H HD22 . LEU A 1 58 ? 10.440  2.805   -3.997  1.00 0.00 ? 58 LEU A HD22 1  
ATOM 890   H HD23 . LEU A 1 58 ? 11.603  2.832   -2.654  1.00 0.00 ? 58 LEU A HD23 1  
ATOM 891   N N    . LYS A 1 59 ? 13.844  7.556   -4.016  1.00 0.00 ? 59 LYS A N    1  
ATOM 892   C CA   . LYS A 1 59 ? 14.898  8.145   -4.835  1.00 0.00 ? 59 LYS A CA   1  
ATOM 893   C C    . LYS A 1 59 ? 16.037  8.562   -3.914  1.00 0.00 ? 59 LYS A C    1  
ATOM 894   O O    . LYS A 1 59 ? 15.777  9.102   -2.838  1.00 0.00 ? 59 LYS A O    1  
ATOM 895   C CB   . LYS A 1 59 ? 14.337  9.367   -5.568  1.00 0.00 ? 59 LYS A CB   1  
ATOM 896   C CG   . LYS A 1 59 ? 15.163  9.783   -6.791  1.00 0.00 ? 59 LYS A CG   1  
ATOM 897   C CD   . LYS A 1 59 ? 14.929  8.840   -7.981  1.00 0.00 ? 59 LYS A CD   1  
ATOM 898   C CE   . LYS A 1 59 ? 14.964  9.609   -9.302  1.00 0.00 ? 59 LYS A CE   1  
ATOM 899   N NZ   . LYS A 1 59 ? 13.781  10.477  -9.486  1.00 0.00 ? 59 LYS A NZ   1  
ATOM 900   H H    . LYS A 1 59 ? 13.213  8.186   -3.538  1.00 0.00 ? 59 LYS A H    1  
ATOM 901   H HA   . LYS A 1 59 ? 15.253  7.409   -5.556  1.00 0.00 ? 59 LYS A HA   1  
ATOM 902   H HB2  . LYS A 1 59 ? 13.322  9.170   -5.906  1.00 0.00 ? 59 LYS A HB2  1  
ATOM 903   H HB3  . LYS A 1 59 ? 14.292  10.194  -4.862  1.00 0.00 ? 59 LYS A HB3  1  
ATOM 904   H HG2  . LYS A 1 59 ? 14.861  10.793  -7.062  1.00 0.00 ? 59 LYS A HG2  1  
ATOM 905   H HG3  . LYS A 1 59 ? 16.227  9.809   -6.553  1.00 0.00 ? 59 LYS A HG3  1  
ATOM 906   H HD2  . LYS A 1 59 ? 15.708  8.076   -7.988  1.00 0.00 ? 59 LYS A HD2  1  
ATOM 907   H HD3  . LYS A 1 59 ? 13.963  8.341   -7.894  1.00 0.00 ? 59 LYS A HD3  1  
ATOM 908   H HE2  . LYS A 1 59 ? 15.872  10.212  -9.346  1.00 0.00 ? 59 LYS A HE2  1  
ATOM 909   H HE3  . LYS A 1 59 ? 14.987  8.889   -10.121 1.00 0.00 ? 59 LYS A HE3  1  
ATOM 910   H HZ1  . LYS A 1 59 ? 13.738  11.251  -8.830  1.00 0.00 ? 59 LYS A HZ1  1  
ATOM 911   H HZ2  . LYS A 1 59 ? 13.801  10.871  -10.426 1.00 0.00 ? 59 LYS A HZ2  1  
ATOM 912   H HZ3  . LYS A 1 59 ? 12.918  9.954   -9.402  1.00 0.00 ? 59 LYS A HZ3  1  
ATOM 913   N N    . ASN A 1 60 ? 17.280  8.365   -4.356  1.00 0.00 ? 60 ASN A N    1  
ATOM 914   C CA   . ASN A 1 60 ? 18.485  8.465   -3.533  1.00 0.00 ? 60 ASN A CA   1  
ATOM 915   C C    . ASN A 1 60 ? 18.284  7.817   -2.148  1.00 0.00 ? 60 ASN A C    1  
ATOM 916   O O    . ASN A 1 60 ? 18.494  8.484   -1.129  1.00 0.00 ? 60 ASN A O    1  
ATOM 917   C CB   . ASN A 1 60 ? 19.010  9.918   -3.448  1.00 0.00 ? 60 ASN A CB   1  
ATOM 918   C CG   . ASN A 1 60 ? 19.461  10.500  -4.782  1.00 0.00 ? 60 ASN A CG   1  
ATOM 919   O OD1  . ASN A 1 60 ? 19.917  9.777   -5.668  1.00 0.00 ? 60 ASN A OD1  1  
ATOM 920   N ND2  . ASN A 1 60 ? 19.344  11.806  -4.975  1.00 0.00 ? 60 ASN A ND2  1  
ATOM 921   H H    . ASN A 1 60 ? 17.400  7.919   -5.255  1.00 0.00 ? 60 ASN A H    1  
ATOM 922   H HA   . ASN A 1 60 ? 19.248  7.879   -4.033  1.00 0.00 ? 60 ASN A HA   1  
ATOM 923   H HB2  . ASN A 1 60 ? 18.227  10.538  -3.013  1.00 0.00 ? 60 ASN A HB2  1  
ATOM 924   H HB3  . ASN A 1 60 ? 19.868  9.941   -2.774  1.00 0.00 ? 60 ASN A HB3  1  
ATOM 925   H HD21 . ASN A 1 60 ? 19.119  12.434  -4.213  1.00 0.00 ? 60 ASN A HD21 1  
ATOM 926   H HD22 . ASN A 1 60 ? 19.657  12.192  -5.862  1.00 0.00 ? 60 ASN A HD22 1  
ATOM 927   N N    . PRO A 1 61 ? 17.929  6.518   -2.078  1.00 0.00 ? 61 PRO A N    1  
ATOM 928   C CA   . PRO A 1 61 ? 17.664  5.846   -0.810  1.00 0.00 ? 61 PRO A CA   1  
ATOM 929   C C    . PRO A 1 61 ? 18.959  5.667   0.010   1.00 0.00 ? 61 PRO A C    1  
ATOM 930   O O    . PRO A 1 61 ? 20.063  5.764   -0.551  1.00 0.00 ? 61 PRO A O    1  
ATOM 931   C CB   . PRO A 1 61 ? 17.039  4.501   -1.196  1.00 0.00 ? 61 PRO A CB   1  
ATOM 932   C CG   . PRO A 1 61 ? 17.693  4.192   -2.539  1.00 0.00 ? 61 PRO A CG   1  
ATOM 933   C CD   . PRO A 1 61 ? 17.827  5.571   -3.181  1.00 0.00 ? 61 PRO A CD   1  
ATOM 934   H HA   . PRO A 1 61 ? 16.941  6.433   -0.241  1.00 0.00 ? 61 PRO A HA   1  
ATOM 935   H HB2  . PRO A 1 61 ? 17.245  3.719   -0.464  1.00 0.00 ? 61 PRO A HB2  1  
ATOM 936   H HB3  . PRO A 1 61 ? 15.963  4.625   -1.331  1.00 0.00 ? 61 PRO A HB3  1  
ATOM 937   H HG2  . PRO A 1 61 ? 18.685  3.772   -2.367  1.00 0.00 ? 61 PRO A HG2  1  
ATOM 938   H HG3  . PRO A 1 61 ? 17.084  3.519   -3.144  1.00 0.00 ? 61 PRO A HG3  1  
ATOM 939   H HD2  . PRO A 1 61 ? 18.714  5.603   -3.815  1.00 0.00 ? 61 PRO A HD2  1  
ATOM 940   H HD3  . PRO A 1 61 ? 16.934  5.784   -3.767  1.00 0.00 ? 61 PRO A HD3  1  
ATOM 941   N N    . PRO A 1 62 ? 18.852  5.412   1.327   1.00 0.00 ? 62 PRO A N    1  
ATOM 942   C CA   . PRO A 1 62 ? 19.994  5.202   2.205   1.00 0.00 ? 62 PRO A CA   1  
ATOM 943   C C    . PRO A 1 62 ? 20.557  3.791   2.024   1.00 0.00 ? 62 PRO A C    1  
ATOM 944   O O    . PRO A 1 62 ? 20.023  2.819   2.564   1.00 0.00 ? 62 PRO A O    1  
ATOM 945   C CB   . PRO A 1 62 ? 19.466  5.441   3.622   1.00 0.00 ? 62 PRO A CB   1  
ATOM 946   C CG   . PRO A 1 62 ? 17.996  5.034   3.530   1.00 0.00 ? 62 PRO A CG   1  
ATOM 947   C CD   . PRO A 1 62 ? 17.613  5.395   2.095   1.00 0.00 ? 62 PRO A CD   1  
ATOM 948   H HA   . PRO A 1 62 ? 20.774  5.933   1.992   1.00 0.00 ? 62 PRO A HA   1  
ATOM 949   H HB2  . PRO A 1 62 ? 20.007  4.861   4.371   1.00 0.00 ? 62 PRO A HB2  1  
ATOM 950   H HB3  . PRO A 1 62 ? 19.535  6.502   3.848   1.00 0.00 ? 62 PRO A HB3  1  
ATOM 951   H HG2  . PRO A 1 62 ? 17.904  3.957   3.670   1.00 0.00 ? 62 PRO A HG2  1  
ATOM 952   H HG3  . PRO A 1 62 ? 17.384  5.568   4.257   1.00 0.00 ? 62 PRO A HG3  1  
ATOM 953   H HD2  . PRO A 1 62 ? 16.913  4.659   1.701   1.00 0.00 ? 62 PRO A HD2  1  
ATOM 954   H HD3  . PRO A 1 62 ? 17.158  6.385   2.076   1.00 0.00 ? 62 PRO A HD3  1  
ATOM 955   N N    . LYS A 1 63 ? 21.653  3.663   1.276   1.00 0.00 ? 63 LYS A N    1  
ATOM 956   C CA   . LYS A 1 63 ? 22.398  2.422   1.145   1.00 0.00 ? 63 LYS A CA   1  
ATOM 957   C C    . LYS A 1 63 ? 23.867  2.788   1.068   1.00 0.00 ? 63 LYS A C    1  
ATOM 958   O O    . LYS A 1 63 ? 24.356  3.255   0.042   1.00 0.00 ? 63 LYS A O    1  
ATOM 959   C CB   . LYS A 1 63 ? 21.885  1.600   -0.046  1.00 0.00 ? 63 LYS A CB   1  
ATOM 960   C CG   . LYS A 1 63 ? 22.494  0.188   -0.043  1.00 0.00 ? 63 LYS A CG   1  
ATOM 961   C CD   . LYS A 1 63 ? 21.736  -0.780  -0.956  1.00 0.00 ? 63 LYS A CD   1  
ATOM 962   C CE   . LYS A 1 63 ? 21.830  -0.374  -2.427  1.00 0.00 ? 63 LYS A CE   1  
ATOM 963   N NZ   . LYS A 1 63 ? 20.828  -1.086  -3.240  1.00 0.00 ? 63 LYS A NZ   1  
ATOM 964   H H    . LYS A 1 63 ? 22.076  4.485   0.856   1.00 0.00 ? 63 LYS A H    1  
ATOM 965   H HA   . LYS A 1 63 ? 22.244  1.836   2.048   1.00 0.00 ? 63 LYS A HA   1  
ATOM 966   H HB2  . LYS A 1 63 ? 20.801  1.514   0.038   1.00 0.00 ? 63 LYS A HB2  1  
ATOM 967   H HB3  . LYS A 1 63 ? 22.120  2.113   -0.978  1.00 0.00 ? 63 LYS A HB3  1  
ATOM 968   H HG2  . LYS A 1 63 ? 23.535  0.238   -0.353  1.00 0.00 ? 63 LYS A HG2  1  
ATOM 969   H HG3  . LYS A 1 63 ? 22.459  -0.215  0.968   1.00 0.00 ? 63 LYS A HG3  1  
ATOM 970   H HD2  . LYS A 1 63 ? 22.156  -1.781  -0.840  1.00 0.00 ? 63 LYS A HD2  1  
ATOM 971   H HD3  . LYS A 1 63 ? 20.691  -0.804  -0.642  1.00 0.00 ? 63 LYS A HD3  1  
ATOM 972   H HE2  . LYS A 1 63 ? 21.649  0.698   -2.511  1.00 0.00 ? 63 LYS A HE2  1  
ATOM 973   H HE3  . LYS A 1 63 ? 22.838  -0.585  -2.794  1.00 0.00 ? 63 LYS A HE3  1  
ATOM 974   H HZ1  . LYS A 1 63 ? 20.901  -0.800  -4.212  1.00 0.00 ? 63 LYS A HZ1  1  
ATOM 975   H HZ2  . LYS A 1 63 ? 20.986  -2.091  -3.209  1.00 0.00 ? 63 LYS A HZ2  1  
ATOM 976   H HZ3  . LYS A 1 63 ? 19.891  -0.848  -2.930  1.00 0.00 ? 63 LYS A HZ3  1  
ATOM 977   N N    . LYS A 1 64 ? 24.549  2.658   2.203   1.00 0.00 ? 64 LYS A N    1  
ATOM 978   C CA   . LYS A 1 64 ? 25.971  2.955   2.330   1.00 0.00 ? 64 LYS A CA   1  
ATOM 979   C C    . LYS A 1 64 ? 26.588  1.984   3.328   1.00 0.00 ? 64 LYS A C    1  
ATOM 980   O O    . LYS A 1 64 ? 27.567  1.309   3.003   1.00 0.00 ? 64 LYS A O    1  
ATOM 981   C CB   . LYS A 1 64 ? 26.152  4.434   2.715   1.00 0.00 ? 64 LYS A CB   1  
ATOM 982   C CG   . LYS A 1 64 ? 27.578  4.956   2.449   1.00 0.00 ? 64 LYS A CG   1  
ATOM 983   C CD   . LYS A 1 64 ? 27.587  6.202   1.548   1.00 0.00 ? 64 LYS A CD   1  
ATOM 984   C CE   . LYS A 1 64 ? 27.178  5.829   0.117   1.00 0.00 ? 64 LYS A CE   1  
ATOM 985   N NZ   . LYS A 1 64 ? 27.110  7.001   -0.779  1.00 0.00 ? 64 LYS A NZ   1  
ATOM 986   H H    . LYS A 1 64 ? 24.048  2.292   3.000   1.00 0.00 ? 64 LYS A H    1  
ATOM 987   H HA   . LYS A 1 64 ? 26.438  2.790   1.357   1.00 0.00 ? 64 LYS A HA   1  
ATOM 988   H HB2  . LYS A 1 64 ? 25.437  5.033   2.149   1.00 0.00 ? 64 LYS A HB2  1  
ATOM 989   H HB3  . LYS A 1 64 ? 25.913  4.571   3.768   1.00 0.00 ? 64 LYS A HB3  1  
ATOM 990   H HG2  . LYS A 1 64 ? 28.038  5.211   3.403   1.00 0.00 ? 64 LYS A HG2  1  
ATOM 991   H HG3  . LYS A 1 64 ? 28.191  4.182   1.986   1.00 0.00 ? 64 LYS A HG3  1  
ATOM 992   H HD2  . LYS A 1 64 ? 26.905  6.954   1.951   1.00 0.00 ? 64 LYS A HD2  1  
ATOM 993   H HD3  . LYS A 1 64 ? 28.597  6.617   1.531   1.00 0.00 ? 64 LYS A HD3  1  
ATOM 994   H HE2  . LYS A 1 64 ? 27.907  5.121   -0.283  1.00 0.00 ? 64 LYS A HE2  1  
ATOM 995   H HE3  . LYS A 1 64 ? 26.203  5.335   0.128   1.00 0.00 ? 64 LYS A HE3  1  
ATOM 996   H HZ1  . LYS A 1 64 ? 27.962  7.556   -0.734  1.00 0.00 ? 64 LYS A HZ1  1  
ATOM 997   H HZ2  . LYS A 1 64 ? 26.956  6.696   -1.735  1.00 0.00 ? 64 LYS A HZ2  1  
ATOM 998   H HZ3  . LYS A 1 64 ? 26.354  7.626   -0.512  1.00 0.00 ? 64 LYS A HZ3  1  
ATOM 999   N N    . LYS A 1 65 ? 25.995  1.861   4.521   1.00 0.00 ? 65 LYS A N    1  
ATOM 1000  C CA   . LYS A 1 65 ? 26.355  0.851   5.508   1.00 0.00 ? 65 LYS A CA   1  
ATOM 1001  C C    . LYS A 1 65 ? 25.092  0.397   6.237   1.00 0.00 ? 65 LYS A C    1  
ATOM 1002  O O    . LYS A 1 65 ? 24.224  1.232   6.494   1.00 0.00 ? 65 LYS A O    1  
ATOM 1003  C CB   . LYS A 1 65 ? 27.421  1.454   6.445   1.00 0.00 ? 65 LYS A CB   1  
ATOM 1004  C CG   . LYS A 1 65 ? 27.844  0.572   7.634   1.00 0.00 ? 65 LYS A CG   1  
ATOM 1005  C CD   . LYS A 1 65 ? 27.002  0.871   8.880   1.00 0.00 ? 65 LYS A CD   1  
ATOM 1006  C CE   . LYS A 1 65 ? 27.507  0.120   10.112  1.00 0.00 ? 65 LYS A CE   1  
ATOM 1007  N NZ   . LYS A 1 65 ? 26.585  0.307   11.249  1.00 0.00 ? 65 LYS A NZ   1  
ATOM 1008  H H    . LYS A 1 65 ? 25.212  2.449   4.777   1.00 0.00 ? 65 LYS A H    1  
ATOM 1009  H HA   . LYS A 1 65 ? 26.787  0.004   4.982   1.00 0.00 ? 65 LYS A HA   1  
ATOM 1010  H HB2  . LYS A 1 65 ? 28.312  1.651   5.849   1.00 0.00 ? 65 LYS A HB2  1  
ATOM 1011  H HB3  . LYS A 1 65 ? 27.072  2.418   6.819   1.00 0.00 ? 65 LYS A HB3  1  
ATOM 1012  H HG2  . LYS A 1 65 ? 27.772  -0.484  7.371   1.00 0.00 ? 65 LYS A HG2  1  
ATOM 1013  H HG3  . LYS A 1 65 ? 28.886  0.793   7.868   1.00 0.00 ? 65 LYS A HG3  1  
ATOM 1014  H HD2  . LYS A 1 65 ? 27.054  1.941   9.085   1.00 0.00 ? 65 LYS A HD2  1  
ATOM 1015  H HD3  . LYS A 1 65 ? 25.962  0.605   8.705   1.00 0.00 ? 65 LYS A HD3  1  
ATOM 1016  H HE2  . LYS A 1 65 ? 27.592  -0.944  9.885   1.00 0.00 ? 65 LYS A HE2  1  
ATOM 1017  H HE3  . LYS A 1 65 ? 28.492  0.511   10.375  1.00 0.00 ? 65 LYS A HE3  1  
ATOM 1018  H HZ1  . LYS A 1 65 ? 26.988  -0.054  12.110  1.00 0.00 ? 65 LYS A HZ1  1  
ATOM 1019  H HZ2  . LYS A 1 65 ? 26.342  1.285   11.359  1.00 0.00 ? 65 LYS A HZ2  1  
ATOM 1020  H HZ3  . LYS A 1 65 ? 25.709  -0.188  11.102  1.00 0.00 ? 65 LYS A HZ3  1  
ATOM 1021  N N    . MET A 1 66 ? 25.014  -0.880  6.616   1.00 0.00 ? 66 MET A N    1  
ATOM 1022  C CA   . MET A 1 66 ? 24.115  -1.455  7.621   1.00 0.00 ? 66 MET A CA   1  
ATOM 1023  C C    . MET A 1 66 ? 24.811  -2.688  8.218   1.00 0.00 ? 66 MET A C    1  
ATOM 1024  O O    . MET A 1 66 ? 25.779  -3.185  7.637   1.00 0.00 ? 66 MET A O    1  
ATOM 1025  C CB   . MET A 1 66 ? 22.792  -1.936  7.005   1.00 0.00 ? 66 MET A CB   1  
ATOM 1026  C CG   . MET A 1 66 ? 21.799  -0.862  6.560   1.00 0.00 ? 66 MET A CG   1  
ATOM 1027  S SD   . MET A 1 66 ? 20.278  -1.554  5.840   1.00 0.00 ? 66 MET A SD   1  
ATOM 1028  C CE   . MET A 1 66 ? 19.673  -2.616  7.179   1.00 0.00 ? 66 MET A CE   1  
ATOM 1029  H H    . MET A 1 66 ? 25.755  -1.521  6.339   1.00 0.00 ? 66 MET A H    1  
ATOM 1030  H HA   . MET A 1 66 ? 23.914  -0.724  8.406   1.00 0.00 ? 66 MET A HA   1  
ATOM 1031  H HB2  . MET A 1 66 ? 23.009  -2.599  6.167   1.00 0.00 ? 66 MET A HB2  1  
ATOM 1032  H HB3  . MET A 1 66 ? 22.282  -2.513  7.772   1.00 0.00 ? 66 MET A HB3  1  
ATOM 1033  H HG2  . MET A 1 66 ? 21.534  -0.242  7.417   1.00 0.00 ? 66 MET A HG2  1  
ATOM 1034  H HG3  . MET A 1 66 ? 22.268  -0.231  5.808   1.00 0.00 ? 66 MET A HG3  1  
ATOM 1035  H HE1  . MET A 1 66 ? 18.666  -2.949  6.940   1.00 0.00 ? 66 MET A HE1  1  
ATOM 1036  H HE2  . MET A 1 66 ? 20.309  -3.491  7.289   1.00 0.00 ? 66 MET A HE2  1  
ATOM 1037  H HE3  . MET A 1 66 ? 19.664  -2.061  8.113   1.00 0.00 ? 66 MET A HE3  1  
ATOM 1038  N N    . LYS A 1 67 ? 24.318  -3.205  9.350   1.00 0.00 ? 67 LYS A N    1  
ATOM 1039  C CA   . LYS A 1 67 ? 24.576  -4.556  9.848   1.00 0.00 ? 67 LYS A CA   1  
ATOM 1040  C C    . LYS A 1 67 ? 23.460  -4.913  10.834  1.00 0.00 ? 67 LYS A C    1  
ATOM 1041  O O    . LYS A 1 67 ? 23.596  -4.636  12.029  1.00 0.00 ? 67 LYS A O    1  
ATOM 1042  C CB   . LYS A 1 67 ? 25.982  -4.646  10.476  1.00 0.00 ? 67 LYS A CB   1  
ATOM 1043  C CG   . LYS A 1 67 ? 26.424  -6.107  10.691  1.00 0.00 ? 67 LYS A CG   1  
ATOM 1044  C CD   . LYS A 1 67 ? 27.935  -6.242  10.953  1.00 0.00 ? 67 LYS A CD   1  
ATOM 1045  C CE   . LYS A 1 67 ? 28.724  -5.861  9.690   1.00 0.00 ? 67 LYS A CE   1  
ATOM 1046  N NZ   . LYS A 1 67 ? 30.188  -5.849  9.871   1.00 0.00 ? 67 LYS A NZ   1  
ATOM 1047  H H    . LYS A 1 67 ? 23.587  -2.692  9.825   1.00 0.00 ? 67 LYS A H    1  
ATOM 1048  H HA   . LYS A 1 67 ? 24.528  -5.240  8.998   1.00 0.00 ? 67 LYS A HA   1  
ATOM 1049  H HB2  . LYS A 1 67 ? 26.681  -4.156  9.803   1.00 0.00 ? 67 LYS A HB2  1  
ATOM 1050  H HB3  . LYS A 1 67 ? 26.016  -4.105  11.422  1.00 0.00 ? 67 LYS A HB3  1  
ATOM 1051  H HG2  . LYS A 1 67 ? 25.879  -6.521  11.540  1.00 0.00 ? 67 LYS A HG2  1  
ATOM 1052  H HG3  . LYS A 1 67 ? 26.174  -6.696  9.807   1.00 0.00 ? 67 LYS A HG3  1  
ATOM 1053  H HD2  . LYS A 1 67 ? 28.214  -5.595  11.788  1.00 0.00 ? 67 LYS A HD2  1  
ATOM 1054  H HD3  . LYS A 1 67 ? 28.156  -7.278  11.218  1.00 0.00 ? 67 LYS A HD3  1  
ATOM 1055  H HE2  . LYS A 1 67 ? 28.465  -6.548  8.881   1.00 0.00 ? 67 LYS A HE2  1  
ATOM 1056  H HE3  . LYS A 1 67 ? 28.428  -4.860  9.375   1.00 0.00 ? 67 LYS A HE3  1  
ATOM 1057  H HZ1  . LYS A 1 67 ? 30.557  -6.800  9.882   1.00 0.00 ? 67 LYS A HZ1  1  
ATOM 1058  H HZ2  . LYS A 1 67 ? 30.599  -5.349  9.084   1.00 0.00 ? 67 LYS A HZ2  1  
ATOM 1059  H HZ3  . LYS A 1 67 ? 30.454  -5.374  10.716  1.00 0.00 ? 67 LYS A HZ3  1  
ATOM 1060  N N    . LEU A 1 68 ? 22.321  -5.419  10.366  1.00 0.00 ? 68 LEU A N    1  
ATOM 1061  C CA   . LEU A 1 68 ? 21.177  -5.769  11.210  1.00 0.00 ? 68 LEU A CA   1  
ATOM 1062  C C    . LEU A 1 68 ? 20.360  -6.892  10.569  1.00 0.00 ? 68 LEU A C    1  
ATOM 1063  O O    . LEU A 1 68 ? 20.538  -7.203  9.390   1.00 0.00 ? 68 LEU A O    1  
ATOM 1064  C CB   . LEU A 1 68 ? 20.293  -4.517  11.446  1.00 0.00 ? 68 LEU A CB   1  
ATOM 1065  C CG   . LEU A 1 68 ? 20.227  -4.108  12.929  1.00 0.00 ? 68 LEU A CG   1  
ATOM 1066  C CD1  . LEU A 1 68 ? 19.591  -2.722  13.068  1.00 0.00 ? 68 LEU A CD1  1  
ATOM 1067  C CD2  . LEU A 1 68 ? 19.434  -5.104  13.778  1.00 0.00 ? 68 LEU A CD2  1  
ATOM 1068  H H    . LEU A 1 68 ? 22.218  -5.594  9.367   1.00 0.00 ? 68 LEU A H    1  
ATOM 1069  H HA   . LEU A 1 68 ? 21.561  -6.142  12.162  1.00 0.00 ? 68 LEU A HA   1  
ATOM 1070  H HB2  . LEU A 1 68 ? 20.691  -3.679  10.870  1.00 0.00 ? 68 LEU A HB2  1  
ATOM 1071  H HB3  . LEU A 1 68 ? 19.279  -4.694  11.079  1.00 0.00 ? 68 LEU A HB3  1  
ATOM 1072  H HG   . LEU A 1 68 ? 21.240  -4.054  13.325  1.00 0.00 ? 68 LEU A HG   1  
ATOM 1073  H HD11 . LEU A 1 68 ? 20.183  -1.988  12.522  1.00 0.00 ? 68 LEU A HD11 1  
ATOM 1074  H HD12 . LEU A 1 68 ? 18.577  -2.732  12.665  1.00 0.00 ? 68 LEU A HD12 1  
ATOM 1075  H HD13 . LEU A 1 68 ? 19.561  -2.435  14.120  1.00 0.00 ? 68 LEU A HD13 1  
ATOM 1076  H HD21 . LEU A 1 68 ? 19.455  -4.790  14.822  1.00 0.00 ? 68 LEU A HD21 1  
ATOM 1077  H HD22 . LEU A 1 68 ? 18.396  -5.151  13.450  1.00 0.00 ? 68 LEU A HD22 1  
ATOM 1078  H HD23 . LEU A 1 68 ? 19.878  -6.094  13.725  1.00 0.00 ? 68 LEU A HD23 1  
ATOM 1079  N N    . MET A 1 69 ? 19.421  -7.451  11.333  1.00 0.00 ? 69 MET A N    1  
ATOM 1080  C CA   . MET A 1 69 ? 18.330  -8.303  10.874  1.00 0.00 ? 69 MET A CA   1  
ATOM 1081  C C    . MET A 1 69 ? 17.050  -7.817  11.578  1.00 0.00 ? 69 MET A C    1  
ATOM 1082  O O    . MET A 1 69 ? 16.958  -6.631  11.913  1.00 0.00 ? 69 MET A O    1  
ATOM 1083  C CB   . MET A 1 69 ? 18.651  -9.798  11.072  1.00 0.00 ? 69 MET A CB   1  
ATOM 1084  C CG   . MET A 1 69 ? 19.868  -10.251 10.258  1.00 0.00 ? 69 MET A CG   1  
ATOM 1085  S SD   . MET A 1 69 ? 20.144  -12.042 10.264  1.00 0.00 ? 69 MET A SD   1  
ATOM 1086  C CE   . MET A 1 69 ? 18.821  -12.574 9.146   1.00 0.00 ? 69 MET A CE   1  
ATOM 1087  H H    . MET A 1 69 ? 19.266  -7.085  12.261  1.00 0.00 ? 69 MET A H    1  
ATOM 1088  H HA   . MET A 1 69 ? 18.189  -8.133  9.809   1.00 0.00 ? 69 MET A HA   1  
ATOM 1089  H HB2  . MET A 1 69 ? 18.836  -10.010 12.122  1.00 0.00 ? 69 MET A HB2  1  
ATOM 1090  H HB3  . MET A 1 69 ? 17.792  -10.384 10.750  1.00 0.00 ? 69 MET A HB3  1  
ATOM 1091  H HG2  . MET A 1 69 ? 19.754  -9.922  9.224   1.00 0.00 ? 69 MET A HG2  1  
ATOM 1092  H HG3  . MET A 1 69 ? 20.756  -9.771  10.669  1.00 0.00 ? 69 MET A HG3  1  
ATOM 1093  H HE1  . MET A 1 69 ? 18.959  -12.098 8.176   1.00 0.00 ? 69 MET A HE1  1  
ATOM 1094  H HE2  . MET A 1 69 ? 18.866  -13.653 9.012   1.00 0.00 ? 69 MET A HE2  1  
ATOM 1095  H HE3  . MET A 1 69 ? 17.848  -12.307 9.557   1.00 0.00 ? 69 MET A HE3  1  
ATOM 1096  N N    . ARG A 1 70 ? 16.034  -8.665  11.749  1.00 0.00 ? 70 ARG A N    1  
ATOM 1097  C CA   . ARG A 1 70 ? 14.741  -8.322  12.329  1.00 0.00 ? 70 ARG A CA   1  
ATOM 1098  C C    . ARG A 1 70 ? 14.461  -9.271  13.459  1.00 0.00 ? 70 ARG A C    1  
ATOM 1099  O O    . ARG A 1 70 ? 14.851  -10.451 13.358  1.00 0.00 ? 70 ARG A O    1  
ATOM 1100  C CB   . ARG A 1 70 ? 13.634  -8.430  11.270  1.00 0.00 ? 70 ARG A CB   1  
ATOM 1101  C CG   . ARG A 1 70 ? 13.391  -7.093  10.571  1.00 0.00 ? 70 ARG A CG   1  
ATOM 1102  C CD   . ARG A 1 70 ? 12.282  -7.249  9.526   1.00 0.00 ? 70 ARG A CD   1  
ATOM 1103  N NE   . ARG A 1 70 ? 11.873  -5.960  8.951   1.00 0.00 ? 70 ARG A NE   1  
ATOM 1104  C CZ   . ARG A 1 70 ? 12.573  -5.211  8.092   1.00 0.00 ? 70 ARG A CZ   1  
ATOM 1105  N NH1  . ARG A 1 70 ? 13.762  -5.611  7.654   1.00 0.00 ? 70 ARG A NH1  1  
ATOM 1106  N NH2  . ARG A 1 70 ? 12.068  -4.058  7.680   1.00 0.00 ? 70 ARG A NH2  1  
ATOM 1107  H H    . ARG A 1 70 ? 16.176  -9.658  11.619  1.00 0.00 ? 70 ARG A H    1  
ATOM 1108  H HA   . ARG A 1 70 ? 14.765  -7.315  12.748  1.00 0.00 ? 70 ARG A HA   1  
ATOM 1109  H HB2  . ARG A 1 70 ? 13.890  -9.197  10.539  1.00 0.00 ? 70 ARG A HB2  1  
ATOM 1110  H HB3  . ARG A 1 70 ? 12.705  -8.735  11.752  1.00 0.00 ? 70 ARG A HB3  1  
ATOM 1111  H HG2  . ARG A 1 70 ? 13.088  -6.350  11.310  1.00 0.00 ? 70 ARG A HG2  1  
ATOM 1112  H HG3  . ARG A 1 70 ? 14.311  -6.763  10.094  1.00 0.00 ? 70 ARG A HG3  1  
ATOM 1113  H HD2  . ARG A 1 70 ? 12.624  -7.915  8.733   1.00 0.00 ? 70 ARG A HD2  1  
ATOM 1114  H HD3  . ARG A 1 70 ? 11.409  -7.693  10.005  1.00 0.00 ? 70 ARG A HD3  1  
ATOM 1115  H HE   . ARG A 1 70 ? 10.920  -5.682  9.180   1.00 0.00 ? 70 ARG A HE   1  
ATOM 1116  H HH11 . ARG A 1 70 ? 14.182  -6.466  7.994   1.00 0.00 ? 70 ARG A HH11 1  
ATOM 1117  H HH12 . ARG A 1 70 ? 14.302  -5.105  6.954   1.00 0.00 ? 70 ARG A HH12 1  
ATOM 1118  H HH21 . ARG A 1 70 ? 11.216  -3.670  8.089   1.00 0.00 ? 70 ARG A HH21 1  
ATOM 1119  H HH22 . ARG A 1 70 ? 12.506  -3.495  6.952   1.00 0.00 ? 70 ARG A HH22 1  
ATOM 1120  N N    . GLY A 1 1  ? -12.233 -17.674 -31.186 1.00 0.00 ? 1  GLY A N    2  
ATOM 1121  C CA   . GLY A 1 1  ? -12.713 -18.040 -29.852 1.00 0.00 ? 1  GLY A CA   2  
ATOM 1122  C C    . GLY A 1 1  ? -13.706 -17.016 -29.345 1.00 0.00 ? 1  GLY A C    2  
ATOM 1123  O O    . GLY A 1 1  ? -13.316 -15.906 -28.972 1.00 0.00 ? 1  GLY A O    2  
ATOM 1124  H H1   . GLY A 1 1  ? -12.933 -17.667 -31.900 1.00 0.00 ? 1  GLY A H1   2  
ATOM 1125  H HA2  . GLY A 1 1  ? -13.181 -19.022 -29.897 1.00 0.00 ? 1  GLY A HA2  2  
ATOM 1126  H HA3  . GLY A 1 1  ? -11.864 -18.079 -29.173 1.00 0.00 ? 1  GLY A HA3  2  
ATOM 1127  N N    . SER A 1 2  ? -14.986 -17.383 -29.332 1.00 0.00 ? 2  SER A N    2  
ATOM 1128  C CA   . SER A 1 2  ? -16.084 -16.599 -28.801 1.00 0.00 ? 2  SER A CA   2  
ATOM 1129  C C    . SER A 1 2  ? -17.033 -17.633 -28.208 1.00 0.00 ? 2  SER A C    2  
ATOM 1130  O O    . SER A 1 2  ? -17.552 -18.478 -28.943 1.00 0.00 ? 2  SER A O    2  
ATOM 1131  C CB   . SER A 1 2  ? -16.712 -15.760 -29.925 1.00 0.00 ? 2  SER A CB   2  
ATOM 1132  O OG   . SER A 1 2  ? -17.659 -14.836 -29.423 1.00 0.00 ? 2  SER A OG   2  
ATOM 1133  H H    . SER A 1 2  ? -15.253 -18.304 -29.659 1.00 0.00 ? 2  SER A H    2  
ATOM 1134  H HA   . SER A 1 2  ? -15.709 -15.940 -28.018 1.00 0.00 ? 2  SER A HA   2  
ATOM 1135  H HB2  . SER A 1 2  ? -15.923 -15.199 -30.429 1.00 0.00 ? 2  SER A HB2  2  
ATOM 1136  H HB3  . SER A 1 2  ? -17.195 -16.416 -30.651 1.00 0.00 ? 2  SER A HB3  2  
ATOM 1137  H HG   . SER A 1 2  ? -18.511 -15.319 -29.299 1.00 0.00 ? 2  SER A HG   2  
ATOM 1138  N N    . SER A 1 3  ? -17.172 -17.654 -26.884 1.00 0.00 ? 3  SER A N    2  
ATOM 1139  C CA   . SER A 1 3  ? -17.912 -18.682 -26.171 1.00 0.00 ? 3  SER A CA   2  
ATOM 1140  C C    . SER A 1 3  ? -18.219 -18.133 -24.779 1.00 0.00 ? 3  SER A C    2  
ATOM 1141  O O    . SER A 1 3  ? -19.377 -17.836 -24.469 1.00 0.00 ? 3  SER A O    2  
ATOM 1142  C CB   . SER A 1 3  ? -17.062 -19.965 -26.151 1.00 0.00 ? 3  SER A CB   2  
ATOM 1143  O OG   . SER A 1 3  ? -17.813 -21.130 -25.877 1.00 0.00 ? 3  SER A OG   2  
ATOM 1144  H H    . SER A 1 3  ? -16.763 -16.903 -26.330 1.00 0.00 ? 3  SER A H    2  
ATOM 1145  H HA   . SER A 1 3  ? -18.847 -18.880 -26.699 1.00 0.00 ? 3  SER A HA   2  
ATOM 1146  H HB2  . SER A 1 3  ? -16.596 -20.087 -27.127 1.00 0.00 ? 3  SER A HB2  2  
ATOM 1147  H HB3  . SER A 1 3  ? -16.268 -19.879 -25.410 1.00 0.00 ? 3  SER A HB3  2  
ATOM 1148  H HG   . SER A 1 3  ? -17.863 -21.187 -24.902 1.00 0.00 ? 3  SER A HG   2  
ATOM 1149  N N    . GLY A 1 4  ? -17.178 -17.935 -23.973 1.00 0.00 ? 4  GLY A N    2  
ATOM 1150  C CA   . GLY A 1 4  ? -17.209 -17.333 -22.655 1.00 0.00 ? 4  GLY A CA   2  
ATOM 1151  C C    . GLY A 1 4  ? -15.805 -16.846 -22.312 1.00 0.00 ? 4  GLY A C    2  
ATOM 1152  O O    . GLY A 1 4  ? -14.855 -17.079 -23.071 1.00 0.00 ? 4  GLY A O    2  
ATOM 1153  H H    . GLY A 1 4  ? -16.245 -18.114 -24.319 1.00 0.00 ? 4  GLY A H    2  
ATOM 1154  H HA2  . GLY A 1 4  ? -17.893 -16.485 -22.665 1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1155  H HA3  . GLY A 1 4  ? -17.537 -18.068 -21.918 1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1156  N N    . SER A 1 5  ? -15.667 -16.152 -21.188 1.00 0.00 ? 5  SER A N    2  
ATOM 1157  C CA   . SER A 1 5  ? -14.404 -15.584 -20.747 1.00 0.00 ? 5  SER A CA   2  
ATOM 1158  C C    . SER A 1 5  ? -13.681 -16.586 -19.838 1.00 0.00 ? 5  SER A C    2  
ATOM 1159  O O    . SER A 1 5  ? -12.600 -17.051 -20.198 1.00 0.00 ? 5  SER A O    2  
ATOM 1160  C CB   . SER A 1 5  ? -14.693 -14.223 -20.109 1.00 0.00 ? 5  SER A CB   2  
ATOM 1161  O OG   . SER A 1 5  ? -13.521 -13.445 -20.008 1.00 0.00 ? 5  SER A OG   2  
ATOM 1162  H H    . SER A 1 5  ? -16.487 -15.993 -20.609 1.00 0.00 ? 5  SER A H    2  
ATOM 1163  H HA   . SER A 1 5  ? -13.775 -15.405 -21.619 1.00 0.00 ? 5  SER A HA   2  
ATOM 1164  H HB2  . SER A 1 5  ? -15.391 -13.683 -20.748 1.00 0.00 ? 5  SER A HB2  2  
ATOM 1165  H HB3  . SER A 1 5  ? -15.145 -14.354 -19.125 1.00 0.00 ? 5  SER A HB3  2  
ATOM 1166  H HG   . SER A 1 5  ? -13.392 -13.271 -19.049 1.00 0.00 ? 5  SER A HG   2  
ATOM 1167  N N    . SER A 1 6  ? -14.301 -16.979 -18.719 1.00 0.00 ? 6  SER A N    2  
ATOM 1168  C CA   . SER A 1 6  ? -13.722 -17.823 -17.676 1.00 0.00 ? 6  SER A CA   2  
ATOM 1169  C C    . SER A 1 6  ? -12.386 -17.280 -17.140 1.00 0.00 ? 6  SER A C    2  
ATOM 1170  O O    . SER A 1 6  ? -11.296 -17.664 -17.574 1.00 0.00 ? 6  SER A O    2  
ATOM 1171  C CB   . SER A 1 6  ? -13.659 -19.282 -18.134 1.00 0.00 ? 6  SER A CB   2  
ATOM 1172  O OG   . SER A 1 6  ? -14.971 -19.803 -18.275 1.00 0.00 ? 6  SER A OG   2  
ATOM 1173  H H    . SER A 1 6  ? -15.213 -16.592 -18.505 1.00 0.00 ? 6  SER A H    2  
ATOM 1174  H HA   . SER A 1 6  ? -14.421 -17.804 -16.841 1.00 0.00 ? 6  SER A HA   2  
ATOM 1175  H HB2  . SER A 1 6  ? -13.134 -19.358 -19.085 1.00 0.00 ? 6  SER A HB2  2  
ATOM 1176  H HB3  . SER A 1 6  ? -13.123 -19.865 -17.383 1.00 0.00 ? 6  SER A HB3  2  
ATOM 1177  H HG   . SER A 1 6  ? -15.422 -19.324 -18.988 1.00 0.00 ? 6  SER A HG   2  
ATOM 1178  N N    . GLY A 1 7  ? -12.487 -16.376 -16.164 1.00 0.00 ? 7  GLY A N    2  
ATOM 1179  C CA   . GLY A 1 7  ? -11.363 -15.804 -15.440 1.00 0.00 ? 7  GLY A CA   2  
ATOM 1180  C C    . GLY A 1 7  ? -11.905 -14.830 -14.406 1.00 0.00 ? 7  GLY A C    2  
ATOM 1181  O O    . GLY A 1 7  ? -12.266 -13.705 -14.759 1.00 0.00 ? 7  GLY A O    2  
ATOM 1182  H H    . GLY A 1 7  ? -13.412 -16.117 -15.843 1.00 0.00 ? 7  GLY A H    2  
ATOM 1183  H HA2  . GLY A 1 7  ? -10.804 -16.596 -14.946 1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1184  H HA3  . GLY A 1 7  ? -10.705 -15.280 -16.133 1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1185  N N    . ARG A 1 8  ? -12.083 -15.257 -13.157 1.00 0.00 ? 8  ARG A N    2  
ATOM 1186  C CA   . ARG A 1 8  ? -12.683 -14.456 -12.096 1.00 0.00 ? 8  ARG A CA   2  
ATOM 1187  C C    . ARG A 1 8  ? -11.754 -14.473 -10.888 1.00 0.00 ? 8  ARG A C    2  
ATOM 1188  O O    . ARG A 1 8  ? -11.806 -15.390 -10.068 1.00 0.00 ? 8  ARG A O    2  
ATOM 1189  C CB   . ARG A 1 8  ? -14.109 -14.960 -11.790 1.00 0.00 ? 8  ARG A CB   2  
ATOM 1190  C CG   . ARG A 1 8  ? -14.897 -14.078 -10.804 1.00 0.00 ? 8  ARG A CG   2  
ATOM 1191  C CD   . ARG A 1 8  ? -15.750 -12.954 -11.416 1.00 0.00 ? 8  ARG A CD   2  
ATOM 1192  N NE   . ARG A 1 8  ? -15.056 -12.105 -12.399 1.00 0.00 ? 8  ARG A NE   2  
ATOM 1193  C CZ   . ARG A 1 8  ? -14.051 -11.242 -12.209 1.00 0.00 ? 8  ARG A CZ   2  
ATOM 1194  N NH1  . ARG A 1 8  ? -13.483 -11.066 -11.021 1.00 0.00 ? 8  ARG A NH1  2  
ATOM 1195  N NH2  . ARG A 1 8  ? -13.587 -10.567 -13.247 1.00 0.00 ? 8  ARG A NH2  2  
ATOM 1196  H H    . ARG A 1 8  ? -11.754 -16.183 -12.895 1.00 0.00 ? 8  ARG A H    2  
ATOM 1197  H HA   . ARG A 1 8  ? -12.748 -13.430 -12.440 1.00 0.00 ? 8  ARG A HA   2  
ATOM 1198  H HB2  . ARG A 1 8  ? -14.678 -15.044 -12.715 1.00 0.00 ? 8  ARG A HB2  2  
ATOM 1199  H HB3  . ARG A 1 8  ? -14.025 -15.959 -11.357 1.00 0.00 ? 8  ARG A HB3  2  
ATOM 1200  H HG2  . ARG A 1 8  ? -15.585 -14.725 -10.261 1.00 0.00 ? 8  ARG A HG2  2  
ATOM 1201  H HG3  . ARG A 1 8  ? -14.218 -13.653 -10.073 1.00 0.00 ? 8  ARG A HG3  2  
ATOM 1202  H HD2  . ARG A 1 8  ? -16.601 -13.416 -11.920 1.00 0.00 ? 8  ARG A HD2  2  
ATOM 1203  H HD3  . ARG A 1 8  ? -16.143 -12.328 -10.614 1.00 0.00 ? 8  ARG A HD3  2  
ATOM 1204  H HE   . ARG A 1 8  ? -15.443 -12.174 -13.339 1.00 0.00 ? 8  ARG A HE   2  
ATOM 1205  H HH11 . ARG A 1 8  ? -13.794 -11.528 -10.171 1.00 0.00 ? 8  ARG A HH11 2  
ATOM 1206  H HH12 . ARG A 1 8  ? -12.628 -10.508 -10.955 1.00 0.00 ? 8  ARG A HH12 2  
ATOM 1207  H HH21 . ARG A 1 8  ? -13.947 -10.703 -14.191 1.00 0.00 ? 8  ARG A HH21 2  
ATOM 1208  H HH22 . ARG A 1 8  ? -12.793 -9.930  -13.160 1.00 0.00 ? 8  ARG A HH22 2  
ATOM 1209  N N    . GLY A 1 9  ? -10.940 -13.432 -10.746 1.00 0.00 ? 9  GLY A N    2  
ATOM 1210  C CA   . GLY A 1 9  ? -9.937  -13.317 -9.702  1.00 0.00 ? 9  GLY A CA   2  
ATOM 1211  C C    . GLY A 1 9  ? -8.641  -14.001 -10.124 1.00 0.00 ? 9  GLY A C    2  
ATOM 1212  O O    . GLY A 1 9  ? -8.597  -14.765 -11.096 1.00 0.00 ? 9  GLY A O    2  
ATOM 1213  H H    . GLY A 1 9  ? -10.866 -12.770 -11.515 1.00 0.00 ? 9  GLY A H    2  
ATOM 1214  H HA2  . GLY A 1 9  ? -9.740  -12.262 -9.512  1.00 0.00 ? 9  GLY A HA2  2  
ATOM 1215  H HA3  . GLY A 1 9  ? -10.298 -13.780 -8.783  1.00 0.00 ? 9  GLY A HA3  2  
ATOM 1216  N N    . ARG A 1 10 ? -7.570  -13.729 -9.376  1.00 0.00 ? 10 ARG A N    2  
ATOM 1217  C CA   . ARG A 1 10 ? -6.230  -14.214 -9.696  1.00 0.00 ? 10 ARG A CA   2  
ATOM 1218  C C    . ARG A 1 10 ? -5.445  -14.517 -8.434  1.00 0.00 ? 10 ARG A C    2  
ATOM 1219  O O    . ARG A 1 10 ? -4.890  -15.610 -8.320  1.00 0.00 ? 10 ARG A O    2  
ATOM 1220  C CB   . ARG A 1 10 ? -5.504  -13.161 -10.551 1.00 0.00 ? 10 ARG A CB   2  
ATOM 1221  C CG   . ARG A 1 10 ? -4.287  -13.721 -11.293 1.00 0.00 ? 10 ARG A CG   2  
ATOM 1222  C CD   . ARG A 1 10 ? -4.666  -14.578 -12.503 1.00 0.00 ? 10 ARG A CD   2  
ATOM 1223  N NE   . ARG A 1 10 ? -3.466  -15.215 -13.062 1.00 0.00 ? 10 ARG A NE   2  
ATOM 1224  C CZ   . ARG A 1 10 ? -3.179  -15.385 -14.355 1.00 0.00 ? 10 ARG A CZ   2  
ATOM 1225  N NH1  . ARG A 1 10 ? -4.058  -15.145 -15.317 1.00 0.00 ? 10 ARG A NH1  2  
ATOM 1226  N NH2  . ARG A 1 10 ? -1.975  -15.803 -14.709 1.00 0.00 ? 10 ARG A NH2  2  
ATOM 1227  H H    . ARG A 1 10 ? -7.685  -13.093 -8.596  1.00 0.00 ? 10 ARG A H    2  
ATOM 1228  H HA   . ARG A 1 10 ? -6.329  -15.138 -10.266 1.00 0.00 ? 10 ARG A HA   2  
ATOM 1229  H HB2  . ARG A 1 10 ? -6.191  -12.756 -11.282 1.00 0.00 ? 10 ARG A HB2  2  
ATOM 1230  H HB3  . ARG A 1 10 ? -5.184  -12.333 -9.918  1.00 0.00 ? 10 ARG A HB3  2  
ATOM 1231  H HG2  . ARG A 1 10 ? -3.691  -12.882 -11.655 1.00 0.00 ? 10 ARG A HG2  2  
ATOM 1232  H HG3  . ARG A 1 10 ? -3.687  -14.312 -10.603 1.00 0.00 ? 10 ARG A HG3  2  
ATOM 1233  H HD2  . ARG A 1 10 ? -5.374  -15.347 -12.204 1.00 0.00 ? 10 ARG A HD2  2  
ATOM 1234  H HD3  . ARG A 1 10 ? -5.138  -13.941 -13.250 1.00 0.00 ? 10 ARG A HD3  2  
ATOM 1235  H HE   . ARG A 1 10 ? -2.785  -15.533 -12.375 1.00 0.00 ? 10 ARG A HE   2  
ATOM 1236  H HH11 . ARG A 1 10 ? -5.027  -14.862 -15.171 1.00 0.00 ? 10 ARG A HH11 2  
ATOM 1237  H HH12 . ARG A 1 10 ? -3.749  -15.237 -16.281 1.00 0.00 ? 10 ARG A HH12 2  
ATOM 1238  H HH21 . ARG A 1 10 ? -1.213  -15.853 -14.032 1.00 0.00 ? 10 ARG A HH21 2  
ATOM 1239  H HH22 . ARG A 1 10 ? -1.725  -15.794 -15.699 1.00 0.00 ? 10 ARG A HH22 2  
ATOM 1240  N N    . TYR A 1 11 ? -5.411  -13.580 -7.492  1.00 0.00 ? 11 TYR A N    2  
ATOM 1241  C CA   . TYR A 1 11 ? -4.625  -13.672 -6.271  1.00 0.00 ? 11 TYR A CA   2  
ATOM 1242  C C    . TYR A 1 11 ? -5.552  -13.468 -5.068  1.00 0.00 ? 11 TYR A C    2  
ATOM 1243  O O    . TYR A 1 11 ? -6.783  -13.515 -5.212  1.00 0.00 ? 11 TYR A O    2  
ATOM 1244  C CB   . TYR A 1 11 ? -3.448  -12.686 -6.362  1.00 0.00 ? 11 TYR A CB   2  
ATOM 1245  C CG   . TYR A 1 11 ? -2.605  -12.848 -7.618  1.00 0.00 ? 11 TYR A CG   2  
ATOM 1246  C CD1  . TYR A 1 11 ? -1.897  -14.044 -7.839  1.00 0.00 ? 11 TYR A CD1  2  
ATOM 1247  C CD2  . TYR A 1 11 ? -2.572  -11.833 -8.593  1.00 0.00 ? 11 TYR A CD2  2  
ATOM 1248  C CE1  . TYR A 1 11 ? -1.199  -14.242 -9.041  1.00 0.00 ? 11 TYR A CE1  2  
ATOM 1249  C CE2  . TYR A 1 11 ? -1.874  -12.024 -9.800  1.00 0.00 ? 11 TYR A CE2  2  
ATOM 1250  C CZ   . TYR A 1 11 ? -1.209  -13.249 -10.042 1.00 0.00 ? 11 TYR A CZ   2  
ATOM 1251  O OH   . TYR A 1 11 ? -0.651  -13.528 -11.253 1.00 0.00 ? 11 TYR A OH   2  
ATOM 1252  H H    . TYR A 1 11 ? -5.889  -12.699 -7.644  1.00 0.00 ? 11 TYR A H    2  
ATOM 1253  H HA   . TYR A 1 11 ? -4.208  -14.676 -6.188  1.00 0.00 ? 11 TYR A HA   2  
ATOM 1254  H HB2  . TYR A 1 11 ? -3.837  -11.670 -6.311  1.00 0.00 ? 11 TYR A HB2  2  
ATOM 1255  H HB3  . TYR A 1 11 ? -2.795  -12.839 -5.506  1.00 0.00 ? 11 TYR A HB3  2  
ATOM 1256  H HD1  . TYR A 1 11 ? -1.906  -14.828 -7.096  1.00 0.00 ? 11 TYR A HD1  2  
ATOM 1257  H HD2  . TYR A 1 11 ? -3.107  -10.909 -8.426  1.00 0.00 ? 11 TYR A HD2  2  
ATOM 1258  H HE1  . TYR A 1 11 ? -0.667  -15.160 -9.214  1.00 0.00 ? 11 TYR A HE1  2  
ATOM 1259  H HE2  . TYR A 1 11 ? -1.888  -11.243 -10.546 1.00 0.00 ? 11 TYR A HE2  2  
ATOM 1260  H HH   . TYR A 1 11 ? -0.670  -12.762 -11.856 1.00 0.00 ? 11 TYR A HH   2  
ATOM 1261  N N    . ARG A 1 12 ? -4.990  -13.362 -3.865  1.00 0.00 ? 12 ARG A N    2  
ATOM 1262  C CA   . ARG A 1 12 ? -5.720  -13.214 -2.607  1.00 0.00 ? 12 ARG A CA   2  
ATOM 1263  C C    . ARG A 1 12 ? -5.346  -11.879 -1.976  1.00 0.00 ? 12 ARG A C    2  
ATOM 1264  O O    . ARG A 1 12 ? -4.315  -11.303 -2.326  1.00 0.00 ? 12 ARG A O    2  
ATOM 1265  C CB   . ARG A 1 12 ? -5.372  -14.368 -1.666  1.00 0.00 ? 12 ARG A CB   2  
ATOM 1266  C CG   . ARG A 1 12 ? -5.885  -15.706 -2.215  1.00 0.00 ? 12 ARG A CG   2  
ATOM 1267  C CD   . ARG A 1 12 ? -5.322  -16.871 -1.413  1.00 0.00 ? 12 ARG A CD   2  
ATOM 1268  N NE   . ARG A 1 12 ? -5.651  -16.779 0.021   1.00 0.00 ? 12 ARG A NE   2  
ATOM 1269  C CZ   . ARG A 1 12 ? -6.416  -17.613 0.730   1.00 0.00 ? 12 ARG A CZ   2  
ATOM 1270  N NH1  . ARG A 1 12 ? -7.050  -18.635 0.162   1.00 0.00 ? 12 ARG A NH1  2  
ATOM 1271  N NH2  . ARG A 1 12 ? -6.547  -17.412 2.033   1.00 0.00 ? 12 ARG A NH2  2  
ATOM 1272  H H    . ARG A 1 12 ? -3.976  -13.345 -3.794  1.00 0.00 ? 12 ARG A H    2  
ATOM 1273  H HA   . ARG A 1 12 ? -6.790  -13.259 -2.797  1.00 0.00 ? 12 ARG A HA   2  
ATOM 1274  H HB2  . ARG A 1 12 ? -4.292  -14.411 -1.527  1.00 0.00 ? 12 ARG A HB2  2  
ATOM 1275  H HB3  . ARG A 1 12 ? -5.836  -14.186 -0.696  1.00 0.00 ? 12 ARG A HB3  2  
ATOM 1276  H HG2  . ARG A 1 12 ? -6.972  -15.723 -2.181  1.00 0.00 ? 12 ARG A HG2  2  
ATOM 1277  H HG3  . ARG A 1 12 ? -5.567  -15.840 -3.249  1.00 0.00 ? 12 ARG A HG3  2  
ATOM 1278  H HD2  . ARG A 1 12 ? -5.701  -17.792 -1.848  1.00 0.00 ? 12 ARG A HD2  2  
ATOM 1279  H HD3  . ARG A 1 12 ? -4.240  -16.853 -1.525  1.00 0.00 ? 12 ARG A HD3  2  
ATOM 1280  H HE   . ARG A 1 12 ? -5.111  -16.098 0.542   1.00 0.00 ? 12 ARG A HE   2  
ATOM 1281  H HH11 . ARG A 1 12 ? -7.006  -18.780 -0.837  1.00 0.00 ? 12 ARG A HH11 2  
ATOM 1282  H HH12 . ARG A 1 12 ? -7.532  -19.313 0.738   1.00 0.00 ? 12 ARG A HH12 2  
ATOM 1283  H HH21 . ARG A 1 12 ? -6.059  -16.637 2.485   1.00 0.00 ? 12 ARG A HH21 2  
ATOM 1284  H HH22 . ARG A 1 12 ? -7.071  -18.068 2.604   1.00 0.00 ? 12 ARG A HH22 2  
ATOM 1285  N N    . GLN A 1 13 ? -6.126  -11.429 -0.987  1.00 0.00 ? 13 GLN A N    2  
ATOM 1286  C CA   . GLN A 1 13 ? -5.951  -10.126 -0.345  1.00 0.00 ? 13 GLN A CA   2  
ATOM 1287  C C    . GLN A 1 13 ? -5.944  -9.013  -1.405  1.00 0.00 ? 13 GLN A C    2  
ATOM 1288  O O    . GLN A 1 13 ? -6.432  -9.208  -2.524  1.00 0.00 ? 13 GLN A O    2  
ATOM 1289  C CB   . GLN A 1 13 ? -4.702  -10.105 0.568   1.00 0.00 ? 13 GLN A CB   2  
ATOM 1290  C CG   . GLN A 1 13 ? -4.600  -11.274 1.559   1.00 0.00 ? 13 GLN A CG   2  
ATOM 1291  C CD   . GLN A 1 13 ? -5.778  -11.325 2.522   1.00 0.00 ? 13 GLN A CD   2  
ATOM 1292  O OE1  . GLN A 1 13 ? -5.826  -10.627 3.529   1.00 0.00 ? 13 GLN A OE1  2  
ATOM 1293  N NE2  . GLN A 1 13 ? -6.764  -12.162 2.250   1.00 0.00 ? 13 GLN A NE2  2  
ATOM 1294  H H    . GLN A 1 13 ? -7.003  -11.900 -0.806  1.00 0.00 ? 13 GLN A H    2  
ATOM 1295  H HA   . GLN A 1 13 ? -6.826  -9.958  0.285   1.00 0.00 ? 13 GLN A HA   2  
ATOM 1296  H HB2  . GLN A 1 13 ? -3.804  -10.104 -0.049  1.00 0.00 ? 13 GLN A HB2  2  
ATOM 1297  H HB3  . GLN A 1 13 ? -4.708  -9.179  1.142   1.00 0.00 ? 13 GLN A HB3  2  
ATOM 1298  H HG2  . GLN A 1 13 ? -4.513  -12.217 1.017   1.00 0.00 ? 13 GLN A HG2  2  
ATOM 1299  H HG3  . GLN A 1 13 ? -3.690  -11.157 2.142   1.00 0.00 ? 13 GLN A HG3  2  
ATOM 1300  H HE21 . GLN A 1 13 ? -6.817  -12.563 1.325   1.00 0.00 ? 13 GLN A HE21 2  
ATOM 1301  H HE22 . GLN A 1 13 ? -7.647  -11.979 2.728   1.00 0.00 ? 13 GLN A HE22 2  
ATOM 1302  N N    . TYR A 1 14 ? -5.495  -7.810  -1.054  1.00 0.00 ? 14 TYR A N    2  
ATOM 1303  C CA   . TYR A 1 14 ? -5.330  -6.721  -2.004  1.00 0.00 ? 14 TYR A CA   2  
ATOM 1304  C C    . TYR A 1 14 ? -4.280  -7.091  -3.058  1.00 0.00 ? 14 TYR A C    2  
ATOM 1305  O O    . TYR A 1 14 ? -3.441  -7.968  -2.834  1.00 0.00 ? 14 TYR A O    2  
ATOM 1306  C CB   . TYR A 1 14 ? -4.968  -5.432  -1.258  1.00 0.00 ? 14 TYR A CB   2  
ATOM 1307  C CG   . TYR A 1 14 ? -3.590  -5.454  -0.611  1.00 0.00 ? 14 TYR A CG   2  
ATOM 1308  C CD1  . TYR A 1 14 ? -2.462  -5.040  -1.342  1.00 0.00 ? 14 TYR A CD1  2  
ATOM 1309  C CD2  . TYR A 1 14 ? -3.421  -5.899  0.713   1.00 0.00 ? 14 TYR A CD2  2  
ATOM 1310  C CE1  . TYR A 1 14 ? -1.177  -5.105  -0.780  1.00 0.00 ? 14 TYR A CE1  2  
ATOM 1311  C CE2  . TYR A 1 14 ? -2.135  -6.007  1.268   1.00 0.00 ? 14 TYR A CE2  2  
ATOM 1312  C CZ   . TYR A 1 14 ? -1.004  -5.599  0.532   1.00 0.00 ? 14 TYR A CZ   2  
ATOM 1313  O OH   . TYR A 1 14 ? 0.239   -5.737  1.066   1.00 0.00 ? 14 TYR A OH   2  
ATOM 1314  H H    . TYR A 1 14 ? -5.227  -7.653  -0.094  1.00 0.00 ? 14 TYR A H    2  
ATOM 1315  H HA   . TYR A 1 14 ? -6.283  -6.562  -2.508  1.00 0.00 ? 14 TYR A HA   2  
ATOM 1316  H HB2  . TYR A 1 14 ? -5.023  -4.602  -1.966  1.00 0.00 ? 14 TYR A HB2  2  
ATOM 1317  H HB3  . TYR A 1 14 ? -5.727  -5.256  -0.494  1.00 0.00 ? 14 TYR A HB3  2  
ATOM 1318  H HD1  . TYR A 1 14 ? -2.567  -4.623  -2.333  1.00 0.00 ? 14 TYR A HD1  2  
ATOM 1319  H HD2  . TYR A 1 14 ? -4.271  -6.132  1.332   1.00 0.00 ? 14 TYR A HD2  2  
ATOM 1320  H HE1  . TYR A 1 14 ? -0.335  -4.757  -1.370  1.00 0.00 ? 14 TYR A HE1  2  
ATOM 1321  H HE2  . TYR A 1 14 ? -2.011  -6.400  2.265   1.00 0.00 ? 14 TYR A HE2  2  
ATOM 1322  H HH   . TYR A 1 14 ? 0.233   -6.106  1.973   1.00 0.00 ? 14 TYR A HH   2  
ATOM 1323  N N    . ASN A 1 15 ? -4.305  -6.377  -4.180  1.00 0.00 ? 15 ASN A N    2  
ATOM 1324  C CA   . ASN A 1 15 ? -3.384  -6.497  -5.308  1.00 0.00 ? 15 ASN A CA   2  
ATOM 1325  C C    . ASN A 1 15 ? -2.493  -5.264  -5.346  1.00 0.00 ? 15 ASN A C    2  
ATOM 1326  O O    . ASN A 1 15 ? -2.844  -4.241  -4.758  1.00 0.00 ? 15 ASN A O    2  
ATOM 1327  C CB   . ASN A 1 15 ? -4.162  -6.654  -6.624  1.00 0.00 ? 15 ASN A CB   2  
ATOM 1328  C CG   . ASN A 1 15 ? -4.775  -8.041  -6.770  1.00 0.00 ? 15 ASN A CG   2  
ATOM 1329  O OD1  . ASN A 1 15 ? -4.242  -9.024  -6.257  1.00 0.00 ? 15 ASN A OD1  2  
ATOM 1330  N ND2  . ASN A 1 15 ? -5.911  -8.156  -7.425  1.00 0.00 ? 15 ASN A ND2  2  
ATOM 1331  H H    . ASN A 1 15 ? -4.944  -5.600  -4.234  1.00 0.00 ? 15 ASN A H    2  
ATOM 1332  H HA   . ASN A 1 15 ? -2.745  -7.368  -5.165  1.00 0.00 ? 15 ASN A HA   2  
ATOM 1333  H HB2  . ASN A 1 15 ? -4.937  -5.889  -6.674  1.00 0.00 ? 15 ASN A HB2  2  
ATOM 1334  H HB3  . ASN A 1 15 ? -3.489  -6.501  -7.469  1.00 0.00 ? 15 ASN A HB3  2  
ATOM 1335  H HD21 . ASN A 1 15 ? -6.296  -7.330  -7.888  1.00 0.00 ? 15 ASN A HD21 2  
ATOM 1336  H HD22 . ASN A 1 15 ? -6.307  -9.074  -7.614  1.00 0.00 ? 15 ASN A HD22 2  
ATOM 1337  N N    . SER A 1 16 ? -1.341  -5.345  -6.010  1.00 0.00 ? 16 SER A N    2  
ATOM 1338  C CA   . SER A 1 16 ? -0.414  -4.227  -6.170  1.00 0.00 ? 16 SER A CA   2  
ATOM 1339  C C    . SER A 1 16 ? -1.121  -2.951  -6.646  1.00 0.00 ? 16 SER A C    2  
ATOM 1340  O O    . SER A 1 16 ? -0.791  -1.849  -6.214  1.00 0.00 ? 16 SER A O    2  
ATOM 1341  C CB   . SER A 1 16 ? 0.705   -4.646  -7.133  1.00 0.00 ? 16 SER A CB   2  
ATOM 1342  O OG   . SER A 1 16 ? 0.206   -5.413  -8.225  1.00 0.00 ? 16 SER A OG   2  
ATOM 1343  H H    . SER A 1 16 ? -1.086  -6.200  -6.485  1.00 0.00 ? 16 SER A H    2  
ATOM 1344  H HA   . SER A 1 16 ? 0.033   -4.005  -5.202  1.00 0.00 ? 16 SER A HA   2  
ATOM 1345  H HB2  . SER A 1 16 ? 1.215   -3.758  -7.504  1.00 0.00 ? 16 SER A HB2  2  
ATOM 1346  H HB3  . SER A 1 16 ? 1.425   -5.244  -6.576  1.00 0.00 ? 16 SER A HB3  2  
ATOM 1347  H HG   . SER A 1 16 ? 0.747   -5.205  -9.013  1.00 0.00 ? 16 SER A HG   2  
ATOM 1348  N N    . GLU A 1 17 ? -2.102  -3.102  -7.529  1.00 0.00 ? 17 GLU A N    2  
ATOM 1349  C CA   . GLU A 1 17 ? -2.901  -2.026  -8.097  1.00 0.00 ? 17 GLU A CA   2  
ATOM 1350  C C    . GLU A 1 17 ? -3.702  -1.333  -6.983  1.00 0.00 ? 17 GLU A C    2  
ATOM 1351  O O    . GLU A 1 17 ? -3.660  -0.109  -6.866  1.00 0.00 ? 17 GLU A O    2  
ATOM 1352  C CB   . GLU A 1 17 ? -3.830  -2.634  -9.161  1.00 0.00 ? 17 GLU A CB   2  
ATOM 1353  C CG   . GLU A 1 17 ? -3.072  -3.397  -10.266 1.00 0.00 ? 17 GLU A CG   2  
ATOM 1354  C CD   . GLU A 1 17 ? -4.002  -4.347  -11.013 1.00 0.00 ? 17 GLU A CD   2  
ATOM 1355  O OE1  . GLU A 1 17 ? -4.554  -5.267  -10.361 1.00 0.00 ? 17 GLU A OE1  2  
ATOM 1356  O OE2  . GLU A 1 17 ? -4.214  -4.171  -12.236 1.00 0.00 ? 17 GLU A OE2  2  
ATOM 1357  H H    . GLU A 1 17 ? -2.245  -4.028  -7.902  1.00 0.00 ? 17 GLU A H    2  
ATOM 1358  H HA   . GLU A 1 17 ? -2.245  -1.293  -8.573  1.00 0.00 ? 17 GLU A HA   2  
ATOM 1359  H HB2  . GLU A 1 17 ? -4.516  -3.321  -8.661  1.00 0.00 ? 17 GLU A HB2  2  
ATOM 1360  H HB3  . GLU A 1 17 ? -4.419  -1.839  -9.618  1.00 0.00 ? 17 GLU A HB3  2  
ATOM 1361  H HG2  . GLU A 1 17 ? -2.625  -2.679  -10.956 1.00 0.00 ? 17 GLU A HG2  2  
ATOM 1362  H HG3  . GLU A 1 17 ? -2.267  -3.999  -9.842  1.00 0.00 ? 17 GLU A HG3  2  
ATOM 1363  N N    . ILE A 1 18 ? -4.384  -2.133  -6.151  1.00 0.00 ? 18 ILE A N    2  
ATOM 1364  C CA   . ILE A 1 18 ? -5.220  -1.716  -5.024  1.00 0.00 ? 18 ILE A CA   2  
ATOM 1365  C C    . ILE A 1 18 ? -4.380  -1.024  -3.952  1.00 0.00 ? 18 ILE A C    2  
ATOM 1366  O O    . ILE A 1 18 ? -4.842  -0.067  -3.333  1.00 0.00 ? 18 ILE A O    2  
ATOM 1367  C CB   . ILE A 1 18 ? -5.933  -2.956  -4.421  1.00 0.00 ? 18 ILE A CB   2  
ATOM 1368  C CG1  . ILE A 1 18 ? -6.997  -3.559  -5.361  1.00 0.00 ? 18 ILE A CG1  2  
ATOM 1369  C CG2  . ILE A 1 18 ? -6.552  -2.661  -3.045  1.00 0.00 ? 18 ILE A CG2  2  
ATOM 1370  C CD1  . ILE A 1 18 ? -8.327  -2.811  -5.266  1.00 0.00 ? 18 ILE A CD1  2  
ATOM 1371  H H    . ILE A 1 18 ? -4.265  -3.123  -6.288  1.00 0.00 ? 18 ILE A H    2  
ATOM 1372  H HA   . ILE A 1 18 ? -5.962  -1.003  -5.385  1.00 0.00 ? 18 ILE A HA   2  
ATOM 1373  H HB   . ILE A 1 18 ? -5.182  -3.722  -4.255  1.00 0.00 ? 18 ILE A HB   2  
ATOM 1374  H HG12 . ILE A 1 18 ? -6.643  -3.543  -6.391  1.00 0.00 ? 18 ILE A HG12 2  
ATOM 1375  H HG13 . ILE A 1 18 ? -7.168  -4.601  -5.084  1.00 0.00 ? 18 ILE A HG13 2  
ATOM 1376  H HG21 . ILE A 1 18 ? -5.766  -2.495  -2.322  1.00 0.00 ? 18 ILE A HG21 2  
ATOM 1377  H HG22 . ILE A 1 18 ? -7.148  -1.751  -3.106  1.00 0.00 ? 18 ILE A HG22 2  
ATOM 1378  H HG23 . ILE A 1 18 ? -7.165  -3.494  -2.702  1.00 0.00 ? 18 ILE A HG23 2  
ATOM 1379  H HD11 . ILE A 1 18 ? -8.779  -3.022  -4.295  1.00 0.00 ? 18 ILE A HD11 2  
ATOM 1380  H HD12 . ILE A 1 18 ? -8.151  -1.736  -5.337  1.00 0.00 ? 18 ILE A HD12 2  
ATOM 1381  H HD13 . ILE A 1 18 ? -9.001  -3.143  -6.053  1.00 0.00 ? 18 ILE A HD13 2  
ATOM 1382  N N    . LEU A 1 19 ? -3.185  -1.549  -3.674  1.00 0.00 ? 19 LEU A N    2  
ATOM 1383  C CA   . LEU A 1 19 ? -2.334  -1.006  -2.626  1.00 0.00 ? 19 LEU A CA   2  
ATOM 1384  C C    . LEU A 1 19 ? -2.052  0.465   -2.913  1.00 0.00 ? 19 LEU A C    2  
ATOM 1385  O O    . LEU A 1 19 ? -2.170  1.295   -2.016  1.00 0.00 ? 19 LEU A O    2  
ATOM 1386  C CB   . LEU A 1 19 ? -1.066  -1.862  -2.491  1.00 0.00 ? 19 LEU A CB   2  
ATOM 1387  C CG   . LEU A 1 19 ? 0.012   -1.259  -1.578  1.00 0.00 ? 19 LEU A CG   2  
ATOM 1388  C CD1  . LEU A 1 19 ? -0.496  -1.084  -0.141  1.00 0.00 ? 19 LEU A CD1  2  
ATOM 1389  C CD2  . LEU A 1 19 ? 1.222   -2.200  -1.553  1.00 0.00 ? 19 LEU A CD2  2  
ATOM 1390  H H    . LEU A 1 19 ? -2.876  -2.351  -4.211  1.00 0.00 ? 19 LEU A H    2  
ATOM 1391  H HA   . LEU A 1 19 ? -2.882  -1.048  -1.685  1.00 0.00 ? 19 LEU A HA   2  
ATOM 1392  H HB2  . LEU A 1 19 ? -1.366  -2.807  -2.071  1.00 0.00 ? 19 LEU A HB2  2  
ATOM 1393  H HB3  . LEU A 1 19 ? -0.633  -2.086  -3.466  1.00 0.00 ? 19 LEU A HB3  2  
ATOM 1394  H HG   . LEU A 1 19 ? 0.317   -0.297  -1.982  1.00 0.00 ? 19 LEU A HG   2  
ATOM 1395  H HD11 . LEU A 1 19 ? -0.889  -2.030  0.231   1.00 0.00 ? 19 LEU A HD11 2  
ATOM 1396  H HD12 . LEU A 1 19 ? 0.314   -0.740  0.500   1.00 0.00 ? 19 LEU A HD12 2  
ATOM 1397  H HD13 . LEU A 1 19 ? -1.285  -0.331  -0.121  1.00 0.00 ? 19 LEU A HD13 2  
ATOM 1398  H HD21 . LEU A 1 19 ? 1.505   -2.463  -2.573  1.00 0.00 ? 19 LEU A HD21 2  
ATOM 1399  H HD22 . LEU A 1 19 ? 2.065   -1.690  -1.095  1.00 0.00 ? 19 LEU A HD22 2  
ATOM 1400  H HD23 . LEU A 1 19 ? 0.991   -3.111  -1.003  1.00 0.00 ? 19 LEU A HD23 2  
ATOM 1401  N N    . GLU A 1 20 ? -1.743  0.778   -4.168  1.00 0.00 ? 20 GLU A N    2  
ATOM 1402  C CA   . GLU A 1 20 ? -1.469  2.133   -4.606  1.00 0.00 ? 20 GLU A CA   2  
ATOM 1403  C C    . GLU A 1 20 ? -2.701  3.027   -4.484  1.00 0.00 ? 20 GLU A C    2  
ATOM 1404  O O    . GLU A 1 20 ? -2.557  4.167   -4.054  1.00 0.00 ? 20 GLU A O    2  
ATOM 1405  C CB   . GLU A 1 20 ? -0.950  2.091   -6.043  1.00 0.00 ? 20 GLU A CB   2  
ATOM 1406  C CG   . GLU A 1 20 ? 0.488   1.569   -6.084  1.00 0.00 ? 20 GLU A CG   2  
ATOM 1407  C CD   . GLU A 1 20 ? 1.457   2.575   -5.480  1.00 0.00 ? 20 GLU A CD   2  
ATOM 1408  O OE1  . GLU A 1 20 ? 1.615   3.651   -6.105  1.00 0.00 ? 20 GLU A OE1  2  
ATOM 1409  O OE2  . GLU A 1 20 ? 2.057   2.275   -4.429  1.00 0.00 ? 20 GLU A OE2  2  
ATOM 1410  H H    . GLU A 1 20 ? -1.709  0.034   -4.854  1.00 0.00 ? 20 GLU A H    2  
ATOM 1411  H HA   . GLU A 1 20 ? -0.700  2.554   -3.958  1.00 0.00 ? 20 GLU A HA   2  
ATOM 1412  H HB2  . GLU A 1 20 ? -1.582  1.434   -6.640  1.00 0.00 ? 20 GLU A HB2  2  
ATOM 1413  H HB3  . GLU A 1 20 ? -0.984  3.090   -6.479  1.00 0.00 ? 20 GLU A HB3  2  
ATOM 1414  H HG2  . GLU A 1 20 ? 0.562   0.610   -5.569  1.00 0.00 ? 20 GLU A HG2  2  
ATOM 1415  H HG3  . GLU A 1 20 ? 0.765   1.412   -7.122  1.00 0.00 ? 20 GLU A HG3  2  
ATOM 1416  N N    . GLU A 1 21 ? -3.903  2.531   -4.787  1.00 0.00 ? 21 GLU A N    2  
ATOM 1417  C CA   . GLU A 1 21 ? -5.147  3.236   -4.554  1.00 0.00 ? 21 GLU A CA   2  
ATOM 1418  C C    . GLU A 1 21 ? -5.264  3.740   -3.124  1.00 0.00 ? 21 GLU A C    2  
ATOM 1419  O O    . GLU A 1 21 ? -5.433  4.944   -2.903  1.00 0.00 ? 21 GLU A O    2  
ATOM 1420  C CB   . GLU A 1 21 ? -6.329  2.393   -4.926  1.00 0.00 ? 21 GLU A CB   2  
ATOM 1421  C CG   . GLU A 1 21 ? -6.446  2.030   -6.397  1.00 0.00 ? 21 GLU A CG   2  
ATOM 1422  C CD   . GLU A 1 21 ? -6.237  3.209   -7.347  1.00 0.00 ? 21 GLU A CD   2  
ATOM 1423  O OE1  . GLU A 1 21 ? -6.942  4.237   -7.213  1.00 0.00 ? 21 GLU A OE1  2  
ATOM 1424  O OE2  . GLU A 1 21 ? -5.389  3.119   -8.264  1.00 0.00 ? 21 GLU A OE2  2  
ATOM 1425  H H    . GLU A 1 21 ? -3.999  1.582   -5.106  1.00 0.00 ? 21 GLU A H    2  
ATOM 1426  H HA   . GLU A 1 21 ? -5.284  4.070   -5.209  1.00 0.00 ? 21 GLU A HA   2  
ATOM 1427  H HB2  . GLU A 1 21 ? -6.412  1.504   -4.311  1.00 0.00 ? 21 GLU A HB2  2  
ATOM 1428  H HB3  . GLU A 1 21 ? -7.126  3.067   -4.696  1.00 0.00 ? 21 GLU A HB3  2  
ATOM 1429  H HG2  . GLU A 1 21 ? -5.777  1.202   -6.620  1.00 0.00 ? 21 GLU A HG2  2  
ATOM 1430  H HG3  . GLU A 1 21 ? -7.456  1.692   -6.534  1.00 0.00 ? 21 GLU A HG3  2  
ATOM 1431  N N    . ALA A 1 22 ? -5.163  2.813   -2.173  1.00 0.00 ? 22 ALA A N    2  
ATOM 1432  C CA   . ALA A 1 22 ? -5.296  3.065   -0.745  1.00 0.00 ? 22 ALA A CA   2  
ATOM 1433  C C    . ALA A 1 22 ? -4.152  3.899   -0.182  1.00 0.00 ? 22 ALA A C    2  
ATOM 1434  O O    . ALA A 1 22 ? -4.262  4.422   0.927   1.00 0.00 ? 22 ALA A O    2  
ATOM 1435  C CB   . ALA A 1 22 ? -5.318  1.722   -0.035  1.00 0.00 ? 22 ALA A CB   2  
ATOM 1436  H H    . ALA A 1 22 ? -4.997  1.858   -2.483  1.00 0.00 ? 22 ALA A H    2  
ATOM 1437  H HA   . ALA A 1 22 ? -6.229  3.601   -0.548  1.00 0.00 ? 22 ALA A HA   2  
ATOM 1438  H HB1  . ALA A 1 22 ? -4.299  1.352   0.071   1.00 0.00 ? 22 ALA A HB1  2  
ATOM 1439  H HB2  . ALA A 1 22 ? -5.791  1.844   0.941   1.00 0.00 ? 22 ALA A HB2  2  
ATOM 1440  H HB3  . ALA A 1 22 ? -5.879  1.015   -0.641  1.00 0.00 ? 22 ALA A HB3  2  
ATOM 1441  N N    . ILE A 1 23 ? -3.056  4.025   -0.919  1.00 0.00 ? 23 ILE A N    2  
ATOM 1442  C CA   . ILE A 1 23 ? -1.981  4.942   -0.576  1.00 0.00 ? 23 ILE A CA   2  
ATOM 1443  C C    . ILE A 1 23 ? -2.394  6.326   -1.066  1.00 0.00 ? 23 ILE A C    2  
ATOM 1444  O O    . ILE A 1 23 ? -2.444  7.276   -0.283  1.00 0.00 ? 23 ILE A O    2  
ATOM 1445  C CB   . ILE A 1 23 ? -0.663  4.413   -1.173  1.00 0.00 ? 23 ILE A CB   2  
ATOM 1446  C CG1  . ILE A 1 23 ? -0.181  3.238   -0.300  1.00 0.00 ? 23 ILE A CG1  2  
ATOM 1447  C CG2  . ILE A 1 23 ? 0.421   5.494   -1.267  1.00 0.00 ? 23 ILE A CG2  2  
ATOM 1448  C CD1  . ILE A 1 23 ? 0.783   2.333   -1.064  1.00 0.00 ? 23 ILE A CD1  2  
ATOM 1449  H H    . ILE A 1 23 ? -3.038  3.527   -1.809  1.00 0.00 ? 23 ILE A H    2  
ATOM 1450  H HA   . ILE A 1 23 ? -1.873  4.988   0.509   1.00 0.00 ? 23 ILE A HA   2  
ATOM 1451  H HB   . ILE A 1 23 ? -0.856  4.050   -2.181  1.00 0.00 ? 23 ILE A HB   2  
ATOM 1452  H HG12 . ILE A 1 23 ? 0.315   3.611   0.593   1.00 0.00 ? 23 ILE A HG12 2  
ATOM 1453  H HG13 . ILE A 1 23 ? -1.034  2.637   0.026   1.00 0.00 ? 23 ILE A HG13 2  
ATOM 1454  H HG21 . ILE A 1 23 ? 0.504   6.009   -0.313  1.00 0.00 ? 23 ILE A HG21 2  
ATOM 1455  H HG22 . ILE A 1 23 ? 1.378   5.048   -1.537  1.00 0.00 ? 23 ILE A HG22 2  
ATOM 1456  H HG23 . ILE A 1 23 ? 0.158   6.210   -2.046  1.00 0.00 ? 23 ILE A HG23 2  
ATOM 1457  H HD11 . ILE A 1 23 ? 0.881   1.400   -0.519  1.00 0.00 ? 23 ILE A HD11 2  
ATOM 1458  H HD12 . ILE A 1 23 ? 0.384   2.108   -2.050  1.00 0.00 ? 23 ILE A HD12 2  
ATOM 1459  H HD13 . ILE A 1 23 ? 1.758   2.808   -1.167  1.00 0.00 ? 23 ILE A HD13 2  
ATOM 1460  N N    . SER A 1 24 ? -2.730  6.445   -2.346  1.00 0.00 ? 24 SER A N    2  
ATOM 1461  C CA   . SER A 1 24 ? -3.068  7.687   -3.005  1.00 0.00 ? 24 SER A CA   2  
ATOM 1462  C C    . SER A 1 24 ? -4.266  8.405   -2.373  1.00 0.00 ? 24 SER A C    2  
ATOM 1463  O O    . SER A 1 24 ? -4.285  9.635   -2.412  1.00 0.00 ? 24 SER A O    2  
ATOM 1464  C CB   . SER A 1 24 ? -3.272  7.377   -4.488  1.00 0.00 ? 24 SER A CB   2  
ATOM 1465  O OG   . SER A 1 24 ? -2.013  7.109   -5.076  1.00 0.00 ? 24 SER A OG   2  
ATOM 1466  H H    . SER A 1 24 ? -2.692  5.629   -2.951  1.00 0.00 ? 24 SER A H    2  
ATOM 1467  H HA   . SER A 1 24 ? -2.211  8.354   -2.919  1.00 0.00 ? 24 SER A HA   2  
ATOM 1468  H HB2  . SER A 1 24 ? -3.910  6.499   -4.590  1.00 0.00 ? 24 SER A HB2  2  
ATOM 1469  H HB3  . SER A 1 24 ? -3.728  8.228   -4.992  1.00 0.00 ? 24 SER A HB3  2  
ATOM 1470  H HG   . SER A 1 24 ? -1.527  7.956   -5.119  1.00 0.00 ? 24 SER A HG   2  
ATOM 1471  N N    . VAL A 1 25 ? -5.228  7.715   -1.748  1.00 0.00 ? 25 VAL A N    2  
ATOM 1472  C CA   . VAL A 1 25 ? -6.249  8.367   -0.919  1.00 0.00 ? 25 VAL A CA   2  
ATOM 1473  C C    . VAL A 1 25 ? -5.561  9.130   0.225   1.00 0.00 ? 25 VAL A C    2  
ATOM 1474  O O    . VAL A 1 25 ? -5.672  10.348  0.326   1.00 0.00 ? 25 VAL A O    2  
ATOM 1475  C CB   . VAL A 1 25 ? -7.342  7.378   -0.415  1.00 0.00 ? 25 VAL A CB   2  
ATOM 1476  C CG1  . VAL A 1 25 ? -8.613  7.376   -1.261  1.00 0.00 ? 25 VAL A CG1  2  
ATOM 1477  C CG2  . VAL A 1 25 ? -6.876  5.964   -0.243  1.00 0.00 ? 25 VAL A CG2  2  
ATOM 1478  H H    . VAL A 1 25 ? -5.210  6.701   -1.797  1.00 0.00 ? 25 VAL A H    2  
ATOM 1479  H HA   . VAL A 1 25 ? -6.735  9.108   -1.550  1.00 0.00 ? 25 VAL A HA   2  
ATOM 1480  H HB   . VAL A 1 25 ? -7.639  7.594   0.593   1.00 0.00 ? 25 VAL A HB   2  
ATOM 1481  H HG11 . VAL A 1 25 ? -8.388  7.016   -2.261  1.00 0.00 ? 25 VAL A HG11 2  
ATOM 1482  H HG12 . VAL A 1 25 ? -9.350  6.711   -0.811  1.00 0.00 ? 25 VAL A HG12 2  
ATOM 1483  H HG13 . VAL A 1 25 ? -9.038  8.372   -1.324  1.00 0.00 ? 25 VAL A HG13 2  
ATOM 1484  H HG21 . VAL A 1 25 ? -5.851  5.972   0.095   1.00 0.00 ? 25 VAL A HG21 2  
ATOM 1485  H HG22 . VAL A 1 25 ? -7.488  5.491   0.519   1.00 0.00 ? 25 VAL A HG22 2  
ATOM 1486  H HG23 . VAL A 1 25 ? -6.997  5.438   -1.182  1.00 0.00 ? 25 VAL A HG23 2  
ATOM 1487  N N    . VAL A 1 26 ? -4.834  8.435   1.089   1.00 0.00 ? 26 VAL A N    2  
ATOM 1488  C CA   . VAL A 1 26 ? -4.158  8.977   2.265   1.00 0.00 ? 26 VAL A CA   2  
ATOM 1489  C C    . VAL A 1 26 ? -3.189  10.106  1.889   1.00 0.00 ? 26 VAL A C    2  
ATOM 1490  O O    . VAL A 1 26 ? -3.133  11.122  2.584   1.00 0.00 ? 26 VAL A O    2  
ATOM 1491  C CB   . VAL A 1 26 ? -3.460  7.830   3.029   1.00 0.00 ? 26 VAL A CB   2  
ATOM 1492  C CG1  . VAL A 1 26 ? -2.834  8.320   4.339   1.00 0.00 ? 26 VAL A CG1  2  
ATOM 1493  C CG2  . VAL A 1 26 ? -4.454  6.715   3.389   1.00 0.00 ? 26 VAL A CG2  2  
ATOM 1494  H H    . VAL A 1 26 ? -4.740  7.453   0.908   1.00 0.00 ? 26 VAL A H    2  
ATOM 1495  H HA   . VAL A 1 26 ? -4.920  9.406   2.911   1.00 0.00 ? 26 VAL A HA   2  
ATOM 1496  H HB   . VAL A 1 26 ? -2.674  7.406   2.406   1.00 0.00 ? 26 VAL A HB   2  
ATOM 1497  H HG11 . VAL A 1 26 ? -2.391  7.479   4.868   1.00 0.00 ? 26 VAL A HG11 2  
ATOM 1498  H HG12 . VAL A 1 26 ? -2.047  9.044   4.129   1.00 0.00 ? 26 VAL A HG12 2  
ATOM 1499  H HG13 . VAL A 1 26 ? -3.604  8.780   4.958   1.00 0.00 ? 26 VAL A HG13 2  
ATOM 1500  H HG21 . VAL A 1 26 ? -5.256  7.119   4.006   1.00 0.00 ? 26 VAL A HG21 2  
ATOM 1501  H HG22 . VAL A 1 26 ? -4.883  6.279   2.492   1.00 0.00 ? 26 VAL A HG22 2  
ATOM 1502  H HG23 . VAL A 1 26 ? -3.938  5.907   3.906   1.00 0.00 ? 26 VAL A HG23 2  
ATOM 1503  N N    . MET A 1 27 ? -2.456  9.965   0.785   1.00 0.00 ? 27 MET A N    2  
ATOM 1504  C CA   . MET A 1 27 ? -1.532  10.983  0.296   1.00 0.00 ? 27 MET A CA   2  
ATOM 1505  C C    . MET A 1 27 ? -2.252  12.276  -0.054  1.00 0.00 ? 27 MET A C    2  
ATOM 1506  O O    . MET A 1 27 ? -1.822  13.354  0.363   1.00 0.00 ? 27 MET A O    2  
ATOM 1507  C CB   . MET A 1 27 ? -0.820  10.475  -0.950  1.00 0.00 ? 27 MET A CB   2  
ATOM 1508  C CG   . MET A 1 27 ? 0.213   9.427   -0.592  1.00 0.00 ? 27 MET A CG   2  
ATOM 1509  S SD   . MET A 1 27 ? 1.170   8.991   -2.042  1.00 0.00 ? 27 MET A SD   2  
ATOM 1510  C CE   . MET A 1 27 ? 2.557   8.275   -1.163  1.00 0.00 ? 27 MET A CE   2  
ATOM 1511  H H    . MET A 1 27 ? -2.535  9.092   0.271   1.00 0.00 ? 27 MET A H    2  
ATOM 1512  H HA   . MET A 1 27 ? -0.796  11.200  1.072   1.00 0.00 ? 27 MET A HA   2  
ATOM 1513  H HB2  . MET A 1 27 ? -1.538  10.068  -1.661  1.00 0.00 ? 27 MET A HB2  2  
ATOM 1514  H HB3  . MET A 1 27 ? -0.295  11.303  -1.423  1.00 0.00 ? 27 MET A HB3  2  
ATOM 1515  H HG2  . MET A 1 27 ? 0.881   9.839   0.165   1.00 0.00 ? 27 MET A HG2  2  
ATOM 1516  H HG3  . MET A 1 27 ? -0.264  8.537   -0.186  1.00 0.00 ? 27 MET A HG3  2  
ATOM 1517  H HE1  . MET A 1 27 ? 3.297   8.016   -1.906  1.00 0.00 ? 27 MET A HE1  2  
ATOM 1518  H HE2  . MET A 1 27 ? 2.967   9.002   -0.467  1.00 0.00 ? 27 MET A HE2  2  
ATOM 1519  H HE3  . MET A 1 27 ? 2.251   7.389   -0.611  1.00 0.00 ? 27 MET A HE3  2  
ATOM 1520  N N    . SER A 1 28 ? -3.336  12.176  -0.820  1.00 0.00 ? 28 SER A N    2  
ATOM 1521  C CA   . SER A 1 28 ? -4.158  13.313  -1.190  1.00 0.00 ? 28 SER A CA   2  
ATOM 1522  C C    . SER A 1 28 ? -5.047  13.797  -0.032  1.00 0.00 ? 28 SER A C    2  
ATOM 1523  O O    . SER A 1 28 ? -5.827  14.739  -0.210  1.00 0.00 ? 28 SER A O    2  
ATOM 1524  C CB   . SER A 1 28 ? -4.977  12.912  -2.412  1.00 0.00 ? 28 SER A CB   2  
ATOM 1525  O OG   . SER A 1 28 ? -4.139  12.583  -3.513  1.00 0.00 ? 28 SER A OG   2  
ATOM 1526  H H    . SER A 1 28 ? -3.640  11.267  -1.155  1.00 0.00 ? 28 SER A H    2  
ATOM 1527  H HA   . SER A 1 28 ? -3.505  14.140  -1.467  1.00 0.00 ? 28 SER A HA   2  
ATOM 1528  H HB2  . SER A 1 28 ? -5.587  12.045  -2.171  1.00 0.00 ? 28 SER A HB2  2  
ATOM 1529  H HB3  . SER A 1 28 ? -5.640  13.728  -2.693  1.00 0.00 ? 28 SER A HB3  2  
ATOM 1530  H HG   . SER A 1 28 ? -3.223  12.884  -3.336  1.00 0.00 ? 28 SER A HG   2  
ATOM 1531  N N    . GLY A 1 29 ? -4.951  13.188  1.156   1.00 0.00 ? 29 GLY A N    2  
ATOM 1532  C CA   . GLY A 1 29 ? -5.696  13.642  2.314   1.00 0.00 ? 29 GLY A CA   2  
ATOM 1533  C C    . GLY A 1 29 ? -7.150  13.211  2.266   1.00 0.00 ? 29 GLY A C    2  
ATOM 1534  O O    . GLY A 1 29 ? -7.981  13.873  2.881   1.00 0.00 ? 29 GLY A O    2  
ATOM 1535  H H    . GLY A 1 29 ? -4.339  12.388  1.277   1.00 0.00 ? 29 GLY A H    2  
ATOM 1536  H HA2  . GLY A 1 29 ? -5.230  13.263  3.224   1.00 0.00 ? 29 GLY A HA2  2  
ATOM 1537  H HA3  . GLY A 1 29 ? -5.687  14.729  2.317   1.00 0.00 ? 29 GLY A HA3  2  
ATOM 1538  N N    . LYS A 1 30 ? -7.479  12.161  1.511   1.00 0.00 ? 30 LYS A N    2  
ATOM 1539  C CA   . LYS A 1 30 ? -8.857  11.712  1.318   1.00 0.00 ? 30 LYS A CA   2  
ATOM 1540  C C    . LYS A 1 30 ? -9.367  11.041  2.588   1.00 0.00 ? 30 LYS A C    2  
ATOM 1541  O O    . LYS A 1 30 ? -10.572 11.033  2.849   1.00 0.00 ? 30 LYS A O    2  
ATOM 1542  C CB   . LYS A 1 30 ? -8.887  10.736  0.128   1.00 0.00 ? 30 LYS A CB   2  
ATOM 1543  C CG   . LYS A 1 30 ? -8.312  11.321  -1.181  1.00 0.00 ? 30 LYS A CG   2  
ATOM 1544  C CD   . LYS A 1 30 ? -9.017  12.552  -1.751  1.00 0.00 ? 30 LYS A CD   2  
ATOM 1545  C CE   . LYS A 1 30 ? -10.307 12.160  -2.482  1.00 0.00 ? 30 LYS A CE   2  
ATOM 1546  N NZ   . LYS A 1 30 ? -10.070 11.482  -3.776  1.00 0.00 ? 30 LYS A NZ   2  
ATOM 1547  H H    . LYS A 1 30 ? -6.732  11.602  1.092   1.00 0.00 ? 30 LYS A H    2  
ATOM 1548  H HA   . LYS A 1 30 ? -9.495  12.576  1.117   1.00 0.00 ? 30 LYS A HA   2  
ATOM 1549  H HB2  . LYS A 1 30 ? -8.288  9.875   0.406   1.00 0.00 ? 30 LYS A HB2  2  
ATOM 1550  H HB3  . LYS A 1 30 ? -9.884  10.335  -0.035  1.00 0.00 ? 30 LYS A HB3  2  
ATOM 1551  H HG2  . LYS A 1 30 ? -7.283  11.608  -1.006  1.00 0.00 ? 30 LYS A HG2  2  
ATOM 1552  H HG3  . LYS A 1 30 ? -8.300  10.543  -1.940  1.00 0.00 ? 30 LYS A HG3  2  
ATOM 1553  H HD2  . LYS A 1 30 ? -9.219  13.262  -0.946  1.00 0.00 ? 30 LYS A HD2  2  
ATOM 1554  H HD3  . LYS A 1 30 ? -8.344  13.056  -2.444  1.00 0.00 ? 30 LYS A HD3  2  
ATOM 1555  H HE2  . LYS A 1 30 ? -10.900 11.513  -1.836  1.00 0.00 ? 30 LYS A HE2  2  
ATOM 1556  H HE3  . LYS A 1 30 ? -10.879 13.063  -2.682  1.00 0.00 ? 30 LYS A HE3  2  
ATOM 1557  H HZ1  . LYS A 1 30 ? -9.602  10.585  -3.676  1.00 0.00 ? 30 LYS A HZ1  2  
ATOM 1558  H HZ2  . LYS A 1 30 ? -10.951 11.317  -4.255  1.00 0.00 ? 30 LYS A HZ2  2  
ATOM 1559  H HZ3  . LYS A 1 30 ? -9.533  12.076  -4.401  1.00 0.00 ? 30 LYS A HZ3  2  
ATOM 1560  N N    . MET A 1 31 ? -8.456  10.472  3.373   1.00 0.00 ? 31 MET A N    2  
ATOM 1561  C CA   . MET A 1 31 ? -8.680  9.772   4.622   1.00 0.00 ? 31 MET A CA   2  
ATOM 1562  C C    . MET A 1 31 ? -7.323  9.590   5.311   1.00 0.00 ? 31 MET A C    2  
ATOM 1563  O O    . MET A 1 31 ? -6.304  10.027  4.774   1.00 0.00 ? 31 MET A O    2  
ATOM 1564  C CB   . MET A 1 31 ? -9.330  8.412   4.351   1.00 0.00 ? 31 MET A CB   2  
ATOM 1565  C CG   . MET A 1 31 ? -8.519  7.488   3.457   1.00 0.00 ? 31 MET A CG   2  
ATOM 1566  S SD   . MET A 1 31 ? -9.435  6.136   2.666   1.00 0.00 ? 31 MET A SD   2  
ATOM 1567  C CE   . MET A 1 31 ? -10.818 6.935   1.858   1.00 0.00 ? 31 MET A CE   2  
ATOM 1568  H H    . MET A 1 31 ? -7.472  10.574  3.152   1.00 0.00 ? 31 MET A H    2  
ATOM 1569  H HA   . MET A 1 31 ? -9.333  10.363  5.262   1.00 0.00 ? 31 MET A HA   2  
ATOM 1570  H HB2  . MET A 1 31 ? -9.478  7.945   5.306   1.00 0.00 ? 31 MET A HB2  2  
ATOM 1571  H HB3  . MET A 1 31 ? -10.306 8.508   3.916   1.00 0.00 ? 31 MET A HB3  2  
ATOM 1572  H HG2  . MET A 1 31 ? -8.037  8.070   2.676   1.00 0.00 ? 31 MET A HG2  2  
ATOM 1573  H HG3  . MET A 1 31 ? -7.752  7.051   4.090   1.00 0.00 ? 31 MET A HG3  2  
ATOM 1574  H HE1  . MET A 1 31 ? -11.502 7.278   2.628   1.00 0.00 ? 31 MET A HE1  2  
ATOM 1575  H HE2  . MET A 1 31 ? -10.463 7.763   1.249   1.00 0.00 ? 31 MET A HE2  2  
ATOM 1576  H HE3  . MET A 1 31 ? -11.319 6.187   1.245   1.00 0.00 ? 31 MET A HE3  2  
ATOM 1577  N N    . SER A 1 32 ? -7.305  8.907   6.454   1.00 0.00 ? 32 SER A N    2  
ATOM 1578  C CA   . SER A 1 32 ? -6.092  8.556   7.187   1.00 0.00 ? 32 SER A CA   2  
ATOM 1579  C C    . SER A 1 32 ? -5.716  7.083   6.953   1.00 0.00 ? 32 SER A C    2  
ATOM 1580  O O    . SER A 1 32 ? -6.465  6.354   6.294   1.00 0.00 ? 32 SER A O    2  
ATOM 1581  C CB   . SER A 1 32 ? -6.340  8.854   8.663   1.00 0.00 ? 32 SER A CB   2  
ATOM 1582  O OG   . SER A 1 32 ? -6.878  10.152  8.850   1.00 0.00 ? 32 SER A OG   2  
ATOM 1583  H H    . SER A 1 32 ? -8.177  8.584   6.857   1.00 0.00 ? 32 SER A H    2  
ATOM 1584  H HA   . SER A 1 32 ? -5.262  9.176   6.850   1.00 0.00 ? 32 SER A HA   2  
ATOM 1585  H HB2  . SER A 1 32 ? -7.049  8.122   9.049   1.00 0.00 ? 32 SER A HB2  2  
ATOM 1586  H HB3  . SER A 1 32 ? -5.405  8.764   9.211   1.00 0.00 ? 32 SER A HB3  2  
ATOM 1587  H HG   . SER A 1 32 ? -6.234  10.829  8.591   1.00 0.00 ? 32 SER A HG   2  
ATOM 1588  N N    . VAL A 1 33 ? -4.570  6.640   7.488   1.00 0.00 ? 33 VAL A N    2  
ATOM 1589  C CA   . VAL A 1 33 ? -4.054  5.277   7.331   1.00 0.00 ? 33 VAL A CA   2  
ATOM 1590  C C    . VAL A 1 33 ? -5.088  4.269   7.853   1.00 0.00 ? 33 VAL A C    2  
ATOM 1591  O O    . VAL A 1 33 ? -5.516  3.398   7.099   1.00 0.00 ? 33 VAL A O    2  
ATOM 1592  C CB   . VAL A 1 33 ? -2.663  5.151   8.009   1.00 0.00 ? 33 VAL A CB   2  
ATOM 1593  C CG1  . VAL A 1 33 ? -2.035  3.754   7.900   1.00 0.00 ? 33 VAL A CG1  2  
ATOM 1594  C CG2  . VAL A 1 33 ? -1.665  6.149   7.399   1.00 0.00 ? 33 VAL A CG2  2  
ATOM 1595  H H    . VAL A 1 33 ? -4.024  7.251   8.084   1.00 0.00 ? 33 VAL A H    2  
ATOM 1596  H HA   . VAL A 1 33 ? -3.929  5.089   6.264   1.00 0.00 ? 33 VAL A HA   2  
ATOM 1597  H HB   . VAL A 1 33 ? -2.753  5.379   9.067   1.00 0.00 ? 33 VAL A HB   2  
ATOM 1598  H HG11 . VAL A 1 33 ? -2.712  2.987   8.280   1.00 0.00 ? 33 VAL A HG11 2  
ATOM 1599  H HG12 . VAL A 1 33 ? -1.759  3.528   6.873   1.00 0.00 ? 33 VAL A HG12 2  
ATOM 1600  H HG13 . VAL A 1 33 ? -1.134  3.729   8.513   1.00 0.00 ? 33 VAL A HG13 2  
ATOM 1601  H HG21 . VAL A 1 33 ? -0.711  6.068   7.916   1.00 0.00 ? 33 VAL A HG21 2  
ATOM 1602  H HG22 . VAL A 1 33 ? -1.512  5.934   6.342   1.00 0.00 ? 33 VAL A HG22 2  
ATOM 1603  H HG23 . VAL A 1 33 ? -2.013  7.172   7.524   1.00 0.00 ? 33 VAL A HG23 2  
ATOM 1604  N N    . SER A 1 34 ? -5.557  4.428   9.095   1.00 0.00 ? 34 SER A N    2  
ATOM 1605  C CA   . SER A 1 34 ? -6.546  3.565   9.742   1.00 0.00 ? 34 SER A CA   2  
ATOM 1606  C C    . SER A 1 34 ? -7.782  3.376   8.870   1.00 0.00 ? 34 SER A C    2  
ATOM 1607  O O    . SER A 1 34 ? -8.339  2.276   8.790   1.00 0.00 ? 34 SER A O    2  
ATOM 1608  C CB   . SER A 1 34 ? -6.942  4.199   11.089  1.00 0.00 ? 34 SER A CB   2  
ATOM 1609  O OG   . SER A 1 34 ? -7.800  3.364   11.838  1.00 0.00 ? 34 SER A OG   2  
ATOM 1610  H H    . SER A 1 34 ? -5.217  5.223   9.632   1.00 0.00 ? 34 SER A H    2  
ATOM 1611  H HA   . SER A 1 34 ? -6.100  2.586   9.905   1.00 0.00 ? 34 SER A HA   2  
ATOM 1612  H HB2  . SER A 1 34 ? -6.050  4.388   11.684  1.00 0.00 ? 34 SER A HB2  2  
ATOM 1613  H HB3  . SER A 1 34 ? -7.444  5.153   10.916  1.00 0.00 ? 34 SER A HB3  2  
ATOM 1614  H HG   . SER A 1 34 ? -8.709  3.461   11.483  1.00 0.00 ? 34 SER A HG   2  
ATOM 1615  N N    . LYS A 1 35 ? -8.221  4.471   8.247   1.00 0.00 ? 35 LYS A N    2  
ATOM 1616  C CA   . LYS A 1 35 ? -9.408  4.501   7.428   1.00 0.00 ? 35 LYS A CA   2  
ATOM 1617  C C    . LYS A 1 35 ? -9.184  3.628   6.203   1.00 0.00 ? 35 LYS A C    2  
ATOM 1618  O O    . LYS A 1 35 ? -9.762  2.542   6.131   1.00 0.00 ? 35 LYS A O    2  
ATOM 1619  C CB   . LYS A 1 35 ? -9.769  5.948   7.115   1.00 0.00 ? 35 LYS A CB   2  
ATOM 1620  C CG   . LYS A 1 35 ? -11.001 6.004   6.204   1.00 0.00 ? 35 LYS A CG   2  
ATOM 1621  C CD   . LYS A 1 35 ? -11.932 7.130   6.607   1.00 0.00 ? 35 LYS A CD   2  
ATOM 1622  C CE   . LYS A 1 35 ? -13.038 7.318   5.572   1.00 0.00 ? 35 LYS A CE   2  
ATOM 1623  N NZ   . LYS A 1 35 ? -13.798 8.550   5.830   1.00 0.00 ? 35 LYS A NZ   2  
ATOM 1624  H H    . LYS A 1 35 ? -7.655  5.305   8.314   1.00 0.00 ? 35 LYS A H    2  
ATOM 1625  H HA   . LYS A 1 35 ? -10.228 4.100   8.009   1.00 0.00 ? 35 LYS A HA   2  
ATOM 1626  H HB2  . LYS A 1 35 ? -9.969  6.465   8.054   1.00 0.00 ? 35 LYS A HB2  2  
ATOM 1627  H HB3  . LYS A 1 35 ? -8.927  6.438   6.641   1.00 0.00 ? 35 LYS A HB3  2  
ATOM 1628  H HG2  . LYS A 1 35 ? -10.701 6.141   5.177   1.00 0.00 ? 35 LYS A HG2  2  
ATOM 1629  H HG3  . LYS A 1 35 ? -11.539 5.076   6.244   1.00 0.00 ? 35 LYS A HG3  2  
ATOM 1630  H HD2  . LYS A 1 35 ? -12.366 6.884   7.570   1.00 0.00 ? 35 LYS A HD2  2  
ATOM 1631  H HD3  . LYS A 1 35 ? -11.347 8.041   6.700   1.00 0.00 ? 35 LYS A HD3  2  
ATOM 1632  H HE2  . LYS A 1 35 ? -12.586 7.382   4.580   1.00 0.00 ? 35 LYS A HE2  2  
ATOM 1633  H HE3  . LYS A 1 35 ? -13.713 6.462   5.596   1.00 0.00 ? 35 LYS A HE3  2  
ATOM 1634  H HZ1  . LYS A 1 35 ? -13.169 9.345   5.895   1.00 0.00 ? 35 LYS A HZ1  2  
ATOM 1635  H HZ2  . LYS A 1 35 ? -14.444 8.724   5.068   1.00 0.00 ? 35 LYS A HZ2  2  
ATOM 1636  H HZ3  . LYS A 1 35 ? -14.347 8.500   6.684   1.00 0.00 ? 35 LYS A HZ3  2  
ATOM 1637  N N    . ALA A 1 36 ? -8.357  4.093   5.263   1.00 0.00 ? 36 ALA A N    2  
ATOM 1638  C CA   . ALA A 1 36 ? -8.081  3.418   4.006   1.00 0.00 ? 36 ALA A CA   2  
ATOM 1639  C C    . ALA A 1 36 ? -7.664  1.965   4.181   1.00 0.00 ? 36 ALA A C    2  
ATOM 1640  O O    . ALA A 1 36 ? -8.107  1.141   3.390   1.00 0.00 ? 36 ALA A O    2  
ATOM 1641  C CB   . ALA A 1 36 ? -6.961  4.162   3.266   1.00 0.00 ? 36 ALA A CB   2  
ATOM 1642  H H    . ALA A 1 36 ? -8.006  5.040   5.338   1.00 0.00 ? 36 ALA A H    2  
ATOM 1643  H HA   . ALA A 1 36 ? -9.021  3.419   3.435   1.00 0.00 ? 36 ALA A HA   2  
ATOM 1644  H HB1  . ALA A 1 36 ? -6.010  3.981   3.761   1.00 0.00 ? 36 ALA A HB1  2  
ATOM 1645  H HB2  . ALA A 1 36 ? -6.908  3.821   2.232   1.00 0.00 ? 36 ALA A HB2  2  
ATOM 1646  H HB3  . ALA A 1 36 ? -7.121  5.236   3.284   1.00 0.00 ? 36 ALA A HB3  2  
ATOM 1647  N N    . GLN A 1 37 ? -6.875  1.624   5.202   1.00 0.00 ? 37 GLN A N    2  
ATOM 1648  C CA   . GLN A 1 37 ? -6.548  0.252   5.547   1.00 0.00 ? 37 GLN A CA   2  
ATOM 1649  C C    . GLN A 1 37 ? -7.821  -0.590  5.501   1.00 0.00 ? 37 GLN A C    2  
ATOM 1650  O O    . GLN A 1 37 ? -7.913  -1.540  4.723   1.00 0.00 ? 37 GLN A O    2  
ATOM 1651  C CB   . GLN A 1 37 ? -5.859  0.263   6.923   1.00 0.00 ? 37 GLN A CB   2  
ATOM 1652  C CG   . GLN A 1 37 ? -5.987  -1.036  7.742   1.00 0.00 ? 37 GLN A CG   2  
ATOM 1653  C CD   . GLN A 1 37 ? -6.572  -0.819  9.126   1.00 0.00 ? 37 GLN A CD   2  
ATOM 1654  O OE1  . GLN A 1 37 ? -6.086  -0.012  9.914   1.00 0.00 ? 37 GLN A OE1  2  
ATOM 1655  N NE2  . GLN A 1 37 ? -7.597  -1.576  9.482   1.00 0.00 ? 37 GLN A NE2  2  
ATOM 1656  H H    . GLN A 1 37 ? -6.495  2.334   5.820   1.00 0.00 ? 37 GLN A H    2  
ATOM 1657  H HA   . GLN A 1 37 ? -5.851  -0.145  4.811   1.00 0.00 ? 37 GLN A HA   2  
ATOM 1658  H HB2  . GLN A 1 37 ? -4.806  0.517   6.762   1.00 0.00 ? 37 GLN A HB2  2  
ATOM 1659  H HB3  . GLN A 1 37 ? -6.303  1.055   7.520   1.00 0.00 ? 37 GLN A HB3  2  
ATOM 1660  H HG2  . GLN A 1 37 ? -6.615  -1.753  7.231   1.00 0.00 ? 37 GLN A HG2  2  
ATOM 1661  H HG3  . GLN A 1 37 ? -5.026  -1.507  7.839   1.00 0.00 ? 37 GLN A HG3  2  
ATOM 1662  H HE21 . GLN A 1 37 ? -7.983  -2.294  8.859   1.00 0.00 ? 37 GLN A HE21 2  
ATOM 1663  H HE22 . GLN A 1 37 ? -8.171  -1.222  10.245  1.00 0.00 ? 37 GLN A HE22 2  
ATOM 1664  N N    . SER A 1 38 ? -8.798  -0.240  6.334   1.00 0.00 ? 38 SER A N    2  
ATOM 1665  C CA   . SER A 1 38 ? -10.000 -1.030  6.466   1.00 0.00 ? 38 SER A CA   2  
ATOM 1666  C C    . SER A 1 38 ? -10.847 -0.946  5.184   1.00 0.00 ? 38 SER A C    2  
ATOM 1667  O O    . SER A 1 38 ? -11.491 -1.933  4.820   1.00 0.00 ? 38 SER A O    2  
ATOM 1668  C CB   . SER A 1 38 ? -10.764 -0.530  7.693   1.00 0.00 ? 38 SER A CB   2  
ATOM 1669  O OG   . SER A 1 38 ? -11.827 -1.387  8.057   1.00 0.00 ? 38 SER A OG   2  
ATOM 1670  H H    . SER A 1 38 ? -8.703  0.604   6.887   1.00 0.00 ? 38 SER A H    2  
ATOM 1671  H HA   . SER A 1 38 ? -9.667  -2.056  6.644   1.00 0.00 ? 38 SER A HA   2  
ATOM 1672  H HB2  . SER A 1 38 ? -10.082 -0.450  8.540   1.00 0.00 ? 38 SER A HB2  2  
ATOM 1673  H HB3  . SER A 1 38 ? -11.163 0.458   7.472   1.00 0.00 ? 38 SER A HB3  2  
ATOM 1674  H HG   . SER A 1 38 ? -12.317 -0.919  8.764   1.00 0.00 ? 38 SER A HG   2  
ATOM 1675  N N    . ILE A 1 39 ? -10.860 0.206   4.495   1.00 0.00 ? 39 ILE A N    2  
ATOM 1676  C CA   . ILE A 1 39 ? -11.620 0.405   3.257   1.00 0.00 ? 39 ILE A CA   2  
ATOM 1677  C C    . ILE A 1 39 ? -11.131 -0.577  2.189   1.00 0.00 ? 39 ILE A C    2  
ATOM 1678  O O    . ILE A 1 39 ? -11.921 -1.324  1.616   1.00 0.00 ? 39 ILE A O    2  
ATOM 1679  C CB   . ILE A 1 39 ? -11.599 1.879   2.786   1.00 0.00 ? 39 ILE A CB   2  
ATOM 1680  C CG1  . ILE A 1 39 ? -12.312 2.725   3.859   1.00 0.00 ? 39 ILE A CG1  2  
ATOM 1681  C CG2  . ILE A 1 39 ? -12.278 2.044   1.413   1.00 0.00 ? 39 ILE A CG2  2  
ATOM 1682  C CD1  . ILE A 1 39 ? -12.538 4.186   3.504   1.00 0.00 ? 39 ILE A CD1  2  
ATOM 1683  H H    . ILE A 1 39 ? -10.306 0.976   4.849   1.00 0.00 ? 39 ILE A H    2  
ATOM 1684  H HA   . ILE A 1 39 ? -12.658 0.192   3.471   1.00 0.00 ? 39 ILE A HA   2  
ATOM 1685  H HB   . ILE A 1 39 ? -10.577 2.225   2.689   1.00 0.00 ? 39 ILE A HB   2  
ATOM 1686  H HG12 . ILE A 1 39 ? -13.272 2.282   4.061   1.00 0.00 ? 39 ILE A HG12 2  
ATOM 1687  H HG13 . ILE A 1 39 ? -11.754 2.696   4.787   1.00 0.00 ? 39 ILE A HG13 2  
ATOM 1688  H HG21 . ILE A 1 39 ? -11.797 1.418   0.660   1.00 0.00 ? 39 ILE A HG21 2  
ATOM 1689  H HG22 . ILE A 1 39 ? -13.334 1.774   1.479   1.00 0.00 ? 39 ILE A HG22 2  
ATOM 1690  H HG23 . ILE A 1 39 ? -12.189 3.071   1.060   1.00 0.00 ? 39 ILE A HG23 2  
ATOM 1691  H HD11 . ILE A 1 39 ? -11.583 4.632   3.262   1.00 0.00 ? 39 ILE A HD11 2  
ATOM 1692  H HD12 . ILE A 1 39 ? -13.215 4.266   2.656   1.00 0.00 ? 39 ILE A HD12 2  
ATOM 1693  H HD13 . ILE A 1 39 ? -12.988 4.690   4.356   1.00 0.00 ? 39 ILE A HD13 2  
ATOM 1694  N N    . TYR A 1 40 ? -9.833  -0.550  1.908   1.00 0.00 ? 40 TYR A N    2  
ATOM 1695  C CA   . TYR A 1 40 ? -9.213  -1.210  0.769   1.00 0.00 ? 40 TYR A CA   2  
ATOM 1696  C C    . TYR A 1 40 ? -8.777  -2.640  1.102   1.00 0.00 ? 40 TYR A C    2  
ATOM 1697  O O    . TYR A 1 40 ? -8.512  -3.429  0.192   1.00 0.00 ? 40 TYR A O    2  
ATOM 1698  C CB   . TYR A 1 40 ? -8.026  -0.342  0.339   1.00 0.00 ? 40 TYR A CB   2  
ATOM 1699  C CG   . TYR A 1 40 ? -8.417  0.928   -0.409  1.00 0.00 ? 40 TYR A CG   2  
ATOM 1700  C CD1  . TYR A 1 40 ? -8.736  2.114   0.287   1.00 0.00 ? 40 TYR A CD1  2  
ATOM 1701  C CD2  . TYR A 1 40 ? -8.338  0.968   -1.809  1.00 0.00 ? 40 TYR A CD2  2  
ATOM 1702  C CE1  . TYR A 1 40 ? -9.002  3.315   -0.394  1.00 0.00 ? 40 TYR A CE1  2  
ATOM 1703  C CE2  . TYR A 1 40 ? -8.603  2.160   -2.494  1.00 0.00 ? 40 TYR A CE2  2  
ATOM 1704  C CZ   . TYR A 1 40 ? -8.970  3.330   -1.804  1.00 0.00 ? 40 TYR A CZ   2  
ATOM 1705  O OH   . TYR A 1 40 ? -9.258  4.462   -2.499  1.00 0.00 ? 40 TYR A OH   2  
ATOM 1706  H H    . TYR A 1 40 ? -9.234  0.053   2.459   1.00 0.00 ? 40 TYR A H    2  
ATOM 1707  H HA   . TYR A 1 40 ? -9.928  -1.261  -0.055  1.00 0.00 ? 40 TYR A HA   2  
ATOM 1708  H HB2  . TYR A 1 40 ? -7.472  -0.044  1.227   1.00 0.00 ? 40 TYR A HB2  2  
ATOM 1709  H HB3  . TYR A 1 40 ? -7.326  -0.940  -0.254  1.00 0.00 ? 40 TYR A HB3  2  
ATOM 1710  H HD1  . TYR A 1 40 ? -8.740  2.126   1.356   1.00 0.00 ? 40 TYR A HD1  2  
ATOM 1711  H HD2  . TYR A 1 40 ? -8.016  0.109   -2.373  1.00 0.00 ? 40 TYR A HD2  2  
ATOM 1712  H HE1  . TYR A 1 40 ? -9.187  4.231   0.156   1.00 0.00 ? 40 TYR A HE1  2  
ATOM 1713  H HE2  . TYR A 1 40 ? -8.462  2.186   -3.556  1.00 0.00 ? 40 TYR A HE2  2  
ATOM 1714  H HH   . TYR A 1 40 ? -9.367  4.270   -3.437  1.00 0.00 ? 40 TYR A HH   2  
ATOM 1715  N N    . GLY A 1 41 ? -8.711  -2.991  2.389   1.00 0.00 ? 41 GLY A N    2  
ATOM 1716  C CA   . GLY A 1 41 ? -8.358  -4.324  2.854   1.00 0.00 ? 41 GLY A CA   2  
ATOM 1717  C C    . GLY A 1 41 ? -6.850  -4.498  2.996   1.00 0.00 ? 41 GLY A C    2  
ATOM 1718  O O    . GLY A 1 41 ? -6.346  -5.617  2.868   1.00 0.00 ? 41 GLY A O    2  
ATOM 1719  H H    . GLY A 1 41 ? -8.808  -2.262  3.086   1.00 0.00 ? 41 GLY A H    2  
ATOM 1720  H HA2  . GLY A 1 41 ? -8.816  -4.488  3.827   1.00 0.00 ? 41 GLY A HA2  2  
ATOM 1721  H HA3  . GLY A 1 41 ? -8.747  -5.063  2.154   1.00 0.00 ? 41 GLY A HA3  2  
ATOM 1722  N N    . ILE A 1 42 ? -6.127  -3.401  3.213   1.00 0.00 ? 42 ILE A N    2  
ATOM 1723  C CA   . ILE A 1 42 ? -4.679  -3.364  3.367   1.00 0.00 ? 42 ILE A CA   2  
ATOM 1724  C C    . ILE A 1 42 ? -4.367  -3.456  4.871   1.00 0.00 ? 42 ILE A C    2  
ATOM 1725  O O    . ILE A 1 42 ? -5.139  -2.915  5.663   1.00 0.00 ? 42 ILE A O    2  
ATOM 1726  C CB   . ILE A 1 42 ? -4.135  -2.033  2.796   1.00 0.00 ? 42 ILE A CB   2  
ATOM 1727  C CG1  . ILE A 1 42 ? -4.777  -1.508  1.507   1.00 0.00 ? 42 ILE A CG1  2  
ATOM 1728  C CG2  . ILE A 1 42 ? -2.613  -2.145  2.627   1.00 0.00 ? 42 ILE A CG2  2  
ATOM 1729  C CD1  . ILE A 1 42 ? -4.577  -2.346  0.257   1.00 0.00 ? 42 ILE A CD1  2  
ATOM 1730  H H    . ILE A 1 42 ? -6.633  -2.545  3.412   1.00 0.00 ? 42 ILE A H    2  
ATOM 1731  H HA   . ILE A 1 42 ? -4.242  -4.203  2.826   1.00 0.00 ? 42 ILE A HA   2  
ATOM 1732  H HB   . ILE A 1 42 ? -4.372  -1.238  3.495   1.00 0.00 ? 42 ILE A HB   2  
ATOM 1733  H HG12 . ILE A 1 42 ? -5.842  -1.386  1.672   1.00 0.00 ? 42 ILE A HG12 2  
ATOM 1734  H HG13 . ILE A 1 42 ? -4.381  -0.515  1.316   1.00 0.00 ? 42 ILE A HG13 2  
ATOM 1735  H HG21 . ILE A 1 42 ? -2.221  -1.253  2.141   1.00 0.00 ? 42 ILE A HG21 2  
ATOM 1736  H HG22 . ILE A 1 42 ? -2.129  -2.238  3.598   1.00 0.00 ? 42 ILE A HG22 2  
ATOM 1737  H HG23 . ILE A 1 42 ? -2.381  -3.028  2.021   1.00 0.00 ? 42 ILE A HG23 2  
ATOM 1738  H HD11 . ILE A 1 42 ? -3.527  -2.585  0.100   1.00 0.00 ? 42 ILE A HD11 2  
ATOM 1739  H HD12 . ILE A 1 42 ? -5.171  -3.252  0.341   1.00 0.00 ? 42 ILE A HD12 2  
ATOM 1740  H HD13 . ILE A 1 42 ? -4.920  -1.750  -0.582  1.00 0.00 ? 42 ILE A HD13 2  
ATOM 1741  N N    . PRO A 1 43 ? -3.270  -4.086  5.322   1.00 0.00 ? 43 PRO A N    2  
ATOM 1742  C CA   . PRO A 1 43 ? -2.830  -3.969  6.709   1.00 0.00 ? 43 PRO A CA   2  
ATOM 1743  C C    . PRO A 1 43 ? -2.339  -2.555  7.020   1.00 0.00 ? 43 PRO A C    2  
ATOM 1744  O O    . PRO A 1 43 ? -1.734  -1.905  6.172   1.00 0.00 ? 43 PRO A O    2  
ATOM 1745  C CB   . PRO A 1 43 ? -1.699  -4.976  6.889   1.00 0.00 ? 43 PRO A CB   2  
ATOM 1746  C CG   . PRO A 1 43 ? -1.396  -5.550  5.512   1.00 0.00 ? 43 PRO A CG   2  
ATOM 1747  C CD   . PRO A 1 43 ? -2.404  -4.951  4.547   1.00 0.00 ? 43 PRO A CD   2  
ATOM 1748  H HA   . PRO A 1 43 ? -3.657  -4.218  7.379   1.00 0.00 ? 43 PRO A HA   2  
ATOM 1749  H HB2  . PRO A 1 43 ? -0.808  -4.525  7.329   1.00 0.00 ? 43 PRO A HB2  2  
ATOM 1750  H HB3  . PRO A 1 43 ? -2.051  -5.780  7.517   1.00 0.00 ? 43 PRO A HB3  2  
ATOM 1751  H HG2  . PRO A 1 43 ? -0.388  -5.304  5.200   1.00 0.00 ? 43 PRO A HG2  2  
ATOM 1752  H HG3  . PRO A 1 43 ? -1.510  -6.625  5.542   1.00 0.00 ? 43 PRO A HG3  2  
ATOM 1753  H HD2  . PRO A 1 43 ? -1.870  -4.395  3.781   1.00 0.00 ? 43 PRO A HD2  2  
ATOM 1754  H HD3  . PRO A 1 43 ? -2.987  -5.745  4.088   1.00 0.00 ? 43 PRO A HD3  2  
ATOM 1755  N N    . HIS A 1 44 ? -2.543  -2.108  8.259   1.00 0.00 ? 44 HIS A N    2  
ATOM 1756  C CA   . HIS A 1 44 ? -2.214  -0.769  8.727   1.00 0.00 ? 44 HIS A CA   2  
ATOM 1757  C C    . HIS A 1 44 ? -0.714  -0.535  8.657   1.00 0.00 ? 44 HIS A C    2  
ATOM 1758  O O    . HIS A 1 44 ? -0.294  0.434   8.043   1.00 0.00 ? 44 HIS A O    2  
ATOM 1759  C CB   . HIS A 1 44 ? -2.716  -0.579  10.161  1.00 0.00 ? 44 HIS A CB   2  
ATOM 1760  C CG   . HIS A 1 44 ? -2.729  0.854   10.628  1.00 0.00 ? 44 HIS A CG   2  
ATOM 1761  N ND1  . HIS A 1 44 ? -3.864  1.598   10.849  1.00 0.00 ? 44 HIS A ND1  2  
ATOM 1762  C CD2  . HIS A 1 44 ? -1.648  1.633   10.949  1.00 0.00 ? 44 HIS A CD2  2  
ATOM 1763  C CE1  . HIS A 1 44 ? -3.474  2.799   11.308  1.00 0.00 ? 44 HIS A CE1  2  
ATOM 1764  N NE2  . HIS A 1 44 ? -2.137  2.866   11.390  1.00 0.00 ? 44 HIS A NE2  2  
ATOM 1765  H H    . HIS A 1 44 ? -3.006  -2.733  8.910   1.00 0.00 ? 44 HIS A H    2  
ATOM 1766  H HA   . HIS A 1 44 ? -2.713  -0.047  8.077   1.00 0.00 ? 44 HIS A HA   2  
ATOM 1767  H HB2  . HIS A 1 44 ? -3.733  -0.953  10.212  1.00 0.00 ? 44 HIS A HB2  2  
ATOM 1768  H HB3  . HIS A 1 44 ? -2.111  -1.169  10.851  1.00 0.00 ? 44 HIS A HB3  2  
ATOM 1769  H HD1  . HIS A 1 44 ? -4.819  1.282   10.682  1.00 0.00 ? 44 HIS A HD1  2  
ATOM 1770  H HD2  . HIS A 1 44 ? -0.606  1.352   10.887  1.00 0.00 ? 44 HIS A HD2  2  
ATOM 1771  H HE1  . HIS A 1 44 ? -4.135  3.606   11.581  1.00 0.00 ? 44 HIS A HE1  2  
ATOM 1772  N N    . SER A 1 45 ? 0.088   -1.400  9.286   1.00 0.00 ? 45 SER A N    2  
ATOM 1773  C CA   . SER A 1 45 ? 1.535   -1.232  9.369   1.00 0.00 ? 45 SER A CA   2  
ATOM 1774  C C    . SER A 1 45 ? 2.140   -1.147  7.966   1.00 0.00 ? 45 SER A C    2  
ATOM 1775  O O    . SER A 1 45 ? 2.940   -0.257  7.680   1.00 0.00 ? 45 SER A O    2  
ATOM 1776  C CB   . SER A 1 45 ? 2.128   -2.394  10.177  1.00 0.00 ? 45 SER A CB   2  
ATOM 1777  O OG   . SER A 1 45 ? 1.360   -2.624  11.352  1.00 0.00 ? 45 SER A OG   2  
ATOM 1778  H H    . SER A 1 45 ? -0.311  -2.161  9.817   1.00 0.00 ? 45 SER A H    2  
ATOM 1779  H HA   . SER A 1 45 ? 1.749   -0.297  9.890   1.00 0.00 ? 45 SER A HA   2  
ATOM 1780  H HB2  . SER A 1 45 ? 2.116   -3.300  9.570   1.00 0.00 ? 45 SER A HB2  2  
ATOM 1781  H HB3  . SER A 1 45 ? 3.161   -2.166  10.442  1.00 0.00 ? 45 SER A HB3  2  
ATOM 1782  H HG   . SER A 1 45 ? 1.691   -3.428  11.776  1.00 0.00 ? 45 SER A HG   2  
ATOM 1783  N N    . THR A 1 46 ? 1.710   -2.047  7.078   1.00 0.00 ? 46 THR A N    2  
ATOM 1784  C CA   . THR A 1 46 ? 2.128   -2.065  5.693   1.00 0.00 ? 46 THR A CA   2  
ATOM 1785  C C    . THR A 1 46 ? 1.692   -0.786  4.991   1.00 0.00 ? 46 THR A C    2  
ATOM 1786  O O    . THR A 1 46 ? 2.541   -0.125  4.408   1.00 0.00 ? 46 THR A O    2  
ATOM 1787  C CB   . THR A 1 46 ? 1.560   -3.323  5.027   1.00 0.00 ? 46 THR A CB   2  
ATOM 1788  O OG1  . THR A 1 46 ? 1.970   -4.453  5.775   1.00 0.00 ? 46 THR A OG1  2  
ATOM 1789  C CG2  . THR A 1 46 ? 1.987   -3.471  3.561   1.00 0.00 ? 46 THR A CG2  2  
ATOM 1790  H H    . THR A 1 46 ? 1.046   -2.758  7.345   1.00 0.00 ? 46 THR A H    2  
ATOM 1791  H HA   . THR A 1 46 ? 3.217   -2.089  5.680   1.00 0.00 ? 46 THR A HA   2  
ATOM 1792  H HB   . THR A 1 46 ? 0.472   -3.274  5.071   1.00 0.00 ? 46 THR A HB   2  
ATOM 1793  H HG1  . THR A 1 46 ? 2.881   -4.677  5.482   1.00 0.00 ? 46 THR A HG1  2  
ATOM 1794  H HG21 . THR A 1 46 ? 1.652   -4.434  3.176   1.00 0.00 ? 46 THR A HG21 2  
ATOM 1795  H HG22 . THR A 1 46 ? 1.528   -2.685  2.960   1.00 0.00 ? 46 THR A HG22 2  
ATOM 1796  H HG23 . THR A 1 46 ? 3.072   -3.387  3.464   1.00 0.00 ? 46 THR A HG23 2  
ATOM 1797  N N    . LEU A 1 47 ? 0.407   -0.424  5.039   1.00 0.00 ? 47 LEU A N    2  
ATOM 1798  C CA   . LEU A 1 47 ? -0.109  0.783   4.418   1.00 0.00 ? 47 LEU A CA   2  
ATOM 1799  C C    . LEU A 1 47 ? 0.716   1.973   4.874   1.00 0.00 ? 47 LEU A C    2  
ATOM 1800  O O    . LEU A 1 47 ? 1.182   2.727   4.037   1.00 0.00 ? 47 LEU A O    2  
ATOM 1801  C CB   . LEU A 1 47 ? -1.592  0.997   4.762   1.00 0.00 ? 47 LEU A CB   2  
ATOM 1802  C CG   . LEU A 1 47 ? -2.158  2.254   4.074   1.00 0.00 ? 47 LEU A CG   2  
ATOM 1803  C CD1  . LEU A 1 47 ? -2.336  2.032   2.579   1.00 0.00 ? 47 LEU A CD1  2  
ATOM 1804  C CD2  . LEU A 1 47 ? -3.550  2.575   4.603   1.00 0.00 ? 47 LEU A CD2  2  
ATOM 1805  H H    . LEU A 1 47 ? -0.260  -1.012  5.515   1.00 0.00 ? 47 LEU A H    2  
ATOM 1806  H HA   . LEU A 1 47 ? 0.005   0.673   3.340   1.00 0.00 ? 47 LEU A HA   2  
ATOM 1807  H HB2  . LEU A 1 47 ? -2.169  0.125   4.456   1.00 0.00 ? 47 LEU A HB2  2  
ATOM 1808  H HB3  . LEU A 1 47 ? -1.691  1.107   5.843   1.00 0.00 ? 47 LEU A HB3  2  
ATOM 1809  H HG   . LEU A 1 47 ? -1.520  3.127   4.241   1.00 0.00 ? 47 LEU A HG   2  
ATOM 1810  H HD11 . LEU A 1 47 ? -2.712  2.951   2.135   1.00 0.00 ? 47 LEU A HD11 2  
ATOM 1811  H HD12 . LEU A 1 47 ? -1.390  1.775   2.112   1.00 0.00 ? 47 LEU A HD12 2  
ATOM 1812  H HD13 . LEU A 1 47 ? -3.052  1.226   2.417   1.00 0.00 ? 47 LEU A HD13 2  
ATOM 1813  H HD21 . LEU A 1 47 ? -4.245  1.784   4.326   1.00 0.00 ? 47 LEU A HD21 2  
ATOM 1814  H HD22 . LEU A 1 47 ? -3.522  2.668   5.683   1.00 0.00 ? 47 LEU A HD22 2  
ATOM 1815  H HD23 . LEU A 1 47 ? -3.871  3.515   4.160   1.00 0.00 ? 47 LEU A HD23 2  
ATOM 1816  N N    . GLU A 1 48 ? 0.919   2.132   6.180   1.00 0.00 ? 48 GLU A N    2  
ATOM 1817  C CA   . GLU A 1 48 ? 1.662   3.220   6.762   1.00 0.00 ? 48 GLU A CA   2  
ATOM 1818  C C    . GLU A 1 48 ? 3.056   3.292   6.121   1.00 0.00 ? 48 GLU A C    2  
ATOM 1819  O O    . GLU A 1 48 ? 3.407   4.299   5.506   1.00 0.00 ? 48 GLU A O    2  
ATOM 1820  C CB   . GLU A 1 48 ? 1.733   3.018   8.284   1.00 0.00 ? 48 GLU A CB   2  
ATOM 1821  C CG   . GLU A 1 48 ? 2.009   4.389   8.887   1.00 0.00 ? 48 GLU A CG   2  
ATOM 1822  C CD   . GLU A 1 48 ? 2.360   4.384   10.366  1.00 0.00 ? 48 GLU A CD   2  
ATOM 1823  O OE1  . GLU A 1 48 ? 3.200   3.548   10.785  1.00 0.00 ? 48 GLU A OE1  2  
ATOM 1824  O OE2  . GLU A 1 48 ? 1.849   5.271   11.080  1.00 0.00 ? 48 GLU A OE2  2  
ATOM 1825  H H    . GLU A 1 48 ? 0.548   1.467   6.847   1.00 0.00 ? 48 GLU A H    2  
ATOM 1826  H HA   . GLU A 1 48 ? 1.105   4.139   6.557   1.00 0.00 ? 48 GLU A HA   2  
ATOM 1827  H HB2  . GLU A 1 48 ? 0.789   2.646   8.676   1.00 0.00 ? 48 GLU A HB2  2  
ATOM 1828  H HB3  . GLU A 1 48 ? 2.520   2.302   8.532   1.00 0.00 ? 48 GLU A HB3  2  
ATOM 1829  H HG2  . GLU A 1 48 ? 2.838   4.810   8.344   1.00 0.00 ? 48 GLU A HG2  2  
ATOM 1830  H HG3  . GLU A 1 48 ? 1.140   5.027   8.728   1.00 0.00 ? 48 GLU A HG3  2  
ATOM 1831  N N    . TYR A 1 49 ? 3.828   2.203   6.216   1.00 0.00 ? 49 TYR A N    2  
ATOM 1832  C CA   . TYR A 1 49 ? 5.145   2.067   5.605   1.00 0.00 ? 49 TYR A CA   2  
ATOM 1833  C C    . TYR A 1 49 ? 5.107   2.451   4.129   1.00 0.00 ? 49 TYR A C    2  
ATOM 1834  O O    . TYR A 1 49 ? 5.990   3.162   3.668   1.00 0.00 ? 49 TYR A O    2  
ATOM 1835  C CB   . TYR A 1 49 ? 5.633   0.612   5.747   1.00 0.00 ? 49 TYR A CB   2  
ATOM 1836  C CG   . TYR A 1 49 ? 6.833   0.272   4.883   1.00 0.00 ? 49 TYR A CG   2  
ATOM 1837  C CD1  . TYR A 1 49 ? 6.609   -0.192  3.577   1.00 0.00 ? 49 TYR A CD1  2  
ATOM 1838  C CD2  . TYR A 1 49 ? 8.151   0.474   5.331   1.00 0.00 ? 49 TYR A CD2  2  
ATOM 1839  C CE1  . TYR A 1 49 ? 7.680   -0.442  2.704   1.00 0.00 ? 49 TYR A CE1  2  
ATOM 1840  C CE2  . TYR A 1 49 ? 9.233   0.212   4.469   1.00 0.00 ? 49 TYR A CE2  2  
ATOM 1841  C CZ   . TYR A 1 49 ? 9.006   -0.238  3.146   1.00 0.00 ? 49 TYR A CZ   2  
ATOM 1842  O OH   . TYR A 1 49 ? 10.063  -0.522  2.334   1.00 0.00 ? 49 TYR A OH   2  
ATOM 1843  H H    . TYR A 1 49 ? 3.446   1.389   6.690   1.00 0.00 ? 49 TYR A H    2  
ATOM 1844  H HA   . TYR A 1 49 ? 5.843   2.746   6.104   1.00 0.00 ? 49 TYR A HA   2  
ATOM 1845  H HB2  . TYR A 1 49 ? 5.850   0.391   6.782   1.00 0.00 ? 49 TYR A HB2  2  
ATOM 1846  H HB3  . TYR A 1 49 ? 4.826   -0.062  5.464   1.00 0.00 ? 49 TYR A HB3  2  
ATOM 1847  H HD1  . TYR A 1 49 ? 5.589   -0.301  3.242   1.00 0.00 ? 49 TYR A HD1  2  
ATOM 1848  H HD2  . TYR A 1 49 ? 8.341   0.842   6.329   1.00 0.00 ? 49 TYR A HD2  2  
ATOM 1849  H HE1  . TYR A 1 49 ? 7.471   -0.766  1.693   1.00 0.00 ? 49 TYR A HE1  2  
ATOM 1850  H HE2  . TYR A 1 49 ? 10.242  0.363   4.819   1.00 0.00 ? 49 TYR A HE2  2  
ATOM 1851  H HH   . TYR A 1 49 ? 9.815   -0.618  1.402   1.00 0.00 ? 49 TYR A HH   2  
ATOM 1852  N N    . LYS A 1 50 ? 4.137   1.948   3.373   1.00 0.00 ? 50 LYS A N    2  
ATOM 1853  C CA   . LYS A 1 50 ? 4.070   2.062   1.923   1.00 0.00 ? 50 LYS A CA   2  
ATOM 1854  C C    . LYS A 1 50 ? 3.641   3.459   1.490   1.00 0.00 ? 50 LYS A C    2  
ATOM 1855  O O    . LYS A 1 50 ? 4.176   3.956   0.507   1.00 0.00 ? 50 LYS A O    2  
ATOM 1856  C CB   . LYS A 1 50 ? 3.061   1.016   1.432   1.00 0.00 ? 50 LYS A CB   2  
ATOM 1857  C CG   . LYS A 1 50 ? 3.533   -0.438  1.407   1.00 0.00 ? 50 LYS A CG   2  
ATOM 1858  C CD   . LYS A 1 50 ? 4.758   -0.580  0.508   1.00 0.00 ? 50 LYS A CD   2  
ATOM 1859  C CE   . LYS A 1 50 ? 5.100   -2.016  0.130   1.00 0.00 ? 50 LYS A CE   2  
ATOM 1860  N NZ   . LYS A 1 50 ? 6.246   -2.028  -0.799  1.00 0.00 ? 50 LYS A NZ   2  
ATOM 1861  H H    . LYS A 1 50 ? 3.423   1.389   3.832   1.00 0.00 ? 50 LYS A H    2  
ATOM 1862  H HA   . LYS A 1 50 ? 5.063   1.904   1.476   1.00 0.00 ? 50 LYS A HA   2  
ATOM 1863  H HB2  . LYS A 1 50 ? 2.190   1.037   2.086   1.00 0.00 ? 50 LYS A HB2  2  
ATOM 1864  H HB3  . LYS A 1 50 ? 2.777   1.282   0.420   1.00 0.00 ? 50 LYS A HB3  2  
ATOM 1865  H HG2  . LYS A 1 50 ? 3.772   -0.781  2.417   1.00 0.00 ? 50 LYS A HG2  2  
ATOM 1866  H HG3  . LYS A 1 50 ? 2.710   -1.034  1.024   1.00 0.00 ? 50 LYS A HG3  2  
ATOM 1867  H HD2  . LYS A 1 50 ? 4.657   0.011   -0.394  1.00 0.00 ? 50 LYS A HD2  2  
ATOM 1868  H HD3  . LYS A 1 50 ? 5.586   -0.157  1.048   1.00 0.00 ? 50 LYS A HD3  2  
ATOM 1869  H HE2  . LYS A 1 50 ? 5.346   -2.571  1.034   1.00 0.00 ? 50 LYS A HE2  2  
ATOM 1870  H HE3  . LYS A 1 50 ? 4.237   -2.477  -0.353  1.00 0.00 ? 50 LYS A HE3  2  
ATOM 1871  H HZ1  . LYS A 1 50 ? 5.916   -1.790  -1.730  1.00 0.00 ? 50 LYS A HZ1  2  
ATOM 1872  H HZ2  . LYS A 1 50 ? 6.935   -1.319  -0.538  1.00 0.00 ? 50 LYS A HZ2  2  
ATOM 1873  H HZ3  . LYS A 1 50 ? 6.669   -2.950  -0.852  1.00 0.00 ? 50 LYS A HZ3  2  
ATOM 1874  N N    . VAL A 1 51 ? 2.765   4.135   2.231   1.00 0.00 ? 51 VAL A N    2  
ATOM 1875  C CA   . VAL A 1 51 ? 2.536   5.567   2.092   1.00 0.00 ? 51 VAL A CA   2  
ATOM 1876  C C    . VAL A 1 51 ? 3.890   6.270   2.221   1.00 0.00 ? 51 VAL A C    2  
ATOM 1877  O O    . VAL A 1 51 ? 4.254   7.068   1.365   1.00 0.00 ? 51 VAL A O    2  
ATOM 1878  C CB   . VAL A 1 51 ? 1.518   6.042   3.156   1.00 0.00 ? 51 VAL A CB   2  
ATOM 1879  C CG1  . VAL A 1 51 ? 1.352   7.562   3.176   1.00 0.00 ? 51 VAL A CG1  2  
ATOM 1880  C CG2  . VAL A 1 51 ? 0.102   5.487   2.964   1.00 0.00 ? 51 VAL A CG2  2  
ATOM 1881  H H    . VAL A 1 51 ? 2.314   3.656   3.004   1.00 0.00 ? 51 VAL A H    2  
ATOM 1882  H HA   . VAL A 1 51 ? 2.146   5.767   1.096   1.00 0.00 ? 51 VAL A HA   2  
ATOM 1883  H HB   . VAL A 1 51 ? 1.864   5.732   4.141   1.00 0.00 ? 51 VAL A HB   2  
ATOM 1884  H HG11 . VAL A 1 51 ? 1.097   7.919   2.177   1.00 0.00 ? 51 VAL A HG11 2  
ATOM 1885  H HG12 . VAL A 1 51 ? 0.565   7.825   3.883   1.00 0.00 ? 51 VAL A HG12 2  
ATOM 1886  H HG13 . VAL A 1 51 ? 2.279   8.023   3.505   1.00 0.00 ? 51 VAL A HG13 2  
ATOM 1887  H HG21 . VAL A 1 51 ? 0.127   4.429   2.744   1.00 0.00 ? 51 VAL A HG21 2  
ATOM 1888  H HG22 . VAL A 1 51 ? -0.442  5.622   3.900   1.00 0.00 ? 51 VAL A HG22 2  
ATOM 1889  H HG23 . VAL A 1 51 ? -0.410  5.994   2.146   1.00 0.00 ? 51 VAL A HG23 2  
ATOM 1890  N N    . LYS A 1 52 ? 4.640   5.965   3.280   1.00 0.00 ? 52 LYS A N    2  
ATOM 1891  C CA   . LYS A 1 52 ? 5.904   6.614   3.650   1.00 0.00 ? 52 LYS A CA   2  
ATOM 1892  C C    . LYS A 1 52 ? 7.035   6.285   2.691   1.00 0.00 ? 52 LYS A C    2  
ATOM 1893  O O    . LYS A 1 52 ? 7.933   7.091   2.479   1.00 0.00 ? 52 LYS A O    2  
ATOM 1894  C CB   . LYS A 1 52 ? 6.173   6.247   5.114   1.00 0.00 ? 52 LYS A CB   2  
ATOM 1895  C CG   . LYS A 1 52 ? 5.188   7.078   5.954   1.00 0.00 ? 52 LYS A CG   2  
ATOM 1896  C CD   . LYS A 1 52 ? 4.768   6.413   7.259   1.00 0.00 ? 52 LYS A CD   2  
ATOM 1897  C CE   . LYS A 1 52 ? 5.485   6.980   8.481   1.00 0.00 ? 52 LYS A CE   2  
ATOM 1898  N NZ   . LYS A 1 52 ? 6.897   6.559   8.576   1.00 0.00 ? 52 LYS A NZ   2  
ATOM 1899  H H    . LYS A 1 52 ? 4.255   5.297   3.944   1.00 0.00 ? 52 LYS A H    2  
ATOM 1900  H HA   . LYS A 1 52 ? 5.804   7.690   3.590   1.00 0.00 ? 52 LYS A HA   2  
ATOM 1901  H HB2  . LYS A 1 52 ? 6.002   5.181   5.257   1.00 0.00 ? 52 LYS A HB2  2  
ATOM 1902  H HB3  . LYS A 1 52 ? 7.191   6.461   5.414   1.00 0.00 ? 52 LYS A HB3  2  
ATOM 1903  H HG2  . LYS A 1 52 ? 5.594   8.075   6.134   1.00 0.00 ? 52 LYS A HG2  2  
ATOM 1904  H HG3  . LYS A 1 52 ? 4.271   7.202   5.382   1.00 0.00 ? 52 LYS A HG3  2  
ATOM 1905  H HD2  . LYS A 1 52 ? 3.692   6.591   7.359   1.00 0.00 ? 52 LYS A HD2  2  
ATOM 1906  H HD3  . LYS A 1 52 ? 4.929   5.339   7.199   1.00 0.00 ? 52 LYS A HD3  2  
ATOM 1907  H HE2  . LYS A 1 52 ? 5.434   8.070   8.445   1.00 0.00 ? 52 LYS A HE2  2  
ATOM 1908  H HE3  . LYS A 1 52 ? 4.958   6.650   9.378   1.00 0.00 ? 52 LYS A HE3  2  
ATOM 1909  H HZ1  . LYS A 1 52 ? 7.321   7.003   9.387   1.00 0.00 ? 52 LYS A HZ1  2  
ATOM 1910  H HZ2  . LYS A 1 52 ? 6.975   5.554   8.684   1.00 0.00 ? 52 LYS A HZ2  2  
ATOM 1911  H HZ3  . LYS A 1 52 ? 7.436   6.864   7.772   1.00 0.00 ? 52 LYS A HZ3  2  
ATOM 1912  N N    . GLU A 1 53 ? 6.934   5.137   2.049   1.00 0.00 ? 53 GLU A N    2  
ATOM 1913  C CA   . GLU A 1 53 ? 7.752   4.698   0.948   1.00 0.00 ? 53 GLU A CA   2  
ATOM 1914  C C    . GLU A 1 53 ? 7.422   5.584   -0.261  1.00 0.00 ? 53 GLU A C    2  
ATOM 1915  O O    . GLU A 1 53 ? 8.253   6.319   -0.784  1.00 0.00 ? 53 GLU A O    2  
ATOM 1916  C CB   . GLU A 1 53 ? 7.470   3.196   0.700   1.00 0.00 ? 53 GLU A CB   2  
ATOM 1917  C CG   . GLU A 1 53 ? 8.575   2.641   -0.175  1.00 0.00 ? 53 GLU A CG   2  
ATOM 1918  C CD   . GLU A 1 53 ? 8.343   1.279   -0.838  1.00 0.00 ? 53 GLU A CD   2  
ATOM 1919  O OE1  . GLU A 1 53 ? 7.483   0.473   -0.410  1.00 0.00 ? 53 GLU A OE1  2  
ATOM 1920  O OE2  . GLU A 1 53 ? 8.925   1.050   -1.917  1.00 0.00 ? 53 GLU A OE2  2  
ATOM 1921  H H    . GLU A 1 53 ? 6.208   4.530   2.392   1.00 0.00 ? 53 GLU A H    2  
ATOM 1922  H HA   . GLU A 1 53 ? 8.802   4.836   1.216   1.00 0.00 ? 53 GLU A HA   2  
ATOM 1923  H HB2  . GLU A 1 53 ? 7.475   2.647   1.639   1.00 0.00 ? 53 GLU A HB2  2  
ATOM 1924  H HB3  . GLU A 1 53 ? 6.513   3.055   0.204   1.00 0.00 ? 53 GLU A HB3  2  
ATOM 1925  H HG2  . GLU A 1 53 ? 8.660   3.352   -0.978  1.00 0.00 ? 53 GLU A HG2  2  
ATOM 1926  H HG3  . GLU A 1 53 ? 9.483   2.640   0.422   1.00 0.00 ? 53 GLU A HG3  2  
ATOM 1927  N N    . ARG A 1 54 ? 6.179   5.545   -0.731  1.00 0.00 ? 54 ARG A N    2  
ATOM 1928  C CA   . ARG A 1 54 ? 5.766   6.229   -1.951  1.00 0.00 ? 54 ARG A CA   2  
ATOM 1929  C C    . ARG A 1 54 ? 5.764   7.754   -1.818  1.00 0.00 ? 54 ARG A C    2  
ATOM 1930  O O    . ARG A 1 54 ? 5.659   8.431   -2.840  1.00 0.00 ? 54 ARG A O    2  
ATOM 1931  C CB   . ARG A 1 54 ? 4.404   5.661   -2.370  1.00 0.00 ? 54 ARG A CB   2  
ATOM 1932  C CG   . ARG A 1 54 ? 4.503   4.227   -2.903  1.00 0.00 ? 54 ARG A CG   2  
ATOM 1933  C CD   . ARG A 1 54 ? 4.826   4.274   -4.398  1.00 0.00 ? 54 ARG A CD   2  
ATOM 1934  N NE   . ARG A 1 54 ? 5.561   3.081   -4.836  1.00 0.00 ? 54 ARG A NE   2  
ATOM 1935  C CZ   . ARG A 1 54 ? 5.286   2.342   -5.914  1.00 0.00 ? 54 ARG A CZ   2  
ATOM 1936  N NH1  . ARG A 1 54 ? 4.273   2.622   -6.731  1.00 0.00 ? 54 ARG A NH1  2  
ATOM 1937  N NH2  . ARG A 1 54 ? 6.078   1.307   -6.159  1.00 0.00 ? 54 ARG A NH2  2  
ATOM 1938  H H    . ARG A 1 54 ? 5.485   4.977   -0.250  1.00 0.00 ? 54 ARG A H    2  
ATOM 1939  H HA   . ARG A 1 54 ? 6.493   6.008   -2.730  1.00 0.00 ? 54 ARG A HA   2  
ATOM 1940  H HB2  . ARG A 1 54 ? 3.740   5.675   -1.508  1.00 0.00 ? 54 ARG A HB2  2  
ATOM 1941  H HB3  . ARG A 1 54 ? 3.979   6.288   -3.149  1.00 0.00 ? 54 ARG A HB3  2  
ATOM 1942  H HG2  . ARG A 1 54 ? 5.266   3.669   -2.357  1.00 0.00 ? 54 ARG A HG2  2  
ATOM 1943  H HG3  . ARG A 1 54 ? 3.545   3.722   -2.766  1.00 0.00 ? 54 ARG A HG3  2  
ATOM 1944  H HD2  . ARG A 1 54 ? 3.877   4.365   -4.925  1.00 0.00 ? 54 ARG A HD2  2  
ATOM 1945  H HD3  . ARG A 1 54 ? 5.436   5.150   -4.628  1.00 0.00 ? 54 ARG A HD3  2  
ATOM 1946  H HE   . ARG A 1 54 ? 6.306   2.787   -4.221  1.00 0.00 ? 54 ARG A HE   2  
ATOM 1947  H HH11 . ARG A 1 54 ? 3.650   3.410   -6.510  1.00 0.00 ? 54 ARG A HH11 2  
ATOM 1948  H HH12 . ARG A 1 54 ? 3.993   2.040   -7.517  1.00 0.00 ? 54 ARG A HH12 2  
ATOM 1949  H HH21 . ARG A 1 54 ? 6.894   1.134   -5.577  1.00 0.00 ? 54 ARG A HH21 2  
ATOM 1950  H HH22 . ARG A 1 54 ? 5.822   0.616   -6.858  1.00 0.00 ? 54 ARG A HH22 2  
ATOM 1951  N N    . LEU A 1 55 ? 5.880   8.299   -0.609  1.00 0.00 ? 55 LEU A N    2  
ATOM 1952  C CA   . LEU A 1 55 ? 5.764   9.706   -0.209  1.00 0.00 ? 55 LEU A CA   2  
ATOM 1953  C C    . LEU A 1 55 ? 6.776   10.641  -0.864  1.00 0.00 ? 55 LEU A C    2  
ATOM 1954  O O    . LEU A 1 55 ? 6.782   11.841  -0.574  1.00 0.00 ? 55 LEU A O    2  
ATOM 1955  C CB   . LEU A 1 55 ? 5.877   9.794   1.327   1.00 0.00 ? 55 LEU A CB   2  
ATOM 1956  C CG   . LEU A 1 55 ? 4.579   10.337  1.968   1.00 0.00 ? 55 LEU A CG   2  
ATOM 1957  C CD1  . LEU A 1 55 ? 4.580   10.132  3.488   1.00 0.00 ? 55 LEU A CD1  2  
ATOM 1958  C CD2  . LEU A 1 55 ? 4.359   11.822  1.653   1.00 0.00 ? 55 LEU A CD2  2  
ATOM 1959  H H    . LEU A 1 55 ? 5.894   7.645   0.161   1.00 0.00 ? 55 LEU A H    2  
ATOM 1960  H HA   . LEU A 1 55 ? 4.779   10.054  -0.525  1.00 0.00 ? 55 LEU A HA   2  
ATOM 1961  H HB2  . LEU A 1 55 ? 6.106   8.809   1.728   1.00 0.00 ? 55 LEU A HB2  2  
ATOM 1962  H HB3  . LEU A 1 55 ? 6.736   10.405  1.614   1.00 0.00 ? 55 LEU A HB3  2  
ATOM 1963  H HG   . LEU A 1 55 ? 3.730   9.782   1.571   1.00 0.00 ? 55 LEU A HG   2  
ATOM 1964  H HD11 . LEU A 1 55 ? 5.543   10.422  3.912   1.00 0.00 ? 55 LEU A HD11 2  
ATOM 1965  H HD12 . LEU A 1 55 ? 3.785   10.715  3.952   1.00 0.00 ? 55 LEU A HD12 2  
ATOM 1966  H HD13 . LEU A 1 55 ? 4.381   9.084   3.701   1.00 0.00 ? 55 LEU A HD13 2  
ATOM 1967  H HD21 . LEU A 1 55 ? 3.453   12.177  2.143   1.00 0.00 ? 55 LEU A HD21 2  
ATOM 1968  H HD22 . LEU A 1 55 ? 5.214   12.405  1.996   1.00 0.00 ? 55 LEU A HD22 2  
ATOM 1969  H HD23 . LEU A 1 55 ? 4.233   11.955  0.578   1.00 0.00 ? 55 LEU A HD23 2  
ATOM 1970  N N    . GLY A 1 56 ? 7.670   10.114  -1.689  1.00 0.00 ? 56 GLY A N    2  
ATOM 1971  C CA   . GLY A 1 56 ? 8.695   10.853  -2.395  1.00 0.00 ? 56 GLY A CA   2  
ATOM 1972  C C    . GLY A 1 56 ? 10.098  10.396  -2.013  1.00 0.00 ? 56 GLY A C    2  
ATOM 1973  O O    . GLY A 1 56 ? 11.058  10.749  -2.696  1.00 0.00 ? 56 GLY A O    2  
ATOM 1974  H H    . GLY A 1 56 ? 7.552   9.144   -1.939  1.00 0.00 ? 56 GLY A H    2  
ATOM 1975  H HA2  . GLY A 1 56 ? 8.537   10.705  -3.457  1.00 0.00 ? 56 GLY A HA2  2  
ATOM 1976  H HA3  . GLY A 1 56 ? 8.612   11.915  -2.178  1.00 0.00 ? 56 GLY A HA3  2  
ATOM 1977  N N    . THR A 1 57 ? 10.220  9.582   -0.960  1.00 0.00 ? 57 THR A N    2  
ATOM 1978  C CA   . THR A 1 57 ? 11.497  9.229   -0.355  1.00 0.00 ? 57 THR A CA   2  
ATOM 1979  C C    . THR A 1 57 ? 12.372  8.369   -1.290  1.00 0.00 ? 57 THR A C    2  
ATOM 1980  O O    . THR A 1 57 ? 13.579  8.248   -1.081  1.00 0.00 ? 57 THR A O    2  
ATOM 1981  C CB   . THR A 1 57 ? 11.193  8.619   1.030   1.00 0.00 ? 57 THR A CB   2  
ATOM 1982  O OG1  . THR A 1 57 ? 12.160  8.978   1.997   1.00 0.00 ? 57 THR A OG1  2  
ATOM 1983  C CG2  . THR A 1 57 ? 10.954  7.123   1.059   1.00 0.00 ? 57 THR A CG2  2  
ATOM 1984  H H    . THR A 1 57 ? 9.385   9.309   -0.459  1.00 0.00 ? 57 THR A H    2  
ATOM 1985  H HA   . THR A 1 57 ? 12.015  10.166  -0.183  1.00 0.00 ? 57 THR A HA   2  
ATOM 1986  H HB   . THR A 1 57 ? 10.244  9.043   1.341   1.00 0.00 ? 57 THR A HB   2  
ATOM 1987  H HG1  . THR A 1 57 ? 12.692  8.193   2.225   1.00 0.00 ? 57 THR A HG1  2  
ATOM 1988  H HG21 . THR A 1 57 ? 10.159  6.922   0.358   1.00 0.00 ? 57 THR A HG21 2  
ATOM 1989  H HG22 . THR A 1 57 ? 11.854  6.570   0.791   1.00 0.00 ? 57 THR A HG22 2  
ATOM 1990  H HG23 . THR A 1 57 ? 10.601  6.840   2.051   1.00 0.00 ? 57 THR A HG23 2  
ATOM 1991  N N    . LEU A 1 58 ? 11.774  7.785   -2.331  1.00 0.00 ? 58 LEU A N    2  
ATOM 1992  C CA   . LEU A 1 58 ? 12.360  6.806   -3.238  1.00 0.00 ? 58 LEU A CA   2  
ATOM 1993  C C    . LEU A 1 58 ? 13.321  7.469   -4.226  1.00 0.00 ? 58 LEU A C    2  
ATOM 1994  O O    . LEU A 1 58 ? 14.480  7.061   -4.350  1.00 0.00 ? 58 LEU A O    2  
ATOM 1995  C CB   . LEU A 1 58 ? 11.208  6.097   -3.980  1.00 0.00 ? 58 LEU A CB   2  
ATOM 1996  C CG   . LEU A 1 58 ? 10.364  5.208   -3.041  1.00 0.00 ? 58 LEU A CG   2  
ATOM 1997  C CD1  . LEU A 1 58 ? 8.963   4.971   -3.636  1.00 0.00 ? 58 LEU A CD1  2  
ATOM 1998  C CD2  . LEU A 1 58 ? 11.086  3.868   -2.834  1.00 0.00 ? 58 LEU A CD2  2  
ATOM 1999  H H    . LEU A 1 58 ? 10.792  7.987   -2.444  1.00 0.00 ? 58 LEU A H    2  
ATOM 2000  H HA   . LEU A 1 58 ? 12.926  6.074   -2.658  1.00 0.00 ? 58 LEU A HA   2  
ATOM 2001  H HB2  . LEU A 1 58 ? 10.564  6.853   -4.433  1.00 0.00 ? 58 LEU A HB2  2  
ATOM 2002  H HB3  . LEU A 1 58 ? 11.616  5.489   -4.790  1.00 0.00 ? 58 LEU A HB3  2  
ATOM 2003  H HG   . LEU A 1 58 ? 10.259  5.712   -2.071  1.00 0.00 ? 58 LEU A HG   2  
ATOM 2004  H HD11 . LEU A 1 58 ? 8.455   5.926   -3.784  1.00 0.00 ? 58 LEU A HD11 2  
ATOM 2005  H HD12 . LEU A 1 58 ? 9.031   4.450   -4.591  1.00 0.00 ? 58 LEU A HD12 2  
ATOM 2006  H HD13 . LEU A 1 58 ? 8.351   4.388   -2.946  1.00 0.00 ? 58 LEU A HD13 2  
ATOM 2007  H HD21 . LEU A 1 58 ? 10.501  3.219   -2.188  1.00 0.00 ? 58 LEU A HD21 2  
ATOM 2008  H HD22 . LEU A 1 58 ? 11.231  3.363   -3.789  1.00 0.00 ? 58 LEU A HD22 2  
ATOM 2009  H HD23 . LEU A 1 58 ? 12.052  4.030   -2.360  1.00 0.00 ? 58 LEU A HD23 2  
ATOM 2010  N N    . LYS A 1 59 ? 12.850  8.477   -4.969  1.00 0.00 ? 59 LYS A N    2  
ATOM 2011  C CA   . LYS A 1 59 ? 13.642  9.179   -5.978  1.00 0.00 ? 59 LYS A CA   2  
ATOM 2012  C C    . LYS A 1 59 ? 14.538  10.217  -5.291  1.00 0.00 ? 59 LYS A C    2  
ATOM 2013  O O    . LYS A 1 59 ? 14.437  11.410  -5.583  1.00 0.00 ? 59 LYS A O    2  
ATOM 2014  C CB   . LYS A 1 59 ? 12.731  9.822   -7.041  1.00 0.00 ? 59 LYS A CB   2  
ATOM 2015  C CG   . LYS A 1 59 ? 11.748  8.882   -7.755  1.00 0.00 ? 59 LYS A CG   2  
ATOM 2016  C CD   . LYS A 1 59 ? 12.340  7.854   -8.729  1.00 0.00 ? 59 LYS A CD   2  
ATOM 2017  C CE   . LYS A 1 59 ? 11.228  6.942   -9.283  1.00 0.00 ? 59 LYS A CE   2  
ATOM 2018  N NZ   . LYS A 1 59 ? 10.212  7.654   -10.094 1.00 0.00 ? 59 LYS A NZ   2  
ATOM 2019  H H    . LYS A 1 59 ? 11.885  8.765   -4.828  1.00 0.00 ? 59 LYS A H    2  
ATOM 2020  H HA   . LYS A 1 59 ? 14.277  8.458   -6.489  1.00 0.00 ? 59 LYS A HA   2  
ATOM 2021  H HB2  . LYS A 1 59 ? 12.141  10.601  -6.556  1.00 0.00 ? 59 LYS A HB2  2  
ATOM 2022  H HB3  . LYS A 1 59 ? 13.352  10.309  -7.796  1.00 0.00 ? 59 LYS A HB3  2  
ATOM 2023  H HG2  . LYS A 1 59 ? 11.140  8.352   -7.024  1.00 0.00 ? 59 LYS A HG2  2  
ATOM 2024  H HG3  . LYS A 1 59 ? 11.098  9.530   -8.327  1.00 0.00 ? 59 LYS A HG3  2  
ATOM 2025  H HD2  . LYS A 1 59 ? 12.847  8.367   -9.548  1.00 0.00 ? 59 LYS A HD2  2  
ATOM 2026  H HD3  . LYS A 1 59 ? 13.061  7.233   -8.197  1.00 0.00 ? 59 LYS A HD3  2  
ATOM 2027  H HE2  . LYS A 1 59 ? 11.675  6.152   -9.888  1.00 0.00 ? 59 LYS A HE2  2  
ATOM 2028  H HE3  . LYS A 1 59 ? 10.726  6.464   -8.440  1.00 0.00 ? 59 LYS A HE3  2  
ATOM 2029  H HZ1  . LYS A 1 59 ? 9.395   7.069   -10.253 1.00 0.00 ? 59 LYS A HZ1  2  
ATOM 2030  H HZ2  . LYS A 1 59 ? 9.849   8.484   -9.625  1.00 0.00 ? 59 LYS A HZ2  2  
ATOM 2031  H HZ3  . LYS A 1 59 ? 10.552  7.914   -11.013 1.00 0.00 ? 59 LYS A HZ3  2  
ATOM 2032  N N    . ASN A 1 60 ? 15.453  9.778   -4.422  1.00 0.00 ? 60 ASN A N    2  
ATOM 2033  C CA   . ASN A 1 60 ? 16.446  10.637  -3.769  1.00 0.00 ? 60 ASN A CA   2  
ATOM 2034  C C    . ASN A 1 60 ? 17.859  10.268  -4.240  1.00 0.00 ? 60 ASN A C    2  
ATOM 2035  O O    . ASN A 1 60 ? 18.639  9.685   -3.482  1.00 0.00 ? 60 ASN A O    2  
ATOM 2036  C CB   . ASN A 1 60 ? 16.282  10.594  -2.237  1.00 0.00 ? 60 ASN A CB   2  
ATOM 2037  C CG   . ASN A 1 60 ? 15.202  11.560  -1.773  1.00 0.00 ? 60 ASN A CG   2  
ATOM 2038  O OD1  . ASN A 1 60 ? 15.284  12.754  -2.040  1.00 0.00 ? 60 ASN A OD1  2  
ATOM 2039  N ND2  . ASN A 1 60 ? 14.176  11.097  -1.090  1.00 0.00 ? 60 ASN A ND2  2  
ATOM 2040  H H    . ASN A 1 60 ? 15.483  8.782   -4.229  1.00 0.00 ? 60 ASN A H    2  
ATOM 2041  H HA   . ASN A 1 60 ? 16.287  11.675  -4.069  1.00 0.00 ? 60 ASN A HA   2  
ATOM 2042  H HB2  . ASN A 1 60 ? 16.077  9.576   -1.902  1.00 0.00 ? 60 ASN A HB2  2  
ATOM 2043  H HB3  . ASN A 1 60 ? 17.215  10.915  -1.769  1.00 0.00 ? 60 ASN A HB3  2  
ATOM 2044  H HD21 . ASN A 1 60 ? 14.130  10.108  -0.878  1.00 0.00 ? 60 ASN A HD21 2  
ATOM 2045  H HD22 . ASN A 1 60 ? 13.439  11.720  -0.761  1.00 0.00 ? 60 ASN A HD22 2  
ATOM 2046  N N    . PRO A 1 61 ? 18.220  10.565  -5.503  1.00 0.00 ? 61 PRO A N    2  
ATOM 2047  C CA   . PRO A 1 61 ? 19.589  10.430  -5.978  1.00 0.00 ? 61 PRO A CA   2  
ATOM 2048  C C    . PRO A 1 61 ? 20.448  11.618  -5.517  1.00 0.00 ? 61 PRO A C    2  
ATOM 2049  O O    . PRO A 1 61 ? 19.896  12.640  -5.103  1.00 0.00 ? 61 PRO A O    2  
ATOM 2050  C CB   . PRO A 1 61 ? 19.449  10.413  -7.500  1.00 0.00 ? 61 PRO A CB   2  
ATOM 2051  C CG   . PRO A 1 61 ? 18.309  11.402  -7.738  1.00 0.00 ? 61 PRO A CG   2  
ATOM 2052  C CD   . PRO A 1 61 ? 17.383  11.118  -6.560  1.00 0.00 ? 61 PRO A CD   2  
ATOM 2053  H HA   . PRO A 1 61 ? 20.021  9.504   -5.616  1.00 0.00 ? 61 PRO A HA   2  
ATOM 2054  H HB2  . PRO A 1 61 ? 20.361  10.723  -8.007  1.00 0.00 ? 61 PRO A HB2  2  
ATOM 2055  H HB3  . PRO A 1 61 ? 19.144  9.420   -7.831  1.00 0.00 ? 61 PRO A HB3  2  
ATOM 2056  H HG2  . PRO A 1 61 ? 18.689  12.423  -7.687  1.00 0.00 ? 61 PRO A HG2  2  
ATOM 2057  H HG3  . PRO A 1 61 ? 17.803  11.229  -8.686  1.00 0.00 ? 61 PRO A HG3  2  
ATOM 2058  H HD2  . PRO A 1 61 ? 16.890  12.037  -6.244  1.00 0.00 ? 61 PRO A HD2  2  
ATOM 2059  H HD3  . PRO A 1 61 ? 16.651  10.371  -6.865  1.00 0.00 ? 61 PRO A HD3  2  
ATOM 2060  N N    . PRO A 1 62 ? 21.784  11.552  -5.682  1.00 0.00 ? 62 PRO A N    2  
ATOM 2061  C CA   . PRO A 1 62 ? 22.638  12.708  -5.459  1.00 0.00 ? 62 PRO A CA   2  
ATOM 2062  C C    . PRO A 1 62 ? 22.272  13.827  -6.438  1.00 0.00 ? 62 PRO A C    2  
ATOM 2063  O O    . PRO A 1 62 ? 21.882  14.907  -5.990  1.00 0.00 ? 62 PRO A O    2  
ATOM 2064  C CB   . PRO A 1 62 ? 24.080  12.211  -5.584  1.00 0.00 ? 62 PRO A CB   2  
ATOM 2065  C CG   . PRO A 1 62 ? 23.959  10.953  -6.441  1.00 0.00 ? 62 PRO A CG   2  
ATOM 2066  C CD   . PRO A 1 62 ? 22.585  10.398  -6.066  1.00 0.00 ? 62 PRO A CD   2  
ATOM 2067  H HA   . PRO A 1 62 ? 22.484  13.071  -4.445  1.00 0.00 ? 62 PRO A HA   2  
ATOM 2068  H HB2  . PRO A 1 62 ? 24.736  12.955  -6.037  1.00 0.00 ? 62 PRO A HB2  2  
ATOM 2069  H HB3  . PRO A 1 62 ? 24.450  11.941  -4.594  1.00 0.00 ? 62 PRO A HB3  2  
ATOM 2070  H HG2  . PRO A 1 62 ? 23.972  11.219  -7.499  1.00 0.00 ? 62 PRO A HG2  2  
ATOM 2071  H HG3  . PRO A 1 62 ? 24.752  10.241  -6.222  1.00 0.00 ? 62 PRO A HG3  2  
ATOM 2072  H HD2  . PRO A 1 62 ? 22.159  9.863   -6.914  1.00 0.00 ? 62 PRO A HD2  2  
ATOM 2073  H HD3  . PRO A 1 62 ? 22.684  9.729   -5.209  1.00 0.00 ? 62 PRO A HD3  2  
ATOM 2074  N N    . LYS A 1 63 ? 22.369  13.579  -7.755  1.00 0.00 ? 63 LYS A N    2  
ATOM 2075  C CA   . LYS A 1 63 ? 21.865  14.488  -8.790  1.00 0.00 ? 63 LYS A CA   2  
ATOM 2076  C C    . LYS A 1 63 ? 21.293  13.749  -10.004 1.00 0.00 ? 63 LYS A C    2  
ATOM 2077  O O    . LYS A 1 63 ? 20.292  14.212  -10.553 1.00 0.00 ? 63 LYS A O    2  
ATOM 2078  C CB   . LYS A 1 63 ? 22.941  15.492  -9.252  1.00 0.00 ? 63 LYS A CB   2  
ATOM 2079  C CG   . LYS A 1 63 ? 23.468  16.421  -8.146  1.00 0.00 ? 63 LYS A CG   2  
ATOM 2080  C CD   . LYS A 1 63 ? 24.397  17.509  -8.707  1.00 0.00 ? 63 LYS A CD   2  
ATOM 2081  C CE   . LYS A 1 63 ? 25.195  18.197  -7.588  1.00 0.00 ? 63 LYS A CE   2  
ATOM 2082  N NZ   . LYS A 1 63 ? 24.364  19.079  -6.741  1.00 0.00 ? 63 LYS A NZ   2  
ATOM 2083  H H    . LYS A 1 63 ? 22.725  12.681  -8.041  1.00 0.00 ? 63 LYS A H    2  
ATOM 2084  H HA   . LYS A 1 63 ? 21.046  15.060  -8.355  1.00 0.00 ? 63 LYS A HA   2  
ATOM 2085  H HB2  . LYS A 1 63 ? 23.778  14.945  -9.683  1.00 0.00 ? 63 LYS A HB2  2  
ATOM 2086  H HB3  . LYS A 1 63 ? 22.503  16.115  -10.033 1.00 0.00 ? 63 LYS A HB3  2  
ATOM 2087  H HG2  . LYS A 1 63 ? 22.628  16.899  -7.639  1.00 0.00 ? 63 LYS A HG2  2  
ATOM 2088  H HG3  . LYS A 1 63 ? 24.027  15.826  -7.424  1.00 0.00 ? 63 LYS A HG3  2  
ATOM 2089  H HD2  . LYS A 1 63 ? 25.111  17.043  -9.388  1.00 0.00 ? 63 LYS A HD2  2  
ATOM 2090  H HD3  . LYS A 1 63 ? 23.817  18.241  -9.270  1.00 0.00 ? 63 LYS A HD3  2  
ATOM 2091  H HE2  . LYS A 1 63 ? 25.659  17.425  -6.968  1.00 0.00 ? 63 LYS A HE2  2  
ATOM 2092  H HE3  . LYS A 1 63 ? 25.997  18.786  -8.036  1.00 0.00 ? 63 LYS A HE3  2  
ATOM 2093  H HZ1  . LYS A 1 63 ? 24.012  19.873  -7.250  1.00 0.00 ? 63 LYS A HZ1  2  
ATOM 2094  H HZ2  . LYS A 1 63 ? 23.567  18.590  -6.341  1.00 0.00 ? 63 LYS A HZ2  2  
ATOM 2095  H HZ3  . LYS A 1 63 ? 24.887  19.434  -5.939  1.00 0.00 ? 63 LYS A HZ3  2  
ATOM 2096  N N    . LYS A 1 64 ? 21.902  12.648  -10.477 1.00 0.00 ? 64 LYS A N    2  
ATOM 2097  C CA   . LYS A 1 64 ? 21.431  11.968  -11.694 1.00 0.00 ? 64 LYS A CA   2  
ATOM 2098  C C    . LYS A 1 64 ? 20.002  11.449  -11.543 1.00 0.00 ? 64 LYS A C    2  
ATOM 2099  O O    . LYS A 1 64 ? 19.655  10.915  -10.488 1.00 0.00 ? 64 LYS A O    2  
ATOM 2100  C CB   . LYS A 1 64 ? 22.380  10.839  -12.135 1.00 0.00 ? 64 LYS A CB   2  
ATOM 2101  C CG   . LYS A 1 64 ? 22.476  9.644   -11.170 1.00 0.00 ? 64 LYS A CG   2  
ATOM 2102  C CD   . LYS A 1 64 ? 23.312  8.494   -11.744 1.00 0.00 ? 64 LYS A CD   2  
ATOM 2103  C CE   . LYS A 1 64 ? 23.099  7.270   -10.847 1.00 0.00 ? 64 LYS A CE   2  
ATOM 2104  N NZ   . LYS A 1 64 ? 23.896  6.097   -11.252 1.00 0.00 ? 64 LYS A NZ   2  
ATOM 2105  H H    . LYS A 1 64 ? 22.803  12.377  -10.102 1.00 0.00 ? 64 LYS A H    2  
ATOM 2106  H HA   . LYS A 1 64 ? 21.436  12.709  -12.489 1.00 0.00 ? 64 LYS A HA   2  
ATOM 2107  H HB2  . LYS A 1 64 ? 22.038  10.476  -13.106 1.00 0.00 ? 64 LYS A HB2  2  
ATOM 2108  H HB3  . LYS A 1 64 ? 23.368  11.263  -12.272 1.00 0.00 ? 64 LYS A HB3  2  
ATOM 2109  H HG2  . LYS A 1 64 ? 22.906  9.969   -10.221 1.00 0.00 ? 64 LYS A HG2  2  
ATOM 2110  H HG3  . LYS A 1 64 ? 21.479  9.257   -10.983 1.00 0.00 ? 64 LYS A HG3  2  
ATOM 2111  H HD2  . LYS A 1 64 ? 22.984  8.261   -12.759 1.00 0.00 ? 64 LYS A HD2  2  
ATOM 2112  H HD3  . LYS A 1 64 ? 24.365  8.777   -11.758 1.00 0.00 ? 64 LYS A HD3  2  
ATOM 2113  H HE2  . LYS A 1 64 ? 23.361  7.531   -9.819  1.00 0.00 ? 64 LYS A HE2  2  
ATOM 2114  H HE3  . LYS A 1 64 ? 22.044  7.000   -10.851 1.00 0.00 ? 64 LYS A HE3  2  
ATOM 2115  H HZ1  . LYS A 1 64 ? 23.612  5.718   -12.148 1.00 0.00 ? 64 LYS A HZ1  2  
ATOM 2116  H HZ2  . LYS A 1 64 ? 24.888  6.310   -11.211 1.00 0.00 ? 64 LYS A HZ2  2  
ATOM 2117  H HZ3  . LYS A 1 64 ? 23.765  5.377   -10.543 1.00 0.00 ? 64 LYS A HZ3  2  
ATOM 2118  N N    . LYS A 1 65 ? 19.195  11.475  -12.606 1.00 0.00 ? 65 LYS A N    2  
ATOM 2119  C CA   . LYS A 1 65 ? 17.858  10.875  -12.608 1.00 0.00 ? 65 LYS A CA   2  
ATOM 2120  C C    . LYS A 1 65 ? 17.703  9.919   -13.785 1.00 0.00 ? 65 LYS A C    2  
ATOM 2121  O O    . LYS A 1 65 ? 17.064  10.236  -14.784 1.00 0.00 ? 65 LYS A O    2  
ATOM 2122  C CB   . LYS A 1 65 ? 16.757  11.939  -12.454 1.00 0.00 ? 65 LYS A CB   2  
ATOM 2123  C CG   . LYS A 1 65 ? 16.697  13.014  -13.555 1.00 0.00 ? 65 LYS A CG   2  
ATOM 2124  C CD   . LYS A 1 65 ? 16.586  14.424  -12.967 1.00 0.00 ? 65 LYS A CD   2  
ATOM 2125  C CE   . LYS A 1 65 ? 17.934  14.894  -12.418 1.00 0.00 ? 65 LYS A CE   2  
ATOM 2126  N NZ   . LYS A 1 65 ? 17.873  16.308  -12.011 1.00 0.00 ? 65 LYS A NZ   2  
ATOM 2127  H H    . LYS A 1 65 ? 19.522  11.920  -13.464 1.00 0.00 ? 65 LYS A H    2  
ATOM 2128  H HA   . LYS A 1 65 ? 17.750  10.259  -11.718 1.00 0.00 ? 65 LYS A HA   2  
ATOM 2129  H HB2  . LYS A 1 65 ? 15.791  11.434  -12.411 1.00 0.00 ? 65 LYS A HB2  2  
ATOM 2130  H HB3  . LYS A 1 65 ? 16.900  12.415  -11.483 1.00 0.00 ? 65 LYS A HB3  2  
ATOM 2131  H HG2  . LYS A 1 65 ? 17.576  12.965  -14.198 1.00 0.00 ? 65 LYS A HG2  2  
ATOM 2132  H HG3  . LYS A 1 65 ? 15.818  12.823  -14.171 1.00 0.00 ? 65 LYS A HG3  2  
ATOM 2133  H HD2  . LYS A 1 65 ? 16.256  15.123  -13.729 1.00 0.00 ? 65 LYS A HD2  2  
ATOM 2134  H HD3  . LYS A 1 65 ? 15.837  14.424  -12.181 1.00 0.00 ? 65 LYS A HD3  2  
ATOM 2135  H HE2  . LYS A 1 65 ? 18.205  14.280  -11.558 1.00 0.00 ? 65 LYS A HE2  2  
ATOM 2136  H HE3  . LYS A 1 65 ? 18.692  14.780  -13.194 1.00 0.00 ? 65 LYS A HE3  2  
ATOM 2137  H HZ1  . LYS A 1 65 ? 18.743  16.620  -11.593 1.00 0.00 ? 65 LYS A HZ1  2  
ATOM 2138  H HZ2  . LYS A 1 65 ? 17.694  16.900  -12.822 1.00 0.00 ? 65 LYS A HZ2  2  
ATOM 2139  H HZ3  . LYS A 1 65 ? 17.140  16.441  -11.321 1.00 0.00 ? 65 LYS A HZ3  2  
ATOM 2140  N N    . MET A 1 66 ? 18.276  8.721   -13.633 1.00 0.00 ? 66 MET A N    2  
ATOM 2141  C CA   . MET A 1 66 ? 18.105  7.577   -14.525 1.00 0.00 ? 66 MET A CA   2  
ATOM 2142  C C    . MET A 1 66 ? 18.407  7.958   -15.981 1.00 0.00 ? 66 MET A C    2  
ATOM 2143  O O    . MET A 1 66 ? 17.548  7.856   -16.860 1.00 0.00 ? 66 MET A O    2  
ATOM 2144  C CB   . MET A 1 66 ? 16.709  6.946   -14.345 1.00 0.00 ? 66 MET A CB   2  
ATOM 2145  C CG   . MET A 1 66 ? 16.398  6.442   -12.929 1.00 0.00 ? 66 MET A CG   2  
ATOM 2146  S SD   . MET A 1 66 ? 15.978  7.692   -11.676 1.00 0.00 ? 66 MET A SD   2  
ATOM 2147  C CE   . MET A 1 66 ? 15.444  6.576   -10.356 1.00 0.00 ? 66 MET A CE   2  
ATOM 2148  H H    . MET A 1 66 ? 18.743  8.534   -12.754 1.00 0.00 ? 66 MET A H    2  
ATOM 2149  H HA   . MET A 1 66 ? 18.832  6.820   -14.233 1.00 0.00 ? 66 MET A HA   2  
ATOM 2150  H HB2  . MET A 1 66 ? 15.938  7.654   -14.648 1.00 0.00 ? 66 MET A HB2  2  
ATOM 2151  H HB3  . MET A 1 66 ? 16.651  6.088   -15.014 1.00 0.00 ? 66 MET A HB3  2  
ATOM 2152  H HG2  . MET A 1 66 ? 15.544  5.768   -13.006 1.00 0.00 ? 66 MET A HG2  2  
ATOM 2153  H HG3  . MET A 1 66 ? 17.247  5.858   -12.572 1.00 0.00 ? 66 MET A HG3  2  
ATOM 2154  H HE1  . MET A 1 66 ? 15.236  7.145   -9.450  1.00 0.00 ? 66 MET A HE1  2  
ATOM 2155  H HE2  . MET A 1 66 ? 14.546  6.043   -10.669 1.00 0.00 ? 66 MET A HE2  2  
ATOM 2156  H HE3  . MET A 1 66 ? 16.233  5.853   -10.153 1.00 0.00 ? 66 MET A HE3  2  
ATOM 2157  N N    . LYS A 1 67 ? 19.653  8.376   -16.237 1.00 0.00 ? 67 LYS A N    2  
ATOM 2158  C CA   . LYS A 1 67 ? 20.127  9.062   -17.442 1.00 0.00 ? 67 LYS A CA   2  
ATOM 2159  C C    . LYS A 1 67 ? 19.469  10.423  -17.634 1.00 0.00 ? 67 LYS A C    2  
ATOM 2160  O O    . LYS A 1 67 ? 20.195  11.411  -17.671 1.00 0.00 ? 67 LYS A O    2  
ATOM 2161  C CB   . LYS A 1 67 ? 20.063  8.204   -18.723 1.00 0.00 ? 67 LYS A CB   2  
ATOM 2162  C CG   . LYS A 1 67 ? 21.191  7.168   -18.803 1.00 0.00 ? 67 LYS A CG   2  
ATOM 2163  C CD   . LYS A 1 67 ? 21.139  6.409   -20.136 1.00 0.00 ? 67 LYS A CD   2  
ATOM 2164  C CE   . LYS A 1 67 ? 22.375  5.514   -20.293 1.00 0.00 ? 67 LYS A CE   2  
ATOM 2165  N NZ   . LYS A 1 67 ? 22.247  4.589   -21.439 1.00 0.00 ? 67 LYS A NZ   2  
ATOM 2166  H H    . LYS A 1 67 ? 20.307  8.400   -15.467 1.00 0.00 ? 67 LYS A H    2  
ATOM 2167  H HA   . LYS A 1 67 ? 21.181  9.282   -17.269 1.00 0.00 ? 67 LYS A HA   2  
ATOM 2168  H HB2  . LYS A 1 67 ? 19.100  7.704   -18.812 1.00 0.00 ? 67 LYS A HB2  2  
ATOM 2169  H HB3  . LYS A 1 67 ? 20.166  8.873   -19.578 1.00 0.00 ? 67 LYS A HB3  2  
ATOM 2170  H HG2  . LYS A 1 67 ? 22.144  7.689   -18.734 1.00 0.00 ? 67 LYS A HG2  2  
ATOM 2171  H HG3  . LYS A 1 67 ? 21.107  6.461   -17.975 1.00 0.00 ? 67 LYS A HG3  2  
ATOM 2172  H HD2  . LYS A 1 67 ? 20.231  5.805   -20.159 1.00 0.00 ? 67 LYS A HD2  2  
ATOM 2173  H HD3  . LYS A 1 67 ? 21.110  7.121   -20.964 1.00 0.00 ? 67 LYS A HD3  2  
ATOM 2174  H HE2  . LYS A 1 67 ? 23.258  6.144   -20.427 1.00 0.00 ? 67 LYS A HE2  2  
ATOM 2175  H HE3  . LYS A 1 67 ? 22.509  4.925   -19.383 1.00 0.00 ? 67 LYS A HE3  2  
ATOM 2176  H HZ1  . LYS A 1 67 ? 22.019  5.076   -22.293 1.00 0.00 ? 67 LYS A HZ1  2  
ATOM 2177  H HZ2  . LYS A 1 67 ? 23.122  4.091   -21.595 1.00 0.00 ? 67 LYS A HZ2  2  
ATOM 2178  H HZ3  . LYS A 1 67 ? 21.516  3.904   -21.256 1.00 0.00 ? 67 LYS A HZ3  2  
ATOM 2179  N N    . LEU A 1 68 ? 18.144  10.497  -17.777 1.00 0.00 ? 68 LEU A N    2  
ATOM 2180  C CA   . LEU A 1 68 ? 17.440  11.654  -18.333 1.00 0.00 ? 68 LEU A CA   2  
ATOM 2181  C C    . LEU A 1 68 ? 18.171  12.132  -19.590 1.00 0.00 ? 68 LEU A C    2  
ATOM 2182  O O    . LEU A 1 68 ? 18.636  13.268  -19.681 1.00 0.00 ? 68 LEU A O    2  
ATOM 2183  C CB   . LEU A 1 68 ? 17.244  12.749  -17.270 1.00 0.00 ? 68 LEU A CB   2  
ATOM 2184  C CG   . LEU A 1 68 ? 16.338  13.909  -17.735 1.00 0.00 ? 68 LEU A CG   2  
ATOM 2185  C CD1  . LEU A 1 68 ? 14.864  13.498  -17.779 1.00 0.00 ? 68 LEU A CD1  2  
ATOM 2186  C CD2  . LEU A 1 68 ? 16.495  15.076  -16.764 1.00 0.00 ? 68 LEU A CD2  2  
ATOM 2187  H H    . LEU A 1 68 ? 17.621  9.635   -17.676 1.00 0.00 ? 68 LEU A H    2  
ATOM 2188  H HA   . LEU A 1 68 ? 16.455  11.312  -18.640 1.00 0.00 ? 68 LEU A HA   2  
ATOM 2189  H HB2  . LEU A 1 68 ? 16.803  12.300  -16.382 1.00 0.00 ? 68 LEU A HB2  2  
ATOM 2190  H HB3  . LEU A 1 68 ? 18.224  13.144  -16.999 1.00 0.00 ? 68 LEU A HB3  2  
ATOM 2191  H HG   . LEU A 1 68 ? 16.624  14.260  -18.722 1.00 0.00 ? 68 LEU A HG   2  
ATOM 2192  H HD11 . LEU A 1 68 ? 14.726  12.637  -18.428 1.00 0.00 ? 68 LEU A HD11 2  
ATOM 2193  H HD12 . LEU A 1 68 ? 14.511  13.250  -16.778 1.00 0.00 ? 68 LEU A HD12 2  
ATOM 2194  H HD13 . LEU A 1 68 ? 14.267  14.312  -18.181 1.00 0.00 ? 68 LEU A HD13 2  
ATOM 2195  H HD21 . LEU A 1 68 ? 16.158  14.767  -15.785 1.00 0.00 ? 68 LEU A HD21 2  
ATOM 2196  H HD22 . LEU A 1 68 ? 17.539  15.390  -16.715 1.00 0.00 ? 68 LEU A HD22 2  
ATOM 2197  H HD23 . LEU A 1 68 ? 15.893  15.918  -17.090 1.00 0.00 ? 68 LEU A HD23 2  
ATOM 2198  N N    . MET A 1 69 ? 18.338  11.215  -20.539 1.00 0.00 ? 69 MET A N    2  
ATOM 2199  C CA   . MET A 1 69 ? 18.925  11.482  -21.837 1.00 0.00 ? 69 MET A CA   2  
ATOM 2200  C C    . MET A 1 69 ? 18.119  10.717  -22.875 1.00 0.00 ? 69 MET A C    2  
ATOM 2201  O O    . MET A 1 69 ? 18.443  9.569   -23.198 1.00 0.00 ? 69 MET A O    2  
ATOM 2202  C CB   . MET A 1 69 ? 20.417  11.123  -21.871 1.00 0.00 ? 69 MET A CB   2  
ATOM 2203  C CG   . MET A 1 69 ? 21.258  12.060  -20.999 1.00 0.00 ? 69 MET A CG   2  
ATOM 2204  S SD   . MET A 1 69 ? 23.039  11.734  -21.011 1.00 0.00 ? 69 MET A SD   2  
ATOM 2205  C CE   . MET A 1 69 ? 23.393  12.120  -22.750 1.00 0.00 ? 69 MET A CE   2  
ATOM 2206  H H    . MET A 1 69 ? 17.903  10.310  -20.397 1.00 0.00 ? 69 MET A H    2  
ATOM 2207  H HA   . MET A 1 69 ? 18.834  12.546  -22.056 1.00 0.00 ? 69 MET A HA   2  
ATOM 2208  H HB2  . MET A 1 69 ? 20.561  10.094  -21.542 1.00 0.00 ? 69 MET A HB2  2  
ATOM 2209  H HB3  . MET A 1 69 ? 20.756  11.211  -22.903 1.00 0.00 ? 69 MET A HB3  2  
ATOM 2210  H HG2  . MET A 1 69 ? 21.089  13.087  -21.325 1.00 0.00 ? 69 MET A HG2  2  
ATOM 2211  H HG3  . MET A 1 69 ? 20.920  11.977  -19.971 1.00 0.00 ? 69 MET A HG3  2  
ATOM 2212  H HE1  . MET A 1 69 ? 22.998  13.105  -22.995 1.00 0.00 ? 69 MET A HE1  2  
ATOM 2213  H HE2  . MET A 1 69 ? 24.468  12.120  -22.920 1.00 0.00 ? 69 MET A HE2  2  
ATOM 2214  H HE3  . MET A 1 69 ? 22.943  11.373  -23.403 1.00 0.00 ? 69 MET A HE3  2  
ATOM 2215  N N    . ARG A 1 70 ? 17.070  11.355  -23.384 1.00 0.00 ? 70 ARG A N    2  
ATOM 2216  C CA   . ARG A 1 70 ? 16.446  11.068  -24.659 1.00 0.00 ? 70 ARG A CA   2  
ATOM 2217  C C    . ARG A 1 70 ? 16.429  12.400  -25.367 1.00 0.00 ? 70 ARG A C    2  
ATOM 2218  O O    . ARG A 1 70 ? 15.781  13.333  -24.851 1.00 0.00 ? 70 ARG A O    2  
ATOM 2219  C CB   . ARG A 1 70 ? 15.049  10.473  -24.497 1.00 0.00 ? 70 ARG A CB   2  
ATOM 2220  C CG   . ARG A 1 70 ? 14.486  10.106  -25.877 1.00 0.00 ? 70 ARG A CG   2  
ATOM 2221  C CD   . ARG A 1 70 ? 13.098  9.480   -25.771 1.00 0.00 ? 70 ARG A CD   2  
ATOM 2222  N NE   . ARG A 1 70 ? 12.549  9.180   -27.103 1.00 0.00 ? 70 ARG A NE   2  
ATOM 2223  C CZ   . ARG A 1 70 ? 12.598  8.034   -27.796 1.00 0.00 ? 70 ARG A CZ   2  
ATOM 2224  N NH1  . ARG A 1 70 ? 13.176  6.942   -27.310 1.00 0.00 ? 70 ARG A NH1  2  
ATOM 2225  N NH2  . ARG A 1 70 ? 12.005  7.990   -28.976 1.00 0.00 ? 70 ARG A NH2  2  
ATOM 2226  H H    . ARG A 1 70 ? 16.870  12.289  -23.044 1.00 0.00 ? 70 ARG A H    2  
ATOM 2227  H HA   . ARG A 1 70 ? 17.075  10.364  -25.217 1.00 0.00 ? 70 ARG A HA   2  
ATOM 2228  H HB2  . ARG A 1 70 ? 15.102  9.577   -23.882 1.00 0.00 ? 70 ARG A HB2  2  
ATOM 2229  H HB3  . ARG A 1 70 ? 14.388  11.195  -24.007 1.00 0.00 ? 70 ARG A HB3  2  
ATOM 2230  H HG2  . ARG A 1 70 ? 14.417  11.000  -26.499 1.00 0.00 ? 70 ARG A HG2  2  
ATOM 2231  H HG3  . ARG A 1 70 ? 15.157  9.392   -26.351 1.00 0.00 ? 70 ARG A HG3  2  
ATOM 2232  H HD2  . ARG A 1 70 ? 13.159  8.576   -25.170 1.00 0.00 ? 70 ARG A HD2  2  
ATOM 2233  H HD3  . ARG A 1 70 ? 12.431  10.181  -25.270 1.00 0.00 ? 70 ARG A HD3  2  
ATOM 2234  H HE   . ARG A 1 70 ? 12.156  9.982   -27.604 1.00 0.00 ? 70 ARG A HE   2  
ATOM 2235  H HH11 . ARG A 1 70 ? 13.739  6.976   -26.467 1.00 0.00 ? 70 ARG A HH11 2  
ATOM 2236  H HH12 . ARG A 1 70 ? 13.287  6.106   -27.885 1.00 0.00 ? 70 ARG A HH12 2  
ATOM 2237  H HH21 . ARG A 1 70 ? 11.666  8.868   -29.374 1.00 0.00 ? 70 ARG A HH21 2  
ATOM 2238  H HH22 . ARG A 1 70 ? 11.880  7.124   -29.490 1.00 0.00 ? 70 ARG A HH22 2  
ATOM 2239  N N    . GLY A 1 1  ? 1.341   -21.717 7.790   1.00 0.00 ? 1  GLY A N    3  
ATOM 2240  C CA   . GLY A 1 1  ? 0.067   -22.448 7.793   1.00 0.00 ? 1  GLY A CA   3  
ATOM 2241  C C    . GLY A 1 1  ? -0.694  -22.128 6.522   1.00 0.00 ? 1  GLY A C    3  
ATOM 2242  O O    . GLY A 1 1  ? -0.348  -21.174 5.822   1.00 0.00 ? 1  GLY A O    3  
ATOM 2243  H H1   . GLY A 1 1  ? 1.911   -21.858 8.600   1.00 0.00 ? 1  GLY A H1   3  
ATOM 2244  H HA2  . GLY A 1 1  ? 0.263   -23.519 7.835   1.00 0.00 ? 1  GLY A HA2  3  
ATOM 2245  H HA3  . GLY A 1 1  ? -0.526  -22.145 8.656   1.00 0.00 ? 1  GLY A HA3  3  
ATOM 2246  N N    . SER A 1 2  ? -1.723  -22.904 6.204   1.00 0.00 ? 2  SER A N    3  
ATOM 2247  C CA   . SER A 1 2  ? -2.601  -22.654 5.078   1.00 0.00 ? 2  SER A CA   3  
ATOM 2248  C C    . SER A 1 2  ? -3.993  -23.076 5.531   1.00 0.00 ? 2  SER A C    3  
ATOM 2249  O O    . SER A 1 2  ? -4.300  -24.265 5.591   1.00 0.00 ? 2  SER A O    3  
ATOM 2250  C CB   . SER A 1 2  ? -2.096  -23.429 3.851   1.00 0.00 ? 2  SER A CB   3  
ATOM 2251  O OG   . SER A 1 2  ? -2.648  -22.897 2.661   1.00 0.00 ? 2  SER A OG   3  
ATOM 2252  H H    . SER A 1 2  ? -1.957  -23.714 6.778   1.00 0.00 ? 2  SER A H    3  
ATOM 2253  H HA   . SER A 1 2  ? -2.601  -21.585 4.851   1.00 0.00 ? 2  SER A HA   3  
ATOM 2254  H HB2  . SER A 1 2  ? -1.011  -23.336 3.787   1.00 0.00 ? 2  SER A HB2  3  
ATOM 2255  H HB3  . SER A 1 2  ? -2.344  -24.488 3.937   1.00 0.00 ? 2  SER A HB3  3  
ATOM 2256  H HG   . SER A 1 2  ? -3.616  -22.744 2.783   1.00 0.00 ? 2  SER A HG   3  
ATOM 2257  N N    . SER A 1 3  ? -4.821  -22.112 5.920   1.00 0.00 ? 3  SER A N    3  
ATOM 2258  C CA   . SER A 1 3  ? -6.158  -22.369 6.429   1.00 0.00 ? 3  SER A CA   3  
ATOM 2259  C C    . SER A 1 3  ? -7.014  -23.029 5.342   1.00 0.00 ? 3  SER A C    3  
ATOM 2260  O O    . SER A 1 3  ? -7.367  -22.406 4.336   1.00 0.00 ? 3  SER A O    3  
ATOM 2261  C CB   . SER A 1 3  ? -6.732  -21.061 6.973   1.00 0.00 ? 3  SER A CB   3  
ATOM 2262  O OG   . SER A 1 3  ? -5.789  -20.515 7.886   1.00 0.00 ? 3  SER A OG   3  
ATOM 2263  H H    . SER A 1 3  ? -4.521  -21.150 5.887   1.00 0.00 ? 3  SER A H    3  
ATOM 2264  H HA   . SER A 1 3  ? -6.072  -23.070 7.261   1.00 0.00 ? 3  SER A HA   3  
ATOM 2265  H HB2  . SER A 1 3  ? -6.909  -20.358 6.158   1.00 0.00 ? 3  SER A HB2  3  
ATOM 2266  H HB3  . SER A 1 3  ? -7.672  -21.264 7.484   1.00 0.00 ? 3  SER A HB3  3  
ATOM 2267  H HG   . SER A 1 3  ? -5.622  -21.196 8.573   1.00 0.00 ? 3  SER A HG   3  
ATOM 2268  N N    . GLY A 1 4  ? -7.277  -24.322 5.510   1.00 0.00 ? 4  GLY A N    3  
ATOM 2269  C CA   . GLY A 1 4  ? -7.951  -25.166 4.549   1.00 0.00 ? 4  GLY A CA   3  
ATOM 2270  C C    . GLY A 1 4  ? -7.020  -25.503 3.389   1.00 0.00 ? 4  GLY A C    3  
ATOM 2271  O O    . GLY A 1 4  ? -6.205  -26.423 3.497   1.00 0.00 ? 4  GLY A O    3  
ATOM 2272  H H    . GLY A 1 4  ? -6.899  -24.774 6.337   1.00 0.00 ? 4  GLY A H    3  
ATOM 2273  H HA2  . GLY A 1 4  ? -8.239  -26.085 5.053   1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2274  H HA3  . GLY A 1 4  ? -8.846  -24.662 4.185   1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2275  N N    . SER A 1 5  ? -7.166  -24.793 2.274   1.00 0.00 ? 5  SER A N    3  
ATOM 2276  C CA   . SER A 1 5  ? -6.440  -25.036 1.034   1.00 0.00 ? 5  SER A CA   3  
ATOM 2277  C C    . SER A 1 5  ? -6.256  -23.735 0.245   1.00 0.00 ? 5  SER A C    3  
ATOM 2278  O O    . SER A 1 5  ? -5.208  -23.537 -0.375  1.00 0.00 ? 5  SER A O    3  
ATOM 2279  C CB   . SER A 1 5  ? -7.219  -26.066 0.198   1.00 0.00 ? 5  SER A CB   3  
ATOM 2280  O OG   . SER A 1 5  ? -6.470  -26.414 -0.946  1.00 0.00 ? 5  SER A OG   3  
ATOM 2281  H H    . SER A 1 5  ? -7.842  -24.040 2.291   1.00 0.00 ? 5  SER A H    3  
ATOM 2282  H HA   . SER A 1 5  ? -5.455  -25.440 1.276   1.00 0.00 ? 5  SER A HA   3  
ATOM 2283  H HB2  . SER A 1 5  ? -7.400  -26.964 0.795   1.00 0.00 ? 5  SER A HB2  3  
ATOM 2284  H HB3  . SER A 1 5  ? -8.172  -25.643 -0.123  1.00 0.00 ? 5  SER A HB3  3  
ATOM 2285  H HG   . SER A 1 5  ? -7.004  -27.004 -1.509  1.00 0.00 ? 5  SER A HG   3  
ATOM 2286  N N    . SER A 1 6  ? -7.264  -22.861 0.254   1.00 0.00 ? 6  SER A N    3  
ATOM 2287  C CA   . SER A 1 6  ? -7.260  -21.585 -0.447  1.00 0.00 ? 6  SER A CA   3  
ATOM 2288  C C    . SER A 1 6  ? -7.927  -20.519 0.427   1.00 0.00 ? 6  SER A C    3  
ATOM 2289  O O    . SER A 1 6  ? -7.527  -19.357 0.372   1.00 0.00 ? 6  SER A O    3  
ATOM 2290  C CB   . SER A 1 6  ? -7.988  -21.773 -1.788  1.00 0.00 ? 6  SER A CB   3  
ATOM 2291  O OG   . SER A 1 6  ? -7.764  -20.718 -2.706  1.00 0.00 ? 6  SER A OG   3  
ATOM 2292  H H    . SER A 1 6  ? -8.103  -23.130 0.746   1.00 0.00 ? 6  SER A H    3  
ATOM 2293  H HA   . SER A 1 6  ? -6.226  -21.287 -0.638  1.00 0.00 ? 6  SER A HA   3  
ATOM 2294  H HB2  . SER A 1 6  ? -7.635  -22.697 -2.247  1.00 0.00 ? 6  SER A HB2  3  
ATOM 2295  H HB3  . SER A 1 6  ? -9.058  -21.866 -1.601  1.00 0.00 ? 6  SER A HB3  3  
ATOM 2296  H HG   . SER A 1 6  ? -8.144  -19.894 -2.349  1.00 0.00 ? 6  SER A HG   3  
ATOM 2297  N N    . GLY A 1 7  ? -8.897  -20.887 1.270   1.00 0.00 ? 7  GLY A N    3  
ATOM 2298  C CA   . GLY A 1 7  ? -9.727  -19.963 2.033   1.00 0.00 ? 7  GLY A CA   3  
ATOM 2299  C C    . GLY A 1 7  ? -11.106 -19.831 1.393   1.00 0.00 ? 7  GLY A C    3  
ATOM 2300  O O    . GLY A 1 7  ? -11.363 -20.384 0.316   1.00 0.00 ? 7  GLY A O    3  
ATOM 2301  H H    . GLY A 1 7  ? -9.212  -21.847 1.281   1.00 0.00 ? 7  GLY A H    3  
ATOM 2302  H HA2  . GLY A 1 7  ? -9.829  -20.341 3.051   1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2303  H HA3  . GLY A 1 7  ? -9.270  -18.976 2.073   1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2304  N N    . ARG A 1 8  ? -12.024 -19.149 2.080   1.00 0.00 ? 8  ARG A N    3  
ATOM 2305  C CA   . ARG A 1 8  ? -13.441 -19.089 1.710   1.00 0.00 ? 8  ARG A CA   3  
ATOM 2306  C C    . ARG A 1 8  ? -13.824 -17.754 1.070   1.00 0.00 ? 8  ARG A C    3  
ATOM 2307  O O    . ARG A 1 8  ? -14.879 -17.684 0.446   1.00 0.00 ? 8  ARG A O    3  
ATOM 2308  C CB   . ARG A 1 8  ? -14.264 -19.432 2.966   1.00 0.00 ? 8  ARG A CB   3  
ATOM 2309  C CG   . ARG A 1 8  ? -15.787 -19.351 2.788   1.00 0.00 ? 8  ARG A CG   3  
ATOM 2310  C CD   . ARG A 1 8  ? -16.493 -20.073 3.939   1.00 0.00 ? 8  ARG A CD   3  
ATOM 2311  N NE   . ARG A 1 8  ? -17.951 -19.901 3.865   1.00 0.00 ? 8  ARG A NE   3  
ATOM 2312  C CZ   . ARG A 1 8  ? -18.875 -20.684 4.435   1.00 0.00 ? 8  ARG A CZ   3  
ATOM 2313  N NH1  . ARG A 1 8  ? -18.560 -21.864 4.957   1.00 0.00 ? 8  ARG A NH1  3  
ATOM 2314  N NH2  . ARG A 1 8  ? -20.133 -20.264 4.497   1.00 0.00 ? 8  ARG A NH2  3  
ATOM 2315  H H    . ARG A 1 8  ? -11.764 -18.796 2.994   1.00 0.00 ? 8  ARG A H    3  
ATOM 2316  H HA   . ARG A 1 8  ? -13.660 -19.853 0.962   1.00 0.00 ? 8  ARG A HA   3  
ATOM 2317  H HB2  . ARG A 1 8  ? -14.000 -20.448 3.264   1.00 0.00 ? 8  ARG A HB2  3  
ATOM 2318  H HB3  . ARG A 1 8  ? -13.982 -18.763 3.777   1.00 0.00 ? 8  ARG A HB3  3  
ATOM 2319  H HG2  . ARG A 1 8  ? -16.092 -18.303 2.772   1.00 0.00 ? 8  ARG A HG2  3  
ATOM 2320  H HG3  . ARG A 1 8  ? -16.070 -19.822 1.847   1.00 0.00 ? 8  ARG A HG3  3  
ATOM 2321  H HD2  . ARG A 1 8  ? -16.236 -21.129 3.902   1.00 0.00 ? 8  ARG A HD2  3  
ATOM 2322  H HD3  . ARG A 1 8  ? -16.142 -19.662 4.887   1.00 0.00 ? 8  ARG A HD3  3  
ATOM 2323  H HE   . ARG A 1 8  ? -18.239 -19.016 3.451   1.00 0.00 ? 8  ARG A HE   3  
ATOM 2324  H HH11 . ARG A 1 8  ? -17.674 -22.326 4.752   1.00 0.00 ? 8  ARG A HH11 3  
ATOM 2325  H HH12 . ARG A 1 8  ? -19.237 -22.374 5.531   1.00 0.00 ? 8  ARG A HH12 3  
ATOM 2326  H HH21 . ARG A 1 8  ? -20.379 -19.331 4.179   1.00 0.00 ? 8  ARG A HH21 3  
ATOM 2327  H HH22 . ARG A 1 8  ? -20.855 -20.772 5.006   1.00 0.00 ? 8  ARG A HH22 3  
ATOM 2328  N N    . GLY A 1 9  ? -12.982 -16.724 1.152   1.00 0.00 ? 9  GLY A N    3  
ATOM 2329  C CA   . GLY A 1 9  ? -13.239 -15.413 0.574   1.00 0.00 ? 9  GLY A CA   3  
ATOM 2330  C C    . GLY A 1 9  ? -12.090 -15.038 -0.342  1.00 0.00 ? 9  GLY A C    3  
ATOM 2331  O O    . GLY A 1 9  ? -10.990 -14.785 0.147   1.00 0.00 ? 9  GLY A O    3  
ATOM 2332  H H    . GLY A 1 9  ? -12.093 -16.841 1.612   1.00 0.00 ? 9  GLY A H    3  
ATOM 2333  H HA2  . GLY A 1 9  ? -14.177 -15.397 0.019   1.00 0.00 ? 9  GLY A HA2  3  
ATOM 2334  H HA3  . GLY A 1 9  ? -13.303 -14.681 1.378   1.00 0.00 ? 9  GLY A HA3  3  
ATOM 2335  N N    . ARG A 1 10 ? -12.302 -15.033 -1.663  1.00 0.00 ? 10 ARG A N    3  
ATOM 2336  C CA   . ARG A 1 10 ? -11.276 -14.603 -2.619  1.00 0.00 ? 10 ARG A CA   3  
ATOM 2337  C C    . ARG A 1 10 ? -10.849 -13.163 -2.359  1.00 0.00 ? 10 ARG A C    3  
ATOM 2338  O O    . ARG A 1 10 ? -9.692  -12.824 -2.588  1.00 0.00 ? 10 ARG A O    3  
ATOM 2339  C CB   . ARG A 1 10 ? -11.737 -14.820 -4.072  1.00 0.00 ? 10 ARG A CB   3  
ATOM 2340  C CG   . ARG A 1 10 ? -12.892 -13.939 -4.564  1.00 0.00 ? 10 ARG A CG   3  
ATOM 2341  C CD   . ARG A 1 10 ? -13.600 -14.550 -5.785  1.00 0.00 ? 10 ARG A CD   3  
ATOM 2342  N NE   . ARG A 1 10 ? -13.727 -13.605 -6.908  1.00 0.00 ? 10 ARG A NE   3  
ATOM 2343  C CZ   . ARG A 1 10 ? -14.611 -12.608 -7.049  1.00 0.00 ? 10 ARG A CZ   3  
ATOM 2344  N NH1  . ARG A 1 10 ? -15.521 -12.334 -6.122  1.00 0.00 ? 10 ARG A NH1  3  
ATOM 2345  N NH2  . ARG A 1 10 ? -14.550 -11.862 -8.143  1.00 0.00 ? 10 ARG A NH2  3  
ATOM 2346  H H    . ARG A 1 10 ? -13.198 -15.358 -2.025  1.00 0.00 ? 10 ARG A H    3  
ATOM 2347  H HA   . ARG A 1 10 ? -10.393 -15.223 -2.460  1.00 0.00 ? 10 ARG A HA   3  
ATOM 2348  H HB2  . ARG A 1 10 ? -10.897 -14.601 -4.726  1.00 0.00 ? 10 ARG A HB2  3  
ATOM 2349  H HB3  . ARG A 1 10 ? -12.006 -15.870 -4.186  1.00 0.00 ? 10 ARG A HB3  3  
ATOM 2350  H HG2  . ARG A 1 10 ? -13.619 -13.813 -3.766  1.00 0.00 ? 10 ARG A HG2  3  
ATOM 2351  H HG3  . ARG A 1 10 ? -12.481 -12.966 -4.830  1.00 0.00 ? 10 ARG A HG3  3  
ATOM 2352  H HD2  . ARG A 1 10 ? -13.025 -15.407 -6.138  1.00 0.00 ? 10 ARG A HD2  3  
ATOM 2353  H HD3  . ARG A 1 10 ? -14.587 -14.905 -5.490  1.00 0.00 ? 10 ARG A HD3  3  
ATOM 2354  H HE   . ARG A 1 10 ? -13.082 -13.773 -7.674  1.00 0.00 ? 10 ARG A HE   3  
ATOM 2355  H HH11 . ARG A 1 10 ? -15.585 -12.846 -5.237  1.00 0.00 ? 10 ARG A HH11 3  
ATOM 2356  H HH12 . ARG A 1 10 ? -16.178 -11.562 -6.237  1.00 0.00 ? 10 ARG A HH12 3  
ATOM 2357  H HH21 . ARG A 1 10 ? -13.798 -12.037 -8.811  1.00 0.00 ? 10 ARG A HH21 3  
ATOM 2358  H HH22 . ARG A 1 10 ? -15.194 -11.104 -8.360  1.00 0.00 ? 10 ARG A HH22 3  
ATOM 2359  N N    . TYR A 1 11 ? -11.765 -12.319 -1.882  1.00 0.00 ? 11 TYR A N    3  
ATOM 2360  C CA   . TYR A 1 11 ? -11.449 -11.001 -1.362  1.00 0.00 ? 11 TYR A CA   3  
ATOM 2361  C C    . TYR A 1 11 ? -10.706 -11.209 -0.044  1.00 0.00 ? 11 TYR A C    3  
ATOM 2362  O O    . TYR A 1 11 ? -11.322 -11.537 0.974   1.00 0.00 ? 11 TYR A O    3  
ATOM 2363  C CB   . TYR A 1 11 ? -12.720 -10.161 -1.167  1.00 0.00 ? 11 TYR A CB   3  
ATOM 2364  C CG   . TYR A 1 11 ? -13.273 -9.483  -2.411  1.00 0.00 ? 11 TYR A CG   3  
ATOM 2365  C CD1  . TYR A 1 11 ? -13.368 -10.156 -3.647  1.00 0.00 ? 11 TYR A CD1  3  
ATOM 2366  C CD2  . TYR A 1 11 ? -13.695 -8.142  -2.323  1.00 0.00 ? 11 TYR A CD2  3  
ATOM 2367  C CE1  . TYR A 1 11 ? -13.904 -9.499  -4.770  1.00 0.00 ? 11 TYR A CE1  3  
ATOM 2368  C CE2  . TYR A 1 11 ? -14.243 -7.486  -3.435  1.00 0.00 ? 11 TYR A CE2  3  
ATOM 2369  C CZ   . TYR A 1 11 ? -14.361 -8.167  -4.665  1.00 0.00 ? 11 TYR A CZ   3  
ATOM 2370  O OH   . TYR A 1 11 ? -14.890 -7.537  -5.747  1.00 0.00 ? 11 TYR A OH   3  
ATOM 2371  H H    . TYR A 1 11 ? -12.688 -12.670 -1.683  1.00 0.00 ? 11 TYR A H    3  
ATOM 2372  H HA   . TYR A 1 11 ? -10.802 -10.476 -2.061  1.00 0.00 ? 11 TYR A HA   3  
ATOM 2373  H HB2  . TYR A 1 11 ? -13.500 -10.779 -0.721  1.00 0.00 ? 11 TYR A HB2  3  
ATOM 2374  H HB3  . TYR A 1 11 ? -12.474 -9.378  -0.448  1.00 0.00 ? 11 TYR A HB3  3  
ATOM 2375  H HD1  . TYR A 1 11 ? -13.042 -11.181 -3.753  1.00 0.00 ? 11 TYR A HD1  3  
ATOM 2376  H HD2  . TYR A 1 11 ? -13.601 -7.600  -1.393  1.00 0.00 ? 11 TYR A HD2  3  
ATOM 2377  H HE1  . TYR A 1 11 ? -13.983 -10.010 -5.716  1.00 0.00 ? 11 TYR A HE1  3  
ATOM 2378  H HE2  . TYR A 1 11 ? -14.557 -6.456  -3.340  1.00 0.00 ? 11 TYR A HE2  3  
ATOM 2379  H HH   . TYR A 1 11 ? -15.477 -6.815  -5.480  1.00 0.00 ? 11 TYR A HH   3  
ATOM 2380  N N    . ARG A 1 12 ? -9.378  -11.089 -0.071  1.00 0.00 ? 12 ARG A N    3  
ATOM 2381  C CA   . ARG A 1 12 ? -8.573  -10.964 1.137   1.00 0.00 ? 12 ARG A CA   3  
ATOM 2382  C C    . ARG A 1 12 ? -7.303  -10.220 0.745   1.00 0.00 ? 12 ARG A C    3  
ATOM 2383  O O    . ARG A 1 12 ? -7.182  -9.039  1.059   1.00 0.00 ? 12 ARG A O    3  
ATOM 2384  C CB   . ARG A 1 12 ? -8.344  -12.339 1.815   1.00 0.00 ? 12 ARG A CB   3  
ATOM 2385  C CG   . ARG A 1 12 ? -8.400  -12.303 3.355   1.00 0.00 ? 12 ARG A CG   3  
ATOM 2386  C CD   . ARG A 1 12 ? -7.184  -11.680 4.054   1.00 0.00 ? 12 ARG A CD   3  
ATOM 2387  N NE   . ARG A 1 12 ? -7.102  -10.223 3.867   1.00 0.00 ? 12 ARG A NE   3  
ATOM 2388  C CZ   . ARG A 1 12 ? -6.163  -9.413  4.359   1.00 0.00 ? 12 ARG A CZ   3  
ATOM 2389  N NH1  . ARG A 1 12 ? -5.281  -9.831  5.256   1.00 0.00 ? 12 ARG A NH1  3  
ATOM 2390  N NH2  . ARG A 1 12 ? -6.117  -8.162  3.943   1.00 0.00 ? 12 ARG A NH2  3  
ATOM 2391  H H    . ARG A 1 12 ? -8.960  -10.812 -0.953  1.00 0.00 ? 12 ARG A H    3  
ATOM 2392  H HA   . ARG A 1 12 ? -9.143  -10.332 1.821   1.00 0.00 ? 12 ARG A HA   3  
ATOM 2393  H HB2  . ARG A 1 12 ? -9.135  -13.021 1.498   1.00 0.00 ? 12 ARG A HB2  3  
ATOM 2394  H HB3  . ARG A 1 12 ? -7.403  -12.784 1.498   1.00 0.00 ? 12 ARG A HB3  3  
ATOM 2395  H HG2  . ARG A 1 12 ? -9.307  -11.791 3.678   1.00 0.00 ? 12 ARG A HG2  3  
ATOM 2396  H HG3  . ARG A 1 12 ? -8.475  -13.334 3.700   1.00 0.00 ? 12 ARG A HG3  3  
ATOM 2397  H HD2  . ARG A 1 12 ? -7.264  -11.889 5.121   1.00 0.00 ? 12 ARG A HD2  3  
ATOM 2398  H HD3  . ARG A 1 12 ? -6.273  -12.147 3.677   1.00 0.00 ? 12 ARG A HD3  3  
ATOM 2399  H HE   . ARG A 1 12 ? -7.817  -9.781  3.299   1.00 0.00 ? 12 ARG A HE   3  
ATOM 2400  H HH11 . ARG A 1 12 ? -5.333  -10.766 5.654   1.00 0.00 ? 12 ARG A HH11 3  
ATOM 2401  H HH12 . ARG A 1 12 ? -4.694  -9.152  5.743   1.00 0.00 ? 12 ARG A HH12 3  
ATOM 2402  H HH21 . ARG A 1 12 ? -6.816  -7.791  3.299   1.00 0.00 ? 12 ARG A HH21 3  
ATOM 2403  H HH22 . ARG A 1 12 ? -5.329  -7.558  4.140   1.00 0.00 ? 12 ARG A HH22 3  
ATOM 2404  N N    . GLN A 1 13 ? -6.403  -10.882 0.018   1.00 0.00 ? 13 GLN A N    3  
ATOM 2405  C CA   . GLN A 1 13 ? -5.153  -10.309 -0.463  1.00 0.00 ? 13 GLN A CA   3  
ATOM 2406  C C    . GLN A 1 13 ? -5.448  -9.198  -1.477  1.00 0.00 ? 13 GLN A C    3  
ATOM 2407  O O    . GLN A 1 13 ? -5.805  -9.502  -2.619  1.00 0.00 ? 13 GLN A O    3  
ATOM 2408  C CB   . GLN A 1 13 ? -4.280  -11.406 -1.103  1.00 0.00 ? 13 GLN A CB   3  
ATOM 2409  C CG   . GLN A 1 13 ? -3.741  -12.465 -0.126  1.00 0.00 ? 13 GLN A CG   3  
ATOM 2410  C CD   . GLN A 1 13 ? -4.780  -13.449 0.417   1.00 0.00 ? 13 GLN A CD   3  
ATOM 2411  O OE1  . GLN A 1 13 ? -4.858  -13.686 1.616   1.00 0.00 ? 13 GLN A OE1  3  
ATOM 2412  N NE2  . GLN A 1 13 ? -5.590  -14.076 -0.421  1.00 0.00 ? 13 GLN A NE2  3  
ATOM 2413  H H    . GLN A 1 13 ? -6.608  -11.838 -0.232  1.00 0.00 ? 13 GLN A H    3  
ATOM 2414  H HA   . GLN A 1 13 ? -4.614  -9.875  0.380   1.00 0.00 ? 13 GLN A HA   3  
ATOM 2415  H HB2  . GLN A 1 13 ? -4.839  -11.898 -1.897  1.00 0.00 ? 13 GLN A HB2  3  
ATOM 2416  H HB3  . GLN A 1 13 ? -3.418  -10.920 -1.561  1.00 0.00 ? 13 GLN A HB3  3  
ATOM 2417  H HG2  . GLN A 1 13 ? -2.978  -13.043 -0.645  1.00 0.00 ? 13 GLN A HG2  3  
ATOM 2418  H HG3  . GLN A 1 13 ? -3.255  -11.959 0.709   1.00 0.00 ? 13 GLN A HG3  3  
ATOM 2419  H HE21 . GLN A 1 13 ? -5.585  -13.910 -1.427  1.00 0.00 ? 13 GLN A HE21 3  
ATOM 2420  H HE22 . GLN A 1 13 ? -6.181  -14.825 -0.074  1.00 0.00 ? 13 GLN A HE22 3  
ATOM 2421  N N    . TYR A 1 14 ? -5.295  -7.929  -1.087  1.00 0.00 ? 14 TYR A N    3  
ATOM 2422  C CA   . TYR A 1 14 ? -5.405  -6.780  -1.990  1.00 0.00 ? 14 TYR A CA   3  
ATOM 2423  C C    . TYR A 1 14 ? -4.479  -6.974  -3.200  1.00 0.00 ? 14 TYR A C    3  
ATOM 2424  O O    . TYR A 1 14 ? -3.423  -7.606  -3.093  1.00 0.00 ? 14 TYR A O    3  
ATOM 2425  C CB   . TYR A 1 14 ? -5.061  -5.491  -1.220  1.00 0.00 ? 14 TYR A CB   3  
ATOM 2426  C CG   . TYR A 1 14 ? -3.673  -5.487  -0.604  1.00 0.00 ? 14 TYR A CG   3  
ATOM 2427  C CD1  . TYR A 1 14 ? -2.562  -5.132  -1.386  1.00 0.00 ? 14 TYR A CD1  3  
ATOM 2428  C CD2  . TYR A 1 14 ? -3.479  -5.858  0.737   1.00 0.00 ? 14 TYR A CD2  3  
ATOM 2429  C CE1  . TYR A 1 14 ? -1.254  -5.270  -0.896  1.00 0.00 ? 14 TYR A CE1  3  
ATOM 2430  C CE2  . TYR A 1 14 ? -2.179  -6.002  1.241   1.00 0.00 ? 14 TYR A CE2  3  
ATOM 2431  C CZ   . TYR A 1 14 ? -1.064  -5.754  0.416   1.00 0.00 ? 14 TYR A CZ   3  
ATOM 2432  O OH   . TYR A 1 14 ? 0.173   -6.053  0.886   1.00 0.00 ? 14 TYR A OH   3  
ATOM 2433  H H    . TYR A 1 14 ? -5.042  -7.735  -0.128  1.00 0.00 ? 14 TYR A H    3  
ATOM 2434  H HA   . TYR A 1 14 ? -6.433  -6.696  -2.349  1.00 0.00 ? 14 TYR A HA   3  
ATOM 2435  H HB2  . TYR A 1 14 ? -5.137  -4.636  -1.890  1.00 0.00 ? 14 TYR A HB2  3  
ATOM 2436  H HB3  . TYR A 1 14 ? -5.807  -5.344  -0.439  1.00 0.00 ? 14 TYR A HB3  3  
ATOM 2437  H HD1  . TYR A 1 14 ? -2.717  -4.741  -2.376  1.00 0.00 ? 14 TYR A HD1  3  
ATOM 2438  H HD2  . TYR A 1 14 ? -4.315  -6.047  1.390   1.00 0.00 ? 14 TYR A HD2  3  
ATOM 2439  H HE1  . TYR A 1 14 ? -0.421  -5.017  -1.543  1.00 0.00 ? 14 TYR A HE1  3  
ATOM 2440  H HE2  . TYR A 1 14 ? -2.026  -6.343  2.251   1.00 0.00 ? 14 TYR A HE2  3  
ATOM 2441  H HH   . TYR A 1 14 ? 0.109   -6.866  1.408   1.00 0.00 ? 14 TYR A HH   3  
ATOM 2442  N N    . ASN A 1 15 ? -4.851  -6.434  -4.359  1.00 0.00 ? 15 ASN A N    3  
ATOM 2443  C CA   . ASN A 1 15 ? -3.984  -6.433  -5.542  1.00 0.00 ? 15 ASN A CA   3  
ATOM 2444  C C    . ASN A 1 15 ? -2.932  -5.341  -5.361  1.00 0.00 ? 15 ASN A C    3  
ATOM 2445  O O    . ASN A 1 15 ? -3.194  -4.386  -4.636  1.00 0.00 ? 15 ASN A O    3  
ATOM 2446  C CB   . ASN A 1 15 ? -4.799  -6.148  -6.813  1.00 0.00 ? 15 ASN A CB   3  
ATOM 2447  C CG   . ASN A 1 15 ? -5.942  -7.131  -7.033  1.00 0.00 ? 15 ASN A CG   3  
ATOM 2448  O OD1  . ASN A 1 15 ? -5.916  -8.276  -6.588  1.00 0.00 ? 15 ASN A OD1  3  
ATOM 2449  N ND2  . ASN A 1 15 ? -6.977  -6.713  -7.736  1.00 0.00 ? 15 ASN A ND2  3  
ATOM 2450  H H    . ASN A 1 15 ? -5.698  -5.887  -4.374  1.00 0.00 ? 15 ASN A H    3  
ATOM 2451  H HA   . ASN A 1 15 ? -3.498  -7.407  -5.638  1.00 0.00 ? 15 ASN A HA   3  
ATOM 2452  H HB2  . ASN A 1 15 ? -5.203  -5.138  -6.757  1.00 0.00 ? 15 ASN A HB2  3  
ATOM 2453  H HB3  . ASN A 1 15 ? -4.130  -6.195  -7.672  1.00 0.00 ? 15 ASN A HB3  3  
ATOM 2454  H HD21 . ASN A 1 15 ? -6.993  -5.769  -8.122  1.00 0.00 ? 15 ASN A HD21 3  
ATOM 2455  H HD22 . ASN A 1 15 ? -7.775  -7.317  -7.859  1.00 0.00 ? 15 ASN A HD22 3  
ATOM 2456  N N    . SER A 1 16 ? -1.787  -5.404  -6.043  1.00 0.00 ? 16 SER A N    3  
ATOM 2457  C CA   . SER A 1 16 ? -0.797  -4.320  -5.979  1.00 0.00 ? 16 SER A CA   3  
ATOM 2458  C C    . SER A 1 16 ? -1.397  -2.976  -6.407  1.00 0.00 ? 16 SER A C    3  
ATOM 2459  O O    . SER A 1 16 ? -1.020  -1.917  -5.912  1.00 0.00 ? 16 SER A O    3  
ATOM 2460  C CB   . SER A 1 16 ? 0.400   -4.652  -6.864  1.00 0.00 ? 16 SER A CB   3  
ATOM 2461  O OG   . SER A 1 16 ? 0.981   -5.901  -6.529  1.00 0.00 ? 16 SER A OG   3  
ATOM 2462  H H    . SER A 1 16 ? -1.569  -6.218  -6.608  1.00 0.00 ? 16 SER A H    3  
ATOM 2463  H HA   . SER A 1 16 ? -0.451  -4.212  -4.956  1.00 0.00 ? 16 SER A HA   3  
ATOM 2464  H HB2  . SER A 1 16 ? 0.105   -4.657  -7.913  1.00 0.00 ? 16 SER A HB2  3  
ATOM 2465  H HB3  . SER A 1 16 ? 1.136   -3.863  -6.732  1.00 0.00 ? 16 SER A HB3  3  
ATOM 2466  H HG   . SER A 1 16 ? 1.887   -5.849  -6.884  1.00 0.00 ? 16 SER A HG   3  
ATOM 2467  N N    . GLU A 1 17 ? -2.375  -3.038  -7.303  1.00 0.00 ? 17 GLU A N    3  
ATOM 2468  C CA   . GLU A 1 17 ? -3.174  -1.924  -7.770  1.00 0.00 ? 17 GLU A CA   3  
ATOM 2469  C C    . GLU A 1 17 ? -3.906  -1.293  -6.583  1.00 0.00 ? 17 GLU A C    3  
ATOM 2470  O O    . GLU A 1 17 ? -3.752  -0.113  -6.318  1.00 0.00 ? 17 GLU A O    3  
ATOM 2471  C CB   . GLU A 1 17 ? -4.156  -2.463  -8.814  1.00 0.00 ? 17 GLU A CB   3  
ATOM 2472  C CG   . GLU A 1 17 ? -3.478  -3.195  -9.986  1.00 0.00 ? 17 GLU A CG   3  
ATOM 2473  C CD   . GLU A 1 17 ? -3.072  -2.240  -11.107 1.00 0.00 ? 17 GLU A CD   3  
ATOM 2474  O OE1  . GLU A 1 17 ? -2.228  -1.342  -10.881 1.00 0.00 ? 17 GLU A OE1  3  
ATOM 2475  O OE2  . GLU A 1 17 ? -3.654  -2.385  -12.207 1.00 0.00 ? 17 GLU A OE2  3  
ATOM 2476  H H    . GLU A 1 17 ? -2.593  -3.942  -7.690  1.00 0.00 ? 17 GLU A H    3  
ATOM 2477  H HA   . GLU A 1 17 ? -2.532  -1.176  -8.233  1.00 0.00 ? 17 GLU A HA   3  
ATOM 2478  H HB2  . GLU A 1 17 ? -4.801  -3.180  -8.314  1.00 0.00 ? 17 GLU A HB2  3  
ATOM 2479  H HB3  . GLU A 1 17 ? -4.795  -1.658  -9.178  1.00 0.00 ? 17 GLU A HB3  3  
ATOM 2480  H HG2  . GLU A 1 17 ? -2.609  -3.765  -9.641  1.00 0.00 ? 17 GLU A HG2  3  
ATOM 2481  H HG3  . GLU A 1 17 ? -4.203  -3.909  -10.383 1.00 0.00 ? 17 GLU A HG3  3  
ATOM 2482  N N    . ILE A 1 18 ? -4.660  -2.098  -5.838  1.00 0.00 ? 18 ILE A N    3  
ATOM 2483  C CA   . ILE A 1 18 ? -5.473  -1.693  -4.695  1.00 0.00 ? 18 ILE A CA   3  
ATOM 2484  C C    . ILE A 1 18 ? -4.593  -1.067  -3.616  1.00 0.00 ? 18 ILE A C    3  
ATOM 2485  O O    . ILE A 1 18 ? -5.025  -0.139  -2.934  1.00 0.00 ? 18 ILE A O    3  
ATOM 2486  C CB   . ILE A 1 18 ? -6.204  -2.951  -4.178  1.00 0.00 ? 18 ILE A CB   3  
ATOM 2487  C CG1  . ILE A 1 18 ? -7.251  -3.422  -5.214  1.00 0.00 ? 18 ILE A CG1  3  
ATOM 2488  C CG2  . ILE A 1 18 ? -6.821  -2.767  -2.785  1.00 0.00 ? 18 ILE A CG2  3  
ATOM 2489  C CD1  . ILE A 1 18 ? -8.631  -2.808  -4.976  1.00 0.00 ? 18 ILE A CD1  3  
ATOM 2490  H H    . ILE A 1 18 ? -4.635  -3.074  -6.068  1.00 0.00 ? 18 ILE A H    3  
ATOM 2491  H HA   . ILE A 1 18 ? -6.199  -0.944  -5.020  1.00 0.00 ? 18 ILE A HA   3  
ATOM 2492  H HB   . ILE A 1 18 ? -5.467  -3.746  -4.066  1.00 0.00 ? 18 ILE A HB   3  
ATOM 2493  H HG12 . ILE A 1 18 ? -6.943  -3.176  -6.232  1.00 0.00 ? 18 ILE A HG12 3  
ATOM 2494  H HG13 . ILE A 1 18 ? -7.332  -4.504  -5.161  1.00 0.00 ? 18 ILE A HG13 3  
ATOM 2495  H HG21 . ILE A 1 18 ? -7.481  -1.906  -2.776  1.00 0.00 ? 18 ILE A HG21 3  
ATOM 2496  H HG22 . ILE A 1 18 ? -7.381  -3.654  -2.502  1.00 0.00 ? 18 ILE A HG22 3  
ATOM 2497  H HG23 . ILE A 1 18 ? -6.043  -2.602  -2.051  1.00 0.00 ? 18 ILE A HG23 3  
ATOM 2498  H HD11 . ILE A 1 18 ? -9.059  -3.229  -4.065  1.00 0.00 ? 18 ILE A HD11 3  
ATOM 2499  H HD12 . ILE A 1 18 ? -8.540  -1.731  -4.854  1.00 0.00 ? 18 ILE A HD12 3  
ATOM 2500  H HD13 . ILE A 1 18 ? -9.281  -3.021  -5.817  1.00 0.00 ? 18 ILE A HD13 3  
ATOM 2501  N N    . LEU A 1 19 ? -3.379  -1.590  -3.438  1.00 0.00 ? 19 LEU A N    3  
ATOM 2502  C CA   . LEU A 1 19 ? -2.427  -1.015  -2.507  1.00 0.00 ? 19 LEU A CA   3  
ATOM 2503  C C    . LEU A 1 19 ? -2.085  0.409   -2.934  1.00 0.00 ? 19 LEU A C    3  
ATOM 2504  O O    . LEU A 1 19 ? -2.144  1.323   -2.115  1.00 0.00 ? 19 LEU A O    3  
ATOM 2505  C CB   . LEU A 1 19 ? -1.204  -1.932  -2.403  1.00 0.00 ? 19 LEU A CB   3  
ATOM 2506  C CG   . LEU A 1 19 ? -0.057  -1.342  -1.577  1.00 0.00 ? 19 LEU A CG   3  
ATOM 2507  C CD1  . LEU A 1 19 ? -0.541  -1.084  -0.147  1.00 0.00 ? 19 LEU A CD1  3  
ATOM 2508  C CD2  . LEU A 1 19 ? 1.100   -2.344  -1.568  1.00 0.00 ? 19 LEU A CD2  3  
ATOM 2509  H H    . LEU A 1 19 ? -3.090  -2.352  -4.039  1.00 0.00 ? 19 LEU A H    3  
ATOM 2510  H HA   . LEU A 1 19 ? -2.898  -0.955  -1.529  1.00 0.00 ? 19 LEU A HA   3  
ATOM 2511  H HB2  . LEU A 1 19 ? -1.524  -2.855  -1.937  1.00 0.00 ? 19 LEU A HB2  3  
ATOM 2512  H HB3  . LEU A 1 19 ? -0.834  -2.186  -3.391  1.00 0.00 ? 19 LEU A HB3  3  
ATOM 2513  H HG   . LEU A 1 19 ? 0.299   -0.416  -2.029  1.00 0.00 ? 19 LEU A HG   3  
ATOM 2514  H HD11 . LEU A 1 19 ? 0.296   -0.820  0.494   1.00 0.00 ? 19 LEU A HD11 3  
ATOM 2515  H HD12 . LEU A 1 19 ? -1.236  -0.242  -0.155  1.00 0.00 ? 19 LEU A HD12 3  
ATOM 2516  H HD13 . LEU A 1 19 ? -1.048  -1.978  0.229   1.00 0.00 ? 19 LEU A HD13 3  
ATOM 2517  H HD21 . LEU A 1 19 ? 0.828   -3.232  -1.003  1.00 0.00 ? 19 LEU A HD21 3  
ATOM 2518  H HD22 . LEU A 1 19 ? 1.345   -2.638  -2.589  1.00 0.00 ? 19 LEU A HD22 3  
ATOM 2519  H HD23 . LEU A 1 19 ? 1.980   -1.875  -1.140  1.00 0.00 ? 19 LEU A HD23 3  
ATOM 2520  N N    . GLU A 1 20 ? -1.750  0.591   -4.207  1.00 0.00 ? 20 GLU A N    3  
ATOM 2521  C CA   . GLU A 1 20 ? -1.434  1.886   -4.779  1.00 0.00 ? 20 GLU A CA   3  
ATOM 2522  C C    . GLU A 1 20 ? -2.609  2.856   -4.641  1.00 0.00 ? 20 GLU A C    3  
ATOM 2523  O O    . GLU A 1 20 ? -2.388  4.012   -4.282  1.00 0.00 ? 20 GLU A O    3  
ATOM 2524  C CB   . GLU A 1 20 ? -1.036  1.700   -6.249  1.00 0.00 ? 20 GLU A CB   3  
ATOM 2525  C CG   . GLU A 1 20 ? 0.459   1.437   -6.414  1.00 0.00 ? 20 GLU A CG   3  
ATOM 2526  C CD   . GLU A 1 20 ? 1.170   2.759   -6.662  1.00 0.00 ? 20 GLU A CD   3  
ATOM 2527  O OE1  . GLU A 1 20 ? 1.208   3.157   -7.849  1.00 0.00 ? 20 GLU A OE1  3  
ATOM 2528  O OE2  . GLU A 1 20 ? 1.583   3.430   -5.683  1.00 0.00 ? 20 GLU A OE2  3  
ATOM 2529  H H    . GLU A 1 20 ? -1.736  -0.211  -4.827  1.00 0.00 ? 20 GLU A H    3  
ATOM 2530  H HA   . GLU A 1 20 ? -0.591  2.301   -4.224  1.00 0.00 ? 20 GLU A HA   3  
ATOM 2531  H HB2  . GLU A 1 20 ? -1.569  0.866   -6.688  1.00 0.00 ? 20 GLU A HB2  3  
ATOM 2532  H HB3  . GLU A 1 20 ? -1.318  2.583   -6.820  1.00 0.00 ? 20 GLU A HB3  3  
ATOM 2533  H HG2  . GLU A 1 20 ? 0.854   0.933   -5.533  1.00 0.00 ? 20 GLU A HG2  3  
ATOM 2534  H HG3  . GLU A 1 20 ? 0.614   0.784   -7.276  1.00 0.00 ? 20 GLU A HG3  3  
ATOM 2535  N N    . GLU A 1 21 ? -3.842  2.406   -4.880  1.00 0.00 ? 21 GLU A N    3  
ATOM 2536  C CA   . GLU A 1 21 ? -5.055  3.172   -4.669  1.00 0.00 ? 21 GLU A CA   3  
ATOM 2537  C C    . GLU A 1 21 ? -5.147  3.690   -3.241  1.00 0.00 ? 21 GLU A C    3  
ATOM 2538  O O    . GLU A 1 21 ? -5.301  4.890   -3.026  1.00 0.00 ? 21 GLU A O    3  
ATOM 2539  C CB   . GLU A 1 21 ? -6.263  2.323   -4.951  1.00 0.00 ? 21 GLU A CB   3  
ATOM 2540  C CG   . GLU A 1 21 ? -6.520  1.726   -6.316  1.00 0.00 ? 21 GLU A CG   3  
ATOM 2541  C CD   . GLU A 1 21 ? -6.833  2.780   -7.375  1.00 0.00 ? 21 GLU A CD   3  
ATOM 2542  O OE1  . GLU A 1 21 ? -5.940  3.568   -7.763  1.00 0.00 ? 21 GLU A OE1  3  
ATOM 2543  O OE2  . GLU A 1 21 ? -7.976  2.788   -7.892  1.00 0.00 ? 21 GLU A OE2  3  
ATOM 2544  H H    . GLU A 1 21 ? -3.973  1.456   -5.213  1.00 0.00 ? 21 GLU A H    3  
ATOM 2545  H HA   . GLU A 1 21 ? -5.162  4.012   -5.330  1.00 0.00 ? 21 GLU A HA   3  
ATOM 2546  H HB2  . GLU A 1 21 ? -6.307  1.515   -4.235  1.00 0.00 ? 21 GLU A HB2  3  
ATOM 2547  H HB3  . GLU A 1 21 ? -7.059  3.010   -4.762  1.00 0.00 ? 21 GLU A HB3  3  
ATOM 2548  H HG2  . GLU A 1 21 ? -5.690  1.112   -6.627  1.00 0.00 ? 21 GLU A HG2  3  
ATOM 2549  H HG3  . GLU A 1 21 ? -7.374  1.072   -6.159  1.00 0.00 ? 21 GLU A HG3  3  
ATOM 2550  N N    . ALA A 1 22 ? -5.078  2.774   -2.280  1.00 0.00 ? 22 ALA A N    3  
ATOM 2551  C CA   . ALA A 1 22 ? -5.225  3.040   -0.851  1.00 0.00 ? 22 ALA A CA   3  
ATOM 2552  C C    . ALA A 1 22 ? -4.098  3.910   -0.304  1.00 0.00 ? 22 ALA A C    3  
ATOM 2553  O O    . ALA A 1 22 ? -4.236  4.480   0.779   1.00 0.00 ? 22 ALA A O    3  
ATOM 2554  C CB   . ALA A 1 22 ? -5.221  1.706   -0.113  1.00 0.00 ? 22 ALA A CB   3  
ATOM 2555  H H    . ALA A 1 22 ? -4.984  1.820   -2.628  1.00 0.00 ? 22 ALA A H    3  
ATOM 2556  H HA   . ALA A 1 22 ? -6.172  3.567   -0.663  1.00 0.00 ? 22 ALA A HA   3  
ATOM 2557  H HB1  . ALA A 1 22 ? -5.830  0.995   -0.666  1.00 0.00 ? 22 ALA A HB1  3  
ATOM 2558  H HB2  . ALA A 1 22 ? -4.202  1.319   -0.064  1.00 0.00 ? 22 ALA A HB2  3  
ATOM 2559  H HB3  . ALA A 1 22 ? -5.625  1.852   0.889   1.00 0.00 ? 22 ALA A HB3  3  
ATOM 2560  N N    . ILE A 1 23 ? -2.996  4.027   -1.036  1.00 0.00 ? 23 ILE A N    3  
ATOM 2561  C CA   . ILE A 1 23 ? -1.957  5.005   -0.752  1.00 0.00 ? 23 ILE A CA   3  
ATOM 2562  C C    . ILE A 1 23 ? -2.440  6.349   -1.294  1.00 0.00 ? 23 ILE A C    3  
ATOM 2563  O O    . ILE A 1 23 ? -2.511  7.325   -0.548  1.00 0.00 ? 23 ILE A O    3  
ATOM 2564  C CB   . ILE A 1 23 ? -0.638  4.495   -1.360  1.00 0.00 ? 23 ILE A CB   3  
ATOM 2565  C CG1  . ILE A 1 23 ? -0.082  3.377   -0.459  1.00 0.00 ? 23 ILE A CG1  3  
ATOM 2566  C CG2  . ILE A 1 23 ? 0.431   5.584   -1.522  1.00 0.00 ? 23 ILE A CG2  3  
ATOM 2567  C CD1  . ILE A 1 23 ? 0.804   2.404   -1.234  1.00 0.00 ? 23 ILE A CD1  3  
ATOM 2568  H H    . ILE A 1 23 ? -2.957  3.491   -1.904  1.00 0.00 ? 23 ILE A H    3  
ATOM 2569  H HA   . ILE A 1 23 ? -1.829  5.098   0.326   1.00 0.00 ? 23 ILE A HA   3  
ATOM 2570  H HB   . ILE A 1 23 ? -0.865  4.076   -2.340  1.00 0.00 ? 23 ILE A HB   3  
ATOM 2571  H HG12 . ILE A 1 23 ? 0.492   3.819   0.357   1.00 0.00 ? 23 ILE A HG12 3  
ATOM 2572  H HG13 . ILE A 1 23 ? -0.906  2.803   -0.029  1.00 0.00 ? 23 ILE A HG13 3  
ATOM 2573  H HG21 . ILE A 1 23 ? 0.577   6.117   -0.583  1.00 0.00 ? 23 ILE A HG21 3  
ATOM 2574  H HG22 . ILE A 1 23 ? 1.374   5.136   -1.826  1.00 0.00 ? 23 ILE A HG22 3  
ATOM 2575  H HG23 . ILE A 1 23 ? 0.131   6.290   -2.295  1.00 0.00 ? 23 ILE A HG23 3  
ATOM 2576  H HD11 . ILE A 1 23 ? 1.803   2.822   -1.346  1.00 0.00 ? 23 ILE A HD11 3  
ATOM 2577  H HD12 . ILE A 1 23 ? 0.850   1.470   -0.679  1.00 0.00 ? 23 ILE A HD12 3  
ATOM 2578  H HD13 . ILE A 1 23 ? 0.386   2.195   -2.218  1.00 0.00 ? 23 ILE A HD13 3  
ATOM 2579  N N    . SER A 1 24 ? -2.834  6.382   -2.566  1.00 0.00 ? 24 SER A N    3  
ATOM 2580  C CA   . SER A 1 24 ? -3.266  7.555   -3.308  1.00 0.00 ? 24 SER A CA   3  
ATOM 2581  C C    . SER A 1 24 ? -4.350  8.351   -2.563  1.00 0.00 ? 24 SER A C    3  
ATOM 2582  O O    . SER A 1 24 ? -4.235  9.575   -2.480  1.00 0.00 ? 24 SER A O    3  
ATOM 2583  C CB   . SER A 1 24 ? -3.770  7.046   -4.671  1.00 0.00 ? 24 SER A CB   3  
ATOM 2584  O OG   . SER A 1 24 ? -3.607  7.945   -5.743  1.00 0.00 ? 24 SER A OG   3  
ATOM 2585  H H    . SER A 1 24 ? -2.836  5.510   -3.088  1.00 0.00 ? 24 SER A H    3  
ATOM 2586  H HA   . SER A 1 24 ? -2.384  8.194   -3.422  1.00 0.00 ? 24 SER A HA   3  
ATOM 2587  H HB2  . SER A 1 24 ? -3.226  6.144   -4.948  1.00 0.00 ? 24 SER A HB2  3  
ATOM 2588  H HB3  . SER A 1 24 ? -4.831  6.801   -4.591  1.00 0.00 ? 24 SER A HB3  3  
ATOM 2589  H HG   . SER A 1 24 ? -4.134  7.531   -6.464  1.00 0.00 ? 24 SER A HG   3  
ATOM 2590  N N    . VAL A 1 25 ? -5.371  7.698   -1.991  1.00 0.00 ? 25 VAL A N    3  
ATOM 2591  C CA   . VAL A 1 25 ? -6.398  8.343   -1.163  1.00 0.00 ? 25 VAL A CA   3  
ATOM 2592  C C    . VAL A 1 25 ? -5.741  9.138   -0.033  1.00 0.00 ? 25 VAL A C    3  
ATOM 2593  O O    . VAL A 1 25 ? -5.925  10.346  0.055   1.00 0.00 ? 25 VAL A O    3  
ATOM 2594  C CB   . VAL A 1 25 ? -7.437  7.320   -0.622  1.00 0.00 ? 25 VAL A CB   3  
ATOM 2595  C CG1  . VAL A 1 25 ? -8.716  7.316   -1.452  1.00 0.00 ? 25 VAL A CG1  3  
ATOM 2596  C CG2  . VAL A 1 25 ? -6.916  5.919   -0.454  1.00 0.00 ? 25 VAL A CG2  3  
ATOM 2597  H H    . VAL A 1 25 ? -5.429  6.693   -2.132  1.00 0.00 ? 25 VAL A H    3  
ATOM 2598  H HA   . VAL A 1 25 ? -6.929  9.068   -1.785  1.00 0.00 ? 25 VAL A HA   3  
ATOM 2599  H HB   . VAL A 1 25 ? -7.723  7.532   0.393   1.00 0.00 ? 25 VAL A HB   3  
ATOM 2600  H HG11 . VAL A 1 25 ? -8.484  7.098   -2.493  1.00 0.00 ? 25 VAL A HG11 3  
ATOM 2601  H HG12 . VAL A 1 25 ? -9.414  6.576   -1.064  1.00 0.00 ? 25 VAL A HG12 3  
ATOM 2602  H HG13 . VAL A 1 25 ? -9.200  8.284   -1.390  1.00 0.00 ? 25 VAL A HG13 3  
ATOM 2603  H HG21 . VAL A 1 25 ? -7.534  5.393   0.267   1.00 0.00 ? 25 VAL A HG21 3  
ATOM 2604  H HG22 . VAL A 1 25 ? -6.956  5.411   -1.407  1.00 0.00 ? 25 VAL A HG22 3  
ATOM 2605  H HG23 . VAL A 1 25 ? -5.907  5.962   -0.070  1.00 0.00 ? 25 VAL A HG23 3  
ATOM 2606  N N    . VAL A 1 26 ? -4.993  8.475   0.839   1.00 0.00 ? 26 VAL A N    3  
ATOM 2607  C CA   . VAL A 1 26 ? -4.328  9.038   2.009   1.00 0.00 ? 26 VAL A CA   3  
ATOM 2608  C C    . VAL A 1 26 ? -3.393  10.167  1.576   1.00 0.00 ? 26 VAL A C    3  
ATOM 2609  O O    . VAL A 1 26 ? -3.456  11.250  2.151   1.00 0.00 ? 26 VAL A O    3  
ATOM 2610  C CB   . VAL A 1 26 ? -3.590  7.917   2.774   1.00 0.00 ? 26 VAL A CB   3  
ATOM 2611  C CG1  . VAL A 1 26 ? -2.956  8.433   4.070   1.00 0.00 ? 26 VAL A CG1  3  
ATOM 2612  C CG2  . VAL A 1 26 ? -4.535  6.766   3.145   1.00 0.00 ? 26 VAL A CG2  3  
ATOM 2613  H H    . VAL A 1 26 ? -4.847  7.501   0.661   1.00 0.00 ? 26 VAL A H    3  
ATOM 2614  H HA   . VAL A 1 26 ? -5.085  9.462   2.667   1.00 0.00 ? 26 VAL A HA   3  
ATOM 2615  H HB   . VAL A 1 26 ? -2.800  7.512   2.146   1.00 0.00 ? 26 VAL A HB   3  
ATOM 2616  H HG11 . VAL A 1 26 ? -3.721  8.840   4.728   1.00 0.00 ? 26 VAL A HG11 3  
ATOM 2617  H HG12 . VAL A 1 26 ? -2.435  7.623   4.575   1.00 0.00 ? 26 VAL A HG12 3  
ATOM 2618  H HG13 . VAL A 1 26 ? -2.231  9.215   3.848   1.00 0.00 ? 26 VAL A HG13 3  
ATOM 2619  H HG21 . VAL A 1 26 ? -5.018  6.361   2.260   1.00 0.00 ? 26 VAL A HG21 3  
ATOM 2620  H HG22 . VAL A 1 26 ? -3.970  5.953   3.606   1.00 0.00 ? 26 VAL A HG22 3  
ATOM 2621  H HG23 . VAL A 1 26 ? -5.301  7.134   3.824   1.00 0.00 ? 26 VAL A HG23 3  
ATOM 2622  N N    . MET A 1 27 ? -2.593  9.952   0.528   1.00 0.00 ? 27 MET A N    3  
ATOM 2623  C CA   . MET A 1 27 ? -1.692  10.956  -0.026  1.00 0.00 ? 27 MET A CA   3  
ATOM 2624  C C    . MET A 1 27 ? -2.446  12.192  -0.524  1.00 0.00 ? 27 MET A C    3  
ATOM 2625  O O    . MET A 1 27 ? -1.973  13.322  -0.396  1.00 0.00 ? 27 MET A O    3  
ATOM 2626  C CB   . MET A 1 27 ? -0.882  10.342  -1.171  1.00 0.00 ? 27 MET A CB   3  
ATOM 2627  C CG   . MET A 1 27 ? 0.163   9.377   -0.623  1.00 0.00 ? 27 MET A CG   3  
ATOM 2628  S SD   . MET A 1 27 ? 1.456   8.953   -1.807  1.00 0.00 ? 27 MET A SD   3  
ATOM 2629  C CE   . MET A 1 27 ? 2.808   9.115   -0.631  1.00 0.00 ? 27 MET A CE   3  
ATOM 2630  H H    . MET A 1 27 ? -2.597  9.035   0.089   1.00 0.00 ? 27 MET A H    3  
ATOM 2631  H HA   . MET A 1 27 ? -1.003  11.260  0.764   1.00 0.00 ? 27 MET A HA   3  
ATOM 2632  H HB2  . MET A 1 27 ? -1.532  9.842   -1.885  1.00 0.00 ? 27 MET A HB2  3  
ATOM 2633  H HB3  . MET A 1 27 ? -0.355  11.146  -1.687  1.00 0.00 ? 27 MET A HB3  3  
ATOM 2634  H HG2  . MET A 1 27 ? 0.620   9.880   0.218   1.00 0.00 ? 27 MET A HG2  3  
ATOM 2635  H HG3  . MET A 1 27 ? -0.277  8.471   -0.217  1.00 0.00 ? 27 MET A HG3  3  
ATOM 2636  H HE1  . MET A 1 27 ? 2.764   8.289   0.081   1.00 0.00 ? 27 MET A HE1  3  
ATOM 2637  H HE2  . MET A 1 27 ? 3.755   9.120   -1.153  1.00 0.00 ? 27 MET A HE2  3  
ATOM 2638  H HE3  . MET A 1 27 ? 2.715   10.068  -0.111  1.00 0.00 ? 27 MET A HE3  3  
ATOM 2639  N N    . SER A 1 28 ? -3.643  11.987  -1.075  1.00 0.00 ? 28 SER A N    3  
ATOM 2640  C CA   . SER A 1 28 ? -4.536  13.050  -1.520  1.00 0.00 ? 28 SER A CA   3  
ATOM 2641  C C    . SER A 1 28 ? -5.415  13.568  -0.370  1.00 0.00 ? 28 SER A C    3  
ATOM 2642  O O    . SER A 1 28 ? -6.333  14.356  -0.604  1.00 0.00 ? 28 SER A O    3  
ATOM 2643  C CB   . SER A 1 28 ? -5.356  12.563  -2.721  1.00 0.00 ? 28 SER A CB   3  
ATOM 2644  O OG   . SER A 1 28 ? -4.508  11.949  -3.683  1.00 0.00 ? 28 SER A OG   3  
ATOM 2645  H H    . SER A 1 28 ? -3.982  11.035  -1.162  1.00 0.00 ? 28 SER A H    3  
ATOM 2646  H HA   . SER A 1 28 ? -3.928  13.887  -1.857  1.00 0.00 ? 28 SER A HA   3  
ATOM 2647  H HB2  . SER A 1 28 ? -6.093  11.833  -2.389  1.00 0.00 ? 28 SER A HB2  3  
ATOM 2648  H HB3  . SER A 1 28 ? -5.870  13.411  -3.175  1.00 0.00 ? 28 SER A HB3  3  
ATOM 2649  H HG   . SER A 1 28 ? -4.308  11.067  -3.304  1.00 0.00 ? 28 SER A HG   3  
ATOM 2650  N N    . GLY A 1 29 ? -5.164  13.133  0.870   1.00 0.00 ? 29 GLY A N    3  
ATOM 2651  C CA   . GLY A 1 29 ? -5.809  13.640  2.068   1.00 0.00 ? 29 GLY A CA   3  
ATOM 2652  C C    . GLY A 1 29 ? -7.176  13.019  2.333   1.00 0.00 ? 29 GLY A C    3  
ATOM 2653  O O    . GLY A 1 29 ? -7.849  13.417  3.291   1.00 0.00 ? 29 GLY A O    3  
ATOM 2654  H H    . GLY A 1 29 ? -4.448  12.426  1.024   1.00 0.00 ? 29 GLY A H    3  
ATOM 2655  H HA2  . GLY A 1 29 ? -5.156  13.448  2.920   1.00 0.00 ? 29 GLY A HA2  3  
ATOM 2656  H HA3  . GLY A 1 29 ? -5.946  14.715  1.956   1.00 0.00 ? 29 GLY A HA3  3  
ATOM 2657  N N    . LYS A 1 30 ? -7.607  12.052  1.513   1.00 0.00 ? 30 LYS A N    3  
ATOM 2658  C CA   . LYS A 1 30 ? -8.997  11.603  1.451   1.00 0.00 ? 30 LYS A CA   3  
ATOM 2659  C C    . LYS A 1 30 ? -9.445  10.974  2.754   1.00 0.00 ? 30 LYS A C    3  
ATOM 2660  O O    . LYS A 1 30 ? -10.631 11.025  3.096   1.00 0.00 ? 30 LYS A O    3  
ATOM 2661  C CB   . LYS A 1 30 ? -9.152  10.588  0.308   1.00 0.00 ? 30 LYS A CB   3  
ATOM 2662  C CG   . LYS A 1 30 ? -8.994  11.195  -1.096  1.00 0.00 ? 30 LYS A CG   3  
ATOM 2663  C CD   . LYS A 1 30 ? -9.994  12.333  -1.330  1.00 0.00 ? 30 LYS A CD   3  
ATOM 2664  C CE   . LYS A 1 30 ? -10.375 12.503  -2.807  1.00 0.00 ? 30 LYS A CE   3  
ATOM 2665  N NZ   . LYS A 1 30 ? -11.237 11.405  -3.297  1.00 0.00 ? 30 LYS A NZ   3  
ATOM 2666  H H    . LYS A 1 30 ? -6.927  11.607  0.891   1.00 0.00 ? 30 LYS A H    3  
ATOM 2667  H HA   . LYS A 1 30 ? -9.630  12.471  1.275   1.00 0.00 ? 30 LYS A HA   3  
ATOM 2668  H HB2  . LYS A 1 30 ? -8.416  9.803   0.444   1.00 0.00 ? 30 LYS A HB2  3  
ATOM 2669  H HB3  . LYS A 1 30 ? -10.120 10.093  0.377   1.00 0.00 ? 30 LYS A HB3  3  
ATOM 2670  H HG2  . LYS A 1 30 ? -7.982  11.577  -1.226  1.00 0.00 ? 30 LYS A HG2  3  
ATOM 2671  H HG3  . LYS A 1 30 ? -9.157  10.409  -1.829  1.00 0.00 ? 30 LYS A HG3  3  
ATOM 2672  H HD2  . LYS A 1 30 ? -10.898 12.152  -0.747  1.00 0.00 ? 30 LYS A HD2  3  
ATOM 2673  H HD3  . LYS A 1 30 ? -9.535  13.258  -0.972  1.00 0.00 ? 30 LYS A HD3  3  
ATOM 2674  H HE2  . LYS A 1 30 ? -10.916 13.447  -2.909  1.00 0.00 ? 30 LYS A HE2  3  
ATOM 2675  H HE3  . LYS A 1 30 ? -9.466  12.549  -3.410  1.00 0.00 ? 30 LYS A HE3  3  
ATOM 2676  H HZ1  . LYS A 1 30 ? -11.684 11.647  -4.179  1.00 0.00 ? 30 LYS A HZ1  3  
ATOM 2677  H HZ2  . LYS A 1 30 ? -10.694 10.563  -3.459  1.00 0.00 ? 30 LYS A HZ2  3  
ATOM 2678  H HZ3  . LYS A 1 30 ? -11.992 11.206  -2.650  1.00 0.00 ? 30 LYS A HZ3  3  
ATOM 2679  N N    . MET A 1 31 ? -8.508  10.358  3.462   1.00 0.00 ? 31 MET A N    3  
ATOM 2680  C CA   . MET A 1 31 ? -8.702  9.672   4.717   1.00 0.00 ? 31 MET A CA   3  
ATOM 2681  C C    . MET A 1 31 ? -7.345  9.474   5.377   1.00 0.00 ? 31 MET A C    3  
ATOM 2682  O O    . MET A 1 31 ? -6.315  9.825   4.798   1.00 0.00 ? 31 MET A O    3  
ATOM 2683  C CB   . MET A 1 31 ? -9.385  8.331   4.465   1.00 0.00 ? 31 MET A CB   3  
ATOM 2684  C CG   . MET A 1 31 ? -8.644  7.393   3.527   1.00 0.00 ? 31 MET A CG   3  
ATOM 2685  S SD   . MET A 1 31 ? -9.703  6.059   2.919   1.00 0.00 ? 31 MET A SD   3  
ATOM 2686  C CE   . MET A 1 31 ? -10.783 6.941   1.792   1.00 0.00 ? 31 MET A CE   3  
ATOM 2687  H H    . MET A 1 31 ? -7.551  10.375  3.131   1.00 0.00 ? 31 MET A H    3  
ATOM 2688  H HA   . MET A 1 31 ? -9.326  10.268  5.382   1.00 0.00 ? 31 MET A HA   3  
ATOM 2689  H HB2  . MET A 1 31 ? -9.490  7.861   5.424   1.00 0.00 ? 31 MET A HB2  3  
ATOM 2690  H HB3  . MET A 1 31 ? -10.381 8.457   4.074   1.00 0.00 ? 31 MET A HB3  3  
ATOM 2691  H HG2  . MET A 1 31 ? -8.240  7.942   2.675   1.00 0.00 ? 31 MET A HG2  3  
ATOM 2692  H HG3  . MET A 1 31 ? -7.820  6.967   4.093   1.00 0.00 ? 31 MET A HG3  3  
ATOM 2693  H HE1  . MET A 1 31 ? -10.185 7.548   1.117   1.00 0.00 ? 31 MET A HE1  3  
ATOM 2694  H HE2  . MET A 1 31 ? -11.352 6.207   1.227   1.00 0.00 ? 31 MET A HE2  3  
ATOM 2695  H HE3  . MET A 1 31 ? -11.462 7.565   2.365   1.00 0.00 ? 31 MET A HE3  3  
ATOM 2696  N N    . SER A 1 32 ? -7.355  8.918   6.581   1.00 0.00 ? 32 SER A N    3  
ATOM 2697  C CA   . SER A 1 32 ? -6.164  8.543   7.327   1.00 0.00 ? 32 SER A CA   3  
ATOM 2698  C C    . SER A 1 32 ? -5.714  7.154   6.876   1.00 0.00 ? 32 SER A C    3  
ATOM 2699  O O    . SER A 1 32 ? -6.484  6.442   6.219   1.00 0.00 ? 32 SER A O    3  
ATOM 2700  C CB   . SER A 1 32 ? -6.512  8.550   8.818   1.00 0.00 ? 32 SER A CB   3  
ATOM 2701  O OG   . SER A 1 32 ? -7.155  9.766   9.168   1.00 0.00 ? 32 SER A OG   3  
ATOM 2702  H H    . SER A 1 32 ? -8.247  8.627   6.971   1.00 0.00 ? 32 SER A H    3  
ATOM 2703  H HA   . SER A 1 32 ? -5.364  9.261   7.138   1.00 0.00 ? 32 SER A HA   3  
ATOM 2704  H HB2  . SER A 1 32 ? -7.188  7.722   9.037   1.00 0.00 ? 32 SER A HB2  3  
ATOM 2705  H HB3  . SER A 1 32 ? -5.599  8.441   9.401   1.00 0.00 ? 32 SER A HB3  3  
ATOM 2706  H HG   . SER A 1 32 ? -7.546  9.634   10.073  1.00 0.00 ? 32 SER A HG   3  
ATOM 2707  N N    . VAL A 1 33 ? -4.509  6.744   7.276   1.00 0.00 ? 33 VAL A N    3  
ATOM 2708  C CA   . VAL A 1 33 ? -3.998  5.404   7.024   1.00 0.00 ? 33 VAL A CA   3  
ATOM 2709  C C    . VAL A 1 33 ? -4.994  4.392   7.594   1.00 0.00 ? 33 VAL A C    3  
ATOM 2710  O O    . VAL A 1 33 ? -5.475  3.554   6.839   1.00 0.00 ? 33 VAL A O    3  
ATOM 2711  C CB   . VAL A 1 33 ? -2.572  5.235   7.594   1.00 0.00 ? 33 VAL A CB   3  
ATOM 2712  C CG1  . VAL A 1 33 ? -2.032  3.820   7.375   1.00 0.00 ? 33 VAL A CG1  3  
ATOM 2713  C CG2  . VAL A 1 33 ? -1.564  6.203   6.953   1.00 0.00 ? 33 VAL A CG2  3  
ATOM 2714  H H    . VAL A 1 33 ? -3.944  7.359   7.858   1.00 0.00 ? 33 VAL A H    3  
ATOM 2715  H HA   . VAL A 1 33 ? -3.956  5.257   5.944   1.00 0.00 ? 33 VAL A HA   3  
ATOM 2716  H HB   . VAL A 1 33 ? -2.599  5.421   8.661   1.00 0.00 ? 33 VAL A HB   3  
ATOM 2717  H HG11 . VAL A 1 33 ? -2.685  3.072   7.824   1.00 0.00 ? 33 VAL A HG11 3  
ATOM 2718  H HG12 . VAL A 1 33 ? -1.913  3.628   6.317   1.00 0.00 ? 33 VAL A HG12 3  
ATOM 2719  H HG13 . VAL A 1 33 ? -1.058  3.725   7.834   1.00 0.00 ? 33 VAL A HG13 3  
ATOM 2720  H HG21 . VAL A 1 33 ? -1.888  7.235   7.072   1.00 0.00 ? 33 VAL A HG21 3  
ATOM 2721  H HG22 . VAL A 1 33 ? -0.593  6.095   7.439   1.00 0.00 ? 33 VAL A HG22 3  
ATOM 2722  H HG23 . VAL A 1 33 ? -1.452  5.986   5.892   1.00 0.00 ? 33 VAL A HG23 3  
ATOM 2723  N N    . SER A 1 34 ? -5.366  4.485   8.879   1.00 0.00 ? 34 SER A N    3  
ATOM 2724  C CA   . SER A 1 34 ? -6.213  3.469   9.508   1.00 0.00 ? 34 SER A CA   3  
ATOM 2725  C C    . SER A 1 34 ? -7.564  3.325   8.802   1.00 0.00 ? 34 SER A C    3  
ATOM 2726  O O    . SER A 1 34 ? -8.133  2.232   8.734   1.00 0.00 ? 34 SER A O    3  
ATOM 2727  C CB   . SER A 1 34 ? -6.403  3.784   11.000  1.00 0.00 ? 34 SER A CB   3  
ATOM 2728  O OG   . SER A 1 34 ? -6.308  2.627   11.803  1.00 0.00 ? 34 SER A OG   3  
ATOM 2729  H H    . SER A 1 34 ? -4.989  5.219   9.468   1.00 0.00 ? 34 SER A H    3  
ATOM 2730  H HA   . SER A 1 34 ? -5.690  2.525   9.411   1.00 0.00 ? 34 SER A HA   3  
ATOM 2731  H HB2  . SER A 1 34 ? -5.621  4.458   11.333  1.00 0.00 ? 34 SER A HB2  3  
ATOM 2732  H HB3  . SER A 1 34 ? -7.363  4.274   11.163  1.00 0.00 ? 34 SER A HB3  3  
ATOM 2733  H HG   . SER A 1 34 ? -6.659  2.852   12.682  1.00 0.00 ? 34 SER A HG   3  
ATOM 2734  N N    . LYS A 1 35 ? -8.079  4.431   8.263   1.00 0.00 ? 35 LYS A N    3  
ATOM 2735  C CA   . LYS A 1 35 ? -9.314  4.442   7.504   1.00 0.00 ? 35 LYS A CA   3  
ATOM 2736  C C    . LYS A 1 35 ? -9.107  3.653   6.214   1.00 0.00 ? 35 LYS A C    3  
ATOM 2737  O O    . LYS A 1 35 ? -9.641  2.552   6.114   1.00 0.00 ? 35 LYS A O    3  
ATOM 2738  C CB   . LYS A 1 35 ? -9.768  5.892   7.321   1.00 0.00 ? 35 LYS A CB   3  
ATOM 2739  C CG   . LYS A 1 35 ? -11.098 5.994   6.550   1.00 0.00 ? 35 LYS A CG   3  
ATOM 2740  C CD   . LYS A 1 35 ? -12.177 6.849   7.230   1.00 0.00 ? 35 LYS A CD   3  
ATOM 2741  C CE   . LYS A 1 35 ? -12.472 8.152   6.484   1.00 0.00 ? 35 LYS A CE   3  
ATOM 2742  N NZ   . LYS A 1 35 ? -13.688 8.792   7.019   1.00 0.00 ? 35 LYS A NZ   3  
ATOM 2743  H H    . LYS A 1 35 ? -7.513  5.267   8.292   1.00 0.00 ? 35 LYS A H    3  
ATOM 2744  H HA   . LYS A 1 35 ? -10.077 3.915   8.082   1.00 0.00 ? 35 LYS A HA   3  
ATOM 2745  H HB2  . LYS A 1 35 ? -9.871  6.336   8.311   1.00 0.00 ? 35 LYS A HB2  3  
ATOM 2746  H HB3  . LYS A 1 35 ? -8.985  6.439   6.811   1.00 0.00 ? 35 LYS A HB3  3  
ATOM 2747  H HG2  . LYS A 1 35 ? -10.936 6.335   5.535   1.00 0.00 ? 35 LYS A HG2  3  
ATOM 2748  H HG3  . LYS A 1 35 ? -11.496 5.002   6.422   1.00 0.00 ? 35 LYS A HG3  3  
ATOM 2749  H HD2  . LYS A 1 35 ? -13.086 6.249   7.271   1.00 0.00 ? 35 LYS A HD2  3  
ATOM 2750  H HD3  . LYS A 1 35 ? -11.889 7.094   8.251   1.00 0.00 ? 35 LYS A HD3  3  
ATOM 2751  H HE2  . LYS A 1 35 ? -11.622 8.829   6.592   1.00 0.00 ? 35 LYS A HE2  3  
ATOM 2752  H HE3  . LYS A 1 35 ? -12.625 7.933   5.425   1.00 0.00 ? 35 LYS A HE3  3  
ATOM 2753  H HZ1  . LYS A 1 35 ? -13.845 9.701   6.602   1.00 0.00 ? 35 LYS A HZ1  3  
ATOM 2754  H HZ2  . LYS A 1 35 ? -14.483 8.187   6.844   1.00 0.00 ? 35 LYS A HZ2  3  
ATOM 2755  H HZ3  . LYS A 1 35 ? -13.619 8.929   8.025   1.00 0.00 ? 35 LYS A HZ3  3  
ATOM 2756  N N    . ALA A 1 36 ? -8.342  4.161   5.241   1.00 0.00 ? 36 ALA A N    3  
ATOM 2757  C CA   . ALA A 1 36 ? -8.079  3.461   3.984   1.00 0.00 ? 36 ALA A CA   3  
ATOM 2758  C C    . ALA A 1 36 ? -7.645  2.011   4.165   1.00 0.00 ? 36 ALA A C    3  
ATOM 2759  O O    . ALA A 1 36 ? -8.134  1.168   3.423   1.00 0.00 ? 36 ALA A O    3  
ATOM 2760  C CB   . ALA A 1 36 ? -6.996  4.206   3.190   1.00 0.00 ? 36 ALA A CB   3  
ATOM 2761  H H    . ALA A 1 36 ? -8.030  5.125   5.281   1.00 0.00 ? 36 ALA A H    3  
ATOM 2762  H HA   . ALA A 1 36 ? -9.029  3.424   3.431   1.00 0.00 ? 36 ALA A HA   3  
ATOM 2763  H HB1  . ALA A 1 36 ? -6.845  3.726   2.223   1.00 0.00 ? 36 ALA A HB1  3  
ATOM 2764  H HB2  . ALA A 1 36 ? -7.264  5.243   3.026   1.00 0.00 ? 36 ALA A HB2  3  
ATOM 2765  H HB3  . ALA A 1 36 ? -6.062  4.193   3.746   1.00 0.00 ? 36 ALA A HB3  3  
ATOM 2766  N N    . GLN A 1 37 ? -6.808  1.684   5.150   1.00 0.00 ? 37 GLN A N    3  
ATOM 2767  C CA   . GLN A 1 37 ? -6.494  0.313   5.532   1.00 0.00 ? 37 GLN A CA   3  
ATOM 2768  C C    . GLN A 1 37 ? -7.781  -0.511  5.562   1.00 0.00 ? 37 GLN A C    3  
ATOM 2769  O O    . GLN A 1 37 ? -7.901  -1.521  4.864   1.00 0.00 ? 37 GLN A O    3  
ATOM 2770  C CB   . GLN A 1 37 ? -5.735  0.348   6.878   1.00 0.00 ? 37 GLN A CB   3  
ATOM 2771  C CG   . GLN A 1 37 ? -5.900  -0.891  7.785   1.00 0.00 ? 37 GLN A CG   3  
ATOM 2772  C CD   . GLN A 1 37 ? -6.461  -0.626  9.182   1.00 0.00 ? 37 GLN A CD   3  
ATOM 2773  O OE1  . GLN A 1 37 ? -6.011  0.248   9.916   1.00 0.00 ? 37 GLN A OE1  3  
ATOM 2774  N NE2  . GLN A 1 37 ? -7.426  -1.420  9.611   1.00 0.00 ? 37 GLN A NE2  3  
ATOM 2775  H H    . GLN A 1 37 ? -6.389  2.410   5.720   1.00 0.00 ? 37 GLN A H    3  
ATOM 2776  H HA   . GLN A 1 37 ? -5.840  -0.126  4.782   1.00 0.00 ? 37 GLN A HA   3  
ATOM 2777  H HB2  . GLN A 1 37 ? -4.676  0.502   6.637   1.00 0.00 ? 37 GLN A HB2  3  
ATOM 2778  H HB3  . GLN A 1 37 ? -6.072  1.208   7.449   1.00 0.00 ? 37 GLN A HB3  3  
ATOM 2779  H HG2  . GLN A 1 37 ? -6.539  -1.612  7.302   1.00 0.00 ? 37 GLN A HG2  3  
ATOM 2780  H HG3  . GLN A 1 37 ? -4.954  -1.392  7.889   1.00 0.00 ? 37 GLN A HG3  3  
ATOM 2781  H HE21 . GLN A 1 37 ? -7.670  -2.222  9.035   1.00 0.00 ? 37 GLN A HE21 3  
ATOM 2782  H HE22 . GLN A 1 37 ? -7.831  -1.282  10.523  1.00 0.00 ? 37 GLN A HE22 3  
ATOM 2783  N N    . SER A 1 38 ? -8.736  -0.082  6.381   1.00 0.00 ? 38 SER A N    3  
ATOM 2784  C CA   . SER A 1 38 ? -9.943  -0.833  6.623   1.00 0.00 ? 38 SER A CA   3  
ATOM 2785  C C    . SER A 1 38 ? -10.910 -0.742  5.422   1.00 0.00 ? 38 SER A C    3  
ATOM 2786  O O    . SER A 1 38 ? -11.782 -1.604  5.277   1.00 0.00 ? 38 SER A O    3  
ATOM 2787  C CB   . SER A 1 38 ? -10.572 -0.289  7.912   1.00 0.00 ? 38 SER A CB   3  
ATOM 2788  O OG   . SER A 1 38 ? -11.425 -1.255  8.502   1.00 0.00 ? 38 SER A OG   3  
ATOM 2789  H H    . SER A 1 38 ? -8.638  0.821   6.837   1.00 0.00 ? 38 SER A H    3  
ATOM 2790  H HA   . SER A 1 38 ? -9.622  -1.868  6.780   1.00 0.00 ? 38 SER A HA   3  
ATOM 2791  H HB2  . SER A 1 38 ? -9.788  -0.055  8.635   1.00 0.00 ? 38 SER A HB2  3  
ATOM 2792  H HB3  . SER A 1 38 ? -11.123 0.624   7.683   1.00 0.00 ? 38 SER A HB3  3  
ATOM 2793  H HG   . SER A 1 38 ? -12.067 -0.785  9.059   1.00 0.00 ? 38 SER A HG   3  
ATOM 2794  N N    . ILE A 1 39 ? -10.795 0.279   4.560   1.00 0.00 ? 39 ILE A N    3  
ATOM 2795  C CA   . ILE A 1 39 ? -11.610 0.415   3.347   1.00 0.00 ? 39 ILE A CA   3  
ATOM 2796  C C    . ILE A 1 39 ? -11.131 -0.566  2.271   1.00 0.00 ? 39 ILE A C    3  
ATOM 2797  O O    . ILE A 1 39 ? -11.929 -1.304  1.691   1.00 0.00 ? 39 ILE A O    3  
ATOM 2798  C CB   . ILE A 1 39 ? -11.692 1.882   2.857   1.00 0.00 ? 39 ILE A CB   3  
ATOM 2799  C CG1  . ILE A 1 39 ? -12.330 2.737   3.974   1.00 0.00 ? 39 ILE A CG1  3  
ATOM 2800  C CG2  . ILE A 1 39 ? -12.501 1.988   1.548   1.00 0.00 ? 39 ILE A CG2  3  
ATOM 2801  C CD1  . ILE A 1 39 ? -12.752 4.144   3.564   1.00 0.00 ? 39 ILE A CD1  3  
ATOM 2802  H H    . ILE A 1 39 ? -10.096 0.986   4.756   1.00 0.00 ? 39 ILE A H    3  
ATOM 2803  H HA   . ILE A 1 39 ? -12.621 0.148   3.598   1.00 0.00 ? 39 ILE A HA   3  
ATOM 2804  H HB   . ILE A 1 39 ? -10.694 2.263   2.663   1.00 0.00 ? 39 ILE A HB   3  
ATOM 2805  H HG12 . ILE A 1 39 ? -13.197 2.223   4.372   1.00 0.00 ? 39 ILE A HG12 3  
ATOM 2806  H HG13 . ILE A 1 39 ? -11.627 2.837   4.790   1.00 0.00 ? 39 ILE A HG13 3  
ATOM 2807  H HG21 . ILE A 1 39 ? -12.067 1.357   0.773   1.00 0.00 ? 39 ILE A HG21 3  
ATOM 2808  H HG22 . ILE A 1 39 ? -13.536 1.686   1.714   1.00 0.00 ? 39 ILE A HG22 3  
ATOM 2809  H HG23 . ILE A 1 39 ? -12.477 3.008   1.165   1.00 0.00 ? 39 ILE A HG23 3  
ATOM 2810  H HD11 . ILE A 1 39 ? -13.636 4.086   2.934   1.00 0.00 ? 39 ILE A HD11 3  
ATOM 2811  H HD12 . ILE A 1 39 ? -12.982 4.726   4.457   1.00 0.00 ? 39 ILE A HD12 3  
ATOM 2812  H HD13 . ILE A 1 39 ? -11.943 4.606   3.008   1.00 0.00 ? 39 ILE A HD13 3  
ATOM 2813  N N    . TYR A 1 40 ? -9.834  -0.548  1.986   1.00 0.00 ? 40 TYR A N    3  
ATOM 2814  C CA   . TYR A 1 40 ? -9.210  -1.184  0.835   1.00 0.00 ? 40 TYR A CA   3  
ATOM 2815  C C    . TYR A 1 40 ? -8.776  -2.621  1.128   1.00 0.00 ? 40 TYR A C    3  
ATOM 2816  O O    . TYR A 1 40 ? -8.561  -3.395  0.193   1.00 0.00 ? 40 TYR A O    3  
ATOM 2817  C CB   . TYR A 1 40 ? -8.011  -0.318  0.432   1.00 0.00 ? 40 TYR A CB   3  
ATOM 2818  C CG   . TYR A 1 40 ? -8.388  0.934   -0.347  1.00 0.00 ? 40 TYR A CG   3  
ATOM 2819  C CD1  . TYR A 1 40 ? -8.831  2.100   0.314   1.00 0.00 ? 40 TYR A CD1  3  
ATOM 2820  C CD2  . TYR A 1 40 ? -8.196  0.975   -1.736  1.00 0.00 ? 40 TYR A CD2  3  
ATOM 2821  C CE1  . TYR A 1 40 ? -9.093  3.291   -0.390  1.00 0.00 ? 40 TYR A CE1  3  
ATOM 2822  C CE2  . TYR A 1 40 ? -8.447  2.154   -2.442  1.00 0.00 ? 40 TYR A CE2  3  
ATOM 2823  C CZ   . TYR A 1 40 ? -8.896  3.313   -1.789  1.00 0.00 ? 40 TYR A CZ   3  
ATOM 2824  O OH   . TYR A 1 40 ? -9.087  4.439   -2.522  1.00 0.00 ? 40 TYR A OH   3  
ATOM 2825  H H    . TYR A 1 40 ? -9.232  0.044   2.544   1.00 0.00 ? 40 TYR A H    3  
ATOM 2826  H HA   . TYR A 1 40 ? -9.916  -1.207  0.004   1.00 0.00 ? 40 TYR A HA   3  
ATOM 2827  H HB2  . TYR A 1 40 ? -7.485  -0.004  1.329   1.00 0.00 ? 40 TYR A HB2  3  
ATOM 2828  H HB3  . TYR A 1 40 ? -7.285  -0.915  -0.129  1.00 0.00 ? 40 TYR A HB3  3  
ATOM 2829  H HD1  . TYR A 1 40 ? -8.925  2.102   1.381   1.00 0.00 ? 40 TYR A HD1  3  
ATOM 2830  H HD2  . TYR A 1 40 ? -7.798  0.133   -2.278  1.00 0.00 ? 40 TYR A HD2  3  
ATOM 2831  H HE1  . TYR A 1 40 ? -9.373  4.198   0.142   1.00 0.00 ? 40 TYR A HE1  3  
ATOM 2832  H HE2  . TYR A 1 40 ? -8.257  2.170   -3.494  1.00 0.00 ? 40 TYR A HE2  3  
ATOM 2833  H HH   . TYR A 1 40 ? -8.470  4.477   -3.264  1.00 0.00 ? 40 TYR A HH   3  
ATOM 2834  N N    . GLY A 1 41 ? -8.656  -2.983  2.408   1.00 0.00 ? 41 GLY A N    3  
ATOM 2835  C CA   . GLY A 1 41 ? -8.291  -4.326  2.834   1.00 0.00 ? 41 GLY A CA   3  
ATOM 2836  C C    . GLY A 1 41 ? -6.791  -4.462  3.050   1.00 0.00 ? 41 GLY A C    3  
ATOM 2837  O O    . GLY A 1 41 ? -6.253  -5.563  2.962   1.00 0.00 ? 41 GLY A O    3  
ATOM 2838  H H    . GLY A 1 41 ? -8.749  -2.269  3.121   1.00 0.00 ? 41 GLY A H    3  
ATOM 2839  H HA2  . GLY A 1 41 ? -8.806  -4.556  3.765   1.00 0.00 ? 41 GLY A HA2  3  
ATOM 2840  H HA3  . GLY A 1 41 ? -8.607  -5.048  2.083   1.00 0.00 ? 41 GLY A HA3  3  
ATOM 2841  N N    . ILE A 1 42 ? -6.097  -3.351  3.292   1.00 0.00 ? 42 ILE A N    3  
ATOM 2842  C CA   . ILE A 1 42 ? -4.649  -3.330  3.452   1.00 0.00 ? 42 ILE A CA   3  
ATOM 2843  C C    . ILE A 1 42 ? -4.338  -3.456  4.952   1.00 0.00 ? 42 ILE A C    3  
ATOM 2844  O O    . ILE A 1 42 ? -5.080  -2.887  5.750   1.00 0.00 ? 42 ILE A O    3  
ATOM 2845  C CB   . ILE A 1 42 ? -4.079  -2.013  2.874   1.00 0.00 ? 42 ILE A CB   3  
ATOM 2846  C CG1  . ILE A 1 42 ? -4.729  -1.501  1.579   1.00 0.00 ? 42 ILE A CG1  3  
ATOM 2847  C CG2  . ILE A 1 42 ? -2.561  -2.153  2.682   1.00 0.00 ? 42 ILE A CG2  3  
ATOM 2848  C CD1  . ILE A 1 42 ? -4.565  -2.375  0.346   1.00 0.00 ? 42 ILE A CD1  3  
ATOM 2849  H H    . ILE A 1 42 ? -6.607  -2.492  3.464   1.00 0.00 ? 42 ILE A H    3  
ATOM 2850  H HA   . ILE A 1 42 ? -4.216  -4.168  2.906   1.00 0.00 ? 42 ILE A HA   3  
ATOM 2851  H HB   . ILE A 1 42 ? -4.285  -1.212  3.577   1.00 0.00 ? 42 ILE A HB   3  
ATOM 2852  H HG12 . ILE A 1 42 ? -5.788  -1.344  1.753   1.00 0.00 ? 42 ILE A HG12 3  
ATOM 2853  H HG13 . ILE A 1 42 ? -4.316  -0.529  1.342   1.00 0.00 ? 42 ILE A HG13 3  
ATOM 2854  H HG21 . ILE A 1 42 ? -2.068  -2.261  3.643   1.00 0.00 ? 42 ILE A HG21 3  
ATOM 2855  H HG22 . ILE A 1 42 ? -2.348  -3.035  2.071   1.00 0.00 ? 42 ILE A HG22 3  
ATOM 2856  H HG23 . ILE A 1 42 ? -2.162  -1.264  2.197   1.00 0.00 ? 42 ILE A HG23 3  
ATOM 2857  H HD11 . ILE A 1 42 ? -4.904  -1.805  -0.513  1.00 0.00 ? 42 ILE A HD11 3  
ATOM 2858  H HD12 . ILE A 1 42 ? -3.526  -2.655  0.187   1.00 0.00 ? 42 ILE A HD12 3  
ATOM 2859  H HD13 . ILE A 1 42 ? -5.176  -3.263  0.456   1.00 0.00 ? 42 ILE A HD13 3  
ATOM 2860  N N    . PRO A 1 43 ? -3.261  -4.136  5.387   1.00 0.00 ? 43 PRO A N    3  
ATOM 2861  C CA   . PRO A 1 43 ? -2.744  -4.007  6.748   1.00 0.00 ? 43 PRO A CA   3  
ATOM 2862  C C    . PRO A 1 43 ? -2.335  -2.558  7.026   1.00 0.00 ? 43 PRO A C    3  
ATOM 2863  O O    . PRO A 1 43 ? -1.744  -1.910  6.158   1.00 0.00 ? 43 PRO A O    3  
ATOM 2864  C CB   . PRO A 1 43 ? -1.497  -4.900  6.807   1.00 0.00 ? 43 PRO A CB   3  
ATOM 2865  C CG   . PRO A 1 43 ? -1.647  -5.859  5.629   1.00 0.00 ? 43 PRO A CG   3  
ATOM 2866  C CD   . PRO A 1 43 ? -2.450  -5.056  4.613   1.00 0.00 ? 43 PRO A CD   3  
ATOM 2867  H HA   . PRO A 1 43 ? -3.501  -4.346  7.463   1.00 0.00 ? 43 PRO A HA   3  
ATOM 2868  H HB2  . PRO A 1 43 ? -0.601  -4.297  6.670   1.00 0.00 ? 43 PRO A HB2  3  
ATOM 2869  H HB3  . PRO A 1 43 ? -1.436  -5.435  7.750   1.00 0.00 ? 43 PRO A HB3  3  
ATOM 2870  H HG2  . PRO A 1 43 ? -0.684  -6.166  5.221   1.00 0.00 ? 43 PRO A HG2  3  
ATOM 2871  H HG3  . PRO A 1 43 ? -2.222  -6.726  5.945   1.00 0.00 ? 43 PRO A HG3  3  
ATOM 2872  H HD2  . PRO A 1 43 ? -1.770  -4.499  3.971   1.00 0.00 ? 43 PRO A HD2  3  
ATOM 2873  H HD3  . PRO A 1 43 ? -3.073  -5.722  4.019   1.00 0.00 ? 43 PRO A HD3  3  
ATOM 2874  N N    . HIS A 1 44 ? -2.551  -2.063  8.247   1.00 0.00 ? 44 HIS A N    3  
ATOM 2875  C CA   . HIS A 1 44 ? -2.127  -0.717  8.621   1.00 0.00 ? 44 HIS A CA   3  
ATOM 2876  C C    . HIS A 1 44 ? -0.608  -0.635  8.551   1.00 0.00 ? 44 HIS A C    3  
ATOM 2877  O O    . HIS A 1 44 ? -0.091  0.329   8.007   1.00 0.00 ? 44 HIS A O    3  
ATOM 2878  C CB   . HIS A 1 44 ? -2.619  -0.342  10.026  1.00 0.00 ? 44 HIS A CB   3  
ATOM 2879  C CG   . HIS A 1 44 ? -2.519  1.130   10.367  1.00 0.00 ? 44 HIS A CG   3  
ATOM 2880  N ND1  . HIS A 1 44 ? -3.558  1.924   10.796  1.00 0.00 ? 44 HIS A ND1  3  
ATOM 2881  C CD2  . HIS A 1 44 ? -1.382  1.897   10.396  1.00 0.00 ? 44 HIS A CD2  3  
ATOM 2882  C CE1  . HIS A 1 44 ? -3.049  3.130   11.097  1.00 0.00 ? 44 HIS A CE1  3  
ATOM 2883  N NE2  . HIS A 1 44 ? -1.725  3.166   10.881  1.00 0.00 ? 44 HIS A NE2  3  
ATOM 2884  H H    . HIS A 1 44 ? -3.027  -2.618  8.954   1.00 0.00 ? 44 HIS A H    3  
ATOM 2885  H HA   . HIS A 1 44 ? -2.550  -0.012  7.905   1.00 0.00 ? 44 HIS A HA   3  
ATOM 2886  H HB2  . HIS A 1 44 ? -3.661  -0.639  10.115  1.00 0.00 ? 44 HIS A HB2  3  
ATOM 2887  H HB3  . HIS A 1 44 ? -2.047  -0.906  10.764  1.00 0.00 ? 44 HIS A HB3  3  
ATOM 2888  H HD1  . HIS A 1 44 ? -4.545  1.671   10.869  1.00 0.00 ? 44 HIS A HD1  3  
ATOM 2889  H HD2  . HIS A 1 44 ? -0.384  1.570   10.143  1.00 0.00 ? 44 HIS A HD2  3  
ATOM 2890  H HE1  . HIS A 1 44 ? -3.621  3.957   11.491  1.00 0.00 ? 44 HIS A HE1  3  
ATOM 2891  N N    . SER A 1 45 ? 0.102   -1.631  9.084   1.00 0.00 ? 45 SER A N    3  
ATOM 2892  C CA   . SER A 1 45 ? 1.557   -1.668  9.118   1.00 0.00 ? 45 SER A CA   3  
ATOM 2893  C C    . SER A 1 45 ? 2.129   -1.504  7.706   1.00 0.00 ? 45 SER A C    3  
ATOM 2894  O O    . SER A 1 45 ? 2.989   -0.651  7.481   1.00 0.00 ? 45 SER A O    3  
ATOM 2895  C CB   . SER A 1 45 ? 2.001   -2.988  9.763   1.00 0.00 ? 45 SER A CB   3  
ATOM 2896  O OG   . SER A 1 45 ? 1.223   -3.277  10.919  1.00 0.00 ? 45 SER A OG   3  
ATOM 2897  H H    . SER A 1 45 ? -0.371  -2.379  9.565   1.00 0.00 ? 45 SER A H    3  
ATOM 2898  H HA   . SER A 1 45 ? 1.910   -0.838  9.734   1.00 0.00 ? 45 SER A HA   3  
ATOM 2899  H HB2  . SER A 1 45 ? 1.879   -3.806  9.051   1.00 0.00 ? 45 SER A HB2  3  
ATOM 2900  H HB3  . SER A 1 45 ? 3.054   -2.919  10.026  1.00 0.00 ? 45 SER A HB3  3  
ATOM 2901  H HG   . SER A 1 45 ? 1.839   -3.328  11.685  1.00 0.00 ? 45 SER A HG   3  
ATOM 2902  N N    . THR A 1 46 ? 1.617   -2.292  6.754   1.00 0.00 ? 46 THR A N    3  
ATOM 2903  C CA   . THR A 1 46 ? 2.023   -2.223  5.364   1.00 0.00 ? 46 THR A CA   3  
ATOM 2904  C C    . THR A 1 46 ? 1.657   -0.855  4.789   1.00 0.00 ? 46 THR A C    3  
ATOM 2905  O O    . THR A 1 46 ? 2.522   -0.192  4.227   1.00 0.00 ? 46 THR A O    3  
ATOM 2906  C CB   . THR A 1 46 ? 1.356   -3.374  4.596   1.00 0.00 ? 46 THR A CB   3  
ATOM 2907  O OG1  . THR A 1 46 ? 1.513   -4.594  5.297   1.00 0.00 ? 46 THR A OG1  3  
ATOM 2908  C CG2  . THR A 1 46 ? 1.901   -3.539  3.176   1.00 0.00 ? 46 THR A CG2  3  
ATOM 2909  H H    . THR A 1 46 ? 0.935   -3.003  6.980   1.00 0.00 ? 46 THR A H    3  
ATOM 2910  H HA   . THR A 1 46 ? 3.109   -2.330  5.327   1.00 0.00 ? 46 THR A HA   3  
ATOM 2911  H HB   . THR A 1 46 ? 0.286   -3.171  4.526   1.00 0.00 ? 46 THR A HB   3  
ATOM 2912  H HG1  . THR A 1 46 ? 2.408   -4.612  5.699   1.00 0.00 ? 46 THR A HG1  3  
ATOM 2913  H HG21 . THR A 1 46 ? 1.361   -4.351  2.691   1.00 0.00 ? 46 THR A HG21 3  
ATOM 2914  H HG22 . THR A 1 46 ? 1.744   -2.623  2.605   1.00 0.00 ? 46 THR A HG22 3  
ATOM 2915  H HG23 . THR A 1 46 ? 2.968   -3.766  3.204   1.00 0.00 ? 46 THR A HG23 3  
ATOM 2916  N N    . LEU A 1 47 ? 0.398   -0.423  4.925   1.00 0.00 ? 47 LEU A N    3  
ATOM 2917  C CA   . LEU A 1 47 ? -0.080  0.832   4.366   1.00 0.00 ? 47 LEU A CA   3  
ATOM 2918  C C    . LEU A 1 47 ? 0.762   2.000   4.876   1.00 0.00 ? 47 LEU A C    3  
ATOM 2919  O O    . LEU A 1 47 ? 1.174   2.811   4.060   1.00 0.00 ? 47 LEU A O    3  
ATOM 2920  C CB   . LEU A 1 47 ? -1.570  1.032   4.692   1.00 0.00 ? 47 LEU A CB   3  
ATOM 2921  C CG   . LEU A 1 47 ? -2.169  2.255   3.968   1.00 0.00 ? 47 LEU A CG   3  
ATOM 2922  C CD1  . LEU A 1 47 ? -2.270  2.058   2.463   1.00 0.00 ? 47 LEU A CD1  3  
ATOM 2923  C CD2  . LEU A 1 47 ? -3.608  2.478   4.424   1.00 0.00 ? 47 LEU A CD2  3  
ATOM 2924  H H    . LEU A 1 47 ? -0.286  -1.004  5.392   1.00 0.00 ? 47 LEU A H    3  
ATOM 2925  H HA   . LEU A 1 47 ? 0.048   0.771   3.282   1.00 0.00 ? 47 LEU A HA   3  
ATOM 2926  H HB2  . LEU A 1 47 ? -2.125  0.140   4.396   1.00 0.00 ? 47 LEU A HB2  3  
ATOM 2927  H HB3  . LEU A 1 47 ? -1.675  1.165   5.773   1.00 0.00 ? 47 LEU A HB3  3  
ATOM 2928  H HG   . LEU A 1 47 ? -1.584  3.157   4.169   1.00 0.00 ? 47 LEU A HG   3  
ATOM 2929  H HD11 . LEU A 1 47 ? -1.284  1.914   2.029   1.00 0.00 ? 47 LEU A HD11 3  
ATOM 2930  H HD12 . LEU A 1 47 ? -2.906  1.196   2.258   1.00 0.00 ? 47 LEU A HD12 3  
ATOM 2931  H HD13 . LEU A 1 47 ? -2.719  2.955   2.035   1.00 0.00 ? 47 LEU A HD13 3  
ATOM 2932  H HD21 . LEU A 1 47 ? -3.659  2.488   5.507   1.00 0.00 ? 47 LEU A HD21 3  
ATOM 2933  H HD22 . LEU A 1 47 ? -3.957  3.431   4.028   1.00 0.00 ? 47 LEU A HD22 3  
ATOM 2934  H HD23 . LEU A 1 47 ? -4.246  1.678   4.053   1.00 0.00 ? 47 LEU A HD23 3  
ATOM 2935  N N    . GLU A 1 48 ? 1.067   2.066   6.177   1.00 0.00 ? 48 GLU A N    3  
ATOM 2936  C CA   . GLU A 1 48 ? 1.956   3.059   6.767   1.00 0.00 ? 48 GLU A CA   3  
ATOM 2937  C C    . GLU A 1 48 ? 3.250   3.071   5.977   1.00 0.00 ? 48 GLU A C    3  
ATOM 2938  O O    . GLU A 1 48 ? 3.536   4.064   5.315   1.00 0.00 ? 48 GLU A O    3  
ATOM 2939  C CB   . GLU A 1 48 ? 2.258   2.785   8.256   1.00 0.00 ? 48 GLU A CB   3  
ATOM 2940  C CG   . GLU A 1 48 ? 1.495   3.732   9.179   1.00 0.00 ? 48 GLU A CG   3  
ATOM 2941  C CD   . GLU A 1 48 ? 2.054   3.745   10.595  1.00 0.00 ? 48 GLU A CD   3  
ATOM 2942  O OE1  . GLU A 1 48 ? 2.102   2.681   11.251  1.00 0.00 ? 48 GLU A OE1  3  
ATOM 2943  O OE2  . GLU A 1 48 ? 2.365   4.848   11.102  1.00 0.00 ? 48 GLU A OE2  3  
ATOM 2944  H H    . GLU A 1 48 ? 0.710   1.338   6.785   1.00 0.00 ? 48 GLU A H    3  
ATOM 2945  H HA   . GLU A 1 48 ? 1.485   4.036   6.651   1.00 0.00 ? 48 GLU A HA   3  
ATOM 2946  H HB2  . GLU A 1 48 ? 2.037   1.747   8.509   1.00 0.00 ? 48 GLU A HB2  3  
ATOM 2947  H HB3  . GLU A 1 48 ? 3.320   2.956   8.434   1.00 0.00 ? 48 GLU A HB3  3  
ATOM 2948  H HG2  . GLU A 1 48 ? 1.539   4.741   8.776   1.00 0.00 ? 48 GLU A HG2  3  
ATOM 2949  H HG3  . GLU A 1 48 ? 0.457   3.438   9.213   1.00 0.00 ? 48 GLU A HG3  3  
ATOM 2950  N N    . TYR A 1 49 ? 4.004   1.970   6.022   1.00 0.00 ? 49 TYR A N    3  
ATOM 2951  C CA   . TYR A 1 49 ? 5.284   1.830   5.346   1.00 0.00 ? 49 TYR A CA   3  
ATOM 2952  C C    . TYR A 1 49 ? 5.167   2.299   3.901   1.00 0.00 ? 49 TYR A C    3  
ATOM 2953  O O    . TYR A 1 49 ? 5.971   3.100   3.447   1.00 0.00 ? 49 TYR A O    3  
ATOM 2954  C CB   . TYR A 1 49 ? 5.723   0.359   5.430   1.00 0.00 ? 49 TYR A CB   3  
ATOM 2955  C CG   . TYR A 1 49 ? 6.855   -0.019  4.498   1.00 0.00 ? 49 TYR A CG   3  
ATOM 2956  C CD1  . TYR A 1 49 ? 6.547   -0.418  3.189   1.00 0.00 ? 49 TYR A CD1  3  
ATOM 2957  C CD2  . TYR A 1 49 ? 8.193   0.023   4.914   1.00 0.00 ? 49 TYR A CD2  3  
ATOM 2958  C CE1  . TYR A 1 49 ? 7.558   -0.750  2.275   1.00 0.00 ? 49 TYR A CE1  3  
ATOM 2959  C CE2  . TYR A 1 49 ? 9.216   -0.328  4.016   1.00 0.00 ? 49 TYR A CE2  3  
ATOM 2960  C CZ   . TYR A 1 49 ? 8.908   -0.693  2.687   1.00 0.00 ? 49 TYR A CZ   3  
ATOM 2961  O OH   . TYR A 1 49 ? 9.901   -0.932  1.789   1.00 0.00 ? 49 TYR A OH   3  
ATOM 2962  H H    . TYR A 1 49 ? 3.637   1.162   6.517   1.00 0.00 ? 49 TYR A H    3  
ATOM 2963  H HA   . TYR A 1 49 ? 6.032   2.462   5.831   1.00 0.00 ? 49 TYR A HA   3  
ATOM 2964  H HB2  . TYR A 1 49 ? 5.995   0.114   6.450   1.00 0.00 ? 49 TYR A HB2  3  
ATOM 2965  H HB3  . TYR A 1 49 ? 4.875   -0.280  5.190   1.00 0.00 ? 49 TYR A HB3  3  
ATOM 2966  H HD1  . TYR A 1 49 ? 5.515   -0.408  2.890   1.00 0.00 ? 49 TYR A HD1  3  
ATOM 2967  H HD2  . TYR A 1 49 ? 8.438   0.346   5.915   1.00 0.00 ? 49 TYR A HD2  3  
ATOM 2968  H HE1  . TYR A 1 49 ? 7.290   -0.972  1.250   1.00 0.00 ? 49 TYR A HE1  3  
ATOM 2969  H HE2  . TYR A 1 49 ? 10.241  -0.272  4.338   1.00 0.00 ? 49 TYR A HE2  3  
ATOM 2970  H HH   . TYR A 1 49 ? 9.816   -0.248  1.085   1.00 0.00 ? 49 TYR A HH   3  
ATOM 2971  N N    . LYS A 1 50 ? 4.163   1.821   3.173   1.00 0.00 ? 50 LYS A N    3  
ATOM 2972  C CA   . LYS A 1 50 ? 4.042   2.011   1.745   1.00 0.00 ? 50 LYS A CA   3  
ATOM 2973  C C    . LYS A 1 50 ? 3.725   3.465   1.390   1.00 0.00 ? 50 LYS A C    3  
ATOM 2974  O O    . LYS A 1 50 ? 4.297   3.974   0.424   1.00 0.00 ? 50 LYS A O    3  
ATOM 2975  C CB   . LYS A 1 50 ? 2.972   1.031   1.254   1.00 0.00 ? 50 LYS A CB   3  
ATOM 2976  C CG   . LYS A 1 50 ? 3.401   -0.441  1.182   1.00 0.00 ? 50 LYS A CG   3  
ATOM 2977  C CD   . LYS A 1 50 ? 4.573   -0.648  0.214   1.00 0.00 ? 50 LYS A CD   3  
ATOM 2978  C CE   . LYS A 1 50 ? 4.807   -2.108  -0.187  1.00 0.00 ? 50 LYS A CE   3  
ATOM 2979  N NZ   . LYS A 1 50 ? 5.755   -2.182  -1.317  1.00 0.00 ? 50 LYS A NZ   3  
ATOM 2980  H H    . LYS A 1 50 ? 3.479   1.226   3.630   1.00 0.00 ? 50 LYS A H    3  
ATOM 2981  H HA   . LYS A 1 50 ? 5.006   1.789   1.283   1.00 0.00 ? 50 LYS A HA   3  
ATOM 2982  H HB2  . LYS A 1 50 ? 2.114   1.067   1.935   1.00 0.00 ? 50 LYS A HB2  3  
ATOM 2983  H HB3  . LYS A 1 50 ? 2.702   1.335   0.248   1.00 0.00 ? 50 LYS A HB3  3  
ATOM 2984  H HG2  . LYS A 1 50 ? 3.658   -0.833  2.168   1.00 0.00 ? 50 LYS A HG2  3  
ATOM 2985  H HG3  . LYS A 1 50 ? 2.537   -0.993  0.835   1.00 0.00 ? 50 LYS A HG3  3  
ATOM 2986  H HD2  . LYS A 1 50 ? 4.408   -0.065  -0.683  1.00 0.00 ? 50 LYS A HD2  3  
ATOM 2987  H HD3  . LYS A 1 50 ? 5.471   -0.251  0.661   1.00 0.00 ? 50 LYS A HD3  3  
ATOM 2988  H HE2  . LYS A 1 50 ? 5.186   -2.683  0.658   1.00 0.00 ? 50 LYS A HE2  3  
ATOM 2989  H HE3  . LYS A 1 50 ? 3.863   -2.549  -0.504  1.00 0.00 ? 50 LYS A HE3  3  
ATOM 2990  H HZ1  . LYS A 1 50 ? 6.690   -1.893  -1.044  1.00 0.00 ? 50 LYS A HZ1  3  
ATOM 2991  H HZ2  . LYS A 1 50 ? 5.795   -3.110  -1.718  1.00 0.00 ? 50 LYS A HZ2  3  
ATOM 2992  H HZ3  . LYS A 1 50 ? 5.451   -1.542  -2.052  1.00 0.00 ? 50 LYS A HZ3  3  
ATOM 2993  N N    . VAL A 1 51 ? 2.881   4.149   2.167   1.00 0.00 ? 51 VAL A N    3  
ATOM 2994  C CA   . VAL A 1 51 ? 2.701   5.597   2.097   1.00 0.00 ? 51 VAL A CA   3  
ATOM 2995  C C    . VAL A 1 51 ? 4.046   6.277   2.396   1.00 0.00 ? 51 VAL A C    3  
ATOM 2996  O O    . VAL A 1 51 ? 4.500   7.124   1.632   1.00 0.00 ? 51 VAL A O    3  
ATOM 2997  C CB   . VAL A 1 51 ? 1.601   6.034   3.096   1.00 0.00 ? 51 VAL A CB   3  
ATOM 2998  C CG1  . VAL A 1 51 ? 1.406   7.550   3.151   1.00 0.00 ? 51 VAL A CG1  3  
ATOM 2999  C CG2  . VAL A 1 51 ? 0.210   5.463   2.798   1.00 0.00 ? 51 VAL A CG2  3  
ATOM 3000  H H    . VAL A 1 51 ? 2.413   3.661   2.926   1.00 0.00 ? 51 VAL A H    3  
ATOM 3001  H HA   . VAL A 1 51 ? 2.398   5.866   1.086   1.00 0.00 ? 51 VAL A HA   3  
ATOM 3002  H HB   . VAL A 1 51 ? 1.890   5.696   4.091   1.00 0.00 ? 51 VAL A HB   3  
ATOM 3003  H HG11 . VAL A 1 51 ? 0.593   7.781   3.841   1.00 0.00 ? 51 VAL A HG11 3  
ATOM 3004  H HG12 . VAL A 1 51 ? 2.313   8.021   3.518   1.00 0.00 ? 51 VAL A HG12 3  
ATOM 3005  H HG13 . VAL A 1 51 ? 1.159   7.939   2.161   1.00 0.00 ? 51 VAL A HG13 3  
ATOM 3006  H HG21 . VAL A 1 51 ? -0.384  5.560   3.709   1.00 0.00 ? 51 VAL A HG21 3  
ATOM 3007  H HG22 . VAL A 1 51 ? -0.260  6.004   1.976   1.00 0.00 ? 51 VAL A HG22 3  
ATOM 3008  H HG23 . VAL A 1 51 ? 0.268   4.410   2.543   1.00 0.00 ? 51 VAL A HG23 3  
ATOM 3009  N N    . LYS A 1 52 ? 4.681   5.925   3.515   1.00 0.00 ? 52 LYS A N    3  
ATOM 3010  C CA   . LYS A 1 52 ? 5.858   6.597   4.085   1.00 0.00 ? 52 LYS A CA   3  
ATOM 3011  C C    . LYS A 1 52 ? 7.089   6.471   3.207   1.00 0.00 ? 52 LYS A C    3  
ATOM 3012  O O    . LYS A 1 52 ? 7.925   7.368   3.209   1.00 0.00 ? 52 LYS A O    3  
ATOM 3013  C CB   . LYS A 1 52 ? 6.069   6.053   5.507   1.00 0.00 ? 52 LYS A CB   3  
ATOM 3014  C CG   . LYS A 1 52 ? 4.948   6.626   6.397   1.00 0.00 ? 52 LYS A CG   3  
ATOM 3015  C CD   . LYS A 1 52 ? 4.530   5.733   7.570   1.00 0.00 ? 52 LYS A CD   3  
ATOM 3016  C CE   . LYS A 1 52 ? 5.044   6.189   8.939   1.00 0.00 ? 52 LYS A CE   3  
ATOM 3017  N NZ   . LYS A 1 52 ? 4.383   7.425   9.406   1.00 0.00 ? 52 LYS A NZ   3  
ATOM 3018  H H    . LYS A 1 52 ? 4.265   5.188   4.081   1.00 0.00 ? 52 LYS A H    3  
ATOM 3019  H HA   . LYS A 1 52 ? 5.674   7.659   4.161   1.00 0.00 ? 52 LYS A HA   3  
ATOM 3020  H HB2  . LYS A 1 52 ? 6.035   4.964   5.480   1.00 0.00 ? 52 LYS A HB2  3  
ATOM 3021  H HB3  . LYS A 1 52 ? 7.038   6.342   5.910   1.00 0.00 ? 52 LYS A HB3  3  
ATOM 3022  H HG2  . LYS A 1 52 ? 5.236   7.615   6.748   1.00 0.00 ? 52 LYS A HG2  3  
ATOM 3023  H HG3  . LYS A 1 52 ? 4.059   6.750   5.782   1.00 0.00 ? 52 LYS A HG3  3  
ATOM 3024  H HD2  . LYS A 1 52 ? 3.435   5.673   7.568   1.00 0.00 ? 52 LYS A HD2  3  
ATOM 3025  H HD3  . LYS A 1 52 ? 4.903   4.727   7.397   1.00 0.00 ? 52 LYS A HD3  3  
ATOM 3026  H HE2  . LYS A 1 52 ? 4.834   5.394   9.660   1.00 0.00 ? 52 LYS A HE2  3  
ATOM 3027  H HE3  . LYS A 1 52 ? 6.127   6.336   8.900   1.00 0.00 ? 52 LYS A HE3  3  
ATOM 3028  H HZ1  . LYS A 1 52 ? 4.680   8.244   8.882   1.00 0.00 ? 52 LYS A HZ1  3  
ATOM 3029  H HZ2  . LYS A 1 52 ? 3.371   7.337   9.352   1.00 0.00 ? 52 LYS A HZ2  3  
ATOM 3030  H HZ3  . LYS A 1 52 ? 4.585   7.570   10.392  1.00 0.00 ? 52 LYS A HZ3  3  
ATOM 3031  N N    . GLU A 1 53 ? 7.140   5.400   2.435   1.00 0.00 ? 53 GLU A N    3  
ATOM 3032  C CA   . GLU A 1 53 ? 8.040   5.114   1.347   1.00 0.00 ? 53 GLU A CA   3  
ATOM 3033  C C    . GLU A 1 53 ? 7.797   6.126   0.242   1.00 0.00 ? 53 GLU A C    3  
ATOM 3034  O O    . GLU A 1 53 ? 8.664   6.950   -0.065  1.00 0.00 ? 53 GLU A O    3  
ATOM 3035  C CB   . GLU A 1 53 ? 7.765   3.686   0.871   1.00 0.00 ? 53 GLU A CB   3  
ATOM 3036  C CG   . GLU A 1 53 ? 8.537   2.625   1.658   1.00 0.00 ? 53 GLU A CG   3  
ATOM 3037  C CD   . GLU A 1 53 ? 9.685   2.026   0.846   1.00 0.00 ? 53 GLU A CD   3  
ATOM 3038  O OE1  . GLU A 1 53 ? 9.442   1.020   0.140   1.00 0.00 ? 53 GLU A OE1  3  
ATOM 3039  O OE2  . GLU A 1 53 ? 10.842  2.484   0.944   1.00 0.00 ? 53 GLU A OE2  3  
ATOM 3040  H H    . GLU A 1 53 ? 6.392   4.738   2.574   1.00 0.00 ? 53 GLU A H    3  
ATOM 3041  H HA   . GLU A 1 53 ? 9.067   5.177   1.672   1.00 0.00 ? 53 GLU A HA   3  
ATOM 3042  H HB2  . GLU A 1 53 ? 6.705   3.477   0.960   1.00 0.00 ? 53 GLU A HB2  3  
ATOM 3043  H HB3  . GLU A 1 53 ? 7.997   3.611   -0.178  1.00 0.00 ? 53 GLU A HB3  3  
ATOM 3044  H HG2  . GLU A 1 53 ? 8.925   3.051   2.579   1.00 0.00 ? 53 GLU A HG2  3  
ATOM 3045  H HG3  . GLU A 1 53 ? 7.837   1.833   1.925   1.00 0.00 ? 53 GLU A HG3  3  
ATOM 3046  N N    . ARG A 1 54 ? 6.606   6.068   -0.364  1.00 0.00 ? 54 ARG A N    3  
ATOM 3047  C CA   . ARG A 1 54 ? 6.193   6.854   -1.486  1.00 0.00 ? 54 ARG A CA   3  
ATOM 3048  C C    . ARG A 1 54 ? 6.291   8.354   -1.210  1.00 0.00 ? 54 ARG A C    3  
ATOM 3049  O O    . ARG A 1 54 ? 6.570   9.118   -2.132  1.00 0.00 ? 54 ARG A O    3  
ATOM 3050  C CB   . ARG A 1 54 ? 4.788   6.363   -1.837  1.00 0.00 ? 54 ARG A CB   3  
ATOM 3051  C CG   . ARG A 1 54 ? 4.407   7.064   -3.119  1.00 0.00 ? 54 ARG A CG   3  
ATOM 3052  C CD   . ARG A 1 54 ? 3.509   6.250   -4.021  1.00 0.00 ? 54 ARG A CD   3  
ATOM 3053  N NE   . ARG A 1 54 ? 2.868   7.151   -4.987  1.00 0.00 ? 54 ARG A NE   3  
ATOM 3054  C CZ   . ARG A 1 54 ? 2.637   6.940   -6.284  1.00 0.00 ? 54 ARG A CZ   3  
ATOM 3055  N NH1  . ARG A 1 54 ? 2.696   5.728   -6.820  1.00 0.00 ? 54 ARG A NH1  3  
ATOM 3056  N NH2  . ARG A 1 54 ? 2.362   7.986   -7.051  1.00 0.00 ? 54 ARG A NH2  3  
ATOM 3057  H H    . ARG A 1 54 ? 5.872   5.427   -0.108  1.00 0.00 ? 54 ARG A H    3  
ATOM 3058  H HA   . ARG A 1 54 ? 6.827   6.610   -2.335  1.00 0.00 ? 54 ARG A HA   3  
ATOM 3059  H HB2  . ARG A 1 54 ? 4.823   5.286   -2.014  1.00 0.00 ? 54 ARG A HB2  3  
ATOM 3060  H HB3  . ARG A 1 54 ? 4.068   6.587   -1.048  1.00 0.00 ? 54 ARG A HB3  3  
ATOM 3061  H HG2  . ARG A 1 54 ? 3.960   8.016   -2.882  1.00 0.00 ? 54 ARG A HG2  3  
ATOM 3062  H HG3  . ARG A 1 54 ? 5.324   7.234   -3.660  1.00 0.00 ? 54 ARG A HG3  3  
ATOM 3063  H HD2  . ARG A 1 54 ? 4.180   5.538   -4.497  1.00 0.00 ? 54 ARG A HD2  3  
ATOM 3064  H HD3  . ARG A 1 54 ? 2.762   5.732   -3.431  1.00 0.00 ? 54 ARG A HD3  3  
ATOM 3065  H HE   . ARG A 1 54 ? 2.751   8.109   -4.654  1.00 0.00 ? 54 ARG A HE   3  
ATOM 3066  H HH11 . ARG A 1 54 ? 2.583   4.902   -6.225  1.00 0.00 ? 54 ARG A HH11 3  
ATOM 3067  H HH12 . ARG A 1 54 ? 2.469   5.583   -7.801  1.00 0.00 ? 54 ARG A HH12 3  
ATOM 3068  H HH21 . ARG A 1 54 ? 2.244   8.916   -6.648  1.00 0.00 ? 54 ARG A HH21 3  
ATOM 3069  H HH22 . ARG A 1 54 ? 2.227   7.918   -8.058  1.00 0.00 ? 54 ARG A HH22 3  
ATOM 3070  N N    . LEU A 1 55 ? 6.138   8.774   0.048   1.00 0.00 ? 55 LEU A N    3  
ATOM 3071  C CA   . LEU A 1 55 ? 6.358   10.138  0.521   1.00 0.00 ? 55 LEU A CA   3  
ATOM 3072  C C    . LEU A 1 55 ? 7.794   10.626  0.274   1.00 0.00 ? 55 LEU A C    3  
ATOM 3073  O O    . LEU A 1 55 ? 8.052   11.816  0.456   1.00 0.00 ? 55 LEU A O    3  
ATOM 3074  C CB   . LEU A 1 55 ? 5.982   10.241  2.014   1.00 0.00 ? 55 LEU A CB   3  
ATOM 3075  C CG   . LEU A 1 55 ? 4.470   10.419  2.281   1.00 0.00 ? 55 LEU A CG   3  
ATOM 3076  C CD1  . LEU A 1 55 ? 4.171   10.160  3.760   1.00 0.00 ? 55 LEU A CD1  3  
ATOM 3077  C CD2  . LEU A 1 55 ? 3.994   11.827  1.911   1.00 0.00 ? 55 LEU A CD2  3  
ATOM 3078  H H    . LEU A 1 55 ? 5.866   8.078   0.735   1.00 0.00 ? 55 LEU A H    3  
ATOM 3079  H HA   . LEU A 1 55 ? 5.707   10.799  -0.050  1.00 0.00 ? 55 LEU A HA   3  
ATOM 3080  H HB2  . LEU A 1 55 ? 6.342   9.349   2.522   1.00 0.00 ? 55 LEU A HB2  3  
ATOM 3081  H HB3  . LEU A 1 55 ? 6.512   11.081  2.465   1.00 0.00 ? 55 LEU A HB3  3  
ATOM 3082  H HG   . LEU A 1 55 ? 3.886   9.701   1.705   1.00 0.00 ? 55 LEU A HG   3  
ATOM 3083  H HD11 . LEU A 1 55 ? 4.817   10.767  4.393   1.00 0.00 ? 55 LEU A HD11 3  
ATOM 3084  H HD12 . LEU A 1 55 ? 3.129   10.398  3.976   1.00 0.00 ? 55 LEU A HD12 3  
ATOM 3085  H HD13 . LEU A 1 55 ? 4.323   9.105   3.969   1.00 0.00 ? 55 LEU A HD13 3  
ATOM 3086  H HD21 . LEU A 1 55 ? 2.937   11.931  2.154   1.00 0.00 ? 55 LEU A HD21 3  
ATOM 3087  H HD22 . LEU A 1 55 ? 4.553   12.583  2.460   1.00 0.00 ? 55 LEU A HD22 3  
ATOM 3088  H HD23 . LEU A 1 55 ? 4.101   12.004  0.842   1.00 0.00 ? 55 LEU A HD23 3  
ATOM 3089  N N    . GLY A 1 56 ? 8.716   9.779   -0.190  1.00 0.00 ? 56 GLY A N    3  
ATOM 3090  C CA   . GLY A 1 56 ? 9.977   10.188  -0.793  1.00 0.00 ? 56 GLY A CA   3  
ATOM 3091  C C    . GLY A 1 56 ? 11.215  9.666   -0.079  1.00 0.00 ? 56 GLY A C    3  
ATOM 3092  O O    . GLY A 1 56 ? 12.309  10.141  -0.394  1.00 0.00 ? 56 GLY A O    3  
ATOM 3093  H H    . GLY A 1 56 ? 8.483   8.794   -0.245  1.00 0.00 ? 56 GLY A H    3  
ATOM 3094  H HA2  . GLY A 1 56 ? 9.995   9.836   -1.826  1.00 0.00 ? 56 GLY A HA2  3  
ATOM 3095  H HA3  . GLY A 1 56 ? 10.043  11.275  -0.805  1.00 0.00 ? 56 GLY A HA3  3  
ATOM 3096  N N    . THR A 1 57 ? 11.090  8.695   0.830   1.00 0.00 ? 57 THR A N    3  
ATOM 3097  C CA   . THR A 1 57 ? 12.263  8.099   1.494   1.00 0.00 ? 57 THR A CA   3  
ATOM 3098  C C    . THR A 1 57 ? 13.030  7.130   0.577   1.00 0.00 ? 57 THR A C    3  
ATOM 3099  O O    . THR A 1 57 ? 14.118  6.647   0.912   1.00 0.00 ? 57 THR A O    3  
ATOM 3100  C CB   . THR A 1 57 ? 11.818  7.389   2.776   1.00 0.00 ? 57 THR A CB   3  
ATOM 3101  O OG1  . THR A 1 57 ? 10.693  6.585   2.560   1.00 0.00 ? 57 THR A OG1  3  
ATOM 3102  C CG2  . THR A 1 57 ? 11.459  8.392   3.879   1.00 0.00 ? 57 THR A CG2  3  
ATOM 3103  H H    . THR A 1 57 ? 10.192  8.218   0.945   1.00 0.00 ? 57 THR A H    3  
ATOM 3104  H HA   . THR A 1 57 ? 12.960  8.893   1.763   1.00 0.00 ? 57 THR A HA   3  
ATOM 3105  H HB   . THR A 1 57 ? 12.619  6.733   3.097   1.00 0.00 ? 57 THR A HB   3  
ATOM 3106  H HG1  . THR A 1 57 ? 10.997  5.652   2.596   1.00 0.00 ? 57 THR A HG1  3  
ATOM 3107  H HG21 . THR A 1 57 ? 12.304  9.053   4.074   1.00 0.00 ? 57 THR A HG21 3  
ATOM 3108  H HG22 . THR A 1 57 ? 10.600  8.992   3.569   1.00 0.00 ? 57 THR A HG22 3  
ATOM 3109  H HG23 . THR A 1 57 ? 11.199  7.854   4.791   1.00 0.00 ? 57 THR A HG23 3  
ATOM 3110  N N    . LEU A 1 58 ? 12.420  6.829   -0.567  1.00 0.00 ? 58 LEU A N    3  
ATOM 3111  C CA   . LEU A 1 58 ? 12.914  6.039   -1.671  1.00 0.00 ? 58 LEU A CA   3  
ATOM 3112  C C    . LEU A 1 58 ? 13.974  6.864   -2.389  1.00 0.00 ? 58 LEU A C    3  
ATOM 3113  O O    . LEU A 1 58 ? 13.634  7.881   -2.999  1.00 0.00 ? 58 LEU A O    3  
ATOM 3114  C CB   . LEU A 1 58 ? 11.735  5.761   -2.615  1.00 0.00 ? 58 LEU A CB   3  
ATOM 3115  C CG   . LEU A 1 58 ? 10.602  4.950   -1.959  1.00 0.00 ? 58 LEU A CG   3  
ATOM 3116  C CD1  . LEU A 1 58 ? 9.290   5.274   -2.674  1.00 0.00 ? 58 LEU A CD1  3  
ATOM 3117  C CD2  . LEU A 1 58 ? 10.866  3.454   -2.088  1.00 0.00 ? 58 LEU A CD2  3  
ATOM 3118  H H    . LEU A 1 58 ? 11.515  7.251   -0.693  1.00 0.00 ? 58 LEU A H    3  
ATOM 3119  H HA   . LEU A 1 58 ? 13.330  5.102   -1.300  1.00 0.00 ? 58 LEU A HA   3  
ATOM 3120  H HB2  . LEU A 1 58 ? 11.335  6.720   -2.952  1.00 0.00 ? 58 LEU A HB2  3  
ATOM 3121  H HB3  . LEU A 1 58 ? 12.105  5.237   -3.495  1.00 0.00 ? 58 LEU A HB3  3  
ATOM 3122  H HG   . LEU A 1 58 ? 10.512  5.206   -0.895  1.00 0.00 ? 58 LEU A HG   3  
ATOM 3123  H HD11 . LEU A 1 58 ? 9.363   5.033   -3.733  1.00 0.00 ? 58 LEU A HD11 3  
ATOM 3124  H HD12 . LEU A 1 58 ? 8.482   4.691   -2.234  1.00 0.00 ? 58 LEU A HD12 3  
ATOM 3125  H HD13 . LEU A 1 58 ? 9.061   6.334   -2.562  1.00 0.00 ? 58 LEU A HD13 3  
ATOM 3126  H HD21 . LEU A 1 58 ? 9.990   2.896   -1.759  1.00 0.00 ? 58 LEU A HD21 3  
ATOM 3127  H HD22 . LEU A 1 58 ? 11.082  3.186   -3.120  1.00 0.00 ? 58 LEU A HD22 3  
ATOM 3128  H HD23 . LEU A 1 58 ? 11.700  3.191   -1.439  1.00 0.00 ? 58 LEU A HD23 3  
ATOM 3129  N N    . LYS A 1 59 ? 15.237  6.437   -2.328  1.00 0.00 ? 59 LYS A N    3  
ATOM 3130  C CA   . LYS A 1 59 ? 16.414  7.223   -2.708  1.00 0.00 ? 59 LYS A CA   3  
ATOM 3131  C C    . LYS A 1 59 ? 16.538  8.469   -1.814  1.00 0.00 ? 59 LYS A C    3  
ATOM 3132  O O    . LYS A 1 59 ? 15.702  8.732   -0.954  1.00 0.00 ? 59 LYS A O    3  
ATOM 3133  C CB   . LYS A 1 59 ? 16.433  7.522   -4.228  1.00 0.00 ? 59 LYS A CB   3  
ATOM 3134  C CG   . LYS A 1 59 ? 16.434  6.284   -5.145  1.00 0.00 ? 59 LYS A CG   3  
ATOM 3135  C CD   . LYS A 1 59 ? 17.816  5.766   -5.582  1.00 0.00 ? 59 LYS A CD   3  
ATOM 3136  C CE   . LYS A 1 59 ? 18.687  5.239   -4.434  1.00 0.00 ? 59 LYS A CE   3  
ATOM 3137  N NZ   . LYS A 1 59 ? 19.715  6.205   -3.987  1.00 0.00 ? 59 LYS A NZ   3  
ATOM 3138  H H    . LYS A 1 59 ? 15.403  5.640   -1.722  1.00 0.00 ? 59 LYS A H    3  
ATOM 3139  H HA   . LYS A 1 59 ? 17.275  6.602   -2.481  1.00 0.00 ? 59 LYS A HA   3  
ATOM 3140  H HB2  . LYS A 1 59 ? 15.564  8.124   -4.479  1.00 0.00 ? 59 LYS A HB2  3  
ATOM 3141  H HB3  . LYS A 1 59 ? 17.287  8.140   -4.478  1.00 0.00 ? 59 LYS A HB3  3  
ATOM 3142  H HG2  . LYS A 1 59 ? 15.877  5.470   -4.680  1.00 0.00 ? 59 LYS A HG2  3  
ATOM 3143  H HG3  . LYS A 1 59 ? 15.901  6.562   -6.053  1.00 0.00 ? 59 LYS A HG3  3  
ATOM 3144  H HD2  . LYS A 1 59 ? 17.633  4.934   -6.262  1.00 0.00 ? 59 LYS A HD2  3  
ATOM 3145  H HD3  . LYS A 1 59 ? 18.348  6.532   -6.147  1.00 0.00 ? 59 LYS A HD3  3  
ATOM 3146  H HE2  . LYS A 1 59 ? 18.038  4.973   -3.600  1.00 0.00 ? 59 LYS A HE2  3  
ATOM 3147  H HE3  . LYS A 1 59 ? 19.189  4.325   -4.756  1.00 0.00 ? 59 LYS A HE3  3  
ATOM 3148  H HZ1  . LYS A 1 59 ? 20.511  6.209   -4.622  1.00 0.00 ? 59 LYS A HZ1  3  
ATOM 3149  H HZ2  . LYS A 1 59 ? 19.366  7.154   -3.970  1.00 0.00 ? 59 LYS A HZ2  3  
ATOM 3150  H HZ3  . LYS A 1 59 ? 20.064  5.970   -3.058  1.00 0.00 ? 59 LYS A HZ3  3  
ATOM 3151  N N    . ASN A 1 60 ? 17.640  9.207   -1.979  1.00 0.00 ? 60 ASN A N    3  
ATOM 3152  C CA   . ASN A 1 60 ? 18.132  10.260  -1.082  1.00 0.00 ? 60 ASN A CA   3  
ATOM 3153  C C    . ASN A 1 60 ? 17.843  10.022  0.417   1.00 0.00 ? 60 ASN A C    3  
ATOM 3154  O O    . ASN A 1 60 ? 17.417  10.952  1.104   1.00 0.00 ? 60 ASN A O    3  
ATOM 3155  C CB   . ASN A 1 60 ? 17.713  11.665  -1.574  1.00 0.00 ? 60 ASN A CB   3  
ATOM 3156  C CG   . ASN A 1 60 ? 16.211  11.925  -1.499  1.00 0.00 ? 60 ASN A CG   3  
ATOM 3157  O OD1  . ASN A 1 60 ? 15.677  12.475  -0.538  1.00 0.00 ? 60 ASN A OD1  3  
ATOM 3158  N ND2  . ASN A 1 60 ? 15.488  11.553  -2.537  1.00 0.00 ? 60 ASN A ND2  3  
ATOM 3159  H H    . ASN A 1 60 ? 18.243  8.968   -2.752  1.00 0.00 ? 60 ASN A H    3  
ATOM 3160  H HA   . ASN A 1 60 ? 19.212  10.219  -1.164  1.00 0.00 ? 60 ASN A HA   3  
ATOM 3161  H HB2  . ASN A 1 60 ? 18.223  12.422  -0.975  1.00 0.00 ? 60 ASN A HB2  3  
ATOM 3162  H HB3  . ASN A 1 60 ? 18.043  11.788  -2.604  1.00 0.00 ? 60 ASN A HB3  3  
ATOM 3163  H HD21 . ASN A 1 60 ? 15.913  11.112  -3.339  1.00 0.00 ? 60 ASN A HD21 3  
ATOM 3164  H HD22 . ASN A 1 60 ? 14.477  11.596  -2.484  1.00 0.00 ? 60 ASN A HD22 3  
ATOM 3165  N N    . PRO A 1 61 ? 18.137  8.838   0.984   1.00 0.00 ? 61 PRO A N    3  
ATOM 3166  C CA   . PRO A 1 61 ? 17.764  8.513   2.351   1.00 0.00 ? 61 PRO A CA   3  
ATOM 3167  C C    . PRO A 1 61 ? 18.550  9.388   3.345   1.00 0.00 ? 61 PRO A C    3  
ATOM 3168  O O    . PRO A 1 61 ? 19.785  9.393   3.295   1.00 0.00 ? 61 PRO A O    3  
ATOM 3169  C CB   . PRO A 1 61 ? 18.073  7.023   2.506   1.00 0.00 ? 61 PRO A CB   3  
ATOM 3170  C CG   . PRO A 1 61 ? 19.231  6.795   1.541   1.00 0.00 ? 61 PRO A CG   3  
ATOM 3171  C CD   . PRO A 1 61 ? 18.929  7.767   0.405   1.00 0.00 ? 61 PRO A CD   3  
ATOM 3172  H HA   . PRO A 1 61 ? 16.693  8.664   2.456   1.00 0.00 ? 61 PRO A HA   3  
ATOM 3173  H HB2  . PRO A 1 61 ? 18.340  6.763   3.530   1.00 0.00 ? 61 PRO A HB2  3  
ATOM 3174  H HB3  . PRO A 1 61 ? 17.215  6.438   2.173   1.00 0.00 ? 61 PRO A HB3  3  
ATOM 3175  H HG2  . PRO A 1 61 ? 20.174  7.065   2.015   1.00 0.00 ? 61 PRO A HG2  3  
ATOM 3176  H HG3  . PRO A 1 61 ? 19.261  5.767   1.188   1.00 0.00 ? 61 PRO A HG3  3  
ATOM 3177  H HD2  . PRO A 1 61 ? 19.848  8.152   -0.026  1.00 0.00 ? 61 PRO A HD2  3  
ATOM 3178  H HD3  . PRO A 1 61 ? 18.357  7.260   -0.362  1.00 0.00 ? 61 PRO A HD3  3  
ATOM 3179  N N    . PRO A 1 62 ? 17.895  10.125  4.261   1.00 0.00 ? 62 PRO A N    3  
ATOM 3180  C CA   . PRO A 1 62 ? 18.594  10.908  5.277   1.00 0.00 ? 62 PRO A CA   3  
ATOM 3181  C C    . PRO A 1 62 ? 19.305  9.962   6.250   1.00 0.00 ? 62 PRO A C    3  
ATOM 3182  O O    . PRO A 1 62 ? 18.816  8.860   6.503   1.00 0.00 ? 62 PRO A O    3  
ATOM 3183  C CB   . PRO A 1 62 ? 17.503  11.721  5.978   1.00 0.00 ? 62 PRO A CB   3  
ATOM 3184  C CG   . PRO A 1 62 ? 16.251  10.859  5.810   1.00 0.00 ? 62 PRO A CG   3  
ATOM 3185  C CD   . PRO A 1 62 ? 16.454  10.206  4.446   1.00 0.00 ? 62 PRO A CD   3  
ATOM 3186  H HA   . PRO A 1 62 ? 19.314  11.581  4.808   1.00 0.00 ? 62 PRO A HA   3  
ATOM 3187  H HB2  . PRO A 1 62 ? 17.739  11.898  7.028   1.00 0.00 ? 62 PRO A HB2  3  
ATOM 3188  H HB3  . PRO A 1 62 ? 17.363  12.663  5.450   1.00 0.00 ? 62 PRO A HB3  3  
ATOM 3189  H HG2  . PRO A 1 62 ? 16.232  10.090  6.582   1.00 0.00 ? 62 PRO A HG2  3  
ATOM 3190  H HG3  . PRO A 1 62 ? 15.335  11.448  5.836   1.00 0.00 ? 62 PRO A HG3  3  
ATOM 3191  H HD2  . PRO A 1 62 ? 15.989  9.220   4.435   1.00 0.00 ? 62 PRO A HD2  3  
ATOM 3192  H HD3  . PRO A 1 62 ? 16.024  10.837  3.666   1.00 0.00 ? 62 PRO A HD3  3  
ATOM 3193  N N    . LYS A 1 63 ? 20.431  10.369  6.848   1.00 0.00 ? 63 LYS A N    3  
ATOM 3194  C CA   . LYS A 1 63 ? 21.185  9.512   7.772   1.00 0.00 ? 63 LYS A CA   3  
ATOM 3195  C C    . LYS A 1 63 ? 21.124  10.087  9.183   1.00 0.00 ? 63 LYS A C    3  
ATOM 3196  O O    . LYS A 1 63 ? 22.139  10.228  9.862   1.00 0.00 ? 63 LYS A O    3  
ATOM 3197  C CB   . LYS A 1 63 ? 22.606  9.251   7.245   1.00 0.00 ? 63 LYS A CB   3  
ATOM 3198  C CG   . LYS A 1 63 ? 23.181  7.962   7.853   1.00 0.00 ? 63 LYS A CG   3  
ATOM 3199  C CD   . LYS A 1 63 ? 24.624  7.754   7.391   1.00 0.00 ? 63 LYS A CD   3  
ATOM 3200  C CE   . LYS A 1 63 ? 25.141  6.412   7.896   1.00 0.00 ? 63 LYS A CE   3  
ATOM 3201  N NZ   . LYS A 1 63 ? 26.477  6.082   7.369   1.00 0.00 ? 63 LYS A NZ   3  
ATOM 3202  H H    . LYS A 1 63 ? 20.796  11.300  6.675   1.00 0.00 ? 63 LYS A H    3  
ATOM 3203  H HA   . LYS A 1 63 ? 20.697  8.537   7.827   1.00 0.00 ? 63 LYS A HA   3  
ATOM 3204  H HB2  . LYS A 1 63 ? 22.573  9.122   6.164   1.00 0.00 ? 63 LYS A HB2  3  
ATOM 3205  H HB3  . LYS A 1 63 ? 23.252  10.098  7.476   1.00 0.00 ? 63 LYS A HB3  3  
ATOM 3206  H HG2  . LYS A 1 63 ? 23.164  8.015   8.942   1.00 0.00 ? 63 LYS A HG2  3  
ATOM 3207  H HG3  . LYS A 1 63 ? 22.573  7.114   7.528   1.00 0.00 ? 63 LYS A HG3  3  
ATOM 3208  H HD2  . LYS A 1 63 ? 24.666  7.775   6.301   1.00 0.00 ? 63 LYS A HD2  3  
ATOM 3209  H HD3  . LYS A 1 63 ? 25.242  8.546   7.813   1.00 0.00 ? 63 LYS A HD3  3  
ATOM 3210  H HE2  . LYS A 1 63 ? 25.181  6.436   8.985   1.00 0.00 ? 63 LYS A HE2  3  
ATOM 3211  H HE3  . LYS A 1 63 ? 24.446  5.625   7.600   1.00 0.00 ? 63 LYS A HE3  3  
ATOM 3212  H HZ1  . LYS A 1 63 ? 26.427  5.845   6.383   1.00 0.00 ? 63 LYS A HZ1  3  
ATOM 3213  H HZ2  . LYS A 1 63 ? 27.147  6.837   7.488   1.00 0.00 ? 63 LYS A HZ2  3  
ATOM 3214  H HZ3  . LYS A 1 63 ? 26.824  5.260   7.854   1.00 0.00 ? 63 LYS A HZ3  3  
ATOM 3215  N N    . LYS A 1 64 ? 19.914  10.400  9.641   1.00 0.00 ? 64 LYS A N    3  
ATOM 3216  C CA   . LYS A 1 64 ? 19.607  10.700  11.033  1.00 0.00 ? 64 LYS A CA   3  
ATOM 3217  C C    . LYS A 1 64 ? 18.477  9.772   11.465  1.00 0.00 ? 64 LYS A C    3  
ATOM 3218  O O    . LYS A 1 64 ? 17.774  9.206   10.618  1.00 0.00 ? 64 LYS A O    3  
ATOM 3219  C CB   . LYS A 1 64 ? 19.209  12.184  11.173  1.00 0.00 ? 64 LYS A CB   3  
ATOM 3220  C CG   . LYS A 1 64 ? 20.392  13.119  11.498  1.00 0.00 ? 64 LYS A CG   3  
ATOM 3221  C CD   . LYS A 1 64 ? 20.347  13.667  12.938  1.00 0.00 ? 64 LYS A CD   3  
ATOM 3222  C CE   . LYS A 1 64 ? 20.350  12.543  13.978  1.00 0.00 ? 64 LYS A CE   3  
ATOM 3223  N NZ   . LYS A 1 64 ? 20.399  13.029  15.369  1.00 0.00 ? 64 LYS A NZ   3  
ATOM 3224  H H    . LYS A 1 64 ? 19.114  10.217  9.051   1.00 0.00 ? 64 LYS A H    3  
ATOM 3225  H HA   . LYS A 1 64 ? 20.479  10.487  11.655  1.00 0.00 ? 64 LYS A HA   3  
ATOM 3226  H HB2  . LYS A 1 64 ? 18.724  12.524  10.255  1.00 0.00 ? 64 LYS A HB2  3  
ATOM 3227  H HB3  . LYS A 1 64 ? 18.470  12.272  11.965  1.00 0.00 ? 64 LYS A HB3  3  
ATOM 3228  H HG2  . LYS A 1 64 ? 21.339  12.602  11.336  1.00 0.00 ? 64 LYS A HG2  3  
ATOM 3229  H HG3  . LYS A 1 64 ? 20.359  13.967  10.813  1.00 0.00 ? 64 LYS A HG3  3  
ATOM 3230  H HD2  . LYS A 1 64 ? 21.217  14.301  13.098  1.00 0.00 ? 64 LYS A HD2  3  
ATOM 3231  H HD3  . LYS A 1 64 ? 19.451  14.279  13.057  1.00 0.00 ? 64 LYS A HD3  3  
ATOM 3232  H HE2  . LYS A 1 64 ? 19.443  11.954  13.855  1.00 0.00 ? 64 LYS A HE2  3  
ATOM 3233  H HE3  . LYS A 1 64 ? 21.211  11.895  13.801  1.00 0.00 ? 64 LYS A HE3  3  
ATOM 3234  H HZ1  . LYS A 1 64 ? 21.334  13.312  15.642  1.00 0.00 ? 64 LYS A HZ1  3  
ATOM 3235  H HZ2  . LYS A 1 64 ? 19.785  13.817  15.544  1.00 0.00 ? 64 LYS A HZ2  3  
ATOM 3236  H HZ3  . LYS A 1 64 ? 20.126  12.275  15.998  1.00 0.00 ? 64 LYS A HZ3  3  
ATOM 3237  N N    . LYS A 1 65 ? 18.276  9.632   12.777  1.00 0.00 ? 65 LYS A N    3  
ATOM 3238  C CA   . LYS A 1 65 ? 17.143  8.901   13.334  1.00 0.00 ? 65 LYS A CA   3  
ATOM 3239  C C    . LYS A 1 65 ? 15.834  9.571   12.921  1.00 0.00 ? 65 LYS A C    3  
ATOM 3240  O O    . LYS A 1 65 ? 14.869  8.881   12.607  1.00 0.00 ? 65 LYS A O    3  
ATOM 3241  C CB   . LYS A 1 65 ? 17.300  8.819   14.868  1.00 0.00 ? 65 LYS A CB   3  
ATOM 3242  C CG   . LYS A 1 65 ? 16.096  8.207   15.605  1.00 0.00 ? 65 LYS A CG   3  
ATOM 3243  C CD   . LYS A 1 65 ? 15.780  6.769   15.177  1.00 0.00 ? 65 LYS A CD   3  
ATOM 3244  C CE   . LYS A 1 65 ? 14.514  6.310   15.908  1.00 0.00 ? 65 LYS A CE   3  
ATOM 3245  N NZ   . LYS A 1 65 ? 13.829  5.199   15.218  1.00 0.00 ? 65 LYS A NZ   3  
ATOM 3246  H H    . LYS A 1 65 ? 19.008  9.942   13.407  1.00 0.00 ? 65 LYS A H    3  
ATOM 3247  H HA   . LYS A 1 65 ? 17.153  7.892   12.917  1.00 0.00 ? 65 LYS A HA   3  
ATOM 3248  H HB2  . LYS A 1 65 ? 18.188  8.230   15.099  1.00 0.00 ? 65 LYS A HB2  3  
ATOM 3249  H HB3  . LYS A 1 65 ? 17.458  9.822   15.267  1.00 0.00 ? 65 LYS A HB3  3  
ATOM 3250  H HG2  . LYS A 1 65 ? 16.302  8.213   16.676  1.00 0.00 ? 65 LYS A HG2  3  
ATOM 3251  H HG3  . LYS A 1 65 ? 15.220  8.834   15.432  1.00 0.00 ? 65 LYS A HG3  3  
ATOM 3252  H HD2  . LYS A 1 65 ? 15.619  6.726   14.101  1.00 0.00 ? 65 LYS A HD2  3  
ATOM 3253  H HD3  . LYS A 1 65 ? 16.616  6.118   15.436  1.00 0.00 ? 65 LYS A HD3  3  
ATOM 3254  H HE2  . LYS A 1 65 ? 14.777  6.015   16.925  1.00 0.00 ? 65 LYS A HE2  3  
ATOM 3255  H HE3  . LYS A 1 65 ? 13.818  7.150   15.963  1.00 0.00 ? 65 LYS A HE3  3  
ATOM 3256  H HZ1  . LYS A 1 65 ? 12.985  4.953   15.723  1.00 0.00 ? 65 LYS A HZ1  3  
ATOM 3257  H HZ2  . LYS A 1 65 ? 13.551  5.505   14.288  1.00 0.00 ? 65 LYS A HZ2  3  
ATOM 3258  H HZ3  . LYS A 1 65 ? 14.442  4.393   15.144  1.00 0.00 ? 65 LYS A HZ3  3  
ATOM 3259  N N    . MET A 1 66 ? 15.788  10.900  12.943  1.00 0.00 ? 66 MET A N    3  
ATOM 3260  C CA   . MET A 1 66 ? 14.625  11.725  12.644  1.00 0.00 ? 66 MET A CA   3  
ATOM 3261  C C    . MET A 1 66 ? 15.157  13.010  12.015  1.00 0.00 ? 66 MET A C    3  
ATOM 3262  O O    . MET A 1 66 ? 16.308  13.367  12.283  1.00 0.00 ? 66 MET A O    3  
ATOM 3263  C CB   . MET A 1 66 ? 13.905  12.021  13.972  1.00 0.00 ? 66 MET A CB   3  
ATOM 3264  C CG   . MET A 1 66 ? 12.662  12.904  13.832  1.00 0.00 ? 66 MET A CG   3  
ATOM 3265  S SD   . MET A 1 66 ? 11.878  13.299  15.410  1.00 0.00 ? 66 MET A SD   3  
ATOM 3266  C CE   . MET A 1 66 ? 10.968  14.790  14.930  1.00 0.00 ? 66 MET A CE   3  
ATOM 3267  H H    . MET A 1 66 ? 16.622  11.441  13.131  1.00 0.00 ? 66 MET A H    3  
ATOM 3268  H HA   . MET A 1 66 ? 13.954  11.214  11.950  1.00 0.00 ? 66 MET A HA   3  
ATOM 3269  H HB2  . MET A 1 66 ? 13.609  11.080  14.434  1.00 0.00 ? 66 MET A HB2  3  
ATOM 3270  H HB3  . MET A 1 66 ? 14.601  12.520  14.649  1.00 0.00 ? 66 MET A HB3  3  
ATOM 3271  H HG2  . MET A 1 66 ? 12.947  13.849  13.375  1.00 0.00 ? 66 MET A HG2  3  
ATOM 3272  H HG3  . MET A 1 66 ? 11.935  12.403  13.195  1.00 0.00 ? 66 MET A HG3  3  
ATOM 3273  H HE1  . MET A 1 66 ? 10.201  14.527  14.204  1.00 0.00 ? 66 MET A HE1  3  
ATOM 3274  H HE2  . MET A 1 66 ? 10.499  15.240  15.805  1.00 0.00 ? 66 MET A HE2  3  
ATOM 3275  H HE3  . MET A 1 66 ? 11.650  15.512  14.478  1.00 0.00 ? 66 MET A HE3  3  
ATOM 3276  N N    . LYS A 1 67 ? 14.337  13.738  11.251  1.00 0.00 ? 67 LYS A N    3  
ATOM 3277  C CA   . LYS A 1 67 ? 14.637  15.118  10.881  1.00 0.00 ? 67 LYS A CA   3  
ATOM 3278  C C    . LYS A 1 67 ? 14.687  15.914  12.184  1.00 0.00 ? 67 LYS A C    3  
ATOM 3279  O O    . LYS A 1 67 ? 13.648  16.226  12.764  1.00 0.00 ? 67 LYS A O    3  
ATOM 3280  C CB   . LYS A 1 67 ? 13.601  15.661  9.873   1.00 0.00 ? 67 LYS A CB   3  
ATOM 3281  C CG   . LYS A 1 67 ? 14.195  16.506  8.732   1.00 0.00 ? 67 LYS A CG   3  
ATOM 3282  C CD   . LYS A 1 67 ? 14.863  17.836  9.116   1.00 0.00 ? 67 LYS A CD   3  
ATOM 3283  C CE   . LYS A 1 67 ? 16.302  17.670  9.639   1.00 0.00 ? 67 LYS A CE   3  
ATOM 3284  N NZ   . LYS A 1 67 ? 17.138  18.871  9.423   1.00 0.00 ? 67 LYS A NZ   3  
ATOM 3285  H H    . LYS A 1 67 ? 13.415  13.385  11.042  1.00 0.00 ? 67 LYS A H    3  
ATOM 3286  H HA   . LYS A 1 67 ? 15.619  15.123  10.408  1.00 0.00 ? 67 LYS A HA   3  
ATOM 3287  H HB2  . LYS A 1 67 ? 13.089  14.822  9.403   1.00 0.00 ? 67 LYS A HB2  3  
ATOM 3288  H HB3  . LYS A 1 67 ? 12.834  16.243  10.384  1.00 0.00 ? 67 LYS A HB3  3  
ATOM 3289  H HG2  . LYS A 1 67 ? 14.906  15.908  8.167   1.00 0.00 ? 67 LYS A HG2  3  
ATOM 3290  H HG3  . LYS A 1 67 ? 13.373  16.737  8.054   1.00 0.00 ? 67 LYS A HG3  3  
ATOM 3291  H HD2  . LYS A 1 67 ? 14.887  18.436  8.211   1.00 0.00 ? 67 LYS A HD2  3  
ATOM 3292  H HD3  . LYS A 1 67 ? 14.246  18.368  9.841   1.00 0.00 ? 67 LYS A HD3  3  
ATOM 3293  H HE2  . LYS A 1 67 ? 16.260  17.472  10.708  1.00 0.00 ? 67 LYS A HE2  3  
ATOM 3294  H HE3  . LYS A 1 67 ? 16.770  16.825  9.129   1.00 0.00 ? 67 LYS A HE3  3  
ATOM 3295  H HZ1  . LYS A 1 67 ? 16.697  19.698  9.826   1.00 0.00 ? 67 LYS A HZ1  3  
ATOM 3296  H HZ2  . LYS A 1 67 ? 18.044  18.780  9.872   1.00 0.00 ? 67 LYS A HZ2  3  
ATOM 3297  H HZ3  . LYS A 1 67 ? 17.255  19.048  8.432   1.00 0.00 ? 67 LYS A HZ3  3  
ATOM 3298  N N    . LEU A 1 68 ? 15.893  16.143  12.696  1.00 0.00 ? 68 LEU A N    3  
ATOM 3299  C CA   . LEU A 1 68 ? 16.144  16.918  13.894  1.00 0.00 ? 68 LEU A CA   3  
ATOM 3300  C C    . LEU A 1 68 ? 17.458  17.668  13.677  1.00 0.00 ? 68 LEU A C    3  
ATOM 3301  O O    . LEU A 1 68 ? 18.329  17.176  12.951  1.00 0.00 ? 68 LEU A O    3  
ATOM 3302  C CB   . LEU A 1 68 ? 16.194  15.978  15.115  1.00 0.00 ? 68 LEU A CB   3  
ATOM 3303  C CG   . LEU A 1 68 ? 15.533  16.609  16.352  1.00 0.00 ? 68 LEU A CG   3  
ATOM 3304  C CD1  . LEU A 1 68 ? 14.003  16.612  16.236  1.00 0.00 ? 68 LEU A CD1  3  
ATOM 3305  C CD2  . LEU A 1 68 ? 15.914  15.845  17.620  1.00 0.00 ? 68 LEU A CD2  3  
ATOM 3306  H H    . LEU A 1 68 ? 16.714  15.801  12.216  1.00 0.00 ? 68 LEU A H    3  
ATOM 3307  H HA   . LEU A 1 68 ? 15.334  17.638  14.010  1.00 0.00 ? 68 LEU A HA   3  
ATOM 3308  H HB2  . LEU A 1 68 ? 15.692  15.035  14.892  1.00 0.00 ? 68 LEU A HB2  3  
ATOM 3309  H HB3  . LEU A 1 68 ? 17.236  15.745  15.327  1.00 0.00 ? 68 LEU A HB3  3  
ATOM 3310  H HG   . LEU A 1 68 ? 15.879  17.634  16.455  1.00 0.00 ? 68 LEU A HG   3  
ATOM 3311  H HD11 . LEU A 1 68 ? 13.644  15.593  16.097  1.00 0.00 ? 68 LEU A HD11 3  
ATOM 3312  H HD12 . LEU A 1 68 ? 13.563  17.028  17.141  1.00 0.00 ? 68 LEU A HD12 3  
ATOM 3313  H HD13 . LEU A 1 68 ? 13.686  17.214  15.384  1.00 0.00 ? 68 LEU A HD13 3  
ATOM 3314  H HD21 . LEU A 1 68 ? 15.465  16.326  18.487  1.00 0.00 ? 68 LEU A HD21 3  
ATOM 3315  H HD22 . LEU A 1 68 ? 15.573  14.812  17.558  1.00 0.00 ? 68 LEU A HD22 3  
ATOM 3316  H HD23 . LEU A 1 68 ? 16.994  15.861  17.755  1.00 0.00 ? 68 LEU A HD23 3  
ATOM 3317  N N    . MET A 1 69 ? 17.598  18.819  14.334  1.00 0.00 ? 69 MET A N    3  
ATOM 3318  C CA   . MET A 1 69 ? 18.622  19.839  14.134  1.00 0.00 ? 69 MET A CA   3  
ATOM 3319  C C    . MET A 1 69 ? 18.447  20.510  12.765  1.00 0.00 ? 69 MET A C    3  
ATOM 3320  O O    . MET A 1 69 ? 18.790  19.932  11.730  1.00 0.00 ? 69 MET A O    3  
ATOM 3321  C CB   . MET A 1 69 ? 20.041  19.299  14.391  1.00 0.00 ? 69 MET A CB   3  
ATOM 3322  C CG   . MET A 1 69 ? 21.072  20.428  14.486  1.00 0.00 ? 69 MET A CG   3  
ATOM 3323  S SD   . MET A 1 69 ? 22.749  19.887  14.932  1.00 0.00 ? 69 MET A SD   3  
ATOM 3324  C CE   . MET A 1 69 ? 22.510  19.480  16.685  1.00 0.00 ? 69 MET A CE   3  
ATOM 3325  H H    . MET A 1 69 ? 16.781  19.145  14.839  1.00 0.00 ? 69 MET A H    3  
ATOM 3326  H HA   . MET A 1 69 ? 18.433  20.594  14.898  1.00 0.00 ? 69 MET A HA   3  
ATOM 3327  H HB2  . MET A 1 69 ? 20.041  18.748  15.329  1.00 0.00 ? 69 MET A HB2  3  
ATOM 3328  H HB3  . MET A 1 69 ? 20.340  18.626  13.589  1.00 0.00 ? 69 MET A HB3  3  
ATOM 3329  H HG2  . MET A 1 69 ? 21.120  20.927  13.519  1.00 0.00 ? 69 MET A HG2  3  
ATOM 3330  H HG3  . MET A 1 69 ? 20.738  21.162  15.219  1.00 0.00 ? 69 MET A HG3  3  
ATOM 3331  H HE1  . MET A 1 69 ? 23.465  19.179  17.117  1.00 0.00 ? 69 MET A HE1  3  
ATOM 3332  H HE2  . MET A 1 69 ? 22.136  20.355  17.219  1.00 0.00 ? 69 MET A HE2  3  
ATOM 3333  H HE3  . MET A 1 69 ? 21.798  18.661  16.786  1.00 0.00 ? 69 MET A HE3  3  
ATOM 3334  N N    . ARG A 1 70 ? 17.925  21.745  12.802  1.00 0.00 ? 70 ARG A N    3  
ATOM 3335  C CA   . ARG A 1 70 ? 17.678  22.631  11.657  1.00 0.00 ? 70 ARG A CA   3  
ATOM 3336  C C    . ARG A 1 70 ? 17.071  21.857  10.494  1.00 0.00 ? 70 ARG A C    3  
ATOM 3337  O O    . ARG A 1 70 ? 17.497  22.038  9.330   1.00 0.00 ? 70 ARG A O    3  
ATOM 3338  C CB   . ARG A 1 70 ? 18.964  23.399  11.293  1.00 0.00 ? 70 ARG A CB   3  
ATOM 3339  C CG   . ARG A 1 70 ? 19.388  24.389  12.391  1.00 0.00 ? 70 ARG A CG   3  
ATOM 3340  C CD   . ARG A 1 70 ? 20.568  25.269  11.953  1.00 0.00 ? 70 ARG A CD   3  
ATOM 3341  N NE   . ARG A 1 70 ? 20.208  26.129  10.817  1.00 0.00 ? 70 ARG A NE   3  
ATOM 3342  C CZ   . ARG A 1 70 ? 21.003  26.925  10.102  1.00 0.00 ? 70 ARG A CZ   3  
ATOM 3343  N NH1  . ARG A 1 70 ? 22.262  27.144  10.482  1.00 0.00 ? 70 ARG A NH1  3  
ATOM 3344  N NH2  . ARG A 1 70 ? 20.531  27.500  9.002   1.00 0.00 ? 70 ARG A NH2  3  
ATOM 3345  H H    . ARG A 1 70 ? 17.592  22.076  13.699  1.00 0.00 ? 70 ARG A H    3  
ATOM 3346  H HA   . ARG A 1 70 ? 16.923  23.360  11.947  1.00 0.00 ? 70 ARG A HA   3  
ATOM 3347  H HB2  . ARG A 1 70 ? 19.769  22.690  11.092  1.00 0.00 ? 70 ARG A HB2  3  
ATOM 3348  H HB3  . ARG A 1 70 ? 18.778  23.959  10.379  1.00 0.00 ? 70 ARG A HB3  3  
ATOM 3349  H HG2  . ARG A 1 70 ? 18.545  25.031  12.650  1.00 0.00 ? 70 ARG A HG2  3  
ATOM 3350  H HG3  . ARG A 1 70 ? 19.682  23.832  13.280  1.00 0.00 ? 70 ARG A HG3  3  
ATOM 3351  H HD2  . ARG A 1 70 ? 20.866  25.898  12.790  1.00 0.00 ? 70 ARG A HD2  3  
ATOM 3352  H HD3  . ARG A 1 70 ? 21.405  24.629  11.673  1.00 0.00 ? 70 ARG A HD3  3  
ATOM 3353  H HE   . ARG A 1 70 ? 19.218  26.098  10.556  1.00 0.00 ? 70 ARG A HE   3  
ATOM 3354  H HH11 . ARG A 1 70 ? 22.606  26.702  11.320  1.00 0.00 ? 70 ARG A HH11 3  
ATOM 3355  H HH12 . ARG A 1 70 ? 22.887  27.741  9.964   1.00 0.00 ? 70 ARG A HH12 3  
ATOM 3356  H HH21 . ARG A 1 70 ? 19.622  27.193  8.638   1.00 0.00 ? 70 ARG A HH21 3  
ATOM 3357  H HH22 . ARG A 1 70 ? 21.051  28.137  8.423   1.00 0.00 ? 70 ARG A HH22 3  
ATOM 3358  N N    . GLY A 1 1  ? -36.539 -0.847  5.873   1.00 0.00 ? 1  GLY A N    4  
ATOM 3359  C CA   . GLY A 1 1  ? -35.413 -0.140  6.500   1.00 0.00 ? 1  GLY A CA   4  
ATOM 3360  C C    . GLY A 1 1  ? -34.188 -0.390  5.651   1.00 0.00 ? 1  GLY A C    4  
ATOM 3361  O O    . GLY A 1 1  ? -34.340 -0.551  4.442   1.00 0.00 ? 1  GLY A O    4  
ATOM 3362  H H1   . GLY A 1 1  ? -36.707 -0.610  4.916   1.00 0.00 ? 1  GLY A H1   4  
ATOM 3363  H HA2  . GLY A 1 1  ? -35.615 0.931   6.533   1.00 0.00 ? 1  GLY A HA2  4  
ATOM 3364  H HA3  . GLY A 1 1  ? -35.248 -0.522  7.508   1.00 0.00 ? 1  GLY A HA3  4  
ATOM 3365  N N    . SER A 1 2  ? -33.012 -0.472  6.268   1.00 0.00 ? 2  SER A N    4  
ATOM 3366  C CA   . SER A 1 2  ? -31.810 -0.978  5.623   1.00 0.00 ? 2  SER A CA   4  
ATOM 3367  C C    . SER A 1 2  ? -32.038 -2.412  5.116   1.00 0.00 ? 2  SER A C    4  
ATOM 3368  O O    . SER A 1 2  ? -32.996 -3.074  5.528   1.00 0.00 ? 2  SER A O    4  
ATOM 3369  C CB   . SER A 1 2  ? -30.663 -0.935  6.643   1.00 0.00 ? 2  SER A CB   4  
ATOM 3370  O OG   . SER A 1 2  ? -30.766 0.213   7.472   1.00 0.00 ? 2  SER A OG   4  
ATOM 3371  H H    . SER A 1 2  ? -32.865 -0.251  7.244   1.00 0.00 ? 2  SER A H    4  
ATOM 3372  H HA   . SER A 1 2  ? -31.570 -0.326  4.781   1.00 0.00 ? 2  SER A HA   4  
ATOM 3373  H HB2  . SER A 1 2  ? -30.702 -1.823  7.275   1.00 0.00 ? 2  SER A HB2  4  
ATOM 3374  H HB3  . SER A 1 2  ? -29.710 -0.926  6.112   1.00 0.00 ? 2  SER A HB3  4  
ATOM 3375  H HG   . SER A 1 2  ? -29.857 0.431   7.777   1.00 0.00 ? 2  SER A HG   4  
ATOM 3376  N N    . SER A 1 3  ? -31.145 -2.896  4.254   1.00 0.00 ? 3  SER A N    4  
ATOM 3377  C CA   . SER A 1 3  ? -31.119 -4.265  3.762   1.00 0.00 ? 3  SER A CA   4  
ATOM 3378  C C    . SER A 1 3  ? -29.655 -4.586  3.467   1.00 0.00 ? 3  SER A C    4  
ATOM 3379  O O    . SER A 1 3  ? -28.996 -3.809  2.767   1.00 0.00 ? 3  SER A O    4  
ATOM 3380  C CB   . SER A 1 3  ? -32.005 -4.354  2.509   1.00 0.00 ? 3  SER A CB   4  
ATOM 3381  O OG   . SER A 1 3  ? -32.109 -5.672  2.012   1.00 0.00 ? 3  SER A OG   4  
ATOM 3382  H H    . SER A 1 3  ? -30.381 -2.317  3.936   1.00 0.00 ? 3  SER A H    4  
ATOM 3383  H HA   . SER A 1 3  ? -31.506 -4.939  4.530   1.00 0.00 ? 3  SER A HA   4  
ATOM 3384  H HB2  . SER A 1 3  ? -33.007 -4.007  2.765   1.00 0.00 ? 3  SER A HB2  4  
ATOM 3385  H HB3  . SER A 1 3  ? -31.602 -3.708  1.728   1.00 0.00 ? 3  SER A HB3  4  
ATOM 3386  H HG   . SER A 1 3  ? -31.307 -5.870  1.483   1.00 0.00 ? 3  SER A HG   4  
ATOM 3387  N N    . GLY A 1 4  ? -29.148 -5.688  4.012   1.00 0.00 ? 4  GLY A N    4  
ATOM 3388  C CA   . GLY A 1 4  ? -27.770 -6.134  3.878   1.00 0.00 ? 4  GLY A CA   4  
ATOM 3389  C C    . GLY A 1 4  ? -27.653 -7.621  4.213   1.00 0.00 ? 4  GLY A C    4  
ATOM 3390  O O    . GLY A 1 4  ? -28.656 -8.298  4.464   1.00 0.00 ? 4  GLY A O    4  
ATOM 3391  H H    . GLY A 1 4  ? -29.736 -6.262  4.610   1.00 0.00 ? 4  GLY A H    4  
ATOM 3392  H HA2  . GLY A 1 4  ? -27.433 -5.966  2.855   1.00 0.00 ? 4  GLY A HA2  4  
ATOM 3393  H HA3  . GLY A 1 4  ? -27.146 -5.560  4.563   1.00 0.00 ? 4  GLY A HA3  4  
ATOM 3394  N N    . SER A 1 5  ? -26.436 -8.162  4.195   1.00 0.00 ? 5  SER A N    4  
ATOM 3395  C CA   . SER A 1 5  ? -26.163 -9.531  4.641   1.00 0.00 ? 5  SER A CA   4  
ATOM 3396  C C    . SER A 1 5  ? -24.738 -9.671  5.178   1.00 0.00 ? 5  SER A C    4  
ATOM 3397  O O    . SER A 1 5  ? -24.539 -10.357 6.181   1.00 0.00 ? 5  SER A O    4  
ATOM 3398  C CB   . SER A 1 5  ? -26.432 -10.533 3.510   1.00 0.00 ? 5  SER A CB   4  
ATOM 3399  O OG   . SER A 1 5  ? -27.817 -10.543 3.189   1.00 0.00 ? 5  SER A OG   4  
ATOM 3400  H H    . SER A 1 5  ? -25.652 -7.534  4.073   1.00 0.00 ? 5  SER A H    4  
ATOM 3401  H HA   . SER A 1 5  ? -26.835 -9.768  5.468   1.00 0.00 ? 5  SER A HA   4  
ATOM 3402  H HB2  . SER A 1 5  ? -25.849 -10.263 2.629   1.00 0.00 ? 5  SER A HB2  4  
ATOM 3403  H HB3  . SER A 1 5  ? -26.135 -11.531 3.837   1.00 0.00 ? 5  SER A HB3  4  
ATOM 3404  H HG   . SER A 1 5  ? -28.236 -9.835  3.724   1.00 0.00 ? 5  SER A HG   4  
ATOM 3405  N N    . SER A 1 6  ? -23.764 -8.988  4.564   1.00 0.00 ? 6  SER A N    4  
ATOM 3406  C CA   . SER A 1 6  ? -22.368 -8.931  4.990   1.00 0.00 ? 6  SER A CA   4  
ATOM 3407  C C    . SER A 1 6  ? -21.835 -10.293 5.437   1.00 0.00 ? 6  SER A C    4  
ATOM 3408  O O    . SER A 1 6  ? -21.407 -10.475 6.581   1.00 0.00 ? 6  SER A O    4  
ATOM 3409  C CB   . SER A 1 6  ? -22.169 -7.810  6.014   1.00 0.00 ? 6  SER A CB   4  
ATOM 3410  O OG   . SER A 1 6  ? -23.143 -7.817  7.050   1.00 0.00 ? 6  SER A OG   4  
ATOM 3411  H H    . SER A 1 6  ? -23.964 -8.466  3.721   1.00 0.00 ? 6  SER A H    4  
ATOM 3412  H HA   . SER A 1 6  ? -21.773 -8.651  4.121   1.00 0.00 ? 6  SER A HA   4  
ATOM 3413  H HB2  . SER A 1 6  ? -21.173 -7.899  6.443   1.00 0.00 ? 6  SER A HB2  4  
ATOM 3414  H HB3  . SER A 1 6  ? -22.226 -6.856  5.492   1.00 0.00 ? 6  SER A HB3  4  
ATOM 3415  H HG   . SER A 1 6  ? -23.407 -8.736  7.197   1.00 0.00 ? 6  SER A HG   4  
ATOM 3416  N N    . GLY A 1 7  ? -21.876 -11.265 4.524   1.00 0.00 ? 7  GLY A N    4  
ATOM 3417  C CA   . GLY A 1 7  ? -21.229 -12.547 4.727   1.00 0.00 ? 7  GLY A CA   4  
ATOM 3418  C C    . GLY A 1 7  ? -19.740 -12.369 5.010   1.00 0.00 ? 7  GLY A C    4  
ATOM 3419  O O    . GLY A 1 7  ? -19.178 -11.310 4.708   1.00 0.00 ? 7  GLY A O    4  
ATOM 3420  H H    . GLY A 1 7  ? -22.335 -11.109 3.636   1.00 0.00 ? 7  GLY A H    4  
ATOM 3421  H HA2  . GLY A 1 7  ? -21.705 -13.060 5.565   1.00 0.00 ? 7  GLY A HA2  4  
ATOM 3422  H HA3  . GLY A 1 7  ? -21.340 -13.138 3.819   1.00 0.00 ? 7  GLY A HA3  4  
ATOM 3423  N N    . ARG A 1 8  ? -19.090 -13.403 5.543   1.00 0.00 ? 8  ARG A N    4  
ATOM 3424  C CA   . ARG A 1 8  ? -17.707 -13.359 6.033   1.00 0.00 ? 8  ARG A CA   4  
ATOM 3425  C C    . ARG A 1 8  ? -16.776 -12.692 5.020   1.00 0.00 ? 8  ARG A C    4  
ATOM 3426  O O    . ARG A 1 8  ? -16.173 -11.660 5.320   1.00 0.00 ? 8  ARG A O    4  
ATOM 3427  C CB   . ARG A 1 8  ? -17.219 -14.776 6.377   1.00 0.00 ? 8  ARG A CB   4  
ATOM 3428  C CG   . ARG A 1 8  ? -18.006 -15.430 7.520   1.00 0.00 ? 8  ARG A CG   4  
ATOM 3429  C CD   . ARG A 1 8  ? -17.535 -16.871 7.724   1.00 0.00 ? 8  ARG A CD   4  
ATOM 3430  N NE   . ARG A 1 8  ? -18.044 -17.442 8.981   1.00 0.00 ? 8  ARG A NE   4  
ATOM 3431  C CZ   . ARG A 1 8  ? -17.688 -18.619 9.508   1.00 0.00 ? 8  ARG A CZ   4  
ATOM 3432  N NH1  . ARG A 1 8  ? -16.826 -19.410 8.883   1.00 0.00 ? 8  ARG A NH1  4  
ATOM 3433  N NH2  . ARG A 1 8  ? -18.191 -18.984 10.683  1.00 0.00 ? 8  ARG A NH2  4  
ATOM 3434  H H    . ARG A 1 8  ? -19.622 -14.263 5.640   1.00 0.00 ? 8  ARG A H    4  
ATOM 3435  H HA   . ARG A 1 8  ? -17.682 -12.755 6.941   1.00 0.00 ? 8  ARG A HA   4  
ATOM 3436  H HB2  . ARG A 1 8  ? -17.289 -15.409 5.491   1.00 0.00 ? 8  ARG A HB2  4  
ATOM 3437  H HB3  . ARG A 1 8  ? -16.170 -14.715 6.669   1.00 0.00 ? 8  ARG A HB3  4  
ATOM 3438  H HG2  . ARG A 1 8  ? -17.853 -14.855 8.434   1.00 0.00 ? 8  ARG A HG2  4  
ATOM 3439  H HG3  . ARG A 1 8  ? -19.065 -15.452 7.277   1.00 0.00 ? 8  ARG A HG3  4  
ATOM 3440  H HD2  . ARG A 1 8  ? -17.868 -17.481 6.883   1.00 0.00 ? 8  ARG A HD2  4  
ATOM 3441  H HD3  . ARG A 1 8  ? -16.447 -16.877 7.751   1.00 0.00 ? 8  ARG A HD3  4  
ATOM 3442  H HE   . ARG A 1 8  ? -18.709 -16.868 9.495   1.00 0.00 ? 8  ARG A HE   4  
ATOM 3443  H HH11 . ARG A 1 8  ? -16.421 -19.145 7.983   1.00 0.00 ? 8  ARG A HH11 4  
ATOM 3444  H HH12 . ARG A 1 8  ? -16.635 -20.364 9.187   1.00 0.00 ? 8  ARG A HH12 4  
ATOM 3445  H HH21 . ARG A 1 8  ? -18.868 -18.398 11.153  1.00 0.00 ? 8  ARG A HH21 4  
ATOM 3446  H HH22 . ARG A 1 8  ? -17.895 -19.838 11.163  1.00 0.00 ? 8  ARG A HH22 4  
ATOM 3447  N N    . GLY A 1 9  ? -16.732 -13.223 3.805   1.00 0.00 ? 9  GLY A N    4  
ATOM 3448  C CA   . GLY A 1 9  ? -15.798 -12.856 2.761   1.00 0.00 ? 9  GLY A CA   4  
ATOM 3449  C C    . GLY A 1 9  ? -15.118 -14.130 2.291   1.00 0.00 ? 9  GLY A C    4  
ATOM 3450  O O    . GLY A 1 9  ? -14.746 -14.976 3.105   1.00 0.00 ? 9  GLY A O    4  
ATOM 3451  H H    . GLY A 1 9  ? -17.259 -14.075 3.633   1.00 0.00 ? 9  GLY A H    4  
ATOM 3452  H HA2  . GLY A 1 9  ? -16.336 -12.383 1.941   1.00 0.00 ? 9  GLY A HA2  4  
ATOM 3453  H HA3  . GLY A 1 9  ? -15.043 -12.176 3.152   1.00 0.00 ? 9  GLY A HA3  4  
ATOM 3454  N N    . ARG A 1 10 ? -14.968 -14.292 0.974   1.00 0.00 ? 10 ARG A N    4  
ATOM 3455  C CA   . ARG A 1 10 ? -14.355 -15.492 0.412   1.00 0.00 ? 10 ARG A CA   4  
ATOM 3456  C C    . ARG A 1 10 ? -12.870 -15.518 0.760   1.00 0.00 ? 10 ARG A C    4  
ATOM 3457  O O    . ARG A 1 10 ? -12.372 -16.534 1.237   1.00 0.00 ? 10 ARG A O    4  
ATOM 3458  C CB   . ARG A 1 10 ? -14.599 -15.511 -1.103  1.00 0.00 ? 10 ARG A CB   4  
ATOM 3459  C CG   . ARG A 1 10 ? -14.398 -16.895 -1.729  1.00 0.00 ? 10 ARG A CG   4  
ATOM 3460  C CD   . ARG A 1 10 ? -14.570 -16.779 -3.246  1.00 0.00 ? 10 ARG A CD   4  
ATOM 3461  N NE   . ARG A 1 10 ? -13.338 -16.329 -3.919  1.00 0.00 ? 10 ARG A NE   4  
ATOM 3462  C CZ   . ARG A 1 10 ? -12.447 -17.119 -4.530  1.00 0.00 ? 10 ARG A CZ   4  
ATOM 3463  N NH1  . ARG A 1 10 ? -12.538 -18.444 -4.467  1.00 0.00 ? 10 ARG A NH1  4  
ATOM 3464  N NH2  . ARG A 1 10 ? -11.456 -16.552 -5.201  1.00 0.00 ? 10 ARG A NH2  4  
ATOM 3465  H H    . ARG A 1 10 ? -15.288 -13.572 0.336   1.00 0.00 ? 10 ARG A H    4  
ATOM 3466  H HA   . ARG A 1 10 ? -14.831 -16.364 0.866   1.00 0.00 ? 10 ARG A HA   4  
ATOM 3467  H HB2  . ARG A 1 10 ? -15.633 -15.219 -1.293  1.00 0.00 ? 10 ARG A HB2  4  
ATOM 3468  H HB3  . ARG A 1 10 ? -13.942 -14.788 -1.588  1.00 0.00 ? 10 ARG A HB3  4  
ATOM 3469  H HG2  . ARG A 1 10 ? -13.414 -17.296 -1.488  1.00 0.00 ? 10 ARG A HG2  4  
ATOM 3470  H HG3  . ARG A 1 10 ? -15.160 -17.570 -1.338  1.00 0.00 ? 10 ARG A HG3  4  
ATOM 3471  H HD2  . ARG A 1 10 ? -14.880 -17.736 -3.655  1.00 0.00 ? 10 ARG A HD2  4  
ATOM 3472  H HD3  . ARG A 1 10 ? -15.375 -16.077 -3.457  1.00 0.00 ? 10 ARG A HD3  4  
ATOM 3473  H HE   . ARG A 1 10 ? -13.228 -15.327 -4.027  1.00 0.00 ? 10 ARG A HE   4  
ATOM 3474  H HH11 . ARG A 1 10 ? -13.278 -18.909 -3.937  1.00 0.00 ? 10 ARG A HH11 4  
ATOM 3475  H HH12 . ARG A 1 10 ? -11.993 -19.068 -5.070  1.00 0.00 ? 10 ARG A HH12 4  
ATOM 3476  H HH21 . ARG A 1 10 ? -11.379 -15.533 -5.236  1.00 0.00 ? 10 ARG A HH21 4  
ATOM 3477  H HH22 . ARG A 1 10 ? -10.780 -17.077 -5.745  1.00 0.00 ? 10 ARG A HH22 4  
ATOM 3478  N N    . TYR A 1 11 ? -12.179 -14.407 0.508   1.00 0.00 ? 11 TYR A N    4  
ATOM 3479  C CA   . TYR A 1 11 ? -10.781 -14.143 0.818   1.00 0.00 ? 11 TYR A CA   4  
ATOM 3480  C C    . TYR A 1 11 ? -10.640 -12.627 1.007   1.00 0.00 ? 11 TYR A C    4  
ATOM 3481  O O    . TYR A 1 11 ? -11.573 -11.873 0.699   1.00 0.00 ? 11 TYR A O    4  
ATOM 3482  C CB   . TYR A 1 11 ? -9.889  -14.614 -0.339  1.00 0.00 ? 11 TYR A CB   4  
ATOM 3483  C CG   . TYR A 1 11 ? -9.712  -16.114 -0.466  1.00 0.00 ? 11 TYR A CG   4  
ATOM 3484  C CD1  . TYR A 1 11 ? -8.759  -16.782 0.323   1.00 0.00 ? 11 TYR A CD1  4  
ATOM 3485  C CD2  . TYR A 1 11 ? -10.480 -16.840 -1.394  1.00 0.00 ? 11 TYR A CD2  4  
ATOM 3486  C CE1  . TYR A 1 11 ? -8.544  -18.163 0.164   1.00 0.00 ? 11 TYR A CE1  4  
ATOM 3487  C CE2  . TYR A 1 11 ? -10.300 -18.226 -1.532  1.00 0.00 ? 11 TYR A CE2  4  
ATOM 3488  C CZ   . TYR A 1 11 ? -9.311  -18.893 -0.770  1.00 0.00 ? 11 TYR A CZ   4  
ATOM 3489  O OH   . TYR A 1 11 ? -9.101  -20.230 -0.934  1.00 0.00 ? 11 TYR A OH   4  
ATOM 3490  H H    . TYR A 1 11 ? -12.674 -13.591 0.178   1.00 0.00 ? 11 TYR A H    4  
ATOM 3491  H HA   . TYR A 1 11 ? -10.496 -14.657 1.736   1.00 0.00 ? 11 TYR A HA   4  
ATOM 3492  H HB2  . TYR A 1 11 ? -10.291 -14.226 -1.273  1.00 0.00 ? 11 TYR A HB2  4  
ATOM 3493  H HB3  . TYR A 1 11 ? -8.901  -14.179 -0.214  1.00 0.00 ? 11 TYR A HB3  4  
ATOM 3494  H HD1  . TYR A 1 11 ? -8.179  -16.235 1.049   1.00 0.00 ? 11 TYR A HD1  4  
ATOM 3495  H HD2  . TYR A 1 11 ? -11.207 -16.326 -2.001  1.00 0.00 ? 11 TYR A HD2  4  
ATOM 3496  H HE1  . TYR A 1 11 ? -7.796  -18.664 0.763   1.00 0.00 ? 11 TYR A HE1  4  
ATOM 3497  H HE2  . TYR A 1 11 ? -10.899 -18.764 -2.248  1.00 0.00 ? 11 TYR A HE2  4  
ATOM 3498  H HH   . TYR A 1 11 ? -9.910  -20.673 -1.248  1.00 0.00 ? 11 TYR A HH   4  
ATOM 3499  N N    . ARG A 1 12 ? -9.478  -12.156 1.473   1.00 0.00 ? 12 ARG A N    4  
ATOM 3500  C CA   . ARG A 1 12 ? -9.156  -10.734 1.580   1.00 0.00 ? 12 ARG A CA   4  
ATOM 3501  C C    . ARG A 1 12 ? -7.678  -10.581 1.234   1.00 0.00 ? 12 ARG A C    4  
ATOM 3502  O O    . ARG A 1 12 ? -6.826  -10.835 2.085   1.00 0.00 ? 12 ARG A O    4  
ATOM 3503  C CB   . ARG A 1 12 ? -9.506  -10.212 2.990   1.00 0.00 ? 12 ARG A CB   4  
ATOM 3504  C CG   . ARG A 1 12 ? -9.571  -8.679  3.085   1.00 0.00 ? 12 ARG A CG   4  
ATOM 3505  C CD   . ARG A 1 12 ? -10.913 -8.149  2.562   1.00 0.00 ? 12 ARG A CD   4  
ATOM 3506  N NE   . ARG A 1 12 ? -10.953 -6.673  2.492   1.00 0.00 ? 12 ARG A NE   4  
ATOM 3507  C CZ   . ARG A 1 12 ? -11.076 -5.930  1.384   1.00 0.00 ? 12 ARG A CZ   4  
ATOM 3508  N NH1  . ARG A 1 12 ? -11.121 -6.494  0.185   1.00 0.00 ? 12 ARG A NH1  4  
ATOM 3509  N NH2  . ARG A 1 12 ? -11.162 -4.611  1.482   1.00 0.00 ? 12 ARG A NH2  4  
ATOM 3510  H H    . ARG A 1 12 ? -8.725  -12.804 1.669   1.00 0.00 ? 12 ARG A H    4  
ATOM 3511  H HA   . ARG A 1 12 ? -9.748  -10.190 0.843   1.00 0.00 ? 12 ARG A HA   4  
ATOM 3512  H HB2  . ARG A 1 12 ? -10.473 -10.612 3.293   1.00 0.00 ? 12 ARG A HB2  4  
ATOM 3513  H HB3  . ARG A 1 12 ? -8.768  -10.577 3.703   1.00 0.00 ? 12 ARG A HB3  4  
ATOM 3514  H HG2  . ARG A 1 12 ? -9.486  -8.397  4.134   1.00 0.00 ? 12 ARG A HG2  4  
ATOM 3515  H HG3  . ARG A 1 12 ? -8.742  -8.234  2.533   1.00 0.00 ? 12 ARG A HG3  4  
ATOM 3516  H HD2  . ARG A 1 12 ? -11.110 -8.583  1.584   1.00 0.00 ? 12 ARG A HD2  4  
ATOM 3517  H HD3  . ARG A 1 12 ? -11.702 -8.486  3.234   1.00 0.00 ? 12 ARG A HD3  4  
ATOM 3518  H HE   . ARG A 1 12 ? -10.942 -6.173  3.378   1.00 0.00 ? 12 ARG A HE   4  
ATOM 3519  H HH11 . ARG A 1 12 ? -11.165 -7.503  0.078   1.00 0.00 ? 12 ARG A HH11 4  
ATOM 3520  H HH12 . ARG A 1 12 ? -11.322 -5.957  -0.652  1.00 0.00 ? 12 ARG A HH12 4  
ATOM 3521  H HH21 . ARG A 1 12 ? -11.216 -4.161  2.390   1.00 0.00 ? 12 ARG A HH21 4  
ATOM 3522  H HH22 . ARG A 1 12 ? -11.266 -4.018  0.659   1.00 0.00 ? 12 ARG A HH22 4  
ATOM 3523  N N    . GLN A 1 13 ? -7.375  -10.283 -0.026  1.00 0.00 ? 13 GLN A N    4  
ATOM 3524  C CA   . GLN A 1 13 ? -6.034  -10.054 -0.539  1.00 0.00 ? 13 GLN A CA   4  
ATOM 3525  C C    . GLN A 1 13 ? -6.120  -8.867  -1.485  1.00 0.00 ? 13 GLN A C    4  
ATOM 3526  O O    . GLN A 1 13 ? -6.593  -9.020  -2.614  1.00 0.00 ? 13 GLN A O    4  
ATOM 3527  C CB   . GLN A 1 13 ? -5.481  -11.285 -1.277  1.00 0.00 ? 13 GLN A CB   4  
ATOM 3528  C CG   . GLN A 1 13 ? -4.980  -12.391 -0.342  1.00 0.00 ? 13 GLN A CG   4  
ATOM 3529  C CD   . GLN A 1 13 ? -6.035  -13.433 0.007   1.00 0.00 ? 13 GLN A CD   4  
ATOM 3530  O OE1  . GLN A 1 13 ? -6.410  -14.253 -0.827  1.00 0.00 ? 13 GLN A OE1  4  
ATOM 3531  N NE2  . GLN A 1 13 ? -6.490  -13.490 1.246   1.00 0.00 ? 13 GLN A NE2  4  
ATOM 3532  H H    . GLN A 1 13 ? -8.120  -10.113 -0.699  1.00 0.00 ? 13 GLN A H    4  
ATOM 3533  H HA   . GLN A 1 13 ? -5.359  -9.801  0.279   1.00 0.00 ? 13 GLN A HA   4  
ATOM 3534  H HB2  . GLN A 1 13 ? -6.225  -11.682 -1.969  1.00 0.00 ? 13 GLN A HB2  4  
ATOM 3535  H HB3  . GLN A 1 13 ? -4.627  -10.955 -1.868  1.00 0.00 ? 13 GLN A HB3  4  
ATOM 3536  H HG2  . GLN A 1 13 ? -4.168  -12.914 -0.849  1.00 0.00 ? 13 GLN A HG2  4  
ATOM 3537  H HG3  . GLN A 1 13 ? -4.566  -11.949 0.563   1.00 0.00 ? 13 GLN A HG3  4  
ATOM 3538  H HE21 . GLN A 1 13 ? -6.189  -12.768 1.898   1.00 0.00 ? 13 GLN A HE21 4  
ATOM 3539  H HE22 . GLN A 1 13 ? -6.826  -14.382 1.597   1.00 0.00 ? 13 GLN A HE22 4  
ATOM 3540  N N    . TYR A 1 14 ? -5.694  -7.688  -1.025  1.00 0.00 ? 14 TYR A N    4  
ATOM 3541  C CA   . TYR A 1 14 ? -5.654  -6.505  -1.876  1.00 0.00 ? 14 TYR A CA   4  
ATOM 3542  C C    . TYR A 1 14 ? -4.785  -6.779  -3.106  1.00 0.00 ? 14 TYR A C    4  
ATOM 3543  O O    . TYR A 1 14 ? -3.727  -7.398  -2.976  1.00 0.00 ? 14 TYR A O    4  
ATOM 3544  C CB   . TYR A 1 14 ? -5.149  -5.290  -1.091  1.00 0.00 ? 14 TYR A CB   4  
ATOM 3545  C CG   . TYR A 1 14 ? -3.694  -5.347  -0.620  1.00 0.00 ? 14 TYR A CG   4  
ATOM 3546  C CD1  . TYR A 1 14 ? -2.648  -5.009  -1.497  1.00 0.00 ? 14 TYR A CD1  4  
ATOM 3547  C CD2  . TYR A 1 14 ? -3.370  -5.727  0.698   1.00 0.00 ? 14 TYR A CD2  4  
ATOM 3548  C CE1  . TYR A 1 14 ? -1.305  -5.146  -1.117  1.00 0.00 ? 14 TYR A CE1  4  
ATOM 3549  C CE2  . TYR A 1 14 ? -2.025  -5.875  1.092   1.00 0.00 ? 14 TYR A CE2  4  
ATOM 3550  C CZ   . TYR A 1 14 ? -0.983  -5.601  0.177   1.00 0.00 ? 14 TYR A CZ   4  
ATOM 3551  O OH   . TYR A 1 14 ? 0.323   -5.751  0.528   1.00 0.00 ? 14 TYR A OH   4  
ATOM 3552  H H    . TYR A 1 14 ? -5.278  -7.643  -0.102  1.00 0.00 ? 14 TYR A H    4  
ATOM 3553  H HA   . TYR A 1 14 ? -6.673  -6.295  -2.197  1.00 0.00 ? 14 TYR A HA   4  
ATOM 3554  H HB2  . TYR A 1 14 ? -5.290  -4.425  -1.742  1.00 0.00 ? 14 TYR A HB2  4  
ATOM 3555  H HB3  . TYR A 1 14 ? -5.803  -5.155  -0.228  1.00 0.00 ? 14 TYR A HB3  4  
ATOM 3556  H HD1  . TYR A 1 14 ? -2.857  -4.624  -2.481  1.00 0.00 ? 14 TYR A HD1  4  
ATOM 3557  H HD2  . TYR A 1 14 ? -4.156  -5.916  1.412   1.00 0.00 ? 14 TYR A HD2  4  
ATOM 3558  H HE1  . TYR A 1 14 ? -0.532  -4.882  -1.825  1.00 0.00 ? 14 TYR A HE1  4  
ATOM 3559  H HE2  . TYR A 1 14 ? -1.797  -6.224  2.086   1.00 0.00 ? 14 TYR A HE2  4  
ATOM 3560  H HH   . TYR A 1 14 ? 0.460   -6.380  1.239   1.00 0.00 ? 14 TYR A HH   4  
ATOM 3561  N N    . ASN A 1 15 ? -5.215  -6.340  -4.290  1.00 0.00 ? 15 ASN A N    4  
ATOM 3562  C CA   . ASN A 1 15 ? -4.403  -6.381  -5.512  1.00 0.00 ? 15 ASN A CA   4  
ATOM 3563  C C    . ASN A 1 15 ? -3.272  -5.356  -5.434  1.00 0.00 ? 15 ASN A C    4  
ATOM 3564  O O    . ASN A 1 15 ? -3.387  -4.351  -4.738  1.00 0.00 ? 15 ASN A O    4  
ATOM 3565  C CB   . ASN A 1 15 ? -5.260  -6.119  -6.763  1.00 0.00 ? 15 ASN A CB   4  
ATOM 3566  C CG   . ASN A 1 15 ? -6.289  -7.218  -6.982  1.00 0.00 ? 15 ASN A CG   4  
ATOM 3567  O OD1  . ASN A 1 15 ? -5.948  -8.398  -7.009  1.00 0.00 ? 15 ASN A OD1  4  
ATOM 3568  N ND2  . ASN A 1 15 ? -7.556  -6.873  -7.145  1.00 0.00 ? 15 ASN A ND2  4  
ATOM 3569  H H    . ASN A 1 15 ? -6.155  -5.962  -4.325  1.00 0.00 ? 15 ASN A H    4  
ATOM 3570  H HA   . ASN A 1 15 ? -3.960  -7.373  -5.601  1.00 0.00 ? 15 ASN A HA   4  
ATOM 3571  H HB2  . ASN A 1 15 ? -5.742  -5.146  -6.680  1.00 0.00 ? 15 ASN A HB2  4  
ATOM 3572  H HB3  . ASN A 1 15 ? -4.610  -6.095  -7.640  1.00 0.00 ? 15 ASN A HB3  4  
ATOM 3573  H HD21 . ASN A 1 15 ? -7.849  -5.904  -7.055  1.00 0.00 ? 15 ASN A HD21 4  
ATOM 3574  H HD22 . ASN A 1 15 ? -8.255  -7.601  -7.094  1.00 0.00 ? 15 ASN A HD22 4  
ATOM 3575  N N    . SER A 1 16 ? -2.214  -5.552  -6.215  1.00 0.00 ? 16 SER A N    4  
ATOM 3576  C CA   . SER A 1 16 ? -1.074  -4.642  -6.325  1.00 0.00 ? 16 SER A CA   4  
ATOM 3577  C C    . SER A 1 16 ? -1.486  -3.202  -6.631  1.00 0.00 ? 16 SER A C    4  
ATOM 3578  O O    . SER A 1 16 ? -0.831  -2.252  -6.201  1.00 0.00 ? 16 SER A O    4  
ATOM 3579  C CB   . SER A 1 16 ? -0.163  -5.136  -7.453  1.00 0.00 ? 16 SER A CB   4  
ATOM 3580  O OG   . SER A 1 16 ? -0.895  -5.859  -8.443  1.00 0.00 ? 16 SER A OG   4  
ATOM 3581  H H    . SER A 1 16 ? -2.158  -6.358  -6.823  1.00 0.00 ? 16 SER A H    4  
ATOM 3582  H HA   . SER A 1 16 ? -0.517  -4.647  -5.387  1.00 0.00 ? 16 SER A HA   4  
ATOM 3583  H HB2  . SER A 1 16 ? 0.354   -4.270  -7.872  1.00 0.00 ? 16 SER A HB2  4  
ATOM 3584  H HB3  . SER A 1 16 ? 0.576   -5.807  -7.037  1.00 0.00 ? 16 SER A HB3  4  
ATOM 3585  H HG   . SER A 1 16 ? -0.827  -5.415  -9.321  1.00 0.00 ? 16 SER A HG   4  
ATOM 3586  N N    . GLU A 1 17 ? -2.547  -3.051  -7.415  1.00 0.00 ? 17 GLU A N    4  
ATOM 3587  C CA   . GLU A 1 17 ? -3.062  -1.765  -7.830  1.00 0.00 ? 17 GLU A CA   4  
ATOM 3588  C C    . GLU A 1 17 ? -3.873  -1.173  -6.675  1.00 0.00 ? 17 GLU A C    4  
ATOM 3589  O O    . GLU A 1 17 ? -3.643  -0.024  -6.330  1.00 0.00 ? 17 GLU A O    4  
ATOM 3590  C CB   . GLU A 1 17 ? -3.866  -1.951  -9.125  1.00 0.00 ? 17 GLU A CB   4  
ATOM 3591  C CG   . GLU A 1 17 ? -2.978  -2.486  -10.271 1.00 0.00 ? 17 GLU A CG   4  
ATOM 3592  C CD   . GLU A 1 17 ? -1.989  -1.448  -10.818 1.00 0.00 ? 17 GLU A CD   4  
ATOM 3593  O OE1  . GLU A 1 17 ? -2.427  -0.505  -11.519 1.00 0.00 ? 17 GLU A OE1  4  
ATOM 3594  O OE2  . GLU A 1 17 ? -0.764  -1.563  -10.580 1.00 0.00 ? 17 GLU A OE2  4  
ATOM 3595  H H    . GLU A 1 17 ? -2.976  -3.882  -7.794  1.00 0.00 ? 17 GLU A H    4  
ATOM 3596  H HA   . GLU A 1 17 ? -2.229  -1.089  -8.035  1.00 0.00 ? 17 GLU A HA   4  
ATOM 3597  H HB2  . GLU A 1 17 ? -4.673  -2.665  -8.933  1.00 0.00 ? 17 GLU A HB2  4  
ATOM 3598  H HB3  . GLU A 1 17 ? -4.307  -0.998  -9.422  1.00 0.00 ? 17 GLU A HB3  4  
ATOM 3599  H HG2  . GLU A 1 17 ? -2.426  -3.366  -9.926  1.00 0.00 ? 17 GLU A HG2  4  
ATOM 3600  H HG3  . GLU A 1 17 ? -3.627  -2.803  -11.087 1.00 0.00 ? 17 GLU A HG3  4  
ATOM 3601  N N    . ILE A 1 18 ? -4.739  -1.958  -6.013  1.00 0.00 ? 18 ILE A N    4  
ATOM 3602  C CA   . ILE A 1 18 ? -5.531  -1.561  -4.835  1.00 0.00 ? 18 ILE A CA   4  
ATOM 3603  C C    . ILE A 1 18 ? -4.636  -0.963  -3.753  1.00 0.00 ? 18 ILE A C    4  
ATOM 3604  O O    . ILE A 1 18 ? -5.048  -0.033  -3.061  1.00 0.00 ? 18 ILE A O    4  
ATOM 3605  C CB   . ILE A 1 18 ? -6.295  -2.786  -4.272  1.00 0.00 ? 18 ILE A CB   4  
ATOM 3606  C CG1  . ILE A 1 18 ? -7.396  -3.242  -5.252  1.00 0.00 ? 18 ILE A CG1  4  
ATOM 3607  C CG2  . ILE A 1 18 ? -6.858  -2.587  -2.845  1.00 0.00 ? 18 ILE A CG2  4  
ATOM 3608  C CD1  . ILE A 1 18 ? -8.751  -2.602  -4.963  1.00 0.00 ? 18 ILE A CD1  4  
ATOM 3609  H H    . ILE A 1 18 ? -4.776  -2.923  -6.293  1.00 0.00 ? 18 ILE A H    4  
ATOM 3610  H HA   . ILE A 1 18 ? -6.249  -0.797  -5.134  1.00 0.00 ? 18 ILE A HA   4  
ATOM 3611  H HB   . ILE A 1 18 ? -5.584  -3.602  -4.181  1.00 0.00 ? 18 ILE A HB   4  
ATOM 3612  H HG12 . ILE A 1 18 ? -7.116  -3.021  -6.282  1.00 0.00 ? 18 ILE A HG12 4  
ATOM 3613  H HG13 . ILE A 1 18 ? -7.512  -4.318  -5.171  1.00 0.00 ? 18 ILE A HG13 4  
ATOM 3614  H HG21 . ILE A 1 18 ? -7.511  -1.719  -2.800  1.00 0.00 ? 18 ILE A HG21 4  
ATOM 3615  H HG22 . ILE A 1 18 ? -7.399  -3.479  -2.527  1.00 0.00 ? 18 ILE A HG22 4  
ATOM 3616  H HG23 . ILE A 1 18 ? -6.050  -2.420  -2.142  1.00 0.00 ? 18 ILE A HG23 4  
ATOM 3617  H HD11 . ILE A 1 18 ? -8.647  -1.515  -4.942  1.00 0.00 ? 18 ILE A HD11 4  
ATOM 3618  H HD12 . ILE A 1 18 ? -9.460  -2.907  -5.726  1.00 0.00 ? 18 ILE A HD12 4  
ATOM 3619  H HD13 . ILE A 1 18 ? -9.106  -2.958  -3.996  1.00 0.00 ? 18 ILE A HD13 4  
ATOM 3620  N N    . LEU A 1 19 ? -3.443  -1.525  -3.571  1.00 0.00 ? 19 LEU A N    4  
ATOM 3621  C CA   . LEU A 1 19 ? -2.478  -0.999  -2.626  1.00 0.00 ? 19 LEU A CA   4  
ATOM 3622  C C    . LEU A 1 19 ? -2.136  0.447   -2.958  1.00 0.00 ? 19 LEU A C    4  
ATOM 3623  O O    . LEU A 1 19 ? -2.120  1.296   -2.073  1.00 0.00 ? 19 LEU A O    4  
ATOM 3624  C CB   . LEU A 1 19 ? -1.234  -1.889  -2.653  1.00 0.00 ? 19 LEU A CB   4  
ATOM 3625  C CG   . LEU A 1 19 ? -0.084  -1.334  -1.804  1.00 0.00 ? 19 LEU A CG   4  
ATOM 3626  C CD1  . LEU A 1 19 ? -0.471  -1.186  -0.324  1.00 0.00 ? 19 LEU A CD1  4  
ATOM 3627  C CD2  . LEU A 1 19 ? 1.084   -2.309  -1.920  1.00 0.00 ? 19 LEU A CD2  4  
ATOM 3628  H H    . LEU A 1 19 ? -3.183  -2.299  -4.170  1.00 0.00 ? 19 LEU A H    4  
ATOM 3629  H HA   . LEU A 1 19 ? -2.920  -1.020  -1.631  1.00 0.00 ? 19 LEU A HA   4  
ATOM 3630  H HB2  . LEU A 1 19 ? -1.517  -2.848  -2.256  1.00 0.00 ? 19 LEU A HB2  4  
ATOM 3631  H HB3  . LEU A 1 19 ? -0.890  -2.056  -3.680  1.00 0.00 ? 19 LEU A HB3  4  
ATOM 3632  H HG   . LEU A 1 19 ? 0.232   -0.369  -2.197  1.00 0.00 ? 19 LEU A HG   4  
ATOM 3633  H HD11 . LEU A 1 19 ? -1.238  -0.417  -0.217  1.00 0.00 ? 19 LEU A HD11 4  
ATOM 3634  H HD12 . LEU A 1 19 ? -0.844  -2.135  0.063   1.00 0.00 ? 19 LEU A HD12 4  
ATOM 3635  H HD13 . LEU A 1 19 ? 0.392   -0.867  0.255   1.00 0.00 ? 19 LEU A HD13 4  
ATOM 3636  H HD21 . LEU A 1 19 ? 0.838   -3.243  -1.414  1.00 0.00 ? 19 LEU A HD21 4  
ATOM 3637  H HD22 . LEU A 1 19 ? 1.287   -2.520  -2.972  1.00 0.00 ? 19 LEU A HD22 4  
ATOM 3638  H HD23 . LEU A 1 19 ? 1.960   -1.849  -1.477  1.00 0.00 ? 19 LEU A HD23 4  
ATOM 3639  N N    . GLU A 1 20 ? -1.838  0.701   -4.225  1.00 0.00 ? 20 GLU A N    4  
ATOM 3640  C CA   . GLU A 1 20 ? -1.473  1.999   -4.741  1.00 0.00 ? 20 GLU A CA   4  
ATOM 3641  C C    . GLU A 1 20 ? -2.636  2.975   -4.608  1.00 0.00 ? 20 GLU A C    4  
ATOM 3642  O O    . GLU A 1 20 ? -2.412  4.094   -4.161  1.00 0.00 ? 20 GLU A O    4  
ATOM 3643  C CB   . GLU A 1 20 ? -0.929  1.806   -6.161  1.00 0.00 ? 20 GLU A CB   4  
ATOM 3644  C CG   . GLU A 1 20 ? -1.599  2.584   -7.298  1.00 0.00 ? 20 GLU A CG   4  
ATOM 3645  C CD   . GLU A 1 20 ? -1.228  4.066   -7.294  1.00 0.00 ? 20 GLU A CD   4  
ATOM 3646  O OE1  . GLU A 1 20 ? -0.033  4.379   -7.511  1.00 0.00 ? 20 GLU A OE1  4  
ATOM 3647  O OE2  . GLU A 1 20 ? -2.133  4.916   -7.148  1.00 0.00 ? 20 GLU A OE2  4  
ATOM 3648  H H    . GLU A 1 20 ? -1.997  -0.018  -4.919  1.00 0.00 ? 20 GLU A H    4  
ATOM 3649  H HA   . GLU A 1 20 ? -0.665  2.382   -4.123  1.00 0.00 ? 20 GLU A HA   4  
ATOM 3650  H HB2  . GLU A 1 20 ? 0.123   2.061   -6.115  1.00 0.00 ? 20 GLU A HB2  4  
ATOM 3651  H HB3  . GLU A 1 20 ? -0.978  0.748   -6.424  1.00 0.00 ? 20 GLU A HB3  4  
ATOM 3652  H HG2  . GLU A 1 20 ? -1.239  2.154   -8.225  1.00 0.00 ? 20 GLU A HG2  4  
ATOM 3653  H HG3  . GLU A 1 20 ? -2.682  2.452   -7.279  1.00 0.00 ? 20 GLU A HG3  4  
ATOM 3654  N N    . GLU A 1 21 ? -3.865  2.546   -4.901  1.00 0.00 ? 21 GLU A N    4  
ATOM 3655  C CA   . GLU A 1 21 ? -5.066  3.323   -4.687  1.00 0.00 ? 21 GLU A CA   4  
ATOM 3656  C C    . GLU A 1 21 ? -5.124  3.817   -3.259  1.00 0.00 ? 21 GLU A C    4  
ATOM 3657  O O    . GLU A 1 21 ? -5.207  5.019   -3.019  1.00 0.00 ? 21 GLU A O    4  
ATOM 3658  C CB   . GLU A 1 21 ? -6.287  2.484   -4.968  1.00 0.00 ? 21 GLU A CB   4  
ATOM 3659  C CG   . GLU A 1 21 ? -6.451  1.836   -6.328  1.00 0.00 ? 21 GLU A CG   4  
ATOM 3660  C CD   . GLU A 1 21 ? -6.702  2.783   -7.493  1.00 0.00 ? 21 GLU A CD   4  
ATOM 3661  O OE1  . GLU A 1 21 ? -6.225  3.941   -7.494  1.00 0.00 ? 21 GLU A OE1  4  
ATOM 3662  O OE2  . GLU A 1 21 ? -7.299  2.286   -8.471  1.00 0.00 ? 21 GLU A OE2  4  
ATOM 3663  H H    . GLU A 1 21 ? -4.004  1.625   -5.297  1.00 0.00 ? 21 GLU A H    4  
ATOM 3664  H HA   . GLU A 1 21 ? -5.138  4.180   -5.334  1.00 0.00 ? 21 GLU A HA   4  
ATOM 3665  H HB2  . GLU A 1 21 ? -6.369  1.693   -4.230  1.00 0.00 ? 21 GLU A HB2  4  
ATOM 3666  H HB3  . GLU A 1 21 ? -7.088  3.176   -4.823  1.00 0.00 ? 21 GLU A HB3  4  
ATOM 3667  H HG2  . GLU A 1 21 ? -5.587  1.241   -6.569  1.00 0.00 ? 21 GLU A HG2  4  
ATOM 3668  H HG3  . GLU A 1 21 ? -7.285  1.147   -6.219  1.00 0.00 ? 21 GLU A HG3  4  
ATOM 3669  N N    . ALA A 1 22 ? -5.048  2.874   -2.324  1.00 0.00 ? 22 ALA A N    4  
ATOM 3670  C CA   . ALA A 1 22 ? -5.136  3.111   -0.893  1.00 0.00 ? 22 ALA A CA   4  
ATOM 3671  C C    . ALA A 1 22 ? -3.996  3.980   -0.374  1.00 0.00 ? 22 ALA A C    4  
ATOM 3672  O O    . ALA A 1 22 ? -4.104  4.526   0.724   1.00 0.00 ? 22 ALA A O    4  
ATOM 3673  C CB   . ALA A 1 22 ? -5.116  1.765   -0.188  1.00 0.00 ? 22 ALA A CB   4  
ATOM 3674  H H    . ALA A 1 22 ? -4.933  1.925   -2.676  1.00 0.00 ? 22 ALA A H    4  
ATOM 3675  H HA   . ALA A 1 22 ? -6.080  3.612   -0.667  1.00 0.00 ? 22 ALA A HA   4  
ATOM 3676  H HB1  . ALA A 1 22 ? -5.490  1.884   0.827   1.00 0.00 ? 22 ALA A HB1  4  
ATOM 3677  H HB2  . ALA A 1 22 ? -5.751  1.077   -0.736  1.00 0.00 ? 22 ALA A HB2  4  
ATOM 3678  H HB3  . ALA A 1 22 ? -4.102  1.370   -0.172  1.00 0.00 ? 22 ALA A HB3  4  
ATOM 3679  N N    . ILE A 1 23 ? -2.918  4.116   -1.141  1.00 0.00 ? 23 ILE A N    4  
ATOM 3680  C CA   . ILE A 1 23 ? -1.841  5.042   -0.822  1.00 0.00 ? 23 ILE A CA   4  
ATOM 3681  C C    . ILE A 1 23 ? -2.236  6.410   -1.378  1.00 0.00 ? 23 ILE A C    4  
ATOM 3682  O O    . ILE A 1 23 ? -2.294  7.380   -0.622  1.00 0.00 ? 23 ILE A O    4  
ATOM 3683  C CB   . ILE A 1 23 ? -0.526  4.445   -1.354  1.00 0.00 ? 23 ILE A CB   4  
ATOM 3684  C CG1  . ILE A 1 23 ? -0.119  3.299   -0.406  1.00 0.00 ? 23 ILE A CG1  4  
ATOM 3685  C CG2  . ILE A 1 23 ? 0.635   5.450   -1.477  1.00 0.00 ? 23 ILE A CG2  4  
ATOM 3686  C CD1  . ILE A 1 23 ? 0.790   2.299   -1.109  1.00 0.00 ? 23 ILE A CD1  4  
ATOM 3687  H H    . ILE A 1 23 ? -2.921  3.633   -2.046  1.00 0.00 ? 23 ILE A H    4  
ATOM 3688  H HA   . ILE A 1 23 ? -1.758  5.144   0.261   1.00 0.00 ? 23 ILE A HA   4  
ATOM 3689  H HB   . ILE A 1 23 ? -0.736  4.032   -2.341  1.00 0.00 ? 23 ILE A HB   4  
ATOM 3690  H HG12 . ILE A 1 23 ? 0.406   3.704   0.457   1.00 0.00 ? 23 ILE A HG12 4  
ATOM 3691  H HG13 . ILE A 1 23 ? -1.003  2.771   -0.032  1.00 0.00 ? 23 ILE A HG13 4  
ATOM 3692  H HG21 . ILE A 1 23 ? 1.536   4.971   -1.868  1.00 0.00 ? 23 ILE A HG21 4  
ATOM 3693  H HG22 . ILE A 1 23 ? 0.366   6.242   -2.171  1.00 0.00 ? 23 ILE A HG22 4  
ATOM 3694  H HG23 . ILE A 1 23 ? 0.852   5.902   -0.512  1.00 0.00 ? 23 ILE A HG23 4  
ATOM 3695  H HD11 . ILE A 1 23 ? 0.408   2.068   -2.101  1.00 0.00 ? 23 ILE A HD11 4  
ATOM 3696  H HD12 . ILE A 1 23 ? 1.794   2.715   -1.192  1.00 0.00 ? 23 ILE A HD12 4  
ATOM 3697  H HD13 . ILE A 1 23 ? 0.803   1.383   -0.527  1.00 0.00 ? 23 ILE A HD13 4  
ATOM 3698  N N    . SER A 1 24 ? -2.587  6.479   -2.660  1.00 0.00 ? 24 SER A N    4  
ATOM 3699  C CA   . SER A 1 24 ? -3.023  7.675   -3.358  1.00 0.00 ? 24 SER A CA   4  
ATOM 3700  C C    . SER A 1 24 ? -4.158  8.400   -2.622  1.00 0.00 ? 24 SER A C    4  
ATOM 3701  O O    . SER A 1 24 ? -4.066  9.621   -2.489  1.00 0.00 ? 24 SER A O    4  
ATOM 3702  C CB   . SER A 1 24 ? -3.391  7.284   -4.800  1.00 0.00 ? 24 SER A CB   4  
ATOM 3703  O OG   . SER A 1 24 ? -2.206  6.922   -5.488  1.00 0.00 ? 24 SER A OG   4  
ATOM 3704  H H    . SER A 1 24 ? -2.569  5.631   -3.221  1.00 0.00 ? 24 SER A H    4  
ATOM 3705  H HA   . SER A 1 24 ? -2.175  8.364   -3.391  1.00 0.00 ? 24 SER A HA   4  
ATOM 3706  H HB2  . SER A 1 24 ? -4.087  6.445   -4.800  1.00 0.00 ? 24 SER A HB2  4  
ATOM 3707  H HB3  . SER A 1 24 ? -3.857  8.131   -5.303  1.00 0.00 ? 24 SER A HB3  4  
ATOM 3708  H HG   . SER A 1 24 ? -2.374  6.165   -6.110  1.00 0.00 ? 24 SER A HG   4  
ATOM 3709  N N    . VAL A 1 25 ? -5.173  7.708   -2.082  1.00 0.00 ? 25 VAL A N    4  
ATOM 3710  C CA   . VAL A 1 25 ? -6.230  8.335   -1.289  1.00 0.00 ? 25 VAL A CA   4  
ATOM 3711  C C    . VAL A 1 25 ? -5.641  9.054   -0.080  1.00 0.00 ? 25 VAL A C    4  
ATOM 3712  O O    . VAL A 1 25 ? -5.889  10.238  0.102   1.00 0.00 ? 25 VAL A O    4  
ATOM 3713  C CB   . VAL A 1 25 ? -7.346  7.341   -0.874  1.00 0.00 ? 25 VAL A CB   4  
ATOM 3714  C CG1  . VAL A 1 25 ? -8.508  7.407   -1.864  1.00 0.00 ? 25 VAL A CG1  4  
ATOM 3715  C CG2  . VAL A 1 25 ? -6.910  5.918   -0.624  1.00 0.00 ? 25 VAL A CG2  4  
ATOM 3716  H H    . VAL A 1 25 ? -5.226  6.704   -2.231  1.00 0.00 ? 25 VAL A H    4  
ATOM 3717  H HA   . VAL A 1 25 ? -6.670  9.104   -1.921  1.00 0.00 ? 25 VAL A HA   4  
ATOM 3718  H HB   . VAL A 1 25 ? -7.743  7.589   0.099   1.00 0.00 ? 25 VAL A HB   4  
ATOM 3719  H HG11 . VAL A 1 25 ? -8.786  8.437   -2.063  1.00 0.00 ? 25 VAL A HG11 4  
ATOM 3720  H HG12 . VAL A 1 25 ? -8.219  6.934   -2.801  1.00 0.00 ? 25 VAL A HG12 4  
ATOM 3721  H HG13 . VAL A 1 25 ? -9.373  6.901   -1.441  1.00 0.00 ? 25 VAL A HG13 4  
ATOM 3722  H HG21 . VAL A 1 25 ? -7.540  5.477   0.146   1.00 0.00 ? 25 VAL A HG21 4  
ATOM 3723  H HG22 . VAL A 1 25 ? -7.016  5.342   -1.536  1.00 0.00 ? 25 VAL A HG22 4  
ATOM 3724  H HG23 . VAL A 1 25 ? -5.887  5.906   -0.268  1.00 0.00 ? 25 VAL A HG23 4  
ATOM 3725  N N    . VAL A 1 26 ? -4.880  8.354   0.748   1.00 0.00 ? 26 VAL A N    4  
ATOM 3726  C CA   . VAL A 1 26 ? -4.273  8.857   1.974   1.00 0.00 ? 26 VAL A CA   4  
ATOM 3727  C C    . VAL A 1 26 ? -3.352  10.041  1.671   1.00 0.00 ? 26 VAL A C    4  
ATOM 3728  O O    . VAL A 1 26 ? -3.491  11.079  2.317   1.00 0.00 ? 26 VAL A O    4  
ATOM 3729  C CB   . VAL A 1 26 ? -3.573  7.705   2.725   1.00 0.00 ? 26 VAL A CB   4  
ATOM 3730  C CG1  . VAL A 1 26 ? -2.879  8.185   4.007   1.00 0.00 ? 26 VAL A CG1  4  
ATOM 3731  C CG2  . VAL A 1 26 ? -4.597  6.630   3.122   1.00 0.00 ? 26 VAL A CG2  4  
ATOM 3732  H H    . VAL A 1 26 ? -4.729  7.398   0.495   1.00 0.00 ? 26 VAL A H    4  
ATOM 3733  H HA   . VAL A 1 26 ? -5.072  9.232   2.607   1.00 0.00 ? 26 VAL A HA   4  
ATOM 3734  H HB   . VAL A 1 26 ? -2.824  7.251   2.075   1.00 0.00 ? 26 VAL A HB   4  
ATOM 3735  H HG11 . VAL A 1 26 ? -2.449  7.334   4.531   1.00 0.00 ? 26 VAL A HG11 4  
ATOM 3736  H HG12 . VAL A 1 26 ? -2.069  8.873   3.761   1.00 0.00 ? 26 VAL A HG12 4  
ATOM 3737  H HG13 . VAL A 1 26 ? -3.593  8.692   4.657   1.00 0.00 ? 26 VAL A HG13 4  
ATOM 3738  H HG21 . VAL A 1 26 ? -4.085  5.790   3.594   1.00 0.00 ? 26 VAL A HG21 4  
ATOM 3739  H HG22 . VAL A 1 26 ? -5.337  7.049   3.801   1.00 0.00 ? 26 VAL A HG22 4  
ATOM 3740  H HG23 . VAL A 1 26 ? -5.113  6.245   2.246   1.00 0.00 ? 26 VAL A HG23 4  
ATOM 3741  N N    . MET A 1 27 ? -2.479  9.937   0.667   1.00 0.00 ? 27 MET A N    4  
ATOM 3742  C CA   . MET A 1 27 ? -1.600  11.024  0.240   1.00 0.00 ? 27 MET A CA   4  
ATOM 3743  C C    . MET A 1 27 ? -2.421  12.251  -0.149  1.00 0.00 ? 27 MET A C    4  
ATOM 3744  O O    . MET A 1 27 ? -2.182  13.359  0.325   1.00 0.00 ? 27 MET A O    4  
ATOM 3745  C CB   . MET A 1 27 ? -0.765  10.577  -0.961  1.00 0.00 ? 27 MET A CB   4  
ATOM 3746  C CG   . MET A 1 27 ? 0.266   9.530   -0.567  1.00 0.00 ? 27 MET A CG   4  
ATOM 3747  S SD   . MET A 1 27 ? 1.258   9.018   -1.979  1.00 0.00 ? 27 MET A SD   4  
ATOM 3748  C CE   . MET A 1 27 ? 2.822   8.847   -1.112  1.00 0.00 ? 27 MET A CE   4  
ATOM 3749  H H    . MET A 1 27 ? -2.419  9.054   0.166   1.00 0.00 ? 27 MET A H    4  
ATOM 3750  H HA   . MET A 1 27 ? -0.935  11.287  1.065   1.00 0.00 ? 27 MET A HA   4  
ATOM 3751  H HB2  . MET A 1 27 ? -1.414  10.172  -1.738  1.00 0.00 ? 27 MET A HB2  4  
ATOM 3752  H HB3  . MET A 1 27 ? -0.237  11.442  -1.366  1.00 0.00 ? 27 MET A HB3  4  
ATOM 3753  H HG2  . MET A 1 27 ? 0.914   9.967   0.189   1.00 0.00 ? 27 MET A HG2  4  
ATOM 3754  H HG3  . MET A 1 27 ? -0.219  8.655   -0.136  1.00 0.00 ? 27 MET A HG3  4  
ATOM 3755  H HE1  . MET A 1 27 ? 2.768   8.027   -0.392  1.00 0.00 ? 27 MET A HE1  4  
ATOM 3756  H HE2  . MET A 1 27 ? 3.594   8.668   -1.850  1.00 0.00 ? 27 MET A HE2  4  
ATOM 3757  H HE3  . MET A 1 27 ? 3.052   9.777   -0.598  1.00 0.00 ? 27 MET A HE3  4  
ATOM 3758  N N    . SER A 1 28 ? -3.434  12.039  -0.985  1.00 0.00 ? 28 SER A N    4  
ATOM 3759  C CA   . SER A 1 28 ? -4.407  13.036  -1.400  1.00 0.00 ? 28 SER A CA   4  
ATOM 3760  C C    . SER A 1 28 ? -5.349  13.469  -0.266  1.00 0.00 ? 28 SER A C    4  
ATOM 3761  O O    . SER A 1 28 ? -6.258  14.262  -0.511  1.00 0.00 ? 28 SER A O    4  
ATOM 3762  C CB   . SER A 1 28 ? -5.235  12.419  -2.519  1.00 0.00 ? 28 SER A CB   4  
ATOM 3763  O OG   . SER A 1 28 ? -4.478  12.114  -3.677  1.00 0.00 ? 28 SER A OG   4  
ATOM 3764  H H    . SER A 1 28 ? -3.591  11.087  -1.301  1.00 0.00 ? 28 SER A H    4  
ATOM 3765  H HA   . SER A 1 28 ? -3.893  13.920  -1.780  1.00 0.00 ? 28 SER A HA   4  
ATOM 3766  H HB2  . SER A 1 28 ? -5.640  11.487  -2.148  1.00 0.00 ? 28 SER A HB2  4  
ATOM 3767  H HB3  . SER A 1 28 ? -6.078  13.066  -2.771  1.00 0.00 ? 28 SER A HB3  4  
ATOM 3768  H HG   . SER A 1 28 ? -3.992  11.286  -3.497  1.00 0.00 ? 28 SER A HG   4  
ATOM 3769  N N    . GLY A 1 29 ? -5.200  12.948  0.954   1.00 0.00 ? 29 GLY A N    4  
ATOM 3770  C CA   . GLY A 1 29 ? -6.027  13.285  2.098   1.00 0.00 ? 29 GLY A CA   4  
ATOM 3771  C C    . GLY A 1 29 ? -7.498  12.919  1.929   1.00 0.00 ? 29 GLY A C    4  
ATOM 3772  O O    . GLY A 1 29 ? -8.351  13.541  2.573   1.00 0.00 ? 29 GLY A O    4  
ATOM 3773  H H    . GLY A 1 29 ? -4.436  12.303  1.122   1.00 0.00 ? 29 GLY A H    4  
ATOM 3774  H HA2  . GLY A 1 29 ? -5.651  12.757  2.971   1.00 0.00 ? 29 GLY A HA2  4  
ATOM 3775  H HA3  . GLY A 1 29 ? -5.945  14.352  2.275   1.00 0.00 ? 29 GLY A HA3  4  
ATOM 3776  N N    . LYS A 1 30 ? -7.839  11.919  1.105   1.00 0.00 ? 30 LYS A N    4  
ATOM 3777  C CA   . LYS A 1 30 ? -9.217  11.433  1.061   1.00 0.00 ? 30 LYS A CA   4  
ATOM 3778  C C    . LYS A 1 30 ? -9.574  10.772  2.397   1.00 0.00 ? 30 LYS A C    4  
ATOM 3779  O O    . LYS A 1 30 ? -10.752 10.728  2.751   1.00 0.00 ? 30 LYS A O    4  
ATOM 3780  C CB   . LYS A 1 30 ? -9.444  10.470  -0.114  1.00 0.00 ? 30 LYS A CB   4  
ATOM 3781  C CG   . LYS A 1 30 ? -9.607  11.158  -1.487  1.00 0.00 ? 30 LYS A CG   4  
ATOM 3782  C CD   . LYS A 1 30 ? -8.316  11.561  -2.200  1.00 0.00 ? 30 LYS A CD   4  
ATOM 3783  C CE   . LYS A 1 30 ? -8.258  10.965  -3.633  1.00 0.00 ? 30 LYS A CE   4  
ATOM 3784  N NZ   . LYS A 1 30 ? -7.356  11.660  -4.588  1.00 0.00 ? 30 LYS A NZ   4  
ATOM 3785  H H    . LYS A 1 30 ? -7.098  11.349  0.684   1.00 0.00 ? 30 LYS A H    4  
ATOM 3786  H HA   . LYS A 1 30 ? -9.881  12.288  0.932   1.00 0.00 ? 30 LYS A HA   4  
ATOM 3787  H HB2  . LYS A 1 30 ? -8.638  9.741   -0.142  1.00 0.00 ? 30 LYS A HB2  4  
ATOM 3788  H HB3  . LYS A 1 30 ? -10.368 9.923   0.080   1.00 0.00 ? 30 LYS A HB3  4  
ATOM 3789  H HG2  . LYS A 1 30 ? -10.114 10.462  -2.142  1.00 0.00 ? 30 LYS A HG2  4  
ATOM 3790  H HG3  . LYS A 1 30 ? -10.233 12.042  -1.386  1.00 0.00 ? 30 LYS A HG3  4  
ATOM 3791  H HD2  . LYS A 1 30 ? -8.260  12.649  -2.216  1.00 0.00 ? 30 LYS A HD2  4  
ATOM 3792  H HD3  . LYS A 1 30 ? -7.494  11.190  -1.605  1.00 0.00 ? 30 LYS A HD3  4  
ATOM 3793  H HE2  . LYS A 1 30 ? -7.969  9.914   -3.573  1.00 0.00 ? 30 LYS A HE2  4  
ATOM 3794  H HE3  . LYS A 1 30 ? -9.262  11.000  -4.059  1.00 0.00 ? 30 LYS A HE3  4  
ATOM 3795  H HZ1  . LYS A 1 30 ? -7.373  11.194  -5.493  1.00 0.00 ? 30 LYS A HZ1  4  
ATOM 3796  H HZ2  . LYS A 1 30 ? -7.651  12.625  -4.733  1.00 0.00 ? 30 LYS A HZ2  4  
ATOM 3797  H HZ3  . LYS A 1 30 ? -6.388  11.671  -4.295  1.00 0.00 ? 30 LYS A HZ3  4  
ATOM 3798  N N    . MET A 1 31 ? -8.587  10.261  3.137   1.00 0.00 ? 31 MET A N    4  
ATOM 3799  C CA   . MET A 1 31 ? -8.744  9.683   4.464   1.00 0.00 ? 31 MET A CA   4  
ATOM 3800  C C    . MET A 1 31 ? -7.374  9.511   5.127   1.00 0.00 ? 31 MET A C    4  
ATOM 3801  O O    . MET A 1 31 ? -6.359  9.823   4.509   1.00 0.00 ? 31 MET A O    4  
ATOM 3802  C CB   . MET A 1 31 ? -9.442  8.326   4.356   1.00 0.00 ? 31 MET A CB   4  
ATOM 3803  C CG   . MET A 1 31 ? -8.713  7.299   3.513   1.00 0.00 ? 31 MET A CG   4  
ATOM 3804  S SD   . MET A 1 31 ? -9.802  5.961   2.992   1.00 0.00 ? 31 MET A SD   4  
ATOM 3805  C CE   . MET A 1 31 ? -10.607 6.718   1.586   1.00 0.00 ? 31 MET A CE   4  
ATOM 3806  H H    . MET A 1 31 ? -7.627  10.312  2.820   1.00 0.00 ? 31 MET A H    4  
ATOM 3807  H HA   . MET A 1 31 ? -9.346  10.357  5.076   1.00 0.00 ? 31 MET A HA   4  
ATOM 3808  H HB2  . MET A 1 31 ? -9.521  7.921   5.348   1.00 0.00 ? 31 MET A HB2  4  
ATOM 3809  H HB3  . MET A 1 31 ? -10.445 8.416   3.969   1.00 0.00 ? 31 MET A HB3  4  
ATOM 3810  H HG2  . MET A 1 31 ? -8.285  7.763   2.628   1.00 0.00 ? 31 MET A HG2  4  
ATOM 3811  H HG3  . MET A 1 31 ? -7.918  6.887   4.130   1.00 0.00 ? 31 MET A HG3  4  
ATOM 3812  H HE1  . MET A 1 31 ? -11.274 5.986   1.137   1.00 0.00 ? 31 MET A HE1  4  
ATOM 3813  H HE2  . MET A 1 31 ? -11.167 7.585   1.920   1.00 0.00 ? 31 MET A HE2  4  
ATOM 3814  H HE3  . MET A 1 31 ? -9.842  7.011   0.875   1.00 0.00 ? 31 MET A HE3  4  
ATOM 3815  N N    . SER A 1 32 ? -7.353  8.983   6.354   1.00 0.00 ? 32 SER A N    4  
ATOM 3816  C CA   . SER A 1 32 ? -6.140  8.624   7.088   1.00 0.00 ? 32 SER A CA   4  
ATOM 3817  C C    . SER A 1 32 ? -5.657  7.222   6.694   1.00 0.00 ? 32 SER A C    4  
ATOM 3818  O O    . SER A 1 32 ? -6.433  6.465   6.102   1.00 0.00 ? 32 SER A O    4  
ATOM 3819  C CB   . SER A 1 32 ? -6.420  8.646   8.603   1.00 0.00 ? 32 SER A CB   4  
ATOM 3820  O OG   . SER A 1 32 ? -7.673  9.224   8.943   1.00 0.00 ? 32 SER A OG   4  
ATOM 3821  H H    . SER A 1 32 ? -8.215  8.717   6.810   1.00 0.00 ? 32 SER A H    4  
ATOM 3822  H HA   . SER A 1 32 ? -5.360  9.350   6.858   1.00 0.00 ? 32 SER A HA   4  
ATOM 3823  H HB2  . SER A 1 32 ? -6.405  7.626   8.990   1.00 0.00 ? 32 SER A HB2  4  
ATOM 3824  H HB3  . SER A 1 32 ? -5.621  9.199   9.090   1.00 0.00 ? 32 SER A HB3  4  
ATOM 3825  H HG   . SER A 1 32 ? -7.628  10.177  8.694   1.00 0.00 ? 32 SER A HG   4  
ATOM 3826  N N    . VAL A 1 33 ? -4.444  6.837   7.122   1.00 0.00 ? 33 VAL A N    4  
ATOM 3827  C CA   . VAL A 1 33 ? -3.939  5.465   7.008   1.00 0.00 ? 33 VAL A CA   4  
ATOM 3828  C C    . VAL A 1 33 ? -4.973  4.496   7.584   1.00 0.00 ? 33 VAL A C    4  
ATOM 3829  O O    . VAL A 1 33 ? -5.466  3.652   6.843   1.00 0.00 ? 33 VAL A O    4  
ATOM 3830  C CB   . VAL A 1 33 ? -2.545  5.290   7.664   1.00 0.00 ? 33 VAL A CB   4  
ATOM 3831  C CG1  . VAL A 1 33 ? -2.044  3.840   7.600   1.00 0.00 ? 33 VAL A CG1  4  
ATOM 3832  C CG2  . VAL A 1 33 ? -1.484  6.176   6.999   1.00 0.00 ? 33 VAL A CG2  4  
ATOM 3833  H H    . VAL A 1 33 ? -3.847  7.523   7.575   1.00 0.00 ? 33 VAL A H    4  
ATOM 3834  H HA   . VAL A 1 33 ? -3.840  5.238   5.946   1.00 0.00 ? 33 VAL A HA   4  
ATOM 3835  H HB   . VAL A 1 33 ? -2.591  5.559   8.716   1.00 0.00 ? 33 VAL A HB   4  
ATOM 3836  H HG11 . VAL A 1 33 ? -1.846  3.549   6.573   1.00 0.00 ? 33 VAL A HG11 4  
ATOM 3837  H HG12 . VAL A 1 33 ? -1.119  3.767   8.154   1.00 0.00 ? 33 VAL A HG12 4  
ATOM 3838  H HG13 . VAL A 1 33 ? -2.746  3.143   8.063   1.00 0.00 ? 33 VAL A HG13 4  
ATOM 3839  H HG21 . VAL A 1 33 ? -1.772  7.225   7.047   1.00 0.00 ? 33 VAL A HG21 4  
ATOM 3840  H HG22 . VAL A 1 33 ? -0.537  6.059   7.526   1.00 0.00 ? 33 VAL A HG22 4  
ATOM 3841  H HG23 . VAL A 1 33 ? -1.348  5.884   5.957   1.00 0.00 ? 33 VAL A HG23 4  
ATOM 3842  N N    . SER A 1 34 ? -5.336  4.609   8.869   1.00 0.00 ? 34 SER A N    4  
ATOM 3843  C CA   . SER A 1 34 ? -6.184  3.607   9.517   1.00 0.00 ? 34 SER A CA   4  
ATOM 3844  C C    . SER A 1 34 ? -7.522  3.408   8.795   1.00 0.00 ? 34 SER A C    4  
ATOM 3845  O O    . SER A 1 34 ? -8.073  2.307   8.738   1.00 0.00 ? 34 SER A O    4  
ATOM 3846  C CB   . SER A 1 34 ? -6.411  3.993   10.983  1.00 0.00 ? 34 SER A CB   4  
ATOM 3847  O OG   . SER A 1 34 ? -7.071  5.241   11.081  1.00 0.00 ? 34 SER A OG   4  
ATOM 3848  H H    . SER A 1 34 ? -4.909  5.307   9.471   1.00 0.00 ? 34 SER A H    4  
ATOM 3849  H HA   . SER A 1 34 ? -5.644  2.666   9.485   1.00 0.00 ? 34 SER A HA   4  
ATOM 3850  H HB2  . SER A 1 34 ? -7.017  3.225   11.465  1.00 0.00 ? 34 SER A HB2  4  
ATOM 3851  H HB3  . SER A 1 34 ? -5.459  4.055   11.503  1.00 0.00 ? 34 SER A HB3  4  
ATOM 3852  H HG   . SER A 1 34 ? -8.005  5.019   11.258  1.00 0.00 ? 34 SER A HG   4  
ATOM 3853  N N    . LYS A 1 35 ? -8.057  4.494   8.240   1.00 0.00 ? 35 LYS A N    4  
ATOM 3854  C CA   . LYS A 1 35 ? -9.305  4.501   7.505   1.00 0.00 ? 35 LYS A CA   4  
ATOM 3855  C C    . LYS A 1 35 ? -9.112  3.658   6.252   1.00 0.00 ? 35 LYS A C    4  
ATOM 3856  O O    . LYS A 1 35 ? -9.658  2.558   6.188   1.00 0.00 ? 35 LYS A O    4  
ATOM 3857  C CB   . LYS A 1 35 ? -9.717  5.953   7.287   1.00 0.00 ? 35 LYS A CB   4  
ATOM 3858  C CG   . LYS A 1 35 ? -11.050 6.116   6.541   1.00 0.00 ? 35 LYS A CG   4  
ATOM 3859  C CD   . LYS A 1 35 ? -11.833 7.288   7.128   1.00 0.00 ? 35 LYS A CD   4  
ATOM 3860  C CE   . LYS A 1 35 ? -12.962 7.786   6.223   1.00 0.00 ? 35 LYS A CE   4  
ATOM 3861  N NZ   . LYS A 1 35 ? -13.774 8.811   6.915   1.00 0.00 ? 35 LYS A NZ   4  
ATOM 3862  H H    . LYS A 1 35 ? -7.494  5.332   8.272   1.00 0.00 ? 35 LYS A H    4  
ATOM 3863  H HA   . LYS A 1 35 ? -10.074 4.029   8.115   1.00 0.00 ? 35 LYS A HA   4  
ATOM 3864  H HB2  . LYS A 1 35 ? -9.807  6.408   8.274   1.00 0.00 ? 35 LYS A HB2  4  
ATOM 3865  H HB3  . LYS A 1 35 ? -8.926  6.477   6.760   1.00 0.00 ? 35 LYS A HB3  4  
ATOM 3866  H HG2  . LYS A 1 35 ? -10.885 6.271   5.486   1.00 0.00 ? 35 LYS A HG2  4  
ATOM 3867  H HG3  . LYS A 1 35 ? -11.637 5.219   6.626   1.00 0.00 ? 35 LYS A HG3  4  
ATOM 3868  H HD2  . LYS A 1 35 ? -12.255 6.944   8.069   1.00 0.00 ? 35 LYS A HD2  4  
ATOM 3869  H HD3  . LYS A 1 35 ? -11.142 8.110   7.317   1.00 0.00 ? 35 LYS A HD3  4  
ATOM 3870  H HE2  . LYS A 1 35 ? -12.535 8.203   5.305   1.00 0.00 ? 35 LYS A HE2  4  
ATOM 3871  H HE3  . LYS A 1 35 ? -13.604 6.944   5.956   1.00 0.00 ? 35 LYS A HE3  4  
ATOM 3872  H HZ1  . LYS A 1 35 ? -14.199 8.434   7.758   1.00 0.00 ? 35 LYS A HZ1  4  
ATOM 3873  H HZ2  . LYS A 1 35 ? -13.223 9.623   7.172   1.00 0.00 ? 35 LYS A HZ2  4  
ATOM 3874  H HZ3  . LYS A 1 35 ? -14.527 9.137   6.320   1.00 0.00 ? 35 LYS A HZ3  4  
ATOM 3875  N N    . ALA A 1 36 ? -8.332  4.129   5.275   1.00 0.00 ? 36 ALA A N    4  
ATOM 3876  C CA   . ALA A 1 36 ? -8.076  3.387   4.052   1.00 0.00 ? 36 ALA A CA   4  
ATOM 3877  C C    . ALA A 1 36 ? -7.588  1.959   4.275   1.00 0.00 ? 36 ALA A C    4  
ATOM 3878  O O    . ALA A 1 36 ? -8.004  1.101   3.510   1.00 0.00 ? 36 ALA A O    4  
ATOM 3879  C CB   . ALA A 1 36 ? -7.037  4.140   3.212   1.00 0.00 ? 36 ALA A CB   4  
ATOM 3880  H H    . ALA A 1 36 ? -7.997  5.085   5.278   1.00 0.00 ? 36 ALA A H    4  
ATOM 3881  H HA   . ALA A 1 36 ? -9.043  3.308   3.534   1.00 0.00 ? 36 ALA A HA   4  
ATOM 3882  H HB1  . ALA A 1 36 ? -6.082  4.140   3.732   1.00 0.00 ? 36 ALA A HB1  4  
ATOM 3883  H HB2  . ALA A 1 36 ? -6.909  3.661   2.243   1.00 0.00 ? 36 ALA A HB2  4  
ATOM 3884  H HB3  . ALA A 1 36 ? -7.322  5.176   3.061   1.00 0.00 ? 36 ALA A HB3  4  
ATOM 3885  N N    . GLN A 1 37 ? -6.785  1.664   5.299   1.00 0.00 ? 37 GLN A N    4  
ATOM 3886  C CA   . GLN A 1 37 ? -6.461  0.306   5.710   1.00 0.00 ? 37 GLN A CA   4  
ATOM 3887  C C    . GLN A 1 37 ? -7.738  -0.534  5.729   1.00 0.00 ? 37 GLN A C    4  
ATOM 3888  O O    . GLN A 1 37 ? -7.840  -1.505  4.979   1.00 0.00 ? 37 GLN A O    4  
ATOM 3889  C CB   . GLN A 1 37 ? -5.695  0.360   7.050   1.00 0.00 ? 37 GLN A CB   4  
ATOM 3890  C CG   . GLN A 1 37 ? -5.892  -0.846  7.996   1.00 0.00 ? 37 GLN A CG   4  
ATOM 3891  C CD   . GLN A 1 37 ? -6.508  -0.517  9.358   1.00 0.00 ? 37 GLN A CD   4  
ATOM 3892  O OE1  . GLN A 1 37 ? -6.116  0.420   10.056  1.00 0.00 ? 37 GLN A OE1  4  
ATOM 3893  N NE2  . GLN A 1 37 ? -7.453  -1.331  9.798   1.00 0.00 ? 37 GLN A NE2  4  
ATOM 3894  H H    . GLN A 1 37 ? -6.394  2.400   5.871   1.00 0.00 ? 37 GLN A H    4  
ATOM 3895  H HA   . GLN A 1 37 ? -5.802  -0.132  4.962   1.00 0.00 ? 37 GLN A HA   4  
ATOM 3896  H HB2  . GLN A 1 37 ? -4.635  0.460   6.790   1.00 0.00 ? 37 GLN A HB2  4  
ATOM 3897  H HB3  . GLN A 1 37 ? -5.982  1.258   7.589   1.00 0.00 ? 37 GLN A HB3  4  
ATOM 3898  H HG2  . GLN A 1 37 ? -6.493  -1.605  7.509   1.00 0.00 ? 37 GLN A HG2  4  
ATOM 3899  H HG3  . GLN A 1 37 ? -4.948  -1.320  8.169   1.00 0.00 ? 37 GLN A HG3  4  
ATOM 3900  H HE21 . GLN A 1 37 ? -7.638  -2.174  9.243   1.00 0.00 ? 37 GLN A HE21 4  
ATOM 3901  H HE22 . GLN A 1 37 ? -8.102  -1.034  10.526  1.00 0.00 ? 37 GLN A HE22 4  
ATOM 3902  N N    . SER A 1 38 ? -8.712  -0.152  6.555   1.00 0.00 ? 38 SER A N    4  
ATOM 3903  C CA   . SER A 1 38 ? -9.913  -0.941  6.734   1.00 0.00 ? 38 SER A CA   4  
ATOM 3904  C C    . SER A 1 38 ? -10.717 -0.970  5.422   1.00 0.00 ? 38 SER A C    4  
ATOM 3905  O O    . SER A 1 38 ? -11.228 -2.023  5.038   1.00 0.00 ? 38 SER A O    4  
ATOM 3906  C CB   . SER A 1 38 ? -10.706 -0.354  7.911   1.00 0.00 ? 38 SER A CB   4  
ATOM 3907  O OG   . SER A 1 38 ? -11.690 -1.252  8.391   1.00 0.00 ? 38 SER A OG   4  
ATOM 3908  H H    . SER A 1 38 ? -8.627  0.729   7.049   1.00 0.00 ? 38 SER A H    4  
ATOM 3909  H HA   . SER A 1 38 ? -9.579  -1.951  6.992   1.00 0.00 ? 38 SER A HA   4  
ATOM 3910  H HB2  . SER A 1 38 ? -10.013 -0.143  8.727   1.00 0.00 ? 38 SER A HB2  4  
ATOM 3911  H HB3  . SER A 1 38 ? -11.177 0.580   7.602   1.00 0.00 ? 38 SER A HB3  4  
ATOM 3912  H HG   . SER A 1 38 ? -11.218 -1.927  8.934   1.00 0.00 ? 38 SER A HG   4  
ATOM 3913  N N    . ILE A 1 39 ? -10.803 0.161   4.705   1.00 0.00 ? 39 ILE A N    4  
ATOM 3914  C CA   . ILE A 1 39 ? -11.571 0.290   3.462   1.00 0.00 ? 39 ILE A CA   4  
ATOM 3915  C C    . ILE A 1 39 ? -11.017 -0.649  2.380   1.00 0.00 ? 39 ILE A C    4  
ATOM 3916  O O    . ILE A 1 39 ? -11.738 -1.492  1.842   1.00 0.00 ? 39 ILE A O    4  
ATOM 3917  C CB   . ILE A 1 39 ? -11.660 1.768   3.007   1.00 0.00 ? 39 ILE A CB   4  
ATOM 3918  C CG1  . ILE A 1 39 ? -12.342 2.588   4.124   1.00 0.00 ? 39 ILE A CG1  4  
ATOM 3919  C CG2  . ILE A 1 39 ? -12.416 1.901   1.672   1.00 0.00 ? 39 ILE A CG2  4  
ATOM 3920  C CD1  . ILE A 1 39 ? -12.787 4.000   3.761   1.00 0.00 ? 39 ILE A CD1  4  
ATOM 3921  H H    . ILE A 1 39 ? -10.327 0.977   5.071   1.00 0.00 ? 39 ILE A H    4  
ATOM 3922  H HA   . ILE A 1 39 ? -12.587 -0.011  3.680   1.00 0.00 ? 39 ILE A HA   4  
ATOM 3923  H HB   . ILE A 1 39 ? -10.660 2.158   2.858   1.00 0.00 ? 39 ILE A HB   4  
ATOM 3924  H HG12 . ILE A 1 39 ? -13.201 2.042   4.477   1.00 0.00 ? 39 ILE A HG12 4  
ATOM 3925  H HG13 . ILE A 1 39 ? -11.673 2.673   4.969   1.00 0.00 ? 39 ILE A HG13 4  
ATOM 3926  H HG21 . ILE A 1 39 ? -11.910 1.327   0.897   1.00 0.00 ? 39 ILE A HG21 4  
ATOM 3927  H HG22 . ILE A 1 39 ? -13.440 1.543   1.777   1.00 0.00 ? 39 ILE A HG22 4  
ATOM 3928  H HG23 . ILE A 1 39 ? -12.420 2.938   1.333   1.00 0.00 ? 39 ILE A HG23 4  
ATOM 3929  H HD11 . ILE A 1 39 ? -11.956 4.519   3.306   1.00 0.00 ? 39 ILE A HD11 4  
ATOM 3930  H HD12 . ILE A 1 39 ? -13.610 3.964   3.051   1.00 0.00 ? 39 ILE A HD12 4  
ATOM 3931  H HD13 . ILE A 1 39 ? -13.101 4.523   4.666   1.00 0.00 ? 39 ILE A HD13 4  
ATOM 3932  N N    . TYR A 1 40 ? -9.747  -0.472  2.033   1.00 0.00 ? 40 TYR A N    4  
ATOM 3933  C CA   . TYR A 1 40 ? -9.066  -1.106  0.914   1.00 0.00 ? 40 TYR A CA   4  
ATOM 3934  C C    . TYR A 1 40 ? -8.573  -2.510  1.274   1.00 0.00 ? 40 TYR A C    4  
ATOM 3935  O O    . TYR A 1 40 ? -8.272  -3.303  0.380   1.00 0.00 ? 40 TYR A O    4  
ATOM 3936  C CB   . TYR A 1 40 ? -7.908  -0.201  0.475   1.00 0.00 ? 40 TYR A CB   4  
ATOM 3937  C CG   . TYR A 1 40 ? -8.329  1.066   -0.256  1.00 0.00 ? 40 TYR A CG   4  
ATOM 3938  C CD1  . TYR A 1 40 ? -8.800  2.184   0.463   1.00 0.00 ? 40 TYR A CD1  4  
ATOM 3939  C CD2  . TYR A 1 40 ? -8.131  1.187   -1.643  1.00 0.00 ? 40 TYR A CD2  4  
ATOM 3940  C CE1  . TYR A 1 40 ? -9.152  3.373   -0.194  1.00 0.00 ? 40 TYR A CE1  4  
ATOM 3941  C CE2  . TYR A 1 40 ? -8.460  2.378   -2.301  1.00 0.00 ? 40 TYR A CE2  4  
ATOM 3942  C CZ   . TYR A 1 40 ? -9.049  3.439   -1.595  1.00 0.00 ? 40 TYR A CZ   4  
ATOM 3943  O OH   . TYR A 1 40 ? -9.539  4.530   -2.235  1.00 0.00 ? 40 TYR A OH   4  
ATOM 3944  H H    . TYR A 1 40 ? -9.184  0.167   2.578   1.00 0.00 ? 40 TYR A H    4  
ATOM 3945  H HA   . TYR A 1 40 ? -9.759  -1.196  0.081   1.00 0.00 ? 40 TYR A HA   4  
ATOM 3946  H HB2  . TYR A 1 40 ? -7.339  0.097   1.349   1.00 0.00 ? 40 TYR A HB2  4  
ATOM 3947  H HB3  . TYR A 1 40 ? -7.206  -0.772  -0.134  1.00 0.00 ? 40 TYR A HB3  4  
ATOM 3948  H HD1  . TYR A 1 40 ? -8.872  2.145   1.529   1.00 0.00 ? 40 TYR A HD1  4  
ATOM 3949  H HD2  . TYR A 1 40 ? -7.656  0.409   -2.219  1.00 0.00 ? 40 TYR A HD2  4  
ATOM 3950  H HE1  . TYR A 1 40 ? -9.448  4.264   0.350   1.00 0.00 ? 40 TYR A HE1  4  
ATOM 3951  H HE2  . TYR A 1 40 ? -8.206  2.486   -3.336  1.00 0.00 ? 40 TYR A HE2  4  
ATOM 3952  H HH   . TYR A 1 40 ? -9.295  4.630   -3.174  1.00 0.00 ? 40 TYR A HH   4  
ATOM 3953  N N    . GLY A 1 41 ? -8.540  -2.852  2.563   1.00 0.00 ? 41 GLY A N    4  
ATOM 3954  C CA   . GLY A 1 41 ? -8.187  -4.177  3.052   1.00 0.00 ? 41 GLY A CA   4  
ATOM 3955  C C    . GLY A 1 41 ? -6.688  -4.307  3.291   1.00 0.00 ? 41 GLY A C    4  
ATOM 3956  O O    . GLY A 1 41 ? -6.171  -5.422  3.382   1.00 0.00 ? 41 GLY A O    4  
ATOM 3957  H H    . GLY A 1 41 ? -8.630  -2.118  3.258   1.00 0.00 ? 41 GLY A H    4  
ATOM 3958  H HA2  . GLY A 1 41 ? -8.706  -4.362  3.994   1.00 0.00 ? 41 GLY A HA2  4  
ATOM 3959  H HA3  . GLY A 1 41 ? -8.494  -4.928  2.325   1.00 0.00 ? 41 GLY A HA3  4  
ATOM 3960  N N    . ILE A 1 42 ? -5.976  -3.189  3.391   1.00 0.00 ? 42 ILE A N    4  
ATOM 3961  C CA   . ILE A 1 42 ? -4.530  -3.170  3.456   1.00 0.00 ? 42 ILE A CA   4  
ATOM 3962  C C    . ILE A 1 42 ? -4.186  -3.250  4.942   1.00 0.00 ? 42 ILE A C    4  
ATOM 3963  O O    . ILE A 1 42 ? -4.813  -2.544  5.734   1.00 0.00 ? 42 ILE A O    4  
ATOM 3964  C CB   . ILE A 1 42 ? -3.968  -1.862  2.857   1.00 0.00 ? 42 ILE A CB   4  
ATOM 3965  C CG1  . ILE A 1 42 ? -4.637  -1.396  1.558   1.00 0.00 ? 42 ILE A CG1  4  
ATOM 3966  C CG2  . ILE A 1 42 ? -2.446  -2.024  2.699   1.00 0.00 ? 42 ILE A CG2  4  
ATOM 3967  C CD1  . ILE A 1 42 ? -4.463  -2.305  0.358   1.00 0.00 ? 42 ILE A CD1  4  
ATOM 3968  H H    . ILE A 1 42 ? -6.476  -2.317  3.495   1.00 0.00 ? 42 ILE A H    4  
ATOM 3969  H HA   . ILE A 1 42 ? -4.141  -4.023  2.903   1.00 0.00 ? 42 ILE A HA   4  
ATOM 3970  H HB   . ILE A 1 42 ? -4.177  -1.050  3.549   1.00 0.00 ? 42 ILE A HB   4  
ATOM 3971  H HG12 . ILE A 1 42 ? -5.698  -1.267  1.736   1.00 0.00 ? 42 ILE A HG12 4  
ATOM 3972  H HG13 . ILE A 1 42 ? -4.263  -0.416  1.300   1.00 0.00 ? 42 ILE A HG13 4  
ATOM 3973  H HG21 . ILE A 1 42 ? -2.230  -2.915  2.103   1.00 0.00 ? 42 ILE A HG21 4  
ATOM 3974  H HG22 . ILE A 1 42 ? -2.022  -1.149  2.211   1.00 0.00 ? 42 ILE A HG22 4  
ATOM 3975  H HG23 . ILE A 1 42 ? -1.979  -2.142  3.678   1.00 0.00 ? 42 ILE A HG23 4  
ATOM 3976  H HD11 . ILE A 1 42 ? -3.414  -2.526  0.177   1.00 0.00 ? 42 ILE A HD11 4  
ATOM 3977  H HD12 . ILE A 1 42 ? -5.021  -3.215  0.544   1.00 0.00 ? 42 ILE A HD12 4  
ATOM 3978  H HD13 . ILE A 1 42 ? -4.861  -1.797  -0.513  1.00 0.00 ? 42 ILE A HD13 4  
ATOM 3979  N N    . PRO A 1 43 ? -3.192  -4.052  5.355   1.00 0.00 ? 43 PRO A N    4  
ATOM 3980  C CA   . PRO A 1 43 ? -2.712  -4.000  6.725   1.00 0.00 ? 43 PRO A CA   4  
ATOM 3981  C C    . PRO A 1 43 ? -2.230  -2.594  7.020   1.00 0.00 ? 43 PRO A C    4  
ATOM 3982  O O    . PRO A 1 43 ? -1.471  -2.042  6.227   1.00 0.00 ? 43 PRO A O    4  
ATOM 3983  C CB   . PRO A 1 43 ? -1.508  -4.945  6.805   1.00 0.00 ? 43 PRO A CB   4  
ATOM 3984  C CG   . PRO A 1 43 ? -1.541  -5.745  5.515   1.00 0.00 ? 43 PRO A CG   4  
ATOM 3985  C CD   . PRO A 1 43 ? -2.355  -4.913  4.538   1.00 0.00 ? 43 PRO A CD   4  
ATOM 3986  H HA   . PRO A 1 43 ? -3.525  -4.283  7.406   1.00 0.00 ? 43 PRO A HA   4  
ATOM 3987  H HB2  . PRO A 1 43 ? -0.569  -4.393  6.862   1.00 0.00 ? 43 PRO A HB2  4  
ATOM 3988  H HB3  . PRO A 1 43 ? -1.593  -5.595  7.663   1.00 0.00 ? 43 PRO A HB3  4  
ATOM 3989  H HG2  . PRO A 1 43 ? -0.539  -5.950  5.140   1.00 0.00 ? 43 PRO A HG2  4  
ATOM 3990  H HG3  . PRO A 1 43 ? -2.065  -6.665  5.715   1.00 0.00 ? 43 PRO A HG3  4  
ATOM 3991  H HD2  . PRO A 1 43 ? -1.675  -4.315  3.933   1.00 0.00 ? 43 PRO A HD2  4  
ATOM 3992  H HD3  . PRO A 1 43 ? -2.953  -5.565  3.903   1.00 0.00 ? 43 PRO A HD3  4  
ATOM 3993  N N    . HIS A 1 44 ? -2.569  -2.060  8.186   1.00 0.00 ? 44 HIS A N    4  
ATOM 3994  C CA   . HIS A 1 44 ? -2.060  -0.771  8.624   1.00 0.00 ? 44 HIS A CA   4  
ATOM 3995  C C    . HIS A 1 44 ? -0.531  -0.816  8.639   1.00 0.00 ? 44 HIS A C    4  
ATOM 3996  O O    . HIS A 1 44 ? 0.114   0.098   8.141   1.00 0.00 ? 44 HIS A O    4  
ATOM 3997  C CB   . HIS A 1 44 ? -2.619  -0.481  10.011  1.00 0.00 ? 44 HIS A CB   4  
ATOM 3998  C CG   . HIS A 1 44 ? -2.437  0.925   10.494  1.00 0.00 ? 44 HIS A CG   4  
ATOM 3999  N ND1  . HIS A 1 44 ? -3.457  1.761   10.874  1.00 0.00 ? 44 HIS A ND1  4  
ATOM 4000  C CD2  . HIS A 1 44 ? -1.250  1.544   10.771  1.00 0.00 ? 44 HIS A CD2  4  
ATOM 4001  C CE1  . HIS A 1 44 ? -2.890  2.873   11.373  1.00 0.00 ? 44 HIS A CE1  4  
ATOM 4002  N NE2  . HIS A 1 44 ? -1.550  2.783   11.344  1.00 0.00 ? 44 HIS A NE2  4  
ATOM 4003  H H    . HIS A 1 44 ? -3.234  -2.558  8.769   1.00 0.00 ? 44 HIS A H    4  
ATOM 4004  H HA   . HIS A 1 44 ? -2.396  0.000   7.929   1.00 0.00 ? 44 HIS A HA   4  
ATOM 4005  H HB2  . HIS A 1 44 ? -3.680  -0.721  10.041  1.00 0.00 ? 44 HIS A HB2  4  
ATOM 4006  H HB3  . HIS A 1 44 ? -2.112  -1.132  10.709  1.00 0.00 ? 44 HIS A HB3  4  
ATOM 4007  H HD1  . HIS A 1 44 ? -4.445  1.528   10.825  1.00 0.00 ? 44 HIS A HD1  4  
ATOM 4008  H HD2  . HIS A 1 44 ? -0.258  1.137   10.619  1.00 0.00 ? 44 HIS A HD2  4  
ATOM 4009  H HE1  . HIS A 1 44 ? -3.429  3.720   11.765  1.00 0.00 ? 44 HIS A HE1  4  
ATOM 4010  N N    . SER A 1 45 ? 0.036   -1.908  9.159   1.00 0.00 ? 45 SER A N    4  
ATOM 4011  C CA   . SER A 1 45 ? 1.467   -2.144  9.278   1.00 0.00 ? 45 SER A CA   4  
ATOM 4012  C C    . SER A 1 45 ? 2.191   -2.200  7.925   1.00 0.00 ? 45 SER A C    4  
ATOM 4013  O O    . SER A 1 45 ? 3.415   -2.086  7.901   1.00 0.00 ? 45 SER A O    4  
ATOM 4014  C CB   . SER A 1 45 ? 1.684   -3.465  10.028  1.00 0.00 ? 45 SER A CB   4  
ATOM 4015  O OG   . SER A 1 45 ? 0.680   -3.682  11.012  1.00 0.00 ? 45 SER A OG   4  
ATOM 4016  H H    . SER A 1 45 ? -0.549  -2.608  9.594   1.00 0.00 ? 45 SER A H    4  
ATOM 4017  H HA   . SER A 1 45 ? 1.897   -1.329  9.864   1.00 0.00 ? 45 SER A HA   4  
ATOM 4018  H HB2  . SER A 1 45 ? 1.644   -4.288  9.313   1.00 0.00 ? 45 SER A HB2  4  
ATOM 4019  H HB3  . SER A 1 45 ? 2.670   -3.459  10.491  1.00 0.00 ? 45 SER A HB3  4  
ATOM 4020  H HG   . SER A 1 45 ? 0.834   -3.052  11.753  1.00 0.00 ? 45 SER A HG   4  
ATOM 4021  N N    . THR A 1 46 ? 1.470   -2.382  6.814   1.00 0.00 ? 46 THR A N    4  
ATOM 4022  C CA   . THR A 1 46 ? 2.015   -2.298  5.467   1.00 0.00 ? 46 THR A CA   4  
ATOM 4023  C C    . THR A 1 46 ? 1.681   -0.929  4.872   1.00 0.00 ? 46 THR A C    4  
ATOM 4024  O O    . THR A 1 46 ? 2.566   -0.283  4.323   1.00 0.00 ? 46 THR A O    4  
ATOM 4025  C CB   . THR A 1 46 ? 1.466   -3.473  4.639   1.00 0.00 ? 46 THR A CB   4  
ATOM 4026  O OG1  . THR A 1 46 ? 1.829   -4.680  5.286   1.00 0.00 ? 46 THR A OG1  4  
ATOM 4027  C CG2  . THR A 1 46 ? 2.009   -3.514  3.211   1.00 0.00 ? 46 THR A CG2  4  
ATOM 4028  H H    . THR A 1 46 ? 0.469   -2.518  6.876   1.00 0.00 ? 46 THR A H    4  
ATOM 4029  H HA   . THR A 1 46 ? 3.101   -2.385  5.505   1.00 0.00 ? 46 THR A HA   4  
ATOM 4030  H HB   . THR A 1 46 ? 0.379   -3.407  4.597   1.00 0.00 ? 46 THR A HB   4  
ATOM 4031  H HG1  . THR A 1 46 ? 1.515   -5.418  4.750   1.00 0.00 ? 46 THR A HG1  4  
ATOM 4032  H HG21 . THR A 1 46 ? 3.100   -3.548  3.221   1.00 0.00 ? 46 THR A HG21 4  
ATOM 4033  H HG22 . THR A 1 46 ? 1.628   -4.394  2.694   1.00 0.00 ? 46 THR A HG22 4  
ATOM 4034  H HG23 . THR A 1 46 ? 1.678   -2.632  2.666   1.00 0.00 ? 46 THR A HG23 4  
ATOM 4035  N N    . LEU A 1 47 ? 0.434   -0.471  4.972   1.00 0.00 ? 47 LEU A N    4  
ATOM 4036  C CA   . LEU A 1 47 ? -0.045  0.787   4.428   1.00 0.00 ? 47 LEU A CA   4  
ATOM 4037  C C    . LEU A 1 47 ? 0.796   1.946   4.938   1.00 0.00 ? 47 LEU A C    4  
ATOM 4038  O O    . LEU A 1 47 ? 1.196   2.757   4.118   1.00 0.00 ? 47 LEU A O    4  
ATOM 4039  C CB   . LEU A 1 47 ? -1.524  1.002   4.784   1.00 0.00 ? 47 LEU A CB   4  
ATOM 4040  C CG   . LEU A 1 47 ? -2.140  2.208   4.043   1.00 0.00 ? 47 LEU A CG   4  
ATOM 4041  C CD1  . LEU A 1 47 ? -2.295  1.960   2.546   1.00 0.00 ? 47 LEU A CD1  4  
ATOM 4042  C CD2  . LEU A 1 47 ? -3.565  2.454   4.527   1.00 0.00 ? 47 LEU A CD2  4  
ATOM 4043  H H    . LEU A 1 47 ? -0.255  -1.042  5.429   1.00 0.00 ? 47 LEU A H    4  
ATOM 4044  H HA   . LEU A 1 47 ? 0.065   0.736   3.346   1.00 0.00 ? 47 LEU A HA   4  
ATOM 4045  H HB2  . LEU A 1 47 ? -2.093  0.106   4.543   1.00 0.00 ? 47 LEU A HB2  4  
ATOM 4046  H HB3  . LEU A 1 47 ? -1.592  1.167   5.860   1.00 0.00 ? 47 LEU A HB3  4  
ATOM 4047  H HG   . LEU A 1 47 ? -1.549  3.112   4.209   1.00 0.00 ? 47 LEU A HG   4  
ATOM 4048  H HD11 . LEU A 1 47 ? -2.763  2.833   2.091   1.00 0.00 ? 47 LEU A HD11 4  
ATOM 4049  H HD12 . LEU A 1 47 ? -1.330  1.799   2.076   1.00 0.00 ? 47 LEU A HD12 4  
ATOM 4050  H HD13 . LEU A 1 47 ? -2.941  1.098   2.393   1.00 0.00 ? 47 LEU A HD13 4  
ATOM 4051  H HD21 . LEU A 1 47 ? -3.588  2.530   5.608   1.00 0.00 ? 47 LEU A HD21 4  
ATOM 4052  H HD22 . LEU A 1 47 ? -3.925  3.380   4.080   1.00 0.00 ? 47 LEU A HD22 4  
ATOM 4053  H HD23 . LEU A 1 47 ? -4.212  1.636   4.216   1.00 0.00 ? 47 LEU A HD23 4  
ATOM 4054  N N    . GLU A 1 48 ? 1.082   2.012   6.245   1.00 0.00 ? 48 GLU A N    4  
ATOM 4055  C CA   . GLU A 1 48 ? 1.955   3.029   6.821   1.00 0.00 ? 48 GLU A CA   4  
ATOM 4056  C C    . GLU A 1 48 ? 3.250   3.064   6.014   1.00 0.00 ? 48 GLU A C    4  
ATOM 4057  O O    . GLU A 1 48 ? 3.485   4.038   5.305   1.00 0.00 ? 48 GLU A O    4  
ATOM 4058  C CB   . GLU A 1 48 ? 2.272   2.760   8.303   1.00 0.00 ? 48 GLU A CB   4  
ATOM 4059  C CG   . GLU A 1 48 ? 1.363   3.512   9.263   1.00 0.00 ? 48 GLU A CG   4  
ATOM 4060  C CD   . GLU A 1 48 ? 1.974   3.582   10.655  1.00 0.00 ? 48 GLU A CD   4  
ATOM 4061  O OE1  . GLU A 1 48 ? 1.959   2.578   11.401  1.00 0.00 ? 48 GLU A OE1  4  
ATOM 4062  O OE2  . GLU A 1 48 ? 2.475   4.667   11.027  1.00 0.00 ? 48 GLU A OE2  4  
ATOM 4063  H H    . GLU A 1 48 ? 0.738   1.289   6.871   1.00 0.00 ? 48 GLU A H    4  
ATOM 4064  H HA   . GLU A 1 48 ? 1.452   3.998   6.733   1.00 0.00 ? 48 GLU A HA   4  
ATOM 4065  H HB2  . GLU A 1 48 ? 2.203   1.695   8.514   1.00 0.00 ? 48 GLU A HB2  4  
ATOM 4066  H HB3  . GLU A 1 48 ? 3.293   3.087   8.508   1.00 0.00 ? 48 GLU A HB3  4  
ATOM 4067  H HG2  . GLU A 1 48 ? 1.188   4.527   8.896   1.00 0.00 ? 48 GLU A HG2  4  
ATOM 4068  H HG3  . GLU A 1 48 ? 0.423   2.988   9.321   1.00 0.00 ? 48 GLU A HG3  4  
ATOM 4069  N N    . TYR A 1 49 ? 4.048   1.995   6.087   1.00 0.00 ? 49 TYR A N    4  
ATOM 4070  C CA   . TYR A 1 49 ? 5.317   1.826   5.391   1.00 0.00 ? 49 TYR A CA   4  
ATOM 4071  C C    . TYR A 1 49 ? 5.170   2.306   3.951   1.00 0.00 ? 49 TYR A C    4  
ATOM 4072  O O    . TYR A 1 49 ? 5.864   3.218   3.518   1.00 0.00 ? 49 TYR A O    4  
ATOM 4073  C CB   . TYR A 1 49 ? 5.745   0.342   5.490   1.00 0.00 ? 49 TYR A CB   4  
ATOM 4074  C CG   . TYR A 1 49 ? 6.882   -0.096  4.587   1.00 0.00 ? 49 TYR A CG   4  
ATOM 4075  C CD1  . TYR A 1 49 ? 6.623   -0.404  3.241   1.00 0.00 ? 49 TYR A CD1  4  
ATOM 4076  C CD2  . TYR A 1 49 ? 8.192   -0.197  5.083   1.00 0.00 ? 49 TYR A CD2  4  
ATOM 4077  C CE1  . TYR A 1 49 ? 7.670   -0.712  2.359   1.00 0.00 ? 49 TYR A CE1  4  
ATOM 4078  C CE2  . TYR A 1 49 ? 9.250   -0.537  4.219   1.00 0.00 ? 49 TYR A CE2  4  
ATOM 4079  C CZ   . TYR A 1 49 ? 8.994   -0.759  2.848   1.00 0.00 ? 49 TYR A CZ   4  
ATOM 4080  O OH   . TYR A 1 49 ? 10.035  -0.921  1.990   1.00 0.00 ? 49 TYR A OH   4  
ATOM 4081  H H    . TYR A 1 49 ? 3.775   1.250   6.720   1.00 0.00 ? 49 TYR A H    4  
ATOM 4082  H HA   . TYR A 1 49 ? 6.070   2.452   5.876   1.00 0.00 ? 49 TYR A HA   4  
ATOM 4083  H HB2  . TYR A 1 49 ? 6.027   0.129   6.516   1.00 0.00 ? 49 TYR A HB2  4  
ATOM 4084  H HB3  . TYR A 1 49 ? 4.890   -0.295  5.270   1.00 0.00 ? 49 TYR A HB3  4  
ATOM 4085  H HD1  . TYR A 1 49 ? 5.613   -0.343  2.878   1.00 0.00 ? 49 TYR A HD1  4  
ATOM 4086  H HD2  . TYR A 1 49 ? 8.382   0.027   6.122   1.00 0.00 ? 49 TYR A HD2  4  
ATOM 4087  H HE1  . TYR A 1 49 ? 7.459   -0.852  1.303   1.00 0.00 ? 49 TYR A HE1  4  
ATOM 4088  H HE2  . TYR A 1 49 ? 10.266  -0.567  4.583   1.00 0.00 ? 49 TYR A HE2  4  
ATOM 4089  H HH   . TYR A 1 49 ? 9.990   -0.179  1.339   1.00 0.00 ? 49 TYR A HH   4  
ATOM 4090  N N    . LYS A 1 50 ? 4.229   1.729   3.212   1.00 0.00 ? 50 LYS A N    4  
ATOM 4091  C CA   . LYS A 1 50 ? 4.089   1.917   1.781   1.00 0.00 ? 50 LYS A CA   4  
ATOM 4092  C C    . LYS A 1 50 ? 3.716   3.362   1.420   1.00 0.00 ? 50 LYS A C    4  
ATOM 4093  O O    . LYS A 1 50 ? 4.154   3.826   0.365   1.00 0.00 ? 50 LYS A O    4  
ATOM 4094  C CB   . LYS A 1 50 ? 3.019   0.936   1.304   1.00 0.00 ? 50 LYS A CB   4  
ATOM 4095  C CG   . LYS A 1 50 ? 3.394   -0.546  1.276   1.00 0.00 ? 50 LYS A CG   4  
ATOM 4096  C CD   . LYS A 1 50 ? 4.475   -0.922  0.255   1.00 0.00 ? 50 LYS A CD   4  
ATOM 4097  C CE   . LYS A 1 50 ? 4.279   -2.372  -0.188  1.00 0.00 ? 50 LYS A CE   4  
ATOM 4098  N NZ   . LYS A 1 50 ? 4.656   -2.595  -1.597  1.00 0.00 ? 50 LYS A NZ   4  
ATOM 4099  H H    . LYS A 1 50 ? 3.598   1.084   3.677   1.00 0.00 ? 50 LYS A H    4  
ATOM 4100  H HA   . LYS A 1 50 ? 5.045   1.693   1.295   1.00 0.00 ? 50 LYS A HA   4  
ATOM 4101  H HB2  . LYS A 1 50 ? 2.157   1.019   1.973   1.00 0.00 ? 50 LYS A HB2  4  
ATOM 4102  H HB3  . LYS A 1 50 ? 2.745   1.215   0.295   1.00 0.00 ? 50 LYS A HB3  4  
ATOM 4103  H HG2  . LYS A 1 50 ? 3.693   -0.891  2.264   1.00 0.00 ? 50 LYS A HG2  4  
ATOM 4104  H HG3  . LYS A 1 50 ? 2.473   -1.061  1.026   1.00 0.00 ? 50 LYS A HG3  4  
ATOM 4105  H HD2  . LYS A 1 50 ? 4.472   -0.248  -0.591  1.00 0.00 ? 50 LYS A HD2  4  
ATOM 4106  H HD3  . LYS A 1 50 ? 5.451   -0.816  0.703   1.00 0.00 ? 50 LYS A HD3  4  
ATOM 4107  H HE2  . LYS A 1 50 ? 4.871   -3.006  0.467   1.00 0.00 ? 50 LYS A HE2  4  
ATOM 4108  H HE3  . LYS A 1 50 ? 3.233   -2.649  -0.062  1.00 0.00 ? 50 LYS A HE3  4  
ATOM 4109  H HZ1  . LYS A 1 50 ? 4.109   -2.028  -2.241  1.00 0.00 ? 50 LYS A HZ1  4  
ATOM 4110  H HZ2  . LYS A 1 50 ? 5.627   -2.367  -1.776  1.00 0.00 ? 50 LYS A HZ2  4  
ATOM 4111  H HZ3  . LYS A 1 50 ? 4.516   -3.562  -1.875  1.00 0.00 ? 50 LYS A HZ3  4  
ATOM 4112  N N    . VAL A 1 51 ? 2.948   4.068   2.253   1.00 0.00 ? 51 VAL A N    4  
ATOM 4113  C CA   . VAL A 1 51 ? 2.733   5.509   2.162   1.00 0.00 ? 51 VAL A CA   4  
ATOM 4114  C C    . VAL A 1 51 ? 4.052   6.231   2.460   1.00 0.00 ? 51 VAL A C    4  
ATOM 4115  O O    . VAL A 1 51 ? 4.508   7.019   1.641   1.00 0.00 ? 51 VAL A O    4  
ATOM 4116  C CB   . VAL A 1 51 ? 1.615   5.953   3.137   1.00 0.00 ? 51 VAL A CB   4  
ATOM 4117  C CG1  . VAL A 1 51 ? 1.450   7.473   3.177   1.00 0.00 ? 51 VAL A CG1  4  
ATOM 4118  C CG2  . VAL A 1 51 ? 0.226   5.402   2.805   1.00 0.00 ? 51 VAL A CG2  4  
ATOM 4119  H H    . VAL A 1 51 ? 2.585   3.609   3.082   1.00 0.00 ? 51 VAL A H    4  
ATOM 4120  H HA   . VAL A 1 51 ? 2.436   5.752   1.144   1.00 0.00 ? 51 VAL A HA   4  
ATOM 4121  H HB   . VAL A 1 51 ? 1.870   5.619   4.141   1.00 0.00 ? 51 VAL A HB   4  
ATOM 4122  H HG11 . VAL A 1 51 ? 2.331   7.916   3.628   1.00 0.00 ? 51 VAL A HG11 4  
ATOM 4123  H HG12 . VAL A 1 51 ? 1.321   7.863   2.165   1.00 0.00 ? 51 VAL A HG12 4  
ATOM 4124  H HG13 . VAL A 1 51 ? 0.584   7.736   3.785   1.00 0.00 ? 51 VAL A HG13 4  
ATOM 4125  H HG21 . VAL A 1 51 ? -0.199  5.924   1.947   1.00 0.00 ? 51 VAL A HG21 4  
ATOM 4126  H HG22 . VAL A 1 51 ? 0.274   4.341   2.595   1.00 0.00 ? 51 VAL A HG22 4  
ATOM 4127  H HG23 . VAL A 1 51 ? -0.406  5.543   3.682   1.00 0.00 ? 51 VAL A HG23 4  
ATOM 4128  N N    . LYS A 1 52 ? 4.643   5.987   3.631   1.00 0.00 ? 52 LYS A N    4  
ATOM 4129  C CA   . LYS A 1 52 ? 5.790   6.693   4.222   1.00 0.00 ? 52 LYS A CA   4  
ATOM 4130  C C    . LYS A 1 52 ? 7.020   6.659   3.333   1.00 0.00 ? 52 LYS A C    4  
ATOM 4131  O O    . LYS A 1 52 ? 7.754   7.640   3.255   1.00 0.00 ? 52 LYS A O    4  
ATOM 4132  C CB   . LYS A 1 52 ? 6.031   6.081   5.613   1.00 0.00 ? 52 LYS A CB   4  
ATOM 4133  C CG   . LYS A 1 52 ? 4.945   6.617   6.567   1.00 0.00 ? 52 LYS A CG   4  
ATOM 4134  C CD   . LYS A 1 52 ? 4.498   5.633   7.658   1.00 0.00 ? 52 LYS A CD   4  
ATOM 4135  C CE   . LYS A 1 52 ? 4.499   6.226   9.069   1.00 0.00 ? 52 LYS A CE   4  
ATOM 4136  N NZ   . LYS A 1 52 ? 3.199   6.821   9.437   1.00 0.00 ? 52 LYS A NZ   4  
ATOM 4137  H H    . LYS A 1 52 ? 4.223   5.266   4.214   1.00 0.00 ? 52 LYS A H    4  
ATOM 4138  H HA   . LYS A 1 52 ? 5.555   7.743   4.356   1.00 0.00 ? 52 LYS A HA   4  
ATOM 4139  H HB2  . LYS A 1 52 ? 5.989   4.994   5.540   1.00 0.00 ? 52 LYS A HB2  4  
ATOM 4140  H HB3  . LYS A 1 52 ? 7.018   6.344   5.992   1.00 0.00 ? 52 LYS A HB3  4  
ATOM 4141  H HG2  . LYS A 1 52 ? 5.293   7.548   7.011   1.00 0.00 ? 52 LYS A HG2  4  
ATOM 4142  H HG3  . LYS A 1 52 ? 4.065   6.849   5.970   1.00 0.00 ? 52 LYS A HG3  4  
ATOM 4143  H HD2  . LYS A 1 52 ? 3.481   5.313   7.413   1.00 0.00 ? 52 LYS A HD2  4  
ATOM 4144  H HD3  . LYS A 1 52 ? 5.150   4.758   7.653   1.00 0.00 ? 52 LYS A HD3  4  
ATOM 4145  H HE2  . LYS A 1 52 ? 4.690   5.413   9.770   1.00 0.00 ? 52 LYS A HE2  4  
ATOM 4146  H HE3  . LYS A 1 52 ? 5.298   6.964   9.155   1.00 0.00 ? 52 LYS A HE3  4  
ATOM 4147  H HZ1  . LYS A 1 52 ? 3.322   7.647   10.011  1.00 0.00 ? 52 LYS A HZ1  4  
ATOM 4148  H HZ2  . LYS A 1 52 ? 2.664   7.073   8.610   1.00 0.00 ? 52 LYS A HZ2  4  
ATOM 4149  H HZ3  . LYS A 1 52 ? 2.669   6.139   9.984   1.00 0.00 ? 52 LYS A HZ3  4  
ATOM 4150  N N    . GLU A 1 53 ? 7.160   5.560   2.613   1.00 0.00 ? 53 GLU A N    4  
ATOM 4151  C CA   . GLU A 1 53 ? 8.063   5.286   1.520   1.00 0.00 ? 53 GLU A CA   4  
ATOM 4152  C C    . GLU A 1 53 ? 7.780   6.293   0.401   1.00 0.00 ? 53 GLU A C    4  
ATOM 4153  O O    . GLU A 1 53 ? 8.582   7.179   0.085   1.00 0.00 ? 53 GLU A O    4  
ATOM 4154  C CB   . GLU A 1 53 ? 7.766   3.837   1.086   1.00 0.00 ? 53 GLU A CB   4  
ATOM 4155  C CG   . GLU A 1 53 ? 8.356   2.759   2.002   1.00 0.00 ? 53 GLU A CG   4  
ATOM 4156  C CD   . GLU A 1 53 ? 9.734   2.222   1.625   1.00 0.00 ? 53 GLU A CD   4  
ATOM 4157  O OE1  . GLU A 1 53 ? 9.823   1.343   0.739   1.00 0.00 ? 53 GLU A OE1  4  
ATOM 4158  O OE2  . GLU A 1 53 ? 10.719  2.610   2.300   1.00 0.00 ? 53 GLU A OE2  4  
ATOM 4159  H H    . GLU A 1 53 ? 6.460   4.855   2.796   1.00 0.00 ? 53 GLU A H    4  
ATOM 4160  H HA   . GLU A 1 53 ? 9.097   5.369   1.844   1.00 0.00 ? 53 GLU A HA   4  
ATOM 4161  H HB2  . GLU A 1 53 ? 6.685   3.699   1.060   1.00 0.00 ? 53 GLU A HB2  4  
ATOM 4162  H HB3  . GLU A 1 53 ? 8.087   3.667   0.082   1.00 0.00 ? 53 GLU A HB3  4  
ATOM 4163  H HG2  . GLU A 1 53 ? 8.405   3.160   3.006   1.00 0.00 ? 53 GLU A HG2  4  
ATOM 4164  H HG3  . GLU A 1 53 ? 7.663   1.923   2.002   1.00 0.00 ? 53 GLU A HG3  4  
ATOM 4165  N N    . ARG A 1 54 ? 6.611   6.147   -0.228  1.00 0.00 ? 54 ARG A N    4  
ATOM 4166  C CA   . ARG A 1 54 ? 6.228   6.881   -1.428  1.00 0.00 ? 54 ARG A CA   4  
ATOM 4167  C C    . ARG A 1 54 ? 6.083   8.376   -1.193  1.00 0.00 ? 54 ARG A C    4  
ATOM 4168  O O    . ARG A 1 54 ? 6.195   9.135   -2.151  1.00 0.00 ? 54 ARG A O    4  
ATOM 4169  C CB   . ARG A 1 54 ? 4.946   6.264   -1.999  1.00 0.00 ? 54 ARG A CB   4  
ATOM 4170  C CG   . ARG A 1 54 ? 5.248   4.961   -2.742  1.00 0.00 ? 54 ARG A CG   4  
ATOM 4171  C CD   . ARG A 1 54 ? 5.748   5.275   -4.151  1.00 0.00 ? 54 ARG A CD   4  
ATOM 4172  N NE   . ARG A 1 54 ? 6.441   4.142   -4.785  1.00 0.00 ? 54 ARG A NE   4  
ATOM 4173  C CZ   . ARG A 1 54 ? 6.156   3.630   -5.987  1.00 0.00 ? 54 ARG A CZ   4  
ATOM 4174  N NH1  . ARG A 1 54 ? 4.978   3.821   -6.575  1.00 0.00 ? 54 ARG A NH1  4  
ATOM 4175  N NH2  . ARG A 1 54 ? 7.084   2.916   -6.608  1.00 0.00 ? 54 ARG A NH2  4  
ATOM 4176  H H    . ARG A 1 54 ? 5.950   5.476   0.147   1.00 0.00 ? 54 ARG A H    4  
ATOM 4177  H HA   . ARG A 1 54 ? 7.025   6.781   -2.158  1.00 0.00 ? 54 ARG A HA   4  
ATOM 4178  H HB2  . ARG A 1 54 ? 4.233   6.078   -1.195  1.00 0.00 ? 54 ARG A HB2  4  
ATOM 4179  H HB3  . ARG A 1 54 ? 4.487   6.952   -2.704  1.00 0.00 ? 54 ARG A HB3  4  
ATOM 4180  H HG2  . ARG A 1 54 ? 5.980   4.367   -2.193  1.00 0.00 ? 54 ARG A HG2  4  
ATOM 4181  H HG3  . ARG A 1 54 ? 4.325   4.400   -2.829  1.00 0.00 ? 54 ARG A HG3  4  
ATOM 4182  H HD2  . ARG A 1 54 ? 4.889   5.589   -4.739  1.00 0.00 ? 54 ARG A HD2  4  
ATOM 4183  H HD3  . ARG A 1 54 ? 6.444   6.110   -4.117  1.00 0.00 ? 54 ARG A HD3  4  
ATOM 4184  H HE   . ARG A 1 54 ? 7.331   3.874   -4.374  1.00 0.00 ? 54 ARG A HE   4  
ATOM 4185  H HH11 . ARG A 1 54 ? 4.183   4.219   -6.091  1.00 0.00 ? 54 ARG A HH11 4  
ATOM 4186  H HH12 . ARG A 1 54 ? 4.819   3.434   -7.509  1.00 0.00 ? 54 ARG A HH12 4  
ATOM 4187  H HH21 . ARG A 1 54 ? 7.972   2.711   -6.170  1.00 0.00 ? 54 ARG A HH21 4  
ATOM 4188  H HH22 . ARG A 1 54 ? 6.904   2.574   -7.556  1.00 0.00 ? 54 ARG A HH22 4  
ATOM 4189  N N    . LEU A 1 55 ? 5.913   8.821   0.050   1.00 0.00 ? 55 LEU A N    4  
ATOM 4190  C CA   . LEU A 1 55 ? 5.962   10.228  0.425   1.00 0.00 ? 55 LEU A CA   4  
ATOM 4191  C C    . LEU A 1 55 ? 7.307   10.868  0.076   1.00 0.00 ? 55 LEU A C    4  
ATOM 4192  O O    . LEU A 1 55 ? 7.393   12.097  0.055   1.00 0.00 ? 55 LEU A O    4  
ATOM 4193  C CB   . LEU A 1 55 ? 5.640   10.383  1.920   1.00 0.00 ? 55 LEU A CB   4  
ATOM 4194  C CG   . LEU A 1 55 ? 4.126   10.366  2.201   1.00 0.00 ? 55 LEU A CG   4  
ATOM 4195  C CD1  . LEU A 1 55 ? 3.900   10.203  3.703   1.00 0.00 ? 55 LEU A CD1  4  
ATOM 4196  C CD2  . LEU A 1 55 ? 3.442   11.643  1.694   1.00 0.00 ? 55 LEU A CD2  4  
ATOM 4197  H H    . LEU A 1 55 ? 5.781   8.132   0.783   1.00 0.00 ? 55 LEU A H    4  
ATOM 4198  H HA   . LEU A 1 55 ? 5.213   10.756  -0.163  1.00 0.00 ? 55 LEU A HA   4  
ATOM 4199  H HB2  . LEU A 1 55 ? 6.130   9.579   2.471   1.00 0.00 ? 55 LEU A HB2  4  
ATOM 4200  H HB3  . LEU A 1 55 ? 6.053   11.324  2.287   1.00 0.00 ? 55 LEU A HB3  4  
ATOM 4201  H HG   . LEU A 1 55 ? 3.665   9.514   1.702   1.00 0.00 ? 55 LEU A HG   4  
ATOM 4202  H HD11 . LEU A 1 55 ? 4.248   9.212   3.992   1.00 0.00 ? 55 LEU A HD11 4  
ATOM 4203  H HD12 . LEU A 1 55 ? 4.464   10.949  4.263   1.00 0.00 ? 55 LEU A HD12 4  
ATOM 4204  H HD13 . LEU A 1 55 ? 2.838   10.273  3.940   1.00 0.00 ? 55 LEU A HD13 4  
ATOM 4205  H HD21 . LEU A 1 55 ? 3.388   11.633  0.607   1.00 0.00 ? 55 LEU A HD21 4  
ATOM 4206  H HD22 . LEU A 1 55 ? 2.417   11.703  2.064   1.00 0.00 ? 55 LEU A HD22 4  
ATOM 4207  H HD23 . LEU A 1 55 ? 4.012   12.525  1.980   1.00 0.00 ? 55 LEU A HD23 4  
ATOM 4208  N N    . GLY A 1 56 ? 8.322   10.078  -0.277  1.00 0.00 ? 56 GLY A N    4  
ATOM 4209  C CA   . GLY A 1 56 ? 9.513   10.546  -0.959  1.00 0.00 ? 56 GLY A CA   4  
ATOM 4210  C C    . GLY A 1 56 ? 10.769  10.276  -0.155  1.00 0.00 ? 56 GLY A C    4  
ATOM 4211  O O    . GLY A 1 56 ? 11.779  10.934  -0.397  1.00 0.00 ? 56 GLY A O    4  
ATOM 4212  H H    . GLY A 1 56 ? 8.213   9.073   -0.183  1.00 0.00 ? 56 GLY A H    4  
ATOM 4213  H HA2  . GLY A 1 56 ? 9.593   10.030  -1.916  1.00 0.00 ? 56 GLY A HA2  4  
ATOM 4214  H HA3  . GLY A 1 56 ? 9.447   11.616  -1.161  1.00 0.00 ? 56 GLY A HA3  4  
ATOM 4215  N N    . THR A 1 57 ? 10.748  9.357   0.811   1.00 0.00 ? 57 THR A N    4  
ATOM 4216  C CA   . THR A 1 57 ? 11.968  8.911   1.472   1.00 0.00 ? 57 THR A CA   4  
ATOM 4217  C C    . THR A 1 57 ? 12.825  8.068   0.524   1.00 0.00 ? 57 THR A C    4  
ATOM 4218  O O    . THR A 1 57 ? 14.051  8.069   0.612   1.00 0.00 ? 57 THR A O    4  
ATOM 4219  C CB   . THR A 1 57 ? 11.598  8.104   2.720   1.00 0.00 ? 57 THR A CB   4  
ATOM 4220  O OG1  . THR A 1 57 ? 10.712  7.066   2.388   1.00 0.00 ? 57 THR A OG1  4  
ATOM 4221  C CG2  . THR A 1 57 ? 10.924  8.969   3.793   1.00 0.00 ? 57 THR A CG2  4  
ATOM 4222  H H    . THR A 1 57 ? 9.923   8.802   1.021   1.00 0.00 ? 57 THR A H    4  
ATOM 4223  H HA   . THR A 1 57 ? 12.555  9.776   1.765   1.00 0.00 ? 57 THR A HA   4  
ATOM 4224  H HB   . THR A 1 57 ? 12.503  7.651   3.115   1.00 0.00 ? 57 THR A HB   4  
ATOM 4225  H HG1  . THR A 1 57 ? 10.634  6.519   3.195   1.00 0.00 ? 57 THR A HG1  4  
ATOM 4226  H HG21 . THR A 1 57 ? 9.967   9.350   3.433   1.00 0.00 ? 57 THR A HG21 4  
ATOM 4227  H HG22 . THR A 1 57 ? 10.750  8.374   4.689   1.00 0.00 ? 57 THR A HG22 4  
ATOM 4228  H HG23 . THR A 1 57 ? 11.562  9.809   4.054   1.00 0.00 ? 57 THR A HG23 4  
ATOM 4229  N N    . LEU A 1 58 ? 12.165  7.373   -0.407  1.00 0.00 ? 58 LEU A N    4  
ATOM 4230  C CA   . LEU A 1 58 ? 12.731  6.323   -1.239  1.00 0.00 ? 58 LEU A CA   4  
ATOM 4231  C C    . LEU A 1 58 ? 13.945  6.799   -2.022  1.00 0.00 ? 58 LEU A C    4  
ATOM 4232  O O    . LEU A 1 58 ? 13.972  7.934   -2.499  1.00 0.00 ? 58 LEU A O    4  
ATOM 4233  C CB   . LEU A 1 58 ? 11.664  5.818   -2.211  1.00 0.00 ? 58 LEU A CB   4  
ATOM 4234  C CG   . LEU A 1 58 ? 10.542  5.040   -1.506  1.00 0.00 ? 58 LEU A CG   4  
ATOM 4235  C CD1  . LEU A 1 58 ? 9.285   5.093   -2.373  1.00 0.00 ? 58 LEU A CD1  4  
ATOM 4236  C CD2  . LEU A 1 58 ? 10.919  3.581   -1.264  1.00 0.00 ? 58 LEU A CD2  4  
ATOM 4237  H H    . LEU A 1 58 ? 11.156  7.422   -0.346  1.00 0.00 ? 58 LEU A H    4  
ATOM 4238  H HA   . LEU A 1 58 ? 13.030  5.517   -0.576  1.00 0.00 ? 58 LEU A HA   4  
ATOM 4239  H HB2  . LEU A 1 58 ? 11.250  6.685   -2.727  1.00 0.00 ? 58 LEU A HB2  4  
ATOM 4240  H HB3  . LEU A 1 58 ? 12.124  5.183   -2.968  1.00 0.00 ? 58 LEU A HB3  4  
ATOM 4241  H HG   . LEU A 1 58 ? 10.337  5.501   -0.537  1.00 0.00 ? 58 LEU A HG   4  
ATOM 4242  H HD11 . LEU A 1 58 ? 9.485   4.650   -3.347  1.00 0.00 ? 58 LEU A HD11 4  
ATOM 4243  H HD12 . LEU A 1 58 ? 8.476   4.562   -1.873  1.00 0.00 ? 58 LEU A HD12 4  
ATOM 4244  H HD13 . LEU A 1 58 ? 9.001   6.134   -2.514  1.00 0.00 ? 58 LEU A HD13 4  
ATOM 4245  H HD21 . LEU A 1 58 ? 11.464  3.177   -2.115  1.00 0.00 ? 58 LEU A HD21 4  
ATOM 4246  H HD22 . LEU A 1 58 ? 11.504  3.509   -0.348  1.00 0.00 ? 58 LEU A HD22 4  
ATOM 4247  H HD23 . LEU A 1 58 ? 10.018  2.984   -1.127  1.00 0.00 ? 58 LEU A HD23 4  
ATOM 4248  N N    . LYS A 1 59 ? 14.921  5.909   -2.191  1.00 0.00 ? 59 LYS A N    4  
ATOM 4249  C CA   . LYS A 1 59 ? 16.230  6.165   -2.797  1.00 0.00 ? 59 LYS A CA   4  
ATOM 4250  C C    . LYS A 1 59 ? 16.601  5.009   -3.736  1.00 0.00 ? 59 LYS A C    4  
ATOM 4251  O O    . LYS A 1 59 ? 17.767  4.632   -3.856  1.00 0.00 ? 59 LYS A O    4  
ATOM 4252  C CB   . LYS A 1 59 ? 17.258  6.426   -1.663  1.00 0.00 ? 59 LYS A CB   4  
ATOM 4253  C CG   . LYS A 1 59 ? 17.884  7.832   -1.705  1.00 0.00 ? 59 LYS A CG   4  
ATOM 4254  C CD   . LYS A 1 59 ? 16.869  8.951   -1.458  1.00 0.00 ? 59 LYS A CD   4  
ATOM 4255  C CE   . LYS A 1 59 ? 17.524  10.324  -1.277  1.00 0.00 ? 59 LYS A CE   4  
ATOM 4256  N NZ   . LYS A 1 59 ? 16.560  11.296  -0.724  1.00 0.00 ? 59 LYS A NZ   4  
ATOM 4257  H H    . LYS A 1 59 ? 14.765  4.989   -1.790  1.00 0.00 ? 59 LYS A H    4  
ATOM 4258  H HA   . LYS A 1 59 ? 16.161  7.053   -3.429  1.00 0.00 ? 59 LYS A HA   4  
ATOM 4259  H HB2  . LYS A 1 59 ? 16.785  6.291   -0.685  1.00 0.00 ? 59 LYS A HB2  4  
ATOM 4260  H HB3  . LYS A 1 59 ? 18.073  5.704   -1.713  1.00 0.00 ? 59 LYS A HB3  4  
ATOM 4261  H HG2  . LYS A 1 59 ? 18.619  7.879   -0.906  1.00 0.00 ? 59 LYS A HG2  4  
ATOM 4262  H HG3  . LYS A 1 59 ? 18.380  7.990   -2.664  1.00 0.00 ? 59 LYS A HG3  4  
ATOM 4263  H HD2  . LYS A 1 59 ? 16.201  9.015   -2.313  1.00 0.00 ? 59 LYS A HD2  4  
ATOM 4264  H HD3  . LYS A 1 59 ? 16.298  8.709   -0.561  1.00 0.00 ? 59 LYS A HD3  4  
ATOM 4265  H HE2  . LYS A 1 59 ? 18.371  10.237  -0.600  1.00 0.00 ? 59 LYS A HE2  4  
ATOM 4266  H HE3  . LYS A 1 59 ? 17.893  10.679  -2.239  1.00 0.00 ? 59 LYS A HE3  4  
ATOM 4267  H HZ1  . LYS A 1 59 ? 16.324  11.066  0.230   1.00 0.00 ? 59 LYS A HZ1  4  
ATOM 4268  H HZ2  . LYS A 1 59 ? 16.906  12.254  -0.735  1.00 0.00 ? 59 LYS A HZ2  4  
ATOM 4269  H HZ3  . LYS A 1 59 ? 15.696  11.275  -1.259  1.00 0.00 ? 59 LYS A HZ3  4  
ATOM 4270  N N    . ASN A 1 60 ? 15.606  4.392   -4.385  1.00 0.00 ? 60 ASN A N    4  
ATOM 4271  C CA   . ASN A 1 60 ? 15.810  3.284   -5.320  1.00 0.00 ? 60 ASN A CA   4  
ATOM 4272  C C    . ASN A 1 60 ? 15.220  3.674   -6.674  1.00 0.00 ? 60 ASN A C    4  
ATOM 4273  O O    . ASN A 1 60 ? 14.064  3.349   -6.954  1.00 0.00 ? 60 ASN A O    4  
ATOM 4274  C CB   . ASN A 1 60 ? 15.223  1.969   -4.788  1.00 0.00 ? 60 ASN A CB   4  
ATOM 4275  C CG   . ASN A 1 60 ? 16.076  1.374   -3.679  1.00 0.00 ? 60 ASN A CG   4  
ATOM 4276  O OD1  . ASN A 1 60 ? 16.906  0.499   -3.898  1.00 0.00 ? 60 ASN A OD1  4  
ATOM 4277  N ND2  . ASN A 1 60 ? 15.862  1.796   -2.449  1.00 0.00 ? 60 ASN A ND2  4  
ATOM 4278  H H    . ASN A 1 60 ? 14.677  4.785   -4.325  1.00 0.00 ? 60 ASN A H    4  
ATOM 4279  H HA   . ASN A 1 60 ? 16.875  3.103   -5.461  1.00 0.00 ? 60 ASN A HA   4  
ATOM 4280  H HB2  . ASN A 1 60 ? 14.202  2.133   -4.442  1.00 0.00 ? 60 ASN A HB2  4  
ATOM 4281  H HB3  . ASN A 1 60 ? 15.184  1.248   -5.606  1.00 0.00 ? 60 ASN A HB3  4  
ATOM 4282  H HD21 . ASN A 1 60 ? 15.163  2.514   -2.264  1.00 0.00 ? 60 ASN A HD21 4  
ATOM 4283  H HD22 . ASN A 1 60 ? 16.402  1.488   -1.646  1.00 0.00 ? 60 ASN A HD22 4  
ATOM 4284  N N    . PRO A 1 61 ? 15.965  4.421   -7.501  1.00 0.00 ? 61 PRO A N    4  
ATOM 4285  C CA   . PRO A 1 61 ? 15.599  4.693   -8.877  1.00 0.00 ? 61 PRO A CA   4  
ATOM 4286  C C    . PRO A 1 61 ? 16.052  3.520   -9.762  1.00 0.00 ? 61 PRO A C    4  
ATOM 4287  O O    . PRO A 1 61 ? 17.258  3.359   -9.973  1.00 0.00 ? 61 PRO A O    4  
ATOM 4288  C CB   . PRO A 1 61 ? 16.326  5.992   -9.204  1.00 0.00 ? 61 PRO A CB   4  
ATOM 4289  C CG   . PRO A 1 61 ? 17.611  5.933   -8.375  1.00 0.00 ? 61 PRO A CG   4  
ATOM 4290  C CD   . PRO A 1 61 ? 17.209  5.101   -7.158  1.00 0.00 ? 61 PRO A CD   4  
ATOM 4291  H HA   . PRO A 1 61 ? 14.531  4.864   -8.973  1.00 0.00 ? 61 PRO A HA   4  
ATOM 4292  H HB2  . PRO A 1 61 ? 16.524  6.080   -10.271 1.00 0.00 ? 61 PRO A HB2  4  
ATOM 4293  H HB3  . PRO A 1 61 ? 15.721  6.831   -8.858  1.00 0.00 ? 61 PRO A HB3  4  
ATOM 4294  H HG2  . PRO A 1 61 ? 18.402  5.420   -8.920  1.00 0.00 ? 61 PRO A HG2  4  
ATOM 4295  H HG3  . PRO A 1 61 ? 17.939  6.933   -8.090  1.00 0.00 ? 61 PRO A HG3  4  
ATOM 4296  H HD2  . PRO A 1 61 ? 17.997  4.386   -6.916  1.00 0.00 ? 61 PRO A HD2  4  
ATOM 4297  H HD3  . PRO A 1 61 ? 17.034  5.760   -6.312  1.00 0.00 ? 61 PRO A HD3  4  
ATOM 4298  N N    . PRO A 1 62 ? 15.147  2.686   -10.296 1.00 0.00 ? 62 PRO A N    4  
ATOM 4299  C CA   . PRO A 1 62 ? 15.544  1.603   -11.182 1.00 0.00 ? 62 PRO A CA   4  
ATOM 4300  C C    . PRO A 1 62 ? 16.042  2.153   -12.526 1.00 0.00 ? 62 PRO A C    4  
ATOM 4301  O O    . PRO A 1 62 ? 15.904  3.340   -12.837 1.00 0.00 ? 62 PRO A O    4  
ATOM 4302  C CB   . PRO A 1 62 ? 14.287  0.743   -11.341 1.00 0.00 ? 62 PRO A CB   4  
ATOM 4303  C CG   . PRO A 1 62 ? 13.179  1.784   -11.267 1.00 0.00 ? 62 PRO A CG   4  
ATOM 4304  C CD   . PRO A 1 62 ? 13.696  2.759   -10.211 1.00 0.00 ? 62 PRO A CD   4  
ATOM 4305  H HA   . PRO A 1 62 ? 16.340  1.023   -10.717 1.00 0.00 ? 62 PRO A HA   4  
ATOM 4306  H HB2  . PRO A 1 62 ? 14.266  0.194   -12.283 1.00 0.00 ? 62 PRO A HB2  4  
ATOM 4307  H HB3  . PRO A 1 62 ? 14.202  0.058   -10.497 1.00 0.00 ? 62 PRO A HB3  4  
ATOM 4308  H HG2  . PRO A 1 62 ? 13.104  2.285   -12.232 1.00 0.00 ? 62 PRO A HG2  4  
ATOM 4309  H HG3  . PRO A 1 62 ? 12.226  1.345   -10.984 1.00 0.00 ? 62 PRO A HG3  4  
ATOM 4310  H HD2  . PRO A 1 62 ? 13.329  3.763   -10.425 1.00 0.00 ? 62 PRO A HD2  4  
ATOM 4311  H HD3  . PRO A 1 62 ? 13.373  2.431   -9.224  1.00 0.00 ? 62 PRO A HD3  4  
ATOM 4312  N N    . LYS A 1 63 ? 16.574  1.275   -13.374 1.00 0.00 ? 63 LYS A N    4  
ATOM 4313  C CA   . LYS A 1 63 ? 16.861  1.575   -14.779 1.00 0.00 ? 63 LYS A CA   4  
ATOM 4314  C C    . LYS A 1 63 ? 16.104  0.553   -15.627 1.00 0.00 ? 63 LYS A C    4  
ATOM 4315  O O    . LYS A 1 63 ? 15.246  0.937   -16.429 1.00 0.00 ? 63 LYS A O    4  
ATOM 4316  C CB   . LYS A 1 63 ? 18.388  1.598   -15.000 1.00 0.00 ? 63 LYS A CB   4  
ATOM 4317  C CG   . LYS A 1 63 ? 18.836  2.429   -16.214 1.00 0.00 ? 63 LYS A CG   4  
ATOM 4318  C CD   . LYS A 1 63 ? 19.100  3.921   -15.953 1.00 0.00 ? 63 LYS A CD   4  
ATOM 4319  C CE   . LYS A 1 63 ? 17.871  4.810   -15.714 1.00 0.00 ? 63 LYS A CE   4  
ATOM 4320  N NZ   . LYS A 1 63 ? 17.574  5.075   -14.289 1.00 0.00 ? 63 LYS A NZ   4  
ATOM 4321  H H    . LYS A 1 63 ? 16.673  0.319   -13.048 1.00 0.00 ? 63 LYS A H    4  
ATOM 4322  H HA   . LYS A 1 63 ? 16.455  2.555   -15.027 1.00 0.00 ? 63 LYS A HA   4  
ATOM 4323  H HB2  . LYS A 1 63 ? 18.887  1.990   -14.110 1.00 0.00 ? 63 LYS A HB2  4  
ATOM 4324  H HB3  . LYS A 1 63 ? 18.735  0.574   -15.147 1.00 0.00 ? 63 LYS A HB3  4  
ATOM 4325  H HG2  . LYS A 1 63 ? 19.776  2.002   -16.564 1.00 0.00 ? 63 LYS A HG2  4  
ATOM 4326  H HG3  . LYS A 1 63 ? 18.118  2.328   -17.022 1.00 0.00 ? 63 LYS A HG3  4  
ATOM 4327  H HD2  . LYS A 1 63 ? 19.805  4.029   -15.133 1.00 0.00 ? 63 LYS A HD2  4  
ATOM 4328  H HD3  . LYS A 1 63 ? 19.591  4.309   -16.847 1.00 0.00 ? 63 LYS A HD3  4  
ATOM 4329  H HE2  . LYS A 1 63 ? 18.080  5.774   -16.177 1.00 0.00 ? 63 LYS A HE2  4  
ATOM 4330  H HE3  . LYS A 1 63 ? 17.002  4.393   -16.227 1.00 0.00 ? 63 LYS A HE3  4  
ATOM 4331  H HZ1  . LYS A 1 63 ? 17.235  4.257   -13.795 1.00 0.00 ? 63 LYS A HZ1  4  
ATOM 4332  H HZ2  . LYS A 1 63 ? 18.391  5.433   -13.799 1.00 0.00 ? 63 LYS A HZ2  4  
ATOM 4333  H HZ3  . LYS A 1 63 ? 16.828  5.766   -14.217 1.00 0.00 ? 63 LYS A HZ3  4  
ATOM 4334  N N    . LYS A 1 64 ? 16.270  -0.734  -15.313 1.00 0.00 ? 64 LYS A N    4  
ATOM 4335  C CA   . LYS A 1 64 ? 15.631  -1.903  -15.907 1.00 0.00 ? 64 LYS A CA   4  
ATOM 4336  C C    . LYS A 1 64 ? 16.146  -2.109  -17.327 1.00 0.00 ? 64 LYS A C    4  
ATOM 4337  O O    . LYS A 1 64 ? 16.947  -3.017  -17.535 1.00 0.00 ? 64 LYS A O    4  
ATOM 4338  C CB   . LYS A 1 64 ? 14.094  -1.885  -15.769 1.00 0.00 ? 64 LYS A CB   4  
ATOM 4339  C CG   . LYS A 1 64 ? 13.566  -3.304  -16.005 1.00 0.00 ? 64 LYS A CG   4  
ATOM 4340  C CD   . LYS A 1 64 ? 12.052  -3.390  -16.192 1.00 0.00 ? 64 LYS A CD   4  
ATOM 4341  C CE   . LYS A 1 64 ? 11.716  -4.868  -16.417 1.00 0.00 ? 64 LYS A CE   4  
ATOM 4342  N NZ   . LYS A 1 64 ? 10.410  -5.069  -17.068 1.00 0.00 ? 64 LYS A NZ   4  
ATOM 4343  H H    . LYS A 1 64 ? 17.041  -0.948  -14.689 1.00 0.00 ? 64 LYS A H    4  
ATOM 4344  H HA   . LYS A 1 64 ? 15.993  -2.755  -15.329 1.00 0.00 ? 64 LYS A HA   4  
ATOM 4345  H HB2  . LYS A 1 64 ? 13.812  -1.567  -14.764 1.00 0.00 ? 64 LYS A HB2  4  
ATOM 4346  H HB3  . LYS A 1 64 ? 13.657  -1.201  -16.497 1.00 0.00 ? 64 LYS A HB3  4  
ATOM 4347  H HG2  . LYS A 1 64 ? 14.021  -3.694  -16.911 1.00 0.00 ? 64 LYS A HG2  4  
ATOM 4348  H HG3  . LYS A 1 64 ? 13.861  -3.934  -15.166 1.00 0.00 ? 64 LYS A HG3  4  
ATOM 4349  H HD2  . LYS A 1 64 ? 11.536  -3.018  -15.305 1.00 0.00 ? 64 LYS A HD2  4  
ATOM 4350  H HD3  . LYS A 1 64 ? 11.765  -2.800  -17.065 1.00 0.00 ? 64 LYS A HD3  4  
ATOM 4351  H HE2  . LYS A 1 64 ? 12.483  -5.318  -17.052 1.00 0.00 ? 64 LYS A HE2  4  
ATOM 4352  H HE3  . LYS A 1 64 ? 11.729  -5.389  -15.458 1.00 0.00 ? 64 LYS A HE3  4  
ATOM 4353  H HZ1  . LYS A 1 64 ? 10.245  -6.072  -17.146 1.00 0.00 ? 64 LYS A HZ1  4  
ATOM 4354  H HZ2  . LYS A 1 64 ? 9.656   -4.683  -16.508 1.00 0.00 ? 64 LYS A HZ2  4  
ATOM 4355  H HZ3  . LYS A 1 64 ? 10.401  -4.677  -18.004 1.00 0.00 ? 64 LYS A HZ3  4  
ATOM 4356  N N    . LYS A 1 65 ? 15.739  -1.279  -18.291 1.00 0.00 ? 65 LYS A N    4  
ATOM 4357  C CA   . LYS A 1 65 ? 16.502  -1.168  -19.531 1.00 0.00 ? 65 LYS A CA   4  
ATOM 4358  C C    . LYS A 1 65 ? 17.898  -0.674  -19.154 1.00 0.00 ? 65 LYS A C    4  
ATOM 4359  O O    . LYS A 1 65 ? 18.037  0.098   -18.205 1.00 0.00 ? 65 LYS A O    4  
ATOM 4360  C CB   . LYS A 1 65 ? 15.813  -0.213  -20.525 1.00 0.00 ? 65 LYS A CB   4  
ATOM 4361  C CG   . LYS A 1 65 ? 14.645  -0.853  -21.299 1.00 0.00 ? 65 LYS A CG   4  
ATOM 4362  C CD   . LYS A 1 65 ? 15.060  -1.476  -22.646 1.00 0.00 ? 65 LYS A CD   4  
ATOM 4363  C CE   . LYS A 1 65 ? 16.063  -2.633  -22.559 1.00 0.00 ? 65 LYS A CE   4  
ATOM 4364  N NZ   . LYS A 1 65 ? 15.475  -3.878  -22.041 1.00 0.00 ? 65 LYS A NZ   4  
ATOM 4365  H H    . LYS A 1 65 ? 15.176  -0.487  -18.017 1.00 0.00 ? 65 LYS A H    4  
ATOM 4366  H HA   . LYS A 1 65 ? 16.599  -2.163  -19.962 1.00 0.00 ? 65 LYS A HA   4  
ATOM 4367  H HB2  . LYS A 1 65 ? 15.438  0.653   -19.976 1.00 0.00 ? 65 LYS A HB2  4  
ATOM 4368  H HB3  . LYS A 1 65 ? 16.545  0.158   -21.244 1.00 0.00 ? 65 LYS A HB3  4  
ATOM 4369  H HG2  . LYS A 1 65 ? 14.140  -1.592  -20.679 1.00 0.00 ? 65 LYS A HG2  4  
ATOM 4370  H HG3  . LYS A 1 65 ? 13.923  -0.065  -21.521 1.00 0.00 ? 65 LYS A HG3  4  
ATOM 4371  H HD2  . LYS A 1 65 ? 14.166  -1.801  -23.179 1.00 0.00 ? 65 LYS A HD2  4  
ATOM 4372  H HD3  . LYS A 1 65 ? 15.528  -0.698  -23.248 1.00 0.00 ? 65 LYS A HD3  4  
ATOM 4373  H HE2  . LYS A 1 65 ? 16.477  -2.819  -23.552 1.00 0.00 ? 65 LYS A HE2  4  
ATOM 4374  H HE3  . LYS A 1 65 ? 16.895  -2.335  -21.923 1.00 0.00 ? 65 LYS A HE3  4  
ATOM 4375  H HZ1  . LYS A 1 65 ? 16.219  -4.526  -21.797 1.00 0.00 ? 65 LYS A HZ1  4  
ATOM 4376  H HZ2  . LYS A 1 65 ? 14.935  -3.713  -21.196 1.00 0.00 ? 65 LYS A HZ2  4  
ATOM 4377  H HZ3  . LYS A 1 65 ? 14.853  -4.278  -22.734 1.00 0.00 ? 65 LYS A HZ3  4  
ATOM 4378  N N    . MET A 1 66 ? 18.910  -1.155  -19.872 1.00 0.00 ? 66 MET A N    4  
ATOM 4379  C CA   . MET A 1 66 ? 20.325  -0.798  -19.785 1.00 0.00 ? 66 MET A CA   4  
ATOM 4380  C C    . MET A 1 66 ? 21.079  -1.658  -20.805 1.00 0.00 ? 66 MET A C    4  
ATOM 4381  O O    . MET A 1 66 ? 22.017  -1.184  -21.445 1.00 0.00 ? 66 MET A O    4  
ATOM 4382  C CB   . MET A 1 66 ? 20.910  -1.020  -18.370 1.00 0.00 ? 66 MET A CB   4  
ATOM 4383  C CG   . MET A 1 66 ? 22.343  -0.475  -18.266 1.00 0.00 ? 66 MET A CG   4  
ATOM 4384  S SD   . MET A 1 66 ? 23.169  -0.766  -16.677 1.00 0.00 ? 66 MET A SD   4  
ATOM 4385  C CE   . MET A 1 66 ? 22.381  0.513   -15.658 1.00 0.00 ? 66 MET A CE   4  
ATOM 4386  H H    . MET A 1 66 ? 18.668  -1.644  -20.728 1.00 0.00 ? 66 MET A H    4  
ATOM 4387  H HA   . MET A 1 66 ? 20.432  0.253   -20.055 1.00 0.00 ? 66 MET A HA   4  
ATOM 4388  H HB2  . MET A 1 66 ? 20.313  -0.504  -17.622 1.00 0.00 ? 66 MET A HB2  4  
ATOM 4389  H HB3  . MET A 1 66 ? 20.904  -2.085  -18.132 1.00 0.00 ? 66 MET A HB3  4  
ATOM 4390  H HG2  . MET A 1 66 ? 22.955  -0.936  -19.038 1.00 0.00 ? 66 MET A HG2  4  
ATOM 4391  H HG3  . MET A 1 66 ? 22.328  0.598   -18.463 1.00 0.00 ? 66 MET A HG3  4  
ATOM 4392  H HE1  . MET A 1 66 ? 22.801  0.488   -14.652 1.00 0.00 ? 66 MET A HE1  4  
ATOM 4393  H HE2  . MET A 1 66 ? 22.565  1.495   -16.093 1.00 0.00 ? 66 MET A HE2  4  
ATOM 4394  H HE3  . MET A 1 66 ? 21.308  0.333   -15.602 1.00 0.00 ? 66 MET A HE3  4  
ATOM 4395  N N    . LYS A 1 67 ? 20.681  -2.927  -20.967 1.00 0.00 ? 67 LYS A N    4  
ATOM 4396  C CA   . LYS A 1 67 ? 21.257  -3.886  -21.906 1.00 0.00 ? 67 LYS A CA   4  
ATOM 4397  C C    . LYS A 1 67 ? 20.137  -4.411  -22.804 1.00 0.00 ? 67 LYS A C    4  
ATOM 4398  O O    . LYS A 1 67 ? 18.959  -4.344  -22.442 1.00 0.00 ? 67 LYS A O    4  
ATOM 4399  C CB   . LYS A 1 67 ? 21.941  -5.038  -21.144 1.00 0.00 ? 67 LYS A CB   4  
ATOM 4400  C CG   . LYS A 1 67 ? 23.381  -4.767  -20.667 1.00 0.00 ? 67 LYS A CG   4  
ATOM 4401  C CD   . LYS A 1 67 ? 23.505  -3.622  -19.648 1.00 0.00 ? 67 LYS A CD   4  
ATOM 4402  C CE   . LYS A 1 67 ? 24.564  -3.864  -18.568 1.00 0.00 ? 67 LYS A CE   4  
ATOM 4403  N NZ   . LYS A 1 67 ? 24.052  -4.761  -17.512 1.00 0.00 ? 67 LYS A NZ   4  
ATOM 4404  H H    . LYS A 1 67 ? 19.843  -3.241  -20.495 1.00 0.00 ? 67 LYS A H    4  
ATOM 4405  H HA   . LYS A 1 67 ? 21.991  -3.385  -22.541 1.00 0.00 ? 67 LYS A HA   4  
ATOM 4406  H HB2  . LYS A 1 67 ? 21.319  -5.323  -20.294 1.00 0.00 ? 67 LYS A HB2  4  
ATOM 4407  H HB3  . LYS A 1 67 ? 21.992  -5.902  -21.803 1.00 0.00 ? 67 LYS A HB3  4  
ATOM 4408  H HG2  . LYS A 1 67 ? 23.763  -5.687  -20.226 1.00 0.00 ? 67 LYS A HG2  4  
ATOM 4409  H HG3  . LYS A 1 67 ? 24.009  -4.540  -21.531 1.00 0.00 ? 67 LYS A HG3  4  
ATOM 4410  H HD2  . LYS A 1 67 ? 23.770  -2.715  -20.193 1.00 0.00 ? 67 LYS A HD2  4  
ATOM 4411  H HD3  . LYS A 1 67 ? 22.551  -3.465  -19.146 1.00 0.00 ? 67 LYS A HD3  4  
ATOM 4412  H HE2  . LYS A 1 67 ? 25.463  -4.284  -19.021 1.00 0.00 ? 67 LYS A HE2  4  
ATOM 4413  H HE3  . LYS A 1 67 ? 24.818  -2.906  -18.110 1.00 0.00 ? 67 LYS A HE3  4  
ATOM 4414  H HZ1  . LYS A 1 67 ? 23.219  -4.371  -17.076 1.00 0.00 ? 67 LYS A HZ1  4  
ATOM 4415  H HZ2  . LYS A 1 67 ? 23.752  -5.660  -17.879 1.00 0.00 ? 67 LYS A HZ2  4  
ATOM 4416  H HZ3  . LYS A 1 67 ? 24.709  -4.875  -16.747 1.00 0.00 ? 67 LYS A HZ3  4  
ATOM 4417  N N    . LEU A 1 68 ? 20.522  -4.966  -23.956 1.00 0.00 ? 68 LEU A N    4  
ATOM 4418  C CA   . LEU A 1 68 ? 19.608  -5.448  -24.986 1.00 0.00 ? 68 LEU A CA   4  
ATOM 4419  C C    . LEU A 1 68 ? 18.703  -6.538  -24.423 1.00 0.00 ? 68 LEU A C    4  
ATOM 4420  O O    . LEU A 1 68 ? 17.476  -6.431  -24.513 1.00 0.00 ? 68 LEU A O    4  
ATOM 4421  C CB   . LEU A 1 68 ? 20.386  -5.987  -26.204 1.00 0.00 ? 68 LEU A CB   4  
ATOM 4422  C CG   . LEU A 1 68 ? 21.264  -4.957  -26.941 1.00 0.00 ? 68 LEU A CG   4  
ATOM 4423  C CD1  . LEU A 1 68 ? 22.021  -5.656  -28.077 1.00 0.00 ? 68 LEU A CD1  4  
ATOM 4424  C CD2  . LEU A 1 68 ? 20.450  -3.791  -27.512 1.00 0.00 ? 68 LEU A CD2  4  
ATOM 4425  H H    . LEU A 1 68 ? 21.509  -5.019  -24.148 1.00 0.00 ? 68 LEU A H    4  
ATOM 4426  H HA   . LEU A 1 68 ? 18.974  -4.619  -25.305 1.00 0.00 ? 68 LEU A HA   4  
ATOM 4427  H HB2  . LEU A 1 68 ? 21.023  -6.810  -25.875 1.00 0.00 ? 68 LEU A HB2  4  
ATOM 4428  H HB3  . LEU A 1 68 ? 19.665  -6.398  -26.913 1.00 0.00 ? 68 LEU A HB3  4  
ATOM 4429  H HG   . LEU A 1 68 ? 22.002  -4.558  -26.243 1.00 0.00 ? 68 LEU A HG   4  
ATOM 4430  H HD11 . LEU A 1 68 ? 22.680  -4.945  -28.577 1.00 0.00 ? 68 LEU A HD11 4  
ATOM 4431  H HD12 . LEU A 1 68 ? 22.629  -6.468  -27.678 1.00 0.00 ? 68 LEU A HD12 4  
ATOM 4432  H HD13 . LEU A 1 68 ? 21.317  -6.062  -28.806 1.00 0.00 ? 68 LEU A HD13 4  
ATOM 4433  H HD21 . LEU A 1 68 ? 19.660  -4.167  -28.165 1.00 0.00 ? 68 LEU A HD21 4  
ATOM 4434  H HD22 . LEU A 1 68 ? 20.008  -3.207  -26.704 1.00 0.00 ? 68 LEU A HD22 4  
ATOM 4435  H HD23 . LEU A 1 68 ? 21.102  -3.132  -28.086 1.00 0.00 ? 68 LEU A HD23 4  
ATOM 4436  N N    . MET A 1 69 ? 19.296  -7.594  -23.862 1.00 0.00 ? 69 MET A N    4  
ATOM 4437  C CA   . MET A 1 69 ? 18.547  -8.707  -23.297 1.00 0.00 ? 69 MET A CA   4  
ATOM 4438  C C    . MET A 1 69 ? 17.832  -8.242  -22.029 1.00 0.00 ? 69 MET A C    4  
ATOM 4439  O O    . MET A 1 69 ? 18.267  -7.281  -21.382 1.00 0.00 ? 69 MET A O    4  
ATOM 4440  C CB   . MET A 1 69 ? 19.500  -9.887  -23.061 1.00 0.00 ? 69 MET A CB   4  
ATOM 4441  C CG   . MET A 1 69 ? 18.768  -11.231 -23.058 1.00 0.00 ? 69 MET A CG   4  
ATOM 4442  S SD   . MET A 1 69 ? 19.865  -12.670 -23.185 1.00 0.00 ? 69 MET A SD   4  
ATOM 4443  C CE   . MET A 1 69 ? 20.514  -12.485 -24.876 1.00 0.00 ? 69 MET A CE   4  
ATOM 4444  H H    . MET A 1 69 ? 20.309  -7.614  -23.785 1.00 0.00 ? 69 MET A H    4  
ATOM 4445  H HA   . MET A 1 69 ? 17.798  -9.000  -24.028 1.00 0.00 ? 69 MET A HA   4  
ATOM 4446  H HB2  . MET A 1 69 ? 20.226  -9.903  -23.873 1.00 0.00 ? 69 MET A HB2  4  
ATOM 4447  H HB3  . MET A 1 69 ? 20.039  -9.755  -22.122 1.00 0.00 ? 69 MET A HB3  4  
ATOM 4448  H HG2  . MET A 1 69 ? 18.190  -11.317 -22.137 1.00 0.00 ? 69 MET A HG2  4  
ATOM 4449  H HG3  . MET A 1 69 ? 18.074  -11.263 -23.899 1.00 0.00 ? 69 MET A HG3  4  
ATOM 4450  H HE1  . MET A 1 69 ? 21.069  -13.382 -25.156 1.00 0.00 ? 69 MET A HE1  4  
ATOM 4451  H HE2  . MET A 1 69 ? 19.692  -12.348 -25.580 1.00 0.00 ? 69 MET A HE2  4  
ATOM 4452  H HE3  . MET A 1 69 ? 21.183  -11.627 -24.932 1.00 0.00 ? 69 MET A HE3  4  
ATOM 4453  N N    . ARG A 1 70 ? 16.737  -8.908  -21.664 1.00 0.00 ? 70 ARG A N    4  
ATOM 4454  C CA   . ARG A 1 70 ? 15.810  -8.466  -20.635 1.00 0.00 ? 70 ARG A CA   4  
ATOM 4455  C C    . ARG A 1 70 ? 15.562  -9.626  -19.706 1.00 0.00 ? 70 ARG A C    4  
ATOM 4456  O O    . ARG A 1 70 ? 15.108  -10.683 -20.182 1.00 0.00 ? 70 ARG A O    4  
ATOM 4457  C CB   . ARG A 1 70 ? 14.525  -7.964  -21.311 1.00 0.00 ? 70 ARG A CB   4  
ATOM 4458  C CG   . ARG A 1 70 ? 13.440  -7.612  -20.287 1.00 0.00 ? 70 ARG A CG   4  
ATOM 4459  C CD   . ARG A 1 70 ? 12.221  -6.955  -20.934 1.00 0.00 ? 70 ARG A CD   4  
ATOM 4460  N NE   . ARG A 1 70 ? 11.279  -7.944  -21.469 1.00 0.00 ? 70 ARG A NE   4  
ATOM 4461  C CZ   . ARG A 1 70 ? 10.038  -7.692  -21.890 1.00 0.00 ? 70 ARG A CZ   4  
ATOM 4462  N NH1  . ARG A 1 70 ? 9.609   -6.445  -22.032 1.00 0.00 ? 70 ARG A NH1  4  
ATOM 4463  N NH2  . ARG A 1 70 ? 9.231   -8.701  -22.164 1.00 0.00 ? 70 ARG A NH2  4  
ATOM 4464  H H    . ARG A 1 70 ? 16.453  -9.749  -22.150 1.00 0.00 ? 70 ARG A H    4  
ATOM 4465  H HA   . ARG A 1 70 ? 16.246  -7.652  -20.056 1.00 0.00 ? 70 ARG A HA   4  
ATOM 4466  H HB2  . ARG A 1 70 ? 14.763  -7.080  -21.904 1.00 0.00 ? 70 ARG A HB2  4  
ATOM 4467  H HB3  . ARG A 1 70 ? 14.150  -8.737  -21.976 1.00 0.00 ? 70 ARG A HB3  4  
ATOM 4468  H HG2  . ARG A 1 70 ? 13.126  -8.508  -19.751 1.00 0.00 ? 70 ARG A HG2  4  
ATOM 4469  H HG3  . ARG A 1 70 ? 13.855  -6.913  -19.569 1.00 0.00 ? 70 ARG A HG3  4  
ATOM 4470  H HD2  . ARG A 1 70 ? 11.704  -6.377  -20.170 1.00 0.00 ? 70 ARG A HD2  4  
ATOM 4471  H HD3  . ARG A 1 70 ? 12.544  -6.283  -21.729 1.00 0.00 ? 70 ARG A HD3  4  
ATOM 4472  H HE   . ARG A 1 70 ? 11.619  -8.901  -21.528 1.00 0.00 ? 70 ARG A HE   4  
ATOM 4473  H HH11 . ARG A 1 70 ? 10.262  -5.676  -21.939 1.00 0.00 ? 70 ARG A HH11 4  
ATOM 4474  H HH12 . ARG A 1 70 ? 8.688   -6.227  -22.407 1.00 0.00 ? 70 ARG A HH12 4  
ATOM 4475  H HH21 . ARG A 1 70 ? 9.559   -9.657  -22.023 1.00 0.00 ? 70 ARG A HH21 4  
ATOM 4476  H HH22 . ARG A 1 70 ? 8.260   -8.551  -22.431 1.00 0.00 ? 70 ARG A HH22 4  
ATOM 4477  N N    . GLY A 1 1  ? 8.752   -25.164 -17.515 1.00 0.00 ? 1  GLY A N    5  
ATOM 4478  C CA   . GLY A 1 1  ? 8.311   -25.654 -16.207 1.00 0.00 ? 1  GLY A CA   5  
ATOM 4479  C C    . GLY A 1 1  ? 8.726   -24.655 -15.148 1.00 0.00 ? 1  GLY A C    5  
ATOM 4480  O O    . GLY A 1 1  ? 9.912   -24.563 -14.833 1.00 0.00 ? 1  GLY A O    5  
ATOM 4481  H H1   . GLY A 1 1  ? 8.528   -25.759 -18.287 1.00 0.00 ? 1  GLY A H1   5  
ATOM 4482  H HA2  . GLY A 1 1  ? 7.226   -25.763 -16.208 1.00 0.00 ? 1  GLY A HA2  5  
ATOM 4483  H HA3  . GLY A 1 1  ? 8.781   -26.613 -15.995 1.00 0.00 ? 1  GLY A HA3  5  
ATOM 4484  N N    . SER A 1 2  ? 7.771   -23.890 -14.617 1.00 0.00 ? 2  SER A N    5  
ATOM 4485  C CA   . SER A 1 2  ? 7.982   -22.977 -13.502 1.00 0.00 ? 2  SER A CA   5  
ATOM 4486  C C    . SER A 1 2  ? 6.627   -22.569 -12.917 1.00 0.00 ? 2  SER A C    5  
ATOM 4487  O O    . SER A 1 2  ? 6.450   -22.607 -11.700 1.00 0.00 ? 2  SER A O    5  
ATOM 4488  C CB   . SER A 1 2  ? 8.780   -21.748 -13.971 1.00 0.00 ? 2  SER A CB   5  
ATOM 4489  O OG   . SER A 1 2  ? 9.363   -21.040 -12.894 1.00 0.00 ? 2  SER A OG   5  
ATOM 4490  H H    . SER A 1 2  ? 6.806   -24.080 -14.879 1.00 0.00 ? 2  SER A H    5  
ATOM 4491  H HA   . SER A 1 2  ? 8.556   -23.503 -12.738 1.00 0.00 ? 2  SER A HA   5  
ATOM 4492  H HB2  . SER A 1 2  ? 9.593   -22.073 -14.619 1.00 0.00 ? 2  SER A HB2  5  
ATOM 4493  H HB3  . SER A 1 2  ? 8.132   -21.080 -14.543 1.00 0.00 ? 2  SER A HB3  5  
ATOM 4494  H HG   . SER A 1 2  ? 9.254   -21.556 -12.071 1.00 0.00 ? 2  SER A HG   5  
ATOM 4495  N N    . SER A 1 3  ? 5.657   -22.194 -13.759 1.00 0.00 ? 3  SER A N    5  
ATOM 4496  C CA   . SER A 1 3  ? 4.377   -21.716 -13.260 1.00 0.00 ? 3  SER A CA   5  
ATOM 4497  C C    . SER A 1 3  ? 3.566   -22.844 -12.616 1.00 0.00 ? 3  SER A C    5  
ATOM 4498  O O    . SER A 1 3  ? 3.796   -24.038 -12.859 1.00 0.00 ? 3  SER A O    5  
ATOM 4499  C CB   . SER A 1 3  ? 3.570   -21.018 -14.367 1.00 0.00 ? 3  SER A CB   5  
ATOM 4500  O OG   . SER A 1 3  ? 2.955   -19.860 -13.828 1.00 0.00 ? 3  SER A OG   5  
ATOM 4501  H H    . SER A 1 3  ? 5.802   -22.224 -14.755 1.00 0.00 ? 3  SER A H    5  
ATOM 4502  H HA   . SER A 1 3  ? 4.606   -20.981 -12.491 1.00 0.00 ? 3  SER A HA   5  
ATOM 4503  H HB2  . SER A 1 3  ? 4.225   -20.714 -15.185 1.00 0.00 ? 3  SER A HB2  5  
ATOM 4504  H HB3  . SER A 1 3  ? 2.806   -21.696 -14.749 1.00 0.00 ? 3  SER A HB3  5  
ATOM 4505  H HG   . SER A 1 3  ? 2.165   -19.642 -14.369 1.00 0.00 ? 3  SER A HG   5  
ATOM 4506  N N    . GLY A 1 4  ? 2.578   -22.440 -11.828 1.00 0.00 ? 4  GLY A N    5  
ATOM 4507  C CA   . GLY A 1 4  ? 1.474   -23.255 -11.369 1.00 0.00 ? 4  GLY A CA   5  
ATOM 4508  C C    . GLY A 1 4  ? 0.218   -22.483 -11.712 1.00 0.00 ? 4  GLY A C    5  
ATOM 4509  O O    . GLY A 1 4  ? -0.087  -22.300 -12.893 1.00 0.00 ? 4  GLY A O    5  
ATOM 4510  H H    . GLY A 1 4  ? 2.505   -21.442 -11.660 1.00 0.00 ? 4  GLY A H    5  
ATOM 4511  H HA2  . GLY A 1 4  ? 1.448   -24.200 -11.900 1.00 0.00 ? 4  GLY A HA2  5  
ATOM 4512  H HA3  . GLY A 1 4  ? 1.554   -23.434 -10.296 1.00 0.00 ? 4  GLY A HA3  5  
ATOM 4513  N N    . SER A 1 5  ? -0.471  -21.969 -10.701 1.00 0.00 ? 5  SER A N    5  
ATOM 4514  C CA   . SER A 1 5  ? -1.574  -21.045 -10.889 1.00 0.00 ? 5  SER A CA   5  
ATOM 4515  C C    . SER A 1 5  ? -1.748  -20.260 -9.600  1.00 0.00 ? 5  SER A C    5  
ATOM 4516  O O    . SER A 1 5  ? -2.011  -20.870 -8.562  1.00 0.00 ? 5  SER A O    5  
ATOM 4517  C CB   . SER A 1 5  ? -2.856  -21.798 -11.278 1.00 0.00 ? 5  SER A CB   5  
ATOM 4518  O OG   . SER A 1 5  ? -2.953  -23.081 -10.668 1.00 0.00 ? 5  SER A OG   5  
ATOM 4519  H H    . SER A 1 5  ? -0.185  -22.137 -9.747  1.00 0.00 ? 5  SER A H    5  
ATOM 4520  H HA   . SER A 1 5  ? -1.328  -20.353 -11.692 1.00 0.00 ? 5  SER A HA   5  
ATOM 4521  H HB2  . SER A 1 5  ? -3.722  -21.191 -11.011 1.00 0.00 ? 5  SER A HB2  5  
ATOM 4522  H HB3  . SER A 1 5  ? -2.863  -21.929 -12.360 1.00 0.00 ? 5  SER A HB3  5  
ATOM 4523  H HG   . SER A 1 5  ? -2.891  -22.962 -9.710  1.00 0.00 ? 5  SER A HG   5  
ATOM 4524  N N    . SER A 1 6  ? -1.610  -18.941 -9.662  1.00 0.00 ? 6  SER A N    5  
ATOM 4525  C CA   . SER A 1 6  ? -2.132  -18.040 -8.651  1.00 0.00 ? 6  SER A CA   5  
ATOM 4526  C C    . SER A 1 6  ? -3.451  -17.494 -9.197  1.00 0.00 ? 6  SER A C    5  
ATOM 4527  O O    . SER A 1 6  ? -3.521  -17.121 -10.373 1.00 0.00 ? 6  SER A O    5  
ATOM 4528  C CB   . SER A 1 6  ? -1.096  -16.951 -8.330  1.00 0.00 ? 6  SER A CB   5  
ATOM 4529  O OG   . SER A 1 6  ? -0.393  -16.452 -9.459  1.00 0.00 ? 6  SER A OG   5  
ATOM 4530  H H    . SER A 1 6  ? -1.399  -18.489 -10.542 1.00 0.00 ? 6  SER A H    5  
ATOM 4531  H HA   . SER A 1 6  ? -2.337  -18.586 -7.730  1.00 0.00 ? 6  SER A HA   5  
ATOM 4532  H HB2  . SER A 1 6  ? -1.600  -16.137 -7.820  1.00 0.00 ? 6  SER A HB2  5  
ATOM 4533  H HB3  . SER A 1 6  ? -0.358  -17.369 -7.651  1.00 0.00 ? 6  SER A HB3  5  
ATOM 4534  H HG   . SER A 1 6  ? 0.339   -15.896 -9.107  1.00 0.00 ? 6  SER A HG   5  
ATOM 4535  N N    . GLY A 1 7  ? -4.506  -17.464 -8.380  1.00 0.00 ? 7  GLY A N    5  
ATOM 4536  C CA   . GLY A 1 7  ? -5.829  -16.992 -8.777  1.00 0.00 ? 7  GLY A CA   5  
ATOM 4537  C C    . GLY A 1 7  ? -6.939  -17.810 -8.121  1.00 0.00 ? 7  GLY A C    5  
ATOM 4538  O O    . GLY A 1 7  ? -6.641  -18.737 -7.359  1.00 0.00 ? 7  GLY A O    5  
ATOM 4539  H H    . GLY A 1 7  ? -4.433  -17.795 -7.430  1.00 0.00 ? 7  GLY A H    5  
ATOM 4540  H HA2  . GLY A 1 7  ? -5.934  -15.947 -8.499  1.00 0.00 ? 7  GLY A HA2  5  
ATOM 4541  H HA3  . GLY A 1 7  ? -5.922  -17.070 -9.854  1.00 0.00 ? 7  GLY A HA3  5  
ATOM 4542  N N    . ARG A 1 8  ? -8.198  -17.516 -8.476  1.00 0.00 ? 8  ARG A N    5  
ATOM 4543  C CA   . ARG A 1 8  ? -9.452  -18.116 -7.992  1.00 0.00 ? 8  ARG A CA   5  
ATOM 4544  C C    . ARG A 1 8  ? -9.739  -17.775 -6.527  1.00 0.00 ? 8  ARG A C    5  
ATOM 4545  O O    . ARG A 1 8  ? -8.888  -17.241 -5.816  1.00 0.00 ? 8  ARG A O    5  
ATOM 4546  C CB   . ARG A 1 8  ? -9.501  -19.634 -8.262  1.00 0.00 ? 8  ARG A CB   5  
ATOM 4547  C CG   . ARG A 1 8  ? -9.597  -20.003 -9.752  1.00 0.00 ? 8  ARG A CG   5  
ATOM 4548  C CD   . ARG A 1 8  ? -9.092  -21.427 -10.009 1.00 0.00 ? 8  ARG A CD   5  
ATOM 4549  N NE   . ARG A 1 8  ? -9.727  -22.441 -9.145  1.00 0.00 ? 8  ARG A NE   5  
ATOM 4550  C CZ   . ARG A 1 8  ? -9.343  -23.722 -9.061  1.00 0.00 ? 8  ARG A CZ   5  
ATOM 4551  N NH1  . ARG A 1 8  ? -8.332  -24.200 -9.773  1.00 0.00 ? 8  ARG A NH1  5  
ATOM 4552  N NH2  . ARG A 1 8  ? -9.988  -24.570 -8.274  1.00 0.00 ? 8  ARG A NH2  5  
ATOM 4553  H H    . ARG A 1 8  ? -8.332  -16.726 -9.098  1.00 0.00 ? 8  ARG A H    5  
ATOM 4554  H HA   . ARG A 1 8  ? -10.253 -17.654 -8.572  1.00 0.00 ? 8  ARG A HA   5  
ATOM 4555  H HB2  . ARG A 1 8  ? -8.633  -20.115 -7.814  1.00 0.00 ? 8  ARG A HB2  5  
ATOM 4556  H HB3  . ARG A 1 8  ? -10.376 -20.050 -7.772  1.00 0.00 ? 8  ARG A HB3  5  
ATOM 4557  H HG2  . ARG A 1 8  ? -10.633 -19.911 -10.081 1.00 0.00 ? 8  ARG A HG2  5  
ATOM 4558  H HG3  . ARG A 1 8  ? -8.990  -19.322 -10.346 1.00 0.00 ? 8  ARG A HG3  5  
ATOM 4559  H HD2  . ARG A 1 8  ? -9.261  -21.681 -11.057 1.00 0.00 ? 8  ARG A HD2  5  
ATOM 4560  H HD3  . ARG A 1 8  ? -8.021  -21.432 -9.818  1.00 0.00 ? 8  ARG A HD3  5  
ATOM 4561  H HE   . ARG A 1 8  ? -10.513 -22.126 -8.588  1.00 0.00 ? 8  ARG A HE   5  
ATOM 4562  H HH11 . ARG A 1 8  ? -7.746  -23.611 -10.367 1.00 0.00 ? 8  ARG A HH11 5  
ATOM 4563  H HH12 . ARG A 1 8  ? -8.072  -25.179 -9.701  1.00 0.00 ? 8  ARG A HH12 5  
ATOM 4564  H HH21 . ARG A 1 8  ? -10.677 -24.278 -7.574  1.00 0.00 ? 8  ARG A HH21 5  
ATOM 4565  H HH22 . ARG A 1 8  ? -9.642  -25.529 -8.214  1.00 0.00 ? 8  ARG A HH22 5  
ATOM 4566  N N    . GLY A 1 9  ? -10.957 -18.085 -6.077  1.00 0.00 ? 9  GLY A N    5  
ATOM 4567  C CA   . GLY A 1 9  ? -11.491 -17.689 -4.781  1.00 0.00 ? 9  GLY A CA   5  
ATOM 4568  C C    . GLY A 1 9  ? -12.271 -16.383 -4.902  1.00 0.00 ? 9  GLY A C    5  
ATOM 4569  O O    . GLY A 1 9  ? -12.222 -15.711 -5.935  1.00 0.00 ? 9  GLY A O    5  
ATOM 4570  H H    . GLY A 1 9  ? -11.631 -18.468 -6.728  1.00 0.00 ? 9  GLY A H    5  
ATOM 4571  H HA2  . GLY A 1 9  ? -12.163 -18.466 -4.427  1.00 0.00 ? 9  GLY A HA2  5  
ATOM 4572  H HA3  . GLY A 1 9  ? -10.680 -17.563 -4.063  1.00 0.00 ? 9  GLY A HA3  5  
ATOM 4573  N N    . ARG A 1 10 ? -13.001 -16.012 -3.847  1.00 0.00 ? 10 ARG A N    5  
ATOM 4574  C CA   . ARG A 1 10 ? -13.629 -14.695 -3.736  1.00 0.00 ? 10 ARG A CA   5  
ATOM 4575  C C    . ARG A 1 10 ? -12.622 -13.708 -3.137  1.00 0.00 ? 10 ARG A C    5  
ATOM 4576  O O    . ARG A 1 10 ? -11.458 -14.059 -2.921  1.00 0.00 ? 10 ARG A O    5  
ATOM 4577  C CB   . ARG A 1 10 ? -14.928 -14.791 -2.898  1.00 0.00 ? 10 ARG A CB   5  
ATOM 4578  C CG   . ARG A 1 10 ? -16.023 -13.772 -3.266  1.00 0.00 ? 10 ARG A CG   5  
ATOM 4579  C CD   . ARG A 1 10 ? -16.946 -14.143 -4.431  1.00 0.00 ? 10 ARG A CD   5  
ATOM 4580  N NE   . ARG A 1 10 ? -16.216 -14.564 -5.637  1.00 0.00 ? 10 ARG A NE   5  
ATOM 4581  C CZ   . ARG A 1 10 ? -16.139 -15.803 -6.132  1.00 0.00 ? 10 ARG A CZ   5  
ATOM 4582  N NH1  . ARG A 1 10 ? -16.924 -16.771 -5.672  1.00 0.00 ? 10 ARG A NH1  5  
ATOM 4583  N NH2  . ARG A 1 10 ? -15.254 -16.071 -7.083  1.00 0.00 ? 10 ARG A NH2  5  
ATOM 4584  H H    . ARG A 1 10 ? -12.941 -16.566 -3.007  1.00 0.00 ? 10 ARG A H    5  
ATOM 4585  H HA   . ARG A 1 10 ? -13.860 -14.341 -4.739  1.00 0.00 ? 10 ARG A HA   5  
ATOM 4586  H HB2  . ARG A 1 10 ? -15.356 -15.789 -2.977  1.00 0.00 ? 10 ARG A HB2  5  
ATOM 4587  H HB3  . ARG A 1 10 ? -14.670 -14.618 -1.853  1.00 0.00 ? 10 ARG A HB3  5  
ATOM 4588  H HG2  . ARG A 1 10 ? -16.655 -13.654 -2.390  1.00 0.00 ? 10 ARG A HG2  5  
ATOM 4589  H HG3  . ARG A 1 10 ? -15.584 -12.805 -3.467  1.00 0.00 ? 10 ARG A HG3  5  
ATOM 4590  H HD2  . ARG A 1 10 ? -17.601 -14.933 -4.088  1.00 0.00 ? 10 ARG A HD2  5  
ATOM 4591  H HD3  . ARG A 1 10 ? -17.565 -13.278 -4.673  1.00 0.00 ? 10 ARG A HD3  5  
ATOM 4592  H HE   . ARG A 1 10 ? -15.650 -13.840 -6.077  1.00 0.00 ? 10 ARG A HE   5  
ATOM 4593  H HH11 . ARG A 1 10 ? -17.695 -16.567 -5.041  1.00 0.00 ? 10 ARG A HH11 5  
ATOM 4594  H HH12 . ARG A 1 10 ? -16.706 -17.738 -5.893  1.00 0.00 ? 10 ARG A HH12 5  
ATOM 4595  H HH21 . ARG A 1 10 ? -14.606 -15.332 -7.357  1.00 0.00 ? 10 ARG A HH21 5  
ATOM 4596  H HH22 . ARG A 1 10 ? -15.216 -16.943 -7.608  1.00 0.00 ? 10 ARG A HH22 5  
ATOM 4597  N N    . TYR A 1 11 ? -13.090 -12.493 -2.851  1.00 0.00 ? 11 TYR A N    5  
ATOM 4598  C CA   . TYR A 1 11 ? -12.385 -11.458 -2.115  1.00 0.00 ? 11 TYR A CA   5  
ATOM 4599  C C    . TYR A 1 11 ? -11.685 -12.041 -0.891  1.00 0.00 ? 11 TYR A C    5  
ATOM 4600  O O    . TYR A 1 11 ? -12.260 -12.850 -0.155  1.00 0.00 ? 11 TYR A O    5  
ATOM 4601  C CB   . TYR A 1 11 ? -13.377 -10.384 -1.663  1.00 0.00 ? 11 TYR A CB   5  
ATOM 4602  C CG   . TYR A 1 11 ? -14.056 -9.619  -2.779  1.00 0.00 ? 11 TYR A CG   5  
ATOM 4603  C CD1  . TYR A 1 11 ? -13.407 -8.520  -3.365  1.00 0.00 ? 11 TYR A CD1  5  
ATOM 4604  C CD2  . TYR A 1 11 ? -15.373 -9.935  -3.161  1.00 0.00 ? 11 TYR A CD2  5  
ATOM 4605  C CE1  . TYR A 1 11 ? -14.082 -7.703  -4.285  1.00 0.00 ? 11 TYR A CE1  5  
ATOM 4606  C CE2  . TYR A 1 11 ? -16.050 -9.134  -4.097  1.00 0.00 ? 11 TYR A CE2  5  
ATOM 4607  C CZ   . TYR A 1 11 ? -15.408 -8.008  -4.659  1.00 0.00 ? 11 TYR A CZ   5  
ATOM 4608  O OH   . TYR A 1 11 ? -16.060 -7.180  -5.519  1.00 0.00 ? 11 TYR A OH   5  
ATOM 4609  H H    . TYR A 1 11 ? -14.008 -12.240 -3.182  1.00 0.00 ? 11 TYR A H    5  
ATOM 4610  H HA   . TYR A 1 11 ? -11.647 -11.009 -2.781  1.00 0.00 ? 11 TYR A HA   5  
ATOM 4611  H HB2  . TYR A 1 11 ? -14.137 -10.849 -1.031  1.00 0.00 ? 11 TYR A HB2  5  
ATOM 4612  H HB3  . TYR A 1 11 ? -12.846 -9.666  -1.037  1.00 0.00 ? 11 TYR A HB3  5  
ATOM 4613  H HD1  . TYR A 1 11 ? -12.393 -8.274  -3.089  1.00 0.00 ? 11 TYR A HD1  5  
ATOM 4614  H HD2  . TYR A 1 11 ? -15.878 -10.780 -2.712  1.00 0.00 ? 11 TYR A HD2  5  
ATOM 4615  H HE1  . TYR A 1 11 ? -13.577 -6.845  -4.707  1.00 0.00 ? 11 TYR A HE1  5  
ATOM 4616  H HE2  . TYR A 1 11 ? -17.072 -9.368  -4.359  1.00 0.00 ? 11 TYR A HE2  5  
ATOM 4617  H HH   . TYR A 1 11 ? -16.844 -7.567  -5.925  1.00 0.00 ? 11 TYR A HH   5  
ATOM 4618  N N    . ARG A 1 12 ? -10.435 -11.636 -0.684  1.00 0.00 ? 12 ARG A N    5  
ATOM 4619  C CA   . ARG A 1 12 ? -9.596  -12.118 0.404   1.00 0.00 ? 12 ARG A CA   5  
ATOM 4620  C C    . ARG A 1 12 ? -8.506  -11.099 0.721   1.00 0.00 ? 12 ARG A C    5  
ATOM 4621  O O    . ARG A 1 12 ? -8.386  -10.695 1.877   1.00 0.00 ? 12 ARG A O    5  
ATOM 4622  C CB   . ARG A 1 12 ? -9.000  -13.477 -0.013  1.00 0.00 ? 12 ARG A CB   5  
ATOM 4623  C CG   . ARG A 1 12 ? -8.667  -14.401 1.165   1.00 0.00 ? 12 ARG A CG   5  
ATOM 4624  C CD   . ARG A 1 12 ? -9.363  -15.762 1.028   1.00 0.00 ? 12 ARG A CD   5  
ATOM 4625  N NE   . ARG A 1 12 ? -10.826 -15.606 1.000   1.00 0.00 ? 12 ARG A NE   5  
ATOM 4626  C CZ   . ARG A 1 12 ? -11.721 -16.373 0.374   1.00 0.00 ? 12 ARG A CZ   5  
ATOM 4627  N NH1  . ARG A 1 12 ? -11.367 -17.444 -0.334  1.00 0.00 ? 12 ARG A NH1  5  
ATOM 4628  N NH2  . ARG A 1 12 ? -12.998 -16.043 0.464   1.00 0.00 ? 12 ARG A NH2  5  
ATOM 4629  H H    . ARG A 1 12 ? -10.076 -10.914 -1.303  1.00 0.00 ? 12 ARG A H    5  
ATOM 4630  H HA   . ARG A 1 12 ? -10.227 -12.245 1.286   1.00 0.00 ? 12 ARG A HA   5  
ATOM 4631  H HB2  . ARG A 1 12 ? -9.695  -13.988 -0.679  1.00 0.00 ? 12 ARG A HB2  5  
ATOM 4632  H HB3  . ARG A 1 12 ? -8.094  -13.317 -0.582  1.00 0.00 ? 12 ARG A HB3  5  
ATOM 4633  H HG2  . ARG A 1 12 ? -7.589  -14.558 1.203   1.00 0.00 ? 12 ARG A HG2  5  
ATOM 4634  H HG3  . ARG A 1 12 ? -8.982  -13.936 2.096   1.00 0.00 ? 12 ARG A HG3  5  
ATOM 4635  H HD2  . ARG A 1 12 ? -9.016  -16.245 0.114   1.00 0.00 ? 12 ARG A HD2  5  
ATOM 4636  H HD3  . ARG A 1 12 ? -9.095  -16.385 1.880   1.00 0.00 ? 12 ARG A HD3  5  
ATOM 4637  H HE   . ARG A 1 12 ? -11.176 -14.798 1.502   1.00 0.00 ? 12 ARG A HE   5  
ATOM 4638  H HH11 . ARG A 1 12 ? -10.387 -17.685 -0.481  1.00 0.00 ? 12 ARG A HH11 5  
ATOM 4639  H HH12 . ARG A 1 12 ? -12.042 -18.093 -0.730  1.00 0.00 ? 12 ARG A HH12 5  
ATOM 4640  H HH21 . ARG A 1 12 ? -13.254 -15.221 1.017   1.00 0.00 ? 12 ARG A HH21 5  
ATOM 4641  H HH22 . ARG A 1 12 ? -13.740 -16.616 0.079   1.00 0.00 ? 12 ARG A HH22 5  
ATOM 4642  N N    . GLN A 1 13 ? -7.744  -10.702 -0.304  1.00 0.00 ? 13 GLN A N    5  
ATOM 4643  C CA   . GLN A 1 13 ? -6.495  -9.951  -0.226  1.00 0.00 ? 13 GLN A CA   5  
ATOM 4644  C C    . GLN A 1 13 ? -6.548  -8.736  -1.165  1.00 0.00 ? 13 GLN A C    5  
ATOM 4645  O O    . GLN A 1 13 ? -7.373  -8.710  -2.086  1.00 0.00 ? 13 GLN A O    5  
ATOM 4646  C CB   . GLN A 1 13 ? -5.325  -10.892 -0.567  1.00 0.00 ? 13 GLN A CB   5  
ATOM 4647  C CG   . GLN A 1 13 ? -5.218  -11.327 -2.042  1.00 0.00 ? 13 GLN A CG   5  
ATOM 4648  C CD   . GLN A 1 13 ? -6.297  -12.329 -2.442  1.00 0.00 ? 13 GLN A CD   5  
ATOM 4649  O OE1  . GLN A 1 13 ? -7.349  -11.984 -2.986  1.00 0.00 ? 13 GLN A OE1  5  
ATOM 4650  N NE2  . GLN A 1 13 ? -6.100  -13.595 -2.111  1.00 0.00 ? 13 GLN A NE2  5  
ATOM 4651  H H    . GLN A 1 13 ? -7.979  -11.023 -1.234  1.00 0.00 ? 13 GLN A H    5  
ATOM 4652  H HA   . GLN A 1 13 ? -6.355  -9.609  0.797   1.00 0.00 ? 13 GLN A HA   5  
ATOM 4653  H HB2  . GLN A 1 13 ? -4.403  -10.390 -0.300  1.00 0.00 ? 13 GLN A HB2  5  
ATOM 4654  H HB3  . GLN A 1 13 ? -5.388  -11.778 0.066   1.00 0.00 ? 13 GLN A HB3  5  
ATOM 4655  H HG2  . GLN A 1 13 ? -5.258  -10.462 -2.705  1.00 0.00 ? 13 GLN A HG2  5  
ATOM 4656  H HG3  . GLN A 1 13 ? -4.243  -11.791 -2.187  1.00 0.00 ? 13 GLN A HG3  5  
ATOM 4657  H HE21 . GLN A 1 13 ? -5.338  -13.805 -1.455  1.00 0.00 ? 13 GLN A HE21 5  
ATOM 4658  H HE22 . GLN A 1 13 ? -6.826  -14.274 -2.301  1.00 0.00 ? 13 GLN A HE22 5  
ATOM 4659  N N    . TYR A 1 14 ? -5.651  -7.760  -1.008  1.00 0.00 ? 14 TYR A N    5  
ATOM 4660  C CA   . TYR A 1 14 ? -5.574  -6.612  -1.911  1.00 0.00 ? 14 TYR A CA   5  
ATOM 4661  C C    . TYR A 1 14 ? -4.662  -6.958  -3.092  1.00 0.00 ? 14 TYR A C    5  
ATOM 4662  O O    . TYR A 1 14 ? -3.633  -7.619  -2.904  1.00 0.00 ? 14 TYR A O    5  
ATOM 4663  C CB   . TYR A 1 14 ? -5.104  -5.356  -1.156  1.00 0.00 ? 14 TYR A CB   5  
ATOM 4664  C CG   . TYR A 1 14 ? -3.675  -5.393  -0.615  1.00 0.00 ? 14 TYR A CG   5  
ATOM 4665  C CD1  . TYR A 1 14 ? -2.599  -5.079  -1.461  1.00 0.00 ? 14 TYR A CD1  5  
ATOM 4666  C CD2  . TYR A 1 14 ? -3.398  -5.758  0.719   1.00 0.00 ? 14 TYR A CD2  5  
ATOM 4667  C CE1  . TYR A 1 14 ? -1.270  -5.236  -1.048  1.00 0.00 ? 14 TYR A CE1  5  
ATOM 4668  C CE2  . TYR A 1 14 ? -2.063  -5.896  1.154   1.00 0.00 ? 14 TYR A CE2  5  
ATOM 4669  C CZ   . TYR A 1 14 ? -0.993  -5.659  0.265   1.00 0.00 ? 14 TYR A CZ   5  
ATOM 4670  O OH   . TYR A 1 14 ? 0.292   -5.860  0.660   1.00 0.00 ? 14 TYR A OH   5  
ATOM 4671  H H    . TYR A 1 14 ? -4.936  -7.839  -0.299  1.00 0.00 ? 14 TYR A H    5  
ATOM 4672  H HA   . TYR A 1 14 ? -6.575  -6.396  -2.290  1.00 0.00 ? 14 TYR A HA   5  
ATOM 4673  H HB2  . TYR A 1 14 ? -5.220  -4.501  -1.834  1.00 0.00 ? 14 TYR A HB2  5  
ATOM 4674  H HB3  . TYR A 1 14 ? -5.793  -5.194  -0.326  1.00 0.00 ? 14 TYR A HB3  5  
ATOM 4675  H HD1  . TYR A 1 14 ? -2.767  -4.702  -2.448  1.00 0.00 ? 14 TYR A HD1  5  
ATOM 4676  H HD2  . TYR A 1 14 ? -4.205  -5.950  1.408   1.00 0.00 ? 14 TYR A HD2  5  
ATOM 4677  H HE1  . TYR A 1 14 ? -0.480  -5.002  -1.748  1.00 0.00 ? 14 TYR A HE1  5  
ATOM 4678  H HE2  . TYR A 1 14 ? -1.835  -6.238  2.148   1.00 0.00 ? 14 TYR A HE2  5  
ATOM 4679  H HH   . TYR A 1 14 ? 0.871   -6.015  -0.106  1.00 0.00 ? 14 TYR A HH   5  
ATOM 4680  N N    . ASN A 1 15 ? -5.023  -6.505  -4.299  1.00 0.00 ? 15 ASN A N    5  
ATOM 4681  C CA   . ASN A 1 15 ? -4.136  -6.506  -5.465  1.00 0.00 ? 15 ASN A CA   5  
ATOM 4682  C C    . ASN A 1 15 ? -3.031  -5.478  -5.241  1.00 0.00 ? 15 ASN A C    5  
ATOM 4683  O O    . ASN A 1 15 ? -3.296  -4.432  -4.659  1.00 0.00 ? 15 ASN A O    5  
ATOM 4684  C CB   . ASN A 1 15 ? -4.903  -6.162  -6.761  1.00 0.00 ? 15 ASN A CB   5  
ATOM 4685  C CG   . ASN A 1 15 ? -5.558  -7.366  -7.439  1.00 0.00 ? 15 ASN A CG   5  
ATOM 4686  O OD1  . ASN A 1 15 ? -5.384  -8.509  -7.024  1.00 0.00 ? 15 ASN A OD1  5  
ATOM 4687  N ND2  . ASN A 1 15 ? -6.302  -7.149  -8.507  1.00 0.00 ? 15 ASN A ND2  5  
ATOM 4688  H H    . ASN A 1 15 ? -5.870  -5.962  -4.366  1.00 0.00 ? 15 ASN A H    5  
ATOM 4689  H HA   . ASN A 1 15 ? -3.682  -7.482  -5.579  1.00 0.00 ? 15 ASN A HA   5  
ATOM 4690  H HB2  . ASN A 1 15 ? -5.653  -5.398  -6.563  1.00 0.00 ? 15 ASN A HB2  5  
ATOM 4691  H HB3  . ASN A 1 15 ? -4.199  -5.741  -7.480  1.00 0.00 ? 15 ASN A HB3  5  
ATOM 4692  H HD21 . ASN A 1 15 ? -6.516  -6.181  -8.778  1.00 0.00 ? 15 ASN A HD21 5  
ATOM 4693  H HD22 . ASN A 1 15 ? -6.752  -7.907  -9.003  1.00 0.00 ? 15 ASN A HD22 5  
ATOM 4694  N N    . SER A 1 16 ? -1.825  -5.698  -5.766  1.00 0.00 ? 16 SER A N    5  
ATOM 4695  C CA   . SER A 1 16 ? -0.744  -4.714  -5.711  1.00 0.00 ? 16 SER A CA   5  
ATOM 4696  C C    . SER A 1 16 ? -1.172  -3.343  -6.256  1.00 0.00 ? 16 SER A C    5  
ATOM 4697  O O    . SER A 1 16 ? -0.654  -2.322  -5.817  1.00 0.00 ? 16 SER A O    5  
ATOM 4698  C CB   . SER A 1 16 ? 0.458   -5.268  -6.479  1.00 0.00 ? 16 SER A CB   5  
ATOM 4699  O OG   . SER A 1 16 ? 1.107   -6.276  -5.721  1.00 0.00 ? 16 SER A OG   5  
ATOM 4700  H H    . SER A 1 16 ? -1.609  -6.611  -6.147  1.00 0.00 ? 16 SER A H    5  
ATOM 4701  H HA   . SER A 1 16 ? -0.458  -4.568  -4.672  1.00 0.00 ? 16 SER A HA   5  
ATOM 4702  H HB2  . SER A 1 16 ? 0.107   -5.685  -7.420  1.00 0.00 ? 16 SER A HB2  5  
ATOM 4703  H HB3  . SER A 1 16 ? 1.168   -4.469  -6.693  1.00 0.00 ? 16 SER A HB3  5  
ATOM 4704  H HG   . SER A 1 16 ? 1.458   -6.950  -6.331  1.00 0.00 ? 16 SER A HG   5  
ATOM 4705  N N    . GLU A 1 17 ? -2.146  -3.310  -7.162  1.00 0.00 ? 17 GLU A N    5  
ATOM 4706  C CA   . GLU A 1 17 ? -2.741  -2.100  -7.703  1.00 0.00 ? 17 GLU A CA   5  
ATOM 4707  C C    . GLU A 1 17 ? -3.604  -1.400  -6.642  1.00 0.00 ? 17 GLU A C    5  
ATOM 4708  O O    . GLU A 1 17 ? -3.454  -0.196  -6.444  1.00 0.00 ? 17 GLU A O    5  
ATOM 4709  C CB   . GLU A 1 17 ? -3.571  -2.493  -8.937  1.00 0.00 ? 17 GLU A CB   5  
ATOM 4710  C CG   . GLU A 1 17 ? -2.714  -3.174  -10.018 1.00 0.00 ? 17 GLU A CG   5  
ATOM 4711  C CD   . GLU A 1 17 ? -3.586  -3.800  -11.102 1.00 0.00 ? 17 GLU A CD   5  
ATOM 4712  O OE1  . GLU A 1 17 ? -3.977  -4.977  -10.944 1.00 0.00 ? 17 GLU A OE1  5  
ATOM 4713  O OE2  . GLU A 1 17 ? -3.854  -3.140  -12.131 1.00 0.00 ? 17 GLU A OE2  5  
ATOM 4714  H H    . GLU A 1 17 ? -2.518  -4.187  -7.486  1.00 0.00 ? 17 GLU A H    5  
ATOM 4715  H HA   . GLU A 1 17 ? -1.939  -1.416  -7.997  1.00 0.00 ? 17 GLU A HA   5  
ATOM 4716  H HB2  . GLU A 1 17 ? -4.358  -3.182  -8.624  1.00 0.00 ? 17 GLU A HB2  5  
ATOM 4717  H HB3  . GLU A 1 17 ? -4.035  -1.603  -9.362  1.00 0.00 ? 17 GLU A HB3  5  
ATOM 4718  H HG2  . GLU A 1 17 ? -2.031  -2.444  -10.456 1.00 0.00 ? 17 GLU A HG2  5  
ATOM 4719  H HG3  . GLU A 1 17 ? -2.119  -3.976  -9.574  1.00 0.00 ? 17 GLU A HG3  5  
ATOM 4720  N N    . ILE A 1 18 ? -4.460  -2.145  -5.929  1.00 0.00 ? 18 ILE A N    5  
ATOM 4721  C CA   . ILE A 1 18 ? -5.323  -1.672  -4.837  1.00 0.00 ? 18 ILE A CA   5  
ATOM 4722  C C    . ILE A 1 18 ? -4.489  -1.032  -3.728  1.00 0.00 ? 18 ILE A C    5  
ATOM 4723  O O    . ILE A 1 18 ? -4.919  -0.068  -3.100  1.00 0.00 ? 18 ILE A O    5  
ATOM 4724  C CB   . ILE A 1 18 ? -6.150  -2.863  -4.285  1.00 0.00 ? 18 ILE A CB   5  
ATOM 4725  C CG1  . ILE A 1 18 ? -7.217  -3.316  -5.299  1.00 0.00 ? 18 ILE A CG1  5  
ATOM 4726  C CG2  . ILE A 1 18 ? -6.765  -2.613  -2.896  1.00 0.00 ? 18 ILE A CG2  5  
ATOM 4727  C CD1  . ILE A 1 18 ? -8.540  -2.579  -5.118  1.00 0.00 ? 18 ILE A CD1  5  
ATOM 4728  H H    . ILE A 1 18 ? -4.450  -3.140  -6.095  1.00 0.00 ? 18 ILE A H    5  
ATOM 4729  H HA   . ILE A 1 18 ? -6.006  -0.916  -5.226  1.00 0.00 ? 18 ILE A HA   5  
ATOM 4730  H HB   . ILE A 1 18 ? -5.481  -3.703  -4.145  1.00 0.00 ? 18 ILE A HB   5  
ATOM 4731  H HG12 . ILE A 1 18 ? -6.862  -3.163  -6.317  1.00 0.00 ? 18 ILE A HG12 5  
ATOM 4732  H HG13 . ILE A 1 18 ? -7.396  -4.382  -5.164  1.00 0.00 ? 18 ILE A HG13 5  
ATOM 4733  H HG21 . ILE A 1 18 ? -5.983  -2.468  -2.163  1.00 0.00 ? 18 ILE A HG21 5  
ATOM 4734  H HG22 . ILE A 1 18 ? -7.375  -1.714  -2.910  1.00 0.00 ? 18 ILE A HG22 5  
ATOM 4735  H HG23 . ILE A 1 18 ? -7.369  -3.468  -2.587  1.00 0.00 ? 18 ILE A HG23 5  
ATOM 4736  H HD11 . ILE A 1 18 ? -8.976  -2.903  -4.171  1.00 0.00 ? 18 ILE A HD11 5  
ATOM 4737  H HD12 . ILE A 1 18 ? -8.363  -1.505  -5.081  1.00 0.00 ? 18 ILE A HD12 5  
ATOM 4738  H HD13 . ILE A 1 18 ? -9.211  -2.815  -5.941  1.00 0.00 ? 18 ILE A HD13 5  
ATOM 4739  N N    . LEU A 1 19 ? -3.302  -1.569  -3.465  1.00 0.00 ? 19 LEU A N    5  
ATOM 4740  C CA   . LEU A 1 19 ? -2.397  -0.978  -2.494  1.00 0.00 ? 19 LEU A CA   5  
ATOM 4741  C C    . LEU A 1 19 ? -2.069  0.462   -2.879  1.00 0.00 ? 19 LEU A C    5  
ATOM 4742  O O    . LEU A 1 19 ? -2.099  1.352   -2.032  1.00 0.00 ? 19 LEU A O    5  
ATOM 4743  C CB   . LEU A 1 19 ? -1.153  -1.859  -2.396  1.00 0.00 ? 19 LEU A CB   5  
ATOM 4744  C CG   . LEU A 1 19 ? -0.037  -1.303  -1.510  1.00 0.00 ? 19 LEU A CG   5  
ATOM 4745  C CD1  . LEU A 1 19 ? -0.521  -1.116  -0.072  1.00 0.00 ? 19 LEU A CD1  5  
ATOM 4746  C CD2  . LEU A 1 19 ? 1.105   -2.319  -1.538  1.00 0.00 ? 19 LEU A CD2  5  
ATOM 4747  H H    . LEU A 1 19 ? -3.031  -2.383  -4.002  1.00 0.00 ? 19 LEU A H    5  
ATOM 4748  H HA   . LEU A 1 19 ? -2.901  -0.959  -1.530  1.00 0.00 ? 19 LEU A HA   5  
ATOM 4749  H HB2  . LEU A 1 19 ? -1.468  -2.814  -1.996  1.00 0.00 ? 19 LEU A HB2  5  
ATOM 4750  H HB3  . LEU A 1 19 ? -0.748  -2.037  -3.388  1.00 0.00 ? 19 LEU A HB3  5  
ATOM 4751  H HG   . LEU A 1 19 ? 0.315   -0.354  -1.910  1.00 0.00 ? 19 LEU A HG   5  
ATOM 4752  H HD11 . LEU A 1 19 ? 0.309   -0.842  0.575   1.00 0.00 ? 19 LEU A HD11 5  
ATOM 4753  H HD12 . LEU A 1 19 ? -1.260  -0.315  -0.033  1.00 0.00 ? 19 LEU A HD12 5  
ATOM 4754  H HD13 . LEU A 1 19 ? -0.975  -2.045  0.279   1.00 0.00 ? 19 LEU A HD13 5  
ATOM 4755  H HD21 . LEU A 1 19 ? 0.780   -3.257  -1.084  1.00 0.00 ? 19 LEU A HD21 5  
ATOM 4756  H HD22 . LEU A 1 19 ? 1.410   -2.505  -2.569  1.00 0.00 ? 19 LEU A HD22 5  
ATOM 4757  H HD23 . LEU A 1 19 ? 1.959   -1.928  -0.995  1.00 0.00 ? 19 LEU A HD23 5  
ATOM 4758  N N    . GLU A 1 20 ? -1.775  0.699   -4.154  1.00 0.00 ? 20 GLU A N    5  
ATOM 4759  C CA   . GLU A 1 20 ? -1.377  2.006   -4.644  1.00 0.00 ? 20 GLU A CA   5  
ATOM 4760  C C    . GLU A 1 20 ? -2.543  2.984   -4.580  1.00 0.00 ? 20 GLU A C    5  
ATOM 4761  O O    . GLU A 1 20 ? -2.321  4.147   -4.244  1.00 0.00 ? 20 GLU A O    5  
ATOM 4762  C CB   . GLU A 1 20 ? -0.849  1.900   -6.072  1.00 0.00 ? 20 GLU A CB   5  
ATOM 4763  C CG   . GLU A 1 20 ? 0.418   1.043   -6.134  1.00 0.00 ? 20 GLU A CG   5  
ATOM 4764  C CD   . GLU A 1 20 ? 0.764   0.695   -7.571  1.00 0.00 ? 20 GLU A CD   5  
ATOM 4765  O OE1  . GLU A 1 20 ? 0.865   1.631   -8.393  1.00 0.00 ? 20 GLU A OE1  5  
ATOM 4766  O OE2  . GLU A 1 20 ? 0.969   -0.506  -7.849  1.00 0.00 ? 20 GLU A OE2  5  
ATOM 4767  H H    . GLU A 1 20 ? -1.841  -0.060  -4.823  1.00 0.00 ? 20 GLU A H    5  
ATOM 4768  H HA   . GLU A 1 20 ? -0.579  2.378   -4.003  1.00 0.00 ? 20 GLU A HA   5  
ATOM 4769  H HB2  . GLU A 1 20 ? -1.616  1.475   -6.717  1.00 0.00 ? 20 GLU A HB2  5  
ATOM 4770  H HB3  . GLU A 1 20 ? -0.621  2.902   -6.432  1.00 0.00 ? 20 GLU A HB3  5  
ATOM 4771  H HG2  . GLU A 1 20 ? 1.244   1.588   -5.685  1.00 0.00 ? 20 GLU A HG2  5  
ATOM 4772  H HG3  . GLU A 1 20 ? 0.285   0.120   -5.573  1.00 0.00 ? 20 GLU A HG3  5  
ATOM 4773  N N    . GLU A 1 21 ? -3.768  2.529   -4.859  1.00 0.00 ? 21 GLU A N    5  
ATOM 4774  C CA   . GLU A 1 21 ? -5.007  3.254   -4.637  1.00 0.00 ? 21 GLU A CA   5  
ATOM 4775  C C    . GLU A 1 21 ? -5.061  3.792   -3.215  1.00 0.00 ? 21 GLU A C    5  
ATOM 4776  O O    . GLU A 1 21 ? -5.116  5.004   -3.016  1.00 0.00 ? 21 GLU A O    5  
ATOM 4777  C CB   . GLU A 1 21 ? -6.197  2.355   -4.871  1.00 0.00 ? 21 GLU A CB   5  
ATOM 4778  C CG   . GLU A 1 21 ? -6.390  1.702   -6.237  1.00 0.00 ? 21 GLU A CG   5  
ATOM 4779  C CD   . GLU A 1 21 ? -7.056  2.664   -7.213  1.00 0.00 ? 21 GLU A CD   5  
ATOM 4780  O OE1  . GLU A 1 21 ? -8.167  3.153   -6.897  1.00 0.00 ? 21 GLU A OE1  5  
ATOM 4781  O OE2  . GLU A 1 21 ? -6.531  2.859   -8.331  1.00 0.00 ? 21 GLU A OE2  5  
ATOM 4782  H H    . GLU A 1 21 ? -3.879  1.559   -5.127  1.00 0.00 ? 21 GLU A H    5  
ATOM 4783  H HA   . GLU A 1 21 ? -5.163  4.086   -5.307  1.00 0.00 ? 21 GLU A HA   5  
ATOM 4784  H HB2  . GLU A 1 21 ? -6.259  1.584   -4.119  1.00 0.00 ? 21 GLU A HB2  5  
ATOM 4785  H HB3  . GLU A 1 21 ? -6.992  3.049   -4.711  1.00 0.00 ? 21 GLU A HB3  5  
ATOM 4786  H HG2  . GLU A 1 21 ? -5.439  1.344   -6.623  1.00 0.00 ? 21 GLU A HG2  5  
ATOM 4787  H HG3  . GLU A 1 21 ? -7.047  0.841   -6.094  1.00 0.00 ? 21 GLU A HG3  5  
ATOM 4788  N N    . ALA A 1 22 ? -5.012  2.883   -2.242  1.00 0.00 ? 22 ALA A N    5  
ATOM 4789  C CA   . ALA A 1 22 ? -5.206  3.166   -0.827  1.00 0.00 ? 22 ALA A CA   5  
ATOM 4790  C C    . ALA A 1 22 ? -4.094  4.034   -0.256  1.00 0.00 ? 22 ALA A C    5  
ATOM 4791  O O    . ALA A 1 22 ? -4.249  4.623   0.812   1.00 0.00 ? 22 ALA A O    5  
ATOM 4792  C CB   . ALA A 1 22 ? -5.237  1.836   -0.089  1.00 0.00 ? 22 ALA A CB   5  
ATOM 4793  H H    . ALA A 1 22 ? -4.871  1.917   -2.527  1.00 0.00 ? 22 ALA A H    5  
ATOM 4794  H HA   . ALA A 1 22 ? -6.156  3.694   -0.686  1.00 0.00 ? 22 ALA A HA   5  
ATOM 4795  H HB1  . ALA A 1 22 ? -4.221  1.464   0.034   1.00 0.00 ? 22 ALA A HB1  5  
ATOM 4796  H HB2  . ALA A 1 22 ? -5.718  1.976   0.879   1.00 0.00 ? 22 ALA A HB2  5  
ATOM 4797  H HB3  . ALA A 1 22 ? -5.795  1.118   -0.686  1.00 0.00 ? 22 ALA A HB3  5  
ATOM 4798  N N    . ILE A 1 23 ? -2.972  4.117   -0.959  1.00 0.00 ? 23 ILE A N    5  
ATOM 4799  C CA   . ILE A 1 23 ? -1.920  5.062   -0.647  1.00 0.00 ? 23 ILE A CA   5  
ATOM 4800  C C    . ILE A 1 23 ? -2.329  6.423   -1.218  1.00 0.00 ? 23 ILE A C    5  
ATOM 4801  O O    . ILE A 1 23 ? -2.335  7.407   -0.481  1.00 0.00 ? 23 ILE A O    5  
ATOM 4802  C CB   . ILE A 1 23 ? -0.591  4.507   -1.178  1.00 0.00 ? 23 ILE A CB   5  
ATOM 4803  C CG1  . ILE A 1 23 ? -0.153  3.303   -0.322  1.00 0.00 ? 23 ILE A CG1  5  
ATOM 4804  C CG2  . ILE A 1 23 ? 0.513   5.571   -1.149  1.00 0.00 ? 23 ILE A CG2  5  
ATOM 4805  C CD1  . ILE A 1 23 ? 0.798   2.392   -1.092  1.00 0.00 ? 23 ILE A CD1  5  
ATOM 4806  H H    . ILE A 1 23 ? -2.928  3.561   -1.809  1.00 0.00 ? 23 ILE A H    5  
ATOM 4807  H HA   . ILE A 1 23 ? -1.828  5.152   0.435   1.00 0.00 ? 23 ILE A HA   5  
ATOM 4808  H HB   . ILE A 1 23 ? -0.752  4.174   -2.203  1.00 0.00 ? 23 ILE A HB   5  
ATOM 4809  H HG12 . ILE A 1 23 ? 0.348   3.651   0.579   1.00 0.00 ? 23 ILE A HG12 5  
ATOM 4810  H HG13 . ILE A 1 23 ? -1.020  2.716   -0.016  1.00 0.00 ? 23 ILE A HG13 5  
ATOM 4811  H HG21 . ILE A 1 23 ? 1.484   5.139   -1.378  1.00 0.00 ? 23 ILE A HG21 5  
ATOM 4812  H HG22 . ILE A 1 23 ? 0.291   6.333   -1.888  1.00 0.00 ? 23 ILE A HG22 5  
ATOM 4813  H HG23 . ILE A 1 23 ? 0.555   6.043   -0.170  1.00 0.00 ? 23 ILE A HG23 5  
ATOM 4814  H HD11 . ILE A 1 23 ? 1.773   2.867   -1.191  1.00 0.00 ? 23 ILE A HD11 5  
ATOM 4815  H HD12 . ILE A 1 23 ? 0.887   1.457   -0.545  1.00 0.00 ? 23 ILE A HD12 5  
ATOM 4816  H HD13 . ILE A 1 23 ? 0.398   2.181   -2.080  1.00 0.00 ? 23 ILE A HD13 5  
ATOM 4817  N N    . SER A 1 24 ? -2.703  6.487   -2.500  1.00 0.00 ? 24 SER A N    5  
ATOM 4818  C CA   . SER A 1 24 ? -3.065  7.714   -3.200  1.00 0.00 ? 24 SER A CA   5  
ATOM 4819  C C    . SER A 1 24 ? -4.158  8.499   -2.457  1.00 0.00 ? 24 SER A C    5  
ATOM 4820  O O    . SER A 1 24 ? -3.994  9.707   -2.256  1.00 0.00 ? 24 SER A O    5  
ATOM 4821  C CB   . SER A 1 24 ? -3.464  7.384   -4.648  1.00 0.00 ? 24 SER A CB   5  
ATOM 4822  O OG   . SER A 1 24 ? -3.551  8.572   -5.409  1.00 0.00 ? 24 SER A OG   5  
ATOM 4823  H H    . SER A 1 24 ? -2.779  5.623   -3.028  1.00 0.00 ? 24 SER A H    5  
ATOM 4824  H HA   . SER A 1 24 ? -2.169  8.335   -3.237  1.00 0.00 ? 24 SER A HA   5  
ATOM 4825  H HB2  . SER A 1 24 ? -2.702  6.747   -5.093  1.00 0.00 ? 24 SER A HB2  5  
ATOM 4826  H HB3  . SER A 1 24 ? -4.423  6.863   -4.668  1.00 0.00 ? 24 SER A HB3  5  
ATOM 4827  H HG   . SER A 1 24 ? -3.641  8.351   -6.356  1.00 0.00 ? 24 SER A HG   5  
ATOM 4828  N N    . VAL A 1 25 ? -5.235  7.842   -2.008  1.00 0.00 ? 25 VAL A N    5  
ATOM 4829  C CA   . VAL A 1 25 ? -6.278  8.484   -1.203  1.00 0.00 ? 25 VAL A CA   5  
ATOM 4830  C C    . VAL A 1 25 ? -5.661  9.185   0.009   1.00 0.00 ? 25 VAL A C    5  
ATOM 4831  O O    . VAL A 1 25 ? -5.848  10.382  0.196   1.00 0.00 ? 25 VAL A O    5  
ATOM 4832  C CB   . VAL A 1 25 ? -7.381  7.480   -0.782  1.00 0.00 ? 25 VAL A CB   5  
ATOM 4833  C CG1  . VAL A 1 25 ? -8.579  7.563   -1.724  1.00 0.00 ? 25 VAL A CG1  5  
ATOM 4834  C CG2  . VAL A 1 25 ? -6.916  6.055   -0.625  1.00 0.00 ? 25 VAL A CG2  5  
ATOM 4835  H H    . VAL A 1 25 ? -5.338  6.855   -2.232  1.00 0.00 ? 25 VAL A H    5  
ATOM 4836  H HA   . VAL A 1 25 ? -6.729  9.263   -1.819  1.00 0.00 ? 25 VAL A HA   5  
ATOM 4837  H HB   . VAL A 1 25 ? -7.732  7.680   0.220   1.00 0.00 ? 25 VAL A HB   5  
ATOM 4838  H HG11 . VAL A 1 25 ? -9.378  6.926   -1.352  1.00 0.00 ? 25 VAL A HG11 5  
ATOM 4839  H HG12 . VAL A 1 25 ? -8.959  8.578   -1.766  1.00 0.00 ? 25 VAL A HG12 5  
ATOM 4840  H HG13 . VAL A 1 25 ? -8.288  7.249   -2.727  1.00 0.00 ? 25 VAL A HG13 5  
ATOM 4841  H HG21 . VAL A 1 25 ? -5.918  6.046   -0.209  1.00 0.00 ? 25 VAL A HG21 5  
ATOM 4842  H HG22 . VAL A 1 25 ? -7.576  5.561   0.081   1.00 0.00 ? 25 VAL A HG22 5  
ATOM 4843  H HG23 . VAL A 1 25 ? -6.955  5.552   -1.586  1.00 0.00 ? 25 VAL A HG23 5  
ATOM 4844  N N    . VAL A 1 26 ? -4.929  8.455   0.839   1.00 0.00 ? 26 VAL A N    5  
ATOM 4845  C CA   . VAL A 1 26 ? -4.301  8.952   2.057   1.00 0.00 ? 26 VAL A CA   5  
ATOM 4846  C C    . VAL A 1 26 ? -3.361  10.119  1.743   1.00 0.00 ? 26 VAL A C    5  
ATOM 4847  O O    . VAL A 1 26 ? -3.394  11.134  2.441   1.00 0.00 ? 26 VAL A O    5  
ATOM 4848  C CB   . VAL A 1 26 ? -3.595  7.784   2.778   1.00 0.00 ? 26 VAL A CB   5  
ATOM 4849  C CG1  . VAL A 1 26 ? -2.906  8.239   4.067   1.00 0.00 ? 26 VAL A CG1  5  
ATOM 4850  C CG2  . VAL A 1 26 ? -4.603  6.692   3.163   1.00 0.00 ? 26 VAL A CG2  5  
ATOM 4851  H H    . VAL A 1 26 ? -4.795  7.488   0.601   1.00 0.00 ? 26 VAL A H    5  
ATOM 4852  H HA   . VAL A 1 26 ? -5.087  9.335   2.702   1.00 0.00 ? 26 VAL A HA   5  
ATOM 4853  H HB   . VAL A 1 26 ? -2.845  7.348   2.118   1.00 0.00 ? 26 VAL A HB   5  
ATOM 4854  H HG11 . VAL A 1 26 ? -2.470  7.377   4.571   1.00 0.00 ? 26 VAL A HG11 5  
ATOM 4855  H HG12 . VAL A 1 26 ? -2.104  8.941   3.833   1.00 0.00 ? 26 VAL A HG12 5  
ATOM 4856  H HG13 . VAL A 1 26 ? -3.639  8.720   4.717   1.00 0.00 ? 26 VAL A HG13 5  
ATOM 4857  H HG21 . VAL A 1 26 ? -5.176  6.372   2.297   1.00 0.00 ? 26 VAL A HG21 5  
ATOM 4858  H HG22 . VAL A 1 26 ? -4.070  5.819   3.546   1.00 0.00 ? 26 VAL A HG22 5  
ATOM 4859  H HG23 . VAL A 1 26 ? -5.297  7.077   3.908   1.00 0.00 ? 26 VAL A HG23 5  
ATOM 4860  N N    . MET A 1 27 ? -2.561  10.010  0.683   1.00 0.00 ? 27 MET A N    5  
ATOM 4861  C CA   . MET A 1 27 ? -1.672  11.068  0.234   1.00 0.00 ? 27 MET A CA   5  
ATOM 4862  C C    . MET A 1 27 ? -2.453  12.336  -0.105  1.00 0.00 ? 27 MET A C    5  
ATOM 4863  O O    . MET A 1 27 ? -2.104  13.404  0.394   1.00 0.00 ? 27 MET A O    5  
ATOM 4864  C CB   . MET A 1 27 ? -0.866  10.578  -0.966  1.00 0.00 ? 27 MET A CB   5  
ATOM 4865  C CG   . MET A 1 27 ? 0.179   9.557   -0.535  1.00 0.00 ? 27 MET A CG   5  
ATOM 4866  S SD   . MET A 1 27 ? 1.113   8.945   -1.946  1.00 0.00 ? 27 MET A SD   5  
ATOM 4867  C CE   . MET A 1 27 ? 2.697   8.780   -1.114  1.00 0.00 ? 27 MET A CE   5  
ATOM 4868  H H    . MET A 1 27 ? -2.558  9.142   0.153   1.00 0.00 ? 27 MET A H    5  
ATOM 4869  H HA   . MET A 1 27 ? -0.979  11.308  1.043   1.00 0.00 ? 27 MET A HA   5  
ATOM 4870  H HB2  . MET A 1 27 ? -1.522  10.135  -1.711  1.00 0.00 ? 27 MET A HB2  5  
ATOM 4871  H HB3  . MET A 1 27 ? -0.346  11.421  -1.416  1.00 0.00 ? 27 MET A HB3  5  
ATOM 4872  H HG2  . MET A 1 27 ? 0.857   10.032  0.176   1.00 0.00 ? 27 MET A HG2  5  
ATOM 4873  H HG3  . MET A 1 27 ? -0.290  8.712   -0.035  1.00 0.00 ? 27 MET A HG3  5  
ATOM 4874  H HE1  . MET A 1 27 ? 2.995   9.749   -0.711  1.00 0.00 ? 27 MET A HE1  5  
ATOM 4875  H HE2  . MET A 1 27 ? 2.615   8.043   -0.309  1.00 0.00 ? 27 MET A HE2  5  
ATOM 4876  H HE3  . MET A 1 27 ? 3.433   8.473   -1.850  1.00 0.00 ? 27 MET A HE3  5  
ATOM 4877  N N    . SER A 1 28 ? -3.524  12.239  -0.894  1.00 0.00 ? 28 SER A N    5  
ATOM 4878  C CA   . SER A 1 28 ? -4.388  13.377  -1.190  1.00 0.00 ? 28 SER A CA   5  
ATOM 4879  C C    . SER A 1 28 ? -5.348  13.698  -0.026  1.00 0.00 ? 28 SER A C    5  
ATOM 4880  O O    . SER A 1 28 ? -6.283  14.478  -0.209  1.00 0.00 ? 28 SER A O    5  
ATOM 4881  C CB   . SER A 1 28 ? -5.118  13.156  -2.529  1.00 0.00 ? 28 SER A CB   5  
ATOM 4882  O OG   . SER A 1 28 ? -4.870  14.244  -3.408  1.00 0.00 ? 28 SER A OG   5  
ATOM 4883  H H    . SER A 1 28 ? -3.802  11.326  -1.239  1.00 0.00 ? 28 SER A H    5  
ATOM 4884  H HA   . SER A 1 28 ? -3.739  14.246  -1.306  1.00 0.00 ? 28 SER A HA   5  
ATOM 4885  H HB2  . SER A 1 28 ? -4.771  12.241  -3.008  1.00 0.00 ? 28 SER A HB2  5  
ATOM 4886  H HB3  . SER A 1 28 ? -6.191  13.064  -2.362  1.00 0.00 ? 28 SER A HB3  5  
ATOM 4887  H HG   . SER A 1 28 ? -5.680  14.364  -3.956  1.00 0.00 ? 28 SER A HG   5  
ATOM 4888  N N    . GLY A 1 29 ? -5.155  13.124  1.167   1.00 0.00 ? 29 GLY A N    5  
ATOM 4889  C CA   . GLY A 1 29 ? -5.896  13.487  2.364   1.00 0.00 ? 29 GLY A CA   5  
ATOM 4890  C C    . GLY A 1 29 ? -7.349  13.038  2.316   1.00 0.00 ? 29 GLY A C    5  
ATOM 4891  O O    . GLY A 1 29 ? -8.196  13.597  3.013   1.00 0.00 ? 29 GLY A O    5  
ATOM 4892  H H    . GLY A 1 29 ? -4.413  12.444  1.281   1.00 0.00 ? 29 GLY A H    5  
ATOM 4893  H HA2  . GLY A 1 29 ? -5.422  13.002  3.213   1.00 0.00 ? 29 GLY A HA2  5  
ATOM 4894  H HA3  . GLY A 1 29 ? -5.855  14.568  2.504   1.00 0.00 ? 29 GLY A HA3  5  
ATOM 4895  N N    . LYS A 1 30 ? -7.667  12.030  1.498   1.00 0.00 ? 30 LYS A N    5  
ATOM 4896  C CA   . LYS A 1 30 ? -9.028  11.523  1.362   1.00 0.00 ? 30 LYS A CA   5  
ATOM 4897  C C    . LYS A 1 30 ? -9.432  10.728  2.595   1.00 0.00 ? 30 LYS A C    5  
ATOM 4898  O O    . LYS A 1 30 ? -10.626 10.634  2.880   1.00 0.00 ? 30 LYS A O    5  
ATOM 4899  C CB   . LYS A 1 30 ? -9.145  10.680  0.084   1.00 0.00 ? 30 LYS A CB   5  
ATOM 4900  C CG   . LYS A 1 30 ? -8.764  11.435  -1.208  1.00 0.00 ? 30 LYS A CG   5  
ATOM 4901  C CD   . LYS A 1 30 ? -9.413  12.810  -1.431  1.00 0.00 ? 30 LYS A CD   5  
ATOM 4902  C CE   . LYS A 1 30 ? -10.891 12.769  -1.842  1.00 0.00 ? 30 LYS A CE   5  
ATOM 4903  N NZ   . LYS A 1 30 ? -11.812 12.378  -0.754  1.00 0.00 ? 30 LYS A NZ   5  
ATOM 4904  H H    . LYS A 1 30 ? -6.914  11.553  0.999   1.00 0.00 ? 30 LYS A H    5  
ATOM 4905  H HA   . LYS A 1 30 ? -9.707  12.373  1.303   1.00 0.00 ? 30 LYS A HA   5  
ATOM 4906  H HB2  . LYS A 1 30 ? -8.476  9.833   0.193   1.00 0.00 ? 30 LYS A HB2  5  
ATOM 4907  H HB3  . LYS A 1 30 ? -10.144 10.258  -0.006  1.00 0.00 ? 30 LYS A HB3  5  
ATOM 4908  H HG2  . LYS A 1 30 ? -7.686  11.587  -1.205  1.00 0.00 ? 30 LYS A HG2  5  
ATOM 4909  H HG3  . LYS A 1 30 ? -8.989  10.804  -2.066  1.00 0.00 ? 30 LYS A HG3  5  
ATOM 4910  H HD2  . LYS A 1 30 ? -9.277  13.457  -0.564  1.00 0.00 ? 30 LYS A HD2  5  
ATOM 4911  H HD3  . LYS A 1 30 ? -8.867  13.284  -2.247  1.00 0.00 ? 30 LYS A HD3  5  
ATOM 4912  H HE2  . LYS A 1 30 ? -11.163 13.775  -2.165  1.00 0.00 ? 30 LYS A HE2  5  
ATOM 4913  H HE3  . LYS A 1 30 ? -11.022 12.098  -2.695  1.00 0.00 ? 30 LYS A HE3  5  
ATOM 4914  H HZ1  . LYS A 1 30 ? -11.816 11.373  -0.612  1.00 0.00 ? 30 LYS A HZ1  5  
ATOM 4915  H HZ2  . LYS A 1 30 ? -11.618 12.891  0.104   1.00 0.00 ? 30 LYS A HZ2  5  
ATOM 4916  H HZ3  . LYS A 1 30 ? -12.758 12.635  -1.020  1.00 0.00 ? 30 LYS A HZ3  5  
ATOM 4917  N N    . MET A 1 31 ? -8.476  10.176  3.342   1.00 0.00 ? 31 MET A N    5  
ATOM 4918  C CA   . MET A 1 31 ? -8.685  9.543   4.638   1.00 0.00 ? 31 MET A CA   5  
ATOM 4919  C C    . MET A 1 31 ? -7.341  9.313   5.337   1.00 0.00 ? 31 MET A C    5  
ATOM 4920  O O    . MET A 1 31 ? -6.290  9.551   4.745   1.00 0.00 ? 31 MET A O    5  
ATOM 4921  C CB   . MET A 1 31 ? -9.411  8.205   4.462   1.00 0.00 ? 31 MET A CB   5  
ATOM 4922  C CG   . MET A 1 31 ? -8.675  7.211   3.583   1.00 0.00 ? 31 MET A CG   5  
ATOM 4923  S SD   . MET A 1 31 ? -9.756  5.915   2.944   1.00 0.00 ? 31 MET A SD   5  
ATOM 4924  C CE   . MET A 1 31 ? -10.551 6.811   1.616   1.00 0.00 ? 31 MET A CE   5  
ATOM 4925  H H    . MET A 1 31 ? -7.505  10.262  3.065   1.00 0.00 ? 31 MET A H    5  
ATOM 4926  H HA   . MET A 1 31 ? -9.291  10.203  5.261   1.00 0.00 ? 31 MET A HA   5  
ATOM 4927  H HB2  . MET A 1 31 ? -9.519  7.771   5.439   1.00 0.00 ? 31 MET A HB2  5  
ATOM 4928  H HB3  . MET A 1 31 ? -10.411 8.319   4.071   1.00 0.00 ? 31 MET A HB3  5  
ATOM 4929  H HG2  . MET A 1 31 ? -8.210  7.715   2.737   1.00 0.00 ? 31 MET A HG2  5  
ATOM 4930  H HG3  . MET A 1 31 ? -7.898  6.762   4.195   1.00 0.00 ? 31 MET A HG3  5  
ATOM 4931  H HE1  . MET A 1 31 ? -11.154 6.114   1.040   1.00 0.00 ? 31 MET A HE1  5  
ATOM 4932  H HE2  . MET A 1 31 ? -11.178 7.586   2.046   1.00 0.00 ? 31 MET A HE2  5  
ATOM 4933  H HE3  . MET A 1 31 ? -9.781  7.249   0.991   1.00 0.00 ? 31 MET A HE3  5  
ATOM 4934  N N    . SER A 1 32 ? -7.379  8.796   6.569   1.00 0.00 ? 32 SER A N    5  
ATOM 4935  C CA   . SER A 1 32 ? -6.204  8.383   7.326   1.00 0.00 ? 32 SER A CA   5  
ATOM 4936  C C    . SER A 1 32 ? -5.715  7.005   6.855   1.00 0.00 ? 32 SER A C    5  
ATOM 4937  O O    . SER A 1 32 ? -6.441  6.307   6.138   1.00 0.00 ? 32 SER A O    5  
ATOM 4938  C CB   . SER A 1 32 ? -6.604  8.354   8.806   1.00 0.00 ? 32 SER A CB   5  
ATOM 4939  O OG   . SER A 1 32 ? -7.752  7.543   8.991   1.00 0.00 ? 32 SER A OG   5  
ATOM 4940  H H    . SER A 1 32 ? -8.256  8.486   6.969   1.00 0.00 ? 32 SER A H    5  
ATOM 4941  H HA   . SER A 1 32 ? -5.406  9.115   7.183   1.00 0.00 ? 32 SER A HA   5  
ATOM 4942  H HB2  . SER A 1 32 ? -5.783  7.978   9.412   1.00 0.00 ? 32 SER A HB2  5  
ATOM 4943  H HB3  . SER A 1 32 ? -6.833  9.367   9.131   1.00 0.00 ? 32 SER A HB3  5  
ATOM 4944  H HG   . SER A 1 32 ? -8.161  7.781   9.848   1.00 0.00 ? 32 SER A HG   5  
ATOM 4945  N N    . VAL A 1 33 ? -4.533  6.573   7.315   1.00 0.00 ? 33 VAL A N    5  
ATOM 4946  C CA   . VAL A 1 33 ? -4.042  5.209   7.112   1.00 0.00 ? 33 VAL A CA   5  
ATOM 4947  C C    . VAL A 1 33 ? -5.067  4.233   7.702   1.00 0.00 ? 33 VAL A C    5  
ATOM 4948  O O    . VAL A 1 33 ? -5.559  3.372   6.980   1.00 0.00 ? 33 VAL A O    5  
ATOM 4949  C CB   . VAL A 1 33 ? -2.628  5.009   7.719   1.00 0.00 ? 33 VAL A CB   5  
ATOM 4950  C CG1  . VAL A 1 33 ? -2.055  3.628   7.379   1.00 0.00 ? 33 VAL A CG1  5  
ATOM 4951  C CG2  . VAL A 1 33 ? -1.622  6.058   7.224   1.00 0.00 ? 33 VAL A CG2  5  
ATOM 4952  H H    . VAL A 1 33 ? -4.004  7.149   7.955   1.00 0.00 ? 33 VAL A H    5  
ATOM 4953  H HA   . VAL A 1 33 ? -3.985  5.031   6.038   1.00 0.00 ? 33 VAL A HA   5  
ATOM 4954  H HB   . VAL A 1 33 ? -2.680  5.087   8.802   1.00 0.00 ? 33 VAL A HB   5  
ATOM 4955  H HG11 . VAL A 1 33 ? -2.763  2.840   7.637   1.00 0.00 ? 33 VAL A HG11 5  
ATOM 4956  H HG12 . VAL A 1 33 ? -1.789  3.583   6.328   1.00 0.00 ? 33 VAL A HG12 5  
ATOM 4957  H HG13 . VAL A 1 33 ? -1.159  3.436   7.955   1.00 0.00 ? 33 VAL A HG13 5  
ATOM 4958  H HG21 . VAL A 1 33 ? -0.643  5.867   7.663   1.00 0.00 ? 33 VAL A HG21 5  
ATOM 4959  H HG22 . VAL A 1 33 ? -1.535  6.020   6.138   1.00 0.00 ? 33 VAL A HG22 5  
ATOM 4960  H HG23 . VAL A 1 33 ? -1.932  7.050   7.540   1.00 0.00 ? 33 VAL A HG23 5  
ATOM 4961  N N    . SER A 1 34 ? -5.433  4.401   8.977   1.00 0.00 ? 34 SER A N    5  
ATOM 4962  C CA   . SER A 1 34 ? -6.352  3.536   9.713   1.00 0.00 ? 34 SER A CA   5  
ATOM 4963  C C    . SER A 1 34 ? -7.672  3.332   8.955   1.00 0.00 ? 34 SER A C    5  
ATOM 4964  O O    . SER A 1 34 ? -8.221  2.226   8.910   1.00 0.00 ? 34 SER A O    5  
ATOM 4965  C CB   . SER A 1 34 ? -6.567  4.164   11.102  1.00 0.00 ? 34 SER A CB   5  
ATOM 4966  O OG   . SER A 1 34 ? -7.282  3.312   11.970  1.00 0.00 ? 34 SER A OG   5  
ATOM 4967  H H    . SER A 1 34 ? -4.980  5.147   9.501   1.00 0.00 ? 34 SER A H    5  
ATOM 4968  H HA   . SER A 1 34 ? -5.877  2.565   9.827   1.00 0.00 ? 34 SER A HA   5  
ATOM 4969  H HB2  . SER A 1 34 ? -5.600  4.376   11.559  1.00 0.00 ? 34 SER A HB2  5  
ATOM 4970  H HB3  . SER A 1 34 ? -7.113  5.103   10.994  1.00 0.00 ? 34 SER A HB3  5  
ATOM 4971  H HG   . SER A 1 34 ? -6.687  2.558   12.205  1.00 0.00 ? 34 SER A HG   5  
ATOM 4972  N N    . LYS A 1 35 ? -8.177  4.404   8.340   1.00 0.00 ? 35 LYS A N    5  
ATOM 4973  C CA   . LYS A 1 35 ? -9.382  4.390   7.533   1.00 0.00 ? 35 LYS A CA   5  
ATOM 4974  C C    . LYS A 1 35 ? -9.146  3.599   6.248   1.00 0.00 ? 35 LYS A C    5  
ATOM 4975  O O    . LYS A 1 35 ? -9.711  2.515   6.114   1.00 0.00 ? 35 LYS A O    5  
ATOM 4976  C CB   . LYS A 1 35 ? -9.842  5.824   7.345   1.00 0.00 ? 35 LYS A CB   5  
ATOM 4977  C CG   . LYS A 1 35 ? -11.108 5.903   6.489   1.00 0.00 ? 35 LYS A CG   5  
ATOM 4978  C CD   . LYS A 1 35 ? -12.002 7.033   6.964   1.00 0.00 ? 35 LYS A CD   5  
ATOM 4979  C CE   . LYS A 1 35 ? -13.121 7.270   5.951   1.00 0.00 ? 35 LYS A CE   5  
ATOM 4980  N NZ   . LYS A 1 35 ? -13.925 8.452   6.305   1.00 0.00 ? 35 LYS A NZ   5  
ATOM 4981  H H    . LYS A 1 35 ? -7.653  5.269   8.396   1.00 0.00 ? 35 LYS A H    5  
ATOM 4982  H HA   . LYS A 1 35 ? -10.174 3.901   8.093   1.00 0.00 ? 35 LYS A HA   5  
ATOM 4983  H HB2  . LYS A 1 35 ? -10.051 6.232   8.335   1.00 0.00 ? 35 LYS A HB2  5  
ATOM 4984  H HB3  . LYS A 1 35 ? -9.036  6.398   6.901   1.00 0.00 ? 35 LYS A HB3  5  
ATOM 4985  H HG2  . LYS A 1 35 ? -10.854 6.055   5.452   1.00 0.00 ? 35 LYS A HG2  5  
ATOM 4986  H HG3  . LYS A 1 35 ? -11.654 4.981   6.536   1.00 0.00 ? 35 LYS A HG3  5  
ATOM 4987  H HD2  . LYS A 1 35 ? -12.427 6.748   7.921   1.00 0.00 ? 35 LYS A HD2  5  
ATOM 4988  H HD3  . LYS A 1 35 ? -11.387 7.918   7.092   1.00 0.00 ? 35 LYS A HD3  5  
ATOM 4989  H HE2  . LYS A 1 35 ? -12.684 7.417   4.960   1.00 0.00 ? 35 LYS A HE2  5  
ATOM 4990  H HE3  . LYS A 1 35 ? -13.765 6.388   5.926   1.00 0.00 ? 35 LYS A HE3  5  
ATOM 4991  H HZ1  . LYS A 1 35 ? -13.379 9.307   6.204   1.00 0.00 ? 35 LYS A HZ1  5  
ATOM 4992  H HZ2  . LYS A 1 35 ? -14.751 8.513   5.721   1.00 0.00 ? 35 LYS A HZ2  5  
ATOM 4993  H HZ3  . LYS A 1 35 ? -14.260 8.404   7.256   1.00 0.00 ? 35 LYS A HZ3  5  
ATOM 4994  N N    . ALA A 1 36 ? -8.345  4.097   5.298   1.00 0.00 ? 36 ALA A N    5  
ATOM 4995  C CA   . ALA A 1 36 ? -8.035  3.401   4.052   1.00 0.00 ? 36 ALA A CA   5  
ATOM 4996  C C    . ALA A 1 36 ? -7.625  1.942   4.223   1.00 0.00 ? 36 ALA A C    5  
ATOM 4997  O O    . ALA A 1 36 ? -8.056  1.124   3.420   1.00 0.00 ? 36 ALA A O    5  
ATOM 4998  C CB   . ALA A 1 36 ? -6.926  4.148   3.305   1.00 0.00 ? 36 ALA A CB   5  
ATOM 4999  H H    . ALA A 1 36 ? -8.040  5.064   5.335   1.00 0.00 ? 36 ALA A H    5  
ATOM 5000  H HA   . ALA A 1 36 ? -8.956  3.383   3.459   1.00 0.00 ? 36 ALA A HA   5  
ATOM 5001  H HB1  . ALA A 1 36 ? -6.058  4.240   3.955   1.00 0.00 ? 36 ALA A HB1  5  
ATOM 5002  H HB2  . ALA A 1 36 ? -6.657  3.609   2.397   1.00 0.00 ? 36 ALA A HB2  5  
ATOM 5003  H HB3  . ALA A 1 36 ? -7.244  5.148   3.030   1.00 0.00 ? 36 ALA A HB3  5  
ATOM 5004  N N    . GLN A 1 37 ? -6.870  1.574   5.255   1.00 0.00 ? 37 GLN A N    5  
ATOM 5005  C CA   . GLN A 1 37 ? -6.591  0.186   5.597   1.00 0.00 ? 37 GLN A CA   5  
ATOM 5006  C C    . GLN A 1 37 ? -7.888  -0.618  5.569   1.00 0.00 ? 37 GLN A C    5  
ATOM 5007  O O    . GLN A 1 37 ? -7.965  -1.655  4.915   1.00 0.00 ? 37 GLN A O    5  
ATOM 5008  C CB   . GLN A 1 37 ? -5.890  0.173   6.968   1.00 0.00 ? 37 GLN A CB   5  
ATOM 5009  C CG   . GLN A 1 37 ? -6.068  -1.110  7.821   1.00 0.00 ? 37 GLN A CG   5  
ATOM 5010  C CD   . GLN A 1 37 ? -6.339  -0.902  9.308   1.00 0.00 ? 37 GLN A CD   5  
ATOM 5011  O OE1  . GLN A 1 37 ? -6.011  0.119   9.898   1.00 0.00 ? 37 GLN A OE1  5  
ATOM 5012  N NE2  . GLN A 1 37 ? -6.933  -1.880  9.970   1.00 0.00 ? 37 GLN A NE2  5  
ATOM 5013  H H    . GLN A 1 37 ? -6.494  2.278   5.881   1.00 0.00 ? 37 GLN A H    5  
ATOM 5014  H HA   . GLN A 1 37 ? -5.915  -0.238  4.855   1.00 0.00 ? 37 GLN A HA   5  
ATOM 5015  H HB2  . GLN A 1 37 ? -4.827  0.363   6.757   1.00 0.00 ? 37 GLN A HB2  5  
ATOM 5016  H HB3  . GLN A 1 37 ? -6.280  1.001   7.554   1.00 0.00 ? 37 GLN A HB3  5  
ATOM 5017  H HG2  . GLN A 1 37 ? -6.860  -1.739  7.435   1.00 0.00 ? 37 GLN A HG2  5  
ATOM 5018  H HG3  . GLN A 1 37 ? -5.181  -1.705  7.748   1.00 0.00 ? 37 GLN A HG3  5  
ATOM 5019  H HE21 . GLN A 1 37 ? -7.195  -2.748  9.510   1.00 0.00 ? 37 GLN A HE21 5  
ATOM 5020  H HE22 . GLN A 1 37 ? -7.063  -1.777  10.970  1.00 0.00 ? 37 GLN A HE22 5  
ATOM 5021  N N    . SER A 1 38 ? -8.900  -0.141  6.285   1.00 0.00 ? 38 SER A N    5  
ATOM 5022  C CA   . SER A 1 38 ? -10.140 -0.853  6.466   1.00 0.00 ? 38 SER A CA   5  
ATOM 5023  C C    . SER A 1 38 ? -10.970 -0.807  5.175   1.00 0.00 ? 38 SER A C    5  
ATOM 5024  O O    . SER A 1 38 ? -11.605 -1.803  4.822   1.00 0.00 ? 38 SER A O    5  
ATOM 5025  C CB   . SER A 1 38 ? -10.846 -0.188  7.647   1.00 0.00 ? 38 SER A CB   5  
ATOM 5026  O OG   . SER A 1 38 ? -11.837 -1.026  8.205   1.00 0.00 ? 38 SER A OG   5  
ATOM 5027  H H    . SER A 1 38 ? -8.842  0.806   6.649   1.00 0.00 ? 38 SER A H    5  
ATOM 5028  H HA   . SER A 1 38 ? -9.881  -1.883  6.725   1.00 0.00 ? 38 SER A HA   5  
ATOM 5029  H HB2  . SER A 1 38 ? -10.093 0.018   8.412   1.00 0.00 ? 38 SER A HB2  5  
ATOM 5030  H HB3  . SER A 1 38 ? -11.295 0.753   7.335   1.00 0.00 ? 38 SER A HB3  5  
ATOM 5031  H HG   . SER A 1 38 ? -12.565 -0.447  8.534   1.00 0.00 ? 38 SER A HG   5  
ATOM 5032  N N    . ILE A 1 39 ? -10.950 0.328   4.462   1.00 0.00 ? 39 ILE A N    5  
ATOM 5033  C CA   . ILE A 1 39 ? -11.671 0.528   3.207   1.00 0.00 ? 39 ILE A CA   5  
ATOM 5034  C C    . ILE A 1 39 ? -11.145 -0.439  2.143   1.00 0.00 ? 39 ILE A C    5  
ATOM 5035  O O    . ILE A 1 39 ? -11.917 -1.181  1.531   1.00 0.00 ? 39 ILE A O    5  
ATOM 5036  C CB   . ILE A 1 39 ? -11.617 2.014   2.778   1.00 0.00 ? 39 ILE A CB   5  
ATOM 5037  C CG1  . ILE A 1 39 ? -12.336 2.864   3.855   1.00 0.00 ? 39 ILE A CG1  5  
ATOM 5038  C CG2  . ILE A 1 39 ? -12.185 2.245   1.366   1.00 0.00 ? 39 ILE A CG2  5  
ATOM 5039  C CD1  . ILE A 1 39 ? -12.860 4.230   3.414   1.00 0.00 ? 39 ILE A CD1  5  
ATOM 5040  H H    . ILE A 1 39 ? -10.408 1.100   4.832   1.00 0.00 ? 39 ILE A H    5  
ATOM 5041  H HA   . ILE A 1 39 ? -12.710 0.290   3.384   1.00 0.00 ? 39 ILE A HA   5  
ATOM 5042  H HB   . ILE A 1 39 ? -10.578 2.319   2.744   1.00 0.00 ? 39 ILE A HB   5  
ATOM 5043  H HG12 . ILE A 1 39 ? -13.180 2.307   4.256   1.00 0.00 ? 39 ILE A HG12 5  
ATOM 5044  H HG13 . ILE A 1 39 ? -11.645 3.032   4.675   1.00 0.00 ? 39 ILE A HG13 5  
ATOM 5045  H HG21 . ILE A 1 39 ? -11.698 1.608   0.629   1.00 0.00 ? 39 ILE A HG21 5  
ATOM 5046  H HG22 . ILE A 1 39 ? -13.250 2.047   1.357   1.00 0.00 ? 39 ILE A HG22 5  
ATOM 5047  H HG23 . ILE A 1 39 ? -12.010 3.270   1.042   1.00 0.00 ? 39 ILE A HG23 5  
ATOM 5048  H HD11 . ILE A 1 39 ? -12.130 4.724   2.786   1.00 0.00 ? 39 ILE A HD11 5  
ATOM 5049  H HD12 . ILE A 1 39 ? -13.788 4.110   2.857   1.00 0.00 ? 39 ILE A HD12 5  
ATOM 5050  H HD13 . ILE A 1 39 ? -13.037 4.842   4.295   1.00 0.00 ? 39 ILE A HD13 5  
ATOM 5051  N N    . TYR A 1 40 ? -9.839  -0.402  1.901   1.00 0.00 ? 40 TYR A N    5  
ATOM 5052  C CA   . TYR A 1 40 ? -9.160  -1.071  0.802   1.00 0.00 ? 40 TYR A CA   5  
ATOM 5053  C C    . TYR A 1 40 ? -8.720  -2.489  1.169   1.00 0.00 ? 40 TYR A C    5  
ATOM 5054  O O    . TYR A 1 40 ? -8.424  -3.286  0.278   1.00 0.00 ? 40 TYR A O    5  
ATOM 5055  C CB   . TYR A 1 40 ? -7.962  -0.209  0.394   1.00 0.00 ? 40 TYR A CB   5  
ATOM 5056  C CG   . TYR A 1 40 ? -8.340  1.057   -0.358  1.00 0.00 ? 40 TYR A CG   5  
ATOM 5057  C CD1  . TYR A 1 40 ? -8.740  2.212   0.343   1.00 0.00 ? 40 TYR A CD1  5  
ATOM 5058  C CD2  . TYR A 1 40 ? -8.198  1.121   -1.753  1.00 0.00 ? 40 TYR A CD2  5  
ATOM 5059  C CE1  . TYR A 1 40 ? -9.042  3.404   -0.334  1.00 0.00 ? 40 TYR A CE1  5  
ATOM 5060  C CE2  . TYR A 1 40 ? -8.495  2.308   -2.435  1.00 0.00 ? 40 TYR A CE2  5  
ATOM 5061  C CZ   . TYR A 1 40 ? -8.945  3.446   -1.740  1.00 0.00 ? 40 TYR A CZ   5  
ATOM 5062  O OH   . TYR A 1 40 ? -9.247  4.586   -2.412  1.00 0.00 ? 40 TYR A OH   5  
ATOM 5063  H H    . TYR A 1 40 ? -9.267  0.208   2.476   1.00 0.00 ? 40 TYR A H    5  
ATOM 5064  H HA   . TYR A 1 40 ? -9.840  -1.144  -0.046  1.00 0.00 ? 40 TYR A HA   5  
ATOM 5065  H HB2  . TYR A 1 40 ? -7.420  0.087   1.286   1.00 0.00 ? 40 TYR A HB2  5  
ATOM 5066  H HB3  . TYR A 1 40 ? -7.250  -0.805  -0.183  1.00 0.00 ? 40 TYR A HB3  5  
ATOM 5067  H HD1  . TYR A 1 40 ? -8.794  2.199   1.413   1.00 0.00 ? 40 TYR A HD1  5  
ATOM 5068  H HD2  . TYR A 1 40 ? -7.809  0.284   -2.309  1.00 0.00 ? 40 TYR A HD2  5  
ATOM 5069  H HE1  . TYR A 1 40 ? -9.306  4.300   0.214   1.00 0.00 ? 40 TYR A HE1  5  
ATOM 5070  H HE2  . TYR A 1 40 ? -8.331  2.358   -3.492  1.00 0.00 ? 40 TYR A HE2  5  
ATOM 5071  H HH   . TYR A 1 40 ? -8.987  4.596   -3.350  1.00 0.00 ? 40 TYR A HH   5  
ATOM 5072  N N    . GLY A 1 41 ? -8.704  -2.827  2.458   1.00 0.00 ? 41 GLY A N    5  
ATOM 5073  C CA   . GLY A 1 41 ? -8.363  -4.158  2.933   1.00 0.00 ? 41 GLY A CA   5  
ATOM 5074  C C    . GLY A 1 41 ? -6.853  -4.340  3.034   1.00 0.00 ? 41 GLY A C    5  
ATOM 5075  O O    . GLY A 1 41 ? -6.355  -5.450  2.857   1.00 0.00 ? 41 GLY A O    5  
ATOM 5076  H H    . GLY A 1 41 ? -8.804  -2.100  3.156   1.00 0.00 ? 41 GLY A H    5  
ATOM 5077  H HA2  . GLY A 1 41 ? -8.808  -4.313  3.916   1.00 0.00 ? 41 GLY A HA2  5  
ATOM 5078  H HA3  . GLY A 1 41 ? -8.766  -4.894  2.240   1.00 0.00 ? 41 GLY A HA3  5  
ATOM 5079  N N    . ILE A 1 42 ? -6.109  -3.266  3.264   1.00 0.00 ? 42 ILE A N    5  
ATOM 5080  C CA   . ILE A 1 42 ? -4.659  -3.276  3.399   1.00 0.00 ? 42 ILE A CA   5  
ATOM 5081  C C    . ILE A 1 42 ? -4.345  -3.467  4.892   1.00 0.00 ? 42 ILE A C    5  
ATOM 5082  O O    . ILE A 1 42 ? -5.131  -3.006  5.717   1.00 0.00 ? 42 ILE A O    5  
ATOM 5083  C CB   . ILE A 1 42 ? -4.091  -1.943  2.853   1.00 0.00 ? 42 ILE A CB   5  
ATOM 5084  C CG1  . ILE A 1 42 ? -4.747  -1.423  1.563   1.00 0.00 ? 42 ILE A CG1  5  
ATOM 5085  C CG2  . ILE A 1 42 ? -2.567  -2.043  2.667   1.00 0.00 ? 42 ILE A CG2  5  
ATOM 5086  C CD1  . ILE A 1 42 ? -4.577  -2.284  0.321   1.00 0.00 ? 42 ILE A CD1  5  
ATOM 5087  H H    . ILE A 1 42 ? -6.601  -2.420  3.527   1.00 0.00 ? 42 ILE A H    5  
ATOM 5088  H HA   . ILE A 1 42 ? -4.254  -4.104  2.822   1.00 0.00 ? 42 ILE A HA   5  
ATOM 5089  H HB   . ILE A 1 42 ? -4.317  -1.162  3.572   1.00 0.00 ? 42 ILE A HB   5  
ATOM 5090  H HG12 . ILE A 1 42 ? -5.807  -1.280  1.744   1.00 0.00 ? 42 ILE A HG12 5  
ATOM 5091  H HG13 . ILE A 1 42 ? -4.354  -0.440  1.344   1.00 0.00 ? 42 ILE A HG13 5  
ATOM 5092  H HG21 . ILE A 1 42 ? -2.069  -2.152  3.626   1.00 0.00 ? 42 ILE A HG21 5  
ATOM 5093  H HG22 . ILE A 1 42 ? -2.319  -2.910  2.050   1.00 0.00 ? 42 ILE A HG22 5  
ATOM 5094  H HG23 . ILE A 1 42 ? -2.185  -1.139  2.197   1.00 0.00 ? 42 ILE A HG23 5  
ATOM 5095  H HD11 . ILE A 1 42 ? -3.533  -2.552  0.162   1.00 0.00 ? 42 ILE A HD11 5  
ATOM 5096  H HD12 . ILE A 1 42 ? -5.193  -3.173  0.432   1.00 0.00 ? 42 ILE A HD12 5  
ATOM 5097  H HD13 . ILE A 1 42 ? -4.917  -1.698  -0.529  1.00 0.00 ? 42 ILE A HD13 5  
ATOM 5098  N N    . PRO A 1 43 ? -3.246  -4.128  5.299   1.00 0.00 ? 43 PRO A N    5  
ATOM 5099  C CA   . PRO A 1 43 ? -2.736  -4.011  6.662   1.00 0.00 ? 43 PRO A CA   5  
ATOM 5100  C C    . PRO A 1 43 ? -2.373  -2.562  6.972   1.00 0.00 ? 43 PRO A C    5  
ATOM 5101  O O    . PRO A 1 43 ? -1.792  -1.900  6.110   1.00 0.00 ? 43 PRO A O    5  
ATOM 5102  C CB   . PRO A 1 43 ? -1.471  -4.875  6.725   1.00 0.00 ? 43 PRO A CB   5  
ATOM 5103  C CG   . PRO A 1 43 ? -1.461  -5.692  5.436   1.00 0.00 ? 43 PRO A CG   5  
ATOM 5104  C CD   . PRO A 1 43 ? -2.379  -4.949  4.478   1.00 0.00 ? 43 PRO A CD   5  
ATOM 5105  H HA   . PRO A 1 43 ? -3.494  -4.358  7.362   1.00 0.00 ? 43 PRO A HA   5  
ATOM 5106  H HB2  . PRO A 1 43 ? -0.579  -4.251  6.758   1.00 0.00 ? 43 PRO A HB2  5  
ATOM 5107  H HB3  . PRO A 1 43 ? -1.487  -5.523  7.597   1.00 0.00 ? 43 PRO A HB3  5  
ATOM 5108  H HG2  . PRO A 1 43 ? -0.462  -5.783  5.017   1.00 0.00 ? 43 PRO A HG2  5  
ATOM 5109  H HG3  . PRO A 1 43 ? -1.861  -6.675  5.642   1.00 0.00 ? 43 PRO A HG3  5  
ATOM 5110  H HD2  . PRO A 1 43 ? -1.777  -4.327  3.821   1.00 0.00 ? 43 PRO A HD2  5  
ATOM 5111  H HD3  . PRO A 1 43 ? -2.966  -5.658  3.897   1.00 0.00 ? 43 PRO A HD3  5  
ATOM 5112  N N    . HIS A 1 44 ? -2.617  -2.101  8.205   1.00 0.00 ? 44 HIS A N    5  
ATOM 5113  C CA   . HIS A 1 44 ? -2.213  -0.754  8.598   1.00 0.00 ? 44 HIS A CA   5  
ATOM 5114  C C    . HIS A 1 44 ? -0.712  -0.606  8.414   1.00 0.00 ? 44 HIS A C    5  
ATOM 5115  O O    . HIS A 1 44 ? -0.282  0.320   7.746   1.00 0.00 ? 44 HIS A O    5  
ATOM 5116  C CB   . HIS A 1 44 ? -2.590  -0.425  10.047  1.00 0.00 ? 44 HIS A CB   5  
ATOM 5117  C CG   . HIS A 1 44 ? -2.407  1.042   10.384  1.00 0.00 ? 44 HIS A CG   5  
ATOM 5118  N ND1  . HIS A 1 44 ? -3.410  1.902   10.765  1.00 0.00 ? 44 HIS A ND1  5  
ATOM 5119  C CD2  . HIS A 1 44 ? -1.239  1.766   10.376  1.00 0.00 ? 44 HIS A CD2  5  
ATOM 5120  C CE1  . HIS A 1 44 ? -2.872  3.114   10.963  1.00 0.00 ? 44 HIS A CE1  5  
ATOM 5121  N NE2  . HIS A 1 44 ? -1.550  3.079   10.745  1.00 0.00 ? 44 HIS A NE2  5  
ATOM 5122  H H    . HIS A 1 44 ? -3.119  -2.692  8.864   1.00 0.00 ? 44 HIS A H    5  
ATOM 5123  H HA   . HIS A 1 44 ? -2.714  -0.042  7.942   1.00 0.00 ? 44 HIS A HA   5  
ATOM 5124  H HB2  . HIS A 1 44 ? -3.629  -0.708  10.207  1.00 0.00 ? 44 HIS A HB2  5  
ATOM 5125  H HB3  . HIS A 1 44 ? -1.977  -1.017  10.724  1.00 0.00 ? 44 HIS A HB3  5  
ATOM 5126  H HD1  . HIS A 1 44 ? -4.374  1.651   10.971  1.00 0.00 ? 44 HIS A HD1  5  
ATOM 5127  H HD2  . HIS A 1 44 ? -0.245  1.408   10.143  1.00 0.00 ? 44 HIS A HD2  5  
ATOM 5128  H HE1  . HIS A 1 44 ? -3.413  3.984   11.312  1.00 0.00 ? 44 HIS A HE1  5  
ATOM 5129  N N    . SER A 1 45 ? 0.072   -1.498  9.020   1.00 0.00 ? 45 SER A N    5  
ATOM 5130  C CA   . SER A 1 45 ? 1.523   -1.401  9.091   1.00 0.00 ? 45 SER A CA   5  
ATOM 5131  C C    . SER A 1 45 ? 2.120   -1.266  7.687   1.00 0.00 ? 45 SER A C    5  
ATOM 5132  O O    . SER A 1 45 ? 2.907   -0.362  7.415   1.00 0.00 ? 45 SER A O    5  
ATOM 5133  C CB   . SER A 1 45 ? 2.065   -2.643  9.814   1.00 0.00 ? 45 SER A CB   5  
ATOM 5134  O OG   . SER A 1 45 ? 1.119   -3.198  10.723  1.00 0.00 ? 45 SER A OG   5  
ATOM 5135  H H    . SER A 1 45 ? -0.328  -2.225  9.596   1.00 0.00 ? 45 SER A H    5  
ATOM 5136  H HA   . SER A 1 45 ? 1.783   -0.513  9.672   1.00 0.00 ? 45 SER A HA   5  
ATOM 5137  H HB2  . SER A 1 45 ? 2.315   -3.407  9.078   1.00 0.00 ? 45 SER A HB2  5  
ATOM 5138  H HB3  . SER A 1 45 ? 2.971   -2.366  10.350  1.00 0.00 ? 45 SER A HB3  5  
ATOM 5139  H HG   . SER A 1 45 ? 1.370   -2.879  11.625  1.00 0.00 ? 45 SER A HG   5  
ATOM 5140  N N    . THR A 1 46 ? 1.703   -2.148  6.775   1.00 0.00 ? 46 THR A N    5  
ATOM 5141  C CA   . THR A 1 46 ? 2.128   -2.131  5.392   1.00 0.00 ? 46 THR A CA   5  
ATOM 5142  C C    . THR A 1 46 ? 1.695   -0.831  4.718   1.00 0.00 ? 46 THR A C    5  
ATOM 5143  O O    . THR A 1 46 ? 2.541   -0.175  4.125   1.00 0.00 ? 46 THR A O    5  
ATOM 5144  C CB   . THR A 1 46 ? 1.570   -3.380  4.695   1.00 0.00 ? 46 THR A CB   5  
ATOM 5145  O OG1  . THR A 1 46 ? 1.905   -4.531  5.450   1.00 0.00 ? 46 THR A OG1  5  
ATOM 5146  C CG2  . THR A 1 46 ? 2.041   -3.541  3.248   1.00 0.00 ? 46 THR A CG2  5  
ATOM 5147  H H    . THR A 1 46 ? 1.071   -2.890  7.029   1.00 0.00 ? 46 THR A H    5  
ATOM 5148  H HA   . THR A 1 46 ? 3.217   -2.152  5.391   1.00 0.00 ? 46 THR A HA   5  
ATOM 5149  H HB   . THR A 1 46 ? 0.482   -3.305  4.681   1.00 0.00 ? 46 THR A HB   5  
ATOM 5150  H HG1  . THR A 1 46 ? 2.855   -4.545  5.662   1.00 0.00 ? 46 THR A HG1  5  
ATOM 5151  H HG21 . THR A 1 46 ? 3.131   -3.521  3.195   1.00 0.00 ? 46 THR A HG21 5  
ATOM 5152  H HG22 . THR A 1 46 ? 1.662   -4.485  2.850   1.00 0.00 ? 46 THR A HG22 5  
ATOM 5153  H HG23 . THR A 1 46 ? 1.637   -2.728  2.641   1.00 0.00 ? 46 THR A HG23 5  
ATOM 5154  N N    . LEU A 1 47 ? 0.418   -0.443  4.806   1.00 0.00 ? 47 LEU A N    5  
ATOM 5155  C CA   . LEU A 1 47 ? -0.097  0.804   4.261   1.00 0.00 ? 47 LEU A CA   5  
ATOM 5156  C C    . LEU A 1 47 ? 0.761   1.965   4.738   1.00 0.00 ? 47 LEU A C    5  
ATOM 5157  O O    . LEU A 1 47 ? 1.214   2.738   3.909   1.00 0.00 ? 47 LEU A O    5  
ATOM 5158  C CB   . LEU A 1 47 ? -1.573  1.014   4.649   1.00 0.00 ? 47 LEU A CB   5  
ATOM 5159  C CG   . LEU A 1 47 ? -2.218  2.223   3.943   1.00 0.00 ? 47 LEU A CG   5  
ATOM 5160  C CD1  . LEU A 1 47 ? -2.452  1.938   2.468   1.00 0.00 ? 47 LEU A CD1  5  
ATOM 5161  C CD2  . LEU A 1 47 ? -3.627  2.483   4.476   1.00 0.00 ? 47 LEU A CD2  5  
ATOM 5162  H H    . LEU A 1 47 ? -0.242  -1.025  5.289   1.00 0.00 ? 47 LEU A H    5  
ATOM 5163  H HA   . LEU A 1 47 ? -0.015  0.745   3.177   1.00 0.00 ? 47 LEU A HA   5  
ATOM 5164  H HB2  . LEU A 1 47 ? -2.146  0.120   4.409   1.00 0.00 ? 47 LEU A HB2  5  
ATOM 5165  H HB3  . LEU A 1 47 ? -1.634  1.162   5.725   1.00 0.00 ? 47 LEU A HB3  5  
ATOM 5166  H HG   . LEU A 1 47 ? -1.608  3.129   4.057   1.00 0.00 ? 47 LEU A HG   5  
ATOM 5167  H HD11 . LEU A 1 47 ? -1.517  1.721   1.961   1.00 0.00 ? 47 LEU A HD11 5  
ATOM 5168  H HD12 . LEU A 1 47 ? -3.126  1.086   2.394   1.00 0.00 ? 47 LEU A HD12 5  
ATOM 5169  H HD13 . LEU A 1 47 ? -2.915  2.814   2.017   1.00 0.00 ? 47 LEU A HD13 5  
ATOM 5170  H HD21 . LEU A 1 47 ? -4.299  1.677   4.183   1.00 0.00 ? 47 LEU A HD21 5  
ATOM 5171  H HD22 . LEU A 1 47 ? -3.628  2.529   5.557   1.00 0.00 ? 47 LEU A HD22 5  
ATOM 5172  H HD23 . LEU A 1 47 ? -3.983  3.425   4.062   1.00 0.00 ? 47 LEU A HD23 5  
ATOM 5173  N N    . GLU A 1 48 ? 1.011   2.071   6.044   1.00 0.00 ? 48 GLU A N    5  
ATOM 5174  C CA   . GLU A 1 48 ? 1.835   3.102   6.651   1.00 0.00 ? 48 GLU A CA   5  
ATOM 5175  C C    . GLU A 1 48 ? 3.186   3.129   5.941   1.00 0.00 ? 48 GLU A C    5  
ATOM 5176  O O    . GLU A 1 48 ? 3.489   4.110   5.265   1.00 0.00 ? 48 GLU A O    5  
ATOM 5177  C CB   . GLU A 1 48 ? 1.996   2.879   8.172   1.00 0.00 ? 48 GLU A CB   5  
ATOM 5178  C CG   . GLU A 1 48 ? 1.554   4.118   8.969   1.00 0.00 ? 48 GLU A CG   5  
ATOM 5179  C CD   . GLU A 1 48 ? 2.060   4.109   10.405  1.00 0.00 ? 48 GLU A CD   5  
ATOM 5180  O OE1  . GLU A 1 48 ? 2.026   3.061   11.078  1.00 0.00 ? 48 GLU A OE1  5  
ATOM 5181  O OE2  . GLU A 1 48 ? 2.529   5.176   10.866  1.00 0.00 ? 48 GLU A OE2  5  
ATOM 5182  H H    . GLU A 1 48 ? 0.623   1.370   6.667   1.00 0.00 ? 48 GLU A H    5  
ATOM 5183  H HA   . GLU A 1 48 ? 1.337   4.058   6.480   1.00 0.00 ? 48 GLU A HA   5  
ATOM 5184  H HB2  . GLU A 1 48 ? 1.416   2.014   8.496   1.00 0.00 ? 48 GLU A HB2  5  
ATOM 5185  H HB3  . GLU A 1 48 ? 3.044   2.671   8.404   1.00 0.00 ? 48 GLU A HB3  5  
ATOM 5186  H HG2  . GLU A 1 48 ? 1.912   5.024   8.480   1.00 0.00 ? 48 GLU A HG2  5  
ATOM 5187  H HG3  . GLU A 1 48 ? 0.476   4.184   9.007   1.00 0.00 ? 48 GLU A HG3  5  
ATOM 5188  N N    . TYR A 1 49 ? 3.971   2.050   6.056   1.00 0.00 ? 49 TYR A N    5  
ATOM 5189  C CA   . TYR A 1 49 ? 5.286   1.908   5.438   1.00 0.00 ? 49 TYR A CA   5  
ATOM 5190  C C    . TYR A 1 49 ? 5.233   2.365   3.981   1.00 0.00 ? 49 TYR A C    5  
ATOM 5191  O O    . TYR A 1 49 ? 6.078   3.127   3.525   1.00 0.00 ? 49 TYR A O    5  
ATOM 5192  C CB   . TYR A 1 49 ? 5.728   0.431   5.541   1.00 0.00 ? 49 TYR A CB   5  
ATOM 5193  C CG   . TYR A 1 49 ? 6.926   0.046   4.686   1.00 0.00 ? 49 TYR A CG   5  
ATOM 5194  C CD1  . TYR A 1 49 ? 6.765   -0.144  3.301   1.00 0.00 ? 49 TYR A CD1  5  
ATOM 5195  C CD2  . TYR A 1 49 ? 8.197   -0.130  5.257   1.00 0.00 ? 49 TYR A CD2  5  
ATOM 5196  C CE1  . TYR A 1 49 ? 7.867   -0.394  2.463   1.00 0.00 ? 49 TYR A CE1  5  
ATOM 5197  C CE2  . TYR A 1 49 ? 9.297   -0.432  4.436   1.00 0.00 ? 49 TYR A CE2  5  
ATOM 5198  C CZ   . TYR A 1 49 ? 9.157   -0.515  3.033   1.00 0.00 ? 49 TYR A CZ   5  
ATOM 5199  O OH   . TYR A 1 49 ? 10.271  -0.678  2.261   1.00 0.00 ? 49 TYR A OH   5  
ATOM 5200  H H    . TYR A 1 49 ? 3.617   1.260   6.592   1.00 0.00 ? 49 TYR A H    5  
ATOM 5201  H HA   . TYR A 1 49 ? 6.007   2.546   5.961   1.00 0.00 ? 49 TYR A HA   5  
ATOM 5202  H HB2  . TYR A 1 49 ? 5.939   0.199   6.582   1.00 0.00 ? 49 TYR A HB2  5  
ATOM 5203  H HB3  . TYR A 1 49 ? 4.899   -0.210  5.240   1.00 0.00 ? 49 TYR A HB3  5  
ATOM 5204  H HD1  . TYR A 1 49 ? 5.777   -0.056  2.884   1.00 0.00 ? 49 TYR A HD1  5  
ATOM 5205  H HD2  . TYR A 1 49 ? 8.344   -0.021  6.324   1.00 0.00 ? 49 TYR A HD2  5  
ATOM 5206  H HE1  . TYR A 1 49 ? 7.712   -0.473  1.393   1.00 0.00 ? 49 TYR A HE1  5  
ATOM 5207  H HE2  . TYR A 1 49 ? 10.265  -0.571  4.886   1.00 0.00 ? 49 TYR A HE2  5  
ATOM 5208  H HH   . TYR A 1 49 ? 10.132  -0.582  1.310   1.00 0.00 ? 49 TYR A HH   5  
ATOM 5209  N N    . LYS A 1 50 ? 4.252   1.877   3.227   1.00 0.00 ? 50 LYS A N    5  
ATOM 5210  C CA   . LYS A 1 50 ? 4.164   2.065   1.795   1.00 0.00 ? 50 LYS A CA   5  
ATOM 5211  C C    . LYS A 1 50 ? 3.830   3.519   1.463   1.00 0.00 ? 50 LYS A C    5  
ATOM 5212  O O    . LYS A 1 50 ? 4.474   4.066   0.573   1.00 0.00 ? 50 LYS A O    5  
ATOM 5213  C CB   . LYS A 1 50 ? 3.143   1.060   1.255   1.00 0.00 ? 50 LYS A CB   5  
ATOM 5214  C CG   . LYS A 1 50 ? 3.623   -0.396  1.186   1.00 0.00 ? 50 LYS A CG   5  
ATOM 5215  C CD   . LYS A 1 50 ? 4.828   -0.636  0.267   1.00 0.00 ? 50 LYS A CD   5  
ATOM 5216  C CE   . LYS A 1 50 ? 4.907   -2.116  -0.110  1.00 0.00 ? 50 LYS A CE   5  
ATOM 5217  N NZ   . LYS A 1 50 ? 6.063   -2.428  -0.972  1.00 0.00 ? 50 LYS A NZ   5  
ATOM 5218  H H    . LYS A 1 50 ? 3.558   1.282   3.668   1.00 0.00 ? 50 LYS A H    5  
ATOM 5219  H HA   . LYS A 1 50 ? 5.143   1.868   1.358   1.00 0.00 ? 50 LYS A HA   5  
ATOM 5220  H HB2  . LYS A 1 50 ? 2.257   1.065   1.903   1.00 0.00 ? 50 LYS A HB2  5  
ATOM 5221  H HB3  . LYS A 1 50 ? 2.884   1.367   0.248   1.00 0.00 ? 50 LYS A HB3  5  
ATOM 5222  H HG2  . LYS A 1 50 ? 3.869   -0.765  2.179   1.00 0.00 ? 50 LYS A HG2  5  
ATOM 5223  H HG3  . LYS A 1 50 ? 2.774   -0.973  0.837   1.00 0.00 ? 50 LYS A HG3  5  
ATOM 5224  H HD2  . LYS A 1 50 ? 4.777   -0.013  -0.614  1.00 0.00 ? 50 LYS A HD2  5  
ATOM 5225  H HD3  . LYS A 1 50 ? 5.727   -0.344  0.781   1.00 0.00 ? 50 LYS A HD3  5  
ATOM 5226  H HE2  . LYS A 1 50 ? 4.967   -2.712  0.801   1.00 0.00 ? 50 LYS A HE2  5  
ATOM 5227  H HE3  . LYS A 1 50 ? 3.992   -2.391  -0.639  1.00 0.00 ? 50 LYS A HE3  5  
ATOM 5228  H HZ1  . LYS A 1 50 ? 5.935   -3.336  -1.406  1.00 0.00 ? 50 LYS A HZ1  5  
ATOM 5229  H HZ2  . LYS A 1 50 ? 6.142   -1.772  -1.748  1.00 0.00 ? 50 LYS A HZ2  5  
ATOM 5230  H HZ3  . LYS A 1 50 ? 6.941   -2.431  -0.460  1.00 0.00 ? 50 LYS A HZ3  5  
ATOM 5231  N N    . VAL A 1 51 ? 2.920   4.175   2.189   1.00 0.00 ? 51 VAL A N    5  
ATOM 5232  C CA   . VAL A 1 51 ? 2.703   5.619   2.122   1.00 0.00 ? 51 VAL A CA   5  
ATOM 5233  C C    . VAL A 1 51 ? 4.037   6.333   2.376   1.00 0.00 ? 51 VAL A C    5  
ATOM 5234  O O    . VAL A 1 51 ? 4.450   7.168   1.576   1.00 0.00 ? 51 VAL A O    5  
ATOM 5235  C CB   . VAL A 1 51 ? 1.626   6.040   3.153   1.00 0.00 ? 51 VAL A CB   5  
ATOM 5236  C CG1  . VAL A 1 51 ? 1.435   7.554   3.243   1.00 0.00 ? 51 VAL A CG1  5  
ATOM 5237  C CG2  . VAL A 1 51 ? 0.221   5.490   2.892   1.00 0.00 ? 51 VAL A CG2  5  
ATOM 5238  H H    . VAL A 1 51 ? 2.434   3.672   2.926   1.00 0.00 ? 51 VAL A H    5  
ATOM 5239  H HA   . VAL A 1 51 ? 2.370   5.877   1.118   1.00 0.00 ? 51 VAL A HA   5  
ATOM 5240  H HB   . VAL A 1 51 ? 1.938   5.693   4.135   1.00 0.00 ? 51 VAL A HB   5  
ATOM 5241  H HG11 . VAL A 1 51 ? 1.222   7.962   2.253   1.00 0.00 ? 51 VAL A HG11 5  
ATOM 5242  H HG12 . VAL A 1 51 ? 0.606   7.765   3.920   1.00 0.00 ? 51 VAL A HG12 5  
ATOM 5243  H HG13 . VAL A 1 51 ? 2.338   8.007   3.645   1.00 0.00 ? 51 VAL A HG13 5  
ATOM 5244  H HG21 . VAL A 1 51 ? -0.340  5.557   3.826   1.00 0.00 ? 51 VAL A HG21 5  
ATOM 5245  H HG22 . VAL A 1 51 ? -0.276  6.059   2.105   1.00 0.00 ? 51 VAL A HG22 5  
ATOM 5246  H HG23 . VAL A 1 51 ? 0.266   4.448   2.604   1.00 0.00 ? 51 VAL A HG23 5  
ATOM 5247  N N    . LYS A 1 52 ? 4.698   6.015   3.491   1.00 0.00 ? 52 LYS A N    5  
ATOM 5248  C CA   . LYS A 1 52 ? 5.904   6.681   3.998   1.00 0.00 ? 52 LYS A CA   5  
ATOM 5249  C C    . LYS A 1 52 ? 7.048   6.566   3.006   1.00 0.00 ? 52 LYS A C    5  
ATOM 5250  O O    . LYS A 1 52 ? 7.815   7.507   2.844   1.00 0.00 ? 52 LYS A O    5  
ATOM 5251  C CB   . LYS A 1 52 ? 6.236   6.067   5.370   1.00 0.00 ? 52 LYS A CB   5  
ATOM 5252  C CG   . LYS A 1 52 ? 5.191   6.552   6.394   1.00 0.00 ? 52 LYS A CG   5  
ATOM 5253  C CD   . LYS A 1 52 ? 4.809   5.521   7.461   1.00 0.00 ? 52 LYS A CD   5  
ATOM 5254  C CE   . LYS A 1 52 ? 5.309   5.806   8.881   1.00 0.00 ? 52 LYS A CE   5  
ATOM 5255  N NZ   . LYS A 1 52 ? 4.439   6.728   9.639   1.00 0.00 ? 52 LYS A NZ   5  
ATOM 5256  H H    . LYS A 1 52 ? 4.295   5.288   4.081   1.00 0.00 ? 52 LYS A H    5  
ATOM 5257  H HA   . LYS A 1 52 ? 5.725   7.748   4.128   1.00 0.00 ? 52 LYS A HA   5  
ATOM 5258  H HB2  . LYS A 1 52 ? 6.228   4.980   5.285   1.00 0.00 ? 52 LYS A HB2  5  
ATOM 5259  H HB3  . LYS A 1 52 ? 7.229   6.359   5.696   1.00 0.00 ? 52 LYS A HB3  5  
ATOM 5260  H HG2  . LYS A 1 52 ? 5.531   7.474   6.860   1.00 0.00 ? 52 LYS A HG2  5  
ATOM 5261  H HG3  . LYS A 1 52 ? 4.282   6.771   5.839   1.00 0.00 ? 52 LYS A HG3  5  
ATOM 5262  H HD2  . LYS A 1 52 ? 3.722   5.449   7.443   1.00 0.00 ? 52 LYS A HD2  5  
ATOM 5263  H HD3  . LYS A 1 52 ? 5.207   4.554   7.164   1.00 0.00 ? 52 LYS A HD3  5  
ATOM 5264  H HE2  . LYS A 1 52 ? 5.348   4.863   9.426   1.00 0.00 ? 52 LYS A HE2  5  
ATOM 5265  H HE3  . LYS A 1 52 ? 6.321   6.209   8.825   1.00 0.00 ? 52 LYS A HE3  5  
ATOM 5266  H HZ1  . LYS A 1 52 ? 4.997   7.258   10.300  1.00 0.00 ? 52 LYS A HZ1  5  
ATOM 5267  H HZ2  . LYS A 1 52 ? 3.961   7.390   9.037   1.00 0.00 ? 52 LYS A HZ2  5  
ATOM 5268  H HZ3  . LYS A 1 52 ? 3.728   6.210   10.156  1.00 0.00 ? 52 LYS A HZ3  5  
ATOM 5269  N N    . GLU A 1 53 ? 7.123   5.449   2.298   1.00 0.00 ? 53 GLU A N    5  
ATOM 5270  C CA   . GLU A 1 53 ? 8.061   5.215   1.227   1.00 0.00 ? 53 GLU A CA   5  
ATOM 5271  C C    . GLU A 1 53 ? 7.669   6.029   -0.002  1.00 0.00 ? 53 GLU A C    5  
ATOM 5272  O O    . GLU A 1 53 ? 8.473   6.816   -0.513  1.00 0.00 ? 53 GLU A O    5  
ATOM 5273  C CB   . GLU A 1 53 ? 8.149   3.712   0.952   1.00 0.00 ? 53 GLU A CB   5  
ATOM 5274  C CG   . GLU A 1 53 ? 9.333   3.072   1.689   1.00 0.00 ? 53 GLU A CG   5  
ATOM 5275  C CD   . GLU A 1 53 ? 10.727  3.404   1.134   1.00 0.00 ? 53 GLU A CD   5  
ATOM 5276  O OE1  . GLU A 1 53 ? 11.340  4.435   1.515   1.00 0.00 ? 53 GLU A OE1  5  
ATOM 5277  O OE2  . GLU A 1 53 ? 11.258  2.570   0.376   1.00 0.00 ? 53 GLU A OE2  5  
ATOM 5278  H H    . GLU A 1 53 ? 6.471   4.717   2.541   1.00 0.00 ? 53 GLU A H    5  
ATOM 5279  H HA   . GLU A 1 53 ? 9.025   5.559   1.563   1.00 0.00 ? 53 GLU A HA   5  
ATOM 5280  H HB2  . GLU A 1 53 ? 7.227   3.219   1.260   1.00 0.00 ? 53 GLU A HB2  5  
ATOM 5281  H HB3  . GLU A 1 53 ? 8.230   3.543   -0.102  1.00 0.00 ? 53 GLU A HB3  5  
ATOM 5282  H HG2  . GLU A 1 53 ? 9.288   3.389   2.722   1.00 0.00 ? 53 GLU A HG2  5  
ATOM 5283  H HG3  . GLU A 1 53 ? 9.202   1.992   1.663   1.00 0.00 ? 53 GLU A HG3  5  
ATOM 5284  N N    . ARG A 1 54 ? 6.433   5.855   -0.490  1.00 0.00 ? 54 ARG A N    5  
ATOM 5285  C CA   . ARG A 1 54 ? 5.940   6.523   -1.695  1.00 0.00 ? 54 ARG A CA   5  
ATOM 5286  C C    . ARG A 1 54 ? 5.950   8.047   -1.550  1.00 0.00 ? 54 ARG A C    5  
ATOM 5287  O O    . ARG A 1 54 ? 5.963   8.730   -2.571  1.00 0.00 ? 54 ARG A O    5  
ATOM 5288  C CB   . ARG A 1 54 ? 4.537   6.004   -2.083  1.00 0.00 ? 54 ARG A CB   5  
ATOM 5289  C CG   . ARG A 1 54 ? 4.510   4.584   -2.680  1.00 0.00 ? 54 ARG A CG   5  
ATOM 5290  C CD   . ARG A 1 54 ? 3.808   4.495   -4.050  1.00 0.00 ? 54 ARG A CD   5  
ATOM 5291  N NE   . ARG A 1 54 ? 2.333   4.600   -3.992  1.00 0.00 ? 54 ARG A NE   5  
ATOM 5292  C CZ   . ARG A 1 54 ? 1.594   5.642   -4.408  1.00 0.00 ? 54 ARG A CZ   5  
ATOM 5293  N NH1  . ARG A 1 54 ? 2.158   6.790   -4.745  1.00 0.00 ? 54 ARG A NH1  5  
ATOM 5294  N NH2  . ARG A 1 54 ? 0.267   5.577   -4.482  1.00 0.00 ? 54 ARG A NH2  5  
ATOM 5295  H H    . ARG A 1 54 ? 5.799   5.232   0.005   1.00 0.00 ? 54 ARG A H    5  
ATOM 5296  H HA   . ARG A 1 54 ? 6.637   6.292   -2.500  1.00 0.00 ? 54 ARG A HA   5  
ATOM 5297  H HB2  . ARG A 1 54 ? 3.882   6.044   -1.213  1.00 0.00 ? 54 ARG A HB2  5  
ATOM 5298  H HB3  . ARG A 1 54 ? 4.128   6.681   -2.823  1.00 0.00 ? 54 ARG A HB3  5  
ATOM 5299  H HG2  . ARG A 1 54 ? 5.536   4.239   -2.813  1.00 0.00 ? 54 ARG A HG2  5  
ATOM 5300  H HG3  . ARG A 1 54 ? 4.020   3.906   -1.984  1.00 0.00 ? 54 ARG A HG3  5  
ATOM 5301  H HD2  . ARG A 1 54 ? 4.227   5.246   -4.722  1.00 0.00 ? 54 ARG A HD2  5  
ATOM 5302  H HD3  . ARG A 1 54 ? 4.040   3.521   -4.477  1.00 0.00 ? 54 ARG A HD3  5  
ATOM 5303  H HE   . ARG A 1 54 ? 1.871   3.744   -3.719  1.00 0.00 ? 54 ARG A HE   5  
ATOM 5304  H HH11 . ARG A 1 54 ? 3.166   6.949   -4.760  1.00 0.00 ? 54 ARG A HH11 5  
ATOM 5305  H HH12 . ARG A 1 54 ? 1.580   7.563   -5.070  1.00 0.00 ? 54 ARG A HH12 5  
ATOM 5306  H HH21 . ARG A 1 54 ? -0.307  4.764   -4.298  1.00 0.00 ? 54 ARG A HH21 5  
ATOM 5307  H HH22 . ARG A 1 54 ? -0.222  6.406   -4.820  1.00 0.00 ? 54 ARG A HH22 5  
ATOM 5308  N N    . LEU A 1 55 ? 6.007   8.584   -0.328  1.00 0.00 ? 55 LEU A N    5  
ATOM 5309  C CA   . LEU A 1 55 ? 6.217   10.002  -0.022  1.00 0.00 ? 55 LEU A CA   5  
ATOM 5310  C C    . LEU A 1 55 ? 7.593   10.517  -0.462  1.00 0.00 ? 55 LEU A C    5  
ATOM 5311  O O    . LEU A 1 55 ? 7.891   11.701  -0.263  1.00 0.00 ? 55 LEU A O    5  
ATOM 5312  C CB   . LEU A 1 55 ? 5.997   10.241  1.485   1.00 0.00 ? 55 LEU A CB   5  
ATOM 5313  C CG   . LEU A 1 55 ? 4.520   10.480  1.833   1.00 0.00 ? 55 LEU A CG   5  
ATOM 5314  C CD1  . LEU A 1 55 ? 4.285   10.230  3.318   1.00 0.00 ? 55 LEU A CD1  5  
ATOM 5315  C CD2  . LEU A 1 55 ? 4.075   11.906  1.491   1.00 0.00 ? 55 LEU A CD2  5  
ATOM 5316  H H    . LEU A 1 55 ? 5.906   7.951   0.459   1.00 0.00 ? 55 LEU A H    5  
ATOM 5317  H HA   . LEU A 1 55 ? 5.477   10.575  -0.575  1.00 0.00 ? 55 LEU A HA   5  
ATOM 5318  H HB2  . LEU A 1 55 ? 6.382   9.389   2.040   1.00 0.00 ? 55 LEU A HB2  5  
ATOM 5319  H HB3  . LEU A 1 55 ? 6.567   11.102  1.828   1.00 0.00 ? 55 LEU A HB3  5  
ATOM 5320  H HG   . LEU A 1 55 ? 3.899   9.781   1.283   1.00 0.00 ? 55 LEU A HG   5  
ATOM 5321  H HD11 . LEU A 1 55 ? 3.264   10.493  3.570   1.00 0.00 ? 55 LEU A HD11 5  
ATOM 5322  H HD12 . LEU A 1 55 ? 4.421   9.174   3.531   1.00 0.00 ? 55 LEU A HD12 5  
ATOM 5323  H HD13 . LEU A 1 55 ? 4.978   10.818  3.920   1.00 0.00 ? 55 LEU A HD13 5  
ATOM 5324  H HD21 . LEU A 1 55 ? 3.018   12.040  1.722   1.00 0.00 ? 55 LEU A HD21 5  
ATOM 5325  H HD22 . LEU A 1 55 ? 4.660   12.628  2.059   1.00 0.00 ? 55 LEU A HD22 5  
ATOM 5326  H HD23 . LEU A 1 55 ? 4.210   12.105  0.429   1.00 0.00 ? 55 LEU A HD23 5  
ATOM 5327  N N    . GLY A 1 56 ? 8.456   9.664   -1.022  1.00 0.00 ? 56 GLY A N    5  
ATOM 5328  C CA   . GLY A 1 56 ? 9.631   10.070  -1.782  1.00 0.00 ? 56 GLY A CA   5  
ATOM 5329  C C    . GLY A 1 56 ? 10.950  9.702   -1.112  1.00 0.00 ? 56 GLY A C    5  
ATOM 5330  O O    . GLY A 1 56 ? 12.000  10.150  -1.569  1.00 0.00 ? 56 GLY A O    5  
ATOM 5331  H H    . GLY A 1 56 ? 8.211   8.678   -1.044  1.00 0.00 ? 56 GLY A H    5  
ATOM 5332  H HA2  . GLY A 1 56 ? 9.595   9.574   -2.751  1.00 0.00 ? 56 GLY A HA2  5  
ATOM 5333  H HA3  . GLY A 1 56 ? 9.613   11.147  -1.961  1.00 0.00 ? 56 GLY A HA3  5  
ATOM 5334  N N    . THR A 1 57 ? 10.945  8.914   -0.033  1.00 0.00 ? 57 THR A N    5  
ATOM 5335  C CA   . THR A 1 57 ? 12.194  8.395   0.537   1.00 0.00 ? 57 THR A CA   5  
ATOM 5336  C C    . THR A 1 57 ? 12.845  7.362   -0.390  1.00 0.00 ? 57 THR A C    5  
ATOM 5337  O O    . THR A 1 57 ? 14.006  6.992   -0.215  1.00 0.00 ? 57 THR A O    5  
ATOM 5338  C CB   . THR A 1 57 ? 11.917  7.768   1.908   1.00 0.00 ? 57 THR A CB   5  
ATOM 5339  O OG1  . THR A 1 57 ? 10.770  6.970   1.871   1.00 0.00 ? 57 THR A OG1  5  
ATOM 5340  C CG2  . THR A 1 57 ? 11.653  8.842   2.969   1.00 0.00 ? 57 THR A CG2  5  
ATOM 5341  H H    . THR A 1 57 ? 10.092  8.467   0.299   1.00 0.00 ? 57 THR A H    5  
ATOM 5342  H HA   . THR A 1 57 ? 12.908  9.210   0.664   1.00 0.00 ? 57 THR A HA   5  
ATOM 5343  H HB   . THR A 1 57 ? 12.751  7.125   2.176   1.00 0.00 ? 57 THR A HB   5  
ATOM 5344  H HG1  . THR A 1 57 ? 11.036  6.035   1.711   1.00 0.00 ? 57 THR A HG1  5  
ATOM 5345  H HG21 . THR A 1 57 ? 10.735  9.390   2.740   1.00 0.00 ? 57 THR A HG21 5  
ATOM 5346  H HG22 . THR A 1 57 ? 11.546  8.373   3.948   1.00 0.00 ? 57 THR A HG22 5  
ATOM 5347  H HG23 . THR A 1 57 ? 12.492  9.536   3.008   1.00 0.00 ? 57 THR A HG23 5  
ATOM 5348  N N    . LEU A 1 58 ? 12.084  6.859   -1.359  1.00 0.00 ? 58 LEU A N    5  
ATOM 5349  C CA   . LEU A 1 58 ? 12.538  5.976   -2.416  1.00 0.00 ? 58 LEU A CA   5  
ATOM 5350  C C    . LEU A 1 58 ? 13.543  6.706   -3.302  1.00 0.00 ? 58 LEU A C    5  
ATOM 5351  O O    . LEU A 1 58 ? 13.567  7.939   -3.349  1.00 0.00 ? 58 LEU A O    5  
ATOM 5352  C CB   . LEU A 1 58 ? 11.309  5.557   -3.234  1.00 0.00 ? 58 LEU A CB   5  
ATOM 5353  C CG   . LEU A 1 58 ? 10.373  4.649   -2.417  1.00 0.00 ? 58 LEU A CG   5  
ATOM 5354  C CD1  . LEU A 1 58 ? 8.927   4.797   -2.887  1.00 0.00 ? 58 LEU A CD1  5  
ATOM 5355  C CD2  . LEU A 1 58 ? 10.738  3.179   -2.597  1.00 0.00 ? 58 LEU A CD2  5  
ATOM 5356  H H    . LEU A 1 58 ? 11.128  7.179   -1.397  1.00 0.00 ? 58 LEU A H    5  
ATOM 5357  H HA   . LEU A 1 58 ? 13.010  5.097   -1.976  1.00 0.00 ? 58 LEU A HA   5  
ATOM 5358  H HB2  . LEU A 1 58 ? 10.782  6.462   -3.543  1.00 0.00 ? 58 LEU A HB2  5  
ATOM 5359  H HB3  . LEU A 1 58 ? 11.619  5.041   -4.141  1.00 0.00 ? 58 LEU A HB3  5  
ATOM 5360  H HG   . LEU A 1 58 ? 10.429  4.917   -1.353  1.00 0.00 ? 58 LEU A HG   5  
ATOM 5361  H HD11 . LEU A 1 58 ? 8.799   4.409   -3.896  1.00 0.00 ? 58 LEU A HD11 5  
ATOM 5362  H HD12 . LEU A 1 58 ? 8.269   4.277   -2.191  1.00 0.00 ? 58 LEU A HD12 5  
ATOM 5363  H HD13 . LEU A 1 58 ? 8.668   5.852   -2.886  1.00 0.00 ? 58 LEU A HD13 5  
ATOM 5364  H HD21 . LEU A 1 58 ? 10.048  2.567   -2.018  1.00 0.00 ? 58 LEU A HD21 5  
ATOM 5365  H HD22 . LEU A 1 58 ? 10.679  2.893   -3.645  1.00 0.00 ? 58 LEU A HD22 5  
ATOM 5366  H HD23 . LEU A 1 58 ? 11.747  3.005   -2.226  1.00 0.00 ? 58 LEU A HD23 5  
ATOM 5367  N N    . LYS A 1 59 ? 14.307  5.931   -4.078  1.00 0.00 ? 59 LYS A N    5  
ATOM 5368  C CA   . LYS A 1 59 ? 15.281  6.423   -5.057  1.00 0.00 ? 59 LYS A CA   5  
ATOM 5369  C C    . LYS A 1 59 ? 16.432  7.183   -4.388  1.00 0.00 ? 59 LYS A C    5  
ATOM 5370  O O    . LYS A 1 59 ? 17.016  8.076   -5.001  1.00 0.00 ? 59 LYS A O    5  
ATOM 5371  C CB   . LYS A 1 59 ? 14.605  7.232   -6.172  1.00 0.00 ? 59 LYS A CB   5  
ATOM 5372  C CG   . LYS A 1 59 ? 13.587  6.384   -6.948  1.00 0.00 ? 59 LYS A CG   5  
ATOM 5373  C CD   . LYS A 1 59 ? 12.548  7.282   -7.601  1.00 0.00 ? 59 LYS A CD   5  
ATOM 5374  C CE   . LYS A 1 59 ? 13.173  8.258   -8.603  1.00 0.00 ? 59 LYS A CE   5  
ATOM 5375  N NZ   . LYS A 1 59 ? 12.188  9.239   -9.090  1.00 0.00 ? 59 LYS A NZ   5  
ATOM 5376  H H    . LYS A 1 59 ? 14.220  4.927   -3.965  1.00 0.00 ? 59 LYS A H    5  
ATOM 5377  H HA   . LYS A 1 59 ? 15.689  5.558   -5.568  1.00 0.00 ? 59 LYS A HA   5  
ATOM 5378  H HB2  . LYS A 1 59 ? 14.131  8.118   -5.750  1.00 0.00 ? 59 LYS A HB2  5  
ATOM 5379  H HB3  . LYS A 1 59 ? 15.363  7.574   -6.877  1.00 0.00 ? 59 LYS A HB3  5  
ATOM 5380  H HG2  . LYS A 1 59 ? 14.103  5.779   -7.693  1.00 0.00 ? 59 LYS A HG2  5  
ATOM 5381  H HG3  . LYS A 1 59 ? 13.048  5.717   -6.279  1.00 0.00 ? 59 LYS A HG3  5  
ATOM 5382  H HD2  . LYS A 1 59 ? 11.814  6.650   -8.093  1.00 0.00 ? 59 LYS A HD2  5  
ATOM 5383  H HD3  . LYS A 1 59 ? 12.065  7.830   -6.794  1.00 0.00 ? 59 LYS A HD3  5  
ATOM 5384  H HE2  . LYS A 1 59 ? 13.982  8.806   -8.115  1.00 0.00 ? 59 LYS A HE2  5  
ATOM 5385  H HE3  . LYS A 1 59 ? 13.595  7.703   -9.443  1.00 0.00 ? 59 LYS A HE3  5  
ATOM 5386  H HZ1  . LYS A 1 59 ? 12.638  9.902   -9.711  1.00 0.00 ? 59 LYS A HZ1  5  
ATOM 5387  H HZ2  . LYS A 1 59 ? 11.423  8.782   -9.577  1.00 0.00 ? 59 LYS A HZ2  5  
ATOM 5388  H HZ3  . LYS A 1 59 ? 11.801  9.751   -8.307  1.00 0.00 ? 59 LYS A HZ3  5  
ATOM 5389  N N    . ASN A 1 60 ? 16.781  6.847   -3.142  1.00 0.00 ? 60 ASN A N    5  
ATOM 5390  C CA   . ASN A 1 60 ? 17.922  7.447   -2.452  1.00 0.00 ? 60 ASN A CA   5  
ATOM 5391  C C    . ASN A 1 60 ? 18.894  6.338   -2.024  1.00 0.00 ? 60 ASN A C    5  
ATOM 5392  O O    . ASN A 1 60 ? 18.910  5.953   -0.851  1.00 0.00 ? 60 ASN A O    5  
ATOM 5393  C CB   . ASN A 1 60 ? 17.433  8.339   -1.301  1.00 0.00 ? 60 ASN A CB   5  
ATOM 5394  C CG   . ASN A 1 60 ? 18.540  9.239   -0.762  1.00 0.00 ? 60 ASN A CG   5  
ATOM 5395  O OD1  . ASN A 1 60 ? 19.734  9.000   -0.950  1.00 0.00 ? 60 ASN A OD1  5  
ATOM 5396  N ND2  . ASN A 1 60 ? 18.167  10.323  -0.104  1.00 0.00 ? 60 ASN A ND2  5  
ATOM 5397  H H    . ASN A 1 60 ? 16.271  6.119   -2.661  1.00 0.00 ? 60 ASN A H    5  
ATOM 5398  H HA   . ASN A 1 60 ? 18.461  8.105   -3.133  1.00 0.00 ? 60 ASN A HA   5  
ATOM 5399  H HB2  . ASN A 1 60 ? 16.625  8.971   -1.673  1.00 0.00 ? 60 ASN A HB2  5  
ATOM 5400  H HB3  . ASN A 1 60 ? 17.036  7.721   -0.495  1.00 0.00 ? 60 ASN A HB3  5  
ATOM 5401  H HD21 . ASN A 1 60 ? 17.202  10.642  -0.174  1.00 0.00 ? 60 ASN A HD21 5  
ATOM 5402  H HD22 . ASN A 1 60 ? 18.836  10.980  0.282   1.00 0.00 ? 60 ASN A HD22 5  
ATOM 5403  N N    . PRO A 1 61 ? 19.667  5.762   -2.966  1.00 0.00 ? 61 PRO A N    5  
ATOM 5404  C CA   . PRO A 1 61 ? 20.606  4.686   -2.669  1.00 0.00 ? 61 PRO A CA   5  
ATOM 5405  C C    . PRO A 1 61 ? 21.848  5.223   -1.939  1.00 0.00 ? 61 PRO A C    5  
ATOM 5406  O O    . PRO A 1 61 ? 22.144  6.420   -2.017  1.00 0.00 ? 61 PRO A O    5  
ATOM 5407  C CB   . PRO A 1 61 ? 20.978  4.097   -4.035  1.00 0.00 ? 61 PRO A CB   5  
ATOM 5408  C CG   . PRO A 1 61 ? 20.882  5.301   -4.969  1.00 0.00 ? 61 PRO A CG   5  
ATOM 5409  C CD   . PRO A 1 61 ? 19.707  6.085   -4.388  1.00 0.00 ? 61 PRO A CD   5  
ATOM 5410  H HA   . PRO A 1 61 ? 20.115  3.927   -2.059  1.00 0.00 ? 61 PRO A HA   5  
ATOM 5411  H HB2  . PRO A 1 61 ? 21.978  3.662   -4.046  1.00 0.00 ? 61 PRO A HB2  5  
ATOM 5412  H HB3  . PRO A 1 61 ? 20.236  3.351   -4.324  1.00 0.00 ? 61 PRO A HB3  5  
ATOM 5413  H HG2  . PRO A 1 61 ? 21.794  5.897   -4.902  1.00 0.00 ? 61 PRO A HG2  5  
ATOM 5414  H HG3  . PRO A 1 61 ? 20.696  5.000   -6.001  1.00 0.00 ? 61 PRO A HG3  5  
ATOM 5415  H HD2  . PRO A 1 61 ? 19.853  7.153   -4.553  1.00 0.00 ? 61 PRO A HD2  5  
ATOM 5416  H HD3  . PRO A 1 61 ? 18.784  5.755   -4.862  1.00 0.00 ? 61 PRO A HD3  5  
ATOM 5417  N N    . PRO A 1 62 ? 22.630  4.361   -1.272  1.00 0.00 ? 62 PRO A N    5  
ATOM 5418  C CA   . PRO A 1 62 ? 23.886  4.771   -0.661  1.00 0.00 ? 62 PRO A CA   5  
ATOM 5419  C C    . PRO A 1 62 ? 24.933  5.100   -1.730  1.00 0.00 ? 62 PRO A C    5  
ATOM 5420  O O    . PRO A 1 62 ? 25.022  4.418   -2.754  1.00 0.00 ? 62 PRO A O    5  
ATOM 5421  C CB   . PRO A 1 62 ? 24.325  3.579   0.186   1.00 0.00 ? 62 PRO A CB   5  
ATOM 5422  C CG   . PRO A 1 62 ? 23.688  2.378   -0.507  1.00 0.00 ? 62 PRO A CG   5  
ATOM 5423  C CD   . PRO A 1 62 ? 22.388  2.941   -1.071  1.00 0.00 ? 62 PRO A CD   5  
ATOM 5424  H HA   . PRO A 1 62 ? 23.723  5.639   -0.020  1.00 0.00 ? 62 PRO A HA   5  
ATOM 5425  H HB2  . PRO A 1 62 ? 25.407  3.496   0.231   1.00 0.00 ? 62 PRO A HB2  5  
ATOM 5426  H HB3  . PRO A 1 62 ? 23.917  3.672   1.187   1.00 0.00 ? 62 PRO A HB3  5  
ATOM 5427  H HG2  . PRO A 1 62 ? 24.329  2.033   -1.318  1.00 0.00 ? 62 PRO A HG2  5  
ATOM 5428  H HG3  . PRO A 1 62 ? 23.494  1.573   0.195   1.00 0.00 ? 62 PRO A HG3  5  
ATOM 5429  H HD2  . PRO A 1 62 ? 22.140  2.438   -2.005  1.00 0.00 ? 62 PRO A HD2  5  
ATOM 5430  H HD3  . PRO A 1 62 ? 21.583  2.811   -0.347  1.00 0.00 ? 62 PRO A HD3  5  
ATOM 5431  N N    . LYS A 1 63 ? 25.778  6.093   -1.440  1.00 0.00 ? 63 LYS A N    5  
ATOM 5432  C CA   . LYS A 1 63 ? 26.887  6.534   -2.297  1.00 0.00 ? 63 LYS A CA   5  
ATOM 5433  C C    . LYS A 1 63 ? 28.238  6.355   -1.592  1.00 0.00 ? 63 LYS A C    5  
ATOM 5434  O O    . LYS A 1 63 ? 29.269  6.333   -2.256  1.00 0.00 ? 63 LYS A O    5  
ATOM 5435  C CB   . LYS A 1 63 ? 26.620  7.988   -2.736  1.00 0.00 ? 63 LYS A CB   5  
ATOM 5436  C CG   . LYS A 1 63 ? 27.485  8.499   -3.899  1.00 0.00 ? 63 LYS A CG   5  
ATOM 5437  C CD   . LYS A 1 63 ? 27.030  9.908   -4.321  1.00 0.00 ? 63 LYS A CD   5  
ATOM 5438  C CE   . LYS A 1 63 ? 27.623  10.392  -5.650  1.00 0.00 ? 63 LYS A CE   5  
ATOM 5439  N NZ   . LYS A 1 63 ? 29.051  10.756  -5.573  1.00 0.00 ? 63 LYS A NZ   5  
ATOM 5440  H H    . LYS A 1 63 ? 25.628  6.580   -0.564  1.00 0.00 ? 63 LYS A H    5  
ATOM 5441  H HA   . LYS A 1 63 ? 26.904  5.911   -3.194  1.00 0.00 ? 63 LYS A HA   5  
ATOM 5442  H HB2  . LYS A 1 63 ? 25.574  8.065   -3.040  1.00 0.00 ? 63 LYS A HB2  5  
ATOM 5443  H HB3  . LYS A 1 63 ? 26.782  8.644   -1.886  1.00 0.00 ? 63 LYS A HB3  5  
ATOM 5444  H HG2  . LYS A 1 63 ? 28.524  8.542   -3.580  1.00 0.00 ? 63 LYS A HG2  5  
ATOM 5445  H HG3  . LYS A 1 63 ? 27.391  7.816   -4.743  1.00 0.00 ? 63 LYS A HG3  5  
ATOM 5446  H HD2  . LYS A 1 63 ? 25.946  9.898   -4.441  1.00 0.00 ? 63 LYS A HD2  5  
ATOM 5447  H HD3  . LYS A 1 63 ? 27.276  10.620  -3.535  1.00 0.00 ? 63 LYS A HD3  5  
ATOM 5448  H HE2  . LYS A 1 63 ? 27.494  9.611   -6.400  1.00 0.00 ? 63 LYS A HE2  5  
ATOM 5449  H HE3  . LYS A 1 63 ? 27.062  11.271  -5.975  1.00 0.00 ? 63 LYS A HE3  5  
ATOM 5450  H HZ1  . LYS A 1 63 ? 29.621  9.965   -5.283  1.00 0.00 ? 63 LYS A HZ1  5  
ATOM 5451  H HZ2  . LYS A 1 63 ? 29.368  11.024  -6.504  1.00 0.00 ? 63 LYS A HZ2  5  
ATOM 5452  H HZ3  . LYS A 1 63 ? 29.195  11.566  -4.973  1.00 0.00 ? 63 LYS A HZ3  5  
ATOM 5453  N N    . LYS A 1 64 ? 28.245  6.187   -0.261  1.00 0.00 ? 64 LYS A N    5  
ATOM 5454  C CA   . LYS A 1 64 ? 29.397  5.799   0.565   1.00 0.00 ? 64 LYS A CA   5  
ATOM 5455  C C    . LYS A 1 64 ? 29.103  4.490   1.316   1.00 0.00 ? 64 LYS A C    5  
ATOM 5456  O O    . LYS A 1 64 ? 29.744  4.182   2.319   1.00 0.00 ? 64 LYS A O    5  
ATOM 5457  C CB   . LYS A 1 64 ? 29.798  6.932   1.536   1.00 0.00 ? 64 LYS A CB   5  
ATOM 5458  C CG   . LYS A 1 64 ? 30.679  8.037   0.937   1.00 0.00 ? 64 LYS A CG   5  
ATOM 5459  C CD   . LYS A 1 64 ? 29.949  8.946   -0.059  1.00 0.00 ? 64 LYS A CD   5  
ATOM 5460  C CE   . LYS A 1 64 ? 30.517  10.372  -0.094  1.00 0.00 ? 64 LYS A CE   5  
ATOM 5461  N NZ   . LYS A 1 64 ? 30.214  11.121  1.146   1.00 0.00 ? 64 LYS A NZ   5  
ATOM 5462  H H    . LYS A 1 64 ? 27.362  6.268   0.229   1.00 0.00 ? 64 LYS A H    5  
ATOM 5463  H HA   . LYS A 1 64 ? 30.250  5.591   -0.086  1.00 0.00 ? 64 LYS A HA   5  
ATOM 5464  H HB2  . LYS A 1 64 ? 28.907  7.369   1.987   1.00 0.00 ? 64 LYS A HB2  5  
ATOM 5465  H HB3  . LYS A 1 64 ? 30.388  6.510   2.349   1.00 0.00 ? 64 LYS A HB3  5  
ATOM 5466  H HG2  . LYS A 1 64 ? 31.038  8.636   1.771   1.00 0.00 ? 64 LYS A HG2  5  
ATOM 5467  H HG3  . LYS A 1 64 ? 31.550  7.594   0.451   1.00 0.00 ? 64 LYS A HG3  5  
ATOM 5468  H HD2  . LYS A 1 64 ? 30.040  8.517   -1.057  1.00 0.00 ? 64 LYS A HD2  5  
ATOM 5469  H HD3  . LYS A 1 64 ? 28.890  8.992   0.197   1.00 0.00 ? 64 LYS A HD3  5  
ATOM 5470  H HE2  . LYS A 1 64 ? 31.595  10.335  -0.259  1.00 0.00 ? 64 LYS A HE2  5  
ATOM 5471  H HE3  . LYS A 1 64 ? 30.052  10.893  -0.933  1.00 0.00 ? 64 LYS A HE3  5  
ATOM 5472  H HZ1  . LYS A 1 64 ? 29.242  10.987  1.409   1.00 0.00 ? 64 LYS A HZ1  5  
ATOM 5473  H HZ2  . LYS A 1 64 ? 30.757  10.771  1.936   1.00 0.00 ? 64 LYS A HZ2  5  
ATOM 5474  H HZ3  . LYS A 1 64 ? 30.394  12.108  1.044   1.00 0.00 ? 64 LYS A HZ3  5  
ATOM 5475  N N    . LYS A 1 65 ? 28.118  3.705   0.878   1.00 0.00 ? 65 LYS A N    5  
ATOM 5476  C CA   . LYS A 1 65 ? 27.971  2.302   1.258   1.00 0.00 ? 65 LYS A CA   5  
ATOM 5477  C C    . LYS A 1 65 ? 27.735  1.542   -0.034  1.00 0.00 ? 65 LYS A C    5  
ATOM 5478  O O    . LYS A 1 65 ? 27.255  2.129   -1.004  1.00 0.00 ? 65 LYS A O    5  
ATOM 5479  C CB   . LYS A 1 65 ? 26.820  2.087   2.262   1.00 0.00 ? 65 LYS A CB   5  
ATOM 5480  C CG   . LYS A 1 65 ? 27.318  1.363   3.519   1.00 0.00 ? 65 LYS A CG   5  
ATOM 5481  C CD   . LYS A 1 65 ? 26.187  1.135   4.525   1.00 0.00 ? 65 LYS A CD   5  
ATOM 5482  C CE   . LYS A 1 65 ? 26.723  0.553   5.838   1.00 0.00 ? 65 LYS A CE   5  
ATOM 5483  N NZ   . LYS A 1 65 ? 26.862  -0.916  5.801   1.00 0.00 ? 65 LYS A NZ   5  
ATOM 5484  H H    . LYS A 1 65 ? 27.664  3.933   0.002   1.00 0.00 ? 65 LYS A H    5  
ATOM 5485  H HA   . LYS A 1 65 ? 28.913  1.955   1.691   1.00 0.00 ? 65 LYS A HA   5  
ATOM 5486  H HB2  . LYS A 1 65 ? 26.387  3.046   2.545   1.00 0.00 ? 65 LYS A HB2  5  
ATOM 5487  H HB3  . LYS A 1 65 ? 26.030  1.492   1.798   1.00 0.00 ? 65 LYS A HB3  5  
ATOM 5488  H HG2  . LYS A 1 65 ? 27.752  0.403   3.237   1.00 0.00 ? 65 LYS A HG2  5  
ATOM 5489  H HG3  . LYS A 1 65 ? 28.086  1.977   3.989   1.00 0.00 ? 65 LYS A HG3  5  
ATOM 5490  H HD2  . LYS A 1 65 ? 25.719  2.094   4.746   1.00 0.00 ? 65 LYS A HD2  5  
ATOM 5491  H HD3  . LYS A 1 65 ? 25.435  0.470   4.097   1.00 0.00 ? 65 LYS A HD3  5  
ATOM 5492  H HE2  . LYS A 1 65 ? 27.693  1.006   6.055   1.00 0.00 ? 65 LYS A HE2  5  
ATOM 5493  H HE3  . LYS A 1 65 ? 26.039  0.818   6.642   1.00 0.00 ? 65 LYS A HE3  5  
ATOM 5494  H HZ1  . LYS A 1 65 ? 27.165  -1.236  4.886   1.00 0.00 ? 65 LYS A HZ1  5  
ATOM 5495  H HZ2  . LYS A 1 65 ? 27.547  -1.218  6.489   1.00 0.00 ? 65 LYS A HZ2  5  
ATOM 5496  H HZ3  . LYS A 1 65 ? 25.986  -1.390  6.008   1.00 0.00 ? 65 LYS A HZ3  5  
ATOM 5497  N N    . MET A 1 66 ? 28.063  0.258   -0.044  1.00 0.00 ? 66 MET A N    5  
ATOM 5498  C CA   . MET A 1 66 ? 27.938  -0.596  -1.209  1.00 0.00 ? 66 MET A CA   5  
ATOM 5499  C C    . MET A 1 66 ? 27.831  -2.005  -0.632  1.00 0.00 ? 66 MET A C    5  
ATOM 5500  O O    . MET A 1 66 ? 28.822  -2.528  -0.116  1.00 0.00 ? 66 MET A O    5  
ATOM 5501  C CB   . MET A 1 66 ? 29.163  -0.375  -2.132  1.00 0.00 ? 66 MET A CB   5  
ATOM 5502  C CG   . MET A 1 66 ? 28.850  -0.454  -3.632  1.00 0.00 ? 66 MET A CG   5  
ATOM 5503  S SD   . MET A 1 66 ? 29.087  -2.069  -4.421  1.00 0.00 ? 66 MET A SD   5  
ATOM 5504  C CE   . MET A 1 66 ? 28.486  -1.663  -6.087  1.00 0.00 ? 66 MET A CE   5  
ATOM 5505  H H    . MET A 1 66 ? 28.427  -0.189  0.787   1.00 0.00 ? 66 MET A H    5  
ATOM 5506  H HA   . MET A 1 66 ? 27.021  -0.337  -1.743  1.00 0.00 ? 66 MET A HA   5  
ATOM 5507  H HB2  . MET A 1 66 ? 29.546  0.632   -1.964  1.00 0.00 ? 66 MET A HB2  5  
ATOM 5508  H HB3  . MET A 1 66 ? 29.972  -1.064  -1.886  1.00 0.00 ? 66 MET A HB3  5  
ATOM 5509  H HG2  . MET A 1 66 ? 27.830  -0.111  -3.805  1.00 0.00 ? 66 MET A HG2  5  
ATOM 5510  H HG3  . MET A 1 66 ? 29.511  0.247   -4.143  1.00 0.00 ? 66 MET A HG3  5  
ATOM 5511  H HE1  . MET A 1 66 ? 29.116  -0.889  -6.527  1.00 0.00 ? 66 MET A HE1  5  
ATOM 5512  H HE2  . MET A 1 66 ? 28.517  -2.551  -6.719  1.00 0.00 ? 66 MET A HE2  5  
ATOM 5513  H HE3  . MET A 1 66 ? 27.458  -1.300  -6.037  1.00 0.00 ? 66 MET A HE3  5  
ATOM 5514  N N    . LYS A 1 67 ? 26.623  -2.582  -0.611  1.00 0.00 ? 67 LYS A N    5  
ATOM 5515  C CA   . LYS A 1 67 ? 26.464  -3.983  -0.229  1.00 0.00 ? 67 LYS A CA   5  
ATOM 5516  C C    . LYS A 1 67 ? 27.266  -4.825  -1.216  1.00 0.00 ? 67 LYS A C    5  
ATOM 5517  O O    . LYS A 1 67 ? 26.999  -4.788  -2.420  1.00 0.00 ? 67 LYS A O    5  
ATOM 5518  C CB   . LYS A 1 67 ? 24.990  -4.428  -0.114  1.00 0.00 ? 67 LYS A CB   5  
ATOM 5519  C CG   . LYS A 1 67 ? 24.060  -4.097  -1.300  1.00 0.00 ? 67 LYS A CG   5  
ATOM 5520  C CD   . LYS A 1 67 ? 22.688  -4.795  -1.217  1.00 0.00 ? 67 LYS A CD   5  
ATOM 5521  C CE   . LYS A 1 67 ? 22.829  -6.317  -1.388  1.00 0.00 ? 67 LYS A CE   5  
ATOM 5522  N NZ   . LYS A 1 67 ? 21.550  -7.052  -1.319  1.00 0.00 ? 67 LYS A NZ   5  
ATOM 5523  H H    . LYS A 1 67 ? 25.839  -2.105  -1.035  1.00 0.00 ? 67 LYS A H    5  
ATOM 5524  H HA   . LYS A 1 67 ? 26.915  -4.106  0.759   1.00 0.00 ? 67 LYS A HA   5  
ATOM 5525  H HB2  . LYS A 1 67 ? 24.999  -5.506  0.051   1.00 0.00 ? 67 LYS A HB2  5  
ATOM 5526  H HB3  . LYS A 1 67 ? 24.566  -3.972  0.777   1.00 0.00 ? 67 LYS A HB3  5  
ATOM 5527  H HG2  . LYS A 1 67 ? 23.896  -3.018  -1.324  1.00 0.00 ? 67 LYS A HG2  5  
ATOM 5528  H HG3  . LYS A 1 67 ? 24.533  -4.387  -2.233  1.00 0.00 ? 67 LYS A HG3  5  
ATOM 5529  H HD2  . LYS A 1 67 ? 22.223  -4.571  -0.256  1.00 0.00 ? 67 LYS A HD2  5  
ATOM 5530  H HD3  . LYS A 1 67 ? 22.052  -4.405  -2.014  1.00 0.00 ? 67 LYS A HD3  5  
ATOM 5531  H HE2  . LYS A 1 67 ? 23.306  -6.532  -2.345  1.00 0.00 ? 67 LYS A HE2  5  
ATOM 5532  H HE3  . LYS A 1 67 ? 23.475  -6.700  -0.599  1.00 0.00 ? 67 LYS A HE3  5  
ATOM 5533  H HZ1  . LYS A 1 67 ? 21.010  -6.975  -2.175  1.00 0.00 ? 67 LYS A HZ1  5  
ATOM 5534  H HZ2  . LYS A 1 67 ? 21.766  -8.041  -1.216  1.00 0.00 ? 67 LYS A HZ2  5  
ATOM 5535  H HZ3  . LYS A 1 67 ? 20.985  -6.798  -0.513  1.00 0.00 ? 67 LYS A HZ3  5  
ATOM 5536  N N    . LEU A 1 68 ? 28.261  -5.549  -0.728  1.00 0.00 ? 68 LEU A N    5  
ATOM 5537  C CA   . LEU A 1 68 ? 29.069  -6.478  -1.496  1.00 0.00 ? 68 LEU A CA   5  
ATOM 5538  C C    . LEU A 1 68 ? 29.191  -7.710  -0.624  1.00 0.00 ? 68 LEU A C    5  
ATOM 5539  O O    . LEU A 1 68 ? 29.602  -7.598  0.533   1.00 0.00 ? 68 LEU A O    5  
ATOM 5540  C CB   . LEU A 1 68 ? 30.444  -5.868  -1.819  1.00 0.00 ? 68 LEU A CB   5  
ATOM 5541  C CG   . LEU A 1 68 ? 31.407  -6.861  -2.506  1.00 0.00 ? 68 LEU A CG   5  
ATOM 5542  C CD1  . LEU A 1 68 ? 30.891  -7.317  -3.876  1.00 0.00 ? 68 LEU A CD1  5  
ATOM 5543  C CD2  . LEU A 1 68 ? 32.783  -6.212  -2.677  1.00 0.00 ? 68 LEU A CD2  5  
ATOM 5544  H H    . LEU A 1 68 ? 28.409  -5.557  0.273   1.00 0.00 ? 68 LEU A H    5  
ATOM 5545  H HA   . LEU A 1 68 ? 28.558  -6.731  -2.426  1.00 0.00 ? 68 LEU A HA   5  
ATOM 5546  H HB2  . LEU A 1 68 ? 30.302  -4.999  -2.463  1.00 0.00 ? 68 LEU A HB2  5  
ATOM 5547  H HB3  . LEU A 1 68 ? 30.900  -5.527  -0.887  1.00 0.00 ? 68 LEU A HB3  5  
ATOM 5548  H HG   . LEU A 1 68 ? 31.532  -7.740  -1.875  1.00 0.00 ? 68 LEU A HG   5  
ATOM 5549  H HD11 . LEU A 1 68 ? 30.709  -6.454  -4.518  1.00 0.00 ? 68 LEU A HD11 5  
ATOM 5550  H HD12 . LEU A 1 68 ? 31.632  -7.963  -4.349  1.00 0.00 ? 68 LEU A HD12 5  
ATOM 5551  H HD13 . LEU A 1 68 ? 29.969  -7.886  -3.771  1.00 0.00 ? 68 LEU A HD13 5  
ATOM 5552  H HD21 . LEU A 1 68 ? 32.712  -5.323  -3.304  1.00 0.00 ? 68 LEU A HD21 5  
ATOM 5553  H HD22 . LEU A 1 68 ? 33.182  -5.933  -1.700  1.00 0.00 ? 68 LEU A HD22 5  
ATOM 5554  H HD23 . LEU A 1 68 ? 33.471  -6.924  -3.134  1.00 0.00 ? 68 LEU A HD23 5  
ATOM 5555  N N    . MET A 1 69 ? 28.790  -8.860  -1.140  1.00 0.00 ? 69 MET A N    5  
ATOM 5556  C CA   . MET A 1 69 ? 28.956  -10.155 -0.505  1.00 0.00 ? 69 MET A CA   5  
ATOM 5557  C C    . MET A 1 69 ? 29.141  -11.191 -1.617  1.00 0.00 ? 69 MET A C    5  
ATOM 5558  O O    . MET A 1 69 ? 29.044  -10.852 -2.804  1.00 0.00 ? 69 MET A O    5  
ATOM 5559  C CB   . MET A 1 69 ? 27.738  -10.439 0.397   1.00 0.00 ? 69 MET A CB   5  
ATOM 5560  C CG   . MET A 1 69 ? 28.099  -11.342 1.578   1.00 0.00 ? 69 MET A CG   5  
ATOM 5561  S SD   . MET A 1 69 ? 26.820  -11.423 2.855   1.00 0.00 ? 69 MET A SD   5  
ATOM 5562  C CE   . MET A 1 69 ? 27.778  -12.199 4.183   1.00 0.00 ? 69 MET A CE   5  
ATOM 5563  H H    . MET A 1 69 ? 28.443  -8.890  -2.094  1.00 0.00 ? 69 MET A H    5  
ATOM 5564  H HA   . MET A 1 69 ? 29.863  -10.131 0.102   1.00 0.00 ? 69 MET A HA   5  
ATOM 5565  H HB2  . MET A 1 69 ? 27.372  -9.499  0.811   1.00 0.00 ? 69 MET A HB2  5  
ATOM 5566  H HB3  . MET A 1 69 ? 26.932  -10.888 -0.186  1.00 0.00 ? 69 MET A HB3  5  
ATOM 5567  H HG2  . MET A 1 69 ? 28.287  -12.352 1.216   1.00 0.00 ? 69 MET A HG2  5  
ATOM 5568  H HG3  . MET A 1 69 ? 29.012  -10.963 2.041   1.00 0.00 ? 69 MET A HG3  5  
ATOM 5569  H HE1  . MET A 1 69 ? 27.135  -12.371 5.047   1.00 0.00 ? 69 MET A HE1  5  
ATOM 5570  H HE2  . MET A 1 69 ? 28.196  -13.148 3.843   1.00 0.00 ? 69 MET A HE2  5  
ATOM 5571  H HE3  . MET A 1 69 ? 28.592  -11.538 4.472   1.00 0.00 ? 69 MET A HE3  5  
ATOM 5572  N N    . ARG A 1 70 ? 29.428  -12.433 -1.254  1.00 0.00 ? 70 ARG A N    5  
ATOM 5573  C CA   . ARG A 1 70 ? 29.407  -13.601 -2.114  1.00 0.00 ? 70 ARG A CA   5  
ATOM 5574  C C    . ARG A 1 70 ? 28.788  -14.697 -1.284  1.00 0.00 ? 70 ARG A C    5  
ATOM 5575  O O    . ARG A 1 70 ? 28.965  -14.692 -0.044  1.00 0.00 ? 70 ARG A O    5  
ATOM 5576  C CB   . ARG A 1 70 ? 30.824  -13.989 -2.574  1.00 0.00 ? 70 ARG A CB   5  
ATOM 5577  C CG   . ARG A 1 70 ? 31.135  -13.473 -3.985  1.00 0.00 ? 70 ARG A CG   5  
ATOM 5578  C CD   . ARG A 1 70 ? 32.631  -13.632 -4.281  1.00 0.00 ? 70 ARG A CD   5  
ATOM 5579  N NE   . ARG A 1 70 ? 32.950  -13.331 -5.685  1.00 0.00 ? 70 ARG A NE   5  
ATOM 5580  C CZ   . ARG A 1 70 ? 33.178  -12.132 -6.236  1.00 0.00 ? 70 ARG A CZ   5  
ATOM 5581  N NH1  . ARG A 1 70 ? 33.102  -11.005 -5.533  1.00 0.00 ? 70 ARG A NH1  5  
ATOM 5582  N NH2  . ARG A 1 70 ? 33.494  -12.071 -7.522  1.00 0.00 ? 70 ARG A NH2  5  
ATOM 5583  H H    . ARG A 1 70 ? 29.469  -12.697 -0.275  1.00 0.00 ? 70 ARG A H    5  
ATOM 5584  H HA   . ARG A 1 70 ? 28.760  -13.422 -2.974  1.00 0.00 ? 70 ARG A HA   5  
ATOM 5585  H HB2  . ARG A 1 70 ? 31.557  -13.610 -1.860  1.00 0.00 ? 70 ARG A HB2  5  
ATOM 5586  H HB3  . ARG A 1 70 ? 30.914  -15.077 -2.590  1.00 0.00 ? 70 ARG A HB3  5  
ATOM 5587  H HG2  . ARG A 1 70 ? 30.551  -14.048 -4.707  1.00 0.00 ? 70 ARG A HG2  5  
ATOM 5588  H HG3  . ARG A 1 70 ? 30.858  -12.424 -4.072  1.00 0.00 ? 70 ARG A HG3  5  
ATOM 5589  H HD2  . ARG A 1 70 ? 33.208  -12.986 -3.616  1.00 0.00 ? 70 ARG A HD2  5  
ATOM 5590  H HD3  . ARG A 1 70 ? 32.916  -14.666 -4.082  1.00 0.00 ? 70 ARG A HD3  5  
ATOM 5591  H HE   . ARG A 1 70 ? 33.039  -14.166 -6.262  1.00 0.00 ? 70 ARG A HE   5  
ATOM 5592  H HH11 . ARG A 1 70 ? 32.859  -11.009 -4.536  1.00 0.00 ? 70 ARG A HH11 5  
ATOM 5593  H HH12 . ARG A 1 70 ? 33.237  -10.100 -5.955  1.00 0.00 ? 70 ARG A HH12 5  
ATOM 5594  H HH21 . ARG A 1 70 ? 33.498  -12.896 -8.118  1.00 0.00 ? 70 ARG A HH21 5  
ATOM 5595  H HH22 . ARG A 1 70 ? 33.687  -11.213 -8.035  1.00 0.00 ? 70 ARG A HH22 5  
ATOM 5596  N N    . GLY A 1 1  ? -25.700 -20.623 9.563   1.00 0.00 ? 1  GLY A N    6  
ATOM 5597  C CA   . GLY A 1 1  ? -24.430 -19.931 9.848   1.00 0.00 ? 1  GLY A CA   6  
ATOM 5598  C C    . GLY A 1 1  ? -23.344 -20.480 8.938   1.00 0.00 ? 1  GLY A C    6  
ATOM 5599  O O    . GLY A 1 1  ? -23.644 -21.342 8.114   1.00 0.00 ? 1  GLY A O    6  
ATOM 5600  H H1   . GLY A 1 1  ? -26.474 -20.334 10.127  1.00 0.00 ? 1  GLY A H1   6  
ATOM 5601  H HA2  . GLY A 1 1  ? -24.544 -18.861 9.675   1.00 0.00 ? 1  GLY A HA2  6  
ATOM 5602  H HA3  . GLY A 1 1  ? -24.142 -20.103 10.885  1.00 0.00 ? 1  GLY A HA3  6  
ATOM 5603  N N    . SER A 1 2  ? -22.110 -20.004 9.088   1.00 0.00 ? 2  SER A N    6  
ATOM 5604  C CA   . SER A 1 2  ? -20.934 -20.644 8.505   1.00 0.00 ? 2  SER A CA   6  
ATOM 5605  C C    . SER A 1 2  ? -20.293 -21.547 9.568   1.00 0.00 ? 2  SER A C    6  
ATOM 5606  O O    . SER A 1 2  ? -20.738 -21.555 10.716  1.00 0.00 ? 2  SER A O    6  
ATOM 5607  C CB   . SER A 1 2  ? -19.960 -19.563 8.016   1.00 0.00 ? 2  SER A CB   6  
ATOM 5608  O OG   . SER A 1 2  ? -20.570 -18.761 7.018   1.00 0.00 ? 2  SER A OG   6  
ATOM 5609  H H    . SER A 1 2  ? -21.897 -19.358 9.834   1.00 0.00 ? 2  SER A H    6  
ATOM 5610  H HA   . SER A 1 2  ? -21.228 -21.264 7.657   1.00 0.00 ? 2  SER A HA   6  
ATOM 5611  H HB2  . SER A 1 2  ? -19.658 -18.932 8.853   1.00 0.00 ? 2  SER A HB2  6  
ATOM 5612  H HB3  . SER A 1 2  ? -19.074 -20.039 7.602   1.00 0.00 ? 2  SER A HB3  6  
ATOM 5613  H HG   . SER A 1 2  ? -19.988 -18.769 6.227   1.00 0.00 ? 2  SER A HG   6  
ATOM 5614  N N    . SER A 1 3  ? -19.262 -22.301 9.191   1.00 0.00 ? 3  SER A N    6  
ATOM 5615  C CA   . SER A 1 3  ? -18.345 -22.976 10.097  1.00 0.00 ? 3  SER A CA   6  
ATOM 5616  C C    . SER A 1 3  ? -17.044 -23.193 9.318   1.00 0.00 ? 3  SER A C    6  
ATOM 5617  O O    . SER A 1 3  ? -17.040 -23.132 8.082   1.00 0.00 ? 3  SER A O    6  
ATOM 5618  C CB   . SER A 1 3  ? -18.965 -24.299 10.576  1.00 0.00 ? 3  SER A CB   6  
ATOM 5619  O OG   . SER A 1 3  ? -18.191 -24.882 11.605  1.00 0.00 ? 3  SER A OG   6  
ATOM 5620  H H    . SER A 1 3  ? -18.913 -22.275 8.241   1.00 0.00 ? 3  SER A H    6  
ATOM 5621  H HA   . SER A 1 3  ? -18.155 -22.335 10.959  1.00 0.00 ? 3  SER A HA   6  
ATOM 5622  H HB2  . SER A 1 3  ? -19.965 -24.108 10.965  1.00 0.00 ? 3  SER A HB2  6  
ATOM 5623  H HB3  . SER A 1 3  ? -19.040 -24.996 9.740   1.00 0.00 ? 3  SER A HB3  6  
ATOM 5624  H HG   . SER A 1 3  ? -18.673 -25.631 11.970  1.00 0.00 ? 3  SER A HG   6  
ATOM 5625  N N    . GLY A 1 4  ? -15.950 -23.474 10.020  1.00 0.00 ? 4  GLY A N    6  
ATOM 5626  C CA   . GLY A 1 4  ? -14.625 -23.672 9.464   1.00 0.00 ? 4  GLY A CA   6  
ATOM 5627  C C    . GLY A 1 4  ? -13.738 -22.512 9.883   1.00 0.00 ? 4  GLY A C    6  
ATOM 5628  O O    . GLY A 1 4  ? -13.302 -22.473 11.032  1.00 0.00 ? 4  GLY A O    6  
ATOM 5629  H H    . GLY A 1 4  ? -16.024 -23.472 11.035  1.00 0.00 ? 4  GLY A H    6  
ATOM 5630  H HA2  . GLY A 1 4  ? -14.206 -24.599 9.857   1.00 0.00 ? 4  GLY A HA2  6  
ATOM 5631  H HA3  . GLY A 1 4  ? -14.661 -23.741 8.377   1.00 0.00 ? 4  GLY A HA3  6  
ATOM 5632  N N    . SER A 1 5  ? -13.479 -21.573 8.972   1.00 0.00 ? 5  SER A N    6  
ATOM 5633  C CA   . SER A 1 5  ? -12.477 -20.536 9.169   1.00 0.00 ? 5  SER A CA   6  
ATOM 5634  C C    . SER A 1 5  ? -12.879 -19.241 8.470   1.00 0.00 ? 5  SER A C    6  
ATOM 5635  O O    . SER A 1 5  ? -13.614 -19.270 7.470   1.00 0.00 ? 5  SER A O    6  
ATOM 5636  C CB   . SER A 1 5  ? -11.158 -21.069 8.606   1.00 0.00 ? 5  SER A CB   6  
ATOM 5637  O OG   . SER A 1 5  ? -10.060 -20.264 8.963   1.00 0.00 ? 5  SER A OG   6  
ATOM 5638  H H    . SER A 1 5  ? -13.972 -21.578 8.091   1.00 0.00 ? 5  SER A H    6  
ATOM 5639  H HA   . SER A 1 5  ? -12.364 -20.344 10.237  1.00 0.00 ? 5  SER A HA   6  
ATOM 5640  H HB2  . SER A 1 5  ? -10.987 -22.070 9.004   1.00 0.00 ? 5  SER A HB2  6  
ATOM 5641  H HB3  . SER A 1 5  ? -11.220 -21.136 7.520   1.00 0.00 ? 5  SER A HB3  6  
ATOM 5642  H HG   . SER A 1 5  ? -9.405  -20.897 9.352   1.00 0.00 ? 5  SER A HG   6  
ATOM 5643  N N    . SER A 1 6  ? -12.336 -18.131 8.973   1.00 0.00 ? 6  SER A N    6  
ATOM 5644  C CA   . SER A 1 6  ? -12.551 -16.749 8.561   1.00 0.00 ? 6  SER A CA   6  
ATOM 5645  C C    . SER A 1 6  ? -14.028 -16.331 8.662   1.00 0.00 ? 6  SER A C    6  
ATOM 5646  O O    . SER A 1 6  ? -14.924 -17.149 8.884   1.00 0.00 ? 6  SER A O    6  
ATOM 5647  C CB   . SER A 1 6  ? -11.971 -16.531 7.156   1.00 0.00 ? 6  SER A CB   6  
ATOM 5648  O OG   . SER A 1 6  ? -10.670 -17.082 6.982   1.00 0.00 ? 6  SER A OG   6  
ATOM 5649  H H    . SER A 1 6  ? -11.792 -18.238 9.822   1.00 0.00 ? 6  SER A H    6  
ATOM 5650  H HA   . SER A 1 6  ? -11.986 -16.121 9.252   1.00 0.00 ? 6  SER A HA   6  
ATOM 5651  H HB2  . SER A 1 6  ? -12.641 -17.003 6.440   1.00 0.00 ? 6  SER A HB2  6  
ATOM 5652  H HB3  . SER A 1 6  ? -11.945 -15.463 6.945   1.00 0.00 ? 6  SER A HB3  6  
ATOM 5653  H HG   . SER A 1 6  ? -10.079 -16.736 7.690   1.00 0.00 ? 6  SER A HG   6  
ATOM 5654  N N    . GLY A 1 7  ? -14.310 -15.039 8.502   1.00 0.00 ? 7  GLY A N    6  
ATOM 5655  C CA   . GLY A 1 7  ? -15.656 -14.505 8.334   1.00 0.00 ? 7  GLY A CA   6  
ATOM 5656  C C    . GLY A 1 7  ? -15.720 -14.019 6.899   1.00 0.00 ? 7  GLY A C    6  
ATOM 5657  O O    . GLY A 1 7  ? -15.143 -12.976 6.587   1.00 0.00 ? 7  GLY A O    6  
ATOM 5658  H H    . GLY A 1 7  ? -13.553 -14.382 8.365   1.00 0.00 ? 7  GLY A H    6  
ATOM 5659  H HA2  . GLY A 1 7  ? -16.420 -15.264 8.512   1.00 0.00 ? 7  GLY A HA2  6  
ATOM 5660  H HA3  . GLY A 1 7  ? -15.820 -13.674 9.020   1.00 0.00 ? 7  GLY A HA3  6  
ATOM 5661  N N    . ARG A 1 8  ? -16.277 -14.832 6.000   1.00 0.00 ? 8  ARG A N    6  
ATOM 5662  C CA   . ARG A 1 8  ? -16.245 -14.565 4.563   1.00 0.00 ? 8  ARG A CA   6  
ATOM 5663  C C    . ARG A 1 8  ? -16.881 -13.200 4.279   1.00 0.00 ? 8  ARG A C    6  
ATOM 5664  O O    . ARG A 1 8  ? -17.792 -12.764 4.991   1.00 0.00 ? 8  ARG A O    6  
ATOM 5665  C CB   . ARG A 1 8  ? -17.020 -15.671 3.822   1.00 0.00 ? 8  ARG A CB   6  
ATOM 5666  C CG   . ARG A 1 8  ? -16.291 -16.426 2.704   1.00 0.00 ? 8  ARG A CG   6  
ATOM 5667  C CD   . ARG A 1 8  ? -15.682 -15.536 1.618   1.00 0.00 ? 8  ARG A CD   6  
ATOM 5668  N NE   . ARG A 1 8  ? -15.472 -16.284 0.366   1.00 0.00 ? 8  ARG A NE   6  
ATOM 5669  C CZ   . ARG A 1 8  ? -16.356 -16.385 -0.637  1.00 0.00 ? 8  ARG A CZ   6  
ATOM 5670  N NH1  . ARG A 1 8  ? -17.513 -15.736 -0.576  1.00 0.00 ? 8  ARG A NH1  6  
ATOM 5671  N NH2  . ARG A 1 8  ? -16.096 -17.144 -1.692  1.00 0.00 ? 8  ARG A NH2  6  
ATOM 5672  H H    . ARG A 1 8  ? -16.778 -15.642 6.332   1.00 0.00 ? 8  ARG A H    6  
ATOM 5673  H HA   . ARG A 1 8  ? -15.201 -14.551 4.244   1.00 0.00 ? 8  ARG A HA   6  
ATOM 5674  H HB2  . ARG A 1 8  ? -17.375 -16.416 4.536   1.00 0.00 ? 8  ARG A HB2  6  
ATOM 5675  H HB3  . ARG A 1 8  ? -17.902 -15.215 3.384   1.00 0.00 ? 8  ARG A HB3  6  
ATOM 5676  H HG2  . ARG A 1 8  ? -15.508 -17.052 3.132   1.00 0.00 ? 8  ARG A HG2  6  
ATOM 5677  H HG3  . ARG A 1 8  ? -17.027 -17.077 2.233   1.00 0.00 ? 8  ARG A HG3  6  
ATOM 5678  H HD2  . ARG A 1 8  ? -16.328 -14.678 1.431   1.00 0.00 ? 8  ARG A HD2  6  
ATOM 5679  H HD3  . ARG A 1 8  ? -14.721 -15.176 1.972   1.00 0.00 ? 8  ARG A HD3  6  
ATOM 5680  H HE   . ARG A 1 8  ? -14.581 -16.785 0.315   1.00 0.00 ? 8  ARG A HE   6  
ATOM 5681  H HH11 . ARG A 1 8  ? -17.733 -15.141 0.217   1.00 0.00 ? 8  ARG A HH11 6  
ATOM 5682  H HH12 . ARG A 1 8  ? -18.252 -15.794 -1.269  1.00 0.00 ? 8  ARG A HH12 6  
ATOM 5683  H HH21 . ARG A 1 8  ? -15.248 -17.709 -1.714  1.00 0.00 ? 8  ARG A HH21 6  
ATOM 5684  H HH22 . ARG A 1 8  ? -16.741 -17.218 -2.475  1.00 0.00 ? 8  ARG A HH22 6  
ATOM 5685  N N    . GLY A 1 9  ? -16.476 -12.551 3.193   1.00 0.00 ? 9  GLY A N    6  
ATOM 5686  C CA   . GLY A 1 9  ? -17.160 -11.358 2.746   1.00 0.00 ? 9  GLY A CA   6  
ATOM 5687  C C    . GLY A 1 9  ? -16.821 -11.041 1.310   1.00 0.00 ? 9  GLY A C    6  
ATOM 5688  O O    . GLY A 1 9  ? -17.352 -11.688 0.413   1.00 0.00 ? 9  GLY A O    6  
ATOM 5689  H H    . GLY A 1 9  ? -15.717 -12.899 2.619   1.00 0.00 ? 9  GLY A H    6  
ATOM 5690  H HA2  . GLY A 1 9  ? -18.231 -11.545 2.798   1.00 0.00 ? 9  GLY A HA2  6  
ATOM 5691  H HA3  . GLY A 1 9  ? -16.917 -10.518 3.392   1.00 0.00 ? 9  GLY A HA3  6  
ATOM 5692  N N    . ARG A 1 10 ? -15.967 -10.045 1.074   1.00 0.00 ? 10 ARG A N    6  
ATOM 5693  C CA   . ARG A 1 10 ? -15.794 -9.422  -0.236  1.00 0.00 ? 10 ARG A CA   6  
ATOM 5694  C C    . ARG A 1 10 ? -14.374 -8.902  -0.395  1.00 0.00 ? 10 ARG A C    6  
ATOM 5695  O O    . ARG A 1 10 ? -13.706 -8.680  0.612   1.00 0.00 ? 10 ARG A O    6  
ATOM 5696  C CB   . ARG A 1 10 ? -16.815 -8.278  -0.420  1.00 0.00 ? 10 ARG A CB   6  
ATOM 5697  C CG   . ARG A 1 10 ? -16.732 -7.097  0.576   1.00 0.00 ? 10 ARG A CG   6  
ATOM 5698  C CD   . ARG A 1 10 ? -17.341 -7.395  1.954   1.00 0.00 ? 10 ARG A CD   6  
ATOM 5699  N NE   . ARG A 1 10 ? -17.509 -6.179  2.767   1.00 0.00 ? 10 ARG A NE   6  
ATOM 5700  C CZ   . ARG A 1 10 ? -18.607 -5.798  3.436   1.00 0.00 ? 10 ARG A CZ   6  
ATOM 5701  N NH1  . ARG A 1 10 ? -19.747 -6.479  3.354   1.00 0.00 ? 10 ARG A NH1  6  
ATOM 5702  N NH2  . ARG A 1 10 ? -18.573 -4.711  4.194   1.00 0.00 ? 10 ARG A NH2  6  
ATOM 5703  H H    . ARG A 1 10 ? -15.413 -9.661  1.833   1.00 0.00 ? 10 ARG A H    6  
ATOM 5704  H HA   . ARG A 1 10 ? -15.974 -10.173 -1.009  1.00 0.00 ? 10 ARG A HA   6  
ATOM 5705  H HB2  . ARG A 1 10 ? -16.675 -7.872  -1.423  1.00 0.00 ? 10 ARG A HB2  6  
ATOM 5706  H HB3  . ARG A 1 10 ? -17.822 -8.696  -0.393  1.00 0.00 ? 10 ARG A HB3  6  
ATOM 5707  H HG2  . ARG A 1 10 ? -15.699 -6.773  0.699   1.00 0.00 ? 10 ARG A HG2  6  
ATOM 5708  H HG3  . ARG A 1 10 ? -17.286 -6.268  0.140   1.00 0.00 ? 10 ARG A HG3  6  
ATOM 5709  H HD2  . ARG A 1 10 ? -18.301 -7.876  1.803   1.00 0.00 ? 10 ARG A HD2  6  
ATOM 5710  H HD3  . ARG A 1 10 ? -16.693 -8.075  2.503   1.00 0.00 ? 10 ARG A HD3  6  
ATOM 5711  H HE   . ARG A 1 10 ? -16.659 -5.619  2.856   1.00 0.00 ? 10 ARG A HE   6  
ATOM 5712  H HH11 . ARG A 1 10 ? -19.819 -7.338  2.825   1.00 0.00 ? 10 ARG A HH11 6  
ATOM 5713  H HH12 . ARG A 1 10 ? -20.614 -6.092  3.731   1.00 0.00 ? 10 ARG A HH12 6  
ATOM 5714  H HH21 . ARG A 1 10 ? -17.726 -4.151  4.292   1.00 0.00 ? 10 ARG A HH21 6  
ATOM 5715  H HH22 . ARG A 1 10 ? -19.340 -4.517  4.835   1.00 0.00 ? 10 ARG A HH22 6  
ATOM 5716  N N    . TYR A 1 11 ? -13.969 -8.629  -1.636  1.00 0.00 ? 11 TYR A N    6  
ATOM 5717  C CA   . TYR A 1 11 ? -12.685 -8.060  -2.041  1.00 0.00 ? 11 TYR A CA   6  
ATOM 5718  C C    . TYR A 1 11 ? -11.540 -8.677  -1.231  1.00 0.00 ? 11 TYR A C    6  
ATOM 5719  O O    . TYR A 1 11 ? -10.882 -7.994  -0.446  1.00 0.00 ? 11 TYR A O    6  
ATOM 5720  C CB   . TYR A 1 11 ? -12.760 -6.528  -1.973  1.00 0.00 ? 11 TYR A CB   6  
ATOM 5721  C CG   . TYR A 1 11 ? -13.864 -5.933  -2.830  1.00 0.00 ? 11 TYR A CG   6  
ATOM 5722  C CD1  . TYR A 1 11 ? -13.734 -5.920  -4.231  1.00 0.00 ? 11 TYR A CD1  6  
ATOM 5723  C CD2  . TYR A 1 11 ? -15.022 -5.399  -2.233  1.00 0.00 ? 11 TYR A CD2  6  
ATOM 5724  C CE1  . TYR A 1 11 ? -14.752 -5.377  -5.036  1.00 0.00 ? 11 TYR A CE1  6  
ATOM 5725  C CE2  . TYR A 1 11 ? -16.048 -4.861  -3.030  1.00 0.00 ? 11 TYR A CE2  6  
ATOM 5726  C CZ   . TYR A 1 11 ? -15.914 -4.844  -4.436  1.00 0.00 ? 11 TYR A CZ   6  
ATOM 5727  O OH   . TYR A 1 11 ? -16.909 -4.312  -5.200  1.00 0.00 ? 11 TYR A OH   6  
ATOM 5728  H H    . TYR A 1 11 ? -14.589 -8.897  -2.391  1.00 0.00 ? 11 TYR A H    6  
ATOM 5729  H HA   . TYR A 1 11 ? -12.518 -8.321  -3.086  1.00 0.00 ? 11 TYR A HA   6  
ATOM 5730  H HB2  . TYR A 1 11 ? -12.910 -6.224  -0.937  1.00 0.00 ? 11 TYR A HB2  6  
ATOM 5731  H HB3  . TYR A 1 11 ? -11.805 -6.120  -2.306  1.00 0.00 ? 11 TYR A HB3  6  
ATOM 5732  H HD1  . TYR A 1 11 ? -12.838 -6.309  -4.693  1.00 0.00 ? 11 TYR A HD1  6  
ATOM 5733  H HD2  . TYR A 1 11 ? -15.115 -5.366  -1.158  1.00 0.00 ? 11 TYR A HD2  6  
ATOM 5734  H HE1  . TYR A 1 11 ? -14.626 -5.356  -6.109  1.00 0.00 ? 11 TYR A HE1  6  
ATOM 5735  H HE2  . TYR A 1 11 ? -16.921 -4.434  -2.561  1.00 0.00 ? 11 TYR A HE2  6  
ATOM 5736  H HH   . TYR A 1 11 ? -16.657 -4.280  -6.140  1.00 0.00 ? 11 TYR A HH   6  
ATOM 5737  N N    . ARG A 1 12 ? -11.378 -9.998  -1.363  1.00 0.00 ? 12 ARG A N    6  
ATOM 5738  C CA   . ARG A 1 12 ? -10.384 -10.775 -0.621  1.00 0.00 ? 12 ARG A CA   6  
ATOM 5739  C C    . ARG A 1 12 ? -8.968  -10.379 -1.031  1.00 0.00 ? 12 ARG A C    6  
ATOM 5740  O O    . ARG A 1 12 ? -8.704  -10.253 -2.227  1.00 0.00 ? 12 ARG A O    6  
ATOM 5741  C CB   . ARG A 1 12 ? -10.632 -12.280 -0.743  1.00 0.00 ? 12 ARG A CB   6  
ATOM 5742  C CG   . ARG A 1 12 ? -10.480 -12.759 -2.187  1.00 0.00 ? 12 ARG A CG   6  
ATOM 5743  C CD   . ARG A 1 12 ? -11.477 -13.868 -2.514  1.00 0.00 ? 12 ARG A CD   6  
ATOM 5744  N NE   . ARG A 1 12 ? -10.988 -15.185 -2.089  1.00 0.00 ? 12 ARG A NE   6  
ATOM 5745  C CZ   . ARG A 1 12 ? -11.596 -16.366 -2.248  1.00 0.00 ? 12 ARG A CZ   6  
ATOM 5746  N NH1  . ARG A 1 12 ? -12.813 -16.468 -2.764  1.00 0.00 ? 12 ARG A NH1  6  
ATOM 5747  N NH2  . ARG A 1 12 ? -10.951 -17.459 -1.867  1.00 0.00 ? 12 ARG A NH2  6  
ATOM 5748  H H    . ARG A 1 12 ? -11.907 -10.460 -2.092  1.00 0.00 ? 12 ARG A H    6  
ATOM 5749  H HA   . ARG A 1 12 ? -10.527 -10.566 0.417   1.00 0.00 ? 12 ARG A HA   6  
ATOM 5750  H HB2  . ARG A 1 12 ? -9.930  -12.821 -0.106  1.00 0.00 ? 12 ARG A HB2  6  
ATOM 5751  H HB3  . ARG A 1 12 ? -11.639 -12.479 -0.375  1.00 0.00 ? 12 ARG A HB3  6  
ATOM 5752  H HG2  . ARG A 1 12 ? -10.683 -11.921 -2.841  1.00 0.00 ? 12 ARG A HG2  6  
ATOM 5753  H HG3  . ARG A 1 12 ? -9.452  -13.073 -2.358  1.00 0.00 ? 12 ARG A HG3  6  
ATOM 5754  H HD2  . ARG A 1 12 ? -12.415 -13.632 -2.011  1.00 0.00 ? 12 ARG A HD2  6  
ATOM 5755  H HD3  . ARG A 1 12 ? -11.641 -13.878 -3.589  1.00 0.00 ? 12 ARG A HD3  6  
ATOM 5756  H HE   . ARG A 1 12 ? -10.049 -15.200 -1.703  1.00 0.00 ? 12 ARG A HE   6  
ATOM 5757  H HH11 . ARG A 1 12 ? -13.308 -15.626 -3.059  1.00 0.00 ? 12 ARG A HH11 6  
ATOM 5758  H HH12 . ARG A 1 12 ? -13.277 -17.368 -2.839  1.00 0.00 ? 12 ARG A HH12 6  
ATOM 5759  H HH21 . ARG A 1 12 ? -10.035 -17.331 -1.442  1.00 0.00 ? 12 ARG A HH21 6  
ATOM 5760  H HH22 . ARG A 1 12 ? -11.346 -18.391 -1.921  1.00 0.00 ? 12 ARG A HH22 6  
ATOM 5761  N N    . GLN A 1 13 ? -8.060  -10.259 -0.056  1.00 0.00 ? 13 GLN A N    6  
ATOM 5762  C CA   . GLN A 1 13 ? -6.688  -9.790  -0.249  1.00 0.00 ? 13 GLN A CA   6  
ATOM 5763  C C    . GLN A 1 13 ? -6.669  -8.454  -1.022  1.00 0.00 ? 13 GLN A C    6  
ATOM 5764  O O    . GLN A 1 13 ? -7.692  -7.776  -1.159  1.00 0.00 ? 13 GLN A O    6  
ATOM 5765  C CB   . GLN A 1 13 ? -5.829  -10.916 -0.877  1.00 0.00 ? 13 GLN A CB   6  
ATOM 5766  C CG   . GLN A 1 13 ? -5.148  -11.858 0.122   1.00 0.00 ? 13 GLN A CG   6  
ATOM 5767  C CD   . GLN A 1 13 ? -6.117  -12.685 0.961   1.00 0.00 ? 13 GLN A CD   6  
ATOM 5768  O OE1  . GLN A 1 13 ? -6.620  -13.732 0.565   1.00 0.00 ? 13 GLN A OE1  6  
ATOM 5769  N NE2  . GLN A 1 13 ? -6.342  -12.286 2.198   1.00 0.00 ? 13 GLN A NE2  6  
ATOM 5770  H H    . GLN A 1 13 ? -8.420  -10.210 0.890   1.00 0.00 ? 13 GLN A H    6  
ATOM 5771  H HA   . GLN A 1 13 ? -6.281  -9.564  0.736   1.00 0.00 ? 13 GLN A HA   6  
ATOM 5772  H HB2  . GLN A 1 13 ? -6.443  -11.513 -1.545  1.00 0.00 ? 13 GLN A HB2  6  
ATOM 5773  H HB3  . GLN A 1 13 ? -5.025  -10.484 -1.469  1.00 0.00 ? 13 GLN A HB3  6  
ATOM 5774  H HG2  . GLN A 1 13 ? -4.514  -12.543 -0.440  1.00 0.00 ? 13 GLN A HG2  6  
ATOM 5775  H HG3  . GLN A 1 13 ? -4.498  -11.271 0.773   1.00 0.00 ? 13 GLN A HG3  6  
ATOM 5776  H HE21 . GLN A 1 13 ? -5.976  -11.408 2.562   1.00 0.00 ? 13 GLN A HE21 6  
ATOM 5777  H HE22 . GLN A 1 13 ? -7.017  -12.796 2.764   1.00 0.00 ? 13 GLN A HE22 6  
ATOM 5778  N N    . TYR A 1 14 ? -5.491  -8.004  -1.443  1.00 0.00 ? 14 TYR A N    6  
ATOM 5779  C CA   . TYR A 1 14 ? -5.318  -6.858  -2.320  1.00 0.00 ? 14 TYR A CA   6  
ATOM 5780  C C    . TYR A 1 14 ? -4.269  -7.225  -3.372  1.00 0.00 ? 14 TYR A C    6  
ATOM 5781  O O    . TYR A 1 14 ? -3.570  -8.235  -3.218  1.00 0.00 ? 14 TYR A O    6  
ATOM 5782  C CB   . TYR A 1 14 ? -4.955  -5.615  -1.488  1.00 0.00 ? 14 TYR A CB   6  
ATOM 5783  C CG   . TYR A 1 14 ? -3.545  -5.596  -0.913  1.00 0.00 ? 14 TYR A CG   6  
ATOM 5784  C CD1  . TYR A 1 14 ? -2.489  -5.175  -1.732  1.00 0.00 ? 14 TYR A CD1  6  
ATOM 5785  C CD2  . TYR A 1 14 ? -3.271  -5.947  0.426   1.00 0.00 ? 14 TYR A CD2  6  
ATOM 5786  C CE1  . TYR A 1 14 ? -1.167  -5.185  -1.277  1.00 0.00 ? 14 TYR A CE1  6  
ATOM 5787  C CE2  . TYR A 1 14 ? -1.946  -5.935  0.905   1.00 0.00 ? 14 TYR A CE2  6  
ATOM 5788  C CZ   . TYR A 1 14 ? -0.882  -5.577  0.044   1.00 0.00 ? 14 TYR A CZ   6  
ATOM 5789  O OH   . TYR A 1 14 ? 0.411   -5.571  0.464   1.00 0.00 ? 14 TYR A OH   6  
ATOM 5790  H H    . TYR A 1 14 ? -4.664  -8.572  -1.337  1.00 0.00 ? 14 TYR A H    6  
ATOM 5791  H HA   . TYR A 1 14 ? -6.256  -6.656  -2.837  1.00 0.00 ? 14 TYR A HA   6  
ATOM 5792  H HB2  . TYR A 1 14 ? -5.075  -4.747  -2.136  1.00 0.00 ? 14 TYR A HB2  6  
ATOM 5793  H HB3  . TYR A 1 14 ? -5.679  -5.509  -0.679  1.00 0.00 ? 14 TYR A HB3  6  
ATOM 5794  H HD1  . TYR A 1 14 ? -2.682  -4.807  -2.721  1.00 0.00 ? 14 TYR A HD1  6  
ATOM 5795  H HD2  . TYR A 1 14 ? -4.072  -6.196  1.106   1.00 0.00 ? 14 TYR A HD2  6  
ATOM 5796  H HE1  . TYR A 1 14 ? -0.383  -4.862  -1.946  1.00 0.00 ? 14 TYR A HE1  6  
ATOM 5797  H HE2  . TYR A 1 14 ? -1.747  -6.199  1.931   1.00 0.00 ? 14 TYR A HE2  6  
ATOM 5798  H HH   . TYR A 1 14 ? 0.550   -6.003  1.326   1.00 0.00 ? 14 TYR A HH   6  
ATOM 5799  N N    . ASN A 1 15 ? -4.155  -6.421  -4.424  1.00 0.00 ? 15 ASN A N    6  
ATOM 5800  C CA   . ASN A 1 15 ? -3.143  -6.465  -5.477  1.00 0.00 ? 15 ASN A CA   6  
ATOM 5801  C C    . ASN A 1 15 ? -2.428  -5.123  -5.476  1.00 0.00 ? 15 ASN A C    6  
ATOM 5802  O O    . ASN A 1 15 ? -2.963  -4.150  -4.944  1.00 0.00 ? 15 ASN A O    6  
ATOM 5803  C CB   . ASN A 1 15 ? -3.772  -6.770  -6.845  1.00 0.00 ? 15 ASN A CB   6  
ATOM 5804  C CG   . ASN A 1 15 ? -4.589  -5.641  -7.451  1.00 0.00 ? 15 ASN A CG   6  
ATOM 5805  O OD1  . ASN A 1 15 ? -5.257  -4.917  -6.732  1.00 0.00 ? 15 ASN A OD1  6  
ATOM 5806  N ND2  . ASN A 1 15 ? -4.611  -5.483  -8.758  1.00 0.00 ? 15 ASN A ND2  6  
ATOM 5807  H H    . ASN A 1 15 ? -4.728  -5.587  -4.470  1.00 0.00 ? 15 ASN A H    6  
ATOM 5808  H HA   . ASN A 1 15 ? -2.424  -7.252  -5.247  1.00 0.00 ? 15 ASN A HA   6  
ATOM 5809  H HB2  . ASN A 1 15 ? -2.991  -7.062  -7.543  1.00 0.00 ? 15 ASN A HB2  6  
ATOM 5810  H HB3  . ASN A 1 15 ? -4.451  -7.596  -6.704  1.00 0.00 ? 15 ASN A HB3  6  
ATOM 5811  H HD21 . ASN A 1 15 ? -4.080  -6.047  -9.421  1.00 0.00 ? 15 ASN A HD21 6  
ATOM 5812  H HD22 . ASN A 1 15 ? -5.307  -4.838  -9.135  1.00 0.00 ? 15 ASN A HD22 6  
ATOM 5813  N N    . SER A 1 16 ? -1.218  -5.043  -6.022  1.00 0.00 ? 16 SER A N    6  
ATOM 5814  C CA   . SER A 1 16 ? -0.433  -3.816  -5.929  1.00 0.00 ? 16 SER A CA   6  
ATOM 5815  C C    . SER A 1 16 ? -1.107  -2.587  -6.559  1.00 0.00 ? 16 SER A C    6  
ATOM 5816  O O    . SER A 1 16 ? -0.689  -1.469  -6.273  1.00 0.00 ? 16 SER A O    6  
ATOM 5817  C CB   . SER A 1 16 ? 0.958   -4.057  -6.504  1.00 0.00 ? 16 SER A CB   6  
ATOM 5818  O OG   . SER A 1 16 ? 1.807   -4.502  -5.461  1.00 0.00 ? 16 SER A OG   6  
ATOM 5819  H H    . SER A 1 16 ? -0.823  -5.849  -6.495  1.00 0.00 ? 16 SER A H    6  
ATOM 5820  H HA   . SER A 1 16 ? -0.320  -3.592  -4.872  1.00 0.00 ? 16 SER A HA   6  
ATOM 5821  H HB2  . SER A 1 16 ? 0.900   -4.792  -7.298  1.00 0.00 ? 16 SER A HB2  6  
ATOM 5822  H HB3  . SER A 1 16 ? 1.363   -3.128  -6.905  1.00 0.00 ? 16 SER A HB3  6  
ATOM 5823  H HG   . SER A 1 16 ? 2.101   -3.656  -5.045  1.00 0.00 ? 16 SER A HG   6  
ATOM 5824  N N    . GLU A 1 17 ? -2.145  -2.757  -7.375  1.00 0.00 ? 17 GLU A N    6  
ATOM 5825  C CA   . GLU A 1 17 ? -2.957  -1.660  -7.883  1.00 0.00 ? 17 GLU A CA   6  
ATOM 5826  C C    . GLU A 1 17 ? -3.868  -1.143  -6.769  1.00 0.00 ? 17 GLU A C    6  
ATOM 5827  O O    . GLU A 1 17 ? -3.798  0.031   -6.435  1.00 0.00 ? 17 GLU A O    6  
ATOM 5828  C CB   . GLU A 1 17 ? -3.774  -2.120  -9.089  1.00 0.00 ? 17 GLU A CB   6  
ATOM 5829  C CG   . GLU A 1 17 ? -2.903  -2.822  -10.142 1.00 0.00 ? 17 GLU A CG   6  
ATOM 5830  C CD   . GLU A 1 17 ? -3.692  -3.272  -11.367 1.00 0.00 ? 17 GLU A CD   6  
ATOM 5831  O OE1  . GLU A 1 17 ? -4.857  -2.853  -11.560 1.00 0.00 ? 17 GLU A OE1  6  
ATOM 5832  O OE2  . GLU A 1 17 ? -3.147  -4.093  -12.131 1.00 0.00 ? 17 GLU A OE2  6  
ATOM 5833  H H    . GLU A 1 17 ? -2.462  -3.690  -7.587  1.00 0.00 ? 17 GLU A H    6  
ATOM 5834  H HA   . GLU A 1 17 ? -2.305  -0.845  -8.204  1.00 0.00 ? 17 GLU A HA   6  
ATOM 5835  H HB2  . GLU A 1 17 ? -4.546  -2.805  -8.749  1.00 0.00 ? 17 GLU A HB2  6  
ATOM 5836  H HB3  . GLU A 1 17 ? -4.252  -1.244  -9.531  1.00 0.00 ? 17 GLU A HB3  6  
ATOM 5837  H HG2  . GLU A 1 17 ? -2.099  -2.154  -10.447 1.00 0.00 ? 17 GLU A HG2  6  
ATOM 5838  H HG3  . GLU A 1 17 ? -2.447  -3.714  -9.706  1.00 0.00 ? 17 GLU A HG3  6  
ATOM 5839  N N    . ILE A 1 18 ? -4.672  -2.012  -6.139  1.00 0.00 ? 18 ILE A N    6  
ATOM 5840  C CA   . ILE A 1 18 ? -5.464  -1.679  -4.951  1.00 0.00 ? 18 ILE A CA   6  
ATOM 5841  C C    . ILE A 1 18 ? -4.579  -1.039  -3.876  1.00 0.00 ? 18 ILE A C    6  
ATOM 5842  O O    . ILE A 1 18 ? -5.026  -0.156  -3.145  1.00 0.00 ? 18 ILE A O    6  
ATOM 5843  C CB   . ILE A 1 18 ? -6.144  -2.964  -4.419  1.00 0.00 ? 18 ILE A CB   6  
ATOM 5844  C CG1  . ILE A 1 18 ? -7.322  -3.411  -5.305  1.00 0.00 ? 18 ILE A CG1  6  
ATOM 5845  C CG2  . ILE A 1 18 ? -6.629  -2.805  -2.974  1.00 0.00 ? 18 ILE A CG2  6  
ATOM 5846  C CD1  . ILE A 1 18 ? -8.653  -2.725  -5.002  1.00 0.00 ? 18 ILE A CD1  6  
ATOM 5847  H H    . ILE A 1 18 ? -4.651  -2.988  -6.416  1.00 0.00 ? 18 ILE A H    6  
ATOM 5848  H HA   . ILE A 1 18 ? -6.227  -0.951  -5.225  1.00 0.00 ? 18 ILE A HA   6  
ATOM 5849  H HB   . ILE A 1 18 ? -5.407  -3.773  -4.417  1.00 0.00 ? 18 ILE A HB   6  
ATOM 5850  H HG12 . ILE A 1 18 ? -7.086  -3.247  -6.354  1.00 0.00 ? 18 ILE A HG12 6  
ATOM 5851  H HG13 . ILE A 1 18 ? -7.450  -4.480  -5.157  1.00 0.00 ? 18 ILE A HG13 6  
ATOM 5852  H HG21 . ILE A 1 18 ? -5.782  -2.658  -2.320  1.00 0.00 ? 18 ILE A HG21 6  
ATOM 5853  H HG22 . ILE A 1 18 ? -7.263  -1.926  -2.907  1.00 0.00 ? 18 ILE A HG22 6  
ATOM 5854  H HG23 . ILE A 1 18 ? -7.170  -3.693  -2.658  1.00 0.00 ? 18 ILE A HG23 6  
ATOM 5855  H HD11 . ILE A 1 18 ? -9.014  -3.058  -4.028  1.00 0.00 ? 18 ILE A HD11 6  
ATOM 5856  H HD12 . ILE A 1 18 ? -8.520  -1.644  -5.003  1.00 0.00 ? 18 ILE A HD12 6  
ATOM 5857  H HD13 . ILE A 1 18 ? -9.376  -3.007  -5.760  1.00 0.00 ? 18 ILE A HD13 6  
ATOM 5858  N N    . LEU A 1 19 ? -3.346  -1.521  -3.731  1.00 0.00 ? 19 LEU A N    6  
ATOM 5859  C CA   . LEU A 1 19 ? -2.423  -0.947  -2.770  1.00 0.00 ? 19 LEU A CA   6  
ATOM 5860  C C    . LEU A 1 19 ? -2.093  0.501   -3.132  1.00 0.00 ? 19 LEU A C    6  
ATOM 5861  O O    . LEU A 1 19 ? -2.110  1.350   -2.247  1.00 0.00 ? 19 LEU A O    6  
ATOM 5862  C CB   . LEU A 1 19 ? -1.169  -1.821  -2.665  1.00 0.00 ? 19 LEU A CB   6  
ATOM 5863  C CG   . LEU A 1 19 ? -0.123  -1.265  -1.685  1.00 0.00 ? 19 LEU A CG   6  
ATOM 5864  C CD1  . LEU A 1 19 ? -0.702  -0.998  -0.289  1.00 0.00 ? 19 LEU A CD1  6  
ATOM 5865  C CD2  . LEU A 1 19 ? 1.008   -2.289  -1.543  1.00 0.00 ? 19 LEU A CD2  6  
ATOM 5866  H H    . LEU A 1 19 ? -3.085  -2.301  -4.324  1.00 0.00 ? 19 LEU A H    6  
ATOM 5867  H HA   . LEU A 1 19 ? -2.929  -0.942  -1.798  1.00 0.00 ? 19 LEU A HA   6  
ATOM 5868  H HB2  . LEU A 1 19 ? -1.487  -2.797  -2.323  1.00 0.00 ? 19 LEU A HB2  6  
ATOM 5869  H HB3  . LEU A 1 19 ? -0.710  -1.944  -3.649  1.00 0.00 ? 19 LEU A HB3  6  
ATOM 5870  H HG   . LEU A 1 19 ? 0.281   -0.337  -2.090  1.00 0.00 ? 19 LEU A HG   6  
ATOM 5871  H HD11 . LEU A 1 19 ? -1.248  -1.874  0.061   1.00 0.00 ? 19 LEU A HD11 6  
ATOM 5872  H HD12 . LEU A 1 19 ? 0.095   -0.753  0.410   1.00 0.00 ? 19 LEU A HD12 6  
ATOM 5873  H HD13 . LEU A 1 19 ? -1.376  -0.141  -0.327  1.00 0.00 ? 19 LEU A HD13 6  
ATOM 5874  H HD21 . LEU A 1 19 ? 0.677   -3.127  -0.932  1.00 0.00 ? 19 LEU A HD21 6  
ATOM 5875  H HD22 . LEU A 1 19 ? 1.301   -2.667  -2.522  1.00 0.00 ? 19 LEU A HD22 6  
ATOM 5876  H HD23 . LEU A 1 19 ? 1.874   -1.824  -1.078  1.00 0.00 ? 19 LEU A HD23 6  
ATOM 5877  N N    . GLU A 1 20 ? -1.798  0.792   -4.403  1.00 0.00 ? 20 GLU A N    6  
ATOM 5878  C CA   . GLU A 1 20 ? -1.553  2.159   -4.850  1.00 0.00 ? 20 GLU A CA   6  
ATOM 5879  C C    . GLU A 1 20 ? -2.764  3.034   -4.565  1.00 0.00 ? 20 GLU A C    6  
ATOM 5880  O O    . GLU A 1 20 ? -2.601  4.113   -4.009  1.00 0.00 ? 20 GLU A O    6  
ATOM 5881  C CB   . GLU A 1 20 ? -1.240  2.224   -6.354  1.00 0.00 ? 20 GLU A CB   6  
ATOM 5882  C CG   . GLU A 1 20 ? 0.195   1.845   -6.702  1.00 0.00 ? 20 GLU A CG   6  
ATOM 5883  C CD   . GLU A 1 20 ? 1.230   2.820   -6.158  1.00 0.00 ? 20 GLU A CD   6  
ATOM 5884  O OE1  . GLU A 1 20 ? 1.052   4.053   -6.300  1.00 0.00 ? 20 GLU A OE1  6  
ATOM 5885  O OE2  . GLU A 1 20 ? 2.249   2.311   -5.637  1.00 0.00 ? 20 GLU A OE2  6  
ATOM 5886  H H    . GLU A 1 20 ? -1.860  0.070   -5.110  1.00 0.00 ? 20 GLU A H    6  
ATOM 5887  H HA   . GLU A 1 20 ? -0.720  2.558   -4.268  1.00 0.00 ? 20 GLU A HA   6  
ATOM 5888  H HB2  . GLU A 1 20 ? -1.909  1.568   -6.903  1.00 0.00 ? 20 GLU A HB2  6  
ATOM 5889  H HB3  . GLU A 1 20 ? -1.422  3.236   -6.710  1.00 0.00 ? 20 GLU A HB3  6  
ATOM 5890  H HG2  . GLU A 1 20 ? 0.403   0.851   -6.309  1.00 0.00 ? 20 GLU A HG2  6  
ATOM 5891  H HG3  . GLU A 1 20 ? 0.293   1.815   -7.786  1.00 0.00 ? 20 GLU A HG3  6  
ATOM 5892  N N    . GLU A 1 21 ? -3.972  2.569   -4.888  1.00 0.00 ? 21 GLU A N    6  
ATOM 5893  C CA   . GLU A 1 21 ? -5.208  3.261   -4.593  1.00 0.00 ? 21 GLU A CA   6  
ATOM 5894  C C    . GLU A 1 21 ? -5.255  3.758   -3.158  1.00 0.00 ? 21 GLU A C    6  
ATOM 5895  O O    . GLU A 1 21 ? -5.409  4.959   -2.920  1.00 0.00 ? 21 GLU A O    6  
ATOM 5896  C CB   . GLU A 1 21 ? -6.381  2.362   -4.855  1.00 0.00 ? 21 GLU A CB   6  
ATOM 5897  C CG   . GLU A 1 21 ? -6.682  1.863   -6.257  1.00 0.00 ? 21 GLU A CG   6  
ATOM 5898  C CD   . GLU A 1 21 ? -7.225  2.962   -7.185  1.00 0.00 ? 21 GLU A CD   6  
ATOM 5899  O OE1  . GLU A 1 21 ? -7.026  4.169   -6.910  1.00 0.00 ? 21 GLU A OE1  6  
ATOM 5900  O OE2  . GLU A 1 21 ? -7.991  2.654   -8.122  1.00 0.00 ? 21 GLU A OE2  6  
ATOM 5901  H H    . GLU A 1 21 ? -4.065  1.672   -5.352  1.00 0.00 ? 21 GLU A H    6  
ATOM 5902  H HA   . GLU A 1 21 ? -5.390  4.106   -5.223  1.00 0.00 ? 21 GLU A HA   6  
ATOM 5903  H HB2  . GLU A 1 21 ? -6.360  1.506   -4.192  1.00 0.00 ? 21 GLU A HB2  6  
ATOM 5904  H HB3  . GLU A 1 21 ? -7.183  3.014   -4.579  1.00 0.00 ? 21 GLU A HB3  6  
ATOM 5905  H HG2  . GLU A 1 21 ? -5.819  1.360   -6.677  1.00 0.00 ? 21 GLU A HG2  6  
ATOM 5906  H HG3  . GLU A 1 21 ? -7.442  1.103   -6.098  1.00 0.00 ? 21 GLU A HG3  6  
ATOM 5907  N N    . ALA A 1 22 ? -5.132  2.808   -2.232  1.00 0.00 ? 22 ALA A N    6  
ATOM 5908  C CA   . ALA A 1 22 ? -5.254  2.991   -0.790  1.00 0.00 ? 22 ALA A CA   6  
ATOM 5909  C C    . ALA A 1 22 ? -4.137  3.842   -0.205  1.00 0.00 ? 22 ALA A C    6  
ATOM 5910  O O    . ALA A 1 22 ? -4.274  4.341   0.911   1.00 0.00 ? 22 ALA A O    6  
ATOM 5911  C CB   . ALA A 1 22 ? -5.221  1.615   -0.134  1.00 0.00 ? 22 ALA A CB   6  
ATOM 5912  H H    . ALA A 1 22 ? -4.992  1.874   -2.614  1.00 0.00 ? 22 ALA A H    6  
ATOM 5913  H HA   . ALA A 1 22 ? -6.201  3.493   -0.553  1.00 0.00 ? 22 ALA A HA   6  
ATOM 5914  H HB1  . ALA A 1 22 ? -5.795  0.923   -0.746  1.00 0.00 ? 22 ALA A HB1  6  
ATOM 5915  H HB2  . ALA A 1 22 ? -4.194  1.254   -0.073  1.00 0.00 ? 22 ALA A HB2  6  
ATOM 5916  H HB3  . ALA A 1 22 ? -5.655  1.688   0.863   1.00 0.00 ? 22 ALA A HB3  6  
ATOM 5917  N N    . ILE A 1 23 ? -3.048  4.016   -0.941  1.00 0.00 ? 23 ILE A N    6  
ATOM 5918  C CA   . ILE A 1 23 ? -1.991  4.944   -0.591  1.00 0.00 ? 23 ILE A CA   6  
ATOM 5919  C C    . ILE A 1 23 ? -2.404  6.323   -1.113  1.00 0.00 ? 23 ILE A C    6  
ATOM 5920  O O    . ILE A 1 23 ? -2.473  7.279   -0.341  1.00 0.00 ? 23 ILE A O    6  
ATOM 5921  C CB   . ILE A 1 23 ? -0.676  4.404   -1.172  1.00 0.00 ? 23 ILE A CB   6  
ATOM 5922  C CG1  . ILE A 1 23 ? -0.244  3.170   -0.355  1.00 0.00 ? 23 ILE A CG1  6  
ATOM 5923  C CG2  . ILE A 1 23 ? 0.445   5.449   -1.141  1.00 0.00 ? 23 ILE A CG2  6  
ATOM 5924  C CD1  . ILE A 1 23 ? 0.768   2.324   -1.121  1.00 0.00 ? 23 ILE A CD1  6  
ATOM 5925  H H    . ILE A 1 23 ? -3.008  3.548   -1.846  1.00 0.00 ? 23 ILE A H    6  
ATOM 5926  H HA   . ILE A 1 23 ? -1.889  4.994   0.493   1.00 0.00 ? 23 ILE A HA   6  
ATOM 5927  H HB   . ILE A 1 23 ? -0.865  4.100   -2.202  1.00 0.00 ? 23 ILE A HB   6  
ATOM 5928  H HG12 . ILE A 1 23 ? 0.192   3.482   0.593   1.00 0.00 ? 23 ILE A HG12 6  
ATOM 5929  H HG13 . ILE A 1 23 ? -1.108  2.543   -0.129  1.00 0.00 ? 23 ILE A HG13 6  
ATOM 5930  H HG21 . ILE A 1 23 ? 1.371   5.033   -1.533  1.00 0.00 ? 23 ILE A HG21 6  
ATOM 5931  H HG22 . ILE A 1 23 ? 0.176   6.294   -1.773  1.00 0.00 ? 23 ILE A HG22 6  
ATOM 5932  H HG23 . ILE A 1 23 ? 0.593   5.797   -0.123  1.00 0.00 ? 23 ILE A HG23 6  
ATOM 5933  H HD11 . ILE A 1 23 ? 0.837   1.359   -0.627  1.00 0.00 ? 23 ILE A HD11 6  
ATOM 5934  H HD12 . ILE A 1 23 ? 0.435   2.177   -2.148  1.00 0.00 ? 23 ILE A HD12 6  
ATOM 5935  H HD13 . ILE A 1 23 ? 1.743   2.809   -1.110  1.00 0.00 ? 23 ILE A HD13 6  
ATOM 5936  N N    . SER A 1 24 ? -2.727  6.424   -2.402  1.00 0.00 ? 24 SER A N    6  
ATOM 5937  C CA   . SER A 1 24 ? -3.079  7.647   -3.099  1.00 0.00 ? 24 SER A CA   6  
ATOM 5938  C C    . SER A 1 24 ? -4.304  8.351   -2.486  1.00 0.00 ? 24 SER A C    6  
ATOM 5939  O O    . SER A 1 24 ? -4.366  9.580   -2.535  1.00 0.00 ? 24 SER A O    6  
ATOM 5940  C CB   . SER A 1 24 ? -3.254  7.297   -4.585  1.00 0.00 ? 24 SER A CB   6  
ATOM 5941  O OG   . SER A 1 24 ? -2.017  6.824   -5.110  1.00 0.00 ? 24 SER A OG   6  
ATOM 5942  H H    . SER A 1 24 ? -2.673  5.602   -2.998  1.00 0.00 ? 24 SER A H    6  
ATOM 5943  H HA   . SER A 1 24 ? -2.236  8.335   -3.028  1.00 0.00 ? 24 SER A HA   6  
ATOM 5944  H HB2  . SER A 1 24 ? -4.015  6.523   -4.695  1.00 0.00 ? 24 SER A HB2  6  
ATOM 5945  H HB3  . SER A 1 24 ? -3.572  8.178   -5.136  1.00 0.00 ? 24 SER A HB3  6  
ATOM 5946  H HG   . SER A 1 24 ? -2.151  6.556   -6.032  1.00 0.00 ? 24 SER A HG   6  
ATOM 5947  N N    . VAL A 1 25 ? -5.258  7.636   -1.863  1.00 0.00 ? 25 VAL A N    6  
ATOM 5948  C CA   . VAL A 1 25 ? -6.325  8.261   -1.073  1.00 0.00 ? 25 VAL A CA   6  
ATOM 5949  C C    . VAL A 1 25 ? -5.686  9.079   0.053   1.00 0.00 ? 25 VAL A C    6  
ATOM 5950  O O    . VAL A 1 25 ? -5.849  10.293  0.108   1.00 0.00 ? 25 VAL A O    6  
ATOM 5951  C CB   . VAL A 1 25 ? -7.374  7.247   -0.532  1.00 0.00 ? 25 VAL A CB   6  
ATOM 5952  C CG1  . VAL A 1 25 ? -8.646  7.169   -1.373  1.00 0.00 ? 25 VAL A CG1  6  
ATOM 5953  C CG2  . VAL A 1 25 ? -6.873  5.855   -0.300  1.00 0.00 ? 25 VAL A CG2  6  
ATOM 5954  H H    . VAL A 1 25 ? -5.201  6.621   -1.882  1.00 0.00 ? 25 VAL A H    6  
ATOM 5955  H HA   . VAL A 1 25 ? -6.841  8.965   -1.723  1.00 0.00 ? 25 VAL A HA   6  
ATOM 5956  H HB   . VAL A 1 25 ? -7.673  7.498   0.468   1.00 0.00 ? 25 VAL A HB   6  
ATOM 5957  H HG11 . VAL A 1 25 ? -8.390  6.879   -2.390  1.00 0.00 ? 25 VAL A HG11 6  
ATOM 5958  H HG12 . VAL A 1 25 ? -9.339  6.452   -0.934  1.00 0.00 ? 25 VAL A HG12 6  
ATOM 5959  H HG13 . VAL A 1 25 ? -9.147  8.130   -1.389  1.00 0.00 ? 25 VAL A HG13 6  
ATOM 5960  H HG21 . VAL A 1 25 ? -6.992  5.286   -1.211  1.00 0.00 ? 25 VAL A HG21 6  
ATOM 5961  H HG22 . VAL A 1 25 ? -5.843  5.903   0.023   1.00 0.00 ? 25 VAL A HG22 6  
ATOM 5962  H HG23 . VAL A 1 25 ? -7.463  5.399   0.492   1.00 0.00 ? 25 VAL A HG23 6  
ATOM 5963  N N    . VAL A 1 26 ? -4.957  8.423   0.948   1.00 0.00 ? 26 VAL A N    6  
ATOM 5964  C CA   . VAL A 1 26 ? -4.304  9.005   2.113   1.00 0.00 ? 26 VAL A CA   6  
ATOM 5965  C C    . VAL A 1 26 ? -3.425  10.175  1.686   1.00 0.00 ? 26 VAL A C    6  
ATOM 5966  O O    . VAL A 1 26 ? -3.534  11.254  2.262   1.00 0.00 ? 26 VAL A O    6  
ATOM 5967  C CB   . VAL A 1 26 ? -3.518  7.918   2.882   1.00 0.00 ? 26 VAL A CB   6  
ATOM 5968  C CG1  . VAL A 1 26 ? -2.893  8.460   4.175   1.00 0.00 ? 26 VAL A CG1  6  
ATOM 5969  C CG2  . VAL A 1 26 ? -4.438  6.748   3.256   1.00 0.00 ? 26 VAL A CG2  6  
ATOM 5970  H H    . VAL A 1 26 ? -4.806  7.446   0.789   1.00 0.00 ? 26 VAL A H    6  
ATOM 5971  H HA   . VAL A 1 26 ? -5.079  9.401   2.762   1.00 0.00 ? 26 VAL A HA   6  
ATOM 5972  H HB   . VAL A 1 26 ? -2.716  7.535   2.251   1.00 0.00 ? 26 VAL A HB   6  
ATOM 5973  H HG11 . VAL A 1 26 ? -2.161  9.231   3.933   1.00 0.00 ? 26 VAL A HG11 6  
ATOM 5974  H HG12 . VAL A 1 26 ? -3.662  8.887   4.819   1.00 0.00 ? 26 VAL A HG12 6  
ATOM 5975  H HG13 . VAL A 1 26 ? -2.376  7.660   4.704   1.00 0.00 ? 26 VAL A HG13 6  
ATOM 5976  H HG21 . VAL A 1 26 ? -4.839  6.278   2.363   1.00 0.00 ? 26 VAL A HG21 6  
ATOM 5977  H HG22 . VAL A 1 26 ? -3.876  5.985   3.796   1.00 0.00 ? 26 VAL A HG22 6  
ATOM 5978  H HG23 . VAL A 1 26 ? -5.262  7.115   3.864   1.00 0.00 ? 26 VAL A HG23 6  
ATOM 5979  N N    . MET A 1 27 ? -2.611  9.996   0.646   1.00 0.00 ? 27 MET A N    6  
ATOM 5980  C CA   . MET A 1 27 ? -1.687  11.019  0.190   1.00 0.00 ? 27 MET A CA   6  
ATOM 5981  C C    . MET A 1 27 ? -2.400  12.266  -0.316  1.00 0.00 ? 27 MET A C    6  
ATOM 5982  O O    . MET A 1 27 ? -1.971  13.375  -0.001  1.00 0.00 ? 27 MET A O    6  
ATOM 5983  C CB   . MET A 1 27 ? -0.822  10.479  -0.935  1.00 0.00 ? 27 MET A CB   6  
ATOM 5984  C CG   . MET A 1 27 ? 0.208   9.524   -0.374  1.00 0.00 ? 27 MET A CG   6  
ATOM 5985  S SD   . MET A 1 27 ? 1.283   8.948   -1.680  1.00 0.00 ? 27 MET A SD   6  
ATOM 5986  C CE   . MET A 1 27 ? 2.459   8.149   -0.605  1.00 0.00 ? 27 MET A CE   6  
ATOM 5987  H H    . MET A 1 27 ? -2.579  9.079   0.207   1.00 0.00 ? 27 MET A H    6  
ATOM 5988  H HA   . MET A 1 27 ? -1.043  11.283  1.033   1.00 0.00 ? 27 MET A HA   6  
ATOM 5989  H HB2  . MET A 1 27 ? -1.439  9.971   -1.675  1.00 0.00 ? 27 MET A HB2  6  
ATOM 5990  H HB3  . MET A 1 27 ? -0.294  11.307  -1.412  1.00 0.00 ? 27 MET A HB3  6  
ATOM 5991  H HG2  . MET A 1 27 ? 0.805   10.041  0.378   1.00 0.00 ? 27 MET A HG2  6  
ATOM 5992  H HG3  . MET A 1 27 ? -0.283  8.668   0.090   1.00 0.00 ? 27 MET A HG3  6  
ATOM 5993  H HE1  . MET A 1 27 ? 1.944   7.538   0.128   1.00 0.00 ? 27 MET A HE1  6  
ATOM 5994  H HE2  . MET A 1 27 ? 3.092   7.534   -1.220  1.00 0.00 ? 27 MET A HE2  6  
ATOM 5995  H HE3  . MET A 1 27 ? 3.052   8.902   -0.101  1.00 0.00 ? 27 MET A HE3  6  
ATOM 5996  N N    . SER A 1 28 ? -3.474  12.110  -1.094  1.00 0.00 ? 28 SER A N    6  
ATOM 5997  C CA   . SER A 1 28 ? -4.302  13.235  -1.510  1.00 0.00 ? 28 SER A CA   6  
ATOM 5998  C C    . SER A 1 28 ? -5.141  13.795  -0.354  1.00 0.00 ? 28 SER A C    6  
ATOM 5999  O O    . SER A 1 28 ? -5.820  14.802  -0.554  1.00 0.00 ? 28 SER A O    6  
ATOM 6000  C CB   . SER A 1 28 ? -5.200  12.806  -2.672  1.00 0.00 ? 28 SER A CB   6  
ATOM 6001  O OG   . SER A 1 28 ? -4.423  12.543  -3.827  1.00 0.00 ? 28 SER A OG   6  
ATOM 6002  H H    . SER A 1 28 ? -3.788  11.179  -1.350  1.00 0.00 ? 28 SER A H    6  
ATOM 6003  H HA   . SER A 1 28 ? -3.654  14.040  -1.858  1.00 0.00 ? 28 SER A HA   6  
ATOM 6004  H HB2  . SER A 1 28 ? -5.749  11.911  -2.383  1.00 0.00 ? 28 SER A HB2  6  
ATOM 6005  H HB3  . SER A 1 28 ? -5.917  13.594  -2.904  1.00 0.00 ? 28 SER A HB3  6  
ATOM 6006  H HG   . SER A 1 28 ? -4.236  13.397  -4.270  1.00 0.00 ? 28 SER A HG   6  
ATOM 6007  N N    . GLY A 1 29 ? -5.119  13.192  0.840   1.00 0.00 ? 29 GLY A N    6  
ATOM 6008  C CA   . GLY A 1 29 ? -5.853  13.684  1.995   1.00 0.00 ? 29 GLY A CA   6  
ATOM 6009  C C    . GLY A 1 29 ? -7.286  13.174  2.022   1.00 0.00 ? 29 GLY A C    6  
ATOM 6010  O O    . GLY A 1 29 ? -8.137  13.749  2.705   1.00 0.00 ? 29 GLY A O    6  
ATOM 6011  H H    . GLY A 1 29 ? -4.554  12.360  0.996   1.00 0.00 ? 29 GLY A H    6  
ATOM 6012  H HA2  . GLY A 1 29 ? -5.342  13.351  2.898   1.00 0.00 ? 29 GLY A HA2  6  
ATOM 6013  H HA3  . GLY A 1 29 ? -5.872  14.773  1.977   1.00 0.00 ? 29 GLY A HA3  6  
ATOM 6014  N N    . LYS A 1 30 ? -7.599  12.113  1.268   1.00 0.00 ? 30 LYS A N    6  
ATOM 6015  C CA   . LYS A 1 30 ? -8.959  11.591  1.219   1.00 0.00 ? 30 LYS A CA   6  
ATOM 6016  C C    . LYS A 1 30 ? -9.328  11.030  2.590   1.00 0.00 ? 30 LYS A C    6  
ATOM 6017  O O    . LYS A 1 30 ? -10.492 11.128  2.985   1.00 0.00 ? 30 LYS A O    6  
ATOM 6018  C CB   . LYS A 1 30 ? -9.086  10.519  0.124   1.00 0.00 ? 30 LYS A CB   6  
ATOM 6019  C CG   . LYS A 1 30 ? -8.741  10.985  -1.308  1.00 0.00 ? 30 LYS A CG   6  
ATOM 6020  C CD   . LYS A 1 30 ? -9.429  12.254  -1.819  1.00 0.00 ? 30 LYS A CD   6  
ATOM 6021  C CE   . LYS A 1 30 ? -9.131  12.338  -3.327  1.00 0.00 ? 30 LYS A CE   6  
ATOM 6022  N NZ   . LYS A 1 30 ? -9.312  13.688  -3.895  1.00 0.00 ? 30 LYS A NZ   6  
ATOM 6023  H H    . LYS A 1 30 ? -6.849  11.575  0.825   1.00 0.00 ? 30 LYS A H    6  
ATOM 6024  H HA   . LYS A 1 30 ? -9.638  12.416  0.999   1.00 0.00 ? 30 LYS A HA   6  
ATOM 6025  H HB2  . LYS A 1 30 ? -8.420  9.701   0.385   1.00 0.00 ? 30 LYS A HB2  6  
ATOM 6026  H HB3  . LYS A 1 30 ? -10.087 10.090  0.131   1.00 0.00 ? 30 LYS A HB3  6  
ATOM 6027  H HG2  . LYS A 1 30 ? -7.670  11.151  -1.377  1.00 0.00 ? 30 LYS A HG2  6  
ATOM 6028  H HG3  . LYS A 1 30 ? -8.984  10.179  -1.997  1.00 0.00 ? 30 LYS A HG3  6  
ATOM 6029  H HD2  . LYS A 1 30 ? -10.505 12.199  -1.651  1.00 0.00 ? 30 LYS A HD2  6  
ATOM 6030  H HD3  . LYS A 1 30 ? -9.013  13.114  -1.290  1.00 0.00 ? 30 LYS A HD3  6  
ATOM 6031  H HE2  . LYS A 1 30 ? -8.093  12.038  -3.494  1.00 0.00 ? 30 LYS A HE2  6  
ATOM 6032  H HE3  . LYS A 1 30 ? -9.767  11.626  -3.858  1.00 0.00 ? 30 LYS A HE3  6  
ATOM 6033  H HZ1  . LYS A 1 30 ? -9.102  13.674  -4.889  1.00 0.00 ? 30 LYS A HZ1  6  
ATOM 6034  H HZ2  . LYS A 1 30 ? -10.258 14.045  -3.817  1.00 0.00 ? 30 LYS A HZ2  6  
ATOM 6035  H HZ3  . LYS A 1 30 ? -8.693  14.354  -3.438  1.00 0.00 ? 30 LYS A HZ3  6  
ATOM 6036  N N    . MET A 1 31 ? -8.373  10.442  3.314   1.00 0.00 ? 31 MET A N    6  
ATOM 6037  C CA   . MET A 1 31 ? -8.585  9.785   4.596   1.00 0.00 ? 31 MET A CA   6  
ATOM 6038  C C    . MET A 1 31 ? -7.249  9.559   5.315   1.00 0.00 ? 31 MET A C    6  
ATOM 6039  O O    . MET A 1 31 ? -6.202  9.895   4.769   1.00 0.00 ? 31 MET A O    6  
ATOM 6040  C CB   . MET A 1 31 ? -9.297  8.449   4.358   1.00 0.00 ? 31 MET A CB   6  
ATOM 6041  C CG   . MET A 1 31 ? -8.548  7.473   3.464   1.00 0.00 ? 31 MET A CG   6  
ATOM 6042  S SD   . MET A 1 31 ? -9.563  6.141   2.769   1.00 0.00 ? 31 MET A SD   6  
ATOM 6043  C CE   . MET A 1 31 ? -10.810 6.995   1.818   1.00 0.00 ? 31 MET A CE   6  
ATOM 6044  H H    . MET A 1 31 ? -7.410  10.450  3.002   1.00 0.00 ? 31 MET A H    6  
ATOM 6045  H HA   . MET A 1 31 ? -9.208  10.425  5.223   1.00 0.00 ? 31 MET A HA   6  
ATOM 6046  H HB2  . MET A 1 31 ? -9.444  7.992   5.320   1.00 0.00 ? 31 MET A HB2  6  
ATOM 6047  H HB3  . MET A 1 31 ? -10.270 8.596   3.920   1.00 0.00 ? 31 MET A HB3  6  
ATOM 6048  H HG2  . MET A 1 31 ? -8.068  8.001   2.642   1.00 0.00 ? 31 MET A HG2  6  
ATOM 6049  H HG3  . MET A 1 31 ? -7.781  7.019   4.085   1.00 0.00 ? 31 MET A HG3  6  
ATOM 6050  H HE1  . MET A 1 31 ? -11.496 7.482   2.506   1.00 0.00 ? 31 MET A HE1  6  
ATOM 6051  H HE2  . MET A 1 31 ? -10.333 7.720   1.164   1.00 0.00 ? 31 MET A HE2  6  
ATOM 6052  H HE3  . MET A 1 31 ? -11.348 6.249   1.235   1.00 0.00 ? 31 MET A HE3  6  
ATOM 6053  N N    . SER A 1 32 ? -7.287  8.965   6.511   1.00 0.00 ? 32 SER A N    6  
ATOM 6054  C CA   . SER A 1 32 ? -6.112  8.560   7.278   1.00 0.00 ? 32 SER A CA   6  
ATOM 6055  C C    . SER A 1 32 ? -5.647  7.173   6.831   1.00 0.00 ? 32 SER A C    6  
ATOM 6056  O O    . SER A 1 32 ? -6.375  6.491   6.100   1.00 0.00 ? 32 SER A O    6  
ATOM 6057  C CB   . SER A 1 32 ? -6.482  8.533   8.768   1.00 0.00 ? 32 SER A CB   6  
ATOM 6058  O OG   . SER A 1 32 ? -7.643  7.749   8.988   1.00 0.00 ? 32 SER A OG   6  
ATOM 6059  H H    . SER A 1 32 ? -8.166  8.625   6.875   1.00 0.00 ? 32 SER A H    6  
ATOM 6060  H HA   . SER A 1 32 ? -5.303  9.275   7.116   1.00 0.00 ? 32 SER A HA   6  
ATOM 6061  H HB2  . SER A 1 32 ? -5.654  8.128   9.348   1.00 0.00 ? 32 SER A HB2  6  
ATOM 6062  H HB3  . SER A 1 32 ? -6.678  9.544   9.120   1.00 0.00 ? 32 SER A HB3  6  
ATOM 6063  H HG   . SER A 1 32 ? -7.580  7.402   9.912   1.00 0.00 ? 32 SER A HG   6  
ATOM 6064  N N    . VAL A 1 33 ? -4.494  6.719   7.344   1.00 0.00 ? 33 VAL A N    6  
ATOM 6065  C CA   . VAL A 1 33 ? -4.066  5.336   7.183   1.00 0.00 ? 33 VAL A CA   6  
ATOM 6066  C C    . VAL A 1 33 ? -5.169  4.413   7.701   1.00 0.00 ? 33 VAL A C    6  
ATOM 6067  O O    . VAL A 1 33 ? -5.645  3.623   6.900   1.00 0.00 ? 33 VAL A O    6  
ATOM 6068  C CB   . VAL A 1 33 ? -2.673  5.058   7.800   1.00 0.00 ? 33 VAL A CB   6  
ATOM 6069  C CG1  . VAL A 1 33 ? -2.261  3.581   7.690   1.00 0.00 ? 33 VAL A CG1  6  
ATOM 6070  C CG2  . VAL A 1 33 ? -1.598  5.906   7.102   1.00 0.00 ? 33 VAL A CG2  6  
ATOM 6071  H H    . VAL A 1 33 ? -3.945  7.301   7.959   1.00 0.00 ? 33 VAL A H    6  
ATOM 6072  H HA   . VAL A 1 33 ? -3.984  5.153   6.111   1.00 0.00 ? 33 VAL A HA   6  
ATOM 6073  H HB   . VAL A 1 33 ? -2.670  5.314   8.854   1.00 0.00 ? 33 VAL A HB   6  
ATOM 6074  H HG11 . VAL A 1 33 ? -3.096  2.911   7.890   1.00 0.00 ? 33 VAL A HG11 6  
ATOM 6075  H HG12 . VAL A 1 33 ? -1.846  3.370   6.708   1.00 0.00 ? 33 VAL A HG12 6  
ATOM 6076  H HG13 . VAL A 1 33 ? -1.510  3.363   8.440   1.00 0.00 ? 33 VAL A HG13 6  
ATOM 6077  H HG21 . VAL A 1 33 ? -0.617  5.653   7.503   1.00 0.00 ? 33 VAL A HG21 6  
ATOM 6078  H HG22 . VAL A 1 33 ? -1.599  5.713   6.030   1.00 0.00 ? 33 VAL A HG22 6  
ATOM 6079  H HG23 . VAL A 1 33 ? -1.777  6.967   7.275   1.00 0.00 ? 33 VAL A HG23 6  
ATOM 6080  N N    . SER A 1 34 ? -5.610  4.479   8.969   1.00 0.00 ? 34 SER A N    6  
ATOM 6081  C CA   . SER A 1 34 ? -6.510  3.445   9.496   1.00 0.00 ? 34 SER A CA   6  
ATOM 6082  C C    . SER A 1 34 ? -7.813  3.352   8.711   1.00 0.00 ? 34 SER A C    6  
ATOM 6083  O O    . SER A 1 34 ? -8.333  2.256   8.510   1.00 0.00 ? 34 SER A O    6  
ATOM 6084  C CB   . SER A 1 34 ? -6.824  3.603   10.993  1.00 0.00 ? 34 SER A CB   6  
ATOM 6085  O OG   . SER A 1 34 ? -6.671  2.360   11.666  1.00 0.00 ? 34 SER A OG   6  
ATOM 6086  H H    . SER A 1 34 ? -5.209  5.160   9.608   1.00 0.00 ? 34 SER A H    6  
ATOM 6087  H HA   . SER A 1 34 ? -5.984  2.510   9.349   1.00 0.00 ? 34 SER A HA   6  
ATOM 6088  H HB2  . SER A 1 34 ? -6.159  4.337   11.447  1.00 0.00 ? 34 SER A HB2  6  
ATOM 6089  H HB3  . SER A 1 34 ? -7.850  3.951   11.120  1.00 0.00 ? 34 SER A HB3  6  
ATOM 6090  H HG   . SER A 1 34 ? -6.894  1.636   11.046  1.00 0.00 ? 34 SER A HG   6  
ATOM 6091  N N    . LYS A 1 35 ? -8.314  4.495   8.243   1.00 0.00 ? 35 LYS A N    6  
ATOM 6092  C CA   . LYS A 1 35 ? -9.474  4.547   7.381   1.00 0.00 ? 35 LYS A CA   6  
ATOM 6093  C C    . LYS A 1 35 ? -9.185  3.745   6.113   1.00 0.00 ? 35 LYS A C    6  
ATOM 6094  O O    . LYS A 1 35 ? -9.713  2.647   5.982   1.00 0.00 ? 35 LYS A O    6  
ATOM 6095  C CB   . LYS A 1 35 ? -9.856  6.005   7.180   1.00 0.00 ? 35 LYS A CB   6  
ATOM 6096  C CG   . LYS A 1 35 ? -11.067 6.150   6.252   1.00 0.00 ? 35 LYS A CG   6  
ATOM 6097  C CD   . LYS A 1 35 ? -11.942 7.321   6.679   1.00 0.00 ? 35 LYS A CD   6  
ATOM 6098  C CE   . LYS A 1 35 ? -12.886 7.736   5.544   1.00 0.00 ? 35 LYS A CE   6  
ATOM 6099  N NZ   . LYS A 1 35 ? -14.252 7.984   6.027   1.00 0.00 ? 35 LYS A NZ   6  
ATOM 6100  H H    . LYS A 1 35 ? -7.787  5.343   8.398   1.00 0.00 ? 35 LYS A H    6  
ATOM 6101  H HA   . LYS A 1 35 ? -10.311 4.074   7.894   1.00 0.00 ? 35 LYS A HA   6  
ATOM 6102  H HB2  . LYS A 1 35 ? -10.101 6.413   8.163   1.00 0.00 ? 35 LYS A HB2  6  
ATOM 6103  H HB3  . LYS A 1 35 ? -9.001  6.548   6.787   1.00 0.00 ? 35 LYS A HB3  6  
ATOM 6104  H HG2  . LYS A 1 35 ? -10.744 6.280   5.231   1.00 0.00 ? 35 LYS A HG2  6  
ATOM 6105  H HG3  . LYS A 1 35 ? -11.654 5.246   6.268   1.00 0.00 ? 35 LYS A HG3  6  
ATOM 6106  H HD2  . LYS A 1 35 ? -12.503 7.005   7.555   1.00 0.00 ? 35 LYS A HD2  6  
ATOM 6107  H HD3  . LYS A 1 35 ? -11.311 8.160   6.959   1.00 0.00 ? 35 LYS A HD3  6  
ATOM 6108  H HE2  . LYS A 1 35 ? -12.500 8.632   5.058   1.00 0.00 ? 35 LYS A HE2  6  
ATOM 6109  H HE3  . LYS A 1 35 ? -12.940 6.935   4.805   1.00 0.00 ? 35 LYS A HE3  6  
ATOM 6110  H HZ1  . LYS A 1 35 ? -14.264 8.684   6.762   1.00 0.00 ? 35 LYS A HZ1  6  
ATOM 6111  H HZ2  . LYS A 1 35 ? -14.837 8.280   5.250   1.00 0.00 ? 35 LYS A HZ2  6  
ATOM 6112  H HZ3  . LYS A 1 35 ? -14.640 7.115   6.383   1.00 0.00 ? 35 LYS A HZ3  6  
ATOM 6113  N N    . ALA A 1 36 ? -8.339  4.230   5.199   1.00 0.00 ? 36 ALA A N    6  
ATOM 6114  C CA   . ALA A 1 36 ? -8.037  3.524   3.958   1.00 0.00 ? 36 ALA A CA   6  
ATOM 6115  C C    . ALA A 1 36 ? -7.576  2.084   4.157   1.00 0.00 ? 36 ALA A C    6  
ATOM 6116  O O    . ALA A 1 36 ? -7.999  1.226   3.391   1.00 0.00 ? 36 ALA A O    6  
ATOM 6117  C CB   . ALA A 1 36 ? -6.928  4.266   3.198   1.00 0.00 ? 36 ALA A CB   6  
ATOM 6118  H H    . ALA A 1 36 ? -7.986  5.176   5.279   1.00 0.00 ? 36 ALA A H    6  
ATOM 6119  H HA   . ALA A 1 36 ? -8.979  3.471   3.389   1.00 0.00 ? 36 ALA A HA   6  
ATOM 6120  H HB1  . ALA A 1 36 ? -7.161  5.315   3.060   1.00 0.00 ? 36 ALA A HB1  6  
ATOM 6121  H HB2  . ALA A 1 36 ? -6.004  4.223   3.771   1.00 0.00 ? 36 ALA A HB2  6  
ATOM 6122  H HB3  . ALA A 1 36 ? -6.769  3.802   2.225   1.00 0.00 ? 36 ALA A HB3  6  
ATOM 6123  N N    . GLN A 1 37 ? -6.758  1.796   5.167   1.00 0.00 ? 37 GLN A N    6  
ATOM 6124  C CA   . GLN A 1 37 ? -6.410  0.455   5.593   1.00 0.00 ? 37 GLN A CA   6  
ATOM 6125  C C    . GLN A 1 37 ? -7.678  -0.377  5.613   1.00 0.00 ? 37 GLN A C    6  
ATOM 6126  O O    . GLN A 1 37 ? -7.740  -1.374  4.897   1.00 0.00 ? 37 GLN A O    6  
ATOM 6127  C CB   . GLN A 1 37 ? -5.691  0.515   6.955   1.00 0.00 ? 37 GLN A CB   6  
ATOM 6128  C CG   . GLN A 1 37 ? -5.820  -0.755  7.811   1.00 0.00 ? 37 GLN A CG   6  
ATOM 6129  C CD   . GLN A 1 37 ? -6.607  -0.614  9.112   1.00 0.00 ? 37 GLN A CD   6  
ATOM 6130  O OE1  . GLN A 1 37 ? -6.313  0.240   9.949   1.00 0.00 ? 37 GLN A OE1  6  
ATOM 6131  N NE2  . GLN A 1 37 ? -7.571  -1.493  9.316   1.00 0.00 ? 37 GLN A NE2  6  
ATOM 6132  H H    . GLN A 1 37 ? -6.399  2.542   5.746   1.00 0.00 ? 37 GLN A H    6  
ATOM 6133  H HA   . GLN A 1 37 ? -5.734  0.014   4.863   1.00 0.00 ? 37 GLN A HA   6  
ATOM 6134  H HB2  . GLN A 1 37 ? -4.635  0.725   6.754   1.00 0.00 ? 37 GLN A HB2  6  
ATOM 6135  H HB3  . GLN A 1 37 ? -6.104  1.328   7.536   1.00 0.00 ? 37 GLN A HB3  6  
ATOM 6136  H HG2  . GLN A 1 37 ? -6.280  -1.523  7.220   1.00 0.00 ? 37 GLN A HG2  6  
ATOM 6137  H HG3  . GLN A 1 37 ? -4.852  -1.137  8.052   1.00 0.00 ? 37 GLN A HG3  6  
ATOM 6138  H HE21 . GLN A 1 37 ? -7.733  -2.229  8.630   1.00 0.00 ? 37 GLN A HE21 6  
ATOM 6139  H HE22 . GLN A 1 37 ? -8.147  -1.462  10.156  1.00 0.00 ? 37 GLN A HE22 6  
ATOM 6140  N N    . SER A 1 38 ? -8.664  0.027   6.410   1.00 0.00 ? 38 SER A N    6  
ATOM 6141  C CA   . SER A 1 38 ? -9.838  -0.784  6.571   1.00 0.00 ? 38 SER A CA   6  
ATOM 6142  C C    . SER A 1 38 ? -10.669 -0.768  5.284   1.00 0.00 ? 38 SER A C    6  
ATOM 6143  O O    . SER A 1 38 ? -11.278 -1.779  4.959   1.00 0.00 ? 38 SER A O    6  
ATOM 6144  C CB   . SER A 1 38 ? -10.643 -0.290  7.770   1.00 0.00 ? 38 SER A CB   6  
ATOM 6145  O OG   . SER A 1 38 ? -11.659 -1.228  8.096   1.00 0.00 ? 38 SER A OG   6  
ATOM 6146  H H    . SER A 1 38 ? -8.619  0.920   6.897   1.00 0.00 ? 38 SER A H    6  
ATOM 6147  H HA   . SER A 1 38 ? -9.464  -1.788  6.785   1.00 0.00 ? 38 SER A HA   6  
ATOM 6148  H HB2  . SER A 1 38 ? -9.968  -0.179  8.620   1.00 0.00 ? 38 SER A HB2  6  
ATOM 6149  H HB3  . SER A 1 38 ? -11.085 0.682   7.542   1.00 0.00 ? 38 SER A HB3  6  
ATOM 6150  H HG   . SER A 1 38 ? -12.172 -1.419  7.292   1.00 0.00 ? 38 SER A HG   6  
ATOM 6151  N N    . ILE A 1 39 ? -10.734 0.349   4.551   1.00 0.00 ? 39 ILE A N    6  
ATOM 6152  C CA   . ILE A 1 39 ? -11.536 0.442   3.330   1.00 0.00 ? 39 ILE A CA   6  
ATOM 6153  C C    . ILE A 1 39 ? -11.032 -0.596  2.320   1.00 0.00 ? 39 ILE A C    6  
ATOM 6154  O O    . ILE A 1 39 ? -11.762 -1.501  1.906   1.00 0.00 ? 39 ILE A O    6  
ATOM 6155  C CB   . ILE A 1 39 ? -11.598 1.891   2.786   1.00 0.00 ? 39 ILE A CB   6  
ATOM 6156  C CG1  . ILE A 1 39 ? -12.291 2.770   3.848   1.00 0.00 ? 39 ILE A CG1  6  
ATOM 6157  C CG2  . ILE A 1 39 ? -12.352 1.934   1.445   1.00 0.00 ? 39 ILE A CG2  6  
ATOM 6158  C CD1  . ILE A 1 39 ? -12.653 4.176   3.400   1.00 0.00 ? 39 ILE A CD1  6  
ATOM 6159  H H    . ILE A 1 39 ? -10.235 1.168   4.887   1.00 0.00 ? 39 ILE A H    6  
ATOM 6160  H HA   . ILE A 1 39 ? -12.552 0.181   3.594   1.00 0.00 ? 39 ILE A HA   6  
ATOM 6161  H HB   . ILE A 1 39 ? -10.598 2.282   2.613   1.00 0.00 ? 39 ILE A HB   6  
ATOM 6162  H HG12 . ILE A 1 39 ? -13.185 2.279   4.198   1.00 0.00 ? 39 ILE A HG12 6  
ATOM 6163  H HG13 . ILE A 1 39 ? -11.649 2.875   4.709   1.00 0.00 ? 39 ILE A HG13 6  
ATOM 6164  H HG21 . ILE A 1 39 ? -12.360 2.944   1.036   1.00 0.00 ? 39 ILE A HG21 6  
ATOM 6165  H HG22 . ILE A 1 39 ? -11.850 1.304   0.717   1.00 0.00 ? 39 ILE A HG22 6  
ATOM 6166  H HG23 . ILE A 1 39 ? -13.372 1.576   1.564   1.00 0.00 ? 39 ILE A HG23 6  
ATOM 6167  H HD11 . ILE A 1 39 ? -13.494 4.139   2.710   1.00 0.00 ? 39 ILE A HD11 6  
ATOM 6168  H HD12 . ILE A 1 39 ? -12.925 4.762   4.275   1.00 0.00 ? 39 ILE A HD12 6  
ATOM 6169  H HD13 . ILE A 1 39 ? -11.791 4.614   2.916   1.00 0.00 ? 39 ILE A HD13 6  
ATOM 6170  N N    . TYR A 1 40 ? -9.766  -0.469  1.942   1.00 0.00 ? 40 TYR A N    6  
ATOM 6171  C CA   . TYR A 1 40 ? -9.099  -1.242  0.908   1.00 0.00 ? 40 TYR A CA   6  
ATOM 6172  C C    . TYR A 1 40 ? -8.675  -2.628  1.410   1.00 0.00 ? 40 TYR A C    6  
ATOM 6173  O O    . TYR A 1 40 ? -8.379  -3.520  0.611   1.00 0.00 ? 40 TYR A O    6  
ATOM 6174  C CB   . TYR A 1 40 ? -7.909  -0.401  0.443   1.00 0.00 ? 40 TYR A CB   6  
ATOM 6175  C CG   . TYR A 1 40 ? -8.314  0.836   -0.355  1.00 0.00 ? 40 TYR A CG   6  
ATOM 6176  C CD1  . TYR A 1 40 ? -8.677  2.036   0.293   1.00 0.00 ? 40 TYR A CD1  6  
ATOM 6177  C CD2  . TYR A 1 40 ? -8.237  0.825   -1.755  1.00 0.00 ? 40 TYR A CD2  6  
ATOM 6178  C CE1  . TYR A 1 40 ? -8.972  3.204   -0.433  1.00 0.00 ? 40 TYR A CE1  6  
ATOM 6179  C CE2  . TYR A 1 40 ? -8.531  1.981   -2.483  1.00 0.00 ? 40 TYR A CE2  6  
ATOM 6180  C CZ   . TYR A 1 40 ? -8.907  3.173   -1.842  1.00 0.00 ? 40 TYR A CZ   6  
ATOM 6181  O OH   . TYR A 1 40 ? -9.177  4.264   -2.605  1.00 0.00 ? 40 TYR A OH   6  
ATOM 6182  H H    . TYR A 1 40 ? -9.199  0.225   2.416   1.00 0.00 ? 40 TYR A H    6  
ATOM 6183  H HA   . TYR A 1 40 ? -9.782  -1.382  0.069   1.00 0.00 ? 40 TYR A HA   6  
ATOM 6184  H HB2  . TYR A 1 40 ? -7.349  -0.074  1.316   1.00 0.00 ? 40 TYR A HB2  6  
ATOM 6185  H HB3  . TYR A 1 40 ? -7.215  -1.021  -0.127  1.00 0.00 ? 40 TYR A HB3  6  
ATOM 6186  H HD1  . TYR A 1 40 ? -8.688  2.087   1.362   1.00 0.00 ? 40 TYR A HD1  6  
ATOM 6187  H HD2  . TYR A 1 40 ? -7.885  -0.037  -2.293  1.00 0.00 ? 40 TYR A HD2  6  
ATOM 6188  H HE1  . TYR A 1 40 ? -9.189  4.122   0.095   1.00 0.00 ? 40 TYR A HE1  6  
ATOM 6189  H HE2  . TYR A 1 40 ? -8.411  1.975   -3.547  1.00 0.00 ? 40 TYR A HE2  6  
ATOM 6190  H HH   . TYR A 1 40 ? -9.378  5.068   -2.116  1.00 0.00 ? 40 TYR A HH   6  
ATOM 6191  N N    . GLY A 1 41 ? -8.690  -2.838  2.726   1.00 0.00 ? 41 GLY A N    6  
ATOM 6192  C CA   . GLY A 1 41 ? -8.452  -4.111  3.385   1.00 0.00 ? 41 GLY A CA   6  
ATOM 6193  C C    . GLY A 1 41 ? -6.964  -4.430  3.489   1.00 0.00 ? 41 GLY A C    6  
ATOM 6194  O O    . GLY A 1 41 ? -6.579  -5.601  3.553   1.00 0.00 ? 41 GLY A O    6  
ATOM 6195  H H    . GLY A 1 41 ? -8.785  -2.032  3.333   1.00 0.00 ? 41 GLY A H    6  
ATOM 6196  H HA2  . GLY A 1 41 ? -8.862  -4.055  4.392   1.00 0.00 ? 41 GLY A HA2  6  
ATOM 6197  H HA3  . GLY A 1 41 ? -8.974  -4.901  2.855   1.00 0.00 ? 41 GLY A HA3  6  
ATOM 6198  N N    . ILE A 1 42 ? -6.127  -3.400  3.551   1.00 0.00 ? 42 ILE A N    6  
ATOM 6199  C CA   . ILE A 1 42 ? -4.674  -3.504  3.594   1.00 0.00 ? 42 ILE A CA   6  
ATOM 6200  C C    . ILE A 1 42 ? -4.296  -3.595  5.084   1.00 0.00 ? 42 ILE A C    6  
ATOM 6201  O O    . ILE A 1 42 ? -5.023  -3.055  5.919   1.00 0.00 ? 42 ILE A O    6  
ATOM 6202  C CB   . ILE A 1 42 ? -4.071  -2.224  2.953   1.00 0.00 ? 42 ILE A CB   6  
ATOM 6203  C CG1  . ILE A 1 42 ? -4.699  -1.781  1.617   1.00 0.00 ? 42 ILE A CG1  6  
ATOM 6204  C CG2  . ILE A 1 42 ? -2.549  -2.357  2.778   1.00 0.00 ? 42 ILE A CG2  6  
ATOM 6205  C CD1  . ILE A 1 42 ? -4.538  -2.752  0.458   1.00 0.00 ? 42 ILE A CD1  6  
ATOM 6206  H H    . ILE A 1 42 ? -6.545  -2.479  3.645   1.00 0.00 ? 42 ILE A H    6  
ATOM 6207  H HA   . ILE A 1 42 ? -4.339  -4.394  3.059   1.00 0.00 ? 42 ILE A HA   6  
ATOM 6208  H HB   . ILE A 1 42 ? -4.277  -1.387  3.618   1.00 0.00 ? 42 ILE A HB   6  
ATOM 6209  H HG12 . ILE A 1 42 ? -5.759  -1.603  1.755   1.00 0.00 ? 42 ILE A HG12 6  
ATOM 6210  H HG13 . ILE A 1 42 ? -4.276  -0.822  1.329   1.00 0.00 ? 42 ILE A HG13 6  
ATOM 6211  H HG21 . ILE A 1 42 ? -2.156  -1.481  2.262   1.00 0.00 ? 42 ILE A HG21 6  
ATOM 6212  H HG22 . ILE A 1 42 ? -2.065  -2.418  3.750   1.00 0.00 ? 42 ILE A HG22 6  
ATOM 6213  H HG23 . ILE A 1 42 ? -2.320  -3.258  2.202   1.00 0.00 ? 42 ILE A HG23 6  
ATOM 6214  H HD11 . ILE A 1 42 ? -3.486  -2.936  0.246   1.00 0.00 ? 42 ILE A HD11 6  
ATOM 6215  H HD12 . ILE A 1 42 ? -5.050  -3.683  0.692   1.00 0.00 ? 42 ILE A HD12 6  
ATOM 6216  H HD13 . ILE A 1 42 ? -4.990  -2.299  -0.417  1.00 0.00 ? 42 ILE A HD13 6  
ATOM 6217  N N    . PRO A 1 43 ? -3.202  -4.272  5.470   1.00 0.00 ? 43 PRO A N    6  
ATOM 6218  C CA   . PRO A 1 43 ? -2.683  -4.174  6.828   1.00 0.00 ? 43 PRO A CA   6  
ATOM 6219  C C    . PRO A 1 43 ? -2.241  -2.741  7.100   1.00 0.00 ? 43 PRO A C    6  
ATOM 6220  O O    . PRO A 1 43 ? -1.578  -2.140  6.254   1.00 0.00 ? 43 PRO A O    6  
ATOM 6221  C CB   . PRO A 1 43 ? -1.481  -5.122  6.896   1.00 0.00 ? 43 PRO A CB   6  
ATOM 6222  C CG   . PRO A 1 43 ? -1.680  -6.049  5.702   1.00 0.00 ? 43 PRO A CG   6  
ATOM 6223  C CD   . PRO A 1 43 ? -2.407  -5.191  4.679   1.00 0.00 ? 43 PRO A CD   6  
ATOM 6224  H HA   . PRO A 1 43 ? -3.461  -4.478  7.532   1.00 0.00 ? 43 PRO A HA   6  
ATOM 6225  H HB2  . PRO A 1 43 ? -0.550  -4.571  6.779   1.00 0.00 ? 43 PRO A HB2  6  
ATOM 6226  H HB3  . PRO A 1 43 ? -1.467  -5.676  7.831   1.00 0.00 ? 43 PRO A HB3  6  
ATOM 6227  H HG2  . PRO A 1 43 ? -0.748  -6.428  5.295   1.00 0.00 ? 43 PRO A HG2  6  
ATOM 6228  H HG3  . PRO A 1 43 ? -2.316  -6.866  6.015   1.00 0.00 ? 43 PRO A HG3  6  
ATOM 6229  H HD2  . PRO A 1 43 ? -1.679  -4.645  4.084   1.00 0.00 ? 43 PRO A HD2  6  
ATOM 6230  H HD3  . PRO A 1 43 ? -3.025  -5.816  4.036   1.00 0.00 ? 43 PRO A HD3  6  
ATOM 6231  N N    . HIS A 1 44 ? -2.525  -2.213  8.286   1.00 0.00 ? 44 HIS A N    6  
ATOM 6232  C CA   . HIS A 1 44 ? -2.095  -0.884  8.703   1.00 0.00 ? 44 HIS A CA   6  
ATOM 6233  C C    . HIS A 1 44 ? -0.568  -0.820  8.682   1.00 0.00 ? 44 HIS A C    6  
ATOM 6234  O O    . HIS A 1 44 ? -0.010  0.090   8.078   1.00 0.00 ? 44 HIS A O    6  
ATOM 6235  C CB   . HIS A 1 44 ? -2.660  -0.582  10.093  1.00 0.00 ? 44 HIS A CB   6  
ATOM 6236  C CG   . HIS A 1 44 ? -2.704  0.874   10.464  1.00 0.00 ? 44 HIS A CG   6  
ATOM 6237  N ND1  . HIS A 1 44 ? -3.853  1.610   10.607  1.00 0.00 ? 44 HIS A ND1  6  
ATOM 6238  C CD2  . HIS A 1 44 ? -1.652  1.662   10.848  1.00 0.00 ? 44 HIS A CD2  6  
ATOM 6239  C CE1  . HIS A 1 44 ? -3.498  2.829   11.044  1.00 0.00 ? 44 HIS A CE1  6  
ATOM 6240  N NE2  . HIS A 1 44 ? -2.171  2.907   11.223  1.00 0.00 ? 44 HIS A NE2  6  
ATOM 6241  H H    . HIS A 1 44 ? -3.082  -2.762  8.932   1.00 0.00 ? 44 HIS A H    6  
ATOM 6242  H HA   . HIS A 1 44 ? -2.491  -0.155  7.994   1.00 0.00 ? 44 HIS A HA   6  
ATOM 6243  H HB2  . HIS A 1 44 ? -3.676  -0.971  10.160  1.00 0.00 ? 44 HIS A HB2  6  
ATOM 6244  H HB3  . HIS A 1 44 ? -2.061  -1.099  10.831  1.00 0.00 ? 44 HIS A HB3  6  
ATOM 6245  H HD1  . HIS A 1 44 ? -4.804  1.274   10.442  1.00 0.00 ? 44 HIS A HD1  6  
ATOM 6246  H HD2  . HIS A 1 44 ? -0.617  1.361   10.889  1.00 0.00 ? 44 HIS A HD2  6  
ATOM 6247  H HE1  . HIS A 1 44 ? -4.183  3.635   11.259  1.00 0.00 ? 44 HIS A HE1  6  
ATOM 6248  N N    . SER A 1 45 ? 0.113   -1.811  9.266   1.00 0.00 ? 45 SER A N    6  
ATOM 6249  C CA   . SER A 1 45 ? 1.567   -1.908  9.238   1.00 0.00 ? 45 SER A CA   6  
ATOM 6250  C C    . SER A 1 45 ? 2.145   -2.162  7.836   1.00 0.00 ? 45 SER A C    6  
ATOM 6251  O O    . SER A 1 45 ? 3.356   -2.007  7.671   1.00 0.00 ? 45 SER A O    6  
ATOM 6252  C CB   . SER A 1 45 ? 2.025   -2.989  10.229  1.00 0.00 ? 45 SER A CB   6  
ATOM 6253  O OG   . SER A 1 45 ? 2.099   -2.447  11.535  1.00 0.00 ? 45 SER A OG   6  
ATOM 6254  H H    . SER A 1 45 ? -0.399  -2.497  9.815   1.00 0.00 ? 45 SER A H    6  
ATOM 6255  H HA   . SER A 1 45 ? 1.974   -0.950  9.568   1.00 0.00 ? 45 SER A HA   6  
ATOM 6256  H HB2  . SER A 1 45 ? 1.340   -3.839  10.206  1.00 0.00 ? 45 SER A HB2  6  
ATOM 6257  H HB3  . SER A 1 45 ? 3.022   -3.336  9.955   1.00 0.00 ? 45 SER A HB3  6  
ATOM 6258  H HG   . SER A 1 45 ? 2.944   -1.947  11.554  1.00 0.00 ? 45 SER A HG   6  
ATOM 6259  N N    . THR A 1 46 ? 1.366   -2.555  6.821   1.00 0.00 ? 46 THR A N    6  
ATOM 6260  C CA   . THR A 1 46 ? 1.825   -2.427  5.441   1.00 0.00 ? 46 THR A CA   6  
ATOM 6261  C C    . THR A 1 46 ? 1.591   -0.983  4.978   1.00 0.00 ? 46 THR A C    6  
ATOM 6262  O O    . THR A 1 46 ? 2.532   -0.327  4.537   1.00 0.00 ? 46 THR A O    6  
ATOM 6263  C CB   . THR A 1 46 ? 1.111   -3.454  4.543   1.00 0.00 ? 46 THR A CB   6  
ATOM 6264  O OG1  . THR A 1 46 ? 1.334   -4.788  4.977   1.00 0.00 ? 46 THR A OG1  6  
ATOM 6265  C CG2  . THR A 1 46 ? 1.543   -3.347  3.080   1.00 0.00 ? 46 THR A CG2  6  
ATOM 6266  H H    . THR A 1 46 ? 0.380   -2.759  6.951   1.00 0.00 ? 46 THR A H    6  
ATOM 6267  H HA   . THR A 1 46 ? 2.901   -2.607  5.399   1.00 0.00 ? 46 THR A HA   6  
ATOM 6268  H HB   . THR A 1 46 ? 0.039   -3.268  4.591   1.00 0.00 ? 46 THR A HB   6  
ATOM 6269  H HG1  . THR A 1 46 ? 2.285   -4.989  4.996   1.00 0.00 ? 46 THR A HG1  6  
ATOM 6270  H HG21 . THR A 1 46 ? 0.985   -4.064  2.484   1.00 0.00 ? 46 THR A HG21 6  
ATOM 6271  H HG22 . THR A 1 46 ? 1.309   -2.356  2.694   1.00 0.00 ? 46 THR A HG22 6  
ATOM 6272  H HG23 . THR A 1 46 ? 2.613   -3.537  2.980   1.00 0.00 ? 46 THR A HG23 6  
ATOM 6273  N N    . LEU A 1 47 ? 0.349   -0.498  5.040   1.00 0.00 ? 47 LEU A N    6  
ATOM 6274  C CA   . LEU A 1 47 ? -0.088  0.766   4.474   1.00 0.00 ? 47 LEU A CA   6  
ATOM 6275  C C    . LEU A 1 47 ? 0.767   1.922   4.973   1.00 0.00 ? 47 LEU A C    6  
ATOM 6276  O O    . LEU A 1 47 ? 1.195   2.709   4.144   1.00 0.00 ? 47 LEU A O    6  
ATOM 6277  C CB   . LEU A 1 47 ? -1.575  1.004   4.784   1.00 0.00 ? 47 LEU A CB   6  
ATOM 6278  C CG   . LEU A 1 47 ? -2.141  2.249   4.066   1.00 0.00 ? 47 LEU A CG   6  
ATOM 6279  C CD1  . LEU A 1 47 ? -2.225  2.058   2.555   1.00 0.00 ? 47 LEU A CD1  6  
ATOM 6280  C CD2  . LEU A 1 47 ? -3.581  2.518   4.495   1.00 0.00 ? 47 LEU A CD2  6  
ATOM 6281  H H    . LEU A 1 47 ? -0.373  -1.080  5.433   1.00 0.00 ? 47 LEU A H    6  
ATOM 6282  H HA   . LEU A 1 47 ? 0.040   0.693   3.395   1.00 0.00 ? 47 LEU A HA   6  
ATOM 6283  H HB2  . LEU A 1 47 ? -2.150  0.127   4.489   1.00 0.00 ? 47 LEU A HB2  6  
ATOM 6284  H HB3  . LEU A 1 47 ? -1.680  1.128   5.863   1.00 0.00 ? 47 LEU A HB3  6  
ATOM 6285  H HG   . LEU A 1 47 ? -1.537  3.133   4.293   1.00 0.00 ? 47 LEU A HG   6  
ATOM 6286  H HD11 . LEU A 1 47 ? -2.894  1.227   2.325   1.00 0.00 ? 47 LEU A HD11 6  
ATOM 6287  H HD12 . LEU A 1 47 ? -2.631  2.969   2.117   1.00 0.00 ? 47 LEU A HD12 6  
ATOM 6288  H HD13 . LEU A 1 47 ? -1.242  1.880   2.130   1.00 0.00 ? 47 LEU A HD13 6  
ATOM 6289  H HD21 . LEU A 1 47 ? -4.229  1.724   4.129   1.00 0.00 ? 47 LEU A HD21 6  
ATOM 6290  H HD22 . LEU A 1 47 ? -3.657  2.573   5.574   1.00 0.00 ? 47 LEU A HD22 6  
ATOM 6291  H HD23 . LEU A 1 47 ? -3.902  3.465   4.061   1.00 0.00 ? 47 LEU A HD23 6  
ATOM 6292  N N    . GLU A 1 48 ? 1.043   2.002   6.279   1.00 0.00 ? 48 GLU A N    6  
ATOM 6293  C CA   . GLU A 1 48 ? 1.938   2.984   6.890   1.00 0.00 ? 48 GLU A CA   6  
ATOM 6294  C C    . GLU A 1 48 ? 3.225   3.046   6.072   1.00 0.00 ? 48 GLU A C    6  
ATOM 6295  O O    . GLU A 1 48 ? 3.462   4.022   5.363   1.00 0.00 ? 48 GLU A O    6  
ATOM 6296  C CB   . GLU A 1 48 ? 2.260   2.588   8.348   1.00 0.00 ? 48 GLU A CB   6  
ATOM 6297  C CG   . GLU A 1 48 ? 1.338   3.261   9.366   1.00 0.00 ? 48 GLU A CG   6  
ATOM 6298  C CD   . GLU A 1 48 ? 2.041   4.387   10.112  1.00 0.00 ? 48 GLU A CD   6  
ATOM 6299  O OE1  . GLU A 1 48 ? 2.044   5.530   9.594   1.00 0.00 ? 48 GLU A OE1  6  
ATOM 6300  O OE2  . GLU A 1 48 ? 2.636   4.098   11.176  1.00 0.00 ? 48 GLU A OE2  6  
ATOM 6301  H H    . GLU A 1 48 ? 0.644   1.303   6.899   1.00 0.00 ? 48 GLU A H    6  
ATOM 6302  H HA   . GLU A 1 48 ? 1.453   3.967   6.876   1.00 0.00 ? 48 GLU A HA   6  
ATOM 6303  H HB2  . GLU A 1 48 ? 2.199   1.503   8.457   1.00 0.00 ? 48 GLU A HB2  6  
ATOM 6304  H HB3  . GLU A 1 48 ? 3.287   2.867   8.587   1.00 0.00 ? 48 GLU A HB3  6  
ATOM 6305  H HG2  . GLU A 1 48 ? 0.484   3.683   8.856   1.00 0.00 ? 48 GLU A HG2  6  
ATOM 6306  H HG3  . GLU A 1 48 ? 1.000   2.516   10.082  1.00 0.00 ? 48 GLU A HG3  6  
ATOM 6307  N N    . TYR A 1 49 ? 4.024   1.977   6.143   1.00 0.00 ? 49 TYR A N    6  
ATOM 6308  C CA   . TYR A 1 49 ? 5.301   1.842   5.453   1.00 0.00 ? 49 TYR A CA   6  
ATOM 6309  C C    . TYR A 1 49 ? 5.163   2.288   4.003   1.00 0.00 ? 49 TYR A C    6  
ATOM 6310  O O    . TYR A 1 49 ? 5.933   3.111   3.525   1.00 0.00 ? 49 TYR A O    6  
ATOM 6311  C CB   . TYR A 1 49 ? 5.751   0.370   5.529   1.00 0.00 ? 49 TYR A CB   6  
ATOM 6312  C CG   . TYR A 1 49 ? 6.838   -0.012  4.544   1.00 0.00 ? 49 TYR A CG   6  
ATOM 6313  C CD1  . TYR A 1 49 ? 8.200   0.148   4.851   1.00 0.00 ? 49 TYR A CD1  6  
ATOM 6314  C CD2  . TYR A 1 49 ? 6.463   -0.511  3.285   1.00 0.00 ? 49 TYR A CD2  6  
ATOM 6315  C CE1  . TYR A 1 49 ? 9.178   -0.195  3.899   1.00 0.00 ? 49 TYR A CE1  6  
ATOM 6316  C CE2  . TYR A 1 49 ? 7.433   -0.859  2.330   1.00 0.00 ? 49 TYR A CE2  6  
ATOM 6317  C CZ   . TYR A 1 49 ? 8.801   -0.697  2.632   1.00 0.00 ? 49 TYR A CZ   6  
ATOM 6318  O OH   . TYR A 1 49 ? 9.732   -1.025  1.695   1.00 0.00 ? 49 TYR A OH   6  
ATOM 6319  H H    . TYR A 1 49 ? 3.699   1.192   6.690   1.00 0.00 ? 49 TYR A H    6  
ATOM 6320  H HA   . TYR A 1 49 ? 6.045   2.486   5.931   1.00 0.00 ? 49 TYR A HA   6  
ATOM 6321  H HB2  . TYR A 1 49 ? 6.064   0.126   6.537   1.00 0.00 ? 49 TYR A HB2  6  
ATOM 6322  H HB3  . TYR A 1 49 ? 4.897   -0.276  5.333   1.00 0.00 ? 49 TYR A HB3  6  
ATOM 6323  H HD1  . TYR A 1 49 ? 8.504   0.563   5.804   1.00 0.00 ? 49 TYR A HD1  6  
ATOM 6324  H HD2  . TYR A 1 49 ? 5.412   -0.577  3.055   1.00 0.00 ? 49 TYR A HD2  6  
ATOM 6325  H HE1  . TYR A 1 49 ? 10.219  -0.042  4.140   1.00 0.00 ? 49 TYR A HE1  6  
ATOM 6326  H HE2  . TYR A 1 49 ? 7.138   -1.216  1.355   1.00 0.00 ? 49 TYR A HE2  6  
ATOM 6327  H HH   . TYR A 1 49 ? 10.609  -0.661  1.951   1.00 0.00 ? 49 TYR A HH   6  
ATOM 6328  N N    . LYS A 1 50 ? 4.178   1.749   3.290   1.00 0.00 ? 50 LYS A N    6  
ATOM 6329  C CA   . LYS A 1 50 ? 4.030   1.954   1.869   1.00 0.00 ? 50 LYS A CA   6  
ATOM 6330  C C    . LYS A 1 50 ? 3.710   3.415   1.552   1.00 0.00 ? 50 LYS A C    6  
ATOM 6331  O O    . LYS A 1 50 ? 4.280   3.924   0.593   1.00 0.00 ? 50 LYS A O    6  
ATOM 6332  C CB   . LYS A 1 50 ? 2.939   0.995   1.395   1.00 0.00 ? 50 LYS A CB   6  
ATOM 6333  C CG   . LYS A 1 50 ? 3.288   -0.492  1.374   1.00 0.00 ? 50 LYS A CG   6  
ATOM 6334  C CD   . LYS A 1 50 ? 4.430   -0.846  0.421   1.00 0.00 ? 50 LYS A CD   6  
ATOM 6335  C CE   . LYS A 1 50 ? 4.567   -2.375  0.373   1.00 0.00 ? 50 LYS A CE   6  
ATOM 6336  N NZ   . LYS A 1 50 ? 5.431   -2.867  -0.721  1.00 0.00 ? 50 LYS A NZ   6  
ATOM 6337  H H    . LYS A 1 50 ? 3.498   1.145   3.740   1.00 0.00 ? 50 LYS A H    6  
ATOM 6338  H HA   . LYS A 1 50 ? 4.982   1.738   1.377   1.00 0.00 ? 50 LYS A HA   6  
ATOM 6339  H HB2  . LYS A 1 50 ? 2.093   1.077   2.078   1.00 0.00 ? 50 LYS A HB2  6  
ATOM 6340  H HB3  . LYS A 1 50 ? 2.665   1.285   0.389   1.00 0.00 ? 50 LYS A HB3  6  
ATOM 6341  H HG2  . LYS A 1 50 ? 3.523   -0.838  2.378   1.00 0.00 ? 50 LYS A HG2  6  
ATOM 6342  H HG3  . LYS A 1 50 ? 2.390   -1.014  1.059   1.00 0.00 ? 50 LYS A HG3  6  
ATOM 6343  H HD2  . LYS A 1 50 ? 4.211   -0.445  -0.555  1.00 0.00 ? 50 LYS A HD2  6  
ATOM 6344  H HD3  . LYS A 1 50 ? 5.346   -0.370  0.744   1.00 0.00 ? 50 LYS A HD3  6  
ATOM 6345  H HE2  . LYS A 1 50 ? 4.937   -2.748  1.330   1.00 0.00 ? 50 LYS A HE2  6  
ATOM 6346  H HE3  . LYS A 1 50 ? 3.570   -2.789  0.210   1.00 0.00 ? 50 LYS A HE3  6  
ATOM 6347  H HZ1  . LYS A 1 50 ? 5.347   -3.878  -0.781  1.00 0.00 ? 50 LYS A HZ1  6  
ATOM 6348  H HZ2  . LYS A 1 50 ? 5.125   -2.497  -1.620  1.00 0.00 ? 50 LYS A HZ2  6  
ATOM 6349  H HZ3  . LYS A 1 50 ? 6.410   -2.640  -0.599  1.00 0.00 ? 50 LYS A HZ3  6  
ATOM 6350  N N    . VAL A 1 51 ? 2.883   4.108   2.337   1.00 0.00 ? 51 VAL A N    6  
ATOM 6351  C CA   . VAL A 1 51 ? 2.689   5.553   2.235   1.00 0.00 ? 51 VAL A CA   6  
ATOM 6352  C C    . VAL A 1 51 ? 4.025   6.255   2.483   1.00 0.00 ? 51 VAL A C    6  
ATOM 6353  O O    . VAL A 1 51 ? 4.442   7.078   1.674   1.00 0.00 ? 51 VAL A O    6  
ATOM 6354  C CB   . VAL A 1 51 ? 1.608   6.016   3.244   1.00 0.00 ? 51 VAL A CB   6  
ATOM 6355  C CG1  . VAL A 1 51 ? 1.428   7.536   3.310   1.00 0.00 ? 51 VAL A CG1  6  
ATOM 6356  C CG2  . VAL A 1 51 ? 0.212   5.453   2.960   1.00 0.00 ? 51 VAL A CG2  6  
ATOM 6357  H H    . VAL A 1 51 ? 2.438   3.647   3.127   1.00 0.00 ? 51 VAL A H    6  
ATOM 6358  H HA   . VAL A 1 51 ? 2.377   5.786   1.220   1.00 0.00 ? 51 VAL A HA   6  
ATOM 6359  H HB   . VAL A 1 51 ? 1.909   5.680   4.234   1.00 0.00 ? 51 VAL A HB   6  
ATOM 6360  H HG11 . VAL A 1 51 ? 1.138   7.935   2.338   1.00 0.00 ? 51 VAL A HG11 6  
ATOM 6361  H HG12 . VAL A 1 51 ? 0.650   7.771   4.036   1.00 0.00 ? 51 VAL A HG12 6  
ATOM 6362  H HG13 . VAL A 1 51 ? 2.352   8.003   3.641   1.00 0.00 ? 51 VAL A HG13 6  
ATOM 6363  H HG21 . VAL A 1 51 ? -0.382  5.558   3.868   1.00 0.00 ? 51 VAL A HG21 6  
ATOM 6364  H HG22 . VAL A 1 51 ? -0.265  5.993   2.142   1.00 0.00 ? 51 VAL A HG22 6  
ATOM 6365  H HG23 . VAL A 1 51 ? 0.265   4.400   2.709   1.00 0.00 ? 51 VAL A HG23 6  
ATOM 6366  N N    . LYS A 1 52 ? 4.701   5.945   3.590   1.00 0.00 ? 52 LYS A N    6  
ATOM 6367  C CA   . LYS A 1 52 ? 5.925   6.608   4.057   1.00 0.00 ? 52 LYS A CA   6  
ATOM 6368  C C    . LYS A 1 52 ? 7.049   6.479   3.041   1.00 0.00 ? 52 LYS A C    6  
ATOM 6369  O O    . LYS A 1 52 ? 7.823   7.410   2.857   1.00 0.00 ? 52 LYS A O    6  
ATOM 6370  C CB   . LYS A 1 52 ? 6.268   6.024   5.440   1.00 0.00 ? 52 LYS A CB   6  
ATOM 6371  C CG   . LYS A 1 52 ? 5.228   6.536   6.458   1.00 0.00 ? 52 LYS A CG   6  
ATOM 6372  C CD   . LYS A 1 52 ? 4.807   5.498   7.507   1.00 0.00 ? 52 LYS A CD   6  
ATOM 6373  C CE   . LYS A 1 52 ? 5.285   5.733   8.939   1.00 0.00 ? 52 LYS A CE   6  
ATOM 6374  N NZ   . LYS A 1 52 ? 4.487   6.747   9.648   1.00 0.00 ? 52 LYS A NZ   6  
ATOM 6375  H H    . LYS A 1 52 ? 4.304   5.233   4.199   1.00 0.00 ? 52 LYS A H    6  
ATOM 6376  H HA   . LYS A 1 52 ? 5.745   7.673   4.170   1.00 0.00 ? 52 LYS A HA   6  
ATOM 6377  H HB2  . LYS A 1 52 ? 6.252   4.938   5.371   1.00 0.00 ? 52 LYS A HB2  6  
ATOM 6378  H HB3  . LYS A 1 52 ? 7.264   6.305   5.768   1.00 0.00 ? 52 LYS A HB3  6  
ATOM 6379  H HG2  . LYS A 1 52 ? 5.588   7.450   6.931   1.00 0.00 ? 52 LYS A HG2  6  
ATOM 6380  H HG3  . LYS A 1 52 ? 4.328   6.785   5.898   1.00 0.00 ? 52 LYS A HG3  6  
ATOM 6381  H HD2  . LYS A 1 52 ? 3.714   5.436   7.493   1.00 0.00 ? 52 LYS A HD2  6  
ATOM 6382  H HD3  . LYS A 1 52 ? 5.194   4.529   7.202   1.00 0.00 ? 52 LYS A HD3  6  
ATOM 6383  H HE2  . LYS A 1 52 ? 5.162   4.791   9.478   1.00 0.00 ? 52 LYS A HE2  6  
ATOM 6384  H HE3  . LYS A 1 52 ? 6.341   6.010   8.940   1.00 0.00 ? 52 LYS A HE3  6  
ATOM 6385  H HZ1  . LYS A 1 52 ? 3.499   6.490   9.632   1.00 0.00 ? 52 LYS A HZ1  6  
ATOM 6386  H HZ2  . LYS A 1 52 ? 4.750   6.780   10.627  1.00 0.00 ? 52 LYS A HZ2  6  
ATOM 6387  H HZ3  . LYS A 1 52 ? 4.630   7.676   9.284   1.00 0.00 ? 52 LYS A HZ3  6  
ATOM 6388  N N    . GLU A 1 53 ? 7.082   5.374   2.323   1.00 0.00 ? 53 GLU A N    6  
ATOM 6389  C CA   . GLU A 1 53 ? 7.934   5.124   1.185   1.00 0.00 ? 53 GLU A CA   6  
ATOM 6390  C C    . GLU A 1 53 ? 7.461   5.952   -0.023  1.00 0.00 ? 53 GLU A C    6  
ATOM 6391  O O    . GLU A 1 53 ? 8.201   6.760   -0.594  1.00 0.00 ? 53 GLU A O    6  
ATOM 6392  C CB   . GLU A 1 53 ? 7.835   3.618   0.900   1.00 0.00 ? 53 GLU A CB   6  
ATOM 6393  C CG   . GLU A 1 53 ? 8.709   2.665   1.723   1.00 0.00 ? 53 GLU A CG   6  
ATOM 6394  C CD   . GLU A 1 53 ? 10.182  3.046   1.877   1.00 0.00 ? 53 GLU A CD   6  
ATOM 6395  O OE1  . GLU A 1 53 ? 10.493  3.932   2.703   1.00 0.00 ? 53 GLU A OE1  6  
ATOM 6396  O OE2  . GLU A 1 53 ? 11.048  2.408   1.229   1.00 0.00 ? 53 GLU A OE2  6  
ATOM 6397  H H    . GLU A 1 53 ? 6.417   4.658   2.583   1.00 0.00 ? 53 GLU A H    6  
ATOM 6398  H HA   . GLU A 1 53 ? 8.961   5.413   1.413   1.00 0.00 ? 53 GLU A HA   6  
ATOM 6399  H HB2  . GLU A 1 53 ? 6.801   3.293   1.008   1.00 0.00 ? 53 GLU A HB2  6  
ATOM 6400  H HB3  . GLU A 1 53 ? 8.046   3.459   -0.128  1.00 0.00 ? 53 GLU A HB3  6  
ATOM 6401  H HG2  . GLU A 1 53 ? 8.279   2.585   2.707   1.00 0.00 ? 53 GLU A HG2  6  
ATOM 6402  H HG3  . GLU A 1 53 ? 8.648   1.681   1.261   1.00 0.00 ? 53 GLU A HG3  6  
ATOM 6403  N N    . ARG A 1 54 ? 6.223   5.731   -0.473  1.00 0.00 ? 54 ARG A N    6  
ATOM 6404  C CA   . ARG A 1 54 ? 5.707   6.319   -1.710  1.00 0.00 ? 54 ARG A CA   6  
ATOM 6405  C C    . ARG A 1 54 ? 5.560   7.841   -1.629  1.00 0.00 ? 54 ARG A C    6  
ATOM 6406  O O    . ARG A 1 54 ? 5.420   8.478   -2.677  1.00 0.00 ? 54 ARG A O    6  
ATOM 6407  C CB   . ARG A 1 54 ? 4.397   5.620   -2.126  1.00 0.00 ? 54 ARG A CB   6  
ATOM 6408  C CG   . ARG A 1 54 ? 4.603   4.212   -2.697  1.00 0.00 ? 54 ARG A CG   6  
ATOM 6409  C CD   . ARG A 1 54 ? 5.011   4.303   -4.171  1.00 0.00 ? 54 ARG A CD   6  
ATOM 6410  N NE   . ARG A 1 54 ? 5.690   3.084   -4.633  1.00 0.00 ? 54 ARG A NE   6  
ATOM 6411  C CZ   . ARG A 1 54 ? 5.763   2.660   -5.899  1.00 0.00 ? 54 ARG A CZ   6  
ATOM 6412  N NH1  . ARG A 1 54 ? 5.129   3.271   -6.893  1.00 0.00 ? 54 ARG A NH1  6  
ATOM 6413  N NH2  . ARG A 1 54 ? 6.497   1.589   -6.167  1.00 0.00 ? 54 ARG A NH2  6  
ATOM 6414  H H    . ARG A 1 54 ? 5.614   5.109   0.052   1.00 0.00 ? 54 ARG A H    6  
ATOM 6415  H HA   . ARG A 1 54 ? 6.470   6.149   -2.466  1.00 0.00 ? 54 ARG A HA   6  
ATOM 6416  H HB2  . ARG A 1 54 ? 3.746   5.543   -1.257  1.00 0.00 ? 54 ARG A HB2  6  
ATOM 6417  H HB3  . ARG A 1 54 ? 3.885   6.223   -2.875  1.00 0.00 ? 54 ARG A HB3  6  
ATOM 6418  H HG2  . ARG A 1 54 ? 5.355   3.688   -2.107  1.00 0.00 ? 54 ARG A HG2  6  
ATOM 6419  H HG3  . ARG A 1 54 ? 3.665   3.659   -2.632  1.00 0.00 ? 54 ARG A HG3  6  
ATOM 6420  H HD2  . ARG A 1 54 ? 4.113   4.493   -4.763  1.00 0.00 ? 54 ARG A HD2  6  
ATOM 6421  H HD3  . ARG A 1 54 ? 5.692   5.141   -4.306  1.00 0.00 ? 54 ARG A HD3  6  
ATOM 6422  H HE   . ARG A 1 54 ? 6.201   2.564   -3.926  1.00 0.00 ? 54 ARG A HE   6  
ATOM 6423  H HH11 . ARG A 1 54 ? 4.522   4.076   -6.710  1.00 0.00 ? 54 ARG A HH11 6  
ATOM 6424  H HH12 . ARG A 1 54 ? 5.173   2.951   -7.848  1.00 0.00 ? 54 ARG A HH12 6  
ATOM 6425  H HH21 . ARG A 1 54 ? 7.012   1.144   -5.415  1.00 0.00 ? 54 ARG A HH21 6  
ATOM 6426  H HH22 . ARG A 1 54 ? 6.521   1.199   -7.105  1.00 0.00 ? 54 ARG A HH22 6  
ATOM 6427  N N    . LEU A 1 55 ? 5.660   8.427   -0.431  1.00 0.00 ? 55 LEU A N    6  
ATOM 6428  C CA   . LEU A 1 55 ? 5.788   9.857   -0.147  1.00 0.00 ? 55 LEU A CA   6  
ATOM 6429  C C    . LEU A 1 55 ? 6.971   10.501  -0.875  1.00 0.00 ? 55 LEU A C    6  
ATOM 6430  O O    . LEU A 1 55 ? 7.046   11.725  -0.922  1.00 0.00 ? 55 LEU A O    6  
ATOM 6431  C CB   . LEU A 1 55 ? 5.876   10.082  1.381   1.00 0.00 ? 55 LEU A CB   6  
ATOM 6432  C CG   . LEU A 1 55 ? 4.529   10.512  1.998   1.00 0.00 ? 55 LEU A CG   6  
ATOM 6433  C CD1  . LEU A 1 55 ? 4.494   10.251  3.505   1.00 0.00 ? 55 LEU A CD1  6  
ATOM 6434  C CD2  . LEU A 1 55 ? 4.249   11.994  1.729   1.00 0.00 ? 55 LEU A CD2  6  
ATOM 6435  H H    . LEU A 1 55 ? 5.668   7.808   0.372   1.00 0.00 ? 55 LEU A H    6  
ATOM 6436  H HA   . LEU A 1 55 ? 4.894   10.350  -0.528  1.00 0.00 ? 55 LEU A HA   6  
ATOM 6437  H HB2  . LEU A 1 55 ? 6.231   9.170   1.859   1.00 0.00 ? 55 LEU A HB2  6  
ATOM 6438  H HB3  . LEU A 1 55 ? 6.619   10.847  1.606   1.00 0.00 ? 55 LEU A HB3  6  
ATOM 6439  H HG   . LEU A 1 55 ? 3.726   9.923   1.560   1.00 0.00 ? 55 LEU A HG   6  
ATOM 6440  H HD11 . LEU A 1 55 ? 4.473   9.177   3.669   1.00 0.00 ? 55 LEU A HD11 6  
ATOM 6441  H HD12 . LEU A 1 55 ? 5.365   10.686  3.994   1.00 0.00 ? 55 LEU A HD12 6  
ATOM 6442  H HD13 . LEU A 1 55 ? 3.585   10.670  3.938   1.00 0.00 ? 55 LEU A HD13 6  
ATOM 6443  H HD21 . LEU A 1 55 ? 4.984   12.616  2.241   1.00 0.00 ? 55 LEU A HD21 6  
ATOM 6444  H HD22 . LEU A 1 55 ? 4.300   12.200  0.662   1.00 0.00 ? 55 LEU A HD22 6  
ATOM 6445  H HD23 . LEU A 1 55 ? 3.250   12.249  2.085   1.00 0.00 ? 55 LEU A HD23 6  
ATOM 6446  N N    . GLY A 1 56 ? 7.816   9.712   -1.540  1.00 0.00 ? 56 GLY A N    6  
ATOM 6447  C CA   . GLY A 1 56 ? 8.827   10.176  -2.473  1.00 0.00 ? 56 GLY A CA   6  
ATOM 6448  C C    . GLY A 1 56 ? 10.232  9.756   -2.087  1.00 0.00 ? 56 GLY A C    6  
ATOM 6449  O O    . GLY A 1 56 ? 11.080  9.711   -2.979  1.00 0.00 ? 56 GLY A O    6  
ATOM 6450  H H    . GLY A 1 56 ? 7.756   8.713   -1.376  1.00 0.00 ? 56 GLY A H    6  
ATOM 6451  H HA2  . GLY A 1 56 ? 8.590   9.798   -3.463  1.00 0.00 ? 56 GLY A HA2  6  
ATOM 6452  H HA3  . GLY A 1 56 ? 8.812   11.265  -2.528  1.00 0.00 ? 56 GLY A HA3  6  
ATOM 6453  N N    . THR A 1 57 ? 10.461  9.336   -0.842  1.00 0.00 ? 57 THR A N    6  
ATOM 6454  C CA   . THR A 1 57 ? 11.765  8.949   -0.304  1.00 0.00 ? 57 THR A CA   6  
ATOM 6455  C C    . THR A 1 57 ? 12.443  7.892   -1.180  1.00 0.00 ? 57 THR A C    6  
ATOM 6456  O O    . THR A 1 57 ? 13.627  8.033   -1.498  1.00 0.00 ? 57 THR A O    6  
ATOM 6457  C CB   . THR A 1 57 ? 11.590  8.456   1.143   1.00 0.00 ? 57 THR A CB   6  
ATOM 6458  O OG1  . THR A 1 57 ? 10.405  7.698   1.247   1.00 0.00 ? 57 THR A OG1  6  
ATOM 6459  C CG2  . THR A 1 57 ? 11.468  9.628   2.122   1.00 0.00 ? 57 THR A CG2  6  
ATOM 6460  H H    . THR A 1 57 ? 9.682   9.169   -0.213  1.00 0.00 ? 57 THR A H    6  
ATOM 6461  H HA   . THR A 1 57 ? 12.413  9.825   -0.296  1.00 0.00 ? 57 THR A HA   6  
ATOM 6462  H HB   . THR A 1 57 ? 12.442  7.835   1.416   1.00 0.00 ? 57 THR A HB   6  
ATOM 6463  H HG1  . THR A 1 57 ? 10.430  7.223   2.104   1.00 0.00 ? 57 THR A HG1  6  
ATOM 6464  H HG21 . THR A 1 57 ? 11.418  9.242   3.140   1.00 0.00 ? 57 THR A HG21 6  
ATOM 6465  H HG22 . THR A 1 57 ? 12.346  10.270  2.042   1.00 0.00 ? 57 THR A HG22 6  
ATOM 6466  H HG23 . THR A 1 57 ? 10.569  10.209  1.906   1.00 0.00 ? 57 THR A HG23 6  
ATOM 6467  N N    . LEU A 1 58 ? 11.663  6.917   -1.664  1.00 0.00 ? 58 LEU A N    6  
ATOM 6468  C CA   . LEU A 1 58 ? 12.075  5.830   -2.556  1.00 0.00 ? 58 LEU A CA   6  
ATOM 6469  C C    . LEU A 1 58 ? 13.008  6.298   -3.672  1.00 0.00 ? 58 LEU A C    6  
ATOM 6470  O O    . LEU A 1 58 ? 13.984  5.619   -3.989  1.00 0.00 ? 58 LEU A O    6  
ATOM 6471  C CB   . LEU A 1 58 ? 10.834  5.204   -3.213  1.00 0.00 ? 58 LEU A CB   6  
ATOM 6472  C CG   . LEU A 1 58 ? 9.915   4.449   -2.246  1.00 0.00 ? 58 LEU A CG   6  
ATOM 6473  C CD1  . LEU A 1 58 ? 8.561   4.197   -2.912  1.00 0.00 ? 58 LEU A CD1  6  
ATOM 6474  C CD2  . LEU A 1 58 ? 10.509  3.105   -1.871  1.00 0.00 ? 58 LEU A CD2  6  
ATOM 6475  H H    . LEU A 1 58 ? 10.724  6.893   -1.280  1.00 0.00 ? 58 LEU A H    6  
ATOM 6476  H HA   . LEU A 1 58 ? 12.599  5.079   -1.963  1.00 0.00 ? 58 LEU A HA   6  
ATOM 6477  H HB2  . LEU A 1 58 ? 10.263  6.006   -3.676  1.00 0.00 ? 58 LEU A HB2  6  
ATOM 6478  H HB3  . LEU A 1 58 ? 11.151  4.523   -4.006  1.00 0.00 ? 58 LEU A HB3  6  
ATOM 6479  H HG   . LEU A 1 58 ? 9.780   5.030   -1.338  1.00 0.00 ? 58 LEU A HG   6  
ATOM 6480  H HD11 . LEU A 1 58 ? 8.684   3.564   -3.789  1.00 0.00 ? 58 LEU A HD11 6  
ATOM 6481  H HD12 . LEU A 1 58 ? 7.886   3.716   -2.203  1.00 0.00 ? 58 LEU A HD12 6  
ATOM 6482  H HD13 . LEU A 1 58 ? 8.137   5.148   -3.223  1.00 0.00 ? 58 LEU A HD13 6  
ATOM 6483  H HD21 . LEU A 1 58 ? 9.815   2.566   -1.231  1.00 0.00 ? 58 LEU A HD21 6  
ATOM 6484  H HD22 . LEU A 1 58 ? 10.694  2.528   -2.770  1.00 0.00 ? 58 LEU A HD22 6  
ATOM 6485  H HD23 . LEU A 1 58 ? 11.440  3.257   -1.326  1.00 0.00 ? 58 LEU A HD23 6  
ATOM 6486  N N    . LYS A 1 59 ? 12.699  7.433   -4.297  1.00 0.00 ? 59 LYS A N    6  
ATOM 6487  C CA   . LYS A 1 59 ? 13.495  8.068   -5.339  1.00 0.00 ? 59 LYS A CA   6  
ATOM 6488  C C    . LYS A 1 59 ? 13.582  9.560   -5.012  1.00 0.00 ? 59 LYS A C    6  
ATOM 6489  O O    . LYS A 1 59 ? 13.340  10.399  -5.879  1.00 0.00 ? 59 LYS A O    6  
ATOM 6490  C CB   . LYS A 1 59 ? 12.919  7.776   -6.744  1.00 0.00 ? 59 LYS A CB   6  
ATOM 6491  C CG   . LYS A 1 59 ? 13.057  6.303   -7.164  1.00 0.00 ? 59 LYS A CG   6  
ATOM 6492  C CD   . LYS A 1 59 ? 12.441  6.046   -8.548  1.00 0.00 ? 59 LYS A CD   6  
ATOM 6493  C CE   . LYS A 1 59 ? 12.642  4.580   -8.966  1.00 0.00 ? 59 LYS A CE   6  
ATOM 6494  N NZ   . LYS A 1 59 ? 13.605  4.424   -10.074 1.00 0.00 ? 59 LYS A NZ   6  
ATOM 6495  H H    . LYS A 1 59 ? 11.915  7.962   -3.933  1.00 0.00 ? 59 LYS A H    6  
ATOM 6496  H HA   . LYS A 1 59 ? 14.511  7.667   -5.304  1.00 0.00 ? 59 LYS A HA   6  
ATOM 6497  H HB2  . LYS A 1 59 ? 11.872  8.075   -6.782  1.00 0.00 ? 59 LYS A HB2  6  
ATOM 6498  H HB3  . LYS A 1 59 ? 13.463  8.376   -7.474  1.00 0.00 ? 59 LYS A HB3  6  
ATOM 6499  H HG2  . LYS A 1 59 ? 14.117  6.043   -7.188  1.00 0.00 ? 59 LYS A HG2  6  
ATOM 6500  H HG3  . LYS A 1 59 ? 12.552  5.665   -6.439  1.00 0.00 ? 59 LYS A HG3  6  
ATOM 6501  H HD2  . LYS A 1 59 ? 11.370  6.250   -8.497  1.00 0.00 ? 59 LYS A HD2  6  
ATOM 6502  H HD3  . LYS A 1 59 ? 12.883  6.722   -9.282  1.00 0.00 ? 59 LYS A HD3  6  
ATOM 6503  H HE2  . LYS A 1 59 ? 13.004  4.008   -8.108  1.00 0.00 ? 59 LYS A HE2  6  
ATOM 6504  H HE3  . LYS A 1 59 ? 11.684  4.160   -9.275  1.00 0.00 ? 59 LYS A HE3  6  
ATOM 6505  H HZ1  . LYS A 1 59 ? 13.878  3.449   -10.188 1.00 0.00 ? 59 LYS A HZ1  6  
ATOM 6506  H HZ2  . LYS A 1 59 ? 13.227  4.706   -10.973 1.00 0.00 ? 59 LYS A HZ2  6  
ATOM 6507  H HZ3  . LYS A 1 59 ? 14.482  4.904   -9.893  1.00 0.00 ? 59 LYS A HZ3  6  
ATOM 6508  N N    . ASN A 1 60 ? 13.972  9.909   -3.784  1.00 0.00 ? 60 ASN A N    6  
ATOM 6509  C CA   . ASN A 1 60 ? 14.499  11.235  -3.465  1.00 0.00 ? 60 ASN A CA   6  
ATOM 6510  C C    . ASN A 1 60 ? 15.926  11.039  -2.953  1.00 0.00 ? 60 ASN A C    6  
ATOM 6511  O O    . ASN A 1 60 ? 16.168  11.246  -1.761  1.00 0.00 ? 60 ASN A O    6  
ATOM 6512  C CB   . ASN A 1 60 ? 13.596  12.006  -2.478  1.00 0.00 ? 60 ASN A CB   6  
ATOM 6513  C CG   . ASN A 1 60 ? 13.968  13.489  -2.347  1.00 0.00 ? 60 ASN A CG   6  
ATOM 6514  O OD1  . ASN A 1 60 ? 13.090  14.348  -2.354  1.00 0.00 ? 60 ASN A OD1  6  
ATOM 6515  N ND2  . ASN A 1 60 ? 15.229  13.862  -2.210  1.00 0.00 ? 60 ASN A ND2  6  
ATOM 6516  H H    . ASN A 1 60 ? 14.099  9.181   -3.087  1.00 0.00 ? 60 ASN A H    6  
ATOM 6517  H HA   . ASN A 1 60 ? 14.550  11.839  -4.371  1.00 0.00 ? 60 ASN A HA   6  
ATOM 6518  H HB2  . ASN A 1 60 ? 12.568  11.952  -2.839  1.00 0.00 ? 60 ASN A HB2  6  
ATOM 6519  H HB3  . ASN A 1 60 ? 13.623  11.536  -1.495  1.00 0.00 ? 60 ASN A HB3  6  
ATOM 6520  H HD21 . ASN A 1 60 ? 15.985  13.187  -2.142  1.00 0.00 ? 60 ASN A HD21 6  
ATOM 6521  H HD22 . ASN A 1 60 ? 15.457  14.855  -2.159  1.00 0.00 ? 60 ASN A HD22 6  
ATOM 6522  N N    . PRO A 1 61 ? 16.881  10.661  -3.820  1.00 0.00 ? 61 PRO A N    6  
ATOM 6523  C CA   . PRO A 1 61 ? 18.279  10.571  -3.428  1.00 0.00 ? 61 PRO A CA   6  
ATOM 6524  C C    . PRO A 1 61 ? 18.837  11.965  -3.101  1.00 0.00 ? 61 PRO A C    6  
ATOM 6525  O O    . PRO A 1 61 ? 18.169  12.975  -3.367  1.00 0.00 ? 61 PRO A O    6  
ATOM 6526  C CB   . PRO A 1 61 ? 18.984  9.930   -4.629  1.00 0.00 ? 61 PRO A CB   6  
ATOM 6527  C CG   . PRO A 1 61 ? 18.138  10.364  -5.818  1.00 0.00 ? 61 PRO A CG   6  
ATOM 6528  C CD   . PRO A 1 61 ? 16.729  10.372  -5.240  1.00 0.00 ? 61 PRO A CD   6  
ATOM 6529  H HA   . PRO A 1 61 ? 18.374  9.927   -2.553  1.00 0.00 ? 61 PRO A HA   6  
ATOM 6530  H HB2  . PRO A 1 61 ? 20.017  10.254  -4.750  1.00 0.00 ? 61 PRO A HB2  6  
ATOM 6531  H HB3  . PRO A 1 61 ? 18.935  8.848   -4.522  1.00 0.00 ? 61 PRO A HB3  6  
ATOM 6532  H HG2  . PRO A 1 61 ? 18.419  11.374  -6.120  1.00 0.00 ? 61 PRO A HG2  6  
ATOM 6533  H HG3  . PRO A 1 61 ? 18.228  9.664   -6.646  1.00 0.00 ? 61 PRO A HG3  6  
ATOM 6534  H HD2  . PRO A 1 61 ? 16.125  11.123  -5.747  1.00 0.00 ? 61 PRO A HD2  6  
ATOM 6535  H HD3  . PRO A 1 61 ? 16.293  9.380   -5.361  1.00 0.00 ? 61 PRO A HD3  6  
ATOM 6536  N N    . PRO A 1 62 ? 20.078  12.050  -2.592  1.00 0.00 ? 62 PRO A N    6  
ATOM 6537  C CA   . PRO A 1 62 ? 20.778  13.304  -2.321  1.00 0.00 ? 62 PRO A CA   6  
ATOM 6538  C C    . PRO A 1 62 ? 21.201  14.055  -3.603  1.00 0.00 ? 62 PRO A C    6  
ATOM 6539  O O    . PRO A 1 62 ? 22.363  14.454  -3.744  1.00 0.00 ? 62 PRO A O    6  
ATOM 6540  C CB   . PRO A 1 62 ? 21.955  12.904  -1.411  1.00 0.00 ? 62 PRO A CB   6  
ATOM 6541  C CG   . PRO A 1 62 ? 22.233  11.450  -1.772  1.00 0.00 ? 62 PRO A CG   6  
ATOM 6542  C CD   . PRO A 1 62 ? 20.836  10.925  -2.056  1.00 0.00 ? 62 PRO A CD   6  
ATOM 6543  H HA   . PRO A 1 62 ? 20.112  13.956  -1.755  1.00 0.00 ? 62 PRO A HA   6  
ATOM 6544  H HB2  . PRO A 1 62 ? 22.844  13.516  -1.549  1.00 0.00 ? 62 PRO A HB2  6  
ATOM 6545  H HB3  . PRO A 1 62 ? 21.634  12.960  -0.372  1.00 0.00 ? 62 PRO A HB3  6  
ATOM 6546  H HG2  . PRO A 1 62 ? 22.835  11.395  -2.679  1.00 0.00 ? 62 PRO A HG2  6  
ATOM 6547  H HG3  . PRO A 1 62 ? 22.707  10.906  -0.955  1.00 0.00 ? 62 PRO A HG3  6  
ATOM 6548  H HD2  . PRO A 1 62 ? 20.896  10.087  -2.748  1.00 0.00 ? 62 PRO A HD2  6  
ATOM 6549  H HD3  . PRO A 1 62 ? 20.373  10.606  -1.121  1.00 0.00 ? 62 PRO A HD3  6  
ATOM 6550  N N    . LYS A 1 63 ? 20.288  14.250  -4.563  1.00 0.00 ? 63 LYS A N    6  
ATOM 6551  C CA   . LYS A 1 63 ? 20.510  14.987  -5.806  1.00 0.00 ? 63 LYS A CA   6  
ATOM 6552  C C    . LYS A 1 63 ? 19.158  15.438  -6.368  1.00 0.00 ? 63 LYS A C    6  
ATOM 6553  O O    . LYS A 1 63 ? 18.658  14.876  -7.352  1.00 0.00 ? 63 LYS A O    6  
ATOM 6554  C CB   . LYS A 1 63 ? 21.330  14.110  -6.774  1.00 0.00 ? 63 LYS A CB   6  
ATOM 6555  C CG   . LYS A 1 63 ? 22.263  14.917  -7.681  1.00 0.00 ? 63 LYS A CG   6  
ATOM 6556  C CD   . LYS A 1 63 ? 21.591  15.646  -8.855  1.00 0.00 ? 63 LYS A CD   6  
ATOM 6557  C CE   . LYS A 1 63 ? 22.653  16.251  -9.787  1.00 0.00 ? 63 LYS A CE   6  
ATOM 6558  N NZ   . LYS A 1 63 ? 23.513  15.225  -10.423 1.00 0.00 ? 63 LYS A NZ   6  
ATOM 6559  H H    . LYS A 1 63 ? 19.346  13.926  -4.366  1.00 0.00 ? 63 LYS A H    6  
ATOM 6560  H HA   . LYS A 1 63 ? 21.094  15.876  -5.566  1.00 0.00 ? 63 LYS A HA   6  
ATOM 6561  H HB2  . LYS A 1 63 ? 21.977  13.451  -6.192  1.00 0.00 ? 63 LYS A HB2  6  
ATOM 6562  H HB3  . LYS A 1 63 ? 20.686  13.461  -7.367  1.00 0.00 ? 63 LYS A HB3  6  
ATOM 6563  H HG2  . LYS A 1 63 ? 22.826  15.633  -7.080  1.00 0.00 ? 63 LYS A HG2  6  
ATOM 6564  H HG3  . LYS A 1 63 ? 22.971  14.202  -8.083  1.00 0.00 ? 63 LYS A HG3  6  
ATOM 6565  H HD2  . LYS A 1 63 ? 20.962  14.954  -9.417  1.00 0.00 ? 63 LYS A HD2  6  
ATOM 6566  H HD3  . LYS A 1 63 ? 20.965  16.454  -8.472  1.00 0.00 ? 63 LYS A HD3  6  
ATOM 6567  H HE2  . LYS A 1 63 ? 22.149  16.829  -10.565 1.00 0.00 ? 63 LYS A HE2  6  
ATOM 6568  H HE3  . LYS A 1 63 ? 23.277  16.934  -9.208  1.00 0.00 ? 63 LYS A HE3  6  
ATOM 6569  H HZ1  . LYS A 1 63 ? 24.303  15.624  -10.922 1.00 0.00 ? 63 LYS A HZ1  6  
ATOM 6570  H HZ2  . LYS A 1 63 ? 23.915  14.586  -9.742  1.00 0.00 ? 63 LYS A HZ2  6  
ATOM 6571  H HZ3  . LYS A 1 63 ? 23.000  14.651  -11.088 1.00 0.00 ? 63 LYS A HZ3  6  
ATOM 6572  N N    . LYS A 1 64 ? 18.526  16.423  -5.728  1.00 0.00 ? 64 LYS A N    6  
ATOM 6573  C CA   . LYS A 1 64 ? 17.257  17.001  -6.181  1.00 0.00 ? 64 LYS A CA   6  
ATOM 6574  C C    . LYS A 1 64 ? 17.553  18.356  -6.825  1.00 0.00 ? 64 LYS A C    6  
ATOM 6575  O O    . LYS A 1 64 ? 18.704  18.787  -6.940  1.00 0.00 ? 64 LYS A O    6  
ATOM 6576  C CB   . LYS A 1 64 ? 16.239  17.039  -5.015  1.00 0.00 ? 64 LYS A CB   6  
ATOM 6577  C CG   . LYS A 1 64 ? 14.797  17.458  -5.398  1.00 0.00 ? 64 LYS A CG   6  
ATOM 6578  C CD   . LYS A 1 64 ? 13.733  17.026  -4.376  1.00 0.00 ? 64 LYS A CD   6  
ATOM 6579  C CE   . LYS A 1 64 ? 12.348  17.636  -4.654  1.00 0.00 ? 64 LYS A CE   6  
ATOM 6580  N NZ   . LYS A 1 64 ? 11.678  17.056  -5.837  1.00 0.00 ? 64 LYS A NZ   6  
ATOM 6581  H H    . LYS A 1 64 ? 19.056  16.955  -5.040  1.00 0.00 ? 64 LYS A H    6  
ATOM 6582  H HA   . LYS A 1 64 ? 16.827  16.359  -6.948  1.00 0.00 ? 64 LYS A HA   6  
ATOM 6583  H HB2  . LYS A 1 64 ? 16.192  16.032  -4.596  1.00 0.00 ? 64 LYS A HB2  6  
ATOM 6584  H HB3  . LYS A 1 64 ? 16.610  17.718  -4.246  1.00 0.00 ? 64 LYS A HB3  6  
ATOM 6585  H HG2  . LYS A 1 64 ? 14.750  18.543  -5.474  1.00 0.00 ? 64 LYS A HG2  6  
ATOM 6586  H HG3  . LYS A 1 64 ? 14.546  17.034  -6.369  1.00 0.00 ? 64 LYS A HG3  6  
ATOM 6587  H HD2  . LYS A 1 64 ? 13.662  15.938  -4.358  1.00 0.00 ? 64 LYS A HD2  6  
ATOM 6588  H HD3  . LYS A 1 64 ? 14.041  17.373  -3.391  1.00 0.00 ? 64 LYS A HD3  6  
ATOM 6589  H HE2  . LYS A 1 64 ? 11.717  17.466  -3.780  1.00 0.00 ? 64 LYS A HE2  6  
ATOM 6590  H HE3  . LYS A 1 64 ? 12.455  18.714  -4.788  1.00 0.00 ? 64 LYS A HE3  6  
ATOM 6591  H HZ1  . LYS A 1 64 ? 12.236  17.146  -6.682  1.00 0.00 ? 64 LYS A HZ1  6  
ATOM 6592  H HZ2  . LYS A 1 64 ? 11.487  16.065  -5.719  1.00 0.00 ? 64 LYS A HZ2  6  
ATOM 6593  H HZ3  . LYS A 1 64 ? 10.791  17.512  -6.036  1.00 0.00 ? 64 LYS A HZ3  6  
ATOM 6594  N N    . LYS A 1 65 ? 16.500  19.016  -7.287  1.00 0.00 ? 65 LYS A N    6  
ATOM 6595  C CA   . LYS A 1 65 ? 16.473  20.446  -7.541  1.00 0.00 ? 65 LYS A CA   6  
ATOM 6596  C C    . LYS A 1 65 ? 16.688  21.178  -6.212  1.00 0.00 ? 65 LYS A C    6  
ATOM 6597  O O    . LYS A 1 65 ? 16.433  20.620  -5.141  1.00 0.00 ? 65 LYS A O    6  
ATOM 6598  C CB   . LYS A 1 65 ? 15.121  20.799  -8.183  1.00 0.00 ? 65 LYS A CB   6  
ATOM 6599  C CG   . LYS A 1 65 ? 14.897  19.993  -9.477  1.00 0.00 ? 65 LYS A CG   6  
ATOM 6600  C CD   . LYS A 1 65 ? 13.539  20.283  -10.112 1.00 0.00 ? 65 LYS A CD   6  
ATOM 6601  C CE   . LYS A 1 65 ? 13.251  19.254  -11.212 1.00 0.00 ? 65 LYS A CE   6  
ATOM 6602  N NZ   . LYS A 1 65 ? 11.915  19.452  -11.805 1.00 0.00 ? 65 LYS A NZ   6  
ATOM 6603  H H    . LYS A 1 65 ? 15.603  18.573  -7.182  1.00 0.00 ? 65 LYS A H    6  
ATOM 6604  H HA   . LYS A 1 65 ? 17.282  20.704  -8.226  1.00 0.00 ? 65 LYS A HA   6  
ATOM 6605  H HB2  . LYS A 1 65 ? 14.321  20.580  -7.475  1.00 0.00 ? 65 LYS A HB2  6  
ATOM 6606  H HB3  . LYS A 1 65 ? 15.095  21.865  -8.409  1.00 0.00 ? 65 LYS A HB3  6  
ATOM 6607  H HG2  . LYS A 1 65 ? 15.686  20.238  -10.185 1.00 0.00 ? 65 LYS A HG2  6  
ATOM 6608  H HG3  . LYS A 1 65 ? 14.938  18.925  -9.264  1.00 0.00 ? 65 LYS A HG3  6  
ATOM 6609  H HD2  . LYS A 1 65 ? 12.766  20.214  -9.345  1.00 0.00 ? 65 LYS A HD2  6  
ATOM 6610  H HD3  . LYS A 1 65 ? 13.542  21.287  -10.531 1.00 0.00 ? 65 LYS A HD3  6  
ATOM 6611  H HE2  . LYS A 1 65 ? 14.010  19.329  -11.992 1.00 0.00 ? 65 LYS A HE2  6  
ATOM 6612  H HE3  . LYS A 1 65 ? 13.303  18.258  -10.774 1.00 0.00 ? 65 LYS A HE3  6  
ATOM 6613  H HZ1  . LYS A 1 65 ? 11.980  19.972  -12.675 1.00 0.00 ? 65 LYS A HZ1  6  
ATOM 6614  H HZ2  . LYS A 1 65 ? 11.446  18.571  -11.978 1.00 0.00 ? 65 LYS A HZ2  6  
ATOM 6615  H HZ3  . LYS A 1 65 ? 11.342  20.035  -11.199 1.00 0.00 ? 65 LYS A HZ3  6  
ATOM 6616  N N    . MET A 1 66 ? 17.135  22.428  -6.274  1.00 0.00 ? 66 MET A N    6  
ATOM 6617  C CA   . MET A 1 66 ? 17.422  23.258  -5.111  1.00 0.00 ? 66 MET A CA   6  
ATOM 6618  C C    . MET A 1 66 ? 16.103  23.722  -4.494  1.00 0.00 ? 66 MET A C    6  
ATOM 6619  O O    . MET A 1 66 ? 15.567  24.751  -4.899  1.00 0.00 ? 66 MET A O    6  
ATOM 6620  C CB   . MET A 1 66 ? 18.301  24.452  -5.529  1.00 0.00 ? 66 MET A CB   6  
ATOM 6621  C CG   . MET A 1 66 ? 19.739  24.025  -5.847  1.00 0.00 ? 66 MET A CG   6  
ATOM 6622  S SD   . MET A 1 66 ? 20.720  23.502  -4.410  1.00 0.00 ? 66 MET A SD   6  
ATOM 6623  C CE   . MET A 1 66 ? 21.110  25.122  -3.687  1.00 0.00 ? 66 MET A CE   6  
ATOM 6624  H H    . MET A 1 66 ? 17.229  22.852  -7.190  1.00 0.00 ? 66 MET A H    6  
ATOM 6625  H HA   . MET A 1 66 ? 17.963  22.665  -4.372  1.00 0.00 ? 66 MET A HA   6  
ATOM 6626  H HB2  . MET A 1 66 ? 17.867  24.933  -6.407  1.00 0.00 ? 66 MET A HB2  6  
ATOM 6627  H HB3  . MET A 1 66 ? 18.322  25.185  -4.722  1.00 0.00 ? 66 MET A HB3  6  
ATOM 6628  H HG2  . MET A 1 66 ? 19.711  23.204  -6.565  1.00 0.00 ? 66 MET A HG2  6  
ATOM 6629  H HG3  . MET A 1 66 ? 20.251  24.861  -6.325  1.00 0.00 ? 66 MET A HG3  6  
ATOM 6630  H HE1  . MET A 1 66 ? 20.193  25.634  -3.397  1.00 0.00 ? 66 MET A HE1  6  
ATOM 6631  H HE2  . MET A 1 66 ? 21.739  24.985  -2.807  1.00 0.00 ? 66 MET A HE2  6  
ATOM 6632  H HE3  . MET A 1 66 ? 21.646  25.729  -4.418  1.00 0.00 ? 66 MET A HE3  6  
ATOM 6633  N N    . LYS A 1 67 ? 15.553  22.954  -3.549  1.00 0.00 ? 67 LYS A N    6  
ATOM 6634  C CA   . LYS A 1 67 ? 14.330  23.335  -2.838  1.00 0.00 ? 67 LYS A CA   6  
ATOM 6635  C C    . LYS A 1 67 ? 14.556  24.565  -1.951  1.00 0.00 ? 67 LYS A C    6  
ATOM 6636  O O    . LYS A 1 67 ? 15.708  24.923  -1.678  1.00 0.00 ? 67 LYS A O    6  
ATOM 6637  C CB   . LYS A 1 67 ? 13.808  22.155  -1.993  1.00 0.00 ? 67 LYS A CB   6  
ATOM 6638  C CG   . LYS A 1 67 ? 14.635  21.890  -0.716  1.00 0.00 ? 67 LYS A CG   6  
ATOM 6639  C CD   . LYS A 1 67 ? 13.862  21.038  0.292   1.00 0.00 ? 67 LYS A CD   6  
ATOM 6640  C CE   . LYS A 1 67 ? 14.396  21.301  1.701   1.00 0.00 ? 67 LYS A CE   6  
ATOM 6641  N NZ   . LYS A 1 67 ? 13.825  20.384  2.703   1.00 0.00 ? 67 LYS A NZ   6  
ATOM 6642  H H    . LYS A 1 67 ? 16.009  22.082  -3.322  1.00 0.00 ? 67 LYS A H    6  
ATOM 6643  H HA   . LYS A 1 67 ? 13.580  23.594  -3.589  1.00 0.00 ? 67 LYS A HA   6  
ATOM 6644  H HB2  . LYS A 1 67 ? 12.785  22.394  -1.701  1.00 0.00 ? 67 LYS A HB2  6  
ATOM 6645  H HB3  . LYS A 1 67 ? 13.774  21.250  -2.601  1.00 0.00 ? 67 LYS A HB3  6  
ATOM 6646  H HG2  . LYS A 1 67 ? 15.573  21.404  -0.978  1.00 0.00 ? 67 LYS A HG2  6  
ATOM 6647  H HG3  . LYS A 1 67 ? 14.874  22.827  -0.218  1.00 0.00 ? 67 LYS A HG3  6  
ATOM 6648  H HD2  . LYS A 1 67 ? 12.815  21.330  0.274   1.00 0.00 ? 67 LYS A HD2  6  
ATOM 6649  H HD3  . LYS A 1 67 ? 13.964  19.984  0.031   1.00 0.00 ? 67 LYS A HD3  6  
ATOM 6650  H HE2  . LYS A 1 67 ? 15.478  21.171  1.687   1.00 0.00 ? 67 LYS A HE2  6  
ATOM 6651  H HE3  . LYS A 1 67 ? 14.182  22.335  1.977   1.00 0.00 ? 67 LYS A HE3  6  
ATOM 6652  H HZ1  . LYS A 1 67 ? 12.861  20.602  2.936   1.00 0.00 ? 67 LYS A HZ1  6  
ATOM 6653  H HZ2  . LYS A 1 67 ? 13.860  19.427  2.364   1.00 0.00 ? 67 LYS A HZ2  6  
ATOM 6654  H HZ3  . LYS A 1 67 ? 14.375  20.406  3.557   1.00 0.00 ? 67 LYS A HZ3  6  
ATOM 6655  N N    . LEU A 1 68 ? 13.483  25.086  -1.353  1.00 0.00 ? 68 LEU A N    6  
ATOM 6656  C CA   . LEU A 1 68 ? 13.540  25.930  -0.156  1.00 0.00 ? 68 LEU A CA   6  
ATOM 6657  C C    . LEU A 1 68 ? 13.114  25.115  1.077   1.00 0.00 ? 68 LEU A C    6  
ATOM 6658  O O    . LEU A 1 68 ? 12.588  24.003  0.957   1.00 0.00 ? 68 LEU A O    6  
ATOM 6659  C CB   . LEU A 1 68 ? 12.669  27.185  -0.352  1.00 0.00 ? 68 LEU A CB   6  
ATOM 6660  C CG   . LEU A 1 68 ? 13.432  28.395  -0.936  1.00 0.00 ? 68 LEU A CG   6  
ATOM 6661  C CD1  . LEU A 1 68 ? 13.934  28.168  -2.369  1.00 0.00 ? 68 LEU A CD1  6  
ATOM 6662  C CD2  . LEU A 1 68 ? 12.522  29.628  -0.915  1.00 0.00 ? 68 LEU A CD2  6  
ATOM 6663  H H    . LEU A 1 68 ? 12.574  24.719  -1.616  1.00 0.00 ? 68 LEU A H    6  
ATOM 6664  H HA   . LEU A 1 68 ? 14.568  26.254  0.013   1.00 0.00 ? 68 LEU A HA   6  
ATOM 6665  H HB2  . LEU A 1 68 ? 11.811  26.946  -0.977  1.00 0.00 ? 68 LEU A HB2  6  
ATOM 6666  H HB3  . LEU A 1 68 ? 12.280  27.481  0.620   1.00 0.00 ? 68 LEU A HB3  6  
ATOM 6667  H HG   . LEU A 1 68 ? 14.294  28.606  -0.302  1.00 0.00 ? 68 LEU A HG   6  
ATOM 6668  H HD11 . LEU A 1 68 ? 14.389  29.080  -2.755  1.00 0.00 ? 68 LEU A HD11 6  
ATOM 6669  H HD12 . LEU A 1 68 ? 14.692  27.387  -2.388  1.00 0.00 ? 68 LEU A HD12 6  
ATOM 6670  H HD13 . LEU A 1 68 ? 13.109  27.884  -3.021  1.00 0.00 ? 68 LEU A HD13 6  
ATOM 6671  H HD21 . LEU A 1 68 ? 13.065  30.499  -1.284  1.00 0.00 ? 68 LEU A HD21 6  
ATOM 6672  H HD22 . LEU A 1 68 ? 11.646  29.464  -1.544  1.00 0.00 ? 68 LEU A HD22 6  
ATOM 6673  H HD23 . LEU A 1 68 ? 12.192  29.844  0.100   1.00 0.00 ? 68 LEU A HD23 6  
ATOM 6674  N N    . MET A 1 69 ? 13.345  25.657  2.277   1.00 0.00 ? 69 MET A N    6  
ATOM 6675  C CA   . MET A 1 69 ? 13.100  25.013  3.573   1.00 0.00 ? 69 MET A CA   6  
ATOM 6676  C C    . MET A 1 69 ? 12.422  26.017  4.521   1.00 0.00 ? 69 MET A C    6  
ATOM 6677  O O    . MET A 1 69 ? 12.646  27.223  4.380   1.00 0.00 ? 69 MET A O    6  
ATOM 6678  C CB   . MET A 1 69 ? 14.457  24.498  4.095   1.00 0.00 ? 69 MET A CB   6  
ATOM 6679  C CG   . MET A 1 69 ? 14.391  23.669  5.381   1.00 0.00 ? 69 MET A CG   6  
ATOM 6680  S SD   . MET A 1 69 ? 14.339  24.629  6.919   1.00 0.00 ? 69 MET A SD   6  
ATOM 6681  C CE   . MET A 1 69 ? 14.077  23.272  8.091   1.00 0.00 ? 69 MET A CE   6  
ATOM 6682  H H    . MET A 1 69 ? 13.721  26.599  2.311   1.00 0.00 ? 69 MET A H    6  
ATOM 6683  H HA   . MET A 1 69 ? 12.429  24.165  3.433   1.00 0.00 ? 69 MET A HA   6  
ATOM 6684  H HB2  . MET A 1 69 ? 14.895  23.863  3.325   1.00 0.00 ? 69 MET A HB2  6  
ATOM 6685  H HB3  . MET A 1 69 ? 15.136  25.338  4.249   1.00 0.00 ? 69 MET A HB3  6  
ATOM 6686  H HG2  . MET A 1 69 ? 13.526  23.008  5.334   1.00 0.00 ? 69 MET A HG2  6  
ATOM 6687  H HG3  . MET A 1 69 ? 15.281  23.041  5.422   1.00 0.00 ? 69 MET A HG3  6  
ATOM 6688  H HE1  . MET A 1 69 ? 13.165  22.731  7.836   1.00 0.00 ? 69 MET A HE1  6  
ATOM 6689  H HE2  . MET A 1 69 ? 14.921  22.583  8.060   1.00 0.00 ? 69 MET A HE2  6  
ATOM 6690  H HE3  . MET A 1 69 ? 13.981  23.676  9.099   1.00 0.00 ? 69 MET A HE3  6  
ATOM 6691  N N    . ARG A 1 70 ? 11.622  25.532  5.484   1.00 0.00 ? 70 ARG A N    6  
ATOM 6692  C CA   . ARG A 1 70 ? 10.568  26.297  6.164   1.00 0.00 ? 70 ARG A CA   6  
ATOM 6693  C C    . ARG A 1 70 ? 9.846   27.119  5.110   1.00 0.00 ? 70 ARG A C    6  
ATOM 6694  O O    . ARG A 1 70 ? 9.880   28.368  5.144   1.00 0.00 ? 70 ARG A O    6  
ATOM 6695  C CB   . ARG A 1 70 ? 11.119  27.070  7.380   1.00 0.00 ? 70 ARG A CB   6  
ATOM 6696  C CG   . ARG A 1 70 ? 10.022  27.767  8.214   1.00 0.00 ? 70 ARG A CG   6  
ATOM 6697  C CD   . ARG A 1 70 ? 10.523  28.245  9.587   1.00 0.00 ? 70 ARG A CD   6  
ATOM 6698  N NE   . ARG A 1 70 ? 10.668  27.109  10.506  1.00 0.00 ? 70 ARG A NE   6  
ATOM 6699  C CZ   . ARG A 1 70 ? 10.858  27.119  11.827  1.00 0.00 ? 70 ARG A CZ   6  
ATOM 6700  N NH1  . ARG A 1 70 ? 10.963  28.244  12.528  1.00 0.00 ? 70 ARG A NH1  6  
ATOM 6701  N NH2  . ARG A 1 70 ? 10.927  25.947  12.444  1.00 0.00 ? 70 ARG A NH2  6  
ATOM 6702  H H    . ARG A 1 70 ? 11.532  24.526  5.545   1.00 0.00 ? 70 ARG A H    6  
ATOM 6703  H HA   . ARG A 1 70 ? 9.836   25.582  6.540   1.00 0.00 ? 70 ARG A HA   6  
ATOM 6704  H HB2  . ARG A 1 70 ? 11.631  26.351  8.017   1.00 0.00 ? 70 ARG A HB2  6  
ATOM 6705  H HB3  . ARG A 1 70 ? 11.845  27.813  7.048   1.00 0.00 ? 70 ARG A HB3  6  
ATOM 6706  H HG2  . ARG A 1 70 ? 9.648   28.631  7.671   1.00 0.00 ? 70 ARG A HG2  6  
ATOM 6707  H HG3  . ARG A 1 70 ? 9.186   27.083  8.363   1.00 0.00 ? 70 ARG A HG3  6  
ATOM 6708  H HD2  . ARG A 1 70 ? 11.478  28.758  9.474   1.00 0.00 ? 70 ARG A HD2  6  
ATOM 6709  H HD3  . ARG A 1 70 ? 9.798   28.944  10.003  1.00 0.00 ? 70 ARG A HD3  6  
ATOM 6710  H HE   . ARG A 1 70 ? 10.558  26.202  10.069  1.00 0.00 ? 70 ARG A HE   6  
ATOM 6711  H HH11 . ARG A 1 70 ? 10.925  29.165  12.092  1.00 0.00 ? 70 ARG A HH11 6  
ATOM 6712  H HH12 . ARG A 1 70 ? 11.079  28.244  13.533  1.00 0.00 ? 70 ARG A HH12 6  
ATOM 6713  H HH21 . ARG A 1 70 ? 10.901  25.094  11.901  1.00 0.00 ? 70 ARG A HH21 6  
ATOM 6714  H HH22 . ARG A 1 70 ? 11.092  25.880  13.449  1.00 0.00 ? 70 ARG A HH22 6  
ATOM 6715  N N    . GLY A 1 1  ? -3.721  -6.465  -24.566 1.00 0.00 ? 1  GLY A N    7  
ATOM 6716  C CA   . GLY A 1 1  ? -4.719  -6.504  -23.487 1.00 0.00 ? 1  GLY A CA   7  
ATOM 6717  C C    . GLY A 1 1  ? -4.858  -5.140  -22.836 1.00 0.00 ? 1  GLY A C    7  
ATOM 6718  O O    . GLY A 1 1  ? -3.974  -4.718  -22.085 1.00 0.00 ? 1  GLY A O    7  
ATOM 6719  H H1   . GLY A 1 1  ? -3.637  -7.309  -25.096 1.00 0.00 ? 1  GLY A H1   7  
ATOM 6720  H HA2  . GLY A 1 1  ? -5.681  -6.803  -23.900 1.00 0.00 ? 1  GLY A HA2  7  
ATOM 6721  H HA3  . GLY A 1 1  ? -4.406  -7.232  -22.739 1.00 0.00 ? 1  GLY A HA3  7  
ATOM 6722  N N    . SER A 1 2  ? -5.961  -4.434  -23.095 1.00 0.00 ? 2  SER A N    7  
ATOM 6723  C CA   . SER A 1 2  ? -6.201  -3.089  -22.596 1.00 0.00 ? 2  SER A CA   7  
ATOM 6724  C C    . SER A 1 2  ? -7.668  -2.951  -22.182 1.00 0.00 ? 2  SER A C    7  
ATOM 6725  O O    . SER A 1 2  ? -8.499  -3.822  -22.471 1.00 0.00 ? 2  SER A O    7  
ATOM 6726  C CB   . SER A 1 2  ? -5.717  -2.092  -23.659 1.00 0.00 ? 2  SER A CB   7  
ATOM 6727  O OG   . SER A 1 2  ? -5.885  -0.738  -23.287 1.00 0.00 ? 2  SER A OG   7  
ATOM 6728  H H    . SER A 1 2  ? -6.721  -4.807  -23.655 1.00 0.00 ? 2  SER A H    7  
ATOM 6729  H HA   . SER A 1 2  ? -5.608  -2.939  -21.699 1.00 0.00 ? 2  SER A HA   7  
ATOM 6730  H HB2  . SER A 1 2  ? -4.658  -2.274  -23.838 1.00 0.00 ? 2  SER A HB2  7  
ATOM 6731  H HB3  . SER A 1 2  ? -6.250  -2.257  -24.591 1.00 0.00 ? 2  SER A HB3  7  
ATOM 6732  H HG   . SER A 1 2  ? -6.642  -0.416  -23.831 1.00 0.00 ? 2  SER A HG   7  
ATOM 6733  N N    . SER A 1 3  ? -7.951  -1.895  -21.416 1.00 0.00 ? 3  SER A N    7  
ATOM 6734  C CA   . SER A 1 3  ? -9.108  -1.793  -20.536 1.00 0.00 ? 3  SER A CA   7  
ATOM 6735  C C    . SER A 1 3  ? -9.234  -3.019  -19.615 1.00 0.00 ? 3  SER A C    7  
ATOM 6736  O O    . SER A 1 3  ? -8.343  -3.877  -19.567 1.00 0.00 ? 3  SER A O    7  
ATOM 6737  C CB   . SER A 1 3  ? -10.362 -1.487  -21.363 1.00 0.00 ? 3  SER A CB   7  
ATOM 6738  O OG   . SER A 1 3  ? -10.191 -0.287  -22.094 1.00 0.00 ? 3  SER A OG   7  
ATOM 6739  H H    . SER A 1 3  ? -7.214  -1.222  -21.253 1.00 0.00 ? 3  SER A H    7  
ATOM 6740  H HA   . SER A 1 3  ? -8.932  -0.944  -19.879 1.00 0.00 ? 3  SER A HA   7  
ATOM 6741  H HB2  . SER A 1 3  ? -10.565 -2.309  -22.048 1.00 0.00 ? 3  SER A HB2  7  
ATOM 6742  H HB3  . SER A 1 3  ? -11.210 -1.354  -20.699 1.00 0.00 ? 3  SER A HB3  7  
ATOM 6743  H HG   . SER A 1 3  ? -9.969  0.404   -21.427 1.00 0.00 ? 3  SER A HG   7  
ATOM 6744  N N    . GLY A 1 4  ? -10.288 -3.071  -18.806 1.00 0.00 ? 4  GLY A N    7  
ATOM 6745  C CA   . GLY A 1 4  ? -10.478 -4.105  -17.801 1.00 0.00 ? 4  GLY A CA   7  
ATOM 6746  C C    . GLY A 1 4  ? -11.134 -5.341  -18.398 1.00 0.00 ? 4  GLY A C    7  
ATOM 6747  O O    . GLY A 1 4  ? -11.327 -5.449  -19.612 1.00 0.00 ? 4  GLY A O    7  
ATOM 6748  H H    . GLY A 1 4  ? -11.016 -2.370  -18.876 1.00 0.00 ? 4  GLY A H    7  
ATOM 6749  H HA2  . GLY A 1 4  ? -9.518  -4.383  -17.365 1.00 0.00 ? 4  GLY A HA2  7  
ATOM 6750  H HA3  . GLY A 1 4  ? -11.116 -3.713  -17.009 1.00 0.00 ? 4  GLY A HA3  7  
ATOM 6751  N N    . SER A 1 5  ? -11.497 -6.270  -17.522 1.00 0.00 ? 5  SER A N    7  
ATOM 6752  C CA   . SER A 1 5  ? -12.491 -7.291  -17.784 1.00 0.00 ? 5  SER A CA   7  
ATOM 6753  C C    . SER A 1 5  ? -13.214 -7.503  -16.459 1.00 0.00 ? 5  SER A C    7  
ATOM 6754  O O    . SER A 1 5  ? -12.568 -7.828  -15.456 1.00 0.00 ? 5  SER A O    7  
ATOM 6755  C CB   . SER A 1 5  ? -11.829 -8.564  -18.332 1.00 0.00 ? 5  SER A CB   7  
ATOM 6756  O OG   . SER A 1 5  ? -12.742 -9.649  -18.360 1.00 0.00 ? 5  SER A OG   7  
ATOM 6757  H H    . SER A 1 5  ? -11.278 -6.113  -16.541 1.00 0.00 ? 5  SER A H    7  
ATOM 6758  H HA   . SER A 1 5  ? -13.198 -6.918  -18.528 1.00 0.00 ? 5  SER A HA   7  
ATOM 6759  H HB2  . SER A 1 5  ? -11.471 -8.370  -19.345 1.00 0.00 ? 5  SER A HB2  7  
ATOM 6760  H HB3  . SER A 1 5  ? -10.979 -8.836  -17.707 1.00 0.00 ? 5  SER A HB3  7  
ATOM 6761  H HG   . SER A 1 5  ? -13.602 -9.295  -18.697 1.00 0.00 ? 5  SER A HG   7  
ATOM 6762  N N    . SER A 1 6  ? -14.534 -7.329  -16.475 1.00 0.00 ? 6  SER A N    7  
ATOM 6763  C CA   . SER A 1 6  ? -15.432 -7.432  -15.331 1.00 0.00 ? 6  SER A CA   7  
ATOM 6764  C C    . SER A 1 6  ? -15.120 -6.414  -14.228 1.00 0.00 ? 6  SER A C    7  
ATOM 6765  O O    . SER A 1 6  ? -14.119 -5.696  -14.274 1.00 0.00 ? 6  SER A O    7  
ATOM 6766  C CB   . SER A 1 6  ? -15.421 -8.862  -14.779 1.00 0.00 ? 6  SER A CB   7  
ATOM 6767  O OG   . SER A 1 6  ? -15.410 -9.833  -15.811 1.00 0.00 ? 6  SER A OG   7  
ATOM 6768  H H    . SER A 1 6  ? -14.958 -7.106  -17.364 1.00 0.00 ? 6  SER A H    7  
ATOM 6769  H HA   . SER A 1 6  ? -16.430 -7.213  -15.702 1.00 0.00 ? 6  SER A HA   7  
ATOM 6770  H HB2  . SER A 1 6  ? -14.531 -8.995  -14.164 1.00 0.00 ? 6  SER A HB2  7  
ATOM 6771  H HB3  . SER A 1 6  ? -16.301 -9.008  -14.155 1.00 0.00 ? 6  SER A HB3  7  
ATOM 6772  H HG   . SER A 1 6  ? -16.299 -9.845  -16.209 1.00 0.00 ? 6  SER A HG   7  
ATOM 6773  N N    . GLY A 1 7  ? -15.981 -6.354  -13.213 1.00 0.00 ? 7  GLY A N    7  
ATOM 6774  C CA   . GLY A 1 7  ? -15.815 -5.435  -12.105 1.00 0.00 ? 7  GLY A CA   7  
ATOM 6775  C C    . GLY A 1 7  ? -14.720 -5.887  -11.146 1.00 0.00 ? 7  GLY A C    7  
ATOM 6776  O O    . GLY A 1 7  ? -14.107 -6.949  -11.313 1.00 0.00 ? 7  GLY A O    7  
ATOM 6777  H H    . GLY A 1 7  ? -16.830 -6.904  -13.212 1.00 0.00 ? 7  GLY A H    7  
ATOM 6778  H HA2  . GLY A 1 7  ? -15.559 -4.453  -12.502 1.00 0.00 ? 7  GLY A HA2  7  
ATOM 6779  H HA3  . GLY A 1 7  ? -16.756 -5.364  -11.561 1.00 0.00 ? 7  GLY A HA3  7  
ATOM 6780  N N    . ARG A 1 8  ? -14.479 -5.073  -10.122 1.00 0.00 ? 8  ARG A N    7  
ATOM 6781  C CA   . ARG A 1 8  ? -13.588 -5.388  -9.008  1.00 0.00 ? 8  ARG A CA   7  
ATOM 6782  C C    . ARG A 1 8  ? -14.168 -6.567  -8.232  1.00 0.00 ? 8  ARG A C    7  
ATOM 6783  O O    . ARG A 1 8  ? -15.383 -6.628  -8.012  1.00 0.00 ? 8  ARG A O    7  
ATOM 6784  C CB   . ARG A 1 8  ? -13.435 -4.136  -8.130  1.00 0.00 ? 8  ARG A CB   7  
ATOM 6785  C CG   . ARG A 1 8  ? -12.472 -3.126  -8.783  1.00 0.00 ? 8  ARG A CG   7  
ATOM 6786  C CD   . ARG A 1 8  ? -12.924 -1.670  -8.623  1.00 0.00 ? 8  ARG A CD   7  
ATOM 6787  N NE   . ARG A 1 8  ? -13.886 -1.264  -9.661  1.00 0.00 ? 8  ARG A NE   7  
ATOM 6788  C CZ   . ARG A 1 8  ? -13.928 -0.062  -10.249 1.00 0.00 ? 8  ARG A CZ   7  
ATOM 6789  N NH1  . ARG A 1 8  ? -13.236 0.957   -9.757  1.00 0.00 ? 8  ARG A NH1  7  
ATOM 6790  N NH2  . ARG A 1 8  ? -14.678 0.130   -11.327 1.00 0.00 ? 8  ARG A NH2  7  
ATOM 6791  H H    . ARG A 1 8  ? -15.055 -4.238  -10.057 1.00 0.00 ? 8  ARG A H    7  
ATOM 6792  H HA   . ARG A 1 8  ? -12.606 -5.675  -9.398  1.00 0.00 ? 8  ARG A HA   7  
ATOM 6793  H HB2  . ARG A 1 8  ? -14.417 -3.686  -7.969  1.00 0.00 ? 8  ARG A HB2  7  
ATOM 6794  H HB3  . ARG A 1 8  ? -13.031 -4.420  -7.156  1.00 0.00 ? 8  ARG A HB3  7  
ATOM 6795  H HG2  . ARG A 1 8  ? -11.494 -3.243  -8.313  1.00 0.00 ? 8  ARG A HG2  7  
ATOM 6796  H HG3  . ARG A 1 8  ? -12.347 -3.335  -9.847  1.00 0.00 ? 8  ARG A HG3  7  
ATOM 6797  H HD2  . ARG A 1 8  ? -13.356 -1.514  -7.634  1.00 0.00 ? 8  ARG A HD2  7  
ATOM 6798  H HD3  . ARG A 1 8  ? -12.034 -1.054  -8.720  1.00 0.00 ? 8  ARG A HD3  7  
ATOM 6799  H HE   . ARG A 1 8  ? -14.498 -1.996  -10.011 1.00 0.00 ? 8  ARG A HE   7  
ATOM 6800  H HH11 . ARG A 1 8  ? -12.675 0.863   -8.910  1.00 0.00 ? 8  ARG A HH11 7  
ATOM 6801  H HH12 . ARG A 1 8  ? -13.146 1.840   -10.258 1.00 0.00 ? 8  ARG A HH12 7  
ATOM 6802  H HH21 . ARG A 1 8  ? -15.149 -0.640  -11.801 1.00 0.00 ? 8  ARG A HH21 7  
ATOM 6803  H HH22 . ARG A 1 8  ? -14.686 1.008   -11.837 1.00 0.00 ? 8  ARG A HH22 7  
ATOM 6804  N N    . GLY A 1 9  ? -13.318 -7.507  -7.838  1.00 0.00 ? 9  GLY A N    7  
ATOM 6805  C CA   . GLY A 1 9  ? -13.690 -8.798  -7.291  1.00 0.00 ? 9  GLY A CA   7  
ATOM 6806  C C    . GLY A 1 9  ? -13.016 -9.880  -8.116  1.00 0.00 ? 9  GLY A C    7  
ATOM 6807  O O    . GLY A 1 9  ? -13.628 -10.435 -9.036  1.00 0.00 ? 9  GLY A O    7  
ATOM 6808  H H    . GLY A 1 9  ? -12.318 -7.357  -7.962  1.00 0.00 ? 9  GLY A H    7  
ATOM 6809  H HA2  . GLY A 1 9  ? -13.366 -8.860  -6.252  1.00 0.00 ? 9  GLY A HA2  7  
ATOM 6810  H HA3  . GLY A 1 9  ? -14.768 -8.943  -7.340  1.00 0.00 ? 9  GLY A HA3  7  
ATOM 6811  N N    . ARG A 1 10 ? -11.750 -10.169 -7.822  1.00 0.00 ? 10 ARG A N    7  
ATOM 6812  C CA   . ARG A 1 10 ? -11.025 -11.329 -8.329  1.00 0.00 ? 10 ARG A CA   7  
ATOM 6813  C C    . ARG A 1 10 ? -10.025 -11.763 -7.258  1.00 0.00 ? 10 ARG A C    7  
ATOM 6814  O O    . ARG A 1 10 ? -9.781  -10.999 -6.326  1.00 0.00 ? 10 ARG A O    7  
ATOM 6815  C CB   . ARG A 1 10 ? -10.314 -10.945 -9.639  1.00 0.00 ? 10 ARG A CB   7  
ATOM 6816  C CG   . ARG A 1 10 ? -10.082 -12.141 -10.574 1.00 0.00 ? 10 ARG A CG   7  
ATOM 6817  C CD   . ARG A 1 10 ? -11.414 -12.547 -11.220 1.00 0.00 ? 10 ARG A CD   7  
ATOM 6818  N NE   . ARG A 1 10 ? -11.238 -13.522 -12.303 1.00 0.00 ? 10 ARG A NE   7  
ATOM 6819  C CZ   . ARG A 1 10 ? -10.865 -13.252 -13.560 1.00 0.00 ? 10 ARG A CZ   7  
ATOM 6820  N NH1  . ARG A 1 10 ? -10.522 -12.017 -13.915 1.00 0.00 ? 10 ARG A NH1  7  
ATOM 6821  N NH2  . ARG A 1 10 ? -10.839 -14.237 -14.446 1.00 0.00 ? 10 ARG A NH2  7  
ATOM 6822  H H    . ARG A 1 10 ? -11.269 -9.648  -7.093  1.00 0.00 ? 10 ARG A H    7  
ATOM 6823  H HA   . ARG A 1 10 ? -11.745 -12.131 -8.494  1.00 0.00 ? 10 ARG A HA   7  
ATOM 6824  H HB2  . ARG A 1 10 ? -10.902 -10.199 -10.176 1.00 0.00 ? 10 ARG A HB2  7  
ATOM 6825  H HB3  . ARG A 1 10 ? -9.360  -10.476 -9.402  1.00 0.00 ? 10 ARG A HB3  7  
ATOM 6826  H HG2  . ARG A 1 10 ? -9.374  -11.848 -11.347 1.00 0.00 ? 10 ARG A HG2  7  
ATOM 6827  H HG3  . ARG A 1 10 ? -9.650  -12.982 -10.035 1.00 0.00 ? 10 ARG A HG3  7  
ATOM 6828  H HD2  . ARG A 1 10 ? -12.065 -12.985 -10.464 1.00 0.00 ? 10 ARG A HD2  7  
ATOM 6829  H HD3  . ARG A 1 10 ? -11.907 -11.661 -11.620 1.00 0.00 ? 10 ARG A HD3  7  
ATOM 6830  H HE   . ARG A 1 10 ? -11.504 -14.475 -12.066 1.00 0.00 ? 10 ARG A HE   7  
ATOM 6831  H HH11 . ARG A 1 10 ? -10.443 -11.273 -13.227 1.00 0.00 ? 10 ARG A HH11 7  
ATOM 6832  H HH12 . ARG A 1 10 ? -10.144 -11.795 -14.835 1.00 0.00 ? 10 ARG A HH12 7  
ATOM 6833  H HH21 . ARG A 1 10 ? -10.931 -15.194 -14.113 1.00 0.00 ? 10 ARG A HH21 7  
ATOM 6834  H HH22 . ARG A 1 10 ? -10.582 -14.105 -15.427 1.00 0.00 ? 10 ARG A HH22 7  
ATOM 6835  N N    . TYR A 1 11 ? -9.430  -12.950 -7.400  1.00 0.00 ? 11 TYR A N    7  
ATOM 6836  C CA   . TYR A 1 11 ? -8.353  -13.449 -6.544  1.00 0.00 ? 11 TYR A CA   7  
ATOM 6837  C C    . TYR A 1 11 ? -8.735  -13.387 -5.053  1.00 0.00 ? 11 TYR A C    7  
ATOM 6838  O O    . TYR A 1 11 ? -9.927  -13.402 -4.707  1.00 0.00 ? 11 TYR A O    7  
ATOM 6839  C CB   . TYR A 1 11 ? -7.053  -12.696 -6.890  1.00 0.00 ? 11 TYR A CB   7  
ATOM 6840  C CG   . TYR A 1 11 ? -6.746  -12.594 -8.373  1.00 0.00 ? 11 TYR A CG   7  
ATOM 6841  C CD1  . TYR A 1 11 ? -6.368  -13.743 -9.090  1.00 0.00 ? 11 TYR A CD1  7  
ATOM 6842  C CD2  . TYR A 1 11 ? -6.818  -11.352 -9.032  1.00 0.00 ? 11 TYR A CD2  7  
ATOM 6843  C CE1  . TYR A 1 11 ? -6.022  -13.640 -10.447 1.00 0.00 ? 11 TYR A CE1  7  
ATOM 6844  C CE2  . TYR A 1 11 ? -6.512  -11.254 -10.402 1.00 0.00 ? 11 TYR A CE2  7  
ATOM 6845  C CZ   . TYR A 1 11 ? -6.095  -12.398 -11.115 1.00 0.00 ? 11 TYR A CZ   7  
ATOM 6846  O OH   . TYR A 1 11 ? -5.748  -12.297 -12.430 1.00 0.00 ? 11 TYR A OH   7  
ATOM 6847  H H    . TYR A 1 11 ? -9.702  -13.549 -8.164  1.00 0.00 ? 11 TYR A H    7  
ATOM 6848  H HA   . TYR A 1 11 ? -8.198  -14.499 -6.793  1.00 0.00 ? 11 TYR A HA   7  
ATOM 6849  H HB2  . TYR A 1 11 ? -7.104  -11.691 -6.469  1.00 0.00 ? 11 TYR A HB2  7  
ATOM 6850  H HB3  . TYR A 1 11 ? -6.215  -13.203 -6.418  1.00 0.00 ? 11 TYR A HB3  7  
ATOM 6851  H HD1  . TYR A 1 11 ? -6.317  -14.706 -8.595  1.00 0.00 ? 11 TYR A HD1  7  
ATOM 6852  H HD2  . TYR A 1 11 ? -7.088  -10.458 -8.485  1.00 0.00 ? 11 TYR A HD2  7  
ATOM 6853  H HE1  . TYR A 1 11 ? -5.705  -14.524 -10.973 1.00 0.00 ? 11 TYR A HE1  7  
ATOM 6854  H HE2  . TYR A 1 11 ? -6.557  -10.294 -10.893 1.00 0.00 ? 11 TYR A HE2  7  
ATOM 6855  H HH   . TYR A 1 11 ? -5.139  -13.025 -12.681 1.00 0.00 ? 11 TYR A HH   7  
ATOM 6856  N N    . ARG A 1 12 ? -7.755  -13.366 -4.148  1.00 0.00 ? 12 ARG A N    7  
ATOM 6857  C CA   . ARG A 1 12 ? -7.951  -13.004 -2.749  1.00 0.00 ? 12 ARG A CA   7  
ATOM 6858  C C    . ARG A 1 12 ? -7.048  -11.830 -2.413  1.00 0.00 ? 12 ARG A C    7  
ATOM 6859  O O    . ARG A 1 12 ? -6.058  -11.581 -3.108  1.00 0.00 ? 12 ARG A O    7  
ATOM 6860  C CB   . ARG A 1 12 ? -7.635  -14.197 -1.820  1.00 0.00 ? 12 ARG A CB   7  
ATOM 6861  C CG   . ARG A 1 12 ? -8.825  -14.581 -0.928  1.00 0.00 ? 12 ARG A CG   7  
ATOM 6862  C CD   . ARG A 1 12 ? -9.588  -15.776 -1.499  1.00 0.00 ? 12 ARG A CD   7  
ATOM 6863  N NE   . ARG A 1 12 ? -10.152 -15.531 -2.836  1.00 0.00 ? 12 ARG A NE   7  
ATOM 6864  C CZ   . ARG A 1 12 ? -10.431 -16.476 -3.738  1.00 0.00 ? 12 ARG A CZ   7  
ATOM 6865  N NH1  . ARG A 1 12 ? -10.221 -17.757 -3.446  1.00 0.00 ? 12 ARG A NH1  7  
ATOM 6866  N NH2  . ARG A 1 12 ? -10.981 -16.152 -4.898  1.00 0.00 ? 12 ARG A NH2  7  
ATOM 6867  H H    . ARG A 1 12 ? -6.788  -13.414 -4.455  1.00 0.00 ? 12 ARG A H    7  
ATOM 6868  H HA   . ARG A 1 12 ? -8.980  -12.666 -2.619  1.00 0.00 ? 12 ARG A HA   7  
ATOM 6869  H HB2  . ARG A 1 12 ? -7.302  -15.061 -2.400  1.00 0.00 ? 12 ARG A HB2  7  
ATOM 6870  H HB3  . ARG A 1 12 ? -6.805  -13.931 -1.163  1.00 0.00 ? 12 ARG A HB3  7  
ATOM 6871  H HG2  . ARG A 1 12 ? -8.438  -14.871 0.050   1.00 0.00 ? 12 ARG A HG2  7  
ATOM 6872  H HG3  . ARG A 1 12 ? -9.496  -13.734 -0.778  1.00 0.00 ? 12 ARG A HG3  7  
ATOM 6873  H HD2  . ARG A 1 12 ? -8.885  -16.605 -1.558  1.00 0.00 ? 12 ARG A HD2  7  
ATOM 6874  H HD3  . ARG A 1 12 ? -10.389 -16.043 -0.812  1.00 0.00 ? 12 ARG A HD3  7  
ATOM 6875  H HE   . ARG A 1 12 ? -10.197 -14.564 -3.151  1.00 0.00 ? 12 ARG A HE   7  
ATOM 6876  H HH11 . ARG A 1 12 ? -9.667  -18.001 -2.639  1.00 0.00 ? 12 ARG A HH11 7  
ATOM 6877  H HH12 . ARG A 1 12 ? -10.352 -18.484 -4.154  1.00 0.00 ? 12 ARG A HH12 7  
ATOM 6878  H HH21 . ARG A 1 12 ? -11.153 -15.177 -5.137  1.00 0.00 ? 12 ARG A HH21 7  
ATOM 6879  H HH22 . ARG A 1 12 ? -11.092 -16.827 -5.655  1.00 0.00 ? 12 ARG A HH22 7  
ATOM 6880  N N    . GLN A 1 13 ? -7.326  -11.225 -1.258  1.00 0.00 ? 13 GLN A N    7  
ATOM 6881  C CA   . GLN A 1 13 ? -6.620  -10.090 -0.681  1.00 0.00 ? 13 GLN A CA   7  
ATOM 6882  C C    . GLN A 1 13 ? -6.564  -8.893  -1.628  1.00 0.00 ? 13 GLN A C    7  
ATOM 6883  O O    . GLN A 1 13 ? -6.971  -8.954  -2.787  1.00 0.00 ? 13 GLN A O    7  
ATOM 6884  C CB   . GLN A 1 13 ? -5.210  -10.493 -0.221  1.00 0.00 ? 13 GLN A CB   7  
ATOM 6885  C CG   . GLN A 1 13 ? -5.229  -11.561 0.871   1.00 0.00 ? 13 GLN A CG   7  
ATOM 6886  C CD   . GLN A 1 13 ? -3.800  -11.893 1.253   1.00 0.00 ? 13 GLN A CD   7  
ATOM 6887  O OE1  . GLN A 1 13 ? -3.237  -11.328 2.183   1.00 0.00 ? 13 GLN A OE1  7  
ATOM 6888  N NE2  . GLN A 1 13 ? -3.172  -12.760 0.487   1.00 0.00 ? 13 GLN A NE2  7  
ATOM 6889  H H    . GLN A 1 13 ? -8.184  -11.484 -0.799  1.00 0.00 ? 13 GLN A H    7  
ATOM 6890  H HA   . GLN A 1 13 ? -7.169  -9.792  0.206   1.00 0.00 ? 13 GLN A HA   7  
ATOM 6891  H HB2  . GLN A 1 13 ? -4.630  -10.852 -1.073  1.00 0.00 ? 13 GLN A HB2  7  
ATOM 6892  H HB3  . GLN A 1 13 ? -4.697  -9.621  0.186   1.00 0.00 ? 13 GLN A HB3  7  
ATOM 6893  H HG2  . GLN A 1 13 ? -5.752  -11.174 1.742   1.00 0.00 ? 13 GLN A HG2  7  
ATOM 6894  H HG3  . GLN A 1 13 ? -5.733  -12.465 0.526   1.00 0.00 ? 13 GLN A HG3  7  
ATOM 6895  H HE21 . GLN A 1 13 ? -3.688  -13.191 -0.277  1.00 0.00 ? 13 GLN A HE21 7  
ATOM 6896  H HE22 . GLN A 1 13 ? -2.222  -13.026 0.705   1.00 0.00 ? 13 GLN A HE22 7  
ATOM 6897  N N    . TYR A 1 14 ? -6.016  -7.787  -1.138  1.00 0.00 ? 14 TYR A N    7  
ATOM 6898  C CA   . TYR A 1 14 ? -5.647  -6.689  -2.005  1.00 0.00 ? 14 TYR A CA   7  
ATOM 6899  C C    . TYR A 1 14 ? -4.567  -7.139  -3.000  1.00 0.00 ? 14 TYR A C    7  
ATOM 6900  O O    . TYR A 1 14 ? -3.775  -8.052  -2.717  1.00 0.00 ? 14 TYR A O    7  
ATOM 6901  C CB   . TYR A 1 14 ? -5.184  -5.516  -1.145  1.00 0.00 ? 14 TYR A CB   7  
ATOM 6902  C CG   . TYR A 1 14 ? -3.746  -5.578  -0.659  1.00 0.00 ? 14 TYR A CG   7  
ATOM 6903  C CD1  . TYR A 1 14 ? -2.717  -5.122  -1.505  1.00 0.00 ? 14 TYR A CD1  7  
ATOM 6904  C CD2  . TYR A 1 14 ? -3.432  -6.041  0.634   1.00 0.00 ? 14 TYR A CD2  7  
ATOM 6905  C CE1  . TYR A 1 14 ? -1.376  -5.220  -1.114  1.00 0.00 ? 14 TYR A CE1  7  
ATOM 6906  C CE2  . TYR A 1 14 ? -2.091  -6.132  1.046   1.00 0.00 ? 14 TYR A CE2  7  
ATOM 6907  C CZ   . TYR A 1 14 ? -1.062  -5.740  0.161   1.00 0.00 ? 14 TYR A CZ   7  
ATOM 6908  O OH   . TYR A 1 14 ? 0.232   -5.844  0.553   1.00 0.00 ? 14 TYR A OH   7  
ATOM 6909  H H    . TYR A 1 14 ? -5.782  -7.736  -0.158  1.00 0.00 ? 14 TYR A H    7  
ATOM 6910  H HA   . TYR A 1 14 ? -6.536  -6.382  -2.559  1.00 0.00 ? 14 TYR A HA   7  
ATOM 6911  H HB2  . TYR A 1 14 ? -5.285  -4.628  -1.753  1.00 0.00 ? 14 TYR A HB2  7  
ATOM 6912  H HB3  . TYR A 1 14 ? -5.866  -5.403  -0.300  1.00 0.00 ? 14 TYR A HB3  7  
ATOM 6913  H HD1  . TYR A 1 14 ? -2.948  -4.664  -2.457  1.00 0.00 ? 14 TYR A HD1  7  
ATOM 6914  H HD2  . TYR A 1 14 ? -4.217  -6.272  1.338   1.00 0.00 ? 14 TYR A HD2  7  
ATOM 6915  H HE1  . TYR A 1 14 ? -0.617  -4.882  -1.810  1.00 0.00 ? 14 TYR A HE1  7  
ATOM 6916  H HE2  . TYR A 1 14 ? -1.850  -6.478  2.043   1.00 0.00 ? 14 TYR A HE2  7  
ATOM 6917  H HH   . TYR A 1 14 ? 0.512   -6.778  0.503   1.00 0.00 ? 14 TYR A HH   7  
ATOM 6918  N N    . ASN A 1 15 ? -4.489  -6.446  -4.133  1.00 0.00 ? 15 ASN A N    7  
ATOM 6919  C CA   . ASN A 1 15 ? -3.478  -6.601  -5.173  1.00 0.00 ? 15 ASN A CA   7  
ATOM 6920  C C    . ASN A 1 15 ? -2.625  -5.345  -5.320  1.00 0.00 ? 15 ASN A C    7  
ATOM 6921  O O    . ASN A 1 15 ? -3.005  -4.286  -4.832  1.00 0.00 ? 15 ASN A O    7  
ATOM 6922  C CB   . ASN A 1 15 ? -4.069  -7.044  -6.509  1.00 0.00 ? 15 ASN A CB   7  
ATOM 6923  C CG   . ASN A 1 15 ? -4.851  -5.996  -7.278  1.00 0.00 ? 15 ASN A CG   7  
ATOM 6924  O OD1  . ASN A 1 15 ? -5.930  -5.614  -6.869  1.00 0.00 ? 15 ASN A OD1  7  
ATOM 6925  N ND2  . ASN A 1 15 ? -4.352  -5.511  -8.400  1.00 0.00 ? 15 ASN A ND2  7  
ATOM 6926  H H    . ASN A 1 15 ? -5.162  -5.709  -4.289  1.00 0.00 ? 15 ASN A H    7  
ATOM 6927  H HA   . ASN A 1 15 ? -2.806  -7.393  -4.859  1.00 0.00 ? 15 ASN A HA   7  
ATOM 6928  H HB2  . ASN A 1 15 ? -3.218  -7.280  -7.108  1.00 0.00 ? 15 ASN A HB2  7  
ATOM 6929  H HB3  . ASN A 1 15 ? -4.672  -7.942  -6.384  1.00 0.00 ? 15 ASN A HB3  7  
ATOM 6930  H HD21 . ASN A 1 15 ? -3.500  -5.925  -8.786  1.00 0.00 ? 15 ASN A HD21 7  
ATOM 6931  H HD22 . ASN A 1 15 ? -4.938  -4.922  -8.989  1.00 0.00 ? 15 ASN A HD22 7  
ATOM 6932  N N    . SER A 1 16 ? -1.435  -5.452  -5.908  1.00 0.00 ? 16 SER A N    7  
ATOM 6933  C CA   . SER A 1 16 ? -0.458  -4.366  -5.977  1.00 0.00 ? 16 SER A CA   7  
ATOM 6934  C C    . SER A 1 16 ? -1.001  -3.079  -6.610  1.00 0.00 ? 16 SER A C    7  
ATOM 6935  O O    . SER A 1 16 ? -0.458  -2.003  -6.367  1.00 0.00 ? 16 SER A O    7  
ATOM 6936  C CB   . SER A 1 16 ? 0.780   -4.865  -6.729  1.00 0.00 ? 16 SER A CB   7  
ATOM 6937  O OG   . SER A 1 16 ? 0.471   -5.415  -7.996  1.00 0.00 ? 16 SER A OG   7  
ATOM 6938  H H    . SER A 1 16 ? -1.149  -6.347  -6.294  1.00 0.00 ? 16 SER A H    7  
ATOM 6939  H HA   . SER A 1 16 ? -0.152  -4.125  -4.958  1.00 0.00 ? 16 SER A HA   7  
ATOM 6940  H HB2  . SER A 1 16 ? 1.499   -4.053  -6.844  1.00 0.00 ? 16 SER A HB2  7  
ATOM 6941  H HB3  . SER A 1 16 ? 1.233   -5.653  -6.149  1.00 0.00 ? 16 SER A HB3  7  
ATOM 6942  H HG   . SER A 1 16 ? 0.682   -4.712  -8.645  1.00 0.00 ? 16 SER A HG   7  
ATOM 6943  N N    . GLU A 1 17 ? -2.054  -3.177  -7.419  1.00 0.00 ? 17 GLU A N    7  
ATOM 6944  C CA   . GLU A 1 17 ? -2.679  -2.043  -8.085  1.00 0.00 ? 17 GLU A CA   7  
ATOM 6945  C C    . GLU A 1 17 ? -3.802  -1.474  -7.219  1.00 0.00 ? 17 GLU A C    7  
ATOM 6946  O O    . GLU A 1 17 ? -3.927  -0.255  -7.145  1.00 0.00 ? 17 GLU A O    7  
ATOM 6947  C CB   . GLU A 1 17 ? -3.206  -2.464  -9.457  1.00 0.00 ? 17 GLU A CB   7  
ATOM 6948  C CG   . GLU A 1 17 ? -2.145  -3.160  -10.329 1.00 0.00 ? 17 GLU A CG   7  
ATOM 6949  C CD   . GLU A 1 17 ? -2.767  -3.856  -11.542 1.00 0.00 ? 17 GLU A CD   7  
ATOM 6950  O OE1  . GLU A 1 17 ? -3.799  -3.398  -12.082 1.00 0.00 ? 17 GLU A OE1  7  
ATOM 6951  O OE2  . GLU A 1 17 ? -2.246  -4.920  -11.953 1.00 0.00 ? 17 GLU A OE2  7  
ATOM 6952  H H    . GLU A 1 17 ? -2.415  -4.103  -7.598  1.00 0.00 ? 17 GLU A H    7  
ATOM 6953  H HA   . GLU A 1 17 ? -1.936  -1.259  -8.232  1.00 0.00 ? 17 GLU A HA   7  
ATOM 6954  H HB2  . GLU A 1 17 ? -4.045  -3.135  -9.304  1.00 0.00 ? 17 GLU A HB2  7  
ATOM 6955  H HB3  . GLU A 1 17 ? -3.575  -1.582  -9.981  1.00 0.00 ? 17 GLU A HB3  7  
ATOM 6956  H HG2  . GLU A 1 17 ? -1.422  -2.420  -10.668 1.00 0.00 ? 17 GLU A HG2  7  
ATOM 6957  H HG3  . GLU A 1 17 ? -1.600  -3.914  -9.746  1.00 0.00 ? 17 GLU A HG3  7  
ATOM 6958  N N    . ILE A 1 18 ? -4.566  -2.321  -6.510  1.00 0.00 ? 18 ILE A N    7  
ATOM 6959  C CA   . ILE A 1 18 ? -5.378  -1.895  -5.378  1.00 0.00 ? 18 ILE A CA   7  
ATOM 6960  C C    . ILE A 1 18 ? -4.509  -1.080  -4.435  1.00 0.00 ? 18 ILE A C    7  
ATOM 6961  O O    . ILE A 1 18 ? -4.917  0.002   -4.046  1.00 0.00 ? 18 ILE A O    7  
ATOM 6962  C CB   . ILE A 1 18 ? -6.035  -3.116  -4.692  1.00 0.00 ? 18 ILE A CB   7  
ATOM 6963  C CG1  . ILE A 1 18 ? -7.302  -3.498  -5.470  1.00 0.00 ? 18 ILE A CG1  7  
ATOM 6964  C CG2  . ILE A 1 18 ? -6.400  -2.846  -3.213  1.00 0.00 ? 18 ILE A CG2  7  
ATOM 6965  C CD1  . ILE A 1 18 ? -8.559  -2.701  -5.135  1.00 0.00 ? 18 ILE A CD1  7  
ATOM 6966  H H    . ILE A 1 18 ? -4.472  -3.319  -6.632  1.00 0.00 ? 18 ILE A H    7  
ATOM 6967  H HA   . ILE A 1 18 ? -6.165  -1.223  -5.721  1.00 0.00 ? 18 ILE A HA   7  
ATOM 6968  H HB   . ILE A 1 18 ? -5.340  -3.978  -4.747  1.00 0.00 ? 18 ILE A HB   7  
ATOM 6969  H HG12 . ILE A 1 18 ? -7.117  -3.398  -6.540  1.00 0.00 ? 18 ILE A HG12 7  
ATOM 6970  H HG13 . ILE A 1 18 ? -7.500  -4.543  -5.263  1.00 0.00 ? 18 ILE A HG13 7  
ATOM 6971  H HG21 . ILE A 1 18 ? -6.977  -3.673  -2.802  1.00 0.00 ? 18 ILE A HG21 7  
ATOM 6972  H HG22 . ILE A 1 18 ? -5.497  -2.709  -2.623  1.00 0.00 ? 18 ILE A HG22 7  
ATOM 6973  H HG23 . ILE A 1 18 ? -6.990  -1.933  -3.096  1.00 0.00 ? 18 ILE A HG23 7  
ATOM 6974  H HD11 . ILE A 1 18 ? -9.322  -2.981  -5.854  1.00 0.00 ? 18 ILE A HD11 7  
ATOM 6975  H HD12 . ILE A 1 18 ? -8.902  -2.958  -4.132  1.00 0.00 ? 18 ILE A HD12 7  
ATOM 6976  H HD13 . ILE A 1 18 ? -8.359  -1.630  -5.188  1.00 0.00 ? 18 ILE A HD13 7  
ATOM 6977  N N    . LEU A 1 19 ? -3.351  -1.582  -4.020  1.00 0.00 ? 19 LEU A N    7  
ATOM 6978  C CA   . LEU A 1 19 ? -2.539  -0.974  -2.970  1.00 0.00 ? 19 LEU A CA   7  
ATOM 6979  C C    . LEU A 1 19 ? -2.227  0.501   -3.265  1.00 0.00 ? 19 LEU A C    7  
ATOM 6980  O O    . LEU A 1 19 ? -2.290  1.333   -2.362  1.00 0.00 ? 19 LEU A O    7  
ATOM 6981  C CB   . LEU A 1 19 ? -1.288  -1.840  -2.789  1.00 0.00 ? 19 LEU A CB   7  
ATOM 6982  C CG   . LEU A 1 19 ? -0.193  -1.217  -1.914  1.00 0.00 ? 19 LEU A CG   7  
ATOM 6983  C CD1  . LEU A 1 19 ? -0.688  -1.012  -0.475  1.00 0.00 ? 19 LEU A CD1  7  
ATOM 6984  C CD2  . LEU A 1 19 ? 0.993   -2.178  -1.961  1.00 0.00 ? 19 LEU A CD2  7  
ATOM 6985  H H    . LEU A 1 19 ? -3.090  -2.490  -4.388  1.00 0.00 ? 19 LEU A H    7  
ATOM 6986  H HA   . LEU A 1 19 ? -3.106  -1.002  -2.036  1.00 0.00 ? 19 LEU A HA   7  
ATOM 6987  H HB2  . LEU A 1 19 ? -1.607  -2.775  -2.341  1.00 0.00 ? 19 LEU A HB2  7  
ATOM 6988  H HB3  . LEU A 1 19 ? -0.861  -2.097  -3.756  1.00 0.00 ? 19 LEU A HB3  7  
ATOM 6989  H HG   . LEU A 1 19 ? 0.129   -0.266  -2.331  1.00 0.00 ? 19 LEU A HG   7  
ATOM 6990  H HD11 . LEU A 1 19 ? 0.137   -0.701  0.166   1.00 0.00 ? 19 LEU A HD11 7  
ATOM 6991  H HD12 . LEU A 1 19 ? -1.422  -0.204  -0.456  1.00 0.00 ? 19 LEU A HD12 7  
ATOM 6992  H HD13 . LEU A 1 19 ? -1.166  -1.913  -0.094  1.00 0.00 ? 19 LEU A HD13 7  
ATOM 6993  H HD21 . LEU A 1 19 ? 1.784   -1.822  -1.305  1.00 0.00 ? 19 LEU A HD21 7  
ATOM 6994  H HD22 . LEU A 1 19 ? 0.671   -3.180  -1.684  1.00 0.00 ? 19 LEU A HD22 7  
ATOM 6995  H HD23 . LEU A 1 19 ? 1.386   -2.212  -2.979  1.00 0.00 ? 19 LEU A HD23 7  
ATOM 6996  N N    . GLU A 1 20 ? -1.944  0.831   -4.524  1.00 0.00 ? 20 GLU A N    7  
ATOM 6997  C CA   . GLU A 1 20 ? -1.646  2.197   -4.953  1.00 0.00 ? 20 GLU A CA   7  
ATOM 6998  C C    . GLU A 1 20 ? -2.851  3.132   -4.755  1.00 0.00 ? 20 GLU A C    7  
ATOM 6999  O O    . GLU A 1 20 ? -2.659  4.327   -4.538  1.00 0.00 ? 20 GLU A O    7  
ATOM 7000  C CB   . GLU A 1 20 ? -1.205  2.183   -6.424  1.00 0.00 ? 20 GLU A CB   7  
ATOM 7001  C CG   . GLU A 1 20 ? 0.106   1.409   -6.667  1.00 0.00 ? 20 GLU A CG   7  
ATOM 7002  C CD   . GLU A 1 20 ? 1.367   2.278   -6.599  1.00 0.00 ? 20 GLU A CD   7  
ATOM 7003  O OE1  . GLU A 1 20 ? 1.508   3.189   -7.452  1.00 0.00 ? 20 GLU A OE1  7  
ATOM 7004  O OE2  . GLU A 1 20 ? 2.281   1.919   -5.814  1.00 0.00 ? 20 GLU A OE2  7  
ATOM 7005  H H    . GLU A 1 20 ? -1.974  0.110   -5.231  1.00 0.00 ? 20 GLU A H    7  
ATOM 7006  H HA   . GLU A 1 20 ? -0.819  2.577   -4.352  1.00 0.00 ? 20 GLU A HA   7  
ATOM 7007  H HB2  . GLU A 1 20 ? -1.994  1.713   -7.013  1.00 0.00 ? 20 GLU A HB2  7  
ATOM 7008  H HB3  . GLU A 1 20 ? -1.098  3.209   -6.781  1.00 0.00 ? 20 GLU A HB3  7  
ATOM 7009  H HG2  . GLU A 1 20 ? 0.194   0.582   -5.960  1.00 0.00 ? 20 GLU A HG2  7  
ATOM 7010  H HG3  . GLU A 1 20 ? 0.060   0.974   -7.666  1.00 0.00 ? 20 GLU A HG3  7  
ATOM 7011  N N    . GLU A 1 21 ? -4.079  2.607   -4.781  1.00 0.00 ? 21 GLU A N    7  
ATOM 7012  C CA   . GLU A 1 21 ? -5.315  3.302   -4.476  1.00 0.00 ? 21 GLU A CA   7  
ATOM 7013  C C    . GLU A 1 21 ? -5.304  3.794   -3.035  1.00 0.00 ? 21 GLU A C    7  
ATOM 7014  O O    . GLU A 1 21 ? -5.400  4.996   -2.805  1.00 0.00 ? 21 GLU A O    7  
ATOM 7015  C CB   . GLU A 1 21 ? -6.508  2.413   -4.714  1.00 0.00 ? 21 GLU A CB   7  
ATOM 7016  C CG   . GLU A 1 21 ? -6.676  1.776   -6.103  1.00 0.00 ? 21 GLU A CG   7  
ATOM 7017  C CD   . GLU A 1 21 ? -7.598  2.590   -7.004  1.00 0.00 ? 21 GLU A CD   7  
ATOM 7018  O OE1  . GLU A 1 21 ? -8.757  2.828   -6.588  1.00 0.00 ? 21 GLU A OE1  7  
ATOM 7019  O OE2  . GLU A 1 21 ? -7.168  3.036   -8.089  1.00 0.00 ? 21 GLU A OE2  7  
ATOM 7020  H H    . GLU A 1 21 ? -4.183  1.611   -4.928  1.00 0.00 ? 21 GLU A H    7  
ATOM 7021  H HA   . GLU A 1 21 ? -5.517  4.148   -5.116  1.00 0.00 ? 21 GLU A HA   7  
ATOM 7022  H HB2  . GLU A 1 21 ? -6.570  1.641   -3.954  1.00 0.00 ? 21 GLU A HB2  7  
ATOM 7023  H HB3  . GLU A 1 21 ? -7.305  3.112   -4.543  1.00 0.00 ? 21 GLU A HB3  7  
ATOM 7024  H HG2  . GLU A 1 21 ? -5.715  1.620   -6.583  1.00 0.00 ? 21 GLU A HG2  7  
ATOM 7025  H HG3  . GLU A 1 21 ? -7.132  0.801   -5.962  1.00 0.00 ? 21 GLU A HG3  7  
ATOM 7026  N N    . ALA A 1 22 ? -5.211  2.882   -2.058  1.00 0.00 ? 22 ALA A N    7  
ATOM 7027  C CA   . ALA A 1 22 ? -5.227  3.250   -0.639  1.00 0.00 ? 22 ALA A CA   7  
ATOM 7028  C C    . ALA A 1 22 ? -4.033  4.111   -0.245  1.00 0.00 ? 22 ALA A C    7  
ATOM 7029  O O    . ALA A 1 22 ? -4.063  4.744   0.808   1.00 0.00 ? 22 ALA A O    7  
ATOM 7030  C CB   . ALA A 1 22 ? -5.248  2.032   0.270   1.00 0.00 ? 22 ALA A CB   7  
ATOM 7031  H H    . ALA A 1 22 ? -5.116  1.910   -2.334  1.00 0.00 ? 22 ALA A H    7  
ATOM 7032  H HA   . ALA A 1 22 ? -6.140  3.804   -0.438  1.00 0.00 ? 22 ALA A HA   7  
ATOM 7033  H HB1  . ALA A 1 22 ? -6.158  1.484   0.092   1.00 0.00 ? 22 ALA A HB1  7  
ATOM 7034  H HB2  . ALA A 1 22 ? -4.376  1.402   0.079   1.00 0.00 ? 22 ALA A HB2  7  
ATOM 7035  H HB3  . ALA A 1 22 ? -5.258  2.357   1.308   1.00 0.00 ? 22 ALA A HB3  7  
ATOM 7036  N N    . ILE A 1 23 ? -2.992  4.134   -1.067  1.00 0.00 ? 23 ILE A N    7  
ATOM 7037  C CA   . ILE A 1 23 ? -1.904  5.087   -0.926  1.00 0.00 ? 23 ILE A CA   7  
ATOM 7038  C C    . ILE A 1 23 ? -2.439  6.429   -1.407  1.00 0.00 ? 23 ILE A C    7  
ATOM 7039  O O    . ILE A 1 23 ? -2.552  7.358   -0.612  1.00 0.00 ? 23 ILE A O    7  
ATOM 7040  C CB   . ILE A 1 23 ? -0.665  4.517   -1.648  1.00 0.00 ? 23 ILE A CB   7  
ATOM 7041  C CG1  . ILE A 1 23 ? -0.101  3.456   -0.690  1.00 0.00 ? 23 ILE A CG1  7  
ATOM 7042  C CG2  . ILE A 1 23 ? 0.416   5.545   -1.987  1.00 0.00 ? 23 ILE A CG2  7  
ATOM 7043  C CD1  . ILE A 1 23 ? 0.772   2.392   -1.359  1.00 0.00 ? 23 ILE A CD1  7  
ATOM 7044  H H    . ILE A 1 23 ? -3.061  3.560   -1.904  1.00 0.00 ? 23 ILE A H    7  
ATOM 7045  H HA   . ILE A 1 23 ? -1.671  5.207   0.132   1.00 0.00 ? 23 ILE A HA   7  
ATOM 7046  H HB   . ILE A 1 23 ? -0.983  4.043   -2.575  1.00 0.00 ? 23 ILE A HB   7  
ATOM 7047  H HG12 . ILE A 1 23 ? 0.498   3.961   0.068   1.00 0.00 ? 23 ILE A HG12 7  
ATOM 7048  H HG13 . ILE A 1 23 ? -0.939  2.958   -0.178  1.00 0.00 ? 23 ILE A HG13 7  
ATOM 7049  H HG21 . ILE A 1 23 ? 1.262   5.053   -2.463  1.00 0.00 ? 23 ILE A HG21 7  
ATOM 7050  H HG22 . ILE A 1 23 ? 0.027   6.269   -2.703  1.00 0.00 ? 23 ILE A HG22 7  
ATOM 7051  H HG23 . ILE A 1 23 ? 0.752   6.063   -1.089  1.00 0.00 ? 23 ILE A HG23 7  
ATOM 7052  H HD11 . ILE A 1 23 ? 1.779   2.770   -1.497  1.00 0.00 ? 23 ILE A HD11 7  
ATOM 7053  H HD12 . ILE A 1 23 ? 0.852   1.520   -0.709  1.00 0.00 ? 23 ILE A HD12 7  
ATOM 7054  H HD13 . ILE A 1 23 ? 0.337   2.102   -2.313  1.00 0.00 ? 23 ILE A HD13 7  
ATOM 7055  N N    . SER A 1 24 ? -2.840  6.505   -2.668  1.00 0.00 ? 24 SER A N    7  
ATOM 7056  C CA   . SER A 1 24 ? -3.316  7.710   -3.323  1.00 0.00 ? 24 SER A CA   7  
ATOM 7057  C C    . SER A 1 24 ? -4.389  8.477   -2.527  1.00 0.00 ? 24 SER A C    7  
ATOM 7058  O O    . SER A 1 24 ? -4.241  9.691   -2.370  1.00 0.00 ? 24 SER A O    7  
ATOM 7059  C CB   . SER A 1 24 ? -3.756  7.326   -4.735  1.00 0.00 ? 24 SER A CB   7  
ATOM 7060  O OG   . SER A 1 24 ? -2.624  6.866   -5.459  1.00 0.00 ? 24 SER A OG   7  
ATOM 7061  H H    . SER A 1 24 ? -2.773  5.665   -3.236  1.00 0.00 ? 24 SER A H    7  
ATOM 7062  H HA   . SER A 1 24 ? -2.462  8.381   -3.417  1.00 0.00 ? 24 SER A HA   7  
ATOM 7063  H HB2  . SER A 1 24 ? -4.517  6.543   -4.700  1.00 0.00 ? 24 SER A HB2  7  
ATOM 7064  H HB3  . SER A 1 24 ? -4.171  8.199   -5.227  1.00 0.00 ? 24 SER A HB3  7  
ATOM 7065  H HG   . SER A 1 24 ? -2.565  5.902   -5.307  1.00 0.00 ? 24 SER A HG   7  
ATOM 7066  N N    . VAL A 1 25 ? -5.413  7.820   -1.962  1.00 0.00 ? 25 VAL A N    7  
ATOM 7067  C CA   . VAL A 1 25 ? -6.387  8.473   -1.079  1.00 0.00 ? 25 VAL A CA   7  
ATOM 7068  C C    . VAL A 1 25 ? -5.684  9.145   0.104   1.00 0.00 ? 25 VAL A C    7  
ATOM 7069  O O    . VAL A 1 25 ? -5.810  10.350  0.289   1.00 0.00 ? 25 VAL A O    7  
ATOM 7070  C CB   . VAL A 1 25 ? -7.496  7.489   -0.619  1.00 0.00 ? 25 VAL A CB   7  
ATOM 7071  C CG1  . VAL A 1 25 ? -8.697  7.536   -1.560  1.00 0.00 ? 25 VAL A CG1  7  
ATOM 7072  C CG2  . VAL A 1 25 ? -7.031  6.075   -0.380  1.00 0.00 ? 25 VAL A CG2  7  
ATOM 7073  H H    . VAL A 1 25 ? -5.504  6.819   -2.105  1.00 0.00 ? 25 VAL A H    7  
ATOM 7074  H HA   . VAL A 1 25 ? -6.855  9.272   -1.655  1.00 0.00 ? 25 VAL A HA   7  
ATOM 7075  H HB   . VAL A 1 25 ? -7.877  7.725   0.363   1.00 0.00 ? 25 VAL A HB   7  
ATOM 7076  H HG11 . VAL A 1 25 ? -9.472  6.859   -1.202  1.00 0.00 ? 25 VAL A HG11 7  
ATOM 7077  H HG12 . VAL A 1 25 ? -9.104  8.545   -1.569  1.00 0.00 ? 25 VAL A HG12 7  
ATOM 7078  H HG13 . VAL A 1 25 ? -8.390  7.257   -2.569  1.00 0.00 ? 25 VAL A HG13 7  
ATOM 7079  H HG21 . VAL A 1 25 ? -7.608  5.659   0.439   1.00 0.00 ? 25 VAL A HG21 7  
ATOM 7080  H HG22 . VAL A 1 25 ? -7.182  5.491   -1.278  1.00 0.00 ? 25 VAL A HG22 7  
ATOM 7081  H HG23 . VAL A 1 25 ? -5.991  6.067   -0.082  1.00 0.00 ? 25 VAL A HG23 7  
ATOM 7082  N N    . VAL A 1 26 ? -4.971  8.379   0.920   1.00 0.00 ? 26 VAL A N    7  
ATOM 7083  C CA   . VAL A 1 26 ? -4.262  8.819   2.118   1.00 0.00 ? 26 VAL A CA   7  
ATOM 7084  C C    . VAL A 1 26 ? -3.332  9.982   1.770   1.00 0.00 ? 26 VAL A C    7  
ATOM 7085  O O    . VAL A 1 26 ? -3.341  10.996  2.472   1.00 0.00 ? 26 VAL A O    7  
ATOM 7086  C CB   . VAL A 1 26 ? -3.516  7.609   2.726   1.00 0.00 ? 26 VAL A CB   7  
ATOM 7087  C CG1  . VAL A 1 26 ? -2.643  7.976   3.931   1.00 0.00 ? 26 VAL A CG1  7  
ATOM 7088  C CG2  . VAL A 1 26 ? -4.512  6.538   3.190   1.00 0.00 ? 26 VAL A CG2  7  
ATOM 7089  H H    . VAL A 1 26 ? -4.840  7.425   0.637   1.00 0.00 ? 26 VAL A H    7  
ATOM 7090  H HA   . VAL A 1 26 ? -4.986  9.182   2.844   1.00 0.00 ? 26 VAL A HA   7  
ATOM 7091  H HB   . VAL A 1 26 ? -2.871  7.166   1.969   1.00 0.00 ? 26 VAL A HB   7  
ATOM 7092  H HG11 . VAL A 1 26 ? -1.821  8.609   3.600   1.00 0.00 ? 26 VAL A HG11 7  
ATOM 7093  H HG12 . VAL A 1 26 ? -3.230  8.506   4.683   1.00 0.00 ? 26 VAL A HG12 7  
ATOM 7094  H HG13 . VAL A 1 26 ? -2.212  7.075   4.365   1.00 0.00 ? 26 VAL A HG13 7  
ATOM 7095  H HG21 . VAL A 1 26 ? -3.970  5.617   3.416   1.00 0.00 ? 26 VAL A HG21 7  
ATOM 7096  H HG22 . VAL A 1 26 ? -5.060  6.889   4.060   1.00 0.00 ? 26 VAL A HG22 7  
ATOM 7097  H HG23 . VAL A 1 26 ? -5.219  6.307   2.397   1.00 0.00 ? 26 VAL A HG23 7  
ATOM 7098  N N    . MET A 1 27 ? -2.582  9.866   0.677   1.00 0.00 ? 27 MET A N    7  
ATOM 7099  C CA   . MET A 1 27 ? -1.645  10.868  0.219   1.00 0.00 ? 27 MET A CA   7  
ATOM 7100  C C    . MET A 1 27 ? -2.332  12.191  -0.067  1.00 0.00 ? 27 MET A C    7  
ATOM 7101  O O    . MET A 1 27 ? -2.054  13.188  0.603   1.00 0.00 ? 27 MET A O    7  
ATOM 7102  C CB   . MET A 1 27 ? -0.901  10.358  -1.012  1.00 0.00 ? 27 MET A CB   7  
ATOM 7103  C CG   . MET A 1 27 ? 0.088   9.273   -0.613  1.00 0.00 ? 27 MET A CG   7  
ATOM 7104  S SD   . MET A 1 27 ? 1.146   8.814   -1.989  1.00 0.00 ? 27 MET A SD   7  
ATOM 7105  C CE   . MET A 1 27 ? 2.701   9.134   -1.166  1.00 0.00 ? 27 MET A CE   7  
ATOM 7106  H H    . MET A 1 27 ? -2.593  8.999   0.146   1.00 0.00 ? 27 MET A H    7  
ATOM 7107  H HA   . MET A 1 27 ? -0.941  11.032  1.026   1.00 0.00 ? 27 MET A HA   7  
ATOM 7108  H HB2  . MET A 1 27 ? -1.601  9.968   -1.751  1.00 0.00 ? 27 MET A HB2  7  
ATOM 7109  H HB3  . MET A 1 27 ? -0.347  11.180  -1.465  1.00 0.00 ? 27 MET A HB3  7  
ATOM 7110  H HG2  . MET A 1 27 ? 0.706   9.653   0.201   1.00 0.00 ? 27 MET A HG2  7  
ATOM 7111  H HG3  . MET A 1 27 ? -0.430  8.390   -0.249  1.00 0.00 ? 27 MET A HG3  7  
ATOM 7112  H HE1  . MET A 1 27 ? 2.699   10.160  -0.800  1.00 0.00 ? 27 MET A HE1  7  
ATOM 7113  H HE2  . MET A 1 27 ? 2.803   8.444   -0.327  1.00 0.00 ? 27 MET A HE2  7  
ATOM 7114  H HE3  . MET A 1 27 ? 3.506   9.011   -1.881  1.00 0.00 ? 27 MET A HE3  7  
ATOM 7115  N N    . SER A 1 28 ? -3.295  12.196  -0.995  1.00 0.00 ? 28 SER A N    7  
ATOM 7116  C CA   . SER A 1 28 ? -4.091  13.361  -1.315  1.00 0.00 ? 28 SER A CA   7  
ATOM 7117  C C    . SER A 1 28 ? -4.885  13.875  -0.104  1.00 0.00 ? 28 SER A C    7  
ATOM 7118  O O    . SER A 1 28 ? -5.377  15.004  -0.143  1.00 0.00 ? 28 SER A O    7  
ATOM 7119  C CB   . SER A 1 28 ? -5.011  12.983  -2.474  1.00 0.00 ? 28 SER A CB   7  
ATOM 7120  O OG   . SER A 1 28 ? -4.276  12.549  -3.605  1.00 0.00 ? 28 SER A OG   7  
ATOM 7121  H H    . SER A 1 28 ? -3.552  11.366  -1.520  1.00 0.00 ? 28 SER A H    7  
ATOM 7122  H HA   . SER A 1 28 ? -3.424  14.160  -1.643  1.00 0.00 ? 28 SER A HA   7  
ATOM 7123  H HB2  . SER A 1 28 ? -5.687  12.187  -2.162  1.00 0.00 ? 28 SER A HB2  7  
ATOM 7124  H HB3  . SER A 1 28 ? -5.593  13.849  -2.748  1.00 0.00 ? 28 SER A HB3  7  
ATOM 7125  H HG   . SER A 1 28 ? -3.510  13.159  -3.748  1.00 0.00 ? 28 SER A HG   7  
ATOM 7126  N N    . GLY A 1 29 ? -4.962  13.110  0.992   1.00 0.00 ? 29 GLY A N    7  
ATOM 7127  C CA   . GLY A 1 29 ? -5.578  13.544  2.230   1.00 0.00 ? 29 GLY A CA   7  
ATOM 7128  C C    . GLY A 1 29 ? -7.055  13.197  2.262   1.00 0.00 ? 29 GLY A C    7  
ATOM 7129  O O    . GLY A 1 29 ? -7.822  13.888  2.931   1.00 0.00 ? 29 GLY A O    7  
ATOM 7130  H H    . GLY A 1 29 ? -4.538  12.185  0.988   1.00 0.00 ? 29 GLY A H    7  
ATOM 7131  H HA2  . GLY A 1 29 ? -5.082  13.047  3.061   1.00 0.00 ? 29 GLY A HA2  7  
ATOM 7132  H HA3  . GLY A 1 29 ? -5.461  14.621  2.334   1.00 0.00 ? 29 GLY A HA3  7  
ATOM 7133  N N    . LYS A 1 30 ? -7.471  12.163  1.526   1.00 0.00 ? 30 LYS A N    7  
ATOM 7134  C CA   . LYS A 1 30 ? -8.857  11.720  1.470   1.00 0.00 ? 30 LYS A CA   7  
ATOM 7135  C C    . LYS A 1 30 ? -9.235  10.982  2.746   1.00 0.00 ? 30 LYS A C    7  
ATOM 7136  O O    . LYS A 1 30 ? -10.415 10.931  3.087   1.00 0.00 ? 30 LYS A O    7  
ATOM 7137  C CB   . LYS A 1 30 ? -9.058  10.816  0.240   1.00 0.00 ? 30 LYS A CB   7  
ATOM 7138  C CG   . LYS A 1 30 ? -8.767  11.495  -1.112  1.00 0.00 ? 30 LYS A CG   7  
ATOM 7139  C CD   . LYS A 1 30 ? -9.534  12.810  -1.308  1.00 0.00 ? 30 LYS A CD   7  
ATOM 7140  C CE   . LYS A 1 30 ? -9.417  13.330  -2.745  1.00 0.00 ? 30 LYS A CE   7  
ATOM 7141  N NZ   . LYS A 1 30 ? -10.170 12.525  -3.724  1.00 0.00 ? 30 LYS A NZ   7  
ATOM 7142  H H    . LYS A 1 30 ? -6.768  11.589  1.054   1.00 0.00 ? 30 LYS A H    7  
ATOM 7143  H HA   . LYS A 1 30 ? -9.501  12.596  1.397   1.00 0.00 ? 30 LYS A HA   7  
ATOM 7144  H HB2  . LYS A 1 30 ? -8.404  9.958   0.341   1.00 0.00 ? 30 LYS A HB2  7  
ATOM 7145  H HB3  . LYS A 1 30 ? -10.068 10.412  0.226   1.00 0.00 ? 30 LYS A HB3  7  
ATOM 7146  H HG2  . LYS A 1 30 ? -7.701  11.699  -1.195  1.00 0.00 ? 30 LYS A HG2  7  
ATOM 7147  H HG3  . LYS A 1 30 ? -9.034  10.803  -1.910  1.00 0.00 ? 30 LYS A HG3  7  
ATOM 7148  H HD2  . LYS A 1 30 ? -10.585 12.674  -1.052  1.00 0.00 ? 30 LYS A HD2  7  
ATOM 7149  H HD3  . LYS A 1 30 ? -9.108  13.565  -0.643  1.00 0.00 ? 30 LYS A HD3  7  
ATOM 7150  H HE2  . LYS A 1 30 ? -9.798  14.353  -2.768  1.00 0.00 ? 30 LYS A HE2  7  
ATOM 7151  H HE3  . LYS A 1 30 ? -8.364  13.367  -3.034  1.00 0.00 ? 30 LYS A HE3  7  
ATOM 7152  H HZ1  . LYS A 1 30 ? -10.168 12.995  -4.624  1.00 0.00 ? 30 LYS A HZ1  7  
ATOM 7153  H HZ2  . LYS A 1 30 ? -9.737  11.617  -3.861  1.00 0.00 ? 30 LYS A HZ2  7  
ATOM 7154  H HZ3  . LYS A 1 30 ? -11.128 12.386  -3.415  1.00 0.00 ? 30 LYS A HZ3  7  
ATOM 7155  N N    . MET A 1 31 ? -8.275  10.363  3.432   1.00 0.00 ? 31 MET A N    7  
ATOM 7156  C CA   . MET A 1 31 ? -8.517  9.675   4.691   1.00 0.00 ? 31 MET A CA   7  
ATOM 7157  C C    . MET A 1 31 ? -7.223  9.481   5.485   1.00 0.00 ? 31 MET A C    7  
ATOM 7158  O O    . MET A 1 31 ? -6.147  9.872   5.037   1.00 0.00 ? 31 MET A O    7  
ATOM 7159  C CB   . MET A 1 31 ? -9.201  8.332   4.414   1.00 0.00 ? 31 MET A CB   7  
ATOM 7160  C CG   . MET A 1 31 ? -8.439  7.390   3.493   1.00 0.00 ? 31 MET A CG   7  
ATOM 7161  S SD   . MET A 1 31 ? -9.440  6.076   2.746   1.00 0.00 ? 31 MET A SD   7  
ATOM 7162  C CE   . MET A 1 31 ? -10.703 6.950   1.819   1.00 0.00 ? 31 MET A CE   7  
ATOM 7163  H H    . MET A 1 31 ? -7.329  10.371  3.079   1.00 0.00 ? 31 MET A H    7  
ATOM 7164  H HA   . MET A 1 31 ? -9.188  10.286  5.297   1.00 0.00 ? 31 MET A HA   7  
ATOM 7165  H HB2  . MET A 1 31 ? -9.344  7.860   5.367   1.00 0.00 ? 31 MET A HB2  7  
ATOM 7166  H HB3  . MET A 1 31 ? -10.186 8.459   3.999   1.00 0.00 ? 31 MET A HB3  7  
ATOM 7167  H HG2  . MET A 1 31 ? -7.957  7.947   2.692   1.00 0.00 ? 31 MET A HG2  7  
ATOM 7168  H HG3  . MET A 1 31 ? -7.677  6.921   4.108   1.00 0.00 ? 31 MET A HG3  7  
ATOM 7169  H HE1  . MET A 1 31 ? -11.240 6.217   1.219   1.00 0.00 ? 31 MET A HE1  7  
ATOM 7170  H HE2  . MET A 1 31 ? -11.391 7.414   2.520   1.00 0.00 ? 31 MET A HE2  7  
ATOM 7171  H HE3  . MET A 1 31 ? -10.236 7.696   1.181   1.00 0.00 ? 31 MET A HE3  7  
ATOM 7172  N N    . SER A 1 32 ? -7.327  8.884   6.672   1.00 0.00 ? 32 SER A N    7  
ATOM 7173  C CA   . SER A 1 32 ? -6.201  8.372   7.446   1.00 0.00 ? 32 SER A CA   7  
ATOM 7174  C C    . SER A 1 32 ? -5.711  7.045   6.869   1.00 0.00 ? 32 SER A C    7  
ATOM 7175  O O    . SER A 1 32 ? -6.480  6.334   6.215   1.00 0.00 ? 32 SER A O    7  
ATOM 7176  C CB   . SER A 1 32 ? -6.657  8.136   8.892   1.00 0.00 ? 32 SER A CB   7  
ATOM 7177  O OG   . SER A 1 32 ? -7.159  9.331   9.446   1.00 0.00 ? 32 SER A OG   7  
ATOM 7178  H H    . SER A 1 32 ? -8.255  8.657   7.017   1.00 0.00 ? 32 SER A H    7  
ATOM 7179  H HA   . SER A 1 32 ? -5.381  9.090   7.436   1.00 0.00 ? 32 SER A HA   7  
ATOM 7180  H HB2  . SER A 1 32 ? -7.440  7.376   8.912   1.00 0.00 ? 32 SER A HB2  7  
ATOM 7181  H HB3  . SER A 1 32 ? -5.818  7.784   9.492   1.00 0.00 ? 32 SER A HB3  7  
ATOM 7182  H HG   . SER A 1 32 ? -8.046  9.472   9.071   1.00 0.00 ? 32 SER A HG   7  
ATOM 7183  N N    . VAL A 1 33 ? -4.490  6.653   7.238   1.00 0.00 ? 33 VAL A N    7  
ATOM 7184  C CA   . VAL A 1 33 ? -4.000  5.286   7.104   1.00 0.00 ? 33 VAL A CA   7  
ATOM 7185  C C    . VAL A 1 33 ? -5.035  4.355   7.730   1.00 0.00 ? 33 VAL A C    7  
ATOM 7186  O O    . VAL A 1 33 ? -5.541  3.468   7.044   1.00 0.00 ? 33 VAL A O    7  
ATOM 7187  C CB   . VAL A 1 33 ? -2.602  5.149   7.757   1.00 0.00 ? 33 VAL A CB   7  
ATOM 7188  C CG1  . VAL A 1 33 ? -2.131  3.700   7.988   1.00 0.00 ? 33 VAL A CG1  7  
ATOM 7189  C CG2  . VAL A 1 33 ? -1.550  5.913   6.940   1.00 0.00 ? 33 VAL A CG2  7  
ATOM 7190  H H    . VAL A 1 33 ? -3.925  7.294   7.791   1.00 0.00 ? 33 VAL A H    7  
ATOM 7191  H HA   . VAL A 1 33 ? -3.930  5.057   6.044   1.00 0.00 ? 33 VAL A HA   7  
ATOM 7192  H HB   . VAL A 1 33 ? -2.648  5.614   8.740   1.00 0.00 ? 33 VAL A HB   7  
ATOM 7193  H HG11 . VAL A 1 33 ? -2.943  2.979   8.021   1.00 0.00 ? 33 VAL A HG11 7  
ATOM 7194  H HG12 . VAL A 1 33 ? -1.423  3.383   7.225   1.00 0.00 ? 33 VAL A HG12 7  
ATOM 7195  H HG13 . VAL A 1 33 ? -1.648  3.653   8.959   1.00 0.00 ? 33 VAL A HG13 7  
ATOM 7196  H HG21 . VAL A 1 33 ? -1.433  5.460   5.956   1.00 0.00 ? 33 VAL A HG21 7  
ATOM 7197  H HG22 . VAL A 1 33 ? -1.840  6.957   6.820   1.00 0.00 ? 33 VAL A HG22 7  
ATOM 7198  H HG23 . VAL A 1 33 ? -0.590  5.889   7.454   1.00 0.00 ? 33 VAL A HG23 7  
ATOM 7199  N N    . SER A 1 34 ? -5.389  4.583   9.001   1.00 0.00 ? 34 SER A N    7  
ATOM 7200  C CA   . SER A 1 34 ? -6.296  3.726   9.758   1.00 0.00 ? 34 SER A CA   7  
ATOM 7201  C C    . SER A 1 34 ? -7.679  3.560   9.113   1.00 0.00 ? 34 SER A C    7  
ATOM 7202  O O    . SER A 1 34 ? -8.453  2.687   9.504   1.00 0.00 ? 34 SER A O    7  
ATOM 7203  C CB   . SER A 1 34 ? -6.424  4.287   11.181  1.00 0.00 ? 34 SER A CB   7  
ATOM 7204  O OG   . SER A 1 34 ? -6.753  5.670   11.162  1.00 0.00 ? 34 SER A OG   7  
ATOM 7205  H H    . SER A 1 34 ? -4.978  5.350   9.520   1.00 0.00 ? 34 SER A H    7  
ATOM 7206  H HA   . SER A 1 34 ? -5.840  2.743   9.820   1.00 0.00 ? 34 SER A HA   7  
ATOM 7207  H HB2  . SER A 1 34 ? -7.183  3.723   11.726  1.00 0.00 ? 34 SER A HB2  7  
ATOM 7208  H HB3  . SER A 1 34 ? -5.476  4.166   11.702  1.00 0.00 ? 34 SER A HB3  7  
ATOM 7209  H HG   . SER A 1 34 ? -7.711  5.752   10.967  1.00 0.00 ? 34 SER A HG   7  
ATOM 7210  N N    . LYS A 1 35 ? -8.027  4.429   8.167   1.00 0.00 ? 35 LYS A N    7  
ATOM 7211  C CA   . LYS A 1 35 ? -9.276  4.406   7.445   1.00 0.00 ? 35 LYS A CA   7  
ATOM 7212  C C    . LYS A 1 35 ? -9.073  3.556   6.202   1.00 0.00 ? 35 LYS A C    7  
ATOM 7213  O O    . LYS A 1 35 ? -9.609  2.451   6.152   1.00 0.00 ? 35 LYS A O    7  
ATOM 7214  C CB   . LYS A 1 35 ? -9.685  5.848   7.190   1.00 0.00 ? 35 LYS A CB   7  
ATOM 7215  C CG   . LYS A 1 35 ? -10.921 5.962   6.300   1.00 0.00 ? 35 LYS A CG   7  
ATOM 7216  C CD   . LYS A 1 35 ? -11.782 7.113   6.784   1.00 0.00 ? 35 LYS A CD   7  
ATOM 7217  C CE   . LYS A 1 35 ? -12.868 7.480   5.781   1.00 0.00 ? 35 LYS A CE   7  
ATOM 7218  N NZ   . LYS A 1 35 ? -13.746 8.510   6.354   1.00 0.00 ? 35 LYS A NZ   7  
ATOM 7219  H H    . LYS A 1 35 ? -7.292  5.031   7.819   1.00 0.00 ? 35 LYS A H    7  
ATOM 7220  H HA   . LYS A 1 35 ? -10.052 3.950   8.059   1.00 0.00 ? 35 LYS A HA   7  
ATOM 7221  H HB2  . LYS A 1 35 ? -9.891  6.313   8.153   1.00 0.00 ? 35 LYS A HB2  7  
ATOM 7222  H HB3  . LYS A 1 35 ? -8.861  6.388   6.743   1.00 0.00 ? 35 LYS A HB3  7  
ATOM 7223  H HG2  . LYS A 1 35 ? -10.641 6.127   5.271   1.00 0.00 ? 35 LYS A HG2  7  
ATOM 7224  H HG3  . LYS A 1 35 ? -11.489 5.050   6.320   1.00 0.00 ? 35 LYS A HG3  7  
ATOM 7225  H HD2  . LYS A 1 35 ? -12.236 6.805   7.721   1.00 0.00 ? 35 LYS A HD2  7  
ATOM 7226  H HD3  . LYS A 1 35 ? -11.147 7.973   6.962   1.00 0.00 ? 35 LYS A HD3  7  
ATOM 7227  H HE2  . LYS A 1 35 ? -12.411 7.854   4.863   1.00 0.00 ? 35 LYS A HE2  7  
ATOM 7228  H HE3  . LYS A 1 35 ? -13.463 6.592   5.553   1.00 0.00 ? 35 LYS A HE3  7  
ATOM 7229  H HZ1  . LYS A 1 35 ? -14.546 8.671   5.745   1.00 0.00 ? 35 LYS A HZ1  7  
ATOM 7230  H HZ2  . LYS A 1 35 ? -14.114 8.210   7.252   1.00 0.00 ? 35 LYS A HZ2  7  
ATOM 7231  H HZ3  . LYS A 1 35 ? -13.246 9.389   6.481   1.00 0.00 ? 35 LYS A HZ3  7  
ATOM 7232  N N    . ALA A 1 36 ? -8.294  4.038   5.227   1.00 0.00 ? 36 ALA A N    7  
ATOM 7233  C CA   . ALA A 1 36 ? -8.032  3.336   3.978   1.00 0.00 ? 36 ALA A CA   7  
ATOM 7234  C C    . ALA A 1 36 ? -7.601  1.883   4.173   1.00 0.00 ? 36 ALA A C    7  
ATOM 7235  O O    . ALA A 1 36 ? -8.045  1.038   3.404   1.00 0.00 ? 36 ALA A O    7  
ATOM 7236  C CB   . ALA A 1 36 ? -6.931  4.069   3.204   1.00 0.00 ? 36 ALA A CB   7  
ATOM 7237  H H    . ALA A 1 36 ? -7.961  4.994   5.273   1.00 0.00 ? 36 ALA A H    7  
ATOM 7238  H HA   . ALA A 1 36 ? -8.974  3.325   3.418   1.00 0.00 ? 36 ALA A HA   7  
ATOM 7239  H HB1  . ALA A 1 36 ? -7.083  5.143   3.236   1.00 0.00 ? 36 ALA A HB1  7  
ATOM 7240  H HB2  . ALA A 1 36 ? -5.962  3.863   3.656   1.00 0.00 ? 36 ALA A HB2  7  
ATOM 7241  H HB3  . ALA A 1 36 ? -6.930  3.742   2.165   1.00 0.00 ? 36 ALA A HB3  7  
ATOM 7242  N N    . GLN A 1 37 ? -6.814  1.588   5.209   1.00 0.00 ? 37 GLN A N    7  
ATOM 7243  C CA   . GLN A 1 37 ? -6.522  0.250   5.703   1.00 0.00 ? 37 GLN A CA   7  
ATOM 7244  C C    . GLN A 1 37 ? -7.778  -0.616  5.580   1.00 0.00 ? 37 GLN A C    7  
ATOM 7245  O O    . GLN A 1 37 ? -7.840  -1.552  4.784   1.00 0.00 ? 37 GLN A O    7  
ATOM 7246  C CB   . GLN A 1 37 ? -6.057  0.425   7.166   1.00 0.00 ? 37 GLN A CB   7  
ATOM 7247  C CG   . GLN A 1 37 ? -6.074  -0.828  8.053   1.00 0.00 ? 37 GLN A CG   7  
ATOM 7248  C CD   . GLN A 1 37 ? -6.415  -0.484  9.502   1.00 0.00 ? 37 GLN A CD   7  
ATOM 7249  O OE1  . GLN A 1 37 ? -5.870  0.440   10.104  1.00 0.00 ? 37 GLN A OE1  7  
ATOM 7250  N NE2  . GLN A 1 37 ? -7.368  -1.190  10.076  1.00 0.00 ? 37 GLN A NE2  7  
ATOM 7251  H H    . GLN A 1 37 ? -6.465  2.336   5.796   1.00 0.00 ? 37 GLN A H    7  
ATOM 7252  H HA   . GLN A 1 37 ? -5.728  -0.195  5.113   1.00 0.00 ? 37 GLN A HA   7  
ATOM 7253  H HB2  . GLN A 1 37 ? -5.048  0.839   7.163   1.00 0.00 ? 37 GLN A HB2  7  
ATOM 7254  H HB3  . GLN A 1 37 ? -6.714  1.161   7.628   1.00 0.00 ? 37 GLN A HB3  7  
ATOM 7255  H HG2  . GLN A 1 37 ? -6.813  -1.533  7.686   1.00 0.00 ? 37 GLN A HG2  7  
ATOM 7256  H HG3  . GLN A 1 37 ? -5.117  -1.322  7.990   1.00 0.00 ? 37 GLN A HG3  7  
ATOM 7257  H HE21 . GLN A 1 37 ? -7.690  -2.047  9.643   1.00 0.00 ? 37 GLN A HE21 7  
ATOM 7258  H HE22 . GLN A 1 37 ? -7.794  -0.899  10.957  1.00 0.00 ? 37 GLN A HE22 7  
ATOM 7259  N N    . SER A 1 38 ? -8.806  -0.268  6.345   1.00 0.00 ? 38 SER A N    7  
ATOM 7260  C CA   . SER A 1 38 ? -10.005 -1.061  6.453   1.00 0.00 ? 38 SER A CA   7  
ATOM 7261  C C    . SER A 1 38 ? -10.857 -0.940  5.177   1.00 0.00 ? 38 SER A C    7  
ATOM 7262  O O    . SER A 1 38 ? -11.523 -1.906  4.792   1.00 0.00 ? 38 SER A O    7  
ATOM 7263  C CB   . SER A 1 38 ? -10.751 -0.558  7.694   1.00 0.00 ? 38 SER A CB   7  
ATOM 7264  O OG   . SER A 1 38 ? -11.872 -1.353  8.040   1.00 0.00 ? 38 SER A OG   7  
ATOM 7265  H H    . SER A 1 38 ? -8.754  0.598   6.863   1.00 0.00 ? 38 SER A H    7  
ATOM 7266  H HA   . SER A 1 38 ? -9.674  -2.092  6.611   1.00 0.00 ? 38 SER A HA   7  
ATOM 7267  H HB2  . SER A 1 38 ? -10.063 -0.552  8.542   1.00 0.00 ? 38 SER A HB2  7  
ATOM 7268  H HB3  . SER A 1 38 ? -11.082 0.468   7.510   1.00 0.00 ? 38 SER A HB3  7  
ATOM 7269  H HG   . SER A 1 38 ? -11.603 -2.305  7.987   1.00 0.00 ? 38 SER A HG   7  
ATOM 7270  N N    . ILE A 1 39 ? -10.863 0.230   4.519   1.00 0.00 ? 39 ILE A N    7  
ATOM 7271  C CA   . ILE A 1 39 ? -11.680 0.457   3.324   1.00 0.00 ? 39 ILE A CA   7  
ATOM 7272  C C    . ILE A 1 39 ? -11.253 -0.507  2.220   1.00 0.00 ? 39 ILE A C    7  
ATOM 7273  O O    . ILE A 1 39 ? -12.103 -1.152  1.606   1.00 0.00 ? 39 ILE A O    7  
ATOM 7274  C CB   . ILE A 1 39 ? -11.653 1.933   2.860   1.00 0.00 ? 39 ILE A CB   7  
ATOM 7275  C CG1  . ILE A 1 39 ? -12.283 2.789   3.976   1.00 0.00 ? 39 ILE A CG1  7  
ATOM 7276  C CG2  . ILE A 1 39 ? -12.390 2.125   1.517   1.00 0.00 ? 39 ILE A CG2  7  
ATOM 7277  C CD1  . ILE A 1 39 ? -12.566 4.229   3.576   1.00 0.00 ? 39 ILE A CD1  7  
ATOM 7278  H H    . ILE A 1 39 ? -10.311 0.990   4.901   1.00 0.00 ? 39 ILE A H    7  
ATOM 7279  H HA   . ILE A 1 39 ? -12.709 0.231   3.586   1.00 0.00 ? 39 ILE A HA   7  
ATOM 7280  H HB   . ILE A 1 39 ? -10.627 2.255   2.706   1.00 0.00 ? 39 ILE A HB   7  
ATOM 7281  H HG12 . ILE A 1 39 ? -13.213 2.336   4.296   1.00 0.00 ? 39 ILE A HG12 7  
ATOM 7282  H HG13 . ILE A 1 39 ? -11.620 2.806   4.833   1.00 0.00 ? 39 ILE A HG13 7  
ATOM 7283  H HG21 . ILE A 1 39 ? -12.284 3.152   1.171   1.00 0.00 ? 39 ILE A HG21 7  
ATOM 7284  H HG22 . ILE A 1 39 ? -11.953 1.497   0.739   1.00 0.00 ? 39 ILE A HG22 7  
ATOM 7285  H HG23 . ILE A 1 39 ? -13.449 1.888   1.632   1.00 0.00 ? 39 ILE A HG23 7  
ATOM 7286  H HD11 . ILE A 1 39 ? -12.829 4.798   4.463   1.00 0.00 ? 39 ILE A HD11 7  
ATOM 7287  H HD12 . ILE A 1 39 ? -11.680 4.643   3.106   1.00 0.00 ? 39 ILE A HD12 7  
ATOM 7288  H HD13 . ILE A 1 39 ? -13.400 4.255   2.879   1.00 0.00 ? 39 ILE A HD13 7  
ATOM 7289  N N    . TYR A 1 40 ? -9.954  -0.554  1.939   1.00 0.00 ? 40 TYR A N    7  
ATOM 7290  C CA   . TYR A 1 40 ? -9.391  -1.249  0.795   1.00 0.00 ? 40 TYR A CA   7  
ATOM 7291  C C    . TYR A 1 40 ? -9.046  -2.699  1.144   1.00 0.00 ? 40 TYR A C    7  
ATOM 7292  O O    . TYR A 1 40 ? -9.078  -3.554  0.254   1.00 0.00 ? 40 TYR A O    7  
ATOM 7293  C CB   . TYR A 1 40 ? -8.165  -0.462  0.321   1.00 0.00 ? 40 TYR A CB   7  
ATOM 7294  C CG   . TYR A 1 40 ? -8.502  0.834   -0.420  1.00 0.00 ? 40 TYR A CG   7  
ATOM 7295  C CD1  . TYR A 1 40 ? -8.739  2.019   0.314   1.00 0.00 ? 40 TYR A CD1  7  
ATOM 7296  C CD2  . TYR A 1 40 ? -8.476  0.895   -1.827  1.00 0.00 ? 40 TYR A CD2  7  
ATOM 7297  C CE1  . TYR A 1 40 ? -8.971  3.252   -0.323  1.00 0.00 ? 40 TYR A CE1  7  
ATOM 7298  C CE2  . TYR A 1 40 ? -8.731  2.119   -2.468  1.00 0.00 ? 40 TYR A CE2  7  
ATOM 7299  C CZ   . TYR A 1 40 ? -8.994  3.288   -1.730  1.00 0.00 ? 40 TYR A CZ   7  
ATOM 7300  O OH   . TYR A 1 40 ? -9.260  4.451   -2.373  1.00 0.00 ? 40 TYR A OH   7  
ATOM 7301  H H    . TYR A 1 40 ? -9.315  -0.013  2.511   1.00 0.00 ? 40 TYR A H    7  
ATOM 7302  H HA   . TYR A 1 40 ? -10.121 -1.262  -0.016  1.00 0.00 ? 40 TYR A HA   7  
ATOM 7303  H HB2  . TYR A 1 40 ? -7.553  -0.209  1.174   1.00 0.00 ? 40 TYR A HB2  7  
ATOM 7304  H HB3  . TYR A 1 40 ? -7.500  -1.111  -0.247  1.00 0.00 ? 40 TYR A HB3  7  
ATOM 7305  H HD1  . TYR A 1 40 ? -8.700  1.993   1.384   1.00 0.00 ? 40 TYR A HD1  7  
ATOM 7306  H HD2  . TYR A 1 40 ? -8.257  0.021   -2.435  1.00 0.00 ? 40 TYR A HD2  7  
ATOM 7307  H HE1  . TYR A 1 40 ? -9.070  4.181   0.244   1.00 0.00 ? 40 TYR A HE1  7  
ATOM 7308  H HE2  . TYR A 1 40 ? -8.700  2.178   -3.542  1.00 0.00 ? 40 TYR A HE2  7  
ATOM 7309  H HH   . TYR A 1 40 ? -8.944  4.441   -3.283  1.00 0.00 ? 40 TYR A HH   7  
ATOM 7310  N N    . GLY A 1 41 ? -8.774  -2.993  2.420   1.00 0.00 ? 41 GLY A N    7  
ATOM 7311  C CA   . GLY A 1 41 ? -8.380  -4.312  2.897   1.00 0.00 ? 41 GLY A CA   7  
ATOM 7312  C C    . GLY A 1 41 ? -6.861  -4.433  2.985   1.00 0.00 ? 41 GLY A C    7  
ATOM 7313  O O    . GLY A 1 41 ? -6.304  -5.491  2.683   1.00 0.00 ? 41 GLY A O    7  
ATOM 7314  H H    . GLY A 1 41 ? -8.738  -2.238  3.096   1.00 0.00 ? 41 GLY A H    7  
ATOM 7315  H HA2  . GLY A 1 41 ? -8.795  -4.463  3.892   1.00 0.00 ? 41 GLY A HA2  7  
ATOM 7316  H HA3  . GLY A 1 41 ? -8.768  -5.086  2.237   1.00 0.00 ? 41 GLY A HA3  7  
ATOM 7317  N N    . ILE A 1 42 ? -6.176  -3.347  3.347   1.00 0.00 ? 42 ILE A N    7  
ATOM 7318  C CA   . ILE A 1 42 ? -4.726  -3.286  3.469   1.00 0.00 ? 42 ILE A CA   7  
ATOM 7319  C C    . ILE A 1 42 ? -4.373  -3.277  4.967   1.00 0.00 ? 42 ILE A C    7  
ATOM 7320  O O    . ILE A 1 42 ? -5.031  -2.563  5.724   1.00 0.00 ? 42 ILE A O    7  
ATOM 7321  C CB   . ILE A 1 42 ? -4.162  -2.027  2.765   1.00 0.00 ? 42 ILE A CB   7  
ATOM 7322  C CG1  . ILE A 1 42 ? -4.808  -1.635  1.430   1.00 0.00 ? 42 ILE A CG1  7  
ATOM 7323  C CG2  . ILE A 1 42 ? -2.641  -2.220  2.598   1.00 0.00 ? 42 ILE A CG2  7  
ATOM 7324  C CD1  . ILE A 1 42 ? -4.726  -2.690  0.347   1.00 0.00 ? 42 ILE A CD1  7  
ATOM 7325  H H    . ILE A 1 42 ? -6.692  -2.541  3.685   1.00 0.00 ? 42 ILE A H    7  
ATOM 7326  H HA   . ILE A 1 42 ? -4.310  -4.167  2.983   1.00 0.00 ? 42 ILE A HA   7  
ATOM 7327  H HB   . ILE A 1 42 ? -4.382  -1.161  3.381   1.00 0.00 ? 42 ILE A HB   7  
ATOM 7328  H HG12 . ILE A 1 42 ? -5.854  -1.420  1.609   1.00 0.00 ? 42 ILE A HG12 7  
ATOM 7329  H HG13 . ILE A 1 42 ? -4.354  -0.718  1.058   1.00 0.00 ? 42 ILE A HG13 7  
ATOM 7330  H HG21 . ILE A 1 42 ? -2.454  -3.134  2.023   1.00 0.00 ? 42 ILE A HG21 7  
ATOM 7331  H HG22 . ILE A 1 42 ? -2.206  -1.371  2.074   1.00 0.00 ? 42 ILE A HG22 7  
ATOM 7332  H HG23 . ILE A 1 42 ? -2.163  -2.311  3.578   1.00 0.00 ? 42 ILE A HG23 7  
ATOM 7333  H HD11 . ILE A 1 42 ? -3.719  -2.718  -0.071  1.00 0.00 ? 42 ILE A HD11 7  
ATOM 7334  H HD12 . ILE A 1 42 ? -4.997  -3.648  0.776   1.00 0.00 ? 42 ILE A HD12 7  
ATOM 7335  H HD13 . ILE A 1 42 ? -5.442  -2.441  -0.432  1.00 0.00 ? 42 ILE A HD13 7  
ATOM 7336  N N    . PRO A 1 43 ? -3.354  -4.026  5.424   1.00 0.00 ? 43 PRO A N    7  
ATOM 7337  C CA   . PRO A 1 43 ? -2.909  -3.950  6.812   1.00 0.00 ? 43 PRO A CA   7  
ATOM 7338  C C    . PRO A 1 43 ? -2.359  -2.572  7.178   1.00 0.00 ? 43 PRO A C    7  
ATOM 7339  O O    . PRO A 1 43 ? -1.748  -1.913  6.341   1.00 0.00 ? 43 PRO A O    7  
ATOM 7340  C CB   . PRO A 1 43 ? -1.807  -5.005  6.950   1.00 0.00 ? 43 PRO A CB   7  
ATOM 7341  C CG   . PRO A 1 43 ? -1.518  -5.561  5.560   1.00 0.00 ? 43 PRO A CG   7  
ATOM 7342  C CD   . PRO A 1 43 ? -2.583  -4.986  4.646   1.00 0.00 ? 43 PRO A CD   7  
ATOM 7343  H HA   . PRO A 1 43 ? -3.758  -4.164  7.470   1.00 0.00 ? 43 PRO A HA   7  
ATOM 7344  H HB2  . PRO A 1 43 ? -0.899  -4.603  7.402   1.00 0.00 ? 43 PRO A HB2  7  
ATOM 7345  H HB3  . PRO A 1 43 ? -2.179  -5.812  7.553   1.00 0.00 ? 43 PRO A HB3  7  
ATOM 7346  H HG2  . PRO A 1 43 ? -0.544  -5.249  5.206   1.00 0.00 ? 43 PRO A HG2  7  
ATOM 7347  H HG3  . PRO A 1 43 ? -1.562  -6.647  5.565   1.00 0.00 ? 43 PRO A HG3  7  
ATOM 7348  H HD2  . PRO A 1 43 ? -2.098  -4.506  3.801   1.00 0.00 ? 43 PRO A HD2  7  
ATOM 7349  H HD3  . PRO A 1 43 ? -3.223  -5.783  4.280   1.00 0.00 ? 43 PRO A HD3  7  
ATOM 7350  N N    . HIS A 1 44 ? -2.495  -2.167  8.446   1.00 0.00 ? 44 HIS A N    7  
ATOM 7351  C CA   . HIS A 1 44 ? -2.088  -0.845  8.916   1.00 0.00 ? 44 HIS A CA   7  
ATOM 7352  C C    . HIS A 1 44 ? -0.574  -0.664  8.823   1.00 0.00 ? 44 HIS A C    7  
ATOM 7353  O O    . HIS A 1 44 ? -0.124  0.267   8.161   1.00 0.00 ? 44 HIS A O    7  
ATOM 7354  C CB   . HIS A 1 44 ? -2.572  -0.617  10.354  1.00 0.00 ? 44 HIS A CB   7  
ATOM 7355  C CG   . HIS A 1 44 ? -2.408  0.807   10.820  1.00 0.00 ? 44 HIS A CG   7  
ATOM 7356  N ND1  . HIS A 1 44 ? -3.432  1.703   11.010  1.00 0.00 ? 44 HIS A ND1  7  
ATOM 7357  C CD2  . HIS A 1 44 ? -1.237  1.430   11.161  1.00 0.00 ? 44 HIS A CD2  7  
ATOM 7358  C CE1  . HIS A 1 44 ? -2.890  2.841   11.479  1.00 0.00 ? 44 HIS A CE1  7  
ATOM 7359  N NE2  . HIS A 1 44 ? -1.557  2.723   11.583  1.00 0.00 ? 44 HIS A NE2  7  
ATOM 7360  H H    . HIS A 1 44 ? -2.960  -2.766  9.121   1.00 0.00 ? 44 HIS A H    7  
ATOM 7361  H HA   . HIS A 1 44 ? -2.563  -0.098  8.276   1.00 0.00 ? 44 HIS A HA   7  
ATOM 7362  H HB2  . HIS A 1 44 ? -3.626  -0.883  10.421  1.00 0.00 ? 44 HIS A HB2  7  
ATOM 7363  H HB3  . HIS A 1 44 ? -2.025  -1.263  11.037  1.00 0.00 ? 44 HIS A HB3  7  
ATOM 7364  H HD1  . HIS A 1 44 ? -4.415  1.483   10.856  1.00 0.00 ? 44 HIS A HD1  7  
ATOM 7365  H HD2  . HIS A 1 44 ? -0.245  1.000   11.127  1.00 0.00 ? 44 HIS A HD2  7  
ATOM 7366  H HE1  . HIS A 1 44 ? -3.436  3.734   11.746  1.00 0.00 ? 44 HIS A HE1  7  
ATOM 7367  N N    . SER A 1 45 ? 0.199   -1.535  9.489   1.00 0.00 ? 45 SER A N    7  
ATOM 7368  C CA   . SER A 1 45 ? 1.659   -1.461  9.564   1.00 0.00 ? 45 SER A CA   7  
ATOM 7369  C C    . SER A 1 45 ? 2.232   -1.323  8.147   1.00 0.00 ? 45 SER A C    7  
ATOM 7370  O O    . SER A 1 45 ? 3.020   -0.412  7.876   1.00 0.00 ? 45 SER A O    7  
ATOM 7371  C CB   . SER A 1 45 ? 2.177   -2.702  10.322  1.00 0.00 ? 45 SER A CB   7  
ATOM 7372  O OG   . SER A 1 45 ? 3.568   -2.675  10.594  1.00 0.00 ? 45 SER A OG   7  
ATOM 7373  H H    . SER A 1 45 ? -0.260  -2.262  10.018  1.00 0.00 ? 45 SER A H    7  
ATOM 7374  H HA   . SER A 1 45 ? 1.923   -0.569  10.133  1.00 0.00 ? 45 SER A HA   7  
ATOM 7375  H HB2  . SER A 1 45 ? 1.653   -2.771  11.275  1.00 0.00 ? 45 SER A HB2  7  
ATOM 7376  H HB3  . SER A 1 45 ? 1.953   -3.600  9.744   1.00 0.00 ? 45 SER A HB3  7  
ATOM 7377  H HG   . SER A 1 45 ? 3.743   -1.940  11.221  1.00 0.00 ? 45 SER A HG   7  
ATOM 7378  N N    . THR A 1 46 ? 1.766   -2.178  7.236   1.00 0.00 ? 46 THR A N    7  
ATOM 7379  C CA   . THR A 1 46 ? 2.129   -2.176  5.835   1.00 0.00 ? 46 THR A CA   7  
ATOM 7380  C C    . THR A 1 46 ? 1.701   -0.882  5.135   1.00 0.00 ? 46 THR A C    7  
ATOM 7381  O O    . THR A 1 46 ? 2.535   -0.247  4.495   1.00 0.00 ? 46 THR A O    7  
ATOM 7382  C CB   . THR A 1 46 ? 1.464   -3.402  5.208   1.00 0.00 ? 46 THR A CB   7  
ATOM 7383  O OG1  . THR A 1 46 ? 1.759   -4.551  5.976   1.00 0.00 ? 46 THR A OG1  7  
ATOM 7384  C CG2  . THR A 1 46 ? 1.896   -3.632  3.768   1.00 0.00 ? 46 THR A CG2  7  
ATOM 7385  H H    . THR A 1 46 ? 1.144   -2.935  7.496   1.00 0.00 ? 46 THR A H    7  
ATOM 7386  H HA   . THR A 1 46 ? 3.213   -2.276  5.759   1.00 0.00 ? 46 THR A HA   7  
ATOM 7387  H HB   . THR A 1 46 ? 0.384   -3.255  5.228   1.00 0.00 ? 46 THR A HB   7  
ATOM 7388  H HG1  . THR A 1 46 ? 2.363   -5.120  5.464   1.00 0.00 ? 46 THR A HG1  7  
ATOM 7389  H HG21 . THR A 1 46 ? 1.350   -4.485  3.358   1.00 0.00 ? 46 THR A HG21 7  
ATOM 7390  H HG22 . THR A 1 46 ? 1.648   -2.745  3.190   1.00 0.00 ? 46 THR A HG22 7  
ATOM 7391  H HG23 . THR A 1 46 ? 2.973   -3.797  3.703   1.00 0.00 ? 46 THR A HG23 7  
ATOM 7392  N N    . LEU A 1 47 ? 0.421   -0.498  5.203   1.00 0.00 ? 47 LEU A N    7  
ATOM 7393  C CA   . LEU A 1 47 ? -0.114  0.664   4.512   1.00 0.00 ? 47 LEU A CA   7  
ATOM 7394  C C    . LEU A 1 47 ? 0.671   1.904   4.916   1.00 0.00 ? 47 LEU A C    7  
ATOM 7395  O O    . LEU A 1 47 ? 1.030   2.692   4.047   1.00 0.00 ? 47 LEU A O    7  
ATOM 7396  C CB   . LEU A 1 47 ? -1.617  0.898   4.761   1.00 0.00 ? 47 LEU A CB   7  
ATOM 7397  C CG   . LEU A 1 47 ? -2.173  2.057   3.890   1.00 0.00 ? 47 LEU A CG   7  
ATOM 7398  C CD1  . LEU A 1 47 ? -2.776  1.600   2.562   1.00 0.00 ? 47 LEU A CD1  7  
ATOM 7399  C CD2  . LEU A 1 47 ? -3.314  2.771   4.582   1.00 0.00 ? 47 LEU A CD2  7  
ATOM 7400  H H    . LEU A 1 47 ? -0.244  -1.071  5.685   1.00 0.00 ? 47 LEU A H    7  
ATOM 7401  H HA   . LEU A 1 47 ? 0.027   0.453   3.459   1.00 0.00 ? 47 LEU A HA   7  
ATOM 7402  H HB2  . LEU A 1 47 ? -2.180  -0.011  4.549   1.00 0.00 ? 47 LEU A HB2  7  
ATOM 7403  H HB3  . LEU A 1 47 ? -1.755  1.137   5.818   1.00 0.00 ? 47 LEU A HB3  7  
ATOM 7404  H HG   . LEU A 1 47 ? -1.419  2.828   3.691   1.00 0.00 ? 47 LEU A HG   7  
ATOM 7405  H HD11 . LEU A 1 47 ? -2.096  0.944   2.023   1.00 0.00 ? 47 LEU A HD11 7  
ATOM 7406  H HD12 . LEU A 1 47 ? -3.706  1.059   2.734   1.00 0.00 ? 47 LEU A HD12 7  
ATOM 7407  H HD13 . LEU A 1 47 ? -2.987  2.491   1.963   1.00 0.00 ? 47 LEU A HD13 7  
ATOM 7408  H HD21 . LEU A 1 47 ? -2.921  3.251   5.464   1.00 0.00 ? 47 LEU A HD21 7  
ATOM 7409  H HD22 . LEU A 1 47 ? -3.689  3.521   3.888   1.00 0.00 ? 47 LEU A HD22 7  
ATOM 7410  H HD23 . LEU A 1 47 ? -4.094  2.062   4.858   1.00 0.00 ? 47 LEU A HD23 7  
ATOM 7411  N N    . GLU A 1 48 ? 0.946   2.069   6.211   1.00 0.00 ? 48 GLU A N    7  
ATOM 7412  C CA   . GLU A 1 48 ? 1.794   3.132   6.711   1.00 0.00 ? 48 GLU A CA   7  
ATOM 7413  C C    . GLU A 1 48 ? 3.090   3.132   5.921   1.00 0.00 ? 48 GLU A C    7  
ATOM 7414  O O    . GLU A 1 48 ? 3.340   4.089   5.195   1.00 0.00 ? 48 GLU A O    7  
ATOM 7415  C CB   . GLU A 1 48 ? 2.120   2.942   8.194   1.00 0.00 ? 48 GLU A CB   7  
ATOM 7416  C CG   . GLU A 1 48 ? 1.026   3.435   9.122   1.00 0.00 ? 48 GLU A CG   7  
ATOM 7417  C CD   . GLU A 1 48 ? 1.605   3.710   10.497  1.00 0.00 ? 48 GLU A CD   7  
ATOM 7418  O OE1  . GLU A 1 48 ? 1.982   2.732   11.181  1.00 0.00 ? 48 GLU A OE1  7  
ATOM 7419  O OE2  . GLU A 1 48 ? 1.754   4.915   10.799  1.00 0.00 ? 48 GLU A OE2  7  
ATOM 7420  H H    . GLU A 1 48 ? 0.613   1.374   6.873   1.00 0.00 ? 48 GLU A H    7  
ATOM 7421  H HA   . GLU A 1 48 ? 1.289   4.091   6.567   1.00 0.00 ? 48 GLU A HA   7  
ATOM 7422  H HB2  . GLU A 1 48 ? 2.299   1.889   8.397   1.00 0.00 ? 48 GLU A HB2  7  
ATOM 7423  H HB3  . GLU A 1 48 ? 3.032   3.491   8.426   1.00 0.00 ? 48 GLU A HB3  7  
ATOM 7424  H HG2  . GLU A 1 48 ? 0.592   4.351   8.716   1.00 0.00 ? 48 GLU A HG2  7  
ATOM 7425  H HG3  . GLU A 1 48 ? 0.277   2.662   9.193   1.00 0.00 ? 48 GLU A HG3  7  
ATOM 7426  N N    . TYR A 1 49 ? 3.894   2.075   6.064   1.00 0.00 ? 49 TYR A N    7  
ATOM 7427  C CA   . TYR A 1 49 ? 5.188   1.939   5.415   1.00 0.00 ? 49 TYR A CA   7  
ATOM 7428  C C    . TYR A 1 49 ? 5.087   2.351   3.953   1.00 0.00 ? 49 TYR A C    7  
ATOM 7429  O O    . TYR A 1 49 ? 5.805   3.239   3.511   1.00 0.00 ? 49 TYR A O    7  
ATOM 7430  C CB   . TYR A 1 49 ? 5.660   0.484   5.548   1.00 0.00 ? 49 TYR A CB   7  
ATOM 7431  C CG   . TYR A 1 49 ? 6.813   0.115   4.640   1.00 0.00 ? 49 TYR A CG   7  
ATOM 7432  C CD1  . TYR A 1 49 ? 8.139   0.441   4.969   1.00 0.00 ? 49 TYR A CD1  7  
ATOM 7433  C CD2  . TYR A 1 49 ? 6.532   -0.522  3.421   1.00 0.00 ? 49 TYR A CD2  7  
ATOM 7434  C CE1  . TYR A 1 49 ? 9.178   0.138   4.073   1.00 0.00 ? 49 TYR A CE1  7  
ATOM 7435  C CE2  . TYR A 1 49 ? 7.560   -0.831  2.517   1.00 0.00 ? 49 TYR A CE2  7  
ATOM 7436  C CZ   . TYR A 1 49 ? 8.893   -0.502  2.847   1.00 0.00 ? 49 TYR A CZ   7  
ATOM 7437  O OH   . TYR A 1 49 ? 9.885   -0.684  1.938   1.00 0.00 ? 49 TYR A OH   7  
ATOM 7438  H H    . TYR A 1 49 ? 3.558   1.289   6.612   1.00 0.00 ? 49 TYR A H    7  
ATOM 7439  H HA   . TYR A 1 49 ? 5.905   2.607   5.900   1.00 0.00 ? 49 TYR A HA   7  
ATOM 7440  H HB2  . TYR A 1 49 ? 5.919   0.281   6.575   1.00 0.00 ? 49 TYR A HB2  7  
ATOM 7441  H HB3  . TYR A 1 49 ? 4.836   -0.187  5.325   1.00 0.00 ? 49 TYR A HB3  7  
ATOM 7442  H HD1  . TYR A 1 49 ? 8.366   0.942   5.898   1.00 0.00 ? 49 TYR A HD1  7  
ATOM 7443  H HD2  . TYR A 1 49 ? 5.504   -0.734  3.181   1.00 0.00 ? 49 TYR A HD2  7  
ATOM 7444  H HE1  . TYR A 1 49 ? 10.194  0.417   4.309   1.00 0.00 ? 49 TYR A HE1  7  
ATOM 7445  H HE2  . TYR A 1 49 ? 7.318   -1.255  1.551   1.00 0.00 ? 49 TYR A HE2  7  
ATOM 7446  H HH   . TYR A 1 49 ? 10.196  0.204   1.656   1.00 0.00 ? 49 TYR A HH   7  
ATOM 7447  N N    . LYS A 1 50 ? 4.172   1.746   3.204   1.00 0.00 ? 50 LYS A N    7  
ATOM 7448  C CA   . LYS A 1 50 ? 4.046   1.901   1.782   1.00 0.00 ? 50 LYS A CA   7  
ATOM 7449  C C    . LYS A 1 50 ? 3.713   3.359   1.418   1.00 0.00 ? 50 LYS A C    7  
ATOM 7450  O O    . LYS A 1 50 ? 4.289   3.868   0.463   1.00 0.00 ? 50 LYS A O    7  
ATOM 7451  C CB   . LYS A 1 50 ? 2.969   0.880   1.397   1.00 0.00 ? 50 LYS A CB   7  
ATOM 7452  C CG   . LYS A 1 50 ? 3.344   -0.600  1.356   1.00 0.00 ? 50 LYS A CG   7  
ATOM 7453  C CD   . LYS A 1 50 ? 4.489   -0.983  0.431   1.00 0.00 ? 50 LYS A CD   7  
ATOM 7454  C CE   . LYS A 1 50 ? 4.499   -2.471  0.054   1.00 0.00 ? 50 LYS A CE   7  
ATOM 7455  N NZ   . LYS A 1 50 ? 3.722   -3.393  0.913   1.00 0.00 ? 50 LYS A NZ   7  
ATOM 7456  H H    . LYS A 1 50 ? 3.462   1.141   3.602   1.00 0.00 ? 50 LYS A H    7  
ATOM 7457  H HA   . LYS A 1 50 ? 4.997   1.662   1.299   1.00 0.00 ? 50 LYS A HA   7  
ATOM 7458  H HB2  . LYS A 1 50 ? 2.192   0.887   2.172   1.00 0.00 ? 50 LYS A HB2  7  
ATOM 7459  H HB3  . LYS A 1 50 ? 2.571   1.150   0.426   1.00 0.00 ? 50 LYS A HB3  7  
ATOM 7460  H HG2  . LYS A 1 50 ? 3.624   -0.971  2.342   1.00 0.00 ? 50 LYS A HG2  7  
ATOM 7461  H HG3  . LYS A 1 50 ? 2.437   -1.108  1.043   1.00 0.00 ? 50 LYS A HG3  7  
ATOM 7462  H HD2  . LYS A 1 50 ? 4.489   -0.391  -0.477  1.00 0.00 ? 50 LYS A HD2  7  
ATOM 7463  H HD3  . LYS A 1 50 ? 5.418   -0.727  0.917   1.00 0.00 ? 50 LYS A HD3  7  
ATOM 7464  H HE2  . LYS A 1 50 ? 4.121   -2.543  -0.969  1.00 0.00 ? 50 LYS A HE2  7  
ATOM 7465  H HE3  . LYS A 1 50 ? 5.527   -2.794  0.116   1.00 0.00 ? 50 LYS A HE3  7  
ATOM 7466  H HZ1  . LYS A 1 50 ? 3.634   -4.299  0.458   1.00 0.00 ? 50 LYS A HZ1  7  
ATOM 7467  H HZ2  . LYS A 1 50 ? 4.169   -3.573  1.803   1.00 0.00 ? 50 LYS A HZ2  7  
ATOM 7468  H HZ3  . LYS A 1 50 ? 2.766   -3.073  1.045   1.00 0.00 ? 50 LYS A HZ3  7  
ATOM 7469  N N    . VAL A 1 51 ? 2.872   4.065   2.179   1.00 0.00 ? 51 VAL A N    7  
ATOM 7470  C CA   . VAL A 1 51 ? 2.666   5.516   2.055   1.00 0.00 ? 51 VAL A CA   7  
ATOM 7471  C C    . VAL A 1 51 ? 3.967   6.272   2.370   1.00 0.00 ? 51 VAL A C    7  
ATOM 7472  O O    . VAL A 1 51 ? 4.402   7.112   1.585   1.00 0.00 ? 51 VAL A O    7  
ATOM 7473  C CB   . VAL A 1 51 ? 1.504   5.939   2.984   1.00 0.00 ? 51 VAL A CB   7  
ATOM 7474  C CG1  . VAL A 1 51 ? 1.301   7.449   3.049   1.00 0.00 ? 51 VAL A CG1  7  
ATOM 7475  C CG2  . VAL A 1 51 ? 0.152   5.365   2.542   1.00 0.00 ? 51 VAL A CG2  7  
ATOM 7476  H H    . VAL A 1 51 ? 2.461   3.606   2.985   1.00 0.00 ? 51 VAL A H    7  
ATOM 7477  H HA   . VAL A 1 51 ? 2.402   5.776   1.028   1.00 0.00 ? 51 VAL A HA   7  
ATOM 7478  H HB   . VAL A 1 51 ? 1.702   5.586   3.994   1.00 0.00 ? 51 VAL A HB   7  
ATOM 7479  H HG11 . VAL A 1 51 ? 2.155   7.919   3.535   1.00 0.00 ? 51 VAL A HG11 7  
ATOM 7480  H HG12 . VAL A 1 51 ? 1.187   7.853   2.042   1.00 0.00 ? 51 VAL A HG12 7  
ATOM 7481  H HG13 . VAL A 1 51 ? 0.405   7.654   3.635   1.00 0.00 ? 51 VAL A HG13 7  
ATOM 7482  H HG21 . VAL A 1 51 ? -0.179  5.853   1.627   1.00 0.00 ? 51 VAL A HG21 7  
ATOM 7483  H HG22 . VAL A 1 51 ? 0.233   4.303   2.370   1.00 0.00 ? 51 VAL A HG22 7  
ATOM 7484  H HG23 . VAL A 1 51 ? -0.580  5.525   3.333   1.00 0.00 ? 51 VAL A HG23 7  
ATOM 7485  N N    . LYS A 1 52 ? 4.583   5.998   3.521   1.00 0.00 ? 52 LYS A N    7  
ATOM 7486  C CA   . LYS A 1 52 ? 5.738   6.714   4.085   1.00 0.00 ? 52 LYS A CA   7  
ATOM 7487  C C    . LYS A 1 52 ? 6.974   6.603   3.193   1.00 0.00 ? 52 LYS A C    7  
ATOM 7488  O O    . LYS A 1 52 ? 7.802   7.515   3.182   1.00 0.00 ? 52 LYS A O    7  
ATOM 7489  C CB   . LYS A 1 52 ? 5.949   6.188   5.521   1.00 0.00 ? 52 LYS A CB   7  
ATOM 7490  C CG   . LYS A 1 52 ? 4.805   6.718   6.422   1.00 0.00 ? 52 LYS A CG   7  
ATOM 7491  C CD   . LYS A 1 52 ? 4.273   5.720   7.461   1.00 0.00 ? 52 LYS A CD   7  
ATOM 7492  C CE   . LYS A 1 52 ? 4.550   5.975   8.946   1.00 0.00 ? 52 LYS A CE   7  
ATOM 7493  N NZ   . LYS A 1 52 ? 3.492   6.725   9.653   1.00 0.00 ? 52 LYS A NZ   7  
ATOM 7494  H H    . LYS A 1 52 ? 4.184   5.258   4.092   1.00 0.00 ? 52 LYS A H    7  
ATOM 7495  H HA   . LYS A 1 52 ? 5.506   7.773   4.148   1.00 0.00 ? 52 LYS A HA   7  
ATOM 7496  H HB2  . LYS A 1 52 ? 5.954   5.099   5.491   1.00 0.00 ? 52 LYS A HB2  7  
ATOM 7497  H HB3  . LYS A 1 52 ? 6.906   6.494   5.931   1.00 0.00 ? 52 LYS A HB3  7  
ATOM 7498  H HG2  . LYS A 1 52 ? 5.092   7.653   6.899   1.00 0.00 ? 52 LYS A HG2  7  
ATOM 7499  H HG3  . LYS A 1 52 ? 3.972   6.932   5.756   1.00 0.00 ? 52 LYS A HG3  7  
ATOM 7500  H HD2  . LYS A 1 52 ? 3.195   5.630   7.305   1.00 0.00 ? 52 LYS A HD2  7  
ATOM 7501  H HD3  . LYS A 1 52 ? 4.729   4.759   7.242   1.00 0.00 ? 52 LYS A HD3  7  
ATOM 7502  H HE2  . LYS A 1 52 ? 4.600   4.997   9.435   1.00 0.00 ? 52 LYS A HE2  7  
ATOM 7503  H HE3  . LYS A 1 52 ? 5.507   6.480   9.053   1.00 0.00 ? 52 LYS A HE3  7  
ATOM 7504  H HZ1  . LYS A 1 52 ? 3.188   7.563   9.167   1.00 0.00 ? 52 LYS A HZ1  7  
ATOM 7505  H HZ2  . LYS A 1 52 ? 2.692   6.127   9.848   1.00 0.00 ? 52 LYS A HZ2  7  
ATOM 7506  H HZ3  . LYS A 1 52 ? 3.817   6.968   10.586  1.00 0.00 ? 52 LYS A HZ3  7  
ATOM 7507  N N    . GLU A 1 53 ? 7.025   5.533   2.411   1.00 0.00 ? 53 GLU A N    7  
ATOM 7508  C CA   . GLU A 1 53 ? 7.910   5.225   1.309   1.00 0.00 ? 53 GLU A CA   7  
ATOM 7509  C C    . GLU A 1 53 ? 7.521   6.049   0.077   1.00 0.00 ? 53 GLU A C    7  
ATOM 7510  O O    . GLU A 1 53 ? 8.303   6.860   -0.432  1.00 0.00 ? 53 GLU A O    7  
ATOM 7511  C CB   . GLU A 1 53 ? 7.752   3.726   1.036   1.00 0.00 ? 53 GLU A CB   7  
ATOM 7512  C CG   . GLU A 1 53 ? 8.436   2.822   2.053   1.00 0.00 ? 53 GLU A CG   7  
ATOM 7513  C CD   . GLU A 1 53 ? 9.945   2.649   1.902   1.00 0.00 ? 53 GLU A CD   7  
ATOM 7514  O OE1  . GLU A 1 53 ? 10.374  1.737   1.154   1.00 0.00 ? 53 GLU A OE1  7  
ATOM 7515  O OE2  . GLU A 1 53 ? 10.691  3.339   2.638   1.00 0.00 ? 53 GLU A OE2  7  
ATOM 7516  H H    . GLU A 1 53 ? 6.320   4.832   2.599   1.00 0.00 ? 53 GLU A H    7  
ATOM 7517  H HA   . GLU A 1 53 ? 8.941   5.424   1.579   1.00 0.00 ? 53 GLU A HA   7  
ATOM 7518  H HB2  . GLU A 1 53 ? 6.695   3.477   1.030   1.00 0.00 ? 53 GLU A HB2  7  
ATOM 7519  H HB3  . GLU A 1 53 ? 8.113   3.490   0.064   1.00 0.00 ? 53 GLU A HB3  7  
ATOM 7520  H HG2  . GLU A 1 53 ? 8.240   3.238   3.022   1.00 0.00 ? 53 GLU A HG2  7  
ATOM 7521  H HG3  . GLU A 1 53 ? 7.959   1.847   1.996   1.00 0.00 ? 53 GLU A HG3  7  
ATOM 7522  N N    . ARG A 1 54 ? 6.303   5.830   -0.439  1.00 0.00 ? 54 ARG A N    7  
ATOM 7523  C CA   . ARG A 1 54 ? 5.813   6.441   -1.677  1.00 0.00 ? 54 ARG A CA   7  
ATOM 7524  C C    . ARG A 1 54 ? 5.863   7.961   -1.632  1.00 0.00 ? 54 ARG A C    7  
ATOM 7525  O O    . ARG A 1 54 ? 5.969   8.572   -2.693  1.00 0.00 ? 54 ARG A O    7  
ATOM 7526  C CB   . ARG A 1 54 ? 4.375   5.985   -1.958  1.00 0.00 ? 54 ARG A CB   7  
ATOM 7527  C CG   . ARG A 1 54 ? 4.260   4.548   -2.498  1.00 0.00 ? 54 ARG A CG   7  
ATOM 7528  C CD   . ARG A 1 54 ? 4.024   4.474   -4.011  1.00 0.00 ? 54 ARG A CD   7  
ATOM 7529  N NE   . ARG A 1 54 ? 5.259   4.338   -4.797  1.00 0.00 ? 54 ARG A NE   7  
ATOM 7530  C CZ   . ARG A 1 54 ? 5.678   3.246   -5.444  1.00 0.00 ? 54 ARG A CZ   7  
ATOM 7531  N NH1  . ARG A 1 54 ? 5.006   2.100   -5.385  1.00 0.00 ? 54 ARG A NH1  7  
ATOM 7532  N NH2  . ARG A 1 54 ? 6.807   3.327   -6.145  1.00 0.00 ? 54 ARG A NH2  7  
ATOM 7533  H H    . ARG A 1 54 ? 5.670   5.200   0.048   1.00 0.00 ? 54 ARG A H    7  
ATOM 7534  H HA   . ARG A 1 54 ? 6.458   6.123   -2.489  1.00 0.00 ? 54 ARG A HA   7  
ATOM 7535  H HB2  . ARG A 1 54 ? 3.803   6.060   -1.033  1.00 0.00 ? 54 ARG A HB2  7  
ATOM 7536  H HB3  . ARG A 1 54 ? 3.906   6.671   -2.664  1.00 0.00 ? 54 ARG A HB3  7  
ATOM 7537  H HG2  . ARG A 1 54 ? 5.122   3.944   -2.211  1.00 0.00 ? 54 ARG A HG2  7  
ATOM 7538  H HG3  . ARG A 1 54 ? 3.388   4.108   -2.024  1.00 0.00 ? 54 ARG A HG3  7  
ATOM 7539  H HD2  . ARG A 1 54 ? 3.352   3.644   -4.218  1.00 0.00 ? 54 ARG A HD2  7  
ATOM 7540  H HD3  . ARG A 1 54 ? 3.526   5.381   -4.330  1.00 0.00 ? 54 ARG A HD3  7  
ATOM 7541  H HE   . ARG A 1 54 ? 5.725   5.221   -4.989  1.00 0.00 ? 54 ARG A HE   7  
ATOM 7542  H HH11 . ARG A 1 54 ? 3.992   2.152   -5.206  1.00 0.00 ? 54 ARG A HH11 7  
ATOM 7543  H HH12 . ARG A 1 54 ? 5.257   1.278   -5.927  1.00 0.00 ? 54 ARG A HH12 7  
ATOM 7544  H HH21 . ARG A 1 54 ? 7.223   4.241   -6.272  1.00 0.00 ? 54 ARG A HH21 7  
ATOM 7545  H HH22 . ARG A 1 54 ? 7.113   2.567   -6.744  1.00 0.00 ? 54 ARG A HH22 7  
ATOM 7546  N N    . LEU A 1 55 ? 5.835   8.552   -0.438  1.00 0.00 ? 55 LEU A N    7  
ATOM 7547  C CA   . LEU A 1 55 ? 5.975   9.977   -0.161  1.00 0.00 ? 55 LEU A CA   7  
ATOM 7548  C C    . LEU A 1 55 ? 7.277   10.591  -0.691  1.00 0.00 ? 55 LEU A C    7  
ATOM 7549  O O    . LEU A 1 55 ? 7.402   11.818  -0.689  1.00 0.00 ? 55 LEU A O    7  
ATOM 7550  C CB   . LEU A 1 55 ? 5.844   10.184  1.358   1.00 0.00 ? 55 LEU A CB   7  
ATOM 7551  C CG   . LEU A 1 55 ? 4.421   10.587  1.772   1.00 0.00 ? 55 LEU A CG   7  
ATOM 7552  C CD1  . LEU A 1 55 ? 4.233   10.391  3.270   1.00 0.00 ? 55 LEU A CD1  7  
ATOM 7553  C CD2  . LEU A 1 55 ? 4.195   12.071  1.455   1.00 0.00 ? 55 LEU A CD2  7  
ATOM 7554  H H    . LEU A 1 55 ? 5.651   7.948   0.357   1.00 0.00 ? 55 LEU A H    7  
ATOM 7555  H HA   . LEU A 1 55 ? 5.160   10.497  -0.665  1.00 0.00 ? 55 LEU A HA   7  
ATOM 7556  H HB2  . LEU A 1 55 ? 6.146   9.275   1.878   1.00 0.00 ? 55 LEU A HB2  7  
ATOM 7557  H HB3  . LEU A 1 55 ? 6.523   10.967  1.681   1.00 0.00 ? 55 LEU A HB3  7  
ATOM 7558  H HG   . LEU A 1 55 ? 3.688   9.954   1.267   1.00 0.00 ? 55 LEU A HG   7  
ATOM 7559  H HD11 . LEU A 1 55 ? 3.226   10.695  3.544   1.00 0.00 ? 55 LEU A HD11 7  
ATOM 7560  H HD12 . LEU A 1 55 ? 4.338   9.337   3.512   1.00 0.00 ? 55 LEU A HD12 7  
ATOM 7561  H HD13 . LEU A 1 55 ? 4.962   10.988  3.813   1.00 0.00 ? 55 LEU A HD13 7  
ATOM 7562  H HD21 . LEU A 1 55 ? 5.031   12.672  1.804   1.00 0.00 ? 55 LEU A HD21 7  
ATOM 7563  H HD22 . LEU A 1 55 ? 4.071   12.211  0.382   1.00 0.00 ? 55 LEU A HD22 7  
ATOM 7564  H HD23 . LEU A 1 55 ? 3.298   12.429  1.951   1.00 0.00 ? 55 LEU A HD23 7  
ATOM 7565  N N    . GLY A 1 56 ? 8.215   9.783   -1.191  1.00 0.00 ? 56 GLY A N    7  
ATOM 7566  C CA   . GLY A 1 56 ? 9.400   10.238  -1.906  1.00 0.00 ? 56 GLY A CA   7  
ATOM 7567  C C    . GLY A 1 56 ? 10.707  9.807   -1.255  1.00 0.00 ? 56 GLY A C    7  
ATOM 7568  O O    . GLY A 1 56 ? 11.775  10.097  -1.794  1.00 0.00 ? 56 GLY A O    7  
ATOM 7569  H H    . GLY A 1 56 ? 8.078   8.784   -1.097  1.00 0.00 ? 56 GLY A H    7  
ATOM 7570  H HA2  . GLY A 1 56 ? 9.359   9.842   -2.917  1.00 0.00 ? 56 GLY A HA2  7  
ATOM 7571  H HA3  . GLY A 1 56 ? 9.399   11.325  -1.979  1.00 0.00 ? 56 GLY A HA3  7  
ATOM 7572  N N    . THR A 1 57 ? 10.658  9.054   -0.156  1.00 0.00 ? 57 THR A N    7  
ATOM 7573  C CA   . THR A 1 57 ? 11.846  8.497   0.497   1.00 0.00 ? 57 THR A CA   7  
ATOM 7574  C C    . THR A 1 57 ? 12.446  7.340   -0.323  1.00 0.00 ? 57 THR A C    7  
ATOM 7575  O O    . THR A 1 57 ? 13.508  6.814   0.021   1.00 0.00 ? 57 THR A O    7  
ATOM 7576  C CB   . THR A 1 57 ? 11.464  8.040   1.915   1.00 0.00 ? 57 THR A CB   7  
ATOM 7577  O OG1  . THR A 1 57 ? 10.242  7.351   1.845   1.00 0.00 ? 57 THR A OG1  7  
ATOM 7578  C CG2  . THR A 1 57 ? 11.310  9.210   2.887   1.00 0.00 ? 57 THR A CG2  7  
ATOM 7579  H H    . THR A 1 57 ? 9.766   8.687   0.172   1.00 0.00 ? 57 THR A H    7  
ATOM 7580  H HA   . THR A 1 57 ? 12.610  9.270   0.575   1.00 0.00 ? 57 THR A HA   7  
ATOM 7581  H HB   . THR A 1 57 ? 12.227  7.370   2.297   1.00 0.00 ? 57 THR A HB   7  
ATOM 7582  H HG1  . THR A 1 57 ? 9.789   7.353   2.702   1.00 0.00 ? 57 THR A HG1  7  
ATOM 7583  H HG21 . THR A 1 57 ? 11.099  8.830   3.887   1.00 0.00 ? 57 THR A HG21 7  
ATOM 7584  H HG22 . THR A 1 57 ? 12.231  9.792   2.918   1.00 0.00 ? 57 THR A HG22 7  
ATOM 7585  H HG23 . THR A 1 57 ? 10.492  9.851   2.568   1.00 0.00 ? 57 THR A HG23 7  
ATOM 7586  N N    . LEU A 1 58 ? 11.769  6.931   -1.398  1.00 0.00 ? 58 LEU A N    7  
ATOM 7587  C CA   . LEU A 1 58 ? 12.203  5.906   -2.333  1.00 0.00 ? 58 LEU A CA   7  
ATOM 7588  C C    . LEU A 1 58 ? 13.218  6.494   -3.304  1.00 0.00 ? 58 LEU A C    7  
ATOM 7589  O O    . LEU A 1 58 ? 13.059  7.624   -3.782  1.00 0.00 ? 58 LEU A O    7  
ATOM 7590  C CB   . LEU A 1 58 ? 10.982  5.366   -3.089  1.00 0.00 ? 58 LEU A CB   7  
ATOM 7591  C CG   . LEU A 1 58 ? 10.064  4.564   -2.150  1.00 0.00 ? 58 LEU A CG   7  
ATOM 7592  C CD1  . LEU A 1 58 ? 8.659   4.437   -2.734  1.00 0.00 ? 58 LEU A CD1  7  
ATOM 7593  C CD2  . LEU A 1 58 ? 10.608  3.164   -1.899  1.00 0.00 ? 58 LEU A CD2  7  
ATOM 7594  H H    . LEU A 1 58 ? 10.896  7.400   -1.587  1.00 0.00 ? 58 LEU A H    7  
ATOM 7595  H HA   . LEU A 1 58 ? 12.676  5.097   -1.775  1.00 0.00 ? 58 LEU A HA   7  
ATOM 7596  H HB2  . LEU A 1 58 ? 10.436  6.211   -3.512  1.00 0.00 ? 58 LEU A HB2  7  
ATOM 7597  H HB3  . LEU A 1 58 ? 11.311  4.731   -3.914  1.00 0.00 ? 58 LEU A HB3  7  
ATOM 7598  H HG   . LEU A 1 58 ? 9.984   5.068   -1.187  1.00 0.00 ? 58 LEU A HG   7  
ATOM 7599  H HD11 . LEU A 1 58 ? 7.998   3.999   -1.979  1.00 0.00 ? 58 LEU A HD11 7  
ATOM 7600  H HD12 . LEU A 1 58 ? 8.308   5.436   -2.970  1.00 0.00 ? 58 LEU A HD12 7  
ATOM 7601  H HD13 . LEU A 1 58 ? 8.672   3.844   -3.646  1.00 0.00 ? 58 LEU A HD13 7  
ATOM 7602  H HD21 . LEU A 1 58 ? 10.734  2.632   -2.839  1.00 0.00 ? 58 LEU A HD21 7  
ATOM 7603  H HD22 . LEU A 1 58 ? 11.559  3.218   -1.369  1.00 0.00 ? 58 LEU A HD22 7  
ATOM 7604  H HD23 . LEU A 1 58 ? 9.906   2.635   -1.265  1.00 0.00 ? 58 LEU A HD23 7  
ATOM 7605  N N    . LYS A 1 59 ? 14.240  5.697   -3.608  1.00 0.00 ? 59 LYS A N    7  
ATOM 7606  C CA   . LYS A 1 59 ? 15.416  6.036   -4.413  1.00 0.00 ? 59 LYS A CA   7  
ATOM 7607  C C    . LYS A 1 59 ? 15.780  4.939   -5.398  1.00 0.00 ? 59 LYS A C    7  
ATOM 7608  O O    . LYS A 1 59 ? 16.727  5.129   -6.154  1.00 0.00 ? 59 LYS A O    7  
ATOM 7609  C CB   . LYS A 1 59 ? 16.601  6.313   -3.469  1.00 0.00 ? 59 LYS A CB   7  
ATOM 7610  C CG   . LYS A 1 59 ? 16.633  7.757   -2.968  1.00 0.00 ? 59 LYS A CG   7  
ATOM 7611  C CD   . LYS A 1 59 ? 17.350  8.703   -3.938  1.00 0.00 ? 59 LYS A CD   7  
ATOM 7612  C CE   . LYS A 1 59 ? 17.391  10.116  -3.344  1.00 0.00 ? 59 LYS A CE   7  
ATOM 7613  N NZ   . LYS A 1 59 ? 18.254  11.017  -4.133  1.00 0.00 ? 59 LYS A NZ   7  
ATOM 7614  H H    . LYS A 1 59 ? 14.240  4.784   -3.157  1.00 0.00 ? 59 LYS A H    7  
ATOM 7615  H HA   . LYS A 1 59 ? 15.216  6.911   -5.034  1.00 0.00 ? 59 LYS A HA   7  
ATOM 7616  H HB2  . LYS A 1 59 ? 16.531  5.647   -2.608  1.00 0.00 ? 59 LYS A HB2  7  
ATOM 7617  H HB3  . LYS A 1 59 ? 17.551  6.098   -3.962  1.00 0.00 ? 59 LYS A HB3  7  
ATOM 7618  H HG2  . LYS A 1 59 ? 15.619  8.104   -2.783  1.00 0.00 ? 59 LYS A HG2  7  
ATOM 7619  H HG3  . LYS A 1 59 ? 17.176  7.761   -2.030  1.00 0.00 ? 59 LYS A HG3  7  
ATOM 7620  H HD2  . LYS A 1 59 ? 18.371  8.347   -4.090  1.00 0.00 ? 59 LYS A HD2  7  
ATOM 7621  H HD3  . LYS A 1 59 ? 16.832  8.720   -4.898  1.00 0.00 ? 59 LYS A HD3  7  
ATOM 7622  H HE2  . LYS A 1 59 ? 16.378  10.511  -3.300  1.00 0.00 ? 59 LYS A HE2  7  
ATOM 7623  H HE3  . LYS A 1 59 ? 17.781  10.059  -2.327  1.00 0.00 ? 59 LYS A HE3  7  
ATOM 7624  H HZ1  . LYS A 1 59 ? 19.213  10.675  -4.103  1.00 0.00 ? 59 LYS A HZ1  7  
ATOM 7625  H HZ2  . LYS A 1 59 ? 17.984  11.008  -5.112  1.00 0.00 ? 59 LYS A HZ2  7  
ATOM 7626  H HZ3  . LYS A 1 59 ? 18.233  11.961  -3.777  1.00 0.00 ? 59 LYS A HZ3  7  
ATOM 7627  N N    . ASN A 1 60 ? 15.045  3.830   -5.453  1.00 0.00 ? 60 ASN A N    7  
ATOM 7628  C CA   . ASN A 1 60 ? 15.192  2.801   -6.475  1.00 0.00 ? 60 ASN A CA   7  
ATOM 7629  C C    . ASN A 1 60 ? 14.062  2.959   -7.497  1.00 0.00 ? 60 ASN A C    7  
ATOM 7630  O O    . ASN A 1 60 ? 12.978  2.395   -7.298  1.00 0.00 ? 60 ASN A O    7  
ATOM 7631  C CB   . ASN A 1 60 ? 15.213  1.420   -5.813  1.00 0.00 ? 60 ASN A CB   7  
ATOM 7632  C CG   . ASN A 1 60 ? 15.101  0.274   -6.810  1.00 0.00 ? 60 ASN A CG   7  
ATOM 7633  O OD1  . ASN A 1 60 ? 15.380  0.417   -7.998  1.00 0.00 ? 60 ASN A OD1  7  
ATOM 7634  N ND2  . ASN A 1 60 ? 14.648  -0.877  -6.354  1.00 0.00 ? 60 ASN A ND2  7  
ATOM 7635  H H    . ASN A 1 60 ? 14.322  3.701   -4.754  1.00 0.00 ? 60 ASN A H    7  
ATOM 7636  H HA   . ASN A 1 60 ? 16.149  2.910   -6.984  1.00 0.00 ? 60 ASN A HA   7  
ATOM 7637  H HB2  . ASN A 1 60 ? 16.152  1.327   -5.272  1.00 0.00 ? 60 ASN A HB2  7  
ATOM 7638  H HB3  . ASN A 1 60 ? 14.387  1.348   -5.107  1.00 0.00 ? 60 ASN A HB3  7  
ATOM 7639  H HD21 . ASN A 1 60 ? 14.489  -1.019  -5.367  1.00 0.00 ? 60 ASN A HD21 7  
ATOM 7640  H HD22 . ASN A 1 60 ? 14.491  -1.631  -7.014  1.00 0.00 ? 60 ASN A HD22 7  
ATOM 7641  N N    . PRO A 1 61 ? 14.232  3.779   -8.550  1.00 0.00 ? 61 PRO A N    7  
ATOM 7642  C CA   . PRO A 1 61 ? 13.282  3.878   -9.651  1.00 0.00 ? 61 PRO A CA   7  
ATOM 7643  C C    . PRO A 1 61 ? 13.378  2.651   -10.568 1.00 0.00 ? 61 PRO A C    7  
ATOM 7644  O O    . PRO A 1 61 ? 14.474  2.105   -10.739 1.00 0.00 ? 61 PRO A O    7  
ATOM 7645  C CB   . PRO A 1 61 ? 13.681  5.152   -10.401 1.00 0.00 ? 61 PRO A CB   7  
ATOM 7646  C CG   . PRO A 1 61 ? 15.181  5.283   -10.151 1.00 0.00 ? 61 PRO A CG   7  
ATOM 7647  C CD   . PRO A 1 61 ? 15.339  4.703   -8.755  1.00 0.00 ? 61 PRO A CD   7  
ATOM 7648  H HA   . PRO A 1 61 ? 12.270  3.988   -9.265  1.00 0.00 ? 61 PRO A HA   7  
ATOM 7649  H HB2  . PRO A 1 61 ? 13.449  5.102   -11.467 1.00 0.00 ? 61 PRO A HB2  7  
ATOM 7650  H HB3  . PRO A 1 61 ? 13.173  5.994   -9.938  1.00 0.00 ? 61 PRO A HB3  7  
ATOM 7651  H HG2  . PRO A 1 61 ? 15.737  4.676   -10.866 1.00 0.00 ? 61 PRO A HG2  7  
ATOM 7652  H HG3  . PRO A 1 61 ? 15.507  6.324   -10.164 1.00 0.00 ? 61 PRO A HG3  7  
ATOM 7653  H HD2  . PRO A 1 61 ? 16.309  4.212   -8.669  1.00 0.00 ? 61 PRO A HD2  7  
ATOM 7654  H HD3  . PRO A 1 61 ? 15.251  5.520   -8.041  1.00 0.00 ? 61 PRO A HD3  7  
ATOM 7655  N N    . PRO A 1 62 ? 12.276  2.240   -11.216 1.00 0.00 ? 62 PRO A N    7  
ATOM 7656  C CA   . PRO A 1 62 ? 12.344  1.264   -12.290 1.00 0.00 ? 62 PRO A CA   7  
ATOM 7657  C C    . PRO A 1 62 ? 12.993  1.909   -13.520 1.00 0.00 ? 62 PRO A C    7  
ATOM 7658  O O    . PRO A 1 62 ? 12.890  3.130   -13.710 1.00 0.00 ? 62 PRO A O    7  
ATOM 7659  C CB   . PRO A 1 62 ? 10.893  0.861   -12.559 1.00 0.00 ? 62 PRO A CB   7  
ATOM 7660  C CG   . PRO A 1 62 ? 10.109  2.126   -12.207 1.00 0.00 ? 62 PRO A CG   7  
ATOM 7661  C CD   . PRO A 1 62 ? 10.927  2.774   -11.089 1.00 0.00 ? 62 PRO A CD   7  
ATOM 7662  H HA   . PRO A 1 62 ? 12.915  0.396   -11.970 1.00 0.00 ? 62 PRO A HA   7  
ATOM 7663  H HB2  . PRO A 1 62 ? 10.733  0.560   -13.596 1.00 0.00 ? 62 PRO A HB2  7  
ATOM 7664  H HB3  . PRO A 1 62 ? 10.613  0.053   -11.884 1.00 0.00 ? 62 PRO A HB3  7  
ATOM 7665  H HG2  . PRO A 1 62 ? 10.096  2.794   -13.068 1.00 0.00 ? 62 PRO A HG2  7  
ATOM 7666  H HG3  . PRO A 1 62 ? 9.093   1.897   -11.885 1.00 0.00 ? 62 PRO A HG3  7  
ATOM 7667  H HD2  . PRO A 1 62 ? 10.926  3.855   -11.215 1.00 0.00 ? 62 PRO A HD2  7  
ATOM 7668  H HD3  . PRO A 1 62 ? 10.513  2.512   -10.116 1.00 0.00 ? 62 PRO A HD3  7  
ATOM 7669  N N    . LYS A 1 63 ? 13.598  1.100   -14.398 1.00 0.00 ? 63 LYS A N    7  
ATOM 7670  C CA   . LYS A 1 63 ? 14.082  1.565   -15.703 1.00 0.00 ? 63 LYS A CA   7  
ATOM 7671  C C    . LYS A 1 63 ? 13.436  0.751   -16.810 1.00 0.00 ? 63 LYS A C    7  
ATOM 7672  O O    . LYS A 1 63 ? 12.905  1.337   -17.754 1.00 0.00 ? 63 LYS A O    7  
ATOM 7673  C CB   . LYS A 1 63 ? 15.622  1.560   -15.766 1.00 0.00 ? 63 LYS A CB   7  
ATOM 7674  C CG   . LYS A 1 63 ? 16.177  2.645   -16.709 1.00 0.00 ? 63 LYS A CG   7  
ATOM 7675  C CD   . LYS A 1 63 ? 16.485  3.985   -16.014 1.00 0.00 ? 63 LYS A CD   7  
ATOM 7676  C CE   . LYS A 1 63 ? 15.316  4.618   -15.248 1.00 0.00 ? 63 LYS A CE   7  
ATOM 7677  N NZ   . LYS A 1 63 ? 14.384  5.359   -16.121 1.00 0.00 ? 63 LYS A NZ   7  
ATOM 7678  H H    . LYS A 1 63 ? 13.652  0.108   -14.181 1.00 0.00 ? 63 LYS A H    7  
ATOM 7679  H HA   . LYS A 1 63 ? 13.731  2.583   -15.849 1.00 0.00 ? 63 LYS A HA   7  
ATOM 7680  H HB2  . LYS A 1 63 ? 16.039  1.712   -14.770 1.00 0.00 ? 63 LYS A HB2  7  
ATOM 7681  H HB3  . LYS A 1 63 ? 15.960  0.582   -16.111 1.00 0.00 ? 63 LYS A HB3  7  
ATOM 7682  H HG2  . LYS A 1 63 ? 17.118  2.281   -17.120 1.00 0.00 ? 63 LYS A HG2  7  
ATOM 7683  H HG3  . LYS A 1 63 ? 15.500  2.800   -17.546 1.00 0.00 ? 63 LYS A HG3  7  
ATOM 7684  H HD2  . LYS A 1 63 ? 17.286  3.804   -15.301 1.00 0.00 ? 63 LYS A HD2  7  
ATOM 7685  H HD3  . LYS A 1 63 ? 16.869  4.694   -16.748 1.00 0.00 ? 63 LYS A HD3  7  
ATOM 7686  H HE2  . LYS A 1 63 ? 14.791  3.844   -14.693 1.00 0.00 ? 63 LYS A HE2  7  
ATOM 7687  H HE3  . LYS A 1 63 ? 15.720  5.323   -14.519 1.00 0.00 ? 63 LYS A HE3  7  
ATOM 7688  H HZ1  . LYS A 1 63 ? 14.773  6.284   -16.296 1.00 0.00 ? 63 LYS A HZ1  7  
ATOM 7689  H HZ2  . LYS A 1 63 ? 14.194  4.867   -16.992 1.00 0.00 ? 63 LYS A HZ2  7  
ATOM 7690  H HZ3  . LYS A 1 63 ? 13.490  5.475   -15.658 1.00 0.00 ? 63 LYS A HZ3  7  
ATOM 7691  N N    . LYS A 1 64 ? 13.384  -0.571  -16.663 1.00 0.00 ? 64 LYS A N    7  
ATOM 7692  C CA   . LYS A 1 64 ? 12.428  -1.416  -17.362 1.00 0.00 ? 64 LYS A CA   7  
ATOM 7693  C C    . LYS A 1 64 ? 11.774  -2.317  -16.319 1.00 0.00 ? 64 LYS A C    7  
ATOM 7694  O O    . LYS A 1 64 ? 12.279  -2.432  -15.199 1.00 0.00 ? 64 LYS A O    7  
ATOM 7695  C CB   . LYS A 1 64 ? 13.121  -2.222  -18.475 1.00 0.00 ? 64 LYS A CB   7  
ATOM 7696  C CG   . LYS A 1 64 ? 13.394  -1.421  -19.763 1.00 0.00 ? 64 LYS A CG   7  
ATOM 7697  C CD   . LYS A 1 64 ? 14.786  -0.779  -19.860 1.00 0.00 ? 64 LYS A CD   7  
ATOM 7698  C CE   . LYS A 1 64 ? 14.838  0.047   -21.154 1.00 0.00 ? 64 LYS A CE   7  
ATOM 7699  N NZ   . LYS A 1 64 ? 16.139  0.712   -21.364 1.00 0.00 ? 64 LYS A NZ   7  
ATOM 7700  H H    . LYS A 1 64 ? 13.824  -1.018  -15.864 1.00 0.00 ? 64 LYS A H    7  
ATOM 7701  H HA   . LYS A 1 64 ? 11.646  -0.797  -17.803 1.00 0.00 ? 64 LYS A HA   7  
ATOM 7702  H HB2  . LYS A 1 64 ? 14.044  -2.663  -18.091 1.00 0.00 ? 64 LYS A HB2  7  
ATOM 7703  H HB3  . LYS A 1 64 ? 12.449  -3.032  -18.757 1.00 0.00 ? 64 LYS A HB3  7  
ATOM 7704  H HG2  . LYS A 1 64 ? 13.287  -2.105  -20.606 1.00 0.00 ? 64 LYS A HG2  7  
ATOM 7705  H HG3  . LYS A 1 64 ? 12.633  -0.647  -19.871 1.00 0.00 ? 64 LYS A HG3  7  
ATOM 7706  H HD2  . LYS A 1 64 ? 14.959  -0.127  -19.004 1.00 0.00 ? 64 LYS A HD2  7  
ATOM 7707  H HD3  . LYS A 1 64 ? 15.548  -1.560  -19.880 1.00 0.00 ? 64 LYS A HD3  7  
ATOM 7708  H HE2  . LYS A 1 64 ? 14.621  -0.601  -22.005 1.00 0.00 ? 64 LYS A HE2  7  
ATOM 7709  H HE3  . LYS A 1 64 ? 14.059  0.812   -21.106 1.00 0.00 ? 64 LYS A HE3  7  
ATOM 7710  H HZ1  . LYS A 1 64 ? 16.405  1.289   -20.570 1.00 0.00 ? 64 LYS A HZ1  7  
ATOM 7711  H HZ2  . LYS A 1 64 ? 16.906  0.062   -21.495 1.00 0.00 ? 64 LYS A HZ2  7  
ATOM 7712  H HZ3  . LYS A 1 64 ? 16.106  1.314   -22.180 1.00 0.00 ? 64 LYS A HZ3  7  
ATOM 7713  N N    . LYS A 1 65 ? 10.661  -2.953  -16.681 1.00 0.00 ? 65 LYS A N    7  
ATOM 7714  C CA   . LYS A 1 65 ? 9.974   -3.974  -15.890 1.00 0.00 ? 65 LYS A CA   7  
ATOM 7715  C C    . LYS A 1 65 ? 9.605   -5.138  -16.808 1.00 0.00 ? 65 LYS A C    7  
ATOM 7716  O O    . LYS A 1 65 ? 10.009  -5.138  -17.973 1.00 0.00 ? 65 LYS A O    7  
ATOM 7717  C CB   . LYS A 1 65 ? 8.763   -3.363  -15.156 1.00 0.00 ? 65 LYS A CB   7  
ATOM 7718  C CG   . LYS A 1 65 ? 7.591   -2.980  -16.077 1.00 0.00 ? 65 LYS A CG   7  
ATOM 7719  C CD   . LYS A 1 65 ? 6.452   -2.340  -15.278 1.00 0.00 ? 65 LYS A CD   7  
ATOM 7720  C CE   . LYS A 1 65 ? 5.239   -2.166  -16.196 1.00 0.00 ? 65 LYS A CE   7  
ATOM 7721  N NZ   . LYS A 1 65 ? 4.105   -1.553  -15.485 1.00 0.00 ? 65 LYS A NZ   7  
ATOM 7722  H H    . LYS A 1 65 ? 10.307  -2.808  -17.620 1.00 0.00 ? 65 LYS A H    7  
ATOM 7723  H HA   . LYS A 1 65 ? 10.670  -4.350  -15.138 1.00 0.00 ? 65 LYS A HA   7  
ATOM 7724  H HB2  . LYS A 1 65 ? 8.400   -4.087  -14.426 1.00 0.00 ? 65 LYS A HB2  7  
ATOM 7725  H HB3  . LYS A 1 65 ? 9.094   -2.481  -14.605 1.00 0.00 ? 65 LYS A HB3  7  
ATOM 7726  H HG2  . LYS A 1 65 ? 7.930   -2.276  -16.836 1.00 0.00 ? 65 LYS A HG2  7  
ATOM 7727  H HG3  . LYS A 1 65 ? 7.211   -3.874  -16.572 1.00 0.00 ? 65 LYS A HG3  7  
ATOM 7728  H HD2  . LYS A 1 65 ? 6.185   -2.985  -14.438 1.00 0.00 ? 65 LYS A HD2  7  
ATOM 7729  H HD3  . LYS A 1 65 ? 6.775   -1.369  -14.895 1.00 0.00 ? 65 LYS A HD3  7  
ATOM 7730  H HE2  . LYS A 1 65 ? 5.519   -1.532  -17.039 1.00 0.00 ? 65 LYS A HE2  7  
ATOM 7731  H HE3  . LYS A 1 65 ? 4.933   -3.145  -16.573 1.00 0.00 ? 65 LYS A HE3  7  
ATOM 7732  H HZ1  . LYS A 1 65 ? 4.378   -0.683  -15.040 1.00 0.00 ? 65 LYS A HZ1  7  
ATOM 7733  H HZ2  . LYS A 1 65 ? 3.341   -1.336  -16.120 1.00 0.00 ? 65 LYS A HZ2  7  
ATOM 7734  H HZ3  . LYS A 1 65 ? 3.729   -2.181  -14.780 1.00 0.00 ? 65 LYS A HZ3  7  
ATOM 7735  N N    . MET A 1 66 ? 8.856   -6.120  -16.308 1.00 0.00 ? 66 MET A N    7  
ATOM 7736  C CA   . MET A 1 66 ? 8.113   -7.099  -17.103 1.00 0.00 ? 66 MET A CA   7  
ATOM 7737  C C    . MET A 1 66 ? 6.761   -7.342  -16.429 1.00 0.00 ? 66 MET A C    7  
ATOM 7738  O O    . MET A 1 66 ? 6.601   -7.045  -15.239 1.00 0.00 ? 66 MET A O    7  
ATOM 7739  C CB   . MET A 1 66 ? 8.868   -8.441  -17.182 1.00 0.00 ? 66 MET A CB   7  
ATOM 7740  C CG   . MET A 1 66 ? 10.245  -8.405  -17.857 1.00 0.00 ? 66 MET A CG   7  
ATOM 7741  S SD   . MET A 1 66 ? 10.334  -8.656  -19.659 1.00 0.00 ? 66 MET A SD   7  
ATOM 7742  C CE   . MET A 1 66 ? 9.166   -7.442  -20.327 1.00 0.00 ? 66 MET A CE   7  
ATOM 7743  H H    . MET A 1 66 ? 8.591   -6.087  -15.329 1.00 0.00 ? 66 MET A H    7  
ATOM 7744  H HA   . MET A 1 66 ? 7.937   -6.698  -18.099 1.00 0.00 ? 66 MET A HA   7  
ATOM 7745  H HB2  . MET A 1 66 ? 9.007   -8.802  -16.161 1.00 0.00 ? 66 MET A HB2  7  
ATOM 7746  H HB3  . MET A 1 66 ? 8.249   -9.172  -17.703 1.00 0.00 ? 66 MET A HB3  7  
ATOM 7747  H HG2  . MET A 1 66 ? 10.751  -7.479  -17.598 1.00 0.00 ? 66 MET A HG2  7  
ATOM 7748  H HG3  . MET A 1 66 ? 10.828  -9.208  -17.406 1.00 0.00 ? 66 MET A HG3  7  
ATOM 7749  H HE1  . MET A 1 66 ? 8.159   -7.682  -19.993 1.00 0.00 ? 66 MET A HE1  7  
ATOM 7750  H HE2  . MET A 1 66 ? 9.434   -6.437  -20.006 1.00 0.00 ? 66 MET A HE2  7  
ATOM 7751  H HE3  . MET A 1 66 ? 9.183   -7.483  -21.415 1.00 0.00 ? 66 MET A HE3  7  
ATOM 7752  N N    . LYS A 1 67 ? 5.802   -7.929  -17.146 1.00 0.00 ? 67 LYS A N    7  
ATOM 7753  C CA   . LYS A 1 67 ? 4.652   -8.577  -16.527 1.00 0.00 ? 67 LYS A CA   7  
ATOM 7754  C C    . LYS A 1 67 ? 5.172   -9.859  -15.886 1.00 0.00 ? 67 LYS A C    7  
ATOM 7755  O O    . LYS A 1 67 ? 5.560   -10.767 -16.624 1.00 0.00 ? 67 LYS A O    7  
ATOM 7756  C CB   . LYS A 1 67 ? 3.597   -8.876  -17.600 1.00 0.00 ? 67 LYS A CB   7  
ATOM 7757  C CG   . LYS A 1 67 ? 2.312   -9.530  -17.070 1.00 0.00 ? 67 LYS A CG   7  
ATOM 7758  C CD   . LYS A 1 67 ? 1.311   -8.478  -16.591 1.00 0.00 ? 67 LYS A CD   7  
ATOM 7759  C CE   . LYS A 1 67 ? 0.105   -9.146  -15.932 1.00 0.00 ? 67 LYS A CE   7  
ATOM 7760  N NZ   . LYS A 1 67 ? -0.997  -8.193  -15.717 1.00 0.00 ? 67 LYS A NZ   7  
ATOM 7761  H H    . LYS A 1 67 ? 5.960   -8.111  -18.132 1.00 0.00 ? 67 LYS A H    7  
ATOM 7762  H HA   . LYS A 1 67 ? 4.226   -7.917  -15.772 1.00 0.00 ? 67 LYS A HA   7  
ATOM 7763  H HB2  . LYS A 1 67 ? 3.342   -7.950  -18.116 1.00 0.00 ? 67 LYS A HB2  7  
ATOM 7764  H HB3  . LYS A 1 67 ? 4.044   -9.552  -18.324 1.00 0.00 ? 67 LYS A HB3  7  
ATOM 7765  H HG2  . LYS A 1 67 ? 1.850   -10.096 -17.881 1.00 0.00 ? 67 LYS A HG2  7  
ATOM 7766  H HG3  . LYS A 1 67 ? 2.541   -10.221 -16.260 1.00 0.00 ? 67 LYS A HG3  7  
ATOM 7767  H HD2  . LYS A 1 67 ? 1.791   -7.819  -15.867 1.00 0.00 ? 67 LYS A HD2  7  
ATOM 7768  H HD3  . LYS A 1 67 ? 0.985   -7.895  -17.453 1.00 0.00 ? 67 LYS A HD3  7  
ATOM 7769  H HE2  . LYS A 1 67 ? -0.246  -9.965  -16.559 1.00 0.00 ? 67 LYS A HE2  7  
ATOM 7770  H HE3  . LYS A 1 67 ? 0.417   -9.546  -14.965 1.00 0.00 ? 67 LYS A HE3  7  
ATOM 7771  H HZ1  . LYS A 1 67 ? -0.664  -7.322  -15.310 1.00 0.00 ? 67 LYS A HZ1  7  
ATOM 7772  H HZ2  . LYS A 1 67 ? -1.473  -7.948  -16.580 1.00 0.00 ? 67 LYS A HZ2  7  
ATOM 7773  H HZ3  . LYS A 1 67 ? -1.665  -8.570  -15.051 1.00 0.00 ? 67 LYS A HZ3  7  
ATOM 7774  N N    . LEU A 1 68 ? 5.189   -9.947  -14.556 1.00 0.00 ? 68 LEU A N    7  
ATOM 7775  C CA   . LEU A 1 68 ? 5.652   -11.150 -13.860 1.00 0.00 ? 68 LEU A CA   7  
ATOM 7776  C C    . LEU A 1 68 ? 4.820   -12.372 -14.263 1.00 0.00 ? 68 LEU A C    7  
ATOM 7777  O O    . LEU A 1 68 ? 5.379   -13.443 -14.478 1.00 0.00 ? 68 LEU A O    7  
ATOM 7778  C CB   . LEU A 1 68 ? 5.690   -10.926 -12.339 1.00 0.00 ? 68 LEU A CB   7  
ATOM 7779  C CG   . LEU A 1 68 ? 4.310   -10.849 -11.645 1.00 0.00 ? 68 LEU A CG   7  
ATOM 7780  C CD1  . LEU A 1 68 ? 3.916   -12.184 -11.003 1.00 0.00 ? 68 LEU A CD1  7  
ATOM 7781  C CD2  . LEU A 1 68 ? 4.338   -9.779  -10.561 1.00 0.00 ? 68 LEU A CD2  7  
ATOM 7782  H H    . LEU A 1 68 ? 4.849   -9.154  -14.016 1.00 0.00 ? 68 LEU A H    7  
ATOM 7783  H HA   . LEU A 1 68 ? 6.678   -11.336 -14.186 1.00 0.00 ? 68 LEU A HA   7  
ATOM 7784  H HB2  . LEU A 1 68 ? 6.272   -11.733 -11.890 1.00 0.00 ? 68 LEU A HB2  7  
ATOM 7785  H HB3  . LEU A 1 68 ? 6.248   -10.006 -12.160 1.00 0.00 ? 68 LEU A HB3  7  
ATOM 7786  H HG   . LEU A 1 68 ? 3.543   -10.558 -12.363 1.00 0.00 ? 68 LEU A HG   7  
ATOM 7787  H HD11 . LEU A 1 68 ? 4.637   -12.461 -10.234 1.00 0.00 ? 68 LEU A HD11 7  
ATOM 7788  H HD12 . LEU A 1 68 ? 2.931   -12.105 -10.545 1.00 0.00 ? 68 LEU A HD12 7  
ATOM 7789  H HD13 . LEU A 1 68 ? 3.885   -12.983 -11.743 1.00 0.00 ? 68 LEU A HD13 7  
ATOM 7790  H HD21 . LEU A 1 68 ? 5.133   -10.008 -9.856  1.00 0.00 ? 68 LEU A HD21 7  
ATOM 7791  H HD22 . LEU A 1 68 ? 4.531   -8.806  -11.009 1.00 0.00 ? 68 LEU A HD22 7  
ATOM 7792  H HD23 . LEU A 1 68 ? 3.377   -9.739  -10.048 1.00 0.00 ? 68 LEU A HD23 7  
ATOM 7793  N N    . MET A 1 69 ? 3.505   -12.179 -14.434 1.00 0.00 ? 69 MET A N    7  
ATOM 7794  C CA   . MET A 1 69 ? 2.508   -13.100 -14.977 1.00 0.00 ? 69 MET A CA   7  
ATOM 7795  C C    . MET A 1 69 ? 2.244   -14.334 -14.100 1.00 0.00 ? 69 MET A C    7  
ATOM 7796  O O    . MET A 1 69 ? 1.093   -14.566 -13.718 1.00 0.00 ? 69 MET A O    7  
ATOM 7797  C CB   . MET A 1 69 ? 2.871   -13.446 -16.436 1.00 0.00 ? 69 MET A CB   7  
ATOM 7798  C CG   . MET A 1 69 ? 1.706   -14.044 -17.229 1.00 0.00 ? 69 MET A CG   7  
ATOM 7799  S SD   . MET A 1 69 ? 1.301   -15.771 -16.856 1.00 0.00 ? 69 MET A SD   7  
ATOM 7800  C CE   . MET A 1 69 ? -0.132  -15.932 -17.941 1.00 0.00 ? 69 MET A CE   7  
ATOM 7801  H H    . MET A 1 69 ? 3.164   -11.270 -14.166 1.00 0.00 ? 69 MET A H    7  
ATOM 7802  H HA   . MET A 1 69 ? 1.572   -12.546 -15.011 1.00 0.00 ? 69 MET A HA   7  
ATOM 7803  H HB2  . MET A 1 69 ? 3.172   -12.530 -16.946 1.00 0.00 ? 69 MET A HB2  7  
ATOM 7804  H HB3  . MET A 1 69 ? 3.714   -14.137 -16.459 1.00 0.00 ? 69 MET A HB3  7  
ATOM 7805  H HG2  . MET A 1 69 ? 0.821   -13.429 -17.066 1.00 0.00 ? 69 MET A HG2  7  
ATOM 7806  H HG3  . MET A 1 69 ? 1.955   -13.983 -18.289 1.00 0.00 ? 69 MET A HG3  7  
ATOM 7807  H HE1  . MET A 1 69 ? -0.579  -16.914 -17.797 1.00 0.00 ? 69 MET A HE1  7  
ATOM 7808  H HE2  . MET A 1 69 ? -0.866  -15.162 -17.701 1.00 0.00 ? 69 MET A HE2  7  
ATOM 7809  H HE3  . MET A 1 69 ? 0.177   -15.823 -18.979 1.00 0.00 ? 69 MET A HE3  7  
ATOM 7810  N N    . ARG A 1 70 ? 3.274   -15.141 -13.845 1.00 0.00 ? 70 ARG A N    7  
ATOM 7811  C CA   . ARG A 1 70 ? 3.176   -16.467 -13.248 1.00 0.00 ? 70 ARG A CA   7  
ATOM 7812  C C    . ARG A 1 70 ? 2.656   -16.384 -11.827 1.00 0.00 ? 70 ARG A C    7  
ATOM 7813  O O    . ARG A 1 70 ? 3.176   -15.569 -11.038 1.00 0.00 ? 70 ARG A O    7  
ATOM 7814  C CB   . ARG A 1 70 ? 4.557   -17.145 -13.298 1.00 0.00 ? 70 ARG A CB   7  
ATOM 7815  C CG   . ARG A 1 70 ? 4.430   -18.651 -13.035 1.00 0.00 ? 70 ARG A CG   7  
ATOM 7816  C CD   . ARG A 1 70 ? 5.797   -19.336 -13.011 1.00 0.00 ? 70 ARG A CD   7  
ATOM 7817  N NE   . ARG A 1 70 ? 5.626   -20.791 -13.040 1.00 0.00 ? 70 ARG A NE   7  
ATOM 7818  C CZ   . ARG A 1 70 ? 5.781   -21.602 -14.090 1.00 0.00 ? 70 ARG A CZ   7  
ATOM 7819  N NH1  . ARG A 1 70 ? 6.368   -21.177 -15.201 1.00 0.00 ? 70 ARG A NH1  7  
ATOM 7820  N NH2  . ARG A 1 70 ? 5.321   -22.841 -14.005 1.00 0.00 ? 70 ARG A NH2  7  
ATOM 7821  H H    . ARG A 1 70 ? 4.195   -14.812 -14.122 1.00 0.00 ? 70 ARG A H    7  
ATOM 7822  H HA   . ARG A 1 70 ? 2.474   -17.049 -13.847 1.00 0.00 ? 70 ARG A HA   7  
ATOM 7823  H HB2  . ARG A 1 70 ? 4.991   -17.005 -14.292 1.00 0.00 ? 70 ARG A HB2  7  
ATOM 7824  H HB3  . ARG A 1 70 ? 5.220   -16.690 -12.556 1.00 0.00 ? 70 ARG A HB3  7  
ATOM 7825  H HG2  . ARG A 1 70 ? 3.935   -18.827 -12.080 1.00 0.00 ? 70 ARG A HG2  7  
ATOM 7826  H HG3  . ARG A 1 70 ? 3.824   -19.082 -13.834 1.00 0.00 ? 70 ARG A HG3  7  
ATOM 7827  H HD2  . ARG A 1 70 ? 6.375   -19.013 -13.870 1.00 0.00 ? 70 ARG A HD2  7  
ATOM 7828  H HD3  . ARG A 1 70 ? 6.328   -19.048 -12.103 1.00 0.00 ? 70 ARG A HD3  7  
ATOM 7829  H HE   . ARG A 1 70 ? 5.245   -21.180 -12.179 1.00 0.00 ? 70 ARG A HE   7  
ATOM 7830  H HH11 . ARG A 1 70 ? 6.673   -20.213 -15.280 1.00 0.00 ? 70 ARG A HH11 7  
ATOM 7831  H HH12 . ARG A 1 70 ? 6.586   -21.797 -15.971 1.00 0.00 ? 70 ARG A HH12 7  
ATOM 7832  H HH21 . ARG A 1 70 ? 4.797   -23.087 -13.170 1.00 0.00 ? 70 ARG A HH21 7  
ATOM 7833  H HH22 . ARG A 1 70 ? 5.226   -23.477 -14.797 1.00 0.00 ? 70 ARG A HH22 7  
ATOM 7834  N N    . GLY A 1 1  ? -24.752 -15.996 -18.218 1.00 0.00 ? 1  GLY A N    8  
ATOM 7835  C CA   . GLY A 1 1  ? -24.606 -17.452 -18.397 1.00 0.00 ? 1  GLY A CA   8  
ATOM 7836  C C    . GLY A 1 1  ? -25.439 -18.217 -17.384 1.00 0.00 ? 1  GLY A C    8  
ATOM 7837  O O    . GLY A 1 1  ? -25.928 -17.623 -16.431 1.00 0.00 ? 1  GLY A O    8  
ATOM 7838  H H1   . GLY A 1 1  ? -25.694 -15.672 -18.133 1.00 0.00 ? 1  GLY A H1   8  
ATOM 7839  H HA2  . GLY A 1 1  ? -24.961 -17.708 -19.395 1.00 0.00 ? 1  GLY A HA2  8  
ATOM 7840  H HA3  . GLY A 1 1  ? -23.556 -17.726 -18.312 1.00 0.00 ? 1  GLY A HA3  8  
ATOM 7841  N N    . SER A 1 2  ? -25.622 -19.525 -17.590 1.00 0.00 ? 2  SER A N    8  
ATOM 7842  C CA   . SER A 1 2  ? -26.586 -20.358 -16.865 1.00 0.00 ? 2  SER A CA   8  
ATOM 7843  C C    . SER A 1 2  ? -26.330 -20.464 -15.354 1.00 0.00 ? 2  SER A C    8  
ATOM 7844  O O    . SER A 1 2  ? -27.229 -20.837 -14.605 1.00 0.00 ? 2  SER A O    8  
ATOM 7845  C CB   . SER A 1 2  ? -26.595 -21.757 -17.498 1.00 0.00 ? 2  SER A CB   8  
ATOM 7846  O OG   . SER A 1 2  ? -26.461 -21.657 -18.910 1.00 0.00 ? 2  SER A OG   8  
ATOM 7847  H H    . SER A 1 2  ? -25.290 -19.984 -18.431 1.00 0.00 ? 2  SER A H    8  
ATOM 7848  H HA   . SER A 1 2  ? -27.574 -19.917 -17.001 1.00 0.00 ? 2  SER A HA   8  
ATOM 7849  H HB2  . SER A 1 2  ? -25.761 -22.341 -17.105 1.00 0.00 ? 2  SER A HB2  8  
ATOM 7850  H HB3  . SER A 1 2  ? -27.531 -22.260 -17.247 1.00 0.00 ? 2  SER A HB3  8  
ATOM 7851  H HG   . SER A 1 2  ? -26.699 -22.507 -19.299 1.00 0.00 ? 2  SER A HG   8  
ATOM 7852  N N    . SER A 1 3  ? -25.121 -20.142 -14.891 1.00 0.00 ? 3  SER A N    8  
ATOM 7853  C CA   . SER A 1 3  ? -24.845 -19.870 -13.488 1.00 0.00 ? 3  SER A CA   8  
ATOM 7854  C C    . SER A 1 3  ? -23.742 -18.811 -13.467 1.00 0.00 ? 3  SER A C    8  
ATOM 7855  O O    . SER A 1 3  ? -24.056 -17.625 -13.434 1.00 0.00 ? 3  SER A O    8  
ATOM 7856  C CB   . SER A 1 3  ? -24.516 -21.156 -12.706 1.00 0.00 ? 3  SER A CB   8  
ATOM 7857  O OG   . SER A 1 3  ? -25.374 -22.221 -13.063 1.00 0.00 ? 3  SER A OG   8  
ATOM 7858  H H    . SER A 1 3  ? -24.441 -19.818 -15.557 1.00 0.00 ? 3  SER A H    8  
ATOM 7859  H HA   . SER A 1 3  ? -25.740 -19.427 -13.044 1.00 0.00 ? 3  SER A HA   8  
ATOM 7860  H HB2  . SER A 1 3  ? -23.492 -21.473 -12.904 1.00 0.00 ? 3  SER A HB2  8  
ATOM 7861  H HB3  . SER A 1 3  ? -24.617 -20.954 -11.639 1.00 0.00 ? 3  SER A HB3  8  
ATOM 7862  H HG   . SER A 1 3  ? -26.233 -21.853 -13.334 1.00 0.00 ? 3  SER A HG   8  
ATOM 7863  N N    . GLY A 1 4  ? -22.474 -19.220 -13.625 1.00 0.00 ? 4  GLY A N    8  
ATOM 7864  C CA   . GLY A 1 4  ? -21.323 -18.336 -13.786 1.00 0.00 ? 4  GLY A CA   8  
ATOM 7865  C C    . GLY A 1 4  ? -21.225 -17.335 -12.640 1.00 0.00 ? 4  GLY A C    8  
ATOM 7866  O O    . GLY A 1 4  ? -21.641 -16.190 -12.802 1.00 0.00 ? 4  GLY A O    8  
ATOM 7867  H H    . GLY A 1 4  ? -22.296 -20.212 -13.662 1.00 0.00 ? 4  GLY A H    8  
ATOM 7868  H HA2  . GLY A 1 4  ? -20.408 -18.928 -13.829 1.00 0.00 ? 4  GLY A HA2  8  
ATOM 7869  H HA3  . GLY A 1 4  ? -21.428 -17.786 -14.722 1.00 0.00 ? 4  GLY A HA3  8  
ATOM 7870  N N    . SER A 1 5  ? -20.696 -17.758 -11.493 1.00 0.00 ? 5  SER A N    8  
ATOM 7871  C CA   . SER A 1 5  ? -20.649 -16.915 -10.301 1.00 0.00 ? 5  SER A CA   8  
ATOM 7872  C C    . SER A 1 5  ? -19.886 -15.611 -10.573 1.00 0.00 ? 5  SER A C    8  
ATOM 7873  O O    . SER A 1 5  ? -18.872 -15.615 -11.282 1.00 0.00 ? 5  SER A O    8  
ATOM 7874  C CB   . SER A 1 5  ? -20.046 -17.704 -9.132  1.00 0.00 ? 5  SER A CB   8  
ATOM 7875  O OG   . SER A 1 5  ? -18.778 -18.262 -9.447  1.00 0.00 ? 5  SER A OG   8  
ATOM 7876  H H    . SER A 1 5  ? -20.252 -18.666 -11.458 1.00 0.00 ? 5  SER A H    8  
ATOM 7877  H HA   . SER A 1 5  ? -21.675 -16.655 -10.036 1.00 0.00 ? 5  SER A HA   8  
ATOM 7878  H HB2  . SER A 1 5  ? -19.939 -17.037 -8.277  1.00 0.00 ? 5  SER A HB2  8  
ATOM 7879  H HB3  . SER A 1 5  ? -20.729 -18.508 -8.855  1.00 0.00 ? 5  SER A HB3  8  
ATOM 7880  H HG   . SER A 1 5  ? -18.875 -18.937 -10.150 1.00 0.00 ? 5  SER A HG   8  
ATOM 7881  N N    . SER A 1 6  ? -20.344 -14.502 -10.001 1.00 0.00 ? 6  SER A N    8  
ATOM 7882  C CA   . SER A 1 6  ? -19.623 -13.232 -9.971  1.00 0.00 ? 6  SER A CA   8  
ATOM 7883  C C    . SER A 1 6  ? -19.010 -13.055 -8.573  1.00 0.00 ? 6  SER A C    8  
ATOM 7884  O O    . SER A 1 6  ? -19.284 -13.859 -7.676  1.00 0.00 ? 6  SER A O    8  
ATOM 7885  C CB   . SER A 1 6  ? -20.569 -12.095 -10.378 1.00 0.00 ? 6  SER A CB   8  
ATOM 7886  O OG   . SER A 1 6  ? -20.931 -12.228 -11.747 1.00 0.00 ? 6  SER A OG   8  
ATOM 7887  H H    . SER A 1 6  ? -21.137 -14.580 -9.367  1.00 0.00 ? 6  SER A H    8  
ATOM 7888  H HA   . SER A 1 6  ? -18.814 -13.250 -10.695 1.00 0.00 ? 6  SER A HA   8  
ATOM 7889  H HB2  . SER A 1 6  ? -21.461 -12.124 -9.749  1.00 0.00 ? 6  SER A HB2  8  
ATOM 7890  H HB3  . SER A 1 6  ? -20.065 -11.139 -10.242 1.00 0.00 ? 6  SER A HB3  8  
ATOM 7891  H HG   . SER A 1 6  ? -21.828 -11.853 -11.862 1.00 0.00 ? 6  SER A HG   8  
ATOM 7892  N N    . GLY A 1 7  ? -18.164 -12.041 -8.374  1.00 0.00 ? 7  GLY A N    8  
ATOM 7893  C CA   . GLY A 1 7  ? -17.506 -11.799 -7.097  1.00 0.00 ? 7  GLY A CA   8  
ATOM 7894  C C    . GLY A 1 7  ? -16.062 -11.379 -7.297  1.00 0.00 ? 7  GLY A C    8  
ATOM 7895  O O    . GLY A 1 7  ? -15.780 -10.183 -7.234  1.00 0.00 ? 7  GLY A O    8  
ATOM 7896  H H    . GLY A 1 7  ? -17.952 -11.388 -9.124  1.00 0.00 ? 7  GLY A H    8  
ATOM 7897  H HA2  . GLY A 1 7  ? -18.027 -10.996 -6.578  1.00 0.00 ? 7  GLY A HA2  8  
ATOM 7898  H HA3  . GLY A 1 7  ? -17.531 -12.689 -6.469  1.00 0.00 ? 7  GLY A HA3  8  
ATOM 7899  N N    . ARG A 1 8  ? -15.156 -12.339 -7.544  1.00 0.00 ? 8  ARG A N    8  
ATOM 7900  C CA   . ARG A 1 8  ? -13.695 -12.136 -7.558  1.00 0.00 ? 8  ARG A CA   8  
ATOM 7901  C C    . ARG A 1 8  ? -13.248 -11.219 -6.412  1.00 0.00 ? 8  ARG A C    8  
ATOM 7902  O O    . ARG A 1 8  ? -12.499 -10.256 -6.604  1.00 0.00 ? 8  ARG A O    8  
ATOM 7903  C CB   . ARG A 1 8  ? -13.209 -11.674 -8.948  1.00 0.00 ? 8  ARG A CB   8  
ATOM 7904  C CG   . ARG A 1 8  ? -13.153 -12.838 -9.946  1.00 0.00 ? 8  ARG A CG   8  
ATOM 7905  C CD   . ARG A 1 8  ? -12.696 -12.338 -11.322 1.00 0.00 ? 8  ARG A CD   8  
ATOM 7906  N NE   . ARG A 1 8  ? -12.357 -13.439 -12.236 1.00 0.00 ? 8  ARG A NE   8  
ATOM 7907  C CZ   . ARG A 1 8  ? -13.188 -14.290 -12.843 1.00 0.00 ? 8  ARG A CZ   8  
ATOM 7908  N NH1  . ARG A 1 8  ? -14.485 -14.304 -12.569 1.00 0.00 ? 8  ARG A NH1  8  
ATOM 7909  N NH2  . ARG A 1 8  ? -12.722 -15.136 -13.750 1.00 0.00 ? 8  ARG A NH2  8  
ATOM 7910  H H    . ARG A 1 8  ? -15.500 -13.291 -7.618  1.00 0.00 ? 8  ARG A H    8  
ATOM 7911  H HA   . ARG A 1 8  ? -13.223 -13.099 -7.360  1.00 0.00 ? 8  ARG A HA   8  
ATOM 7912  H HB2  . ARG A 1 8  ? -13.858 -10.884 -9.327  1.00 0.00 ? 8  ARG A HB2  8  
ATOM 7913  H HB3  . ARG A 1 8  ? -12.197 -11.275 -8.865  1.00 0.00 ? 8  ARG A HB3  8  
ATOM 7914  H HG2  . ARG A 1 8  ? -12.448 -13.587 -9.583  1.00 0.00 ? 8  ARG A HG2  8  
ATOM 7915  H HG3  . ARG A 1 8  ? -14.136 -13.294 -10.028 1.00 0.00 ? 8  ARG A HG3  8  
ATOM 7916  H HD2  . ARG A 1 8  ? -13.480 -11.722 -11.766 1.00 0.00 ? 8  ARG A HD2  8  
ATOM 7917  H HD3  . ARG A 1 8  ? -11.806 -11.719 -11.196 1.00 0.00 ? 8  ARG A HD3  8  
ATOM 7918  H HE   . ARG A 1 8  ? -11.373 -13.510 -12.488 1.00 0.00 ? 8  ARG A HE   8  
ATOM 7919  H HH11 . ARG A 1 8  ? -14.899 -13.718 -11.857 1.00 0.00 ? 8  ARG A HH11 8  
ATOM 7920  H HH12 . ARG A 1 8  ? -15.115 -14.921 -13.080 1.00 0.00 ? 8  ARG A HH12 8  
ATOM 7921  H HH21 . ARG A 1 8  ? -11.727 -15.191 -13.969 1.00 0.00 ? 8  ARG A HH21 8  
ATOM 7922  H HH22 . ARG A 1 8  ? -13.331 -15.795 -14.209 1.00 0.00 ? 8  ARG A HH22 8  
ATOM 7923  N N    . GLY A 1 9  ? -13.733 -11.523 -5.212  1.00 0.00 ? 9  GLY A N    8  
ATOM 7924  C CA   . GLY A 1 9  ? -13.414 -10.821 -3.985  1.00 0.00 ? 9  GLY A CA   8  
ATOM 7925  C C    . GLY A 1 9  ? -13.196 -11.860 -2.899  1.00 0.00 ? 9  GLY A C    8  
ATOM 7926  O O    . GLY A 1 9  ? -12.498 -12.848 -3.143  1.00 0.00 ? 9  GLY A O    8  
ATOM 7927  H H    . GLY A 1 9  ? -14.333 -12.331 -5.114  1.00 0.00 ? 9  GLY A H    8  
ATOM 7928  H HA2  . GLY A 1 9  ? -12.502 -10.235 -4.103  1.00 0.00 ? 9  GLY A HA2  8  
ATOM 7929  H HA3  . GLY A 1 9  ? -14.239 -10.158 -3.727  1.00 0.00 ? 9  GLY A HA3  8  
ATOM 7930  N N    . ARG A 1 10 ? -13.832 -11.684 -1.734  1.00 0.00 ? 10 ARG A N    8  
ATOM 7931  C CA   . ARG A 1 10 ? -13.692 -12.547 -0.550  1.00 0.00 ? 10 ARG A CA   8  
ATOM 7932  C C    . ARG A 1 10 ? -12.276 -12.428 0.028   1.00 0.00 ? 10 ARG A C    8  
ATOM 7933  O O    . ARG A 1 10 ? -11.461 -11.658 -0.483  1.00 0.00 ? 10 ARG A O    8  
ATOM 7934  C CB   . ARG A 1 10 ? -14.076 -14.003 -0.917  1.00 0.00 ? 10 ARG A CB   8  
ATOM 7935  C CG   . ARG A 1 10 ? -14.661 -14.869 0.208   1.00 0.00 ? 10 ARG A CG   8  
ATOM 7936  C CD   . ARG A 1 10 ? -15.970 -14.280 0.743   1.00 0.00 ? 10 ARG A CD   8  
ATOM 7937  N NE   . ARG A 1 10 ? -16.909 -15.325 1.175   1.00 0.00 ? 10 ARG A NE   8  
ATOM 7938  C CZ   . ARG A 1 10 ? -17.899 -15.162 2.058   1.00 0.00 ? 10 ARG A CZ   8  
ATOM 7939  N NH1  . ARG A 1 10 ? -17.859 -14.165 2.934   1.00 0.00 ? 10 ARG A NH1  8  
ATOM 7940  N NH2  . ARG A 1 10 ? -18.948 -15.977 2.027   1.00 0.00 ? 10 ARG A NH2  8  
ATOM 7941  H H    . ARG A 1 10 ? -14.367 -10.830 -1.642  1.00 0.00 ? 10 ARG A H    8  
ATOM 7942  H HA   . ARG A 1 10 ? -14.390 -12.166 0.195   1.00 0.00 ? 10 ARG A HA   8  
ATOM 7943  H HB2  . ARG A 1 10 ? -14.817 -13.983 -1.719  1.00 0.00 ? 10 ARG A HB2  8  
ATOM 7944  H HB3  . ARG A 1 10 ? -13.196 -14.515 -1.309  1.00 0.00 ? 10 ARG A HB3  8  
ATOM 7945  H HG2  . ARG A 1 10 ? -14.853 -15.850 -0.220  1.00 0.00 ? 10 ARG A HG2  8  
ATOM 7946  H HG3  . ARG A 1 10 ? -13.951 -15.000 1.024   1.00 0.00 ? 10 ARG A HG3  8  
ATOM 7947  H HD2  . ARG A 1 10 ? -15.740 -13.597 1.559   1.00 0.00 ? 10 ARG A HD2  8  
ATOM 7948  H HD3  . ARG A 1 10 ? -16.461 -13.714 -0.050  1.00 0.00 ? 10 ARG A HD3  8  
ATOM 7949  H HE   . ARG A 1 10 ? -16.879 -16.187 0.632   1.00 0.00 ? 10 ARG A HE   8  
ATOM 7950  H HH11 . ARG A 1 10 ? -16.991 -13.650 3.089   1.00 0.00 ? 10 ARG A HH11 8  
ATOM 7951  H HH12 . ARG A 1 10 ? -18.572 -14.045 3.648   1.00 0.00 ? 10 ARG A HH12 8  
ATOM 7952  H HH21 . ARG A 1 10 ? -19.016 -16.670 1.280   1.00 0.00 ? 10 ARG A HH21 8  
ATOM 7953  H HH22 . ARG A 1 10 ? -19.772 -15.841 2.597   1.00 0.00 ? 10 ARG A HH22 8  
ATOM 7954  N N    . TYR A 1 11 ? -11.985 -13.160 1.108   1.00 0.00 ? 11 TYR A N    8  
ATOM 7955  C CA   . TYR A 1 11 ? -10.688 -13.166 1.786   1.00 0.00 ? 11 TYR A CA   8  
ATOM 7956  C C    . TYR A 1 11 ? -10.254 -11.754 2.211   1.00 0.00 ? 11 TYR A C    8  
ATOM 7957  O O    . TYR A 1 11 ? -11.102 -10.864 2.347   1.00 0.00 ? 11 TYR A O    8  
ATOM 7958  C CB   . TYR A 1 11 ? -9.674  -13.982 0.951   1.00 0.00 ? 11 TYR A CB   8  
ATOM 7959  C CG   . TYR A 1 11 ? -9.582  -15.413 1.440   1.00 0.00 ? 11 TYR A CG   8  
ATOM 7960  C CD1  . TYR A 1 11 ? -10.717 -16.246 1.418   1.00 0.00 ? 11 TYR A CD1  8  
ATOM 7961  C CD2  . TYR A 1 11 ? -8.374  -15.894 1.976   1.00 0.00 ? 11 TYR A CD2  8  
ATOM 7962  C CE1  . TYR A 1 11 ? -10.664 -17.534 1.976   1.00 0.00 ? 11 TYR A CE1  8  
ATOM 7963  C CE2  . TYR A 1 11 ? -8.316  -17.174 2.548   1.00 0.00 ? 11 TYR A CE2  8  
ATOM 7964  C CZ   . TYR A 1 11 ? -9.462  -17.997 2.558   1.00 0.00 ? 11 TYR A CZ   8  
ATOM 7965  O OH   . TYR A 1 11 ? -9.382  -19.240 3.101   1.00 0.00 ? 11 TYR A OH   8  
ATOM 7966  H H    . TYR A 1 11 ? -12.713 -13.711 1.532   1.00 0.00 ? 11 TYR A H    8  
ATOM 7967  H HA   . TYR A 1 11 ? -10.826 -13.703 2.722   1.00 0.00 ? 11 TYR A HA   8  
ATOM 7968  H HB2  . TYR A 1 11 ? -9.953  -13.980 -0.104  1.00 0.00 ? 11 TYR A HB2  8  
ATOM 7969  H HB3  . TYR A 1 11 ? -8.682  -13.535 1.003   1.00 0.00 ? 11 TYR A HB3  8  
ATOM 7970  H HD1  . TYR A 1 11 ? -11.646 -15.903 0.989   1.00 0.00 ? 11 TYR A HD1  8  
ATOM 7971  H HD2  . TYR A 1 11 ? -7.477  -15.294 1.946   1.00 0.00 ? 11 TYR A HD2  8  
ATOM 7972  H HE1  . TYR A 1 11 ? -11.548 -18.157 1.958   1.00 0.00 ? 11 TYR A HE1  8  
ATOM 7973  H HE2  . TYR A 1 11 ? -7.389  -17.538 2.973   1.00 0.00 ? 11 TYR A HE2  8  
ATOM 7974  H HH   . TYR A 1 11 ? -10.242 -19.686 3.148   1.00 0.00 ? 11 TYR A HH   8  
ATOM 7975  N N    . ARG A 1 12 ? -8.976  -11.553 2.531   1.00 0.00 ? 12 ARG A N    8  
ATOM 7976  C CA   . ARG A 1 12 ? -8.398  -10.248 2.822   1.00 0.00 ? 12 ARG A CA   8  
ATOM 7977  C C    . ARG A 1 12 ? -7.008  -10.249 2.213   1.00 0.00 ? 12 ARG A C    8  
ATOM 7978  O O    . ARG A 1 12 ? -6.021  -10.592 2.869   1.00 0.00 ? 12 ARG A O    8  
ATOM 7979  C CB   . ARG A 1 12 ? -8.431  -9.993  4.341   1.00 0.00 ? 12 ARG A CB   8  
ATOM 7980  C CG   . ARG A 1 12 ? -9.051  -8.637  4.707   1.00 0.00 ? 12 ARG A CG   8  
ATOM 7981  C CD   . ARG A 1 12 ? -9.680  -8.700  6.107   1.00 0.00 ? 12 ARG A CD   8  
ATOM 7982  N NE   . ARG A 1 12 ? -10.839 -9.606  6.143   1.00 0.00 ? 12 ARG A NE   8  
ATOM 7983  C CZ   . ARG A 1 12 ? -12.074 -9.344  5.709   1.00 0.00 ? 12 ARG A CZ   8  
ATOM 7984  N NH1  . ARG A 1 12 ? -12.398 -8.151  5.231   1.00 0.00 ? 12 ARG A NH1  8  
ATOM 7985  N NH2  . ARG A 1 12 ? -12.999 -10.290 5.743   1.00 0.00 ? 12 ARG A NH2  8  
ATOM 7986  H H    . ARG A 1 12 ? -8.325  -12.333 2.522   1.00 0.00 ? 12 ARG A H    8  
ATOM 7987  H HA   . ARG A 1 12 ? -8.989  -9.488  2.305   1.00 0.00 ? 12 ARG A HA   8  
ATOM 7988  H HB2  . ARG A 1 12 ? -9.032  -10.778 4.794   1.00 0.00 ? 12 ARG A HB2  8  
ATOM 7989  H HB3  . ARG A 1 12 ? -7.434  -10.058 4.778   1.00 0.00 ? 12 ARG A HB3  8  
ATOM 7990  H HG2  . ARG A 1 12 ? -8.276  -7.869  4.684   1.00 0.00 ? 12 ARG A HG2  8  
ATOM 7991  H HG3  . ARG A 1 12 ? -9.826  -8.371  3.988   1.00 0.00 ? 12 ARG A HG3  8  
ATOM 7992  H HD2  . ARG A 1 12 ? -8.936  -9.064  6.815   1.00 0.00 ? 12 ARG A HD2  8  
ATOM 7993  H HD3  . ARG A 1 12 ? -9.988  -7.703  6.420   1.00 0.00 ? 12 ARG A HD3  8  
ATOM 7994  H HE   . ARG A 1 12 ? -10.643 -10.520 6.543   1.00 0.00 ? 12 ARG A HE   8  
ATOM 7995  H HH11 . ARG A 1 12 ? -11.718 -7.392  5.224   1.00 0.00 ? 12 ARG A HH11 8  
ATOM 7996  H HH12 . ARG A 1 12 ? -13.357 -7.941  4.981   1.00 0.00 ? 12 ARG A HH12 8  
ATOM 7997  H HH21 . ARG A 1 12 ? -12.760 -11.240 6.033   1.00 0.00 ? 12 ARG A HH21 8  
ATOM 7998  H HH22 . ARG A 1 12 ? -13.950 -10.087 5.457   1.00 0.00 ? 12 ARG A HH22 8  
ATOM 7999  N N    . GLN A 1 13 ? -6.926  -9.952  0.925   1.00 0.00 ? 13 GLN A N    8  
ATOM 8000  C CA   . GLN A 1 13 ? -5.680  -9.908  0.197   1.00 0.00 ? 13 GLN A CA   8  
ATOM 8001  C C    . GLN A 1 13 ? -5.821  -8.834  -0.865  1.00 0.00 ? 13 GLN A C    8  
ATOM 8002  O O    . GLN A 1 13 ? -6.446  -9.044  -1.906  1.00 0.00 ? 13 GLN A O    8  
ATOM 8003  C CB   . GLN A 1 13 ? -5.359  -11.297 -0.374  1.00 0.00 ? 13 GLN A CB   8  
ATOM 8004  C CG   . GLN A 1 13 ? -3.900  -11.421 -0.834  1.00 0.00 ? 13 GLN A CG   8  
ATOM 8005  C CD   . GLN A 1 13 ? -2.982  -11.907 0.287   1.00 0.00 ? 13 GLN A CD   8  
ATOM 8006  O OE1  . GLN A 1 13 ? -2.291  -12.913 0.144   1.00 0.00 ? 13 GLN A OE1  8  
ATOM 8007  N NE2  . GLN A 1 13 ? -2.956  -11.270 1.448   1.00 0.00 ? 13 GLN A NE2  8  
ATOM 8008  H H    . GLN A 1 13 ? -7.769  -9.704  0.409   1.00 0.00 ? 13 GLN A H    8  
ATOM 8009  H HA   . GLN A 1 13 ? -4.891  -9.609  0.884   1.00 0.00 ? 13 GLN A HA   8  
ATOM 8010  H HB2  . GLN A 1 13 ? -5.545  -12.053 0.390   1.00 0.00 ? 13 GLN A HB2  8  
ATOM 8011  H HB3  . GLN A 1 13 ? -6.027  -11.504 -1.209  1.00 0.00 ? 13 GLN A HB3  8  
ATOM 8012  H HG2  . GLN A 1 13 ? -3.860  -12.152 -1.643  1.00 0.00 ? 13 GLN A HG2  8  
ATOM 8013  H HG3  . GLN A 1 13 ? -3.534  -10.474 -1.231  1.00 0.00 ? 13 GLN A HG3  8  
ATOM 8014  H HE21 . GLN A 1 13 ? -3.506  -10.446 1.637   1.00 0.00 ? 13 GLN A HE21 8  
ATOM 8015  H HE22 . GLN A 1 13 ? -2.305  -11.613 2.155   1.00 0.00 ? 13 GLN A HE22 8  
ATOM 8016  N N    . TYR A 1 14 ? -5.261  -7.667  -0.575  1.00 0.00 ? 14 TYR A N    8  
ATOM 8017  C CA   . TYR A 1 14 ? -5.135  -6.617  -1.562  1.00 0.00 ? 14 TYR A CA   8  
ATOM 8018  C C    . TYR A 1 14 ? -4.111  -7.037  -2.629  1.00 0.00 ? 14 TYR A C    8  
ATOM 8019  O O    . TYR A 1 14 ? -3.333  -7.979  -2.442  1.00 0.00 ? 14 TYR A O    8  
ATOM 8020  C CB   . TYR A 1 14 ? -4.749  -5.315  -0.855  1.00 0.00 ? 14 TYR A CB   8  
ATOM 8021  C CG   . TYR A 1 14 ? -3.333  -5.311  -0.325  1.00 0.00 ? 14 TYR A CG   8  
ATOM 8022  C CD1  . TYR A 1 14 ? -3.030  -5.854  0.938   1.00 0.00 ? 14 TYR A CD1  8  
ATOM 8023  C CD2  . TYR A 1 14 ? -2.306  -4.806  -1.137  1.00 0.00 ? 14 TYR A CD2  8  
ATOM 8024  C CE1  . TYR A 1 14 ? -1.692  -5.941  1.361   1.00 0.00 ? 14 TYR A CE1  8  
ATOM 8025  C CE2  . TYR A 1 14 ? -0.972  -4.885  -0.715  1.00 0.00 ? 14 TYR A CE2  8  
ATOM 8026  C CZ   . TYR A 1 14 ? -0.649  -5.484  0.521   1.00 0.00 ? 14 TYR A CZ   8  
ATOM 8027  O OH   . TYR A 1 14 ? 0.658   -5.610  0.881   1.00 0.00 ? 14 TYR A OH   8  
ATOM 8028  H H    . TYR A 1 14 ? -4.708  -7.565  0.259   1.00 0.00 ? 14 TYR A H    8  
ATOM 8029  H HA   . TYR A 1 14 ? -6.105  -6.476  -2.043  1.00 0.00 ? 14 TYR A HA   8  
ATOM 8030  H HB2  . TYR A 1 14 ? -4.850  -4.512  -1.577  1.00 0.00 ? 14 TYR A HB2  8  
ATOM 8031  H HB3  . TYR A 1 14 ? -5.450  -5.116  -0.044  1.00 0.00 ? 14 TYR A HB3  8  
ATOM 8032  H HD1  . TYR A 1 14 ? -3.817  -6.225  1.576   1.00 0.00 ? 14 TYR A HD1  8  
ATOM 8033  H HD2  . TYR A 1 14 ? -2.535  -4.352  -2.092  1.00 0.00 ? 14 TYR A HD2  8  
ATOM 8034  H HE1  . TYR A 1 14 ? -1.472  -6.371  2.325   1.00 0.00 ? 14 TYR A HE1  8  
ATOM 8035  H HE2  . TYR A 1 14 ? -0.200  -4.477  -1.343  1.00 0.00 ? 14 TYR A HE2  8  
ATOM 8036  H HH   . TYR A 1 14 ? 0.794   -5.964  1.777   1.00 0.00 ? 14 TYR A HH   8  
ATOM 8037  N N    . ASN A 1 15 ? -4.107  -6.299  -3.734  1.00 0.00 ? 15 ASN A N    8  
ATOM 8038  C CA   . ASN A 1 15 ? -3.290  -6.481  -4.927  1.00 0.00 ? 15 ASN A CA   8  
ATOM 8039  C C    . ASN A 1 15 ? -2.446  -5.235  -5.185  1.00 0.00 ? 15 ASN A C    8  
ATOM 8040  O O    . ASN A 1 15 ? -2.668  -4.202  -4.554  1.00 0.00 ? 15 ASN A O    8  
ATOM 8041  C CB   . ASN A 1 15 ? -4.108  -6.906  -6.149  1.00 0.00 ? 15 ASN A CB   8  
ATOM 8042  C CG   . ASN A 1 15 ? -5.042  -5.867  -6.724  1.00 0.00 ? 15 ASN A CG   8  
ATOM 8043  O OD1  . ASN A 1 15 ? -4.632  -4.759  -7.024  1.00 0.00 ? 15 ASN A OD1  8  
ATOM 8044  N ND2  . ASN A 1 15 ? -6.304  -6.206  -6.914  1.00 0.00 ? 15 ASN A ND2  8  
ATOM 8045  H H    . ASN A 1 15 ? -4.682  -5.470  -3.746  1.00 0.00 ? 15 ASN A H    8  
ATOM 8046  H HA   . ASN A 1 15 ? -2.595  -7.297  -4.721  1.00 0.00 ? 15 ASN A HA   8  
ATOM 8047  H HB2  . ASN A 1 15 ? -3.396  -7.104  -6.933  1.00 0.00 ? 15 ASN A HB2  8  
ATOM 8048  H HB3  . ASN A 1 15 ? -4.654  -7.814  -5.916  1.00 0.00 ? 15 ASN A HB3  8  
ATOM 8049  H HD21 . ASN A 1 15 ? -6.629  -7.146  -6.753  1.00 0.00 ? 15 ASN A HD21 8  
ATOM 8050  H HD22 . ASN A 1 15 ? -6.895  -5.493  -7.338  1.00 0.00 ? 15 ASN A HD22 8  
ATOM 8051  N N    . SER A 1 16 ? -1.388  -5.372  -5.983  1.00 0.00 ? 16 SER A N    8  
ATOM 8052  C CA   . SER A 1 16 ? -0.467  -4.294  -6.322  1.00 0.00 ? 16 SER A CA   8  
ATOM 8053  C C    . SER A 1 16 ? -1.142  -2.963  -6.648  1.00 0.00 ? 16 SER A C    8  
ATOM 8054  O O    . SER A 1 16 ? -0.692  -1.923  -6.164  1.00 0.00 ? 16 SER A O    8  
ATOM 8055  C CB   . SER A 1 16 ? 0.462   -4.753  -7.446  1.00 0.00 ? 16 SER A CB   8  
ATOM 8056  O OG   . SER A 1 16 ? -0.248  -5.269  -8.559  1.00 0.00 ? 16 SER A OG   8  
ATOM 8057  H H    . SER A 1 16 ? -1.244  -6.247  -6.470  1.00 0.00 ? 16 SER A H    8  
ATOM 8058  H HA   . SER A 1 16 ? 0.149   -4.088  -5.463  1.00 0.00 ? 16 SER A HA   8  
ATOM 8059  H HB2  . SER A 1 16 ? 1.089   -3.913  -7.733  1.00 0.00 ? 16 SER A HB2  8  
ATOM 8060  H HB3  . SER A 1 16 ? 1.111   -5.538  -7.080  1.00 0.00 ? 16 SER A HB3  8  
ATOM 8061  H HG   . SER A 1 16 ? 0.304   -5.074  -9.344  1.00 0.00 ? 16 SER A HG   8  
ATOM 8062  N N    . GLU A 1 17 ? -2.202  -2.986  -7.448  1.00 0.00 ? 17 GLU A N    8  
ATOM 8063  C CA   . GLU A 1 17 ? -2.884  -1.784  -7.890  1.00 0.00 ? 17 GLU A CA   8  
ATOM 8064  C C    . GLU A 1 17 ? -3.737  -1.237  -6.754  1.00 0.00 ? 17 GLU A C    8  
ATOM 8065  O O    . GLU A 1 17 ? -3.675  -0.042  -6.483  1.00 0.00 ? 17 GLU A O    8  
ATOM 8066  C CB   . GLU A 1 17 ? -3.729  -2.093  -9.127  1.00 0.00 ? 17 GLU A CB   8  
ATOM 8067  C CG   . GLU A 1 17 ? -2.837  -2.558  -10.289 1.00 0.00 ? 17 GLU A CG   8  
ATOM 8068  C CD   . GLU A 1 17 ? -3.637  -2.956  -11.529 1.00 0.00 ? 17 GLU A CD   8  
ATOM 8069  O OE1  . GLU A 1 17 ? -4.890  -2.918  -11.513 1.00 0.00 ? 17 GLU A OE1  8  
ATOM 8070  O OE2  . GLU A 1 17 ? -2.999  -3.412  -12.500 1.00 0.00 ? 17 GLU A OE2  8  
ATOM 8071  H H    . GLU A 1 17 ? -2.550  -3.875  -7.781  1.00 0.00 ? 17 GLU A H    8  
ATOM 8072  H HA   . GLU A 1 17 ? -2.141  -1.029  -8.154  1.00 0.00 ? 17 GLU A HA   8  
ATOM 8073  H HB2  . GLU A 1 17 ? -4.455  -2.870  -8.887  1.00 0.00 ? 17 GLU A HB2  8  
ATOM 8074  H HB3  . GLU A 1 17 ? -4.267  -1.191  -9.423  1.00 0.00 ? 17 GLU A HB3  8  
ATOM 8075  H HG2  . GLU A 1 17 ? -2.144  -1.754  -10.548 1.00 0.00 ? 17 GLU A HG2  8  
ATOM 8076  H HG3  . GLU A 1 17 ? -2.242  -3.425  -9.978  1.00 0.00 ? 17 GLU A HG3  8  
ATOM 8077  N N    . ILE A 1 18 ? -4.467  -2.106  -6.044  1.00 0.00 ? 18 ILE A N    8  
ATOM 8078  C CA   . ILE A 1 18 ? -5.263  -1.751  -4.869  1.00 0.00 ? 18 ILE A CA   8  
ATOM 8079  C C    . ILE A 1 18 ? -4.392  -0.996  -3.859  1.00 0.00 ? 18 ILE A C    8  
ATOM 8080  O O    . ILE A 1 18 ? -4.861  -0.076  -3.190  1.00 0.00 ? 18 ILE A O    8  
ATOM 8081  C CB   . ILE A 1 18 ? -5.860  -3.037  -4.246  1.00 0.00 ? 18 ILE A CB   8  
ATOM 8082  C CG1  . ILE A 1 18 ? -7.031  -3.602  -5.070  1.00 0.00 ? 18 ILE A CG1  8  
ATOM 8083  C CG2  . ILE A 1 18 ? -6.340  -2.793  -2.802  1.00 0.00 ? 18 ILE A CG2  8  
ATOM 8084  C CD1  . ILE A 1 18 ? -8.392  -2.951  -4.807  1.00 0.00 ? 18 ILE A CD1  8  
ATOM 8085  H H    . ILE A 1 18 ? -4.392  -3.090  -6.300  1.00 0.00 ? 18 ILE A H    8  
ATOM 8086  H HA   . ILE A 1 18 ? -6.069  -1.084  -5.179  1.00 0.00 ? 18 ILE A HA   8  
ATOM 8087  H HB   . ILE A 1 18 ? -5.083  -3.816  -4.242  1.00 0.00 ? 18 ILE A HB   8  
ATOM 8088  H HG12 . ILE A 1 18 ? -6.805  -3.515  -6.131  1.00 0.00 ? 18 ILE A HG12 8  
ATOM 8089  H HG13 . ILE A 1 18 ? -7.118  -4.660  -4.827  1.00 0.00 ? 18 ILE A HG13 8  
ATOM 8090  H HG21 . ILE A 1 18 ? -5.499  -2.570  -2.156  1.00 0.00 ? 18 ILE A HG21 8  
ATOM 8091  H HG22 . ILE A 1 18 ? -6.996  -1.923  -2.780  1.00 0.00 ? 18 ILE A HG22 8  
ATOM 8092  H HG23 . ILE A 1 18 ? -6.864  -3.667  -2.414  1.00 0.00 ? 18 ILE A HG23 8  
ATOM 8093  H HD11 . ILE A 1 18 ? -8.329  -1.874  -4.961  1.00 0.00 ? 18 ILE A HD11 8  
ATOM 8094  H HD12 . ILE A 1 18 ? -9.121  -3.379  -5.486  1.00 0.00 ? 18 ILE A HD12 8  
ATOM 8095  H HD13 . ILE A 1 18 ? -8.713  -3.167  -3.788  1.00 0.00 ? 18 ILE A HD13 8  
ATOM 8096  N N    . LEU A 1 19 ? -3.143  -1.426  -3.700  1.00 0.00 ? 19 LEU A N    8  
ATOM 8097  C CA   . LEU A 1 19 ? -2.218  -0.775  -2.796  1.00 0.00 ? 19 LEU A CA   8  
ATOM 8098  C C    . LEU A 1 19 ? -1.936  0.656   -3.242  1.00 0.00 ? 19 LEU A C    8  
ATOM 8099  O O    . LEU A 1 19 ? -1.983  1.560   -2.411  1.00 0.00 ? 19 LEU A O    8  
ATOM 8100  C CB   . LEU A 1 19 ? -0.972  -1.647  -2.619  1.00 0.00 ? 19 LEU A CB   8  
ATOM 8101  C CG   . LEU A 1 19 ? 0.120   -0.978  -1.779  1.00 0.00 ? 19 LEU A CG   8  
ATOM 8102  C CD1  . LEU A 1 19 ? -0.364  -0.686  -0.352  1.00 0.00 ? 19 LEU A CD1  8  
ATOM 8103  C CD2  . LEU A 1 19 ? 1.317   -1.920  -1.725  1.00 0.00 ? 19 LEU A CD2  8  
ATOM 8104  H H    . LEU A 1 19 ? -2.851  -2.226  -4.252  1.00 0.00 ? 19 LEU A H    8  
ATOM 8105  H HA   . LEU A 1 19 ? -2.707  -0.690  -1.833  1.00 0.00 ? 19 LEU A HA   8  
ATOM 8106  H HB2  . LEU A 1 19 ? -1.278  -2.556  -2.118  1.00 0.00 ? 19 LEU A HB2  8  
ATOM 8107  H HB3  . LEU A 1 19 ? -0.561  -1.938  -3.585  1.00 0.00 ? 19 LEU A HB3  8  
ATOM 8108  H HG   . LEU A 1 19 ? 0.439   -0.059  -2.263  1.00 0.00 ? 19 LEU A HG   8  
ATOM 8109  H HD11 . LEU A 1 19 ? 0.453   -0.303  0.249   1.00 0.00 ? 19 LEU A HD11 8  
ATOM 8110  H HD12 . LEU A 1 19 ? -1.139  0.081   -0.379  1.00 0.00 ? 19 LEU A HD12 8  
ATOM 8111  H HD13 . LEU A 1 19 ? -0.753  -1.594  0.106   1.00 0.00 ? 19 LEU A HD13 8  
ATOM 8112  H HD21 . LEU A 1 19 ? 1.561   -2.243  -2.737  1.00 0.00 ? 19 LEU A HD21 8  
ATOM 8113  H HD22 . LEU A 1 19 ? 2.166   -1.382  -1.316  1.00 0.00 ? 19 LEU A HD22 8  
ATOM 8114  H HD23 . LEU A 1 19 ? 1.091   -2.789  -1.112  1.00 0.00 ? 19 LEU A HD23 8  
ATOM 8115  N N    . GLU A 1 20 ? -1.689  0.883   -4.532  1.00 0.00 ? 20 GLU A N    8  
ATOM 8116  C CA   . GLU A 1 20 ? -1.440  2.224   -5.038  1.00 0.00 ? 20 GLU A CA   8  
ATOM 8117  C C    . GLU A 1 20 ? -2.651  3.128   -4.802  1.00 0.00 ? 20 GLU A C    8  
ATOM 8118  O O    . GLU A 1 20 ? -2.471  4.273   -4.388  1.00 0.00 ? 20 GLU A O    8  
ATOM 8119  C CB   . GLU A 1 20 ? -1.085  2.207   -6.531  1.00 0.00 ? 20 GLU A CB   8  
ATOM 8120  C CG   . GLU A 1 20 ? 0.248   1.510   -6.844  1.00 0.00 ? 20 GLU A CG   8  
ATOM 8121  C CD   . GLU A 1 20 ? 1.436   2.199   -6.173  1.00 0.00 ? 20 GLU A CD   8  
ATOM 8122  O OE1  . GLU A 1 20 ? 1.581   3.429   -6.356  1.00 0.00 ? 20 GLU A OE1  8  
ATOM 8123  O OE2  . GLU A 1 20 ? 2.183   1.527   -5.424  1.00 0.00 ? 20 GLU A OE2  8  
ATOM 8124  H H    . GLU A 1 20 ? -1.741  0.114   -5.191  1.00 0.00 ? 20 GLU A H    8  
ATOM 8125  H HA   . GLU A 1 20 ? -0.603  2.632   -4.471  1.00 0.00 ? 20 GLU A HA   8  
ATOM 8126  H HB2  . GLU A 1 20 ? -1.883  1.715   -7.082  1.00 0.00 ? 20 GLU A HB2  8  
ATOM 8127  H HB3  . GLU A 1 20 ? -1.034  3.241   -6.874  1.00 0.00 ? 20 GLU A HB3  8  
ATOM 8128  H HG2  . GLU A 1 20 ? 0.195   0.475   -6.514  1.00 0.00 ? 20 GLU A HG2  8  
ATOM 8129  H HG3  . GLU A 1 20 ? 0.402   1.516   -7.923  1.00 0.00 ? 20 GLU A HG3  8  
ATOM 8130  N N    . GLU A 1 21 ? -3.872  2.634   -5.042  1.00 0.00 ? 21 GLU A N    8  
ATOM 8131  C CA   . GLU A 1 21 ? -5.132  3.279   -4.714  1.00 0.00 ? 21 GLU A CA   8  
ATOM 8132  C C    . GLU A 1 21 ? -5.141  3.763   -3.274  1.00 0.00 ? 21 GLU A C    8  
ATOM 8133  O O    . GLU A 1 21 ? -5.202  4.965   -3.027  1.00 0.00 ? 21 GLU A O    8  
ATOM 8134  C CB   . GLU A 1 21 ? -6.305  2.345   -4.945  1.00 0.00 ? 21 GLU A CB   8  
ATOM 8135  C CG   . GLU A 1 21 ? -6.549  1.706   -6.309  1.00 0.00 ? 21 GLU A CG   8  
ATOM 8136  C CD   . GLU A 1 21 ? -7.078  2.693   -7.346  1.00 0.00 ? 21 GLU A CD   8  
ATOM 8137  O OE1  . GLU A 1 21 ? -6.463  3.772   -7.516  1.00 0.00 ? 21 GLU A OE1  8  
ATOM 8138  O OE2  . GLU A 1 21 ? -8.130  2.415   -7.964  1.00 0.00 ? 21 GLU A OE2  8  
ATOM 8139  H H    . GLU A 1 21 ? -3.965  1.684   -5.373  1.00 0.00 ? 21 GLU A H    8  
ATOM 8140  H HA   . GLU A 1 21 ? -5.348  4.138   -5.328  1.00 0.00 ? 21 GLU A HA   8  
ATOM 8141  H HB2  . GLU A 1 21 ? -6.312  1.549   -4.208  1.00 0.00 ? 21 GLU A HB2  8  
ATOM 8142  H HB3  . GLU A 1 21 ? -7.123  3.007   -4.747  1.00 0.00 ? 21 GLU A HB3  8  
ATOM 8143  H HG2  . GLU A 1 21 ? -5.648  1.236   -6.673  1.00 0.00 ? 21 GLU A HG2  8  
ATOM 8144  H HG3  . GLU A 1 21 ? -7.280  0.915   -6.149  1.00 0.00 ? 21 GLU A HG3  8  
ATOM 8145  N N    . ALA A 1 22 ? -5.066  2.822   -2.336  1.00 0.00 ? 22 ALA A N    8  
ATOM 8146  C CA   . ALA A 1 22 ? -5.245  3.068   -0.912  1.00 0.00 ? 22 ALA A CA   8  
ATOM 8147  C C    . ALA A 1 22 ? -4.145  3.952   -0.342  1.00 0.00 ? 22 ALA A C    8  
ATOM 8148  O O    . ALA A 1 22 ? -4.315  4.513   0.739   1.00 0.00 ? 22 ALA A O    8  
ATOM 8149  C CB   . ALA A 1 22 ? -5.239  1.725   -0.191  1.00 0.00 ? 22 ALA A CB   8  
ATOM 8150  H H    . ALA A 1 22 ? -4.921  1.870   -2.665  1.00 0.00 ? 22 ALA A H    8  
ATOM 8151  H HA   . ALA A 1 22 ? -6.203  3.578   -0.745  1.00 0.00 ? 22 ALA A HA   8  
ATOM 8152  H HB1  . ALA A 1 22 ? -5.675  1.846   0.801   1.00 0.00 ? 22 ALA A HB1  8  
ATOM 8153  H HB2  . ALA A 1 22 ? -5.819  1.012   -0.771  1.00 0.00 ? 22 ALA A HB2  8  
ATOM 8154  H HB3  . ALA A 1 22 ? -4.218  1.355   -0.115  1.00 0.00 ? 22 ALA A HB3  8  
ATOM 8155  N N    . ILE A 1 23 ? -3.030  4.085   -1.052  1.00 0.00 ? 23 ILE A N    8  
ATOM 8156  C CA   . ILE A 1 23 ? -1.995  5.042   -0.701  1.00 0.00 ? 23 ILE A CA   8  
ATOM 8157  C C    . ILE A 1 23 ? -2.433  6.407   -1.217  1.00 0.00 ? 23 ILE A C    8  
ATOM 8158  O O    . ILE A 1 23 ? -2.469  7.374   -0.458  1.00 0.00 ? 23 ILE A O    8  
ATOM 8159  C CB   . ILE A 1 23 ? -0.663  4.567   -1.295  1.00 0.00 ? 23 ILE A CB   8  
ATOM 8160  C CG1  . ILE A 1 23 ? -0.141  3.386   -0.458  1.00 0.00 ? 23 ILE A CG1  8  
ATOM 8161  C CG2  . ILE A 1 23 ? 0.390   5.688   -1.326  1.00 0.00 ? 23 ILE A CG2  8  
ATOM 8162  C CD1  . ILE A 1 23 ? 0.883   2.580   -1.252  1.00 0.00 ? 23 ILE A CD1  8  
ATOM 8163  H H    . ILE A 1 23 ? -2.990  3.585   -1.943  1.00 0.00 ? 23 ILE A H    8  
ATOM 8164  H HA   . ILE A 1 23 ? -1.893  5.095   0.383   1.00 0.00 ? 23 ILE A HA   8  
ATOM 8165  H HB   . ILE A 1 23 ? -0.860  4.224   -2.313  1.00 0.00 ? 23 ILE A HB   8  
ATOM 8166  H HG12 . ILE A 1 23 ? 0.329   3.749   0.452   1.00 0.00 ? 23 ILE A HG12 8  
ATOM 8167  H HG13 . ILE A 1 23 ? -0.967  2.732   -0.159  1.00 0.00 ? 23 ILE A HG13 8  
ATOM 8168  H HG21 . ILE A 1 23 ? 1.367   5.292   -1.601  1.00 0.00 ? 23 ILE A HG21 8  
ATOM 8169  H HG22 . ILE A 1 23 ? 0.119   6.440   -2.068  1.00 0.00 ? 23 ILE A HG22 8  
ATOM 8170  H HG23 . ILE A 1 23 ? 0.454   6.159   -0.347  1.00 0.00 ? 23 ILE A HG23 8  
ATOM 8171  H HD11 . ILE A 1 23 ? 1.008   1.627   -0.761  1.00 0.00 ? 23 ILE A HD11 8  
ATOM 8172  H HD12 . ILE A 1 23 ? 0.526   2.407   -2.266  1.00 0.00 ? 23 ILE A HD12 8  
ATOM 8173  H HD13 . ILE A 1 23 ? 1.842   3.096   -1.277  1.00 0.00 ? 23 ILE A HD13 8  
ATOM 8174  N N    . SER A 1 24 ? -2.778  6.480   -2.501  1.00 0.00 ? 24 SER A N    8  
ATOM 8175  C CA   . SER A 1 24 ? -3.143  7.695   -3.204  1.00 0.00 ? 24 SER A CA   8  
ATOM 8176  C C    . SER A 1 24 ? -4.259  8.453   -2.473  1.00 0.00 ? 24 SER A C    8  
ATOM 8177  O O    . SER A 1 24 ? -4.099  9.648   -2.238  1.00 0.00 ? 24 SER A O    8  
ATOM 8178  C CB   . SER A 1 24 ? -3.497  7.330   -4.651  1.00 0.00 ? 24 SER A CB   8  
ATOM 8179  O OG   . SER A 1 24 ? -2.373  6.750   -5.295  1.00 0.00 ? 24 SER A OG   8  
ATOM 8180  H H    . SER A 1 24 ? -2.831  5.619   -3.035  1.00 0.00 ? 24 SER A H    8  
ATOM 8181  H HA   . SER A 1 24 ? -2.268  8.346   -3.220  1.00 0.00 ? 24 SER A HA   8  
ATOM 8182  H HB2  . SER A 1 24 ? -4.312  6.600   -4.672  1.00 0.00 ? 24 SER A HB2  8  
ATOM 8183  H HB3  . SER A 1 24 ? -3.796  8.230   -5.184  1.00 0.00 ? 24 SER A HB3  8  
ATOM 8184  H HG   . SER A 1 24 ? -2.339  5.818   -4.994  1.00 0.00 ? 24 SER A HG   8  
ATOM 8185  N N    . VAL A 1 25 ? -5.325  7.778   -2.026  1.00 0.00 ? 25 VAL A N    8  
ATOM 8186  C CA   . VAL A 1 25 ? -6.381  8.392   -1.216  1.00 0.00 ? 25 VAL A CA   8  
ATOM 8187  C C    . VAL A 1 25 ? -5.807  9.112   0.011   1.00 0.00 ? 25 VAL A C    8  
ATOM 8188  O O    . VAL A 1 25 ? -6.040  10.301  0.206   1.00 0.00 ? 25 VAL A O    8  
ATOM 8189  C CB   . VAL A 1 25 ? -7.478  7.366   -0.828  1.00 0.00 ? 25 VAL A CB   8  
ATOM 8190  C CG1  . VAL A 1 25 ? -8.662  7.473   -1.784  1.00 0.00 ? 25 VAL A CG1  8  
ATOM 8191  C CG2  . VAL A 1 25 ? -7.024  5.931   -0.708  1.00 0.00 ? 25 VAL A CG2  8  
ATOM 8192  H H    . VAL A 1 25 ? -5.400  6.788   -2.249  1.00 0.00 ? 25 VAL A H    8  
ATOM 8193  H HA   . VAL A 1 25 ? -6.833  9.158   -1.842  1.00 0.00 ? 25 VAL A HA   8  
ATOM 8194  H HB   . VAL A 1 25 ? -7.844  7.535   0.176   1.00 0.00 ? 25 VAL A HB   8  
ATOM 8195  H HG11 . VAL A 1 25 ? -9.453  6.815   -1.441  1.00 0.00 ? 25 VAL A HG11 8  
ATOM 8196  H HG12 . VAL A 1 25 ? -9.040  8.491   -1.794  1.00 0.00 ? 25 VAL A HG12 8  
ATOM 8197  H HG13 . VAL A 1 25 ? -8.361  7.191   -2.795  1.00 0.00 ? 25 VAL A HG13 8  
ATOM 8198  H HG21 . VAL A 1 25 ? -7.654  5.429   0.019   1.00 0.00 ? 25 VAL A HG21 8  
ATOM 8199  H HG22 . VAL A 1 25 ? -7.112  5.433   -1.669  1.00 0.00 ? 25 VAL A HG22 8  
ATOM 8200  H HG23 . VAL A 1 25 ? -6.006  5.903   -0.340  1.00 0.00 ? 25 VAL A HG23 8  
ATOM 8201  N N    . VAL A 1 26 ? -5.078  8.394   0.853   1.00 0.00 ? 26 VAL A N    8  
ATOM 8202  C CA   . VAL A 1 26 ? -4.463  8.854   2.093   1.00 0.00 ? 26 VAL A CA   8  
ATOM 8203  C C    . VAL A 1 26 ? -3.536  10.040  1.816   1.00 0.00 ? 26 VAL A C    8  
ATOM 8204  O O    . VAL A 1 26 ? -3.648  11.056  2.506   1.00 0.00 ? 26 VAL A O    8  
ATOM 8205  C CB   . VAL A 1 26 ? -3.745  7.668   2.774   1.00 0.00 ? 26 VAL A CB   8  
ATOM 8206  C CG1  . VAL A 1 26 ? -3.042  8.046   4.081   1.00 0.00 ? 26 VAL A CG1  8  
ATOM 8207  C CG2  . VAL A 1 26 ? -4.741  6.559   3.124   1.00 0.00 ? 26 VAL A CG2  8  
ATOM 8208  H H    . VAL A 1 26 ? -4.914  7.447   0.585   1.00 0.00 ? 26 VAL A H    8  
ATOM 8209  H HA   . VAL A 1 26 ? -5.254  9.202   2.752   1.00 0.00 ? 26 VAL A HA   8  
ATOM 8210  H HB   . VAL A 1 26 ? -3.001  7.257   2.093   1.00 0.00 ? 26 VAL A HB   8  
ATOM 8211  H HG11 . VAL A 1 26 ? -2.621  7.155   4.541   1.00 0.00 ? 26 VAL A HG11 8  
ATOM 8212  H HG12 . VAL A 1 26 ? -2.220  8.723   3.866   1.00 0.00 ? 26 VAL A HG12 8  
ATOM 8213  H HG13 . VAL A 1 26 ? -3.741  8.523   4.769   1.00 0.00 ? 26 VAL A HG13 8  
ATOM 8214  H HG21 . VAL A 1 26 ? -5.301  6.256   2.245   1.00 0.00 ? 26 VAL A HG21 8  
ATOM 8215  H HG22 . VAL A 1 26 ? -4.193  5.685   3.477   1.00 0.00 ? 26 VAL A HG22 8  
ATOM 8216  H HG23 . VAL A 1 26 ? -5.438  6.903   3.888   1.00 0.00 ? 26 VAL A HG23 8  
ATOM 8217  N N    . MET A 1 27 ? -2.689  9.947   0.786   1.00 0.00 ? 27 MET A N    8  
ATOM 8218  C CA   . MET A 1 27 ? -1.777  11.007  0.376   1.00 0.00 ? 27 MET A CA   8  
ATOM 8219  C C    . MET A 1 27 ? -2.538  12.272  -0.002  1.00 0.00 ? 27 MET A C    8  
ATOM 8220  O O    . MET A 1 27 ? -2.220  13.360  0.478   1.00 0.00 ? 27 MET A O    8  
ATOM 8221  C CB   . MET A 1 27 ? -0.928  10.552  -0.816  1.00 0.00 ? 27 MET A CB   8  
ATOM 8222  C CG   . MET A 1 27 ? 0.156   9.569   -0.393  1.00 0.00 ? 27 MET A CG   8  
ATOM 8223  S SD   . MET A 1 27 ? 1.416   9.306   -1.664  1.00 0.00 ? 27 MET A SD   8  
ATOM 8224  C CE   . MET A 1 27 ? 2.589   8.388   -0.645  1.00 0.00 ? 27 MET A CE   8  
ATOM 8225  H H    . MET A 1 27 ? -2.671  9.080   0.259   1.00 0.00 ? 27 MET A H    8  
ATOM 8226  H HA   . MET A 1 27 ? -1.123  11.243  1.217   1.00 0.00 ? 27 MET A HA   8  
ATOM 8227  H HB2  . MET A 1 27 ? -1.553  10.107  -1.590  1.00 0.00 ? 27 MET A HB2  8  
ATOM 8228  H HB3  . MET A 1 27 ? -0.441  11.430  -1.234  1.00 0.00 ? 27 MET A HB3  8  
ATOM 8229  H HG2  . MET A 1 27 ? 0.647   9.974   0.489   1.00 0.00 ? 27 MET A HG2  8  
ATOM 8230  H HG3  . MET A 1 27 ? -0.292  8.615   -0.122  1.00 0.00 ? 27 MET A HG3  8  
ATOM 8231  H HE1  . MET A 1 27 ? 2.445   7.320   -0.782  1.00 0.00 ? 27 MET A HE1  8  
ATOM 8232  H HE2  . MET A 1 27 ? 3.604   8.658   -0.928  1.00 0.00 ? 27 MET A HE2  8  
ATOM 8233  H HE3  . MET A 1 27 ? 2.442   8.629   0.405   1.00 0.00 ? 27 MET A HE3  8  
ATOM 8234  N N    . SER A 1 28 ? -3.566  12.136  -0.836  1.00 0.00 ? 28 SER A N    8  
ATOM 8235  C CA   . SER A 1 28 ? -4.494  13.198  -1.191  1.00 0.00 ? 28 SER A CA   8  
ATOM 8236  C C    . SER A 1 28 ? -5.351  13.666  -0.004  1.00 0.00 ? 28 SER A C    8  
ATOM 8237  O O    . SER A 1 28 ? -6.154  14.586  -0.154  1.00 0.00 ? 28 SER A O    8  
ATOM 8238  C CB   . SER A 1 28 ? -5.373  12.670  -2.322  1.00 0.00 ? 28 SER A CB   8  
ATOM 8239  O OG   . SER A 1 28 ? -4.603  12.421  -3.483  1.00 0.00 ? 28 SER A OG   8  
ATOM 8240  H H    . SER A 1 28 ? -3.762  11.225  -1.244  1.00 0.00 ? 28 SER A H    8  
ATOM 8241  H HA   . SER A 1 28 ? -3.926  14.053  -1.554  1.00 0.00 ? 28 SER A HA   8  
ATOM 8242  H HB2  . SER A 1 28 ? -5.822  11.737  -1.994  1.00 0.00 ? 28 SER A HB2  8  
ATOM 8243  H HB3  . SER A 1 28 ? -6.187  13.363  -2.540  1.00 0.00 ? 28 SER A HB3  8  
ATOM 8244  H HG   . SER A 1 28 ? -5.169  11.893  -4.091  1.00 0.00 ? 28 SER A HG   8  
ATOM 8245  N N    . GLY A 1 29 ? -5.210  13.056  1.176   1.00 0.00 ? 29 GLY A N    8  
ATOM 8246  C CA   . GLY A 1 29 ? -5.919  13.440  2.378   1.00 0.00 ? 29 GLY A CA   8  
ATOM 8247  C C    . GLY A 1 29 ? -7.374  12.987  2.370   1.00 0.00 ? 29 GLY A C    8  
ATOM 8248  O O    . GLY A 1 29 ? -8.144  13.494  3.191   1.00 0.00 ? 29 GLY A O    8  
ATOM 8249  H H    . GLY A 1 29 ? -4.562  12.280  1.255   1.00 0.00 ? 29 GLY A H    8  
ATOM 8250  H HA2  . GLY A 1 29 ? -5.419  12.998  3.239   1.00 0.00 ? 29 GLY A HA2  8  
ATOM 8251  H HA3  . GLY A 1 29 ? -5.889  14.526  2.478   1.00 0.00 ? 29 GLY A HA3  8  
ATOM 8252  N N    . LYS A 1 30 ? -7.777  12.042  1.503   1.00 0.00 ? 30 LYS A N    8  
ATOM 8253  C CA   . LYS A 1 30 ? -9.174  11.593  1.450   1.00 0.00 ? 30 LYS A CA   8  
ATOM 8254  C C    . LYS A 1 30 ? -9.556  10.942  2.772   1.00 0.00 ? 30 LYS A C    8  
ATOM 8255  O O    . LYS A 1 30 ? -10.695 11.054  3.228   1.00 0.00 ? 30 LYS A O    8  
ATOM 8256  C CB   . LYS A 1 30 ? -9.402  10.601  0.293   1.00 0.00 ? 30 LYS A CB   8  
ATOM 8257  C CG   . LYS A 1 30 ? -9.658  11.278  -1.063  1.00 0.00 ? 30 LYS A CG   8  
ATOM 8258  C CD   . LYS A 1 30 ? -8.444  11.900  -1.727  1.00 0.00 ? 30 LYS A CD   8  
ATOM 8259  C CE   . LYS A 1 30 ? -8.713  12.335  -3.176  1.00 0.00 ? 30 LYS A CE   8  
ATOM 8260  N NZ   . LYS A 1 30 ? -9.908  13.191  -3.319  1.00 0.00 ? 30 LYS A NZ   8  
ATOM 8261  H H    . LYS A 1 30 ? -7.069  11.507  0.986   1.00 0.00 ? 30 LYS A H    8  
ATOM 8262  H HA   . LYS A 1 30 ? -9.824  12.459  1.314   1.00 0.00 ? 30 LYS A HA   8  
ATOM 8263  H HB2  . LYS A 1 30 ? -8.567  9.908   0.218   1.00 0.00 ? 30 LYS A HB2  8  
ATOM 8264  H HB3  . LYS A 1 30 ? -10.279 9.992   0.520   1.00 0.00 ? 30 LYS A HB3  8  
ATOM 8265  H HG2  . LYS A 1 30 ? -10.033 10.531  -1.750  1.00 0.00 ? 30 LYS A HG2  8  
ATOM 8266  H HG3  . LYS A 1 30 ? -10.396 12.057  -0.948  1.00 0.00 ? 30 LYS A HG3  8  
ATOM 8267  H HD2  . LYS A 1 30 ? -8.100  12.754  -1.142  1.00 0.00 ? 30 LYS A HD2  8  
ATOM 8268  H HD3  . LYS A 1 30 ? -7.686  11.130  -1.750  1.00 0.00 ? 30 LYS A HD3  8  
ATOM 8269  H HE2  . LYS A 1 30 ? -7.844  12.873  -3.558  1.00 0.00 ? 30 LYS A HE2  8  
ATOM 8270  H HE3  . LYS A 1 30 ? -8.852  11.445  -3.793  1.00 0.00 ? 30 LYS A HE3  8  
ATOM 8271  H HZ1  . LYS A 1 30 ? -9.927  13.920  -2.611  1.00 0.00 ? 30 LYS A HZ1  8  
ATOM 8272  H HZ2  . LYS A 1 30 ? -9.885  13.627  -4.238  1.00 0.00 ? 30 LYS A HZ2  8  
ATOM 8273  H HZ3  . LYS A 1 30 ? -10.742 12.611  -3.249  1.00 0.00 ? 30 LYS A HZ3  8  
ATOM 8274  N N    . MET A 1 31 ? -8.605  10.262  3.403   1.00 0.00 ? 31 MET A N    8  
ATOM 8275  C CA   . MET A 1 31 ? -8.781  9.640   4.697   1.00 0.00 ? 31 MET A CA   8  
ATOM 8276  C C    . MET A 1 31 ? -7.433  9.475   5.387   1.00 0.00 ? 31 MET A C    8  
ATOM 8277  O O    . MET A 1 31 ? -6.401  9.816   4.809   1.00 0.00 ? 31 MET A O    8  
ATOM 8278  C CB   . MET A 1 31 ? -9.471  8.291   4.516   1.00 0.00 ? 31 MET A CB   8  
ATOM 8279  C CG   . MET A 1 31 ? -8.735  7.305   3.628   1.00 0.00 ? 31 MET A CG   8  
ATOM 8280  S SD   . MET A 1 31 ? -9.834  6.004   3.027   1.00 0.00 ? 31 MET A SD   8  
ATOM 8281  C CE   . MET A 1 31 ? -10.679 6.886   1.719   1.00 0.00 ? 31 MET A CE   8  
ATOM 8282  H H    . MET A 1 31 ? -7.672  10.213  3.014   1.00 0.00 ? 31 MET A H    8  
ATOM 8283  H HA   . MET A 1 31 ? -9.408  10.285  5.312   1.00 0.00 ? 31 MET A HA   8  
ATOM 8284  H HB2  . MET A 1 31 ? -9.560  7.843   5.488   1.00 0.00 ? 31 MET A HB2  8  
ATOM 8285  H HB3  . MET A 1 31 ? -10.474 8.411   4.129   1.00 0.00 ? 31 MET A HB3  8  
ATOM 8286  H HG2  . MET A 1 31 ? -8.282  7.804   2.771   1.00 0.00 ? 31 MET A HG2  8  
ATOM 8287  H HG3  . MET A 1 31 ? -7.947  6.858   4.231   1.00 0.00 ? 31 MET A HG3  8  
ATOM 8288  H HE1  . MET A 1 31 ? -11.341 6.191   1.209   1.00 0.00 ? 31 MET A HE1  8  
ATOM 8289  H HE2  . MET A 1 31 ? -11.252 7.702   2.150   1.00 0.00 ? 31 MET A HE2  8  
ATOM 8290  H HE3  . MET A 1 31 ? -9.936  7.270   1.028   1.00 0.00 ? 31 MET A HE3  8  
ATOM 8291  N N    . SER A 1 32 ? -7.450  8.934   6.604   1.00 0.00 ? 32 SER A N    8  
ATOM 8292  C CA   . SER A 1 32 ? -6.244  8.608   7.351   1.00 0.00 ? 32 SER A CA   8  
ATOM 8293  C C    . SER A 1 32 ? -5.765  7.205   6.964   1.00 0.00 ? 32 SER A C    8  
ATOM 8294  O O    . SER A 1 32 ? -6.513  6.446   6.340   1.00 0.00 ? 32 SER A O    8  
ATOM 8295  C CB   . SER A 1 32 ? -6.495  8.714   8.867   1.00 0.00 ? 32 SER A CB   8  
ATOM 8296  O OG   . SER A 1 32 ? -7.656  9.463   9.211   1.00 0.00 ? 32 SER A OG   8  
ATOM 8297  H H    . SER A 1 32 ? -8.339  8.649   7.010   1.00 0.00 ? 32 SER A H    8  
ATOM 8298  H HA   . SER A 1 32 ? -5.468  9.319   7.079   1.00 0.00 ? 32 SER A HA   8  
ATOM 8299  H HB2  . SER A 1 32 ? -6.590  7.710   9.274   1.00 0.00 ? 32 SER A HB2  8  
ATOM 8300  H HB3  . SER A 1 32 ? -5.623  9.171   9.336   1.00 0.00 ? 32 SER A HB3  8  
ATOM 8301  H HG   . SER A 1 32 ? -7.724  9.468   10.175  1.00 0.00 ? 32 SER A HG   8  
ATOM 8302  N N    . VAL A 1 33 ? -4.553  6.834   7.397   1.00 0.00 ? 33 VAL A N    8  
ATOM 8303  C CA   . VAL A 1 33 ? -3.980  5.504   7.192   1.00 0.00 ? 33 VAL A CA   8  
ATOM 8304  C C    . VAL A 1 33 ? -4.969  4.437   7.669   1.00 0.00 ? 33 VAL A C    8  
ATOM 8305  O O    . VAL A 1 33 ? -5.370  3.601   6.864   1.00 0.00 ? 33 VAL A O    8  
ATOM 8306  C CB   . VAL A 1 33 ? -2.589  5.406   7.869   1.00 0.00 ? 33 VAL A CB   8  
ATOM 8307  C CG1  . VAL A 1 33 ? -1.974  3.996   7.846   1.00 0.00 ? 33 VAL A CG1  8  
ATOM 8308  C CG2  . VAL A 1 33 ? -1.588  6.351   7.186   1.00 0.00 ? 33 VAL A CG2  8  
ATOM 8309  H H    . VAL A 1 33 ? -3.977  7.516   7.872   1.00 0.00 ? 33 VAL A H    8  
ATOM 8310  H HA   . VAL A 1 33 ? -3.850  5.361   6.118   1.00 0.00 ? 33 VAL A HA   8  
ATOM 8311  H HB   . VAL A 1 33 ? -2.685  5.707   8.912   1.00 0.00 ? 33 VAL A HB   8  
ATOM 8312  H HG11 . VAL A 1 33 ? -1.032  4.016   8.395   1.00 0.00 ? 33 VAL A HG11 8  
ATOM 8313  H HG12 . VAL A 1 33 ? -2.623  3.272   8.343   1.00 0.00 ? 33 VAL A HG12 8  
ATOM 8314  H HG13 . VAL A 1 33 ? -1.782  3.671   6.825   1.00 0.00 ? 33 VAL A HG13 8  
ATOM 8315  H HG21 . VAL A 1 33 ? -1.422  6.035   6.156   1.00 0.00 ? 33 VAL A HG21 8  
ATOM 8316  H HG22 . VAL A 1 33 ? -1.954  7.378   7.191   1.00 0.00 ? 33 VAL A HG22 8  
ATOM 8317  H HG23 . VAL A 1 33 ? -0.636  6.329   7.719   1.00 0.00 ? 33 VAL A HG23 8  
ATOM 8318  N N    . SER A 1 34 ? -5.399  4.458   8.938   1.00 0.00 ? 34 SER A N    8  
ATOM 8319  C CA   . SER A 1 34 ? -6.221  3.364   9.461   1.00 0.00 ? 34 SER A CA   8  
ATOM 8320  C C    . SER A 1 34 ? -7.566  3.248   8.723   1.00 0.00 ? 34 SER A C    8  
ATOM 8321  O O    . SER A 1 34 ? -8.104  2.153   8.570   1.00 0.00 ? 34 SER A O    8  
ATOM 8322  C CB   . SER A 1 34 ? -6.438  3.504   10.973  1.00 0.00 ? 34 SER A CB   8  
ATOM 8323  O OG   . SER A 1 34 ? -6.378  2.237   11.605  1.00 0.00 ? 34 SER A OG   8  
ATOM 8324  H H    . SER A 1 34 ? -5.076  5.183   9.561   1.00 0.00 ? 34 SER A H    8  
ATOM 8325  H HA   . SER A 1 34 ? -5.653  2.454   9.280   1.00 0.00 ? 34 SER A HA   8  
ATOM 8326  H HB2  . SER A 1 34 ? -5.660  4.133   11.407  1.00 0.00 ? 34 SER A HB2  8  
ATOM 8327  H HB3  . SER A 1 34 ? -7.406  3.967   11.169  1.00 0.00 ? 34 SER A HB3  8  
ATOM 8328  H HG   . SER A 1 34 ? -6.511  1.527   10.931  1.00 0.00 ? 34 SER A HG   8  
ATOM 8329  N N    . LYS A 1 35 ? -8.103  4.369   8.239   1.00 0.00 ? 35 LYS A N    8  
ATOM 8330  C CA   . LYS A 1 35 ? -9.353  4.392   7.503   1.00 0.00 ? 35 LYS A CA   8  
ATOM 8331  C C    . LYS A 1 35 ? -9.171  3.636   6.195   1.00 0.00 ? 35 LYS A C    8  
ATOM 8332  O O    . LYS A 1 35 ? -9.751  2.563   6.057   1.00 0.00 ? 35 LYS A O    8  
ATOM 8333  C CB   . LYS A 1 35 ? -9.820  5.840   7.378   1.00 0.00 ? 35 LYS A CB   8  
ATOM 8334  C CG   . LYS A 1 35 ? -11.122 5.996   6.581   1.00 0.00 ? 35 LYS A CG   8  
ATOM 8335  C CD   . LYS A 1 35 ? -11.977 7.125   7.151   1.00 0.00 ? 35 LYS A CD   8  
ATOM 8336  C CE   . LYS A 1 35 ? -12.936 7.721   6.118   1.00 0.00 ? 35 LYS A CE   8  
ATOM 8337  N NZ   . LYS A 1 35 ? -13.721 8.820   6.713   1.00 0.00 ? 35 LYS A NZ   8  
ATOM 8338  H H    . LYS A 1 35 ? -7.614  5.240   8.382   1.00 0.00 ? 35 LYS A H    8  
ATOM 8339  H HA   . LYS A 1 35 ? -10.097 3.854   8.094   1.00 0.00 ? 35 LYS A HA   8  
ATOM 8340  H HB2  . LYS A 1 35 ? -9.983  6.217   8.386   1.00 0.00 ? 35 LYS A HB2  8  
ATOM 8341  H HB3  . LYS A 1 35 ? -9.028  6.435   6.935   1.00 0.00 ? 35 LYS A HB3  8  
ATOM 8342  H HG2  . LYS A 1 35 ? -10.908 6.178   5.540   1.00 0.00 ? 35 LYS A HG2  8  
ATOM 8343  H HG3  . LYS A 1 35 ? -11.684 5.083   6.615   1.00 0.00 ? 35 LYS A HG3  8  
ATOM 8344  H HD2  . LYS A 1 35 ? -12.533 6.733   7.999   1.00 0.00 ? 35 LYS A HD2  8  
ATOM 8345  H HD3  . LYS A 1 35 ? -11.322 7.911   7.508   1.00 0.00 ? 35 LYS A HD3  8  
ATOM 8346  H HE2  . LYS A 1 35 ? -12.359 8.107   5.277   1.00 0.00 ? 35 LYS A HE2  8  
ATOM 8347  H HE3  . LYS A 1 35 ? -13.609 6.943   5.753   1.00 0.00 ? 35 LYS A HE3  8  
ATOM 8348  H HZ1  . LYS A 1 35 ? -13.129 9.501   7.183   1.00 0.00 ? 35 LYS A HZ1  8  
ATOM 8349  H HZ2  . LYS A 1 35 ? -14.261 9.318   6.010   1.00 0.00 ? 35 LYS A HZ2  8  
ATOM 8350  H HZ3  . LYS A 1 35 ? -14.372 8.468   7.401   1.00 0.00 ? 35 LYS A HZ3  8  
ATOM 8351  N N    . ALA A 1 36 ? -8.365  4.132   5.252   1.00 0.00 ? 36 ALA A N    8  
ATOM 8352  C CA   . ALA A 1 36 ? -8.089  3.430   4.005   1.00 0.00 ? 36 ALA A CA   8  
ATOM 8353  C C    . ALA A 1 36 ? -7.588  2.005   4.202   1.00 0.00 ? 36 ALA A C    8  
ATOM 8354  O O    . ALA A 1 36 ? -7.993  1.144   3.427   1.00 0.00 ? 36 ALA A O    8  
ATOM 8355  C CB   . ALA A 1 36 ? -7.036  4.203   3.209   1.00 0.00 ? 36 ALA A CB   8  
ATOM 8356  H H    . ALA A 1 36 ? -8.032  5.089   5.307   1.00 0.00 ? 36 ALA A H    8  
ATOM 8357  H HA   . ALA A 1 36 ? -9.040  3.355   3.458   1.00 0.00 ? 36 ALA A HA   8  
ATOM 8358  H HB1  . ALA A 1 36 ? -6.848  3.715   2.252   1.00 0.00 ? 36 ALA A HB1  8  
ATOM 8359  H HB2  . ALA A 1 36 ? -7.353  5.224   3.028   1.00 0.00 ? 36 ALA A HB2  8  
ATOM 8360  H HB3  . ALA A 1 36 ? -6.115  4.242   3.788   1.00 0.00 ? 36 ALA A HB3  8  
ATOM 8361  N N    . GLN A 1 37 ? -6.782  1.715   5.227   1.00 0.00 ? 37 GLN A N    8  
ATOM 8362  C CA   . GLN A 1 37 ? -6.440  0.356   5.609   1.00 0.00 ? 37 GLN A CA   8  
ATOM 8363  C C    . GLN A 1 37 ? -7.709  -0.477  5.636   1.00 0.00 ? 37 GLN A C    8  
ATOM 8364  O O    . GLN A 1 37 ? -7.767  -1.527  5.005   1.00 0.00 ? 37 GLN A O    8  
ATOM 8365  C CB   . GLN A 1 37 ? -5.696  0.375   6.958   1.00 0.00 ? 37 GLN A CB   8  
ATOM 8366  C CG   . GLN A 1 37 ? -5.929  -0.853  7.862   1.00 0.00 ? 37 GLN A CG   8  
ATOM 8367  C CD   . GLN A 1 37 ? -6.692  -0.639  9.167   1.00 0.00 ? 37 GLN A CD   8  
ATOM 8368  O OE1  . GLN A 1 37 ? -6.344  0.193   10.000  1.00 0.00 ? 37 GLN A OE1  8  
ATOM 8369  N NE2  . GLN A 1 37 ? -7.695  -1.466  9.420   1.00 0.00 ? 37 GLN A NE2  8  
ATOM 8370  H H    . GLN A 1 37 ? -6.411  2.439   5.829   1.00 0.00 ? 37 GLN A H    8  
ATOM 8371  H HA   . GLN A 1 37 ? -5.779  -0.071  4.856   1.00 0.00 ? 37 GLN A HA   8  
ATOM 8372  H HB2  . GLN A 1 37 ? -4.631  0.466   6.717   1.00 0.00 ? 37 GLN A HB2  8  
ATOM 8373  H HB3  . GLN A 1 37 ? -5.979  1.255   7.519   1.00 0.00 ? 37 GLN A HB3  8  
ATOM 8374  H HG2  . GLN A 1 37 ? -6.429  -1.632  7.310   1.00 0.00 ? 37 GLN A HG2  8  
ATOM 8375  H HG3  . GLN A 1 37 ? -4.975  -1.257  8.120   1.00 0.00 ? 37 GLN A HG3  8  
ATOM 8376  H HE21 . GLN A 1 37 ? -7.919  -2.197  8.763   1.00 0.00 ? 37 GLN A HE21 8  
ATOM 8377  H HE22 . GLN A 1 37 ? -8.206  -1.397  10.297  1.00 0.00 ? 37 GLN A HE22 8  
ATOM 8378  N N    . SER A 1 38 ? -8.713  -0.024  6.374   1.00 0.00 ? 38 SER A N    8  
ATOM 8379  C CA   . SER A 1 38 ? -9.917  -0.785  6.558   1.00 0.00 ? 38 SER A CA   8  
ATOM 8380  C C    . SER A 1 38 ? -10.703 -0.830  5.239   1.00 0.00 ? 38 SER A C    8  
ATOM 8381  O O    . SER A 1 38 ? -11.144 -1.902  4.833   1.00 0.00 ? 38 SER A O    8  
ATOM 8382  C CB   . SER A 1 38 ? -10.684 -0.148  7.716   1.00 0.00 ? 38 SER A CB   8  
ATOM 8383  O OG   . SER A 1 38 ? -11.465 -1.117  8.386   1.00 0.00 ? 38 SER A OG   8  
ATOM 8384  H H    . SER A 1 38 ? -8.666  0.905   6.786   1.00 0.00 ? 38 SER A H    8  
ATOM 8385  H HA   . SER A 1 38 ? -9.591  -1.789  6.839   1.00 0.00 ? 38 SER A HA   8  
ATOM 8386  H HB2  . SER A 1 38 ? -9.960  0.246   8.433   1.00 0.00 ? 38 SER A HB2  8  
ATOM 8387  H HB3  . SER A 1 38 ? -11.310 0.671   7.360   1.00 0.00 ? 38 SER A HB3  8  
ATOM 8388  H HG   . SER A 1 38 ? -12.394 -1.037  8.071   1.00 0.00 ? 38 SER A HG   8  
ATOM 8389  N N    . ILE A 1 39 ? -10.852 0.308   4.548   1.00 0.00 ? 39 ILE A N    8  
ATOM 8390  C CA   . ILE A 1 39 ? -11.635 0.410   3.314   1.00 0.00 ? 39 ILE A CA   8  
ATOM 8391  C C    . ILE A 1 39 ? -11.083 -0.549  2.259   1.00 0.00 ? 39 ILE A C    8  
ATOM 8392  O O    . ILE A 1 39 ? -11.817 -1.383  1.727   1.00 0.00 ? 39 ILE A O    8  
ATOM 8393  C CB   . ILE A 1 39 ? -11.736 1.869   2.811   1.00 0.00 ? 39 ILE A CB   8  
ATOM 8394  C CG1  . ILE A 1 39 ? -12.392 2.718   3.923   1.00 0.00 ? 39 ILE A CG1  8  
ATOM 8395  C CG2  . ILE A 1 39 ? -12.520 1.943   1.484   1.00 0.00 ? 39 ILE A CG2  8  
ATOM 8396  C CD1  . ILE A 1 39 ? -12.878 4.097   3.504   1.00 0.00 ? 39 ILE A CD1  8  
ATOM 8397  H H    . ILE A 1 39 ? -10.430 1.151   4.923   1.00 0.00 ? 39 ILE A H    8  
ATOM 8398  H HA   . ILE A 1 39 ? -12.645 0.097   3.550   1.00 0.00 ? 39 ILE A HA   8  
ATOM 8399  H HB   . ILE A 1 39 ? -10.737 2.258   2.626   1.00 0.00 ? 39 ILE A HB   8  
ATOM 8400  H HG12 . ILE A 1 39 ? -13.229 2.177   4.346   1.00 0.00 ? 39 ILE A HG12 8  
ATOM 8401  H HG13 . ILE A 1 39 ? -11.678 2.869   4.720   1.00 0.00 ? 39 ILE A HG13 8  
ATOM 8402  H HG21 . ILE A 1 39 ? -13.538 1.580   1.623   1.00 0.00 ? 39 ILE A HG21 8  
ATOM 8403  H HG22 . ILE A 1 39 ? -12.552 2.968   1.112   1.00 0.00 ? 39 ILE A HG22 8  
ATOM 8404  H HG23 . ILE A 1 39 ? -12.030 1.350   0.711   1.00 0.00 ? 39 ILE A HG23 8  
ATOM 8405  H HD11 . ILE A 1 39 ? -13.118 4.678   4.395   1.00 0.00 ? 39 ILE A HD11 8  
ATOM 8406  H HD12 . ILE A 1 39 ? -12.100 4.594   2.937   1.00 0.00 ? 39 ILE A HD12 8  
ATOM 8407  H HD13 . ILE A 1 39 ? -13.762 3.997   2.881   1.00 0.00 ? 39 ILE A HD13 8  
ATOM 8408  N N    . TYR A 1 40 ? -9.796  -0.440  1.953   1.00 0.00 ? 40 TYR A N    8  
ATOM 8409  C CA   . TYR A 1 40 ? -9.112  -1.200  0.917   1.00 0.00 ? 40 TYR A CA   8  
ATOM 8410  C C    . TYR A 1 40 ? -8.636  -2.563  1.438   1.00 0.00 ? 40 TYR A C    8  
ATOM 8411  O O    . TYR A 1 40 ? -8.153  -3.391  0.665   1.00 0.00 ? 40 TYR A O    8  
ATOM 8412  C CB   . TYR A 1 40 ? -7.948  -0.347  0.402   1.00 0.00 ? 40 TYR A CB   8  
ATOM 8413  C CG   . TYR A 1 40 ? -8.378  0.911   -0.344  1.00 0.00 ? 40 TYR A CG   8  
ATOM 8414  C CD1  . TYR A 1 40 ? -8.791  2.068   0.350   1.00 0.00 ? 40 TYR A CD1  8  
ATOM 8415  C CD2  . TYR A 1 40 ? -8.250  0.965   -1.741  1.00 0.00 ? 40 TYR A CD2  8  
ATOM 8416  C CE1  . TYR A 1 40 ? -9.148  3.243   -0.338  1.00 0.00 ? 40 TYR A CE1  8  
ATOM 8417  C CE2  . TYR A 1 40 ? -8.579  2.140   -2.430  1.00 0.00 ? 40 TYR A CE2  8  
ATOM 8418  C CZ   . TYR A 1 40 ? -9.084  3.264   -1.746  1.00 0.00 ? 40 TYR A CZ   8  
ATOM 8419  O OH   . TYR A 1 40 ? -9.510  4.355   -2.436  1.00 0.00 ? 40 TYR A OH   8  
ATOM 8420  H H    . TYR A 1 40 ? -9.226  0.222   2.469   1.00 0.00 ? 40 TYR A H    8  
ATOM 8421  H HA   . TYR A 1 40 ? -9.799  -1.378  0.089   1.00 0.00 ? 40 TYR A HA   8  
ATOM 8422  H HB2  . TYR A 1 40 ? -7.317  -0.057  1.242   1.00 0.00 ? 40 TYR A HB2  8  
ATOM 8423  H HB3  . TYR A 1 40 ? -7.330  -0.959  -0.255  1.00 0.00 ? 40 TYR A HB3  8  
ATOM 8424  H HD1  . TYR A 1 40 ? -8.805  2.072   1.421   1.00 0.00 ? 40 TYR A HD1  8  
ATOM 8425  H HD2  . TYR A 1 40 ? -7.817  0.140   -2.289  1.00 0.00 ? 40 TYR A HD2  8  
ATOM 8426  H HE1  . TYR A 1 40 ? -9.416  4.149   0.196   1.00 0.00 ? 40 TYR A HE1  8  
ATOM 8427  H HE2  . TYR A 1 40 ? -8.376  2.200   -3.483  1.00 0.00 ? 40 TYR A HE2  8  
ATOM 8428  H HH   . TYR A 1 40 ? -9.556  4.177   -3.399  1.00 0.00 ? 40 TYR A HH   8  
ATOM 8429  N N    . GLY A 1 41 ? -8.791  -2.826  2.737   1.00 0.00 ? 41 GLY A N    8  
ATOM 8430  C CA   . GLY A 1 41 ? -8.427  -4.069  3.390   1.00 0.00 ? 41 GLY A CA   8  
ATOM 8431  C C    . GLY A 1 41 ? -6.931  -4.346  3.332   1.00 0.00 ? 41 GLY A C    8  
ATOM 8432  O O    . GLY A 1 41 ? -6.544  -5.505  3.164   1.00 0.00 ? 41 GLY A O    8  
ATOM 8433  H H    . GLY A 1 41 ? -9.122  -2.089  3.348   1.00 0.00 ? 41 GLY A H    8  
ATOM 8434  H HA2  . GLY A 1 41 ? -8.731  -4.016  4.435   1.00 0.00 ? 41 GLY A HA2  8  
ATOM 8435  H HA3  . GLY A 1 41 ? -8.958  -4.884  2.913   1.00 0.00 ? 41 GLY A HA3  8  
ATOM 8436  N N    . ILE A 1 42 ? -6.097  -3.314  3.445   1.00 0.00 ? 42 ILE A N    8  
ATOM 8437  C CA   . ILE A 1 42 ? -4.635  -3.400  3.532   1.00 0.00 ? 42 ILE A CA   8  
ATOM 8438  C C    . ILE A 1 42 ? -4.285  -3.417  5.022   1.00 0.00 ? 42 ILE A C    8  
ATOM 8439  O O    . ILE A 1 42 ? -5.007  -2.807  5.804   1.00 0.00 ? 42 ILE A O    8  
ATOM 8440  C CB   . ILE A 1 42 ? -4.005  -2.185  2.811   1.00 0.00 ? 42 ILE A CB   8  
ATOM 8441  C CG1  . ILE A 1 42 ? -4.645  -2.045  1.411   1.00 0.00 ? 42 ILE A CG1  8  
ATOM 8442  C CG2  . ILE A 1 42 ? -2.464  -2.262  2.796   1.00 0.00 ? 42 ILE A CG2  8  
ATOM 8443  C CD1  . ILE A 1 42 ? -3.707  -1.673  0.280   1.00 0.00 ? 42 ILE A CD1  8  
ATOM 8444  H H    . ILE A 1 42 ? -6.523  -2.420  3.674   1.00 0.00 ? 42 ILE A H    8  
ATOM 8445  H HA   . ILE A 1 42 ? -4.284  -4.317  3.051   1.00 0.00 ? 42 ILE A HA   8  
ATOM 8446  H HB   . ILE A 1 42 ? -4.272  -1.284  3.366   1.00 0.00 ? 42 ILE A HB   8  
ATOM 8447  H HG12 . ILE A 1 42 ? -5.125  -2.976  1.108   1.00 0.00 ? 42 ILE A HG12 8  
ATOM 8448  H HG13 . ILE A 1 42 ? -5.407  -1.273  1.482   1.00 0.00 ? 42 ILE A HG13 8  
ATOM 8449  H HG21 . ILE A 1 42 ? -2.128  -3.156  2.269   1.00 0.00 ? 42 ILE A HG21 8  
ATOM 8450  H HG22 . ILE A 1 42 ? -2.038  -1.381  2.317   1.00 0.00 ? 42 ILE A HG22 8  
ATOM 8451  H HG23 . ILE A 1 42 ? -2.077  -2.267  3.811   1.00 0.00 ? 42 ILE A HG23 8  
ATOM 8452  H HD11 . ILE A 1 42 ? -3.212  -0.729  0.502   1.00 0.00 ? 42 ILE A HD11 8  
ATOM 8453  H HD12 . ILE A 1 42 ? -2.979  -2.475  0.157   1.00 0.00 ? 42 ILE A HD12 8  
ATOM 8454  H HD13 . ILE A 1 42 ? -4.289  -1.563  -0.629  1.00 0.00 ? 42 ILE A HD13 8  
ATOM 8455  N N    . PRO A 1 43 ? -3.230  -4.109  5.474   1.00 0.00 ? 43 PRO A N    8  
ATOM 8456  C CA   . PRO A 1 43 ? -2.801  -4.013  6.866   1.00 0.00 ? 43 PRO A CA   8  
ATOM 8457  C C    . PRO A 1 43 ? -2.370  -2.578  7.169   1.00 0.00 ? 43 PRO A C    8  
ATOM 8458  O O    . PRO A 1 43 ? -1.740  -1.950  6.317   1.00 0.00 ? 43 PRO A O    8  
ATOM 8459  C CB   . PRO A 1 43 ? -1.616  -4.977  6.999   1.00 0.00 ? 43 PRO A CB   8  
ATOM 8460  C CG   . PRO A 1 43 ? -1.699  -5.861  5.754   1.00 0.00 ? 43 PRO A CG   8  
ATOM 8461  C CD   . PRO A 1 43 ? -2.318  -4.939  4.712   1.00 0.00 ? 43 PRO A CD   8  
ATOM 8462  H HA   . PRO A 1 43 ? -3.619  -4.311  7.526   1.00 0.00 ? 43 PRO A HA   8  
ATOM 8463  H HB2  . PRO A 1 43 ? -0.675  -4.429  7.003   1.00 0.00 ? 43 PRO A HB2  8  
ATOM 8464  H HB3  . PRO A 1 43 ? -1.701  -5.568  7.904   1.00 0.00 ? 43 PRO A HB3  8  
ATOM 8465  H HG2  . PRO A 1 43 ? -0.728  -6.228  5.436   1.00 0.00 ? 43 PRO A HG2  8  
ATOM 8466  H HG3  . PRO A 1 43 ? -2.362  -6.690  5.964   1.00 0.00 ? 43 PRO A HG3  8  
ATOM 8467  H HD2  . PRO A 1 43 ? -1.533  -4.327  4.280   1.00 0.00 ? 43 PRO A HD2  8  
ATOM 8468  H HD3  . PRO A 1 43 ? -2.819  -5.478  3.907   1.00 0.00 ? 43 PRO A HD3  8  
ATOM 8469  N N    . HIS A 1 44 ? -2.642  -2.073  8.376   1.00 0.00 ? 44 HIS A N    8  
ATOM 8470  C CA   . HIS A 1 44 ? -2.235  -0.722  8.760   1.00 0.00 ? 44 HIS A CA   8  
ATOM 8471  C C    . HIS A 1 44 ? -0.720  -0.627  8.646   1.00 0.00 ? 44 HIS A C    8  
ATOM 8472  O O    . HIS A 1 44 ? -0.207  0.289   8.015   1.00 0.00 ? 44 HIS A O    8  
ATOM 8473  C CB   . HIS A 1 44 ? -2.711  -0.380  10.183  1.00 0.00 ? 44 HIS A CB   8  
ATOM 8474  C CG   . HIS A 1 44 ? -2.475  1.056   10.601  1.00 0.00 ? 44 HIS A CG   8  
ATOM 8475  N ND1  . HIS A 1 44 ? -3.434  1.927   11.072  1.00 0.00 ? 44 HIS A ND1  8  
ATOM 8476  C CD2  . HIS A 1 44 ? -1.270  1.709   10.662  1.00 0.00 ? 44 HIS A CD2  8  
ATOM 8477  C CE1  . HIS A 1 44 ? -2.822  3.083   11.378  1.00 0.00 ? 44 HIS A CE1  8  
ATOM 8478  N NE2  . HIS A 1 44 ? -1.505  2.997   11.147  1.00 0.00 ? 44 HIS A NE2  8  
ATOM 8479  H H    . HIS A 1 44 ? -3.247  -2.598  9.002   1.00 0.00 ? 44 HIS A H    8  
ATOM 8480  H HA   . HIS A 1 44 ? -2.680  -0.012  8.061   1.00 0.00 ? 44 HIS A HA   8  
ATOM 8481  H HB2  . HIS A 1 44 ? -3.778  -0.590  10.254  1.00 0.00 ? 44 HIS A HB2  8  
ATOM 8482  H HB3  . HIS A 1 44 ? -2.195  -1.019  10.895  1.00 0.00 ? 44 HIS A HB3  8  
ATOM 8483  H HD1  . HIS A 1 44 ? -4.415  1.737   11.258  1.00 0.00 ? 44 HIS A HD1  8  
ATOM 8484  H HD2  . HIS A 1 44 ? -0.299  1.309   10.406  1.00 0.00 ? 44 HIS A HD2  8  
ATOM 8485  H HE1  . HIS A 1 44 ? -3.315  3.950   11.795  1.00 0.00 ? 44 HIS A HE1  8  
ATOM 8486  N N    . SER A 1 45 ? -0.017  -1.595  9.236   1.00 0.00 ? 45 SER A N    8  
ATOM 8487  C CA   . SER A 1 45 ? 1.432   -1.680  9.282   1.00 0.00 ? 45 SER A CA   8  
ATOM 8488  C C    . SER A 1 45 ? 2.034   -1.530  7.881   1.00 0.00 ? 45 SER A C    8  
ATOM 8489  O O    . SER A 1 45 ? 2.948   -0.723  7.682   1.00 0.00 ? 45 SER A O    8  
ATOM 8490  C CB   . SER A 1 45 ? 1.801   -3.028  9.913   1.00 0.00 ? 45 SER A CB   8  
ATOM 8491  O OG   . SER A 1 45 ? 0.912   -3.383  10.962  1.00 0.00 ? 45 SER A OG   8  
ATOM 8492  H H    . SER A 1 45 ? -0.508  -2.321  9.736   1.00 0.00 ? 45 SER A H    8  
ATOM 8493  H HA   . SER A 1 45 ? 1.804   -0.873  9.910   1.00 0.00 ? 45 SER A HA   8  
ATOM 8494  H HB2  . SER A 1 45 ? 1.737   -3.799  9.146   1.00 0.00 ? 45 SER A HB2  8  
ATOM 8495  H HB3  . SER A 1 45 ? 2.820   -2.995  10.290  1.00 0.00 ? 45 SER A HB3  8  
ATOM 8496  H HG   . SER A 1 45 ? 0.948   -2.699  11.668  1.00 0.00 ? 45 SER A HG   8  
ATOM 8497  N N    . THR A 1 46 ? 1.487   -2.281  6.919   1.00 0.00 ? 46 THR A N    8  
ATOM 8498  C CA   . THR A 1 46 ? 1.856   -2.206  5.524   1.00 0.00 ? 46 THR A CA   8  
ATOM 8499  C C    . THR A 1 46 ? 1.527   -0.830  4.964   1.00 0.00 ? 46 THR A C    8  
ATOM 8500  O O    . THR A 1 46 ? 2.435   -0.128  4.540   1.00 0.00 ? 46 THR A O    8  
ATOM 8501  C CB   . THR A 1 46 ? 1.100   -3.311  4.776   1.00 0.00 ? 46 THR A CB   8  
ATOM 8502  O OG1  . THR A 1 46 ? 1.378   -4.570  5.350   1.00 0.00 ? 46 THR A OG1  8  
ATOM 8503  C CG2  . THR A 1 46 ? 1.349   -3.355  3.272   1.00 0.00 ? 46 THR A CG2  8  
ATOM 8504  H H    . THR A 1 46 ? 0.771   -2.968  7.120   1.00 0.00 ? 46 THR A H    8  
ATOM 8505  H HA   . THR A 1 46 ? 2.934   -2.343  5.454   1.00 0.00 ? 46 THR A HA   8  
ATOM 8506  H HB   . THR A 1 46 ? 0.038   -3.122  4.911   1.00 0.00 ? 46 THR A HB   8  
ATOM 8507  H HG1  . THR A 1 46 ? 1.273   -5.244  4.656   1.00 0.00 ? 46 THR A HG1  8  
ATOM 8508  H HG21 . THR A 1 46 ? 1.182   -2.376  2.830   1.00 0.00 ? 46 THR A HG21 8  
ATOM 8509  H HG22 . THR A 1 46 ? 2.364   -3.690  3.058   1.00 0.00 ? 46 THR A HG22 8  
ATOM 8510  H HG23 . THR A 1 46 ? 0.634   -4.038  2.826   1.00 0.00 ? 46 THR A HG23 8  
ATOM 8511  N N    . LEU A 1 47 ? 0.248   -0.444  4.923   1.00 0.00 ? 47 LEU A N    8  
ATOM 8512  C CA   . LEU A 1 47 ? -0.212  0.769   4.268   1.00 0.00 ? 47 LEU A CA   8  
ATOM 8513  C C    . LEU A 1 47 ? 0.620   1.954   4.727   1.00 0.00 ? 47 LEU A C    8  
ATOM 8514  O O    . LEU A 1 47 ? 1.103   2.707   3.894   1.00 0.00 ? 47 LEU A O    8  
ATOM 8515  C CB   . LEU A 1 47 ? -1.696  1.016   4.571   1.00 0.00 ? 47 LEU A CB   8  
ATOM 8516  C CG   . LEU A 1 47 ? -2.226  2.249   3.814   1.00 0.00 ? 47 LEU A CG   8  
ATOM 8517  C CD1  . LEU A 1 47 ? -2.458  1.926   2.343   1.00 0.00 ? 47 LEU A CD1  8  
ATOM 8518  C CD2  . LEU A 1 47 ? -3.587  2.628   4.370   1.00 0.00 ? 47 LEU A CD2  8  
ATOM 8519  H H    . LEU A 1 47 ? -0.454  -1.046  5.324   1.00 0.00 ? 47 LEU A H    8  
ATOM 8520  H HA   . LEU A 1 47 ? -0.074  0.644   3.195   1.00 0.00 ? 47 LEU A HA   8  
ATOM 8521  H HB2  . LEU A 1 47 ? -2.288  0.142   4.290   1.00 0.00 ? 47 LEU A HB2  8  
ATOM 8522  H HB3  . LEU A 1 47 ? -1.812  1.171   5.644   1.00 0.00 ? 47 LEU A HB3  8  
ATOM 8523  H HG   . LEU A 1 47 ? -1.563  3.116   3.912   1.00 0.00 ? 47 LEU A HG   8  
ATOM 8524  H HD11 . LEU A 1 47 ? -3.200  1.130   2.263   1.00 0.00 ? 47 LEU A HD11 8  
ATOM 8525  H HD12 . LEU A 1 47 ? -2.835  2.821   1.851   1.00 0.00 ? 47 LEU A HD12 8  
ATOM 8526  H HD13 . LEU A 1 47 ? -1.532  1.620   1.862   1.00 0.00 ? 47 LEU A HD13 8  
ATOM 8527  H HD21 . LEU A 1 47 ? -4.270  1.787   4.272   1.00 0.00 ? 47 LEU A HD21 8  
ATOM 8528  H HD22 . LEU A 1 47 ? -3.486  2.899   5.416   1.00 0.00 ? 47 LEU A HD22 8  
ATOM 8529  H HD23 . LEU A 1 47 ? -3.966  3.473   3.800   1.00 0.00 ? 47 LEU A HD23 8  
ATOM 8530  N N    . GLU A 1 48 ? 0.813   2.091   6.036   1.00 0.00 ? 48 GLU A N    8  
ATOM 8531  C CA   . GLU A 1 48 ? 1.586   3.138   6.650   1.00 0.00 ? 48 GLU A CA   8  
ATOM 8532  C C    . GLU A 1 48 ? 2.974   3.208   6.002   1.00 0.00 ? 48 GLU A C    8  
ATOM 8533  O O    . GLU A 1 48 ? 3.320   4.215   5.387   1.00 0.00 ? 48 GLU A O    8  
ATOM 8534  C CB   . GLU A 1 48 ? 1.645   2.844   8.154   1.00 0.00 ? 48 GLU A CB   8  
ATOM 8535  C CG   . GLU A 1 48 ? 2.101   4.119   8.848   1.00 0.00 ? 48 GLU A CG   8  
ATOM 8536  C CD   . GLU A 1 48 ? 2.312   3.980   10.347  1.00 0.00 ? 48 GLU A CD   8  
ATOM 8537  O OE1  . GLU A 1 48 ? 3.092   3.100   10.770  1.00 0.00 ? 48 GLU A OE1  8  
ATOM 8538  O OE2  . GLU A 1 48 ? 1.795   4.823   11.117  1.00 0.00 ? 48 GLU A OE2  8  
ATOM 8539  H H    . GLU A 1 48 ? 0.439   1.406   6.683   1.00 0.00 ? 48 GLU A H    8  
ATOM 8540  H HA   . GLU A 1 48 ? 1.065   4.084   6.486   1.00 0.00 ? 48 GLU A HA   8  
ATOM 8541  H HB2  . GLU A 1 48 ? 0.659   2.583   8.528   1.00 0.00 ? 48 GLU A HB2  8  
ATOM 8542  H HB3  . GLU A 1 48 ? 2.322   2.005   8.344   1.00 0.00 ? 48 GLU A HB3  8  
ATOM 8543  H HG2  . GLU A 1 48 ? 3.043   4.389   8.404   1.00 0.00 ? 48 GLU A HG2  8  
ATOM 8544  H HG3  . GLU A 1 48 ? 1.378   4.910   8.646   1.00 0.00 ? 48 GLU A HG3  8  
ATOM 8545  N N    . TYR A 1 49 ? 3.743   2.119   6.084   1.00 0.00 ? 49 TYR A N    8  
ATOM 8546  C CA   . TYR A 1 49 ? 5.048   1.982   5.447   1.00 0.00 ? 49 TYR A CA   8  
ATOM 8547  C C    . TYR A 1 49 ? 4.963   2.351   3.967   1.00 0.00 ? 49 TYR A C    8  
ATOM 8548  O O    . TYR A 1 49 ? 5.763   3.139   3.483   1.00 0.00 ? 49 TYR A O    8  
ATOM 8549  C CB   . TYR A 1 49 ? 5.531   0.532   5.643   1.00 0.00 ? 49 TYR A CB   8  
ATOM 8550  C CG   . TYR A 1 49 ? 6.669   0.057   4.760   1.00 0.00 ? 49 TYR A CG   8  
ATOM 8551  C CD1  . TYR A 1 49 ? 6.382   -0.392  3.458   1.00 0.00 ? 49 TYR A CD1  8  
ATOM 8552  C CD2  . TYR A 1 49 ? 7.988   -0.016  5.244   1.00 0.00 ? 49 TYR A CD2  8  
ATOM 8553  C CE1  . TYR A 1 49 ? 7.387   -0.928  2.637   1.00 0.00 ? 49 TYR A CE1  8  
ATOM 8554  C CE2  . TYR A 1 49 ? 9.001   -0.554  4.430   1.00 0.00 ? 49 TYR A CE2  8  
ATOM 8555  C CZ   . TYR A 1 49 ? 8.704   -1.023  3.130   1.00 0.00 ? 49 TYR A CZ   8  
ATOM 8556  O OH   . TYR A 1 49 ? 9.692   -1.556  2.361   1.00 0.00 ? 49 TYR A OH   8  
ATOM 8557  H H    . TYR A 1 49 ? 3.326   1.288   6.489   1.00 0.00 ? 49 TYR A H    8  
ATOM 8558  H HA   . TYR A 1 49 ? 5.753   2.676   5.915   1.00 0.00 ? 49 TYR A HA   8  
ATOM 8559  H HB2  . TYR A 1 49 ? 5.799   0.390   6.682   1.00 0.00 ? 49 TYR A HB2  8  
ATOM 8560  H HB3  . TYR A 1 49 ? 4.701   -0.147  5.466   1.00 0.00 ? 49 TYR A HB3  8  
ATOM 8561  H HD1  . TYR A 1 49 ? 5.369   -0.325  3.088   1.00 0.00 ? 49 TYR A HD1  8  
ATOM 8562  H HD2  . TYR A 1 49 ? 8.236   0.335   6.237   1.00 0.00 ? 49 TYR A HD2  8  
ATOM 8563  H HE1  . TYR A 1 49 ? 7.144   -1.255  1.631   1.00 0.00 ? 49 TYR A HE1  8  
ATOM 8564  H HE2  . TYR A 1 49 ? 10.009  -0.607  4.806   1.00 0.00 ? 49 TYR A HE2  8  
ATOM 8565  H HH   . TYR A 1 49 ? 9.384   -1.838  1.488   1.00 0.00 ? 49 TYR A HH   8  
ATOM 8566  N N    . LYS A 1 50 ? 4.011   1.783   3.230   1.00 0.00 ? 50 LYS A N    8  
ATOM 8567  C CA   . LYS A 1 50 ? 3.949   1.864   1.783   1.00 0.00 ? 50 LYS A CA   8  
ATOM 8568  C C    . LYS A 1 50 ? 3.655   3.304   1.329   1.00 0.00 ? 50 LYS A C    8  
ATOM 8569  O O    . LYS A 1 50 ? 4.254   3.745   0.347   1.00 0.00 ? 50 LYS A O    8  
ATOM 8570  C CB   . LYS A 1 50 ? 2.888   0.867   1.309   1.00 0.00 ? 50 LYS A CB   8  
ATOM 8571  C CG   . LYS A 1 50 ? 3.191   -0.628  1.458   1.00 0.00 ? 50 LYS A CG   8  
ATOM 8572  C CD   . LYS A 1 50 ? 4.281   -1.182  0.538   1.00 0.00 ? 50 LYS A CD   8  
ATOM 8573  C CE   . LYS A 1 50 ? 4.055   -2.693  0.415   1.00 0.00 ? 50 LYS A CE   8  
ATOM 8574  N NZ   . LYS A 1 50 ? 4.939   -3.337  -0.572  1.00 0.00 ? 50 LYS A NZ   8  
ATOM 8575  H H    . LYS A 1 50 ? 3.332   1.187   3.692   1.00 0.00 ? 50 LYS A H    8  
ATOM 8576  H HA   . LYS A 1 50 ? 4.917   1.568   1.372   1.00 0.00 ? 50 LYS A HA   8  
ATOM 8577  H HB2  . LYS A 1 50 ? 1.990   1.035   1.904   1.00 0.00 ? 50 LYS A HB2  8  
ATOM 8578  H HB3  . LYS A 1 50 ? 2.704   1.056   0.258   1.00 0.00 ? 50 LYS A HB3  8  
ATOM 8579  H HG2  . LYS A 1 50 ? 3.446   -0.863  2.489   1.00 0.00 ? 50 LYS A HG2  8  
ATOM 8580  H HG3  . LYS A 1 50 ? 2.266   -1.154  1.233   1.00 0.00 ? 50 LYS A HG3  8  
ATOM 8581  H HD2  . LYS A 1 50 ? 4.264   -0.702  -0.432  1.00 0.00 ? 50 LYS A HD2  8  
ATOM 8582  H HD3  . LYS A 1 50 ? 5.249   -0.975  0.958   1.00 0.00 ? 50 LYS A HD3  8  
ATOM 8583  H HE2  . LYS A 1 50 ? 4.215   -3.145  1.393   1.00 0.00 ? 50 LYS A HE2  8  
ATOM 8584  H HE3  . LYS A 1 50 ? 3.019   -2.870  0.120   1.00 0.00 ? 50 LYS A HE3  8  
ATOM 8585  H HZ1  . LYS A 1 50 ? 5.909   -3.297  -0.268  1.00 0.00 ? 50 LYS A HZ1  8  
ATOM 8586  H HZ2  . LYS A 1 50 ? 4.695   -4.319  -0.656  1.00 0.00 ? 50 LYS A HZ2  8  
ATOM 8587  H HZ3  . LYS A 1 50 ? 4.859   -2.891  -1.481  1.00 0.00 ? 50 LYS A HZ3  8  
ATOM 8588  N N    . VAL A 1 51 ? 2.819   4.057   2.057   1.00 0.00 ? 51 VAL A N    8  
ATOM 8589  C CA   . VAL A 1 51 ? 2.651   5.508   1.933   1.00 0.00 ? 51 VAL A CA   8  
ATOM 8590  C C    . VAL A 1 51 ? 4.022   6.166   2.127   1.00 0.00 ? 51 VAL A C    8  
ATOM 8591  O O    . VAL A 1 51 ? 4.506   6.885   1.255   1.00 0.00 ? 51 VAL A O    8  
ATOM 8592  C CB   . VAL A 1 51 ? 1.613   5.998   2.982   1.00 0.00 ? 51 VAL A CB   8  
ATOM 8593  C CG1  . VAL A 1 51 ? 1.454   7.517   3.059   1.00 0.00 ? 51 VAL A CG1  8  
ATOM 8594  C CG2  . VAL A 1 51 ? 0.186   5.473   2.777   1.00 0.00 ? 51 VAL A CG2  8  
ATOM 8595  H H    . VAL A 1 51 ? 2.359   3.630   2.857   1.00 0.00 ? 51 VAL A H    8  
ATOM 8596  H HA   . VAL A 1 51 ? 2.304   5.758   0.933   1.00 0.00 ? 51 VAL A HA   8  
ATOM 8597  H HB   . VAL A 1 51 ? 1.936   5.663   3.963   1.00 0.00 ? 51 VAL A HB   8  
ATOM 8598  H HG11 . VAL A 1 51 ? 1.114   7.910   2.104   1.00 0.00 ? 51 VAL A HG11 8  
ATOM 8599  H HG12 . VAL A 1 51 ? 0.714   7.758   3.824   1.00 0.00 ? 51 VAL A HG12 8  
ATOM 8600  H HG13 . VAL A 1 51 ? 2.396   7.980   3.340   1.00 0.00 ? 51 VAL A HG13 8  
ATOM 8601  H HG21 . VAL A 1 51 ? -0.359  5.610   3.713   1.00 0.00 ? 51 VAL A HG21 8  
ATOM 8602  H HG22 . VAL A 1 51 ? -0.316  6.007   1.972   1.00 0.00 ? 51 VAL A HG22 8  
ATOM 8603  H HG23 . VAL A 1 51 ? 0.189   4.418   2.544   1.00 0.00 ? 51 VAL A HG23 8  
ATOM 8604  N N    . LYS A 1 52 ? 4.658   5.911   3.267   1.00 0.00 ? 52 LYS A N    8  
ATOM 8605  C CA   . LYS A 1 52 ? 5.878   6.573   3.743   1.00 0.00 ? 52 LYS A CA   8  
ATOM 8606  C C    . LYS A 1 52 ? 7.109   6.217   2.935   1.00 0.00 ? 52 LYS A C    8  
ATOM 8607  O O    . LYS A 1 52 ? 8.144   6.868   3.053   1.00 0.00 ? 52 LYS A O    8  
ATOM 8608  C CB   . LYS A 1 52 ? 6.038   6.200   5.216   1.00 0.00 ? 52 LYS A CB   8  
ATOM 8609  C CG   . LYS A 1 52 ? 4.950   6.941   6.003   1.00 0.00 ? 52 LYS A CG   8  
ATOM 8610  C CD   . LYS A 1 52 ? 4.594   6.257   7.318   1.00 0.00 ? 52 LYS A CD   8  
ATOM 8611  C CE   . LYS A 1 52 ? 5.439   6.657   8.528   1.00 0.00 ? 52 LYS A CE   8  
ATOM 8612  N NZ   . LYS A 1 52 ? 6.874   6.348   8.354   1.00 0.00 ? 52 LYS A NZ   8  
ATOM 8613  H H    . LYS A 1 52 ? 4.209   5.276   3.923   1.00 0.00 ? 52 LYS A H    8  
ATOM 8614  H HA   . LYS A 1 52 ? 5.766   7.650   3.675   1.00 0.00 ? 52 LYS A HA   8  
ATOM 8615  H HB2  . LYS A 1 52 ? 5.923   5.121   5.316   1.00 0.00 ? 52 LYS A HB2  8  
ATOM 8616  H HB3  . LYS A 1 52 ? 7.016   6.471   5.597   1.00 0.00 ? 52 LYS A HB3  8  
ATOM 8617  H HG2  . LYS A 1 52 ? 5.242   7.976   6.176   1.00 0.00 ? 52 LYS A HG2  8  
ATOM 8618  H HG3  . LYS A 1 52 ? 4.048   6.934   5.394   1.00 0.00 ? 52 LYS A HG3  8  
ATOM 8619  H HD2  . LYS A 1 52 ? 3.544   6.487   7.521   1.00 0.00 ? 52 LYS A HD2  8  
ATOM 8620  H HD3  . LYS A 1 52 ? 4.685   5.184   7.179   1.00 0.00 ? 52 LYS A HD3  8  
ATOM 8621  H HE2  . LYS A 1 52 ? 5.315   7.725   8.720   1.00 0.00 ? 52 LYS A HE2  8  
ATOM 8622  H HE3  . LYS A 1 52 ? 5.064   6.115   9.398   1.00 0.00 ? 52 LYS A HE3  8  
ATOM 8623  H HZ1  . LYS A 1 52 ? 7.318   6.277   9.262   1.00 0.00 ? 52 LYS A HZ1  8  
ATOM 8624  H HZ2  . LYS A 1 52 ? 7.025   5.477   7.850   1.00 0.00 ? 52 LYS A HZ2  8  
ATOM 8625  H HZ3  . LYS A 1 52 ? 7.328   7.097   7.840   1.00 0.00 ? 52 LYS A HZ3  8  
ATOM 8626  N N    . GLU A 1 53 ? 7.007   5.186   2.119   1.00 0.00 ? 53 GLU A N    8  
ATOM 8627  C CA   . GLU A 1 53 ? 7.952   4.799   1.110   1.00 0.00 ? 53 GLU A CA   8  
ATOM 8628  C C    . GLU A 1 53 ? 7.771   5.720   -0.089  1.00 0.00 ? 53 GLU A C    8  
ATOM 8629  O O    . GLU A 1 53 ? 8.691   6.441   -0.482  1.00 0.00 ? 53 GLU A O    8  
ATOM 8630  C CB   . GLU A 1 53 ? 7.687   3.336   0.742   1.00 0.00 ? 53 GLU A CB   8  
ATOM 8631  C CG   . GLU A 1 53 ? 8.393   2.276   1.584   1.00 0.00 ? 53 GLU A CG   8  
ATOM 8632  C CD   . GLU A 1 53 ? 9.915   2.389   1.697   1.00 0.00 ? 53 GLU A CD   8  
ATOM 8633  O OE1  . GLU A 1 53 ? 10.412  3.243   2.474   1.00 0.00 ? 53 GLU A OE1  8  
ATOM 8634  O OE2  . GLU A 1 53 ? 10.629  1.541   1.106   1.00 0.00 ? 53 GLU A OE2  8  
ATOM 8635  H H    . GLU A 1 53 ? 6.160   4.643   2.203   1.00 0.00 ? 53 GLU A H    8  
ATOM 8636  H HA   . GLU A 1 53 ? 8.952   4.918   1.491   1.00 0.00 ? 53 GLU A HA   8  
ATOM 8637  H HB2  . GLU A 1 53 ? 6.621   3.141   0.802   1.00 0.00 ? 53 GLU A HB2  8  
ATOM 8638  H HB3  . GLU A 1 53 ? 7.941   3.190   -0.282  1.00 0.00 ? 53 GLU A HB3  8  
ATOM 8639  H HG2  . GLU A 1 53 ? 7.982   2.352   2.572   1.00 0.00 ? 53 GLU A HG2  8  
ATOM 8640  H HG3  . GLU A 1 53 ? 8.133   1.297   1.181   1.00 0.00 ? 53 GLU A HG3  8  
ATOM 8641  N N    . ARG A 1 54 ? 6.569   5.711   -0.676  1.00 0.00 ? 54 ARG A N    8  
ATOM 8642  C CA   . ARG A 1 54 ? 6.211   6.440   -1.869  1.00 0.00 ? 54 ARG A CA   8  
ATOM 8643  C C    . ARG A 1 54 ? 6.356   7.954   -1.642  1.00 0.00 ? 54 ARG A C    8  
ATOM 8644  O O    . ARG A 1 54 ? 6.586   8.696   -2.595  1.00 0.00 ? 54 ARG A O    8  
ATOM 8645  C CB   . ARG A 1 54 ? 4.794   5.955   -2.213  1.00 0.00 ? 54 ARG A CB   8  
ATOM 8646  C CG   . ARG A 1 54 ? 4.053   6.820   -3.214  1.00 0.00 ? 54 ARG A CG   8  
ATOM 8647  C CD   . ARG A 1 54 ? 4.490   6.672   -4.673  1.00 0.00 ? 54 ARG A CD   8  
ATOM 8648  N NE   . ARG A 1 54 ? 4.005   7.790   -5.498  1.00 0.00 ? 54 ARG A NE   8  
ATOM 8649  C CZ   . ARG A 1 54 ? 2.749   8.069   -5.876  1.00 0.00 ? 54 ARG A CZ   8  
ATOM 8650  N NH1  . ARG A 1 54 ? 1.710   7.318   -5.530  1.00 0.00 ? 54 ARG A NH1  8  
ATOM 8651  N NH2  . ARG A 1 54 ? 2.516   9.144   -6.608  1.00 0.00 ? 54 ARG A NH2  8  
ATOM 8652  H H    . ARG A 1 54 ? 5.772   5.233   -0.274  1.00 0.00 ? 54 ARG A H    8  
ATOM 8653  H HA   . ARG A 1 54 ? 6.878   6.138   -2.672  1.00 0.00 ? 54 ARG A HA   8  
ATOM 8654  H HB2  . ARG A 1 54 ? 4.836   4.930   -2.582  1.00 0.00 ? 54 ARG A HB2  8  
ATOM 8655  H HB3  . ARG A 1 54 ? 4.197   5.952   -1.301  1.00 0.00 ? 54 ARG A HB3  8  
ATOM 8656  H HG2  . ARG A 1 54 ? 3.012   6.554   -3.141  1.00 0.00 ? 54 ARG A HG2  8  
ATOM 8657  H HG3  . ARG A 1 54 ? 4.160   7.840   -2.880  1.00 0.00 ? 54 ARG A HG3  8  
ATOM 8658  H HD2  . ARG A 1 54 ? 5.580   6.666   -4.722  1.00 0.00 ? 54 ARG A HD2  8  
ATOM 8659  H HD3  . ARG A 1 54 ? 4.118   5.728   -5.073  1.00 0.00 ? 54 ARG A HD3  8  
ATOM 8660  H HE   . ARG A 1 54 ? 4.751   8.333   -5.926  1.00 0.00 ? 54 ARG A HE   8  
ATOM 8661  H HH11 . ARG A 1 54 ? 1.824   6.458   -4.989  1.00 0.00 ? 54 ARG A HH11 8  
ATOM 8662  H HH12 . ARG A 1 54 ? 0.779   7.527   -5.863  1.00 0.00 ? 54 ARG A HH12 8  
ATOM 8663  H HH21 . ARG A 1 54 ? 3.258   9.811   -6.819  1.00 0.00 ? 54 ARG A HH21 8  
ATOM 8664  H HH22 . ARG A 1 54 ? 1.571   9.344   -6.933  1.00 0.00 ? 54 ARG A HH22 8  
ATOM 8665  N N    . LEU A 1 55 ? 6.281   8.419   -0.391  1.00 0.00 ? 55 LEU A N    8  
ATOM 8666  C CA   . LEU A 1 55 ? 6.579   9.792   0.020   1.00 0.00 ? 55 LEU A CA   8  
ATOM 8667  C C    . LEU A 1 55 ? 8.030   10.207  -0.259  1.00 0.00 ? 55 LEU A C    8  
ATOM 8668  O O    . LEU A 1 55 ? 8.336   11.396  -0.151  1.00 0.00 ? 55 LEU A O    8  
ATOM 8669  C CB   . LEU A 1 55 ? 6.218   9.991   1.507   1.00 0.00 ? 55 LEU A CB   8  
ATOM 8670  C CG   . LEU A 1 55 ? 4.740   10.385  1.697   1.00 0.00 ? 55 LEU A CG   8  
ATOM 8671  C CD1  . LEU A 1 55 ? 4.281   10.213  3.144   1.00 0.00 ? 55 LEU A CD1  8  
ATOM 8672  C CD2  . LEU A 1 55 ? 4.476   11.838  1.274   1.00 0.00 ? 55 LEU A CD2  8  
ATOM 8673  H H    . LEU A 1 55 ? 6.003   7.759   0.327   1.00 0.00 ? 55 LEU A H    8  
ATOM 8674  H HA   . LEU A 1 55 ? 5.960   10.451  -0.587  1.00 0.00 ? 55 LEU A HA   8  
ATOM 8675  H HB2  . LEU A 1 55 ? 6.430   9.068   2.046   1.00 0.00 ? 55 LEU A HB2  8  
ATOM 8676  H HB3  . LEU A 1 55 ? 6.849   10.766  1.944   1.00 0.00 ? 55 LEU A HB3  8  
ATOM 8677  H HG   . LEU A 1 55 ? 4.129   9.724   1.089   1.00 0.00 ? 55 LEU A HG   8  
ATOM 8678  H HD11 . LEU A 1 55 ? 4.848   10.868  3.805   1.00 0.00 ? 55 LEU A HD11 8  
ATOM 8679  H HD12 . LEU A 1 55 ? 3.220   10.451  3.227   1.00 0.00 ? 55 LEU A HD12 8  
ATOM 8680  H HD13 . LEU A 1 55 ? 4.414   9.178   3.449   1.00 0.00 ? 55 LEU A HD13 8  
ATOM 8681  H HD21 . LEU A 1 55 ? 3.427   12.081  1.440   1.00 0.00 ? 55 LEU A HD21 8  
ATOM 8682  H HD22 . LEU A 1 55 ? 5.089   12.519  1.866   1.00 0.00 ? 55 LEU A HD22 8  
ATOM 8683  H HD23 . LEU A 1 55 ? 4.697   11.986  0.219   1.00 0.00 ? 55 LEU A HD23 8  
ATOM 8684  N N    . GLY A 1 56 ? 8.906   9.290   -0.682  1.00 0.00 ? 56 GLY A N    8  
ATOM 8685  C CA   . GLY A 1 56 ? 10.159  9.615   -1.348  1.00 0.00 ? 56 GLY A CA   8  
ATOM 8686  C C    . GLY A 1 56 ? 11.393  9.112   -0.613  1.00 0.00 ? 56 GLY A C    8  
ATOM 8687  O O    . GLY A 1 56 ? 12.482  9.627   -0.862  1.00 0.00 ? 56 GLY A O    8  
ATOM 8688  H H    . GLY A 1 56 ? 8.626   8.315   -0.687  1.00 0.00 ? 56 GLY A H    8  
ATOM 8689  H HA2  . GLY A 1 56 ? 10.145  9.160   -2.338  1.00 0.00 ? 56 GLY A HA2  8  
ATOM 8690  H HA3  . GLY A 1 56 ? 10.250  10.693  -1.482  1.00 0.00 ? 56 GLY A HA3  8  
ATOM 8691  N N    . THR A 1 57 ? 11.279  8.150   0.304   1.00 0.00 ? 57 THR A N    8  
ATOM 8692  C CA   . THR A 1 57 ? 12.472  7.516   0.884   1.00 0.00 ? 57 THR A CA   8  
ATOM 8693  C C    . THR A 1 57 ? 13.211  6.738   -0.212  1.00 0.00 ? 57 THR A C    8  
ATOM 8694  O O    . THR A 1 57 ? 14.441  6.687   -0.241  1.00 0.00 ? 57 THR A O    8  
ATOM 8695  C CB   . THR A 1 57 ? 12.062  6.576   2.026   1.00 0.00 ? 57 THR A CB   8  
ATOM 8696  O OG1  . THR A 1 57 ? 11.137  5.652   1.499   1.00 0.00 ? 57 THR A OG1  8  
ATOM 8697  C CG2  . THR A 1 57 ? 11.389  7.357   3.155   1.00 0.00 ? 57 THR A CG2  8  
ATOM 8698  H H    . THR A 1 57 ? 10.390  7.679   0.459   1.00 0.00 ? 57 THR A H    8  
ATOM 8699  H HA   . THR A 1 57 ? 13.142  8.279   1.284   1.00 0.00 ? 57 THR A HA   8  
ATOM 8700  H HB   . THR A 1 57 ? 12.941  6.054   2.407   1.00 0.00 ? 57 THR A HB   8  
ATOM 8701  H HG1  . THR A 1 57 ? 11.094  4.844   2.048   1.00 0.00 ? 57 THR A HG1  8  
ATOM 8702  H HG21 . THR A 1 57 ? 10.431  7.747   2.822   1.00 0.00 ? 57 THR A HG21 8  
ATOM 8703  H HG22 . THR A 1 57 ? 11.240  6.707   4.013   1.00 0.00 ? 57 THR A HG22 8  
ATOM 8704  H HG23 . THR A 1 57 ? 12.011  8.196   3.459   1.00 0.00 ? 57 THR A HG23 8  
ATOM 8705  N N    . LEU A 1 58 ? 12.434  6.168   -1.136  1.00 0.00 ? 58 LEU A N    8  
ATOM 8706  C CA   . LEU A 1 58 ? 12.827  5.255   -2.195  1.00 0.00 ? 58 LEU A CA   8  
ATOM 8707  C C    . LEU A 1 58 ? 13.950  5.864   -3.038  1.00 0.00 ? 58 LEU A C    8  
ATOM 8708  O O    . LEU A 1 58 ? 15.040  5.294   -3.086  1.00 0.00 ? 58 LEU A O    8  
ATOM 8709  C CB   . LEU A 1 58 ? 11.577  4.893   -3.027  1.00 0.00 ? 58 LEU A CB   8  
ATOM 8710  C CG   . LEU A 1 58 ? 10.465  4.181   -2.222  1.00 0.00 ? 58 LEU A CG   8  
ATOM 8711  C CD1  . LEU A 1 58 ? 9.097   4.315   -2.892  1.00 0.00 ? 58 LEU A CD1  8  
ATOM 8712  C CD2  . LEU A 1 58 ? 10.715  2.691   -2.039  1.00 0.00 ? 58 LEU A CD2  8  
ATOM 8713  H H    . LEU A 1 58 ? 11.443  6.246   -0.946  1.00 0.00 ? 58 LEU A H    8  
ATOM 8714  H HA   . LEU A 1 58 ? 13.212  4.343   -1.736  1.00 0.00 ? 58 LEU A HA   8  
ATOM 8715  H HB2  . LEU A 1 58 ? 11.165  5.813   -3.432  1.00 0.00 ? 58 LEU A HB2  8  
ATOM 8716  H HB3  . LEU A 1 58 ? 11.874  4.269   -3.870  1.00 0.00 ? 58 LEU A HB3  8  
ATOM 8717  H HG   . LEU A 1 58 ? 10.386  4.627   -1.234  1.00 0.00 ? 58 LEU A HG   8  
ATOM 8718  H HD11 . LEU A 1 58 ? 9.088   3.815   -3.859  1.00 0.00 ? 58 LEU A HD11 8  
ATOM 8719  H HD12 . LEU A 1 58 ? 8.339   3.871   -2.240  1.00 0.00 ? 58 LEU A HD12 8  
ATOM 8720  H HD13 . LEU A 1 58 ? 8.870   5.370   -3.023  1.00 0.00 ? 58 LEU A HD13 8  
ATOM 8721  H HD21 . LEU A 1 58 ? 9.881   2.283   -1.470  1.00 0.00 ? 58 LEU A HD21 8  
ATOM 8722  H HD22 . LEU A 1 58 ? 10.758  2.204   -3.012  1.00 0.00 ? 58 LEU A HD22 8  
ATOM 8723  H HD23 . LEU A 1 58 ? 11.641  2.532   -1.487  1.00 0.00 ? 58 LEU A HD23 8  
ATOM 8724  N N    . LYS A 1 59 ? 13.707  6.988   -3.726  1.00 0.00 ? 59 LYS A N    8  
ATOM 8725  C CA   . LYS A 1 59 ? 14.641  7.586   -4.690  1.00 0.00 ? 59 LYS A CA   8  
ATOM 8726  C C    . LYS A 1 59 ? 14.441  9.101   -4.756  1.00 0.00 ? 59 LYS A C    8  
ATOM 8727  O O    . LYS A 1 59 ? 14.305  9.656   -5.851  1.00 0.00 ? 59 LYS A O    8  
ATOM 8728  C CB   . LYS A 1 59 ? 14.449  6.953   -6.087  1.00 0.00 ? 59 LYS A CB   8  
ATOM 8729  C CG   . LYS A 1 59 ? 14.633  5.432   -6.138  1.00 0.00 ? 59 LYS A CG   8  
ATOM 8730  C CD   . LYS A 1 59 ? 14.600  4.926   -7.578  1.00 0.00 ? 59 LYS A CD   8  
ATOM 8731  C CE   . LYS A 1 59 ? 14.543  3.399   -7.553  1.00 0.00 ? 59 LYS A CE   8  
ATOM 8732  N NZ   . LYS A 1 59 ? 14.730  2.829   -8.896  1.00 0.00 ? 59 LYS A NZ   8  
ATOM 8733  H H    . LYS A 1 59 ? 12.788  7.415   -3.656  1.00 0.00 ? 59 LYS A H    8  
ATOM 8734  H HA   . LYS A 1 59 ? 15.677  7.416   -4.374  1.00 0.00 ? 59 LYS A HA   8  
ATOM 8735  H HB2  . LYS A 1 59 ? 13.447  7.188   -6.447  1.00 0.00 ? 59 LYS A HB2  8  
ATOM 8736  H HB3  . LYS A 1 59 ? 15.174  7.403   -6.769  1.00 0.00 ? 59 LYS A HB3  8  
ATOM 8737  H HG2  . LYS A 1 59 ? 15.594  5.166   -5.696  1.00 0.00 ? 59 LYS A HG2  8  
ATOM 8738  H HG3  . LYS A 1 59 ? 13.827  4.951   -5.584  1.00 0.00 ? 59 LYS A HG3  8  
ATOM 8739  H HD2  . LYS A 1 59 ? 13.715  5.314   -8.084  1.00 0.00 ? 59 LYS A HD2  8  
ATOM 8740  H HD3  . LYS A 1 59 ? 15.496  5.266   -8.100  1.00 0.00 ? 59 LYS A HD3  8  
ATOM 8741  H HE2  . LYS A 1 59 ? 15.316  3.018   -6.880  1.00 0.00 ? 59 LYS A HE2  8  
ATOM 8742  H HE3  . LYS A 1 59 ? 13.570  3.097   -7.169  1.00 0.00 ? 59 LYS A HE3  8  
ATOM 8743  H HZ1  . LYS A 1 59 ? 14.423  1.861   -8.921  1.00 0.00 ? 59 LYS A HZ1  8  
ATOM 8744  H HZ2  . LYS A 1 59 ? 14.174  3.335   -9.576  1.00 0.00 ? 59 LYS A HZ2  8  
ATOM 8745  H HZ3  . LYS A 1 59 ? 15.705  2.901   -9.174  1.00 0.00 ? 59 LYS A HZ3  8  
ATOM 8746  N N    . ASN A 1 60 ? 14.408  9.805   -3.623  1.00 0.00 ? 60 ASN A N    8  
ATOM 8747  C CA   . ASN A 1 60 ? 14.454  11.267  -3.631  1.00 0.00 ? 60 ASN A CA   8  
ATOM 8748  C C    . ASN A 1 60 ? 15.591  11.746  -2.727  1.00 0.00 ? 60 ASN A C    8  
ATOM 8749  O O    . ASN A 1 60 ? 15.346  12.102  -1.574  1.00 0.00 ? 60 ASN A O    8  
ATOM 8750  C CB   . ASN A 1 60 ? 13.109  11.922  -3.292  1.00 0.00 ? 60 ASN A CB   8  
ATOM 8751  C CG   . ASN A 1 60 ? 13.286  13.428  -3.418  1.00 0.00 ? 60 ASN A CG   8  
ATOM 8752  O OD1  . ASN A 1 60 ? 13.677  13.922  -4.474  1.00 0.00 ? 60 ASN A OD1  8  
ATOM 8753  N ND2  . ASN A 1 60 ? 13.084  14.180  -2.358  1.00 0.00 ? 60 ASN A ND2  8  
ATOM 8754  H H    . ASN A 1 60 ? 14.613  9.336   -2.744  1.00 0.00 ? 60 ASN A H    8  
ATOM 8755  H HA   . ASN A 1 60 ? 14.682  11.608  -4.639  1.00 0.00 ? 60 ASN A HA   8  
ATOM 8756  H HB2  . ASN A 1 60 ? 12.348  11.587  -3.997  1.00 0.00 ? 60 ASN A HB2  8  
ATOM 8757  H HB3  . ASN A 1 60 ? 12.803  11.662  -2.281  1.00 0.00 ? 60 ASN A HB3  8  
ATOM 8758  H HD21 . ASN A 1 60 ? 12.745  13.782  -1.486  1.00 0.00 ? 60 ASN A HD21 8  
ATOM 8759  H HD22 . ASN A 1 60 ? 13.323  15.165  -2.384  1.00 0.00 ? 60 ASN A HD22 8  
ATOM 8760  N N    . PRO A 1 61 ? 16.840  11.734  -3.213  1.00 0.00 ? 61 PRO A N    8  
ATOM 8761  C CA   . PRO A 1 61 ? 18.002  12.079  -2.407  1.00 0.00 ? 61 PRO A CA   8  
ATOM 8762  C C    . PRO A 1 61 ? 18.072  13.600  -2.176  1.00 0.00 ? 61 PRO A C    8  
ATOM 8763  O O    . PRO A 1 61 ? 17.553  14.369  -2.995  1.00 0.00 ? 61 PRO A O    8  
ATOM 8764  C CB   . PRO A 1 61 ? 19.198  11.572  -3.218  1.00 0.00 ? 61 PRO A CB   8  
ATOM 8765  C CG   . PRO A 1 61 ? 18.710  11.735  -4.655  1.00 0.00 ? 61 PRO A CG   8  
ATOM 8766  C CD   . PRO A 1 61 ? 17.236  11.376  -4.564  1.00 0.00 ? 61 PRO A CD   8  
ATOM 8767  H HA   . PRO A 1 61 ? 17.955  11.550  -1.454  1.00 0.00 ? 61 PRO A HA   8  
ATOM 8768  H HB2  . PRO A 1 61 ? 20.101  12.150  -3.026  1.00 0.00 ? 61 PRO A HB2  8  
ATOM 8769  H HB3  . PRO A 1 61 ? 19.368  10.516  -3.003  1.00 0.00 ? 61 PRO A HB3  8  
ATOM 8770  H HG2  . PRO A 1 61 ? 18.827  12.773  -4.961  1.00 0.00 ? 61 PRO A HG2  8  
ATOM 8771  H HG3  . PRO A 1 61 ? 19.211  11.072  -5.348  1.00 0.00 ? 61 PRO A HG3  8  
ATOM 8772  H HD2  . PRO A 1 61 ? 16.674  11.931  -5.314  1.00 0.00 ? 61 PRO A HD2  8  
ATOM 8773  H HD3  . PRO A 1 61 ? 17.103  10.305  -4.710  1.00 0.00 ? 61 PRO A HD3  8  
ATOM 8774  N N    . PRO A 1 62 ? 18.735  14.058  -1.102  1.00 0.00 ? 62 PRO A N    8  
ATOM 8775  C CA   . PRO A 1 62 ? 18.910  15.474  -0.820  1.00 0.00 ? 62 PRO A CA   8  
ATOM 8776  C C    . PRO A 1 62 ? 19.980  16.109  -1.715  1.00 0.00 ? 62 PRO A C    8  
ATOM 8777  O O    . PRO A 1 62 ? 20.736  15.414  -2.406  1.00 0.00 ? 62 PRO A O    8  
ATOM 8778  C CB   . PRO A 1 62 ? 19.310  15.527  0.657   1.00 0.00 ? 62 PRO A CB   8  
ATOM 8779  C CG   . PRO A 1 62 ? 20.104  14.237  0.837   1.00 0.00 ? 62 PRO A CG   8  
ATOM 8780  C CD   . PRO A 1 62 ? 19.368  13.255  -0.069  1.00 0.00 ? 62 PRO A CD   8  
ATOM 8781  H HA   . PRO A 1 62 ? 17.966  15.994  -0.970  1.00 0.00 ? 62 PRO A HA   8  
ATOM 8782  H HB2  . PRO A 1 62 ? 19.902  16.406  0.905   1.00 0.00 ? 62 PRO A HB2  8  
ATOM 8783  H HB3  . PRO A 1 62 ? 18.415  15.490  1.276   1.00 0.00 ? 62 PRO A HB3  8  
ATOM 8784  H HG2  . PRO A 1 62 ? 21.122  14.369  0.477   1.00 0.00 ? 62 PRO A HG2  8  
ATOM 8785  H HG3  . PRO A 1 62 ? 20.111  13.911  1.873   1.00 0.00 ? 62 PRO A HG3  8  
ATOM 8786  H HD2  . PRO A 1 62 ? 20.082  12.561  -0.506  1.00 0.00 ? 62 PRO A HD2  8  
ATOM 8787  H HD3  . PRO A 1 62 ? 18.607  12.720  0.501   1.00 0.00 ? 62 PRO A HD3  8  
ATOM 8788  N N    . LYS A 1 63 ? 20.072  17.443  -1.641  1.00 0.00 ? 63 LYS A N    8  
ATOM 8789  C CA   . LYS A 1 63 ? 20.950  18.298  -2.444  1.00 0.00 ? 63 LYS A CA   8  
ATOM 8790  C C    . LYS A 1 63 ? 20.745  17.974  -3.928  1.00 0.00 ? 63 LYS A C    8  
ATOM 8791  O O    . LYS A 1 63 ? 21.692  17.767  -4.688  1.00 0.00 ? 63 LYS A O    8  
ATOM 8792  C CB   . LYS A 1 63 ? 22.399  18.195  -1.922  1.00 0.00 ? 63 LYS A CB   8  
ATOM 8793  C CG   . LYS A 1 63 ? 23.268  19.451  -2.096  1.00 0.00 ? 63 LYS A CG   8  
ATOM 8794  C CD   . LYS A 1 63 ? 23.622  19.735  -3.557  1.00 0.00 ? 63 LYS A CD   8  
ATOM 8795  C CE   . LYS A 1 63 ? 24.664  20.846  -3.683  1.00 0.00 ? 63 LYS A CE   8  
ATOM 8796  N NZ   . LYS A 1 63 ? 24.837  21.229  -5.097  1.00 0.00 ? 63 LYS A NZ   8  
ATOM 8797  H H    . LYS A 1 63 ? 19.353  17.914  -1.104  1.00 0.00 ? 63 LYS A H    8  
ATOM 8798  H HA   . LYS A 1 63 ? 20.620  19.326  -2.293  1.00 0.00 ? 63 LYS A HA   8  
ATOM 8799  H HB2  . LYS A 1 63 ? 22.367  17.994  -0.851  1.00 0.00 ? 63 LYS A HB2  8  
ATOM 8800  H HB3  . LYS A 1 63 ? 22.892  17.351  -2.399  1.00 0.00 ? 63 LYS A HB3  8  
ATOM 8801  H HG2  . LYS A 1 63 ? 22.756  20.313  -1.668  1.00 0.00 ? 63 LYS A HG2  8  
ATOM 8802  H HG3  . LYS A 1 63 ? 24.193  19.293  -1.541  1.00 0.00 ? 63 LYS A HG3  8  
ATOM 8803  H HD2  . LYS A 1 63 ? 24.025  18.826  -4.008  1.00 0.00 ? 63 LYS A HD2  8  
ATOM 8804  H HD3  . LYS A 1 63 ? 22.718  20.032  -4.088  1.00 0.00 ? 63 LYS A HD3  8  
ATOM 8805  H HE2  . LYS A 1 63 ? 24.338  21.712  -3.105  1.00 0.00 ? 63 LYS A HE2  8  
ATOM 8806  H HE3  . LYS A 1 63 ? 25.611  20.484  -3.278  1.00 0.00 ? 63 LYS A HE3  8  
ATOM 8807  H HZ1  . LYS A 1 63 ? 23.987  21.683  -5.428  1.00 0.00 ? 63 LYS A HZ1  8  
ATOM 8808  H HZ2  . LYS A 1 63 ? 25.623  21.848  -5.217  1.00 0.00 ? 63 LYS A HZ2  8  
ATOM 8809  H HZ3  . LYS A 1 63 ? 24.962  20.394  -5.667  1.00 0.00 ? 63 LYS A HZ3  8  
ATOM 8810  N N    . LYS A 1 64 ? 19.478  17.868  -4.331  1.00 0.00 ? 64 LYS A N    8  
ATOM 8811  C CA   . LYS A 1 64 ? 19.073  17.668  -5.713  1.00 0.00 ? 64 LYS A CA   8  
ATOM 8812  C C    . LYS A 1 64 ? 17.707  18.331  -5.866  1.00 0.00 ? 64 LYS A C    8  
ATOM 8813  O O    . LYS A 1 64 ? 17.656  19.563  -5.853  1.00 0.00 ? 64 LYS A O    8  
ATOM 8814  C CB   . LYS A 1 64 ? 19.157  16.170  -6.059  1.00 0.00 ? 64 LYS A CB   8  
ATOM 8815  C CG   . LYS A 1 64 ? 19.148  15.941  -7.573  1.00 0.00 ? 64 LYS A CG   8  
ATOM 8816  C CD   . LYS A 1 64 ? 19.338  14.466  -7.957  1.00 0.00 ? 64 LYS A CD   8  
ATOM 8817  C CE   . LYS A 1 64 ? 18.088  13.619  -7.684  1.00 0.00 ? 64 LYS A CE   8  
ATOM 8818  N NZ   . LYS A 1 64 ? 18.191  12.291  -8.323  1.00 0.00 ? 64 LYS A NZ   8  
ATOM 8819  H H    . LYS A 1 64 ? 18.760  18.099  -3.658  1.00 0.00 ? 64 LYS A H    8  
ATOM 8820  H HA   . LYS A 1 64 ? 19.774  18.211  -6.354  1.00 0.00 ? 64 LYS A HA   8  
ATOM 8821  H HB2  . LYS A 1 64 ? 20.090  15.776  -5.667  1.00 0.00 ? 64 LYS A HB2  8  
ATOM 8822  H HB3  . LYS A 1 64 ? 18.360  15.621  -5.571  1.00 0.00 ? 64 LYS A HB3  8  
ATOM 8823  H HG2  . LYS A 1 64 ? 18.218  16.317  -7.994  1.00 0.00 ? 64 LYS A HG2  8  
ATOM 8824  H HG3  . LYS A 1 64 ? 19.969  16.509  -8.011  1.00 0.00 ? 64 LYS A HG3  8  
ATOM 8825  H HD2  . LYS A 1 64 ? 19.563  14.427  -9.022  1.00 0.00 ? 64 LYS A HD2  8  
ATOM 8826  H HD3  . LYS A 1 64 ? 20.193  14.053  -7.418  1.00 0.00 ? 64 LYS A HD3  8  
ATOM 8827  H HE2  . LYS A 1 64 ? 17.946  13.515  -6.609  1.00 0.00 ? 64 LYS A HE2  8  
ATOM 8828  H HE3  . LYS A 1 64 ? 17.220  14.138  -8.091  1.00 0.00 ? 64 LYS A HE3  8  
ATOM 8829  H HZ1  . LYS A 1 64 ? 17.370  11.715  -8.188  1.00 0.00 ? 64 LYS A HZ1  8  
ATOM 8830  H HZ2  . LYS A 1 64 ? 18.313  12.399  -9.328  1.00 0.00 ? 64 LYS A HZ2  8  
ATOM 8831  H HZ3  . LYS A 1 64 ? 19.001  11.762  -8.012  1.00 0.00 ? 64 LYS A HZ3  8  
ATOM 8832  N N    . LYS A 1 65 ? 16.600  17.576  -5.873  1.00 0.00 ? 65 LYS A N    8  
ATOM 8833  C CA   . LYS A 1 65 ? 15.263  18.169  -5.887  1.00 0.00 ? 65 LYS A CA   8  
ATOM 8834  C C    . LYS A 1 65 ? 15.111  19.087  -4.678  1.00 0.00 ? 65 LYS A C    8  
ATOM 8835  O O    . LYS A 1 65 ? 15.531  18.742  -3.566  1.00 0.00 ? 65 LYS A O    8  
ATOM 8836  C CB   . LYS A 1 65 ? 14.181  17.082  -5.898  1.00 0.00 ? 65 LYS A CB   8  
ATOM 8837  C CG   . LYS A 1 65 ? 12.788  17.645  -6.227  1.00 0.00 ? 65 LYS A CG   8  
ATOM 8838  C CD   . LYS A 1 65 ? 11.679  16.600  -6.026  1.00 0.00 ? 65 LYS A CD   8  
ATOM 8839  C CE   . LYS A 1 65 ? 10.619  17.050  -5.010  1.00 0.00 ? 65 LYS A CE   8  
ATOM 8840  N NZ   . LYS A 1 65 ? 11.181  17.239  -3.657  1.00 0.00 ? 65 LYS A NZ   8  
ATOM 8841  H H    . LYS A 1 65 ? 16.672  16.569  -5.809  1.00 0.00 ? 65 LYS A H    8  
ATOM 8842  H HA   . LYS A 1 65 ? 15.179  18.757  -6.803  1.00 0.00 ? 65 LYS A HA   8  
ATOM 8843  H HB2  . LYS A 1 65 ? 14.432  16.346  -6.659  1.00 0.00 ? 65 LYS A HB2  8  
ATOM 8844  H HB3  . LYS A 1 65 ? 14.159  16.596  -4.923  1.00 0.00 ? 65 LYS A HB3  8  
ATOM 8845  H HG2  . LYS A 1 65 ? 12.582  18.514  -5.609  1.00 0.00 ? 65 LYS A HG2  8  
ATOM 8846  H HG3  . LYS A 1 65 ? 12.773  17.978  -7.263  1.00 0.00 ? 65 LYS A HG3  8  
ATOM 8847  H HD2  . LYS A 1 65 ? 11.191  16.421  -6.985  1.00 0.00 ? 65 LYS A HD2  8  
ATOM 8848  H HD3  . LYS A 1 65 ? 12.099  15.648  -5.701  1.00 0.00 ? 65 LYS A HD3  8  
ATOM 8849  H HE2  . LYS A 1 65 ? 10.148  17.974  -5.350  1.00 0.00 ? 65 LYS A HE2  8  
ATOM 8850  H HE3  . LYS A 1 65 ? 9.853   16.275  -4.961  1.00 0.00 ? 65 LYS A HE3  8  
ATOM 8851  H HZ1  . LYS A 1 65 ? 10.446  17.224  -2.955  1.00 0.00 ? 65 LYS A HZ1  8  
ATOM 8852  H HZ2  . LYS A 1 65 ? 11.797  16.477  -3.410  1.00 0.00 ? 65 LYS A HZ2  8  
ATOM 8853  H HZ3  . LYS A 1 65 ? 11.698  18.111  -3.571  1.00 0.00 ? 65 LYS A HZ3  8  
ATOM 8854  N N    . MET A 1 66 ? 14.520  20.251  -4.907  1.00 0.00 ? 66 MET A N    8  
ATOM 8855  C CA   . MET A 1 66 ? 14.223  21.269  -3.916  1.00 0.00 ? 66 MET A CA   8  
ATOM 8856  C C    . MET A 1 66 ? 13.036  20.795  -3.071  1.00 0.00 ? 66 MET A C    8  
ATOM 8857  O O    . MET A 1 66 ? 12.366  19.814  -3.420  1.00 0.00 ? 66 MET A O    8  
ATOM 8858  C CB   . MET A 1 66 ? 13.927  22.576  -4.673  1.00 0.00 ? 66 MET A CB   8  
ATOM 8859  C CG   . MET A 1 66 ? 15.150  23.045  -5.478  1.00 0.00 ? 66 MET A CG   8  
ATOM 8860  S SD   . MET A 1 66 ? 14.789  24.310  -6.719  1.00 0.00 ? 66 MET A SD   8  
ATOM 8861  C CE   . MET A 1 66 ? 16.310  24.187  -7.702  1.00 0.00 ? 66 MET A CE   8  
ATOM 8862  H H    . MET A 1 66 ? 14.110  20.406  -5.822  1.00 0.00 ? 66 MET A H    8  
ATOM 8863  H HA   . MET A 1 66 ? 15.087  21.415  -3.271  1.00 0.00 ? 66 MET A HA   8  
ATOM 8864  H HB2  . MET A 1 66 ? 13.093  22.411  -5.356  1.00 0.00 ? 66 MET A HB2  8  
ATOM 8865  H HB3  . MET A 1 66 ? 13.640  23.363  -3.979  1.00 0.00 ? 66 MET A HB3  8  
ATOM 8866  H HG2  . MET A 1 66 ? 15.907  23.423  -4.789  1.00 0.00 ? 66 MET A HG2  8  
ATOM 8867  H HG3  . MET A 1 66 ? 15.579  22.198  -6.012  1.00 0.00 ? 66 MET A HG3  8  
ATOM 8868  H HE1  . MET A 1 66 ? 16.401  23.180  -8.109  1.00 0.00 ? 66 MET A HE1  8  
ATOM 8869  H HE2  . MET A 1 66 ? 16.275  24.904  -8.523  1.00 0.00 ? 66 MET A HE2  8  
ATOM 8870  H HE3  . MET A 1 66 ? 17.176  24.399  -7.075  1.00 0.00 ? 66 MET A HE3  8  
ATOM 8871  N N    . LYS A 1 67 ? 12.741  21.486  -1.972  1.00 0.00 ? 67 LYS A N    8  
ATOM 8872  C CA   . LYS A 1 67 ? 11.511  21.296  -1.217  1.00 0.00 ? 67 LYS A CA   8  
ATOM 8873  C C    . LYS A 1 67 ? 11.220  22.618  -0.520  1.00 0.00 ? 67 LYS A C    8  
ATOM 8874  O O    . LYS A 1 67 ? 11.783  22.869  0.548   1.00 0.00 ? 67 LYS A O    8  
ATOM 8875  C CB   . LYS A 1 67 ? 11.647  20.129  -0.216  1.00 0.00 ? 67 LYS A CB   8  
ATOM 8876  C CG   . LYS A 1 67 ? 10.301  19.679  0.383   1.00 0.00 ? 67 LYS A CG   8  
ATOM 8877  C CD   . LYS A 1 67 ? 10.218  19.627  1.921   1.00 0.00 ? 67 LYS A CD   8  
ATOM 8878  C CE   . LYS A 1 67 ? 9.847   20.997  2.500   1.00 0.00 ? 67 LYS A CE   8  
ATOM 8879  N NZ   . LYS A 1 67 ? 9.354   20.946  3.894   1.00 0.00 ? 67 LYS A NZ   8  
ATOM 8880  H H    . LYS A 1 67 ? 13.279  22.323  -1.740  1.00 0.00 ? 67 LYS A H    8  
ATOM 8881  H HA   . LYS A 1 67 ? 10.719  21.067  -1.933  1.00 0.00 ? 67 LYS A HA   8  
ATOM 8882  H HB2  . LYS A 1 67 ? 12.082  19.272  -0.731  1.00 0.00 ? 67 LYS A HB2  8  
ATOM 8883  H HB3  . LYS A 1 67 ? 12.331  20.409  0.580   1.00 0.00 ? 67 LYS A HB3  8  
ATOM 8884  H HG2  . LYS A 1 67 ? 9.504   20.318  0.010   1.00 0.00 ? 67 LYS A HG2  8  
ATOM 8885  H HG3  . LYS A 1 67 ? 10.102  18.675  0.011   1.00 0.00 ? 67 LYS A HG3  8  
ATOM 8886  H HD2  . LYS A 1 67 ? 9.424   18.923  2.175   1.00 0.00 ? 67 LYS A HD2  8  
ATOM 8887  H HD3  . LYS A 1 67 ? 11.154  19.268  2.350   1.00 0.00 ? 67 LYS A HD3  8  
ATOM 8888  H HE2  . LYS A 1 67 ? 10.684  21.692  2.416   1.00 0.00 ? 67 LYS A HE2  8  
ATOM 8889  H HE3  . LYS A 1 67 ? 9.029   21.383  1.893   1.00 0.00 ? 67 LYS A HE3  8  
ATOM 8890  H HZ1  . LYS A 1 67 ? 10.027  21.337  4.546   1.00 0.00 ? 67 LYS A HZ1  8  
ATOM 8891  H HZ2  . LYS A 1 67 ? 8.499   21.496  3.964   1.00 0.00 ? 67 LYS A HZ2  8  
ATOM 8892  H HZ3  . LYS A 1 67 ? 9.099   20.003  4.169   1.00 0.00 ? 67 LYS A HZ3  8  
ATOM 8893  N N    . LEU A 1 68 ? 10.380  23.458  -1.129  1.00 0.00 ? 68 LEU A N    8  
ATOM 8894  C CA   . LEU A 1 68 ? 9.945   24.728  -0.544  1.00 0.00 ? 68 LEU A CA   8  
ATOM 8895  C C    . LEU A 1 68 ? 9.364   24.465  0.839   1.00 0.00 ? 68 LEU A C    8  
ATOM 8896  O O    . LEU A 1 68 ? 8.821   23.383  1.066   1.00 0.00 ? 68 LEU A O    8  
ATOM 8897  C CB   . LEU A 1 68 ? 8.850   25.371  -1.421  1.00 0.00 ? 68 LEU A CB   8  
ATOM 8898  C CG   . LEU A 1 68 ? 9.329   26.230  -2.601  1.00 0.00 ? 68 LEU A CG   8  
ATOM 8899  C CD1  . LEU A 1 68 ? 10.017  27.504  -2.112  1.00 0.00 ? 68 LEU A CD1  8  
ATOM 8900  C CD2  . LEU A 1 68 ? 10.236  25.464  -3.573  1.00 0.00 ? 68 LEU A CD2  8  
ATOM 8901  H H    . LEU A 1 68 ? 9.996   23.201  -2.024  1.00 0.00 ? 68 LEU A H    8  
ATOM 8902  H HA   . LEU A 1 68 ? 10.803  25.394  -0.446  1.00 0.00 ? 68 LEU A HA   8  
ATOM 8903  H HB2  . LEU A 1 68 ? 8.189   24.589  -1.798  1.00 0.00 ? 68 LEU A HB2  8  
ATOM 8904  H HB3  . LEU A 1 68 ? 8.233   26.016  -0.792  1.00 0.00 ? 68 LEU A HB3  8  
ATOM 8905  H HG   . LEU A 1 68 ? 8.440   26.537  -3.151  1.00 0.00 ? 68 LEU A HG   8  
ATOM 8906  H HD11 . LEU A 1 68 ? 10.239  28.146  -2.964  1.00 0.00 ? 68 LEU A HD11 8  
ATOM 8907  H HD12 . LEU A 1 68 ? 9.356   28.051  -1.438  1.00 0.00 ? 68 LEU A HD12 8  
ATOM 8908  H HD13 . LEU A 1 68 ? 10.947  27.276  -1.595  1.00 0.00 ? 68 LEU A HD13 8  
ATOM 8909  H HD21 . LEU A 1 68 ? 10.490  26.102  -4.420  1.00 0.00 ? 68 LEU A HD21 8  
ATOM 8910  H HD22 . LEU A 1 68 ? 11.166  25.172  -3.084  1.00 0.00 ? 68 LEU A HD22 8  
ATOM 8911  H HD23 . LEU A 1 68 ? 9.717   24.583  -3.945  1.00 0.00 ? 68 LEU A HD23 8  
ATOM 8912  N N    . MET A 1 69 ? 9.401   25.447  1.738   1.00 0.00 ? 69 MET A N    8  
ATOM 8913  C CA   . MET A 1 69 ? 8.648   25.359  2.985   1.00 0.00 ? 69 MET A CA   8  
ATOM 8914  C C    . MET A 1 69 ? 7.136   25.436  2.720   1.00 0.00 ? 69 MET A C    8  
ATOM 8915  O O    . MET A 1 69 ? 6.691   25.598  1.580   1.00 0.00 ? 69 MET A O    8  
ATOM 8916  C CB   . MET A 1 69 ? 9.154   26.394  3.997   1.00 0.00 ? 69 MET A CB   8  
ATOM 8917  C CG   . MET A 1 69 ? 9.026   27.859  3.571   1.00 0.00 ? 69 MET A CG   8  
ATOM 8918  S SD   . MET A 1 69 ? 9.583   28.980  4.882   1.00 0.00 ? 69 MET A SD   8  
ATOM 8919  C CE   . MET A 1 69 ? 9.833   30.501  3.931   1.00 0.00 ? 69 MET A CE   8  
ATOM 8920  H H    . MET A 1 69 ? 9.820   26.330  1.489   1.00 0.00 ? 69 MET A H    8  
ATOM 8921  H HA   . MET A 1 69 ? 8.843   24.375  3.414   1.00 0.00 ? 69 MET A HA   8  
ATOM 8922  H HB2  . MET A 1 69 ? 8.617   26.256  4.937   1.00 0.00 ? 69 MET A HB2  8  
ATOM 8923  H HB3  . MET A 1 69 ? 10.208  26.186  4.185   1.00 0.00 ? 69 MET A HB3  8  
ATOM 8924  H HG2  . MET A 1 69 ? 9.636   28.026  2.683   1.00 0.00 ? 69 MET A HG2  8  
ATOM 8925  H HG3  . MET A 1 69 ? 7.987   28.084  3.331   1.00 0.00 ? 69 MET A HG3  8  
ATOM 8926  H HE1  . MET A 1 69 ? 10.163  31.298  4.599   1.00 0.00 ? 69 MET A HE1  8  
ATOM 8927  H HE2  . MET A 1 69 ? 10.591  30.338  3.165   1.00 0.00 ? 69 MET A HE2  8  
ATOM 8928  H HE3  . MET A 1 69 ? 8.900   30.798  3.458   1.00 0.00 ? 69 MET A HE3  8  
ATOM 8929  N N    . ARG A 1 70 ? 6.335   25.263  3.769   1.00 0.00 ? 70 ARG A N    8  
ATOM 8930  C CA   . ARG A 1 70 ? 4.878   25.230  3.745   1.00 0.00 ? 70 ARG A CA   8  
ATOM 8931  C C    . ARG A 1 70 ? 4.433   26.174  4.830   1.00 0.00 ? 70 ARG A C    8  
ATOM 8932  O O    . ARG A 1 70 ? 3.611   27.070  4.559   1.00 0.00 ? 70 ARG A O    8  
ATOM 8933  C CB   . ARG A 1 70 ? 4.406   23.791  4.010   1.00 0.00 ? 70 ARG A CB   8  
ATOM 8934  C CG   . ARG A 1 70 ? 2.892   23.574  4.127   1.00 0.00 ? 70 ARG A CG   8  
ATOM 8935  C CD   . ARG A 1 70 ? 2.116   23.774  2.821   1.00 0.00 ? 70 ARG A CD   8  
ATOM 8936  N NE   . ARG A 1 70 ? 0.765   23.193  2.930   1.00 0.00 ? 70 ARG A NE   8  
ATOM 8937  C CZ   . ARG A 1 70 ? 0.435   21.903  2.796   1.00 0.00 ? 70 ARG A CZ   8  
ATOM 8938  N NH1  . ARG A 1 70 ? 1.277   21.008  2.291   1.00 0.00 ? 70 ARG A NH1  8  
ATOM 8939  N NH2  . ARG A 1 70 ? -0.758  21.484  3.181   1.00 0.00 ? 70 ARG A NH2  8  
ATOM 8940  H H    . ARG A 1 70 ? 6.738   25.187  4.694   1.00 0.00 ? 70 ARG A H    8  
ATOM 8941  H HA   . ARG A 1 70 ? 4.504   25.581  2.781   1.00 0.00 ? 70 ARG A HA   8  
ATOM 8942  H HB2  . ARG A 1 70 ? 4.778   23.144  3.219   1.00 0.00 ? 70 ARG A HB2  8  
ATOM 8943  H HB3  . ARG A 1 70 ? 4.852   23.453  4.946   1.00 0.00 ? 70 ARG A HB3  8  
ATOM 8944  H HG2  . ARG A 1 70 ? 2.753   22.540  4.441   1.00 0.00 ? 70 ARG A HG2  8  
ATOM 8945  H HG3  . ARG A 1 70 ? 2.478   24.223  4.900   1.00 0.00 ? 70 ARG A HG3  8  
ATOM 8946  H HD2  . ARG A 1 70 ? 2.037   24.840  2.605   1.00 0.00 ? 70 ARG A HD2  8  
ATOM 8947  H HD3  . ARG A 1 70 ? 2.654   23.296  2.005   1.00 0.00 ? 70 ARG A HD3  8  
ATOM 8948  H HE   . ARG A 1 70 ? 0.022   23.834  3.207   1.00 0.00 ? 70 ARG A HE   8  
ATOM 8949  H HH11 . ARG A 1 70 ? 2.073   21.328  1.744   1.00 0.00 ? 70 ARG A HH11 8  
ATOM 8950  H HH12 . ARG A 1 70 ? 1.014   20.035  2.212   1.00 0.00 ? 70 ARG A HH12 8  
ATOM 8951  H HH21 . ARG A 1 70 ? -1.494  22.140  3.443   1.00 0.00 ? 70 ARG A HH21 8  
ATOM 8952  H HH22 . ARG A 1 70 ? -1.032  20.513  3.047   1.00 0.00 ? 70 ARG A HH22 8  
ATOM 8953  N N    . GLY A 1 1  ? -10.422 -24.177 1.725   1.00 0.00 ? 1  GLY A N    9  
ATOM 8954  C CA   . GLY A 1 1  ? -9.861  -23.818 0.416   1.00 0.00 ? 1  GLY A CA   9  
ATOM 8955  C C    . GLY A 1 1  ? -8.721  -24.747 0.048   1.00 0.00 ? 1  GLY A C    9  
ATOM 8956  O O    . GLY A 1 1  ? -8.248  -25.511 0.894   1.00 0.00 ? 1  GLY A O    9  
ATOM 8957  H H1   . GLY A 1 1  ? -10.912 -25.048 1.751   1.00 0.00 ? 1  GLY A H1   9  
ATOM 8958  H HA2  . GLY A 1 1  ? -10.646 -23.881 -0.336  1.00 0.00 ? 1  GLY A HA2  9  
ATOM 8959  H HA3  . GLY A 1 1  ? -9.479  -22.804 0.448   1.00 0.00 ? 1  GLY A HA3  9  
ATOM 8960  N N    . SER A 1 2  ? -8.278  -24.682 -1.211  1.00 0.00 ? 2  SER A N    9  
ATOM 8961  C CA   . SER A 1 2  ? -7.254  -25.566 -1.749  1.00 0.00 ? 2  SER A CA   9  
ATOM 8962  C C    . SER A 1 2  ? -5.959  -25.404 -0.944  1.00 0.00 ? 2  SER A C    9  
ATOM 8963  O O    . SER A 1 2  ? -5.315  -24.352 -0.995  1.00 0.00 ? 2  SER A O    9  
ATOM 8964  C CB   . SER A 1 2  ? -7.077  -25.317 -3.253  1.00 0.00 ? 2  SER A CB   9  
ATOM 8965  O OG   . SER A 1 2  ? -7.033  -26.545 -3.949  1.00 0.00 ? 2  SER A OG   9  
ATOM 8966  H H    . SER A 1 2  ? -8.629  -23.953 -1.818  1.00 0.00 ? 2  SER A H    9  
ATOM 8967  H HA   . SER A 1 2  ? -7.622  -26.579 -1.617  1.00 0.00 ? 2  SER A HA   9  
ATOM 8968  H HB2  . SER A 1 2  ? -7.927  -24.753 -3.634  1.00 0.00 ? 2  SER A HB2  9  
ATOM 8969  H HB3  . SER A 1 2  ? -6.165  -24.748 -3.441  1.00 0.00 ? 2  SER A HB3  9  
ATOM 8970  H HG   . SER A 1 2  ? -7.929  -26.744 -4.256  1.00 0.00 ? 2  SER A HG   9  
ATOM 8971  N N    . SER A 1 3  ? -5.612  -26.418 -0.157  1.00 0.00 ? 3  SER A N    9  
ATOM 8972  C CA   . SER A 1 3  ? -4.538  -26.406 0.818   1.00 0.00 ? 3  SER A CA   9  
ATOM 8973  C C    . SER A 1 3  ? -3.569  -27.538 0.487   1.00 0.00 ? 3  SER A C    9  
ATOM 8974  O O    . SER A 1 3  ? -3.609  -28.597 1.113   1.00 0.00 ? 3  SER A O    9  
ATOM 8975  C CB   . SER A 1 3  ? -5.140  -26.536 2.222   1.00 0.00 ? 3  SER A CB   9  
ATOM 8976  O OG   . SER A 1 3  ? -5.981  -25.431 2.520   1.00 0.00 ? 3  SER A OG   9  
ATOM 8977  H H    . SER A 1 3  ? -6.151  -27.278 -0.213  1.00 0.00 ? 3  SER A H    9  
ATOM 8978  H HA   . SER A 1 3  ? -3.990  -25.465 0.770   1.00 0.00 ? 3  SER A HA   9  
ATOM 8979  H HB2  . SER A 1 3  ? -5.723  -27.456 2.288   1.00 0.00 ? 3  SER A HB2  9  
ATOM 8980  H HB3  . SER A 1 3  ? -4.329  -26.587 2.947   1.00 0.00 ? 3  SER A HB3  9  
ATOM 8981  H HG   . SER A 1 3  ? -6.728  -25.461 1.893   1.00 0.00 ? 3  SER A HG   9  
ATOM 8982  N N    . GLY A 1 4  ? -2.708  -27.315 -0.503  1.00 0.00 ? 4  GLY A N    9  
ATOM 8983  C CA   . GLY A 1 4  ? -1.590  -28.195 -0.797  1.00 0.00 ? 4  GLY A CA   9  
ATOM 8984  C C    . GLY A 1 4  ? -0.312  -27.633 -0.185  1.00 0.00 ? 4  GLY A C    9  
ATOM 8985  O O    . GLY A 1 4  ? -0.343  -26.679 0.608   1.00 0.00 ? 4  GLY A O    9  
ATOM 8986  H H    . GLY A 1 4  ? -2.717  -26.432 -0.994  1.00 0.00 ? 4  GLY A H    9  
ATOM 8987  H HA2  . GLY A 1 4  ? -1.774  -29.190 -0.395  1.00 0.00 ? 4  GLY A HA2  9  
ATOM 8988  H HA3  . GLY A 1 4  ? -1.474  -28.273 -1.878  1.00 0.00 ? 4  GLY A HA3  9  
ATOM 8989  N N    . SER A 1 5  ? 0.817   -28.190 -0.614  1.00 0.00 ? 5  SER A N    9  
ATOM 8990  C CA   . SER A 1 5  ? 2.168   -27.691 -0.381  1.00 0.00 ? 5  SER A CA   9  
ATOM 8991  C C    . SER A 1 5  ? 2.262   -26.188 -0.682  1.00 0.00 ? 5  SER A C    9  
ATOM 8992  O O    . SER A 1 5  ? 1.486   -25.679 -1.502  1.00 0.00 ? 5  SER A O    9  
ATOM 8993  C CB   . SER A 1 5  ? 3.166   -28.519 -1.223  1.00 0.00 ? 5  SER A CB   9  
ATOM 8994  O OG   . SER A 1 5  ? 2.558   -29.190 -2.325  1.00 0.00 ? 5  SER A OG   9  
ATOM 8995  H H    . SER A 1 5  ? 0.767   -28.993 -1.230  1.00 0.00 ? 5  SER A H    9  
ATOM 8996  H HA   . SER A 1 5  ? 2.408   -27.845 0.673   1.00 0.00 ? 5  SER A HA   9  
ATOM 8997  H HB2  . SER A 1 5  ? 3.972   -27.879 -1.582  1.00 0.00 ? 5  SER A HB2  9  
ATOM 8998  H HB3  . SER A 1 5  ? 3.605   -29.280 -0.577  1.00 0.00 ? 5  SER A HB3  9  
ATOM 8999  H HG   . SER A 1 5  ? 2.667   -28.652 -3.138  1.00 0.00 ? 5  SER A HG   9  
ATOM 9000  N N    . SER A 1 6  ? 3.206   -25.515 -0.014  1.00 0.00 ? 6  SER A N    9  
ATOM 9001  C CA   . SER A 1 6  ? 3.607   -24.107 -0.113  1.00 0.00 ? 6  SER A CA   9  
ATOM 9002  C C    . SER A 1 6  ? 2.595   -23.217 -0.852  1.00 0.00 ? 6  SER A C    9  
ATOM 9003  O O    . SER A 1 6  ? 2.613   -23.143 -2.083  1.00 0.00 ? 6  SER A O    9  
ATOM 9004  C CB   . SER A 1 6  ? 4.995   -24.042 -0.765  1.00 0.00 ? 6  SER A CB   9  
ATOM 9005  O OG   . SER A 1 6  ? 5.868   -25.000 -0.200  1.00 0.00 ? 6  SER A OG   9  
ATOM 9006  H H    . SER A 1 6  ? 3.837   -26.072 0.551   1.00 0.00 ? 6  SER A H    9  
ATOM 9007  H HA   . SER A 1 6  ? 3.712   -23.724 0.903   1.00 0.00 ? 6  SER A HA   9  
ATOM 9008  H HB2  . SER A 1 6  ? 4.904   -24.252 -1.831  1.00 0.00 ? 6  SER A HB2  9  
ATOM 9009  H HB3  . SER A 1 6  ? 5.417   -23.049 -0.627  1.00 0.00 ? 6  SER A HB3  9  
ATOM 9010  H HG   . SER A 1 6  ? 6.316   -24.622 0.586   1.00 0.00 ? 6  SER A HG   9  
ATOM 9011  N N    . GLY A 1 7  ? 1.684   -22.569 -0.122  1.00 0.00 ? 7  GLY A N    9  
ATOM 9012  C CA   . GLY A 1 7  ? 0.623   -21.730 -0.666  1.00 0.00 ? 7  GLY A CA   9  
ATOM 9013  C C    . GLY A 1 7  ? 1.207   -20.498 -1.349  1.00 0.00 ? 7  GLY A C    9  
ATOM 9014  O O    . GLY A 1 7  ? 1.588   -19.538 -0.675  1.00 0.00 ? 7  GLY A O    9  
ATOM 9015  H H    . GLY A 1 7  ? 1.764   -22.597 0.887   1.00 0.00 ? 7  GLY A H    9  
ATOM 9016  H HA2  . GLY A 1 7  ? 0.031   -22.306 -1.377  1.00 0.00 ? 7  GLY A HA2  9  
ATOM 9017  H HA3  . GLY A 1 7  ? -0.030  -21.409 0.145   1.00 0.00 ? 7  GLY A HA3  9  
ATOM 9018  N N    . ARG A 1 8  ? 1.308   -20.523 -2.681  1.00 0.00 ? 8  ARG A N    9  
ATOM 9019  C CA   . ARG A 1 8  ? 1.941   -19.472 -3.482  1.00 0.00 ? 8  ARG A CA   9  
ATOM 9020  C C    . ARG A 1 8  ? 1.229   -18.119 -3.441  1.00 0.00 ? 8  ARG A C    9  
ATOM 9021  O O    . ARG A 1 8  ? 1.776   -17.147 -3.966  1.00 0.00 ? 8  ARG A O    9  
ATOM 9022  C CB   . ARG A 1 8  ? 2.101   -19.945 -4.936  1.00 0.00 ? 8  ARG A CB   9  
ATOM 9023  C CG   . ARG A 1 8  ? 0.789   -20.309 -5.647  1.00 0.00 ? 8  ARG A CG   9  
ATOM 9024  C CD   . ARG A 1 8  ? 1.026   -20.649 -7.129  1.00 0.00 ? 8  ARG A CD   9  
ATOM 9025  N NE   . ARG A 1 8  ? 0.611   -19.560 -8.030  1.00 0.00 ? 8  ARG A NE   9  
ATOM 9026  C CZ   . ARG A 1 8  ? -0.655  -19.212 -8.282  1.00 0.00 ? 8  ARG A CZ   9  
ATOM 9027  N NH1  . ARG A 1 8  ? -1.658  -19.899 -7.744  1.00 0.00 ? 8  ARG A NH1  9  
ATOM 9028  N NH2  . ARG A 1 8  ? -0.937  -18.200 -9.087  1.00 0.00 ? 8  ARG A NH2  9  
ATOM 9029  H H    . ARG A 1 8  ? 0.990   -21.361 -3.156  1.00 0.00 ? 8  ARG A H    9  
ATOM 9030  H HA   . ARG A 1 8  ? 2.943   -19.307 -3.077  1.00 0.00 ? 8  ARG A HA   9  
ATOM 9031  H HB2  . ARG A 1 8  ? 2.585   -19.149 -5.495  1.00 0.00 ? 8  ARG A HB2  9  
ATOM 9032  H HB3  . ARG A 1 8  ? 2.758   -20.811 -4.955  1.00 0.00 ? 8  ARG A HB3  9  
ATOM 9033  H HG2  . ARG A 1 8  ? 0.348   -21.177 -5.162  1.00 0.00 ? 8  ARG A HG2  9  
ATOM 9034  H HG3  . ARG A 1 8  ? 0.080   -19.487 -5.557  1.00 0.00 ? 8  ARG A HG3  9  
ATOM 9035  H HD2  . ARG A 1 8  ? 2.081   -20.875 -7.296  1.00 0.00 ? 8  ARG A HD2  9  
ATOM 9036  H HD3  . ARG A 1 8  ? 0.465   -21.550 -7.380  1.00 0.00 ? 8  ARG A HD3  9  
ATOM 9037  H HE   . ARG A 1 8  ? 1.362   -19.132 -8.569  1.00 0.00 ? 8  ARG A HE   9  
ATOM 9038  H HH11 . ARG A 1 8  ? -1.515  -20.691 -7.113  1.00 0.00 ? 8  ARG A HH11 9  
ATOM 9039  H HH12 . ARG A 1 8  ? -2.633  -19.676 -7.951  1.00 0.00 ? 8  ARG A HH12 9  
ATOM 9040  H HH21 . ARG A 1 8  ? -0.208  -17.652 -9.546  1.00 0.00 ? 8  ARG A HH21 9  
ATOM 9041  H HH22 . ARG A 1 8  ? -1.894  -17.888 -9.260  1.00 0.00 ? 8  ARG A HH22 9  
ATOM 9042  N N    . GLY A 1 9  ? 0.023   -18.020 -2.887  1.00 0.00 ? 9  GLY A N    9  
ATOM 9043  C CA   . GLY A 1 9  ? -0.691  -16.759 -2.765  1.00 0.00 ? 9  GLY A CA   9  
ATOM 9044  C C    . GLY A 1 9  ? -1.850  -16.903 -1.795  1.00 0.00 ? 9  GLY A C    9  
ATOM 9045  O O    . GLY A 1 9  ? -3.020  -16.826 -2.188  1.00 0.00 ? 9  GLY A O    9  
ATOM 9046  H H    . GLY A 1 9  ? -0.419  -18.856 -2.515  1.00 0.00 ? 9  GLY A H    9  
ATOM 9047  H HA2  . GLY A 1 9  ? -0.009  -15.995 -2.396  1.00 0.00 ? 9  GLY A HA2  9  
ATOM 9048  H HA3  . GLY A 1 9  ? -1.059  -16.444 -3.736  1.00 0.00 ? 9  GLY A HA3  9  
ATOM 9049  N N    . ARG A 1 10 ? -1.523  -17.165 -0.531  1.00 0.00 ? 10 ARG A N    9  
ATOM 9050  C CA   . ARG A 1 10 ? -2.463  -17.139 0.583   1.00 0.00 ? 10 ARG A CA   9  
ATOM 9051  C C    . ARG A 1 10 ? -2.782  -15.680 0.910   1.00 0.00 ? 10 ARG A C    9  
ATOM 9052  O O    . ARG A 1 10 ? -1.908  -14.829 0.757   1.00 0.00 ? 10 ARG A O    9  
ATOM 9053  C CB   . ARG A 1 10 ? -1.774  -17.827 1.770   1.00 0.00 ? 10 ARG A CB   9  
ATOM 9054  C CG   . ARG A 1 10 ? -2.618  -17.988 3.030   1.00 0.00 ? 10 ARG A CG   9  
ATOM 9055  C CD   . ARG A 1 10 ? -3.822  -18.918 2.888   1.00 0.00 ? 10 ARG A CD   9  
ATOM 9056  N NE   . ARG A 1 10 ? -4.399  -19.107 4.218   1.00 0.00 ? 10 ARG A NE   9  
ATOM 9057  C CZ   . ARG A 1 10 ? -5.290  -20.006 4.622   1.00 0.00 ? 10 ARG A CZ   9  
ATOM 9058  N NH1  . ARG A 1 10 ? -5.935  -20.769 3.749   1.00 0.00 ? 10 ARG A NH1  9  
ATOM 9059  N NH2  . ARG A 1 10 ? -5.495  -20.111 5.926   1.00 0.00 ? 10 ARG A NH2  9  
ATOM 9060  H H    . ARG A 1 10 ? -0.531  -17.153 -0.302  1.00 0.00 ? 10 ARG A H    9  
ATOM 9061  H HA   . ARG A 1 10 ? -3.371  -17.674 0.302   1.00 0.00 ? 10 ARG A HA   9  
ATOM 9062  H HB2  . ARG A 1 10 ? -1.421  -18.812 1.464   1.00 0.00 ? 10 ARG A HB2  9  
ATOM 9063  H HB3  . ARG A 1 10 ? -0.914  -17.223 2.060   1.00 0.00 ? 10 ARG A HB3  9  
ATOM 9064  H HG2  . ARG A 1 10 ? -1.970  -18.380 3.815   1.00 0.00 ? 10 ARG A HG2  9  
ATOM 9065  H HG3  . ARG A 1 10 ? -2.960  -17.011 3.351   1.00 0.00 ? 10 ARG A HG3  9  
ATOM 9066  H HD2  . ARG A 1 10 ? -4.564  -18.480 2.221   1.00 0.00 ? 10 ARG A HD2  9  
ATOM 9067  H HD3  . ARG A 1 10 ? -3.495  -19.881 2.493   1.00 0.00 ? 10 ARG A HD3  9  
ATOM 9068  H HE   . ARG A 1 10 ? -3.911  -18.613 4.966   1.00 0.00 ? 10 ARG A HE   9  
ATOM 9069  H HH11 . ARG A 1 10 ? -5.850  -20.573 2.755   1.00 0.00 ? 10 ARG A HH11 9  
ATOM 9070  H HH12 . ARG A 1 10 ? -6.588  -21.489 4.050   1.00 0.00 ? 10 ARG A HH12 9  
ATOM 9071  H HH21 . ARG A 1 10 ? -4.905  -19.558 6.542   1.00 0.00 ? 10 ARG A HH21 9  
ATOM 9072  H HH22 . ARG A 1 10 ? -6.095  -20.796 6.378   1.00 0.00 ? 10 ARG A HH22 9  
ATOM 9073  N N    . TYR A 1 11 ? -3.993  -15.420 1.413   1.00 0.00 ? 11 TYR A N    9  
ATOM 9074  C CA   . TYR A 1 11 ? -4.528  -14.106 1.764   1.00 0.00 ? 11 TYR A CA   9  
ATOM 9075  C C    . TYR A 1 11 ? -4.140  -13.063 0.717   1.00 0.00 ? 11 TYR A C    9  
ATOM 9076  O O    . TYR A 1 11 ? -3.264  -12.229 0.947   1.00 0.00 ? 11 TYR A O    9  
ATOM 9077  C CB   . TYR A 1 11 ? -4.110  -13.709 3.187   1.00 0.00 ? 11 TYR A CB   9  
ATOM 9078  C CG   . TYR A 1 11 ? -4.919  -14.352 4.288   1.00 0.00 ? 11 TYR A CG   9  
ATOM 9079  C CD1  . TYR A 1 11 ? -6.229  -13.906 4.533   1.00 0.00 ? 11 TYR A CD1  9  
ATOM 9080  C CD2  . TYR A 1 11 ? -4.347  -15.334 5.115   1.00 0.00 ? 11 TYR A CD2  9  
ATOM 9081  C CE1  . TYR A 1 11 ? -6.963  -14.416 5.614   1.00 0.00 ? 11 TYR A CE1  9  
ATOM 9082  C CE2  . TYR A 1 11 ? -5.074  -15.839 6.206   1.00 0.00 ? 11 TYR A CE2  9  
ATOM 9083  C CZ   . TYR A 1 11 ? -6.370  -15.359 6.479   1.00 0.00 ? 11 TYR A CZ   9  
ATOM 9084  O OH   . TYR A 1 11 ? -7.024  -15.800 7.582   1.00 0.00 ? 11 TYR A OH   9  
ATOM 9085  H H    . TYR A 1 11 ? -4.653  -16.183 1.457   1.00 0.00 ? 11 TYR A H    9  
ATOM 9086  H HA   . TYR A 1 11 ? -5.617  -14.175 1.754   1.00 0.00 ? 11 TYR A HA   9  
ATOM 9087  H HB2  . TYR A 1 11 ? -3.057  -13.945 3.326   1.00 0.00 ? 11 TYR A HB2  9  
ATOM 9088  H HB3  . TYR A 1 11 ? -4.221  -12.630 3.302   1.00 0.00 ? 11 TYR A HB3  9  
ATOM 9089  H HD1  . TYR A 1 11 ? -6.654  -13.117 3.933   1.00 0.00 ? 11 TYR A HD1  9  
ATOM 9090  H HD2  . TYR A 1 11 ? -3.326  -15.652 4.958   1.00 0.00 ? 11 TYR A HD2  9  
ATOM 9091  H HE1  . TYR A 1 11 ? -7.950  -14.026 5.819   1.00 0.00 ? 11 TYR A HE1  9  
ATOM 9092  H HE2  . TYR A 1 11 ? -4.619  -16.539 6.890   1.00 0.00 ? 11 TYR A HE2  9  
ATOM 9093  H HH   . TYR A 1 11 ? -7.639  -15.141 7.933   1.00 0.00 ? 11 TYR A HH   9  
ATOM 9094  N N    . ARG A 1 12 ? -4.814  -13.128 -0.437  1.00 0.00 ? 12 ARG A N    9  
ATOM 9095  C CA   . ARG A 1 12 ? -4.622  -12.195 -1.545  1.00 0.00 ? 12 ARG A CA   9  
ATOM 9096  C C    . ARG A 1 12 ? -4.817  -10.762 -1.072  1.00 0.00 ? 12 ARG A C    9  
ATOM 9097  O O    . ARG A 1 12 ? -3.972  -9.917  -1.346  1.00 0.00 ? 12 ARG A O    9  
ATOM 9098  C CB   . ARG A 1 12 ? -5.597  -12.541 -2.681  1.00 0.00 ? 12 ARG A CB   9  
ATOM 9099  C CG   . ARG A 1 12 ? -5.548  -11.518 -3.831  1.00 0.00 ? 12 ARG A CG   9  
ATOM 9100  C CD   . ARG A 1 12 ? -5.861  -12.132 -5.198  1.00 0.00 ? 12 ARG A CD   9  
ATOM 9101  N NE   . ARG A 1 12 ? -4.636  -12.678 -5.814  1.00 0.00 ? 12 ARG A NE   9  
ATOM 9102  C CZ   . ARG A 1 12 ? -4.243  -12.508 -7.084  1.00 0.00 ? 12 ARG A CZ   9  
ATOM 9103  N NH1  . ARG A 1 12 ? -5.066  -12.013 -8.004  1.00 0.00 ? 12 ARG A NH1  9  
ATOM 9104  N NH2  . ARG A 1 12 ? -3.005  -12.853 -7.416  1.00 0.00 ? 12 ARG A NH2  9  
ATOM 9105  H H    . ARG A 1 12 ? -5.555  -13.810 -0.519  1.00 0.00 ? 12 ARG A H    9  
ATOM 9106  H HA   . ARG A 1 12 ? -3.594  -12.281 -1.909  1.00 0.00 ? 12 ARG A HA   9  
ATOM 9107  H HB2  . ARG A 1 12 ? -5.346  -13.532 -3.061  1.00 0.00 ? 12 ARG A HB2  9  
ATOM 9108  H HB3  . ARG A 1 12 ? -6.616  -12.554 -2.278  1.00 0.00 ? 12 ARG A HB3  9  
ATOM 9109  H HG2  . ARG A 1 12 ? -6.272  -10.730 -3.629  1.00 0.00 ? 12 ARG A HG2  9  
ATOM 9110  H HG3  . ARG A 1 12 ? -4.565  -11.051 -3.881  1.00 0.00 ? 12 ARG A HG3  9  
ATOM 9111  H HD2  . ARG A 1 12 ? -6.621  -12.906 -5.102  1.00 0.00 ? 12 ARG A HD2  9  
ATOM 9112  H HD3  . ARG A 1 12 ? -6.260  -11.337 -5.826  1.00 0.00 ? 12 ARG A HD3  9  
ATOM 9113  H HE   . ARG A 1 12 ? -3.954  -13.041 -5.164  1.00 0.00 ? 12 ARG A HE   9  
ATOM 9114  H HH11 . ARG A 1 12 ? -5.953  -11.596 -7.724  1.00 0.00 ? 12 ARG A HH11 9  
ATOM 9115  H HH12 . ARG A 1 12 ? -4.817  -11.904 -8.984  1.00 0.00 ? 12 ARG A HH12 9  
ATOM 9116  H HH21 . ARG A 1 12 ? -2.356  -13.207 -6.716  1.00 0.00 ? 12 ARG A HH21 9  
ATOM 9117  H HH22 . ARG A 1 12 ? -2.573  -12.545 -8.288  1.00 0.00 ? 12 ARG A HH22 9  
ATOM 9118  N N    . GLN A 1 13 ? -5.927  -10.508 -0.372  1.00 0.00 ? 13 GLN A N    9  
ATOM 9119  C CA   . GLN A 1 13 ? -6.330  -9.168  0.028   1.00 0.00 ? 13 GLN A CA   9  
ATOM 9120  C C    . GLN A 1 13 ? -6.268  -8.241  -1.191  1.00 0.00 ? 13 GLN A C    9  
ATOM 9121  O O    . GLN A 1 13 ? -6.932  -8.519  -2.195  1.00 0.00 ? 13 GLN A O    9  
ATOM 9122  C CB   . GLN A 1 13 ? -5.532  -8.721  1.274   1.00 0.00 ? 13 GLN A CB   9  
ATOM 9123  C CG   . GLN A 1 13 ? -5.604  -9.695  2.467   1.00 0.00 ? 13 GLN A CG   9  
ATOM 9124  C CD   . GLN A 1 13 ? -6.888  -9.603  3.294   1.00 0.00 ? 13 GLN A CD   9  
ATOM 9125  O OE1  . GLN A 1 13 ? -6.823  -9.481  4.513   1.00 0.00 ? 13 GLN A OE1  9  
ATOM 9126  N NE2  . GLN A 1 13 ? -8.069  -9.737  2.706   1.00 0.00 ? 13 GLN A NE2  9  
ATOM 9127  H H    . GLN A 1 13 ? -6.568  -11.271 -0.219  1.00 0.00 ? 13 GLN A H    9  
ATOM 9128  H HA   . GLN A 1 13 ? -7.376  -9.187  0.301   1.00 0.00 ? 13 GLN A HA   9  
ATOM 9129  H HB2  . GLN A 1 13 ? -4.483  -8.618  0.995   1.00 0.00 ? 13 GLN A HB2  9  
ATOM 9130  H HB3  . GLN A 1 13 ? -5.885  -7.742  1.601   1.00 0.00 ? 13 GLN A HB3  9  
ATOM 9131  H HG2  . GLN A 1 13 ? -5.457  -10.723 2.142   1.00 0.00 ? 13 GLN A HG2  9  
ATOM 9132  H HG3  . GLN A 1 13 ? -4.769  -9.457  3.125   1.00 0.00 ? 13 GLN A HG3  9  
ATOM 9133  H HE21 . GLN A 1 13 ? -8.160  -9.828  1.693   1.00 0.00 ? 13 GLN A HE21 9  
ATOM 9134  H HE22 . GLN A 1 13 ? -8.891  -9.429  3.227   1.00 0.00 ? 13 GLN A HE22 9  
ATOM 9135  N N    . TYR A 1 14 ? -5.526  -7.147  -1.100  1.00 0.00 ? 14 TYR A N    9  
ATOM 9136  C CA   . TYR A 1 14 ? -5.516  -6.100  -2.093  1.00 0.00 ? 14 TYR A CA   9  
ATOM 9137  C C    . TYR A 1 14 ? -4.678  -6.529  -3.298  1.00 0.00 ? 14 TYR A C    9  
ATOM 9138  O O    . TYR A 1 14 ? -3.730  -7.311  -3.184  1.00 0.00 ? 14 TYR A O    9  
ATOM 9139  C CB   . TYR A 1 14 ? -4.985  -4.828  -1.427  1.00 0.00 ? 14 TYR A CB   9  
ATOM 9140  C CG   . TYR A 1 14 ? -3.609  -4.967  -0.807  1.00 0.00 ? 14 TYR A CG   9  
ATOM 9141  C CD1  . TYR A 1 14 ? -3.454  -5.406  0.523   1.00 0.00 ? 14 TYR A CD1  9  
ATOM 9142  C CD2  . TYR A 1 14 ? -2.476  -4.660  -1.574  1.00 0.00 ? 14 TYR A CD2  9  
ATOM 9143  C CE1  . TYR A 1 14 ? -2.164  -5.560  1.061   1.00 0.00 ? 14 TYR A CE1  9  
ATOM 9144  C CE2  . TYR A 1 14 ? -1.189  -4.791  -1.038  1.00 0.00 ? 14 TYR A CE2  9  
ATOM 9145  C CZ   . TYR A 1 14 ? -1.026  -5.239  0.287   1.00 0.00 ? 14 TYR A CZ   9  
ATOM 9146  O OH   . TYR A 1 14 ? 0.219   -5.342  0.819   1.00 0.00 ? 14 TYR A OH   9  
ATOM 9147  H H    . TYR A 1 14 ? -4.955  -7.006  -0.284  1.00 0.00 ? 14 TYR A H    9  
ATOM 9148  H HA   . TYR A 1 14 ? -6.543  -5.920  -2.416  1.00 0.00 ? 14 TYR A HA   9  
ATOM 9149  H HB2  . TYR A 1 14 ? -4.955  -4.046  -2.178  1.00 0.00 ? 14 TYR A HB2  9  
ATOM 9150  H HB3  . TYR A 1 14 ? -5.691  -4.513  -0.658  1.00 0.00 ? 14 TYR A HB3  9  
ATOM 9151  H HD1  . TYR A 1 14 ? -4.322  -5.612  1.133   1.00 0.00 ? 14 TYR A HD1  9  
ATOM 9152  H HD2  . TYR A 1 14 ? -2.575  -4.288  -2.579  1.00 0.00 ? 14 TYR A HD2  9  
ATOM 9153  H HE1  . TYR A 1 14 ? -2.043  -5.907  2.071   1.00 0.00 ? 14 TYR A HE1  9  
ATOM 9154  H HE2  . TYR A 1 14 ? -0.343  -4.538  -1.664  1.00 0.00 ? 14 TYR A HE2  9  
ATOM 9155  H HH   . TYR A 1 14 ? 0.279   -6.036  1.490   1.00 0.00 ? 14 TYR A HH   9  
ATOM 9156  N N    . ASN A 1 15 ? -5.016  -5.996  -4.471  1.00 0.00 ? 15 ASN A N    9  
ATOM 9157  C CA   . ASN A 1 15 ? -4.207  -6.154  -5.675  1.00 0.00 ? 15 ASN A CA   9  
ATOM 9158  C C    . ASN A 1 15 ? -3.000  -5.238  -5.595  1.00 0.00 ? 15 ASN A C    9  
ATOM 9159  O O    . ASN A 1 15 ? -3.056  -4.200  -4.935  1.00 0.00 ? 15 ASN A O    9  
ATOM 9160  C CB   . ASN A 1 15 ? -4.995  -5.827  -6.953  1.00 0.00 ? 15 ASN A CB   9  
ATOM 9161  C CG   . ASN A 1 15 ? -6.255  -6.659  -7.139  1.00 0.00 ? 15 ASN A CG   9  
ATOM 9162  O OD1  . ASN A 1 15 ? -6.416  -7.730  -6.563  1.00 0.00 ? 15 ASN A OD1  9  
ATOM 9163  N ND2  . ASN A 1 15 ? -7.182  -6.159  -7.929  1.00 0.00 ? 15 ASN A ND2  9  
ATOM 9164  H H    . ASN A 1 15 ? -5.795  -5.358  -4.492  1.00 0.00 ? 15 ASN A H    9  
ATOM 9165  H HA   . ASN A 1 15 ? -3.853  -7.179  -5.724  1.00 0.00 ? 15 ASN A HA   9  
ATOM 9166  H HB2  . ASN A 1 15 ? -5.251  -4.770  -6.955  1.00 0.00 ? 15 ASN A HB2  9  
ATOM 9167  H HB3  . ASN A 1 15 ? -4.351  -6.014  -7.814  1.00 0.00 ? 15 ASN A HB3  9  
ATOM 9168  H HD21 . ASN A 1 15 ? -7.081  -5.237  -8.342  1.00 0.00 ? 15 ASN A HD21 9  
ATOM 9169  H HD22 . ASN A 1 15 ? -8.005  -6.710  -8.133  1.00 0.00 ? 15 ASN A HD22 9  
ATOM 9170  N N    . SER A 1 16 ? -1.949  -5.543  -6.353  1.00 0.00 ? 16 SER A N    9  
ATOM 9171  C CA   . SER A 1 16 ? -0.780  -4.678  -6.457  1.00 0.00 ? 16 SER A CA   9  
ATOM 9172  C C    . SER A 1 16 ? -1.120  -3.268  -6.956  1.00 0.00 ? 16 SER A C    9  
ATOM 9173  O O    . SER A 1 16 ? -0.331  -2.340  -6.778  1.00 0.00 ? 16 SER A O    9  
ATOM 9174  C CB   . SER A 1 16 ? 0.248   -5.328  -7.382  1.00 0.00 ? 16 SER A CB   9  
ATOM 9175  O OG   . SER A 1 16 ? 0.396   -6.705  -7.101  1.00 0.00 ? 16 SER A OG   9  
ATOM 9176  H H    . SER A 1 16 ? -1.913  -6.414  -6.875  1.00 0.00 ? 16 SER A H    9  
ATOM 9177  H HA   . SER A 1 16 ? -0.354  -4.580  -5.468  1.00 0.00 ? 16 SER A HA   9  
ATOM 9178  H HB2  . SER A 1 16 ? -0.092  -5.228  -8.412  1.00 0.00 ? 16 SER A HB2  9  
ATOM 9179  H HB3  . SER A 1 16 ? 1.201   -4.810  -7.258  1.00 0.00 ? 16 SER A HB3  9  
ATOM 9180  H HG   . SER A 1 16 ? 0.786   -7.129  -7.895  1.00 0.00 ? 16 SER A HG   9  
ATOM 9181  N N    . GLU A 1 17 ? -2.273  -3.125  -7.606  1.00 0.00 ? 17 GLU A N    9  
ATOM 9182  C CA   . GLU A 1 17 ? -2.876  -1.879  -8.044  1.00 0.00 ? 17 GLU A CA   9  
ATOM 9183  C C    . GLU A 1 17 ? -3.498  -1.180  -6.832  1.00 0.00 ? 17 GLU A C    9  
ATOM 9184  O O    . GLU A 1 17 ? -3.103  -0.072  -6.499  1.00 0.00 ? 17 GLU A O    9  
ATOM 9185  C CB   . GLU A 1 17 ? -3.937  -2.200  -9.113  1.00 0.00 ? 17 GLU A CB   9  
ATOM 9186  C CG   . GLU A 1 17 ? -3.398  -3.060  -10.266 1.00 0.00 ? 17 GLU A CG   9  
ATOM 9187  C CD   . GLU A 1 17 ? -2.318  -2.352  -11.082 1.00 0.00 ? 17 GLU A CD   9  
ATOM 9188  O OE1  . GLU A 1 17 ? -2.578  -1.263  -11.636 1.00 0.00 ? 17 GLU A OE1  9  
ATOM 9189  O OE2  . GLU A 1 17 ? -1.196  -2.902  -11.179 1.00 0.00 ? 17 GLU A OE2  9  
ATOM 9190  H H    . GLU A 1 17 ? -2.809  -3.965  -7.753  1.00 0.00 ? 17 GLU A H    9  
ATOM 9191  H HA   . GLU A 1 17 ? -2.111  -1.224  -8.469  1.00 0.00 ? 17 GLU A HA   9  
ATOM 9192  H HB2  . GLU A 1 17 ? -4.749  -2.759  -8.648  1.00 0.00 ? 17 GLU A HB2  9  
ATOM 9193  H HB3  . GLU A 1 17 ? -4.346  -1.270  -9.509  1.00 0.00 ? 17 GLU A HB3  9  
ATOM 9194  H HG2  . GLU A 1 17 ? -2.991  -3.992  -9.855  1.00 0.00 ? 17 GLU A HG2  9  
ATOM 9195  H HG3  . GLU A 1 17 ? -4.225  -3.316  -10.926 1.00 0.00 ? 17 GLU A HG3  9  
ATOM 9196  N N    . ILE A 1 18 ? -4.429  -1.856  -6.142  1.00 0.00 ? 18 ILE A N    9  
ATOM 9197  C CA   . ILE A 1 18 ? -5.197  -1.383  -4.981  1.00 0.00 ? 18 ILE A CA   9  
ATOM 9198  C C    . ILE A 1 18 ? -4.280  -0.760  -3.933  1.00 0.00 ? 18 ILE A C    9  
ATOM 9199  O O    . ILE A 1 18 ? -4.685  0.184   -3.262  1.00 0.00 ? 18 ILE A O    9  
ATOM 9200  C CB   . ILE A 1 18 ? -5.990  -2.565  -4.368  1.00 0.00 ? 18 ILE A CB   9  
ATOM 9201  C CG1  . ILE A 1 18 ? -7.049  -3.135  -5.328  1.00 0.00 ? 18 ILE A CG1  9  
ATOM 9202  C CG2  . ILE A 1 18 ? -6.636  -2.285  -2.996  1.00 0.00 ? 18 ILE A CG2  9  
ATOM 9203  C CD1  . ILE A 1 18 ? -8.364  -2.356  -5.322  1.00 0.00 ? 18 ILE A CD1  9  
ATOM 9204  H H    . ILE A 1 18 ? -4.606  -2.799  -6.443  1.00 0.00 ? 18 ILE A H    9  
ATOM 9205  H HA   . ILE A 1 18 ? -5.899  -0.619  -5.308  1.00 0.00 ? 18 ILE A HA   9  
ATOM 9206  H HB   . ILE A 1 18 ? -5.269  -3.357  -4.207  1.00 0.00 ? 18 ILE A HB   9  
ATOM 9207  H HG12 . ILE A 1 18 ? -6.659  -3.147  -6.339  1.00 0.00 ? 18 ILE A HG12 9  
ATOM 9208  H HG13 . ILE A 1 18 ? -7.256  -4.165  -5.041  1.00 0.00 ? 18 ILE A HG13 9  
ATOM 9209  H HG21 . ILE A 1 18 ? -7.159  -3.172  -2.636  1.00 0.00 ? 18 ILE A HG21 9  
ATOM 9210  H HG22 . ILE A 1 18 ? -5.881  -2.014  -2.259  1.00 0.00 ? 18 ILE A HG22 9  
ATOM 9211  H HG23 . ILE A 1 18 ? -7.349  -1.471  -3.073  1.00 0.00 ? 18 ILE A HG23 9  
ATOM 9212  H HD11 . ILE A 1 18 ? -8.887  -2.553  -4.386  1.00 0.00 ? 18 ILE A HD11 9  
ATOM 9213  H HD12 . ILE A 1 18 ? -8.158  -1.291  -5.412  1.00 0.00 ? 18 ILE A HD12 9  
ATOM 9214  H HD13 . ILE A 1 18 ? -8.989  -2.674  -6.151  1.00 0.00 ? 18 ILE A HD13 9  
ATOM 9215  N N    . LEU A 1 19 ? -3.069  -1.292  -3.770  1.00 0.00 ? 19 LEU A N    9  
ATOM 9216  C CA   . LEU A 1 19 ? -2.107  -0.726  -2.842  1.00 0.00 ? 19 LEU A CA   9  
ATOM 9217  C C    . LEU A 1 19 ? -1.785  0.730   -3.170  1.00 0.00 ? 19 LEU A C    9  
ATOM 9218  O O    . LEU A 1 19 ? -1.845  1.573   -2.278  1.00 0.00 ? 19 LEU A O    9  
ATOM 9219  C CB   . LEU A 1 19 ? -0.872  -1.628  -2.757  1.00 0.00 ? 19 LEU A CB   9  
ATOM 9220  C CG   . LEU A 1 19 ? 0.227   -1.079  -1.837  1.00 0.00 ? 19 LEU A CG   9  
ATOM 9221  C CD1  . LEU A 1 19 ? -0.264  -0.830  -0.401  1.00 0.00 ? 19 LEU A CD1  9  
ATOM 9222  C CD2  . LEU A 1 19 ? 1.352   -2.110  -1.777  1.00 0.00 ? 19 LEU A CD2  9  
ATOM 9223  H H    . LEU A 1 19 ? -2.826  -2.089  -4.343  1.00 0.00 ? 19 LEU A H    9  
ATOM 9224  H HA   . LEU A 1 19 ? -2.577  -0.712  -1.865  1.00 0.00 ? 19 LEU A HA   9  
ATOM 9225  H HB2  . LEU A 1 19 ? -1.200  -2.570  -2.353  1.00 0.00 ? 19 LEU A HB2  9  
ATOM 9226  H HB3  . LEU A 1 19 ? -0.461  -1.841  -3.746  1.00 0.00 ? 19 LEU A HB3  9  
ATOM 9227  H HG   . LEU A 1 19 ? 0.625   -0.158  -2.258  1.00 0.00 ? 19 LEU A HG   9  
ATOM 9228  H HD11 . LEU A 1 19 ? -1.022  -0.047  -0.390  1.00 0.00 ? 19 LEU A HD11 9  
ATOM 9229  H HD12 . LEU A 1 19 ? -0.674  -1.745  0.023   1.00 0.00 ? 19 LEU A HD12 9  
ATOM 9230  H HD13 . LEU A 1 19 ? 0.554   -0.485  0.222   1.00 0.00 ? 19 LEU A HD13 9  
ATOM 9231  H HD21 . LEU A 1 19 ? 1.059   -2.955  -1.154  1.00 0.00 ? 19 LEU A HD21 9  
ATOM 9232  H HD22 . LEU A 1 19 ? 1.591   -2.467  -2.779  1.00 0.00 ? 19 LEU A HD22 9  
ATOM 9233  H HD23 . LEU A 1 19 ? 2.224   -1.625  -1.359  1.00 0.00 ? 19 LEU A HD23 9  
ATOM 9234  N N    . GLU A 1 20 ? -1.479  1.039   -4.429  1.00 0.00 ? 20 GLU A N    9  
ATOM 9235  C CA   . GLU A 1 20 ? -1.174  2.403   -4.836  1.00 0.00 ? 20 GLU A CA   9  
ATOM 9236  C C    . GLU A 1 20 ? -2.412  3.288   -4.667  1.00 0.00 ? 20 GLU A C    9  
ATOM 9237  O O    . GLU A 1 20 ? -2.272  4.431   -4.246  1.00 0.00 ? 20 GLU A O    9  
ATOM 9238  C CB   . GLU A 1 20 ? -0.642  2.440   -6.278  1.00 0.00 ? 20 GLU A CB   9  
ATOM 9239  C CG   . GLU A 1 20 ? 0.689   1.689   -6.451  1.00 0.00 ? 20 GLU A CG   9  
ATOM 9240  C CD   . GLU A 1 20 ? 1.829   2.281   -5.614  1.00 0.00 ? 20 GLU A CD   9  
ATOM 9241  O OE1  . GLU A 1 20 ? 2.242   3.438   -5.867  1.00 0.00 ? 20 GLU A OE1  9  
ATOM 9242  O OE2  . GLU A 1 20 ? 2.333   1.568   -4.710  1.00 0.00 ? 20 GLU A OE2  9  
ATOM 9243  H H    . GLU A 1 20 ? -1.594  0.345   -5.159  1.00 0.00 ? 20 GLU A H    9  
ATOM 9244  H HA   . GLU A 1 20 ? -0.397  2.796   -4.180  1.00 0.00 ? 20 GLU A HA   9  
ATOM 9245  H HB2  . GLU A 1 20 ? -1.382  2.005   -6.949  1.00 0.00 ? 20 GLU A HB2  9  
ATOM 9246  H HB3  . GLU A 1 20 ? -0.497  3.478   -6.576  1.00 0.00 ? 20 GLU A HB3  9  
ATOM 9247  H HG2  . GLU A 1 20 ? 0.550   0.640   -6.192  1.00 0.00 ? 20 GLU A HG2  9  
ATOM 9248  H HG3  . GLU A 1 20 ? 0.977   1.719   -7.500  1.00 0.00 ? 20 GLU A HG3  9  
ATOM 9249  N N    . GLU A 1 21 ? -3.620  2.776   -4.909  1.00 0.00 ? 21 GLU A N    9  
ATOM 9250  C CA   . GLU A 1 21 ? -4.885  3.479   -4.710  1.00 0.00 ? 21 GLU A CA   9  
ATOM 9251  C C    . GLU A 1 21 ? -5.082  3.867   -3.250  1.00 0.00 ? 21 GLU A C    9  
ATOM 9252  O O    . GLU A 1 21 ? -5.368  5.021   -2.944  1.00 0.00 ? 21 GLU A O    9  
ATOM 9253  C CB   . GLU A 1 21 ? -6.037  2.596   -5.142  1.00 0.00 ? 21 GLU A CB   9  
ATOM 9254  C CG   . GLU A 1 21 ? -5.923  1.930   -6.499  1.00 0.00 ? 21 GLU A CG   9  
ATOM 9255  C CD   . GLU A 1 21 ? -6.009  2.918   -7.652  1.00 0.00 ? 21 GLU A CD   9  
ATOM 9256  O OE1  . GLU A 1 21 ? -5.068  3.710   -7.877  1.00 0.00 ? 21 GLU A OE1  9  
ATOM 9257  O OE2  . GLU A 1 21 ? -7.011  2.873   -8.392  1.00 0.00 ? 21 GLU A OE2  9  
ATOM 9258  H H    . GLU A 1 21 ? -3.680  1.834   -5.274  1.00 0.00 ? 21 GLU A H    9  
ATOM 9259  H HA   . GLU A 1 21 ? -4.951  4.372   -5.313  1.00 0.00 ? 21 GLU A HA   9  
ATOM 9260  H HB2  . GLU A 1 21 ? -6.151  1.818   -4.405  1.00 0.00 ? 21 GLU A HB2  9  
ATOM 9261  H HB3  . GLU A 1 21 ? -6.930  3.201   -5.141  1.00 0.00 ? 21 GLU A HB3  9  
ATOM 9262  H HG2  . GLU A 1 21 ? -5.000  1.378   -6.583  1.00 0.00 ? 21 GLU A HG2  9  
ATOM 9263  H HG3  . GLU A 1 21 ? -6.734  1.209   -6.526  1.00 0.00 ? 21 GLU A HG3  9  
ATOM 9264  N N    . ALA A 1 22 ? -4.929  2.897   -2.354  1.00 0.00 ? 22 ALA A N    9  
ATOM 9265  C CA   . ALA A 1 22 ? -5.081  3.053   -0.908  1.00 0.00 ? 22 ALA A CA   9  
ATOM 9266  C C    . ALA A 1 22 ? -4.009  3.960   -0.308  1.00 0.00 ? 22 ALA A C    9  
ATOM 9267  O O    . ALA A 1 22 ? -4.206  4.523   0.766   1.00 0.00 ? 22 ALA A O    9  
ATOM 9268  C CB   . ALA A 1 22 ? -4.987  1.675   -0.264  1.00 0.00 ? 22 ALA A CB   9  
ATOM 9269  H H    . ALA A 1 22 ? -4.738  1.981   -2.763  1.00 0.00 ? 22 ALA A H    9  
ATOM 9270  H HA   . ALA A 1 22 ? -6.056  3.502   -0.677  1.00 0.00 ? 22 ALA A HA   9  
ATOM 9271  H HB1  . ALA A 1 22 ? -5.586  0.975   -0.838  1.00 0.00 ? 22 ALA A HB1  9  
ATOM 9272  H HB2  . ALA A 1 22 ? -3.952  1.337   -0.279  1.00 0.00 ? 22 ALA A HB2  9  
ATOM 9273  H HB3  . ALA A 1 22 ? -5.351  1.725   0.762   1.00 0.00 ? 22 ALA A HB3  9  
ATOM 9274  N N    . ILE A 1 23 ? -2.879  4.117   -0.984  1.00 0.00 ? 23 ILE A N    9  
ATOM 9275  C CA   . ILE A 1 23 ? -1.901  5.138   -0.658  1.00 0.00 ? 23 ILE A CA   9  
ATOM 9276  C C    . ILE A 1 23 ? -2.428  6.470   -1.199  1.00 0.00 ? 23 ILE A C    9  
ATOM 9277  O O    . ILE A 1 23 ? -2.497  7.437   -0.447  1.00 0.00 ? 23 ILE A O    9  
ATOM 9278  C CB   . ILE A 1 23 ? -0.545  4.680   -1.217  1.00 0.00 ? 23 ILE A CB   9  
ATOM 9279  C CG1  . ILE A 1 23 ? -0.040  3.507   -0.350  1.00 0.00 ? 23 ILE A CG1  9  
ATOM 9280  C CG2  . ILE A 1 23 ? 0.513   5.788   -1.251  1.00 0.00 ? 23 ILE A CG2  9  
ATOM 9281  C CD1  . ILE A 1 23 ? 0.932   2.631   -1.135  1.00 0.00 ? 23 ILE A CD1  9  
ATOM 9282  H H    . ILE A 1 23 ? -2.720  3.534   -1.799  1.00 0.00 ? 23 ILE A H    9  
ATOM 9283  H HA   . ILE A 1 23 ? -1.813  5.221   0.426   1.00 0.00 ? 23 ILE A HA   9  
ATOM 9284  H HB   . ILE A 1 23 ? -0.706  4.330   -2.238  1.00 0.00 ? 23 ILE A HB   9  
ATOM 9285  H HG12 . ILE A 1 23 ? 0.463   3.886   0.537   1.00 0.00 ? 23 ILE A HG12 9  
ATOM 9286  H HG13 . ILE A 1 23 ? -0.875  2.892   0.005   1.00 0.00 ? 23 ILE A HG13 9  
ATOM 9287  H HG21 . ILE A 1 23 ? 1.480   5.376   -1.536  1.00 0.00 ? 23 ILE A HG21 9  
ATOM 9288  H HG22 . ILE A 1 23 ? 0.241   6.525   -2.006  1.00 0.00 ? 23 ILE A HG22 9  
ATOM 9289  H HG23 . ILE A 1 23 ? 0.595   6.263   -0.275  1.00 0.00 ? 23 ILE A HG23 9  
ATOM 9290  H HD11 . ILE A 1 23 ? 1.938   3.041   -1.067  1.00 0.00 ? 23 ILE A HD11 9  
ATOM 9291  H HD12 . ILE A 1 23 ? 0.909   1.635   -0.711  1.00 0.00 ? 23 ILE A HD12 9  
ATOM 9292  H HD13 . ILE A 1 23 ? 0.642   2.555   -2.181  1.00 0.00 ? 23 ILE A HD13 9  
ATOM 9293  N N    . SER A 1 24 ? -2.875  6.508   -2.456  1.00 0.00 ? 24 SER A N    9  
ATOM 9294  C CA   . SER A 1 24 ? -3.440  7.662   -3.144  1.00 0.00 ? 24 SER A CA   9  
ATOM 9295  C C    . SER A 1 24 ? -4.575  8.327   -2.363  1.00 0.00 ? 24 SER A C    9  
ATOM 9296  O O    . SER A 1 24 ? -4.622  9.553   -2.328  1.00 0.00 ? 24 SER A O    9  
ATOM 9297  C CB   . SER A 1 24 ? -3.919  7.240   -4.543  1.00 0.00 ? 24 SER A CB   9  
ATOM 9298  O OG   . SER A 1 24 ? -3.003  7.662   -5.533  1.00 0.00 ? 24 SER A OG   9  
ATOM 9299  H H    . SER A 1 24 ? -2.856  5.647   -2.991  1.00 0.00 ? 24 SER A H    9  
ATOM 9300  H HA   . SER A 1 24 ? -2.651  8.407   -3.256  1.00 0.00 ? 24 SER A HA   9  
ATOM 9301  H HB2  . SER A 1 24 ? -4.053  6.157   -4.605  1.00 0.00 ? 24 SER A HB2  9  
ATOM 9302  H HB3  . SER A 1 24 ? -4.883  7.698   -4.752  1.00 0.00 ? 24 SER A HB3  9  
ATOM 9303  H HG   . SER A 1 24 ? -2.128  7.273   -5.326  1.00 0.00 ? 24 SER A HG   9  
ATOM 9304  N N    . VAL A 1 25 ? -5.486  7.575   -1.736  1.00 0.00 ? 25 VAL A N    9  
ATOM 9305  C CA   . VAL A 1 25 ? -6.529  8.170   -0.903  1.00 0.00 ? 25 VAL A CA   9  
ATOM 9306  C C    . VAL A 1 25 ? -5.867  8.994   0.203   1.00 0.00 ? 25 VAL A C    9  
ATOM 9307  O O    . VAL A 1 25 ? -6.075  10.194  0.294   1.00 0.00 ? 25 VAL A O    9  
ATOM 9308  C CB   . VAL A 1 25 ? -7.555  7.124   -0.379  1.00 0.00 ? 25 VAL A CB   9  
ATOM 9309  C CG1  . VAL A 1 25 ? -8.832  7.104   -1.208  1.00 0.00 ? 25 VAL A CG1  9  
ATOM 9310  C CG2  . VAL A 1 25 ? -7.039  5.722   -0.282  1.00 0.00 ? 25 VAL A CG2  9  
ATOM 9311  H H    . VAL A 1 25 ? -5.439  6.565   -1.837  1.00 0.00 ? 25 VAL A H    9  
ATOM 9312  H HA   . VAL A 1 25 ? -7.060  8.877   -1.536  1.00 0.00 ? 25 VAL A HA   9  
ATOM 9313  H HB   . VAL A 1 25 ? -7.832  7.288   0.647   1.00 0.00 ? 25 VAL A HB   9  
ATOM 9314  H HG11 . VAL A 1 25 ? -8.590  6.869   -2.243  1.00 0.00 ? 25 VAL A HG11 9  
ATOM 9315  H HG12 . VAL A 1 25 ? -9.510  6.362   -0.795  1.00 0.00 ? 25 VAL A HG12 9  
ATOM 9316  H HG13 . VAL A 1 25 ? -9.337  8.057   -1.163  1.00 0.00 ? 25 VAL A HG13 9  
ATOM 9317  H HG21 . VAL A 1 25 ? -7.047  5.266   -1.265  1.00 0.00 ? 25 VAL A HG21 9  
ATOM 9318  H HG22 . VAL A 1 25 ? -6.053  5.764   0.146   1.00 0.00 ? 25 VAL A HG22 9  
ATOM 9319  H HG23 . VAL A 1 25 ? -7.680  5.162   0.392   1.00 0.00 ? 25 VAL A HG23 9  
ATOM 9320  N N    . VAL A 1 26 ? -5.049  8.371   1.032   1.00 0.00 ? 26 VAL A N    9  
ATOM 9321  C CA   . VAL A 1 26 ? -4.431  8.970   2.212   1.00 0.00 ? 26 VAL A CA   9  
ATOM 9322  C C    . VAL A 1 26 ? -3.536  10.143  1.816   1.00 0.00 ? 26 VAL A C    9  
ATOM 9323  O O    . VAL A 1 26 ? -3.684  11.241  2.349   1.00 0.00 ? 26 VAL A O    9  
ATOM 9324  C CB   . VAL A 1 26 ? -3.680  7.883   3.007   1.00 0.00 ? 26 VAL A CB   9  
ATOM 9325  C CG1  . VAL A 1 26 ? -3.080  8.426   4.311   1.00 0.00 ? 26 VAL A CG1  9  
ATOM 9326  C CG2  . VAL A 1 26 ? -4.639  6.736   3.356   1.00 0.00 ? 26 VAL A CG2  9  
ATOM 9327  H H    . VAL A 1 26 ? -4.846  7.423   0.789   1.00 0.00 ? 26 VAL A H    9  
ATOM 9328  H HA   . VAL A 1 26 ? -5.225  9.372   2.835   1.00 0.00 ? 26 VAL A HA   9  
ATOM 9329  H HB   . VAL A 1 26 ? -2.871  7.480   2.396   1.00 0.00 ? 26 VAL A HB   9  
ATOM 9330  H HG11 . VAL A 1 26 ? -2.347  9.204   4.090   1.00 0.00 ? 26 VAL A HG11 9  
ATOM 9331  H HG12 . VAL A 1 26 ? -3.864  8.848   4.940   1.00 0.00 ? 26 VAL A HG12 9  
ATOM 9332  H HG13 . VAL A 1 26 ? -2.574  7.624   4.842   1.00 0.00 ? 26 VAL A HG13 9  
ATOM 9333  H HG21 . VAL A 1 26 ? -4.966  6.229   2.451   1.00 0.00 ? 26 VAL A HG21 9  
ATOM 9334  H HG22 . VAL A 1 26 ? -4.129  5.996   3.970   1.00 0.00 ? 26 VAL A HG22 9  
ATOM 9335  H HG23 . VAL A 1 26 ? -5.514  7.136   3.870   1.00 0.00 ? 26 VAL A HG23 9  
ATOM 9336  N N    . MET A 1 27 ? -2.643  9.925   0.853   1.00 0.00 ? 27 MET A N    9  
ATOM 9337  C CA   . MET A 1 27 ? -1.714  10.911  0.329   1.00 0.00 ? 27 MET A CA   9  
ATOM 9338  C C    . MET A 1 27 ? -2.452  12.158  -0.133  1.00 0.00 ? 27 MET A C    9  
ATOM 9339  O O    . MET A 1 27 ? -2.100  13.266  0.272   1.00 0.00 ? 27 MET A O    9  
ATOM 9340  C CB   . MET A 1 27 ? -0.957  10.287  -0.839  1.00 0.00 ? 27 MET A CB   9  
ATOM 9341  C CG   . MET A 1 27 ? 0.108   9.309   -0.349  1.00 0.00 ? 27 MET A CG   9  
ATOM 9342  S SD   . MET A 1 27 ? 1.781   9.978   -0.429  1.00 0.00 ? 27 MET A SD   9  
ATOM 9343  C CE   . MET A 1 27 ? 2.664   8.505   -0.979  1.00 0.00 ? 27 MET A CE   9  
ATOM 9344  H H    . MET A 1 27 ? -2.612  9.005   0.428   1.00 0.00 ? 27 MET A H    9  
ATOM 9345  H HA   . MET A 1 27 ? -1.006  11.193  1.112   1.00 0.00 ? 27 MET A HA   9  
ATOM 9346  H HB2  . MET A 1 27 ? -1.654  9.772   -1.501  1.00 0.00 ? 27 MET A HB2  9  
ATOM 9347  H HB3  . MET A 1 27 ? -0.479  11.072  -1.415  1.00 0.00 ? 27 MET A HB3  9  
ATOM 9348  H HG2  . MET A 1 27 ? -0.096  8.995   0.674   1.00 0.00 ? 27 MET A HG2  9  
ATOM 9349  H HG3  . MET A 1 27 ? 0.051   8.429   -0.976  1.00 0.00 ? 27 MET A HG3  9  
ATOM 9350  H HE1  . MET A 1 27 ? 2.234   8.144   -1.914  1.00 0.00 ? 27 MET A HE1  9  
ATOM 9351  H HE2  . MET A 1 27 ? 3.706   8.765   -1.145  1.00 0.00 ? 27 MET A HE2  9  
ATOM 9352  H HE3  . MET A 1 27 ? 2.597   7.733   -0.214  1.00 0.00 ? 27 MET A HE3  9  
ATOM 9353  N N    . SER A 1 28 ? -3.485  12.002  -0.956  1.00 0.00 ? 28 SER A N    9  
ATOM 9354  C CA   . SER A 1 28 ? -4.293  13.088  -1.455  1.00 0.00 ? 28 SER A CA   9  
ATOM 9355  C C    . SER A 1 28 ? -5.427  13.460  -0.477  1.00 0.00 ? 28 SER A C    9  
ATOM 9356  O O    . SER A 1 28 ? -6.380  14.123  -0.887  1.00 0.00 ? 28 SER A O    9  
ATOM 9357  C CB   . SER A 1 28 ? -4.791  12.681  -2.842  1.00 0.00 ? 28 SER A CB   9  
ATOM 9358  O OG   . SER A 1 28 ? -3.795  12.023  -3.616  1.00 0.00 ? 28 SER A OG   9  
ATOM 9359  H H    . SER A 1 28 ? -3.723  11.115  -1.386  1.00 0.00 ? 28 SER A H    9  
ATOM 9360  H HA   . SER A 1 28 ? -3.660  13.967  -1.578  1.00 0.00 ? 28 SER A HA   9  
ATOM 9361  H HB2  . SER A 1 28 ? -5.648  12.018  -2.723  1.00 0.00 ? 28 SER A HB2  9  
ATOM 9362  H HB3  . SER A 1 28 ? -5.099  13.570  -3.368  1.00 0.00 ? 28 SER A HB3  9  
ATOM 9363  H HG   . SER A 1 28 ? -3.300  12.661  -4.160  1.00 0.00 ? 28 SER A HG   9  
ATOM 9364  N N    . GLY A 1 29 ? -5.352  13.055  0.800   1.00 0.00 ? 29 GLY A N    9  
ATOM 9365  C CA   . GLY A 1 29 ? -6.131  13.646  1.883   1.00 0.00 ? 29 GLY A CA   9  
ATOM 9366  C C    . GLY A 1 29 ? -7.529  13.057  2.046   1.00 0.00 ? 29 GLY A C    9  
ATOM 9367  O O    . GLY A 1 29 ? -8.336  13.595  2.802   1.00 0.00 ? 29 GLY A O    9  
ATOM 9368  H H    . GLY A 1 29 ? -4.656  12.365  1.076   1.00 0.00 ? 29 GLY A H    9  
ATOM 9369  H HA2  . GLY A 1 29 ? -5.586  13.506  2.816   1.00 0.00 ? 29 GLY A HA2  9  
ATOM 9370  H HA3  . GLY A 1 29 ? -6.230  14.717  1.703   1.00 0.00 ? 29 GLY A HA3  9  
ATOM 9371  N N    . LYS A 1 30 ? -7.851  11.953  1.372   1.00 0.00 ? 30 LYS A N    9  
ATOM 9372  C CA   . LYS A 1 30 ? -9.207  11.407  1.320   1.00 0.00 ? 30 LYS A CA   9  
ATOM 9373  C C    . LYS A 1 30 ? -9.605  10.759  2.644   1.00 0.00 ? 30 LYS A C    9  
ATOM 9374  O O    . LYS A 1 30 ? -10.798 10.640  2.932   1.00 0.00 ? 30 LYS A O    9  
ATOM 9375  C CB   . LYS A 1 30 ? -9.279  10.359  0.211   1.00 0.00 ? 30 LYS A CB   9  
ATOM 9376  C CG   . LYS A 1 30 ? -8.874  10.869  -1.181  1.00 0.00 ? 30 LYS A CG   9  
ATOM 9377  C CD   . LYS A 1 30 ? -9.741  11.969  -1.786  1.00 0.00 ? 30 LYS A CD   9  
ATOM 9378  C CE   . LYS A 1 30 ? -9.353  11.989  -3.270  1.00 0.00 ? 30 LYS A CE   9  
ATOM 9379  N NZ   . LYS A 1 30 ? -10.118 12.967  -4.059  1.00 0.00 ? 30 LYS A NZ   9  
ATOM 9380  H H    . LYS A 1 30 ? -7.104  11.440  0.896   1.00 0.00 ? 30 LYS A H    9  
ATOM 9381  H HA   . LYS A 1 30 ? -9.909  12.207  1.092   1.00 0.00 ? 30 LYS A HA   9  
ATOM 9382  H HB2  . LYS A 1 30 ? -8.610  9.550   0.489   1.00 0.00 ? 30 LYS A HB2  9  
ATOM 9383  H HB3  . LYS A 1 30 ? -10.273 9.916   0.164   1.00 0.00 ? 30 LYS A HB3  9  
ATOM 9384  H HG2  . LYS A 1 30 ? -7.842  11.216  -1.176  1.00 0.00 ? 30 LYS A HG2  9  
ATOM 9385  H HG3  . LYS A 1 30 ? -8.926  10.021  -1.851  1.00 0.00 ? 30 LYS A HG3  9  
ATOM 9386  H HD2  . LYS A 1 30 ? -10.795 11.721  -1.668  1.00 0.00 ? 30 LYS A HD2  9  
ATOM 9387  H HD3  . LYS A 1 30 ? -9.519  12.928  -1.313  1.00 0.00 ? 30 LYS A HD3  9  
ATOM 9388  H HE2  . LYS A 1 30 ? -8.290  12.216  -3.346  1.00 0.00 ? 30 LYS A HE2  9  
ATOM 9389  H HE3  . LYS A 1 30 ? -9.518  10.998  -3.695  1.00 0.00 ? 30 LYS A HE3  9  
ATOM 9390  H HZ1  . LYS A 1 30 ? -9.809  12.951  -5.024  1.00 0.00 ? 30 LYS A HZ1  9  
ATOM 9391  H HZ2  . LYS A 1 30 ? -11.099 12.715  -4.034  1.00 0.00 ? 30 LYS A HZ2  9  
ATOM 9392  H HZ3  . LYS A 1 30 ? -9.990  13.910  -3.697  1.00 0.00 ? 30 LYS A HZ3  9  
ATOM 9393  N N    . MET A 1 31 ? -8.637  10.265  3.419   1.00 0.00 ? 31 MET A N    9  
ATOM 9394  C CA   . MET A 1 31 ? -8.847  9.630   4.712   1.00 0.00 ? 31 MET A CA   9  
ATOM 9395  C C    . MET A 1 31 ? -7.508  9.409   5.417   1.00 0.00 ? 31 MET A C    9  
ATOM 9396  O O    . MET A 1 31 ? -6.453  9.657   4.844   1.00 0.00 ? 31 MET A O    9  
ATOM 9397  C CB   . MET A 1 31 ? -9.566  8.286   4.547   1.00 0.00 ? 31 MET A CB   9  
ATOM 9398  C CG   . MET A 1 31 ? -8.892  7.292   3.628   1.00 0.00 ? 31 MET A CG   9  
ATOM 9399  S SD   . MET A 1 31 ? -9.982  5.946   3.102   1.00 0.00 ? 31 MET A SD   9  
ATOM 9400  C CE   . MET A 1 31 ? -11.024 6.819   1.933   1.00 0.00 ? 31 MET A CE   9  
ATOM 9401  H H    . MET A 1 31 ? -7.666  10.403  3.170   1.00 0.00 ? 31 MET A H    9  
ATOM 9402  H HA   . MET A 1 31 ? -9.459  10.288  5.329   1.00 0.00 ? 31 MET A HA   9  
ATOM 9403  H HB2  . MET A 1 31 ? -9.637  7.842   5.519   1.00 0.00 ? 31 MET A HB2  9  
ATOM 9404  H HB3  . MET A 1 31 ? -10.573 8.405   4.193   1.00 0.00 ? 31 MET A HB3  9  
ATOM 9405  H HG2  . MET A 1 31 ? -8.559  7.813   2.739   1.00 0.00 ? 31 MET A HG2  9  
ATOM 9406  H HG3  . MET A 1 31 ? -8.035  6.888   4.164   1.00 0.00 ? 31 MET A HG3  9  
ATOM 9407  H HE1  . MET A 1 31 ? -10.391 7.354   1.229   1.00 0.00 ? 31 MET A HE1  9  
ATOM 9408  H HE2  . MET A 1 31 ? -11.638 6.093   1.405   1.00 0.00 ? 31 MET A HE2  9  
ATOM 9409  H HE3  . MET A 1 31 ? -11.659 7.519   2.470   1.00 0.00 ? 31 MET A HE3  9  
ATOM 9410  N N    . SER A 1 32 ? -7.561  8.889   6.642   1.00 0.00 ? 32 SER A N    9  
ATOM 9411  C CA   . SER A 1 32 ? -6.416  8.460   7.433   1.00 0.00 ? 32 SER A CA   9  
ATOM 9412  C C    . SER A 1 32 ? -5.814  7.146   6.918   1.00 0.00 ? 32 SER A C    9  
ATOM 9413  O O    . SER A 1 32 ? -6.508  6.387   6.234   1.00 0.00 ? 32 SER A O    9  
ATOM 9414  C CB   . SER A 1 32 ? -6.919  8.212   8.856   1.00 0.00 ? 32 SER A CB   9  
ATOM 9415  O OG   . SER A 1 32 ? -7.737  9.274   9.320   1.00 0.00 ? 32 SER A OG   9  
ATOM 9416  H H    . SER A 1 32 ? -8.464  8.714   7.053   1.00 0.00 ? 32 SER A H    9  
ATOM 9417  H HA   . SER A 1 32 ? -5.660  9.247   7.424   1.00 0.00 ? 32 SER A HA   9  
ATOM 9418  H HB2  . SER A 1 32 ? -7.505  7.292   8.876   1.00 0.00 ? 32 SER A HB2  9  
ATOM 9419  H HB3  . SER A 1 32 ? -6.068  8.085   9.518   1.00 0.00 ? 32 SER A HB3  9  
ATOM 9420  H HG   . SER A 1 32 ? -7.221  10.106  9.197   1.00 0.00 ? 32 SER A HG   9  
ATOM 9421  N N    . VAL A 1 33 ? -4.600  6.800   7.375   1.00 0.00 ? 33 VAL A N    9  
ATOM 9422  C CA   . VAL A 1 33 ? -4.042  5.449   7.232   1.00 0.00 ? 33 VAL A CA   9  
ATOM 9423  C C    . VAL A 1 33 ? -5.034  4.447   7.821   1.00 0.00 ? 33 VAL A C    9  
ATOM 9424  O O    . VAL A 1 33 ? -5.474  3.560   7.095   1.00 0.00 ? 33 VAL A O    9  
ATOM 9425  C CB   . VAL A 1 33 ? -2.636  5.314   7.872   1.00 0.00 ? 33 VAL A CB   9  
ATOM 9426  C CG1  . VAL A 1 33 ? -2.067  3.883   7.826   1.00 0.00 ? 33 VAL A CG1  9  
ATOM 9427  C CG2  . VAL A 1 33 ? -1.633  6.255   7.192   1.00 0.00 ? 33 VAL A CG2  9  
ATOM 9428  H H    . VAL A 1 33 ? -4.098  7.460   7.962   1.00 0.00 ? 33 VAL A H    9  
ATOM 9429  H HA   . VAL A 1 33 ? -3.953  5.234   6.167   1.00 0.00 ? 33 VAL A HA   9  
ATOM 9430  H HB   . VAL A 1 33 ? -2.683  5.592   8.919   1.00 0.00 ? 33 VAL A HB   9  
ATOM 9431  H HG11 . VAL A 1 33 ? -2.767  3.150   8.236   1.00 0.00 ? 33 VAL A HG11 9  
ATOM 9432  H HG12 . VAL A 1 33 ? -1.800  3.600   6.810   1.00 0.00 ? 33 VAL A HG12 9  
ATOM 9433  H HG13 . VAL A 1 33 ? -1.176  3.835   8.446   1.00 0.00 ? 33 VAL A HG13 9  
ATOM 9434  H HG21 . VAL A 1 33 ? -0.667  6.178   7.690   1.00 0.00 ? 33 VAL A HG21 9  
ATOM 9435  H HG22 . VAL A 1 33 ? -1.518  5.984   6.142   1.00 0.00 ? 33 VAL A HG22 9  
ATOM 9436  H HG23 . VAL A 1 33 ? -1.986  7.284   7.266   1.00 0.00 ? 33 VAL A HG23 9  
ATOM 9437  N N    . SER A 1 34 ? -5.436  4.597   9.091   1.00 0.00 ? 34 SER A N    9  
ATOM 9438  C CA   . SER A 1 34 ? -6.315  3.630   9.754   1.00 0.00 ? 34 SER A CA   9  
ATOM 9439  C C    . SER A 1 34 ? -7.657  3.429   9.051   1.00 0.00 ? 34 SER A C    9  
ATOM 9440  O O    . SER A 1 34 ? -8.335  2.427   9.273   1.00 0.00 ? 34 SER A O    9  
ATOM 9441  C CB   . SER A 1 34 ? -6.540  4.015   11.222  1.00 0.00 ? 34 SER A CB   9  
ATOM 9442  O OG   . SER A 1 34 ? -6.695  5.410   11.432  1.00 0.00 ? 34 SER A OG   9  
ATOM 9443  H H    . SER A 1 34 ? -5.076  5.363   9.657   1.00 0.00 ? 34 SER A H    9  
ATOM 9444  H HA   . SER A 1 34 ? -5.812  2.670   9.730   1.00 0.00 ? 34 SER A HA   9  
ATOM 9445  H HB2  . SER A 1 34 ? -7.411  3.486   11.614  1.00 0.00 ? 34 SER A HB2  9  
ATOM 9446  H HB3  . SER A 1 34 ? -5.679  3.692   11.800  1.00 0.00 ? 34 SER A HB3  9  
ATOM 9447  H HG   . SER A 1 34 ? -6.384  5.541   12.354  1.00 0.00 ? 34 SER A HG   9  
ATOM 9448  N N    . LYS A 1 35 ? -8.054  4.382   8.216   1.00 0.00 ? 35 LYS A N    9  
ATOM 9449  C CA   . LYS A 1 35 ? -9.313  4.360   7.514   1.00 0.00 ? 35 LYS A CA   9  
ATOM 9450  C C    . LYS A 1 35 ? -9.124  3.554   6.242   1.00 0.00 ? 35 LYS A C    9  
ATOM 9451  O O    . LYS A 1 35 ? -9.593  2.423   6.181   1.00 0.00 ? 35 LYS A O    9  
ATOM 9452  C CB   . LYS A 1 35 ? -9.750  5.805   7.340   1.00 0.00 ? 35 LYS A CB   9  
ATOM 9453  C CG   . LYS A 1 35 ? -11.110 5.960   6.654   1.00 0.00 ? 35 LYS A CG   9  
ATOM 9454  C CD   . LYS A 1 35 ? -11.908 7.049   7.360   1.00 0.00 ? 35 LYS A CD   9  
ATOM 9455  C CE   . LYS A 1 35 ? -13.096 7.521   6.536   1.00 0.00 ? 35 LYS A CE   9  
ATOM 9456  N NZ   . LYS A 1 35 ? -13.837 8.565   7.274   1.00 0.00 ? 35 LYS A NZ   9  
ATOM 9457  H H    . LYS A 1 35 ? -7.388  5.105   7.990   1.00 0.00 ? 35 LYS A H    9  
ATOM 9458  H HA   . LYS A 1 35 ? -10.051 3.849   8.132   1.00 0.00 ? 35 LYS A HA   9  
ATOM 9459  H HB2  . LYS A 1 35 ? -9.796  6.249   8.336   1.00 0.00 ? 35 LYS A HB2  9  
ATOM 9460  H HB3  . LYS A 1 35 ? -8.986  6.338   6.787   1.00 0.00 ? 35 LYS A HB3  9  
ATOM 9461  H HG2  . LYS A 1 35 ? -10.992 6.207   5.612   1.00 0.00 ? 35 LYS A HG2  9  
ATOM 9462  H HG3  . LYS A 1 35 ? -11.649 5.031   6.682   1.00 0.00 ? 35 LYS A HG3  9  
ATOM 9463  H HD2  . LYS A 1 35 ? -12.264 6.633   8.297   1.00 0.00 ? 35 LYS A HD2  9  
ATOM 9464  H HD3  . LYS A 1 35 ? -11.263 7.903   7.561   1.00 0.00 ? 35 LYS A HD3  9  
ATOM 9465  H HE2  . LYS A 1 35 ? -12.727 7.909   5.580   1.00 0.00 ? 35 LYS A HE2  9  
ATOM 9466  H HE3  . LYS A 1 35 ? -13.745 6.668   6.341   1.00 0.00 ? 35 LYS A HE3  9  
ATOM 9467  H HZ1  . LYS A 1 35 ? -14.712 8.782   6.805   1.00 0.00 ? 35 LYS A HZ1  9  
ATOM 9468  H HZ2  . LYS A 1 35 ? -14.067 8.251   8.212   1.00 0.00 ? 35 LYS A HZ2  9  
ATOM 9469  H HZ3  . LYS A 1 35 ? -13.273 9.407   7.338   1.00 0.00 ? 35 LYS A HZ3  9  
ATOM 9470  N N    . ALA A 1 36 ? -8.393  4.079   5.255   1.00 0.00 ? 36 ALA A N    9  
ATOM 9471  C CA   . ALA A 1 36 ? -8.114  3.388   4.002   1.00 0.00 ? 36 ALA A CA   9  
ATOM 9472  C C    . ALA A 1 36 ? -7.557  1.980   4.182   1.00 0.00 ? 36 ALA A C    9  
ATOM 9473  O O    . ALA A 1 36 ? -7.892  1.123   3.374   1.00 0.00 ? 36 ALA A O    9  
ATOM 9474  C CB   . ALA A 1 36 ? -7.102  4.214   3.200   1.00 0.00 ? 36 ALA A CB   9  
ATOM 9475  H H    . ALA A 1 36 ? -8.104  5.048   5.297   1.00 0.00 ? 36 ALA A H    9  
ATOM 9476  H HA   . ALA A 1 36 ? -9.068  3.276   3.465   1.00 0.00 ? 36 ALA A HA   9  
ATOM 9477  H HB1  . ALA A 1 36 ? -6.913  3.739   2.238   1.00 0.00 ? 36 ALA A HB1  9  
ATOM 9478  H HB2  . ALA A 1 36 ? -7.463  5.226   3.036   1.00 0.00 ? 36 ALA A HB2  9  
ATOM 9479  H HB3  . ALA A 1 36 ? -6.168  4.278   3.759   1.00 0.00 ? 36 ALA A HB3  9  
ATOM 9480  N N    . GLN A 1 37 ? -6.779  1.708   5.232   1.00 0.00 ? 37 GLN A N    9  
ATOM 9481  C CA   . GLN A 1 37 ? -6.412  0.358   5.640   1.00 0.00 ? 37 GLN A CA   9  
ATOM 9482  C C    . GLN A 1 37 ? -7.656  -0.526  5.611   1.00 0.00 ? 37 GLN A C    9  
ATOM 9483  O O    . GLN A 1 37 ? -7.711  -1.495  4.859   1.00 0.00 ? 37 GLN A O    9  
ATOM 9484  C CB   . GLN A 1 37 ? -5.740  0.444   7.024   1.00 0.00 ? 37 GLN A CB   9  
ATOM 9485  C CG   . GLN A 1 37 ? -5.865  -0.807  7.926   1.00 0.00 ? 37 GLN A CG   9  
ATOM 9486  C CD   . GLN A 1 37 ? -6.475  -0.562  9.306   1.00 0.00 ? 37 GLN A CD   9  
ATOM 9487  O OE1  . GLN A 1 37 ? -6.065  0.337   10.034  1.00 0.00 ? 37 GLN A OE1  9  
ATOM 9488  N NE2  . GLN A 1 37 ? -7.445  -1.367  9.708   1.00 0.00 ? 37 GLN A NE2  9  
ATOM 9489  H H    . GLN A 1 37 ? -6.480  2.454   5.850   1.00 0.00 ? 37 GLN A H    9  
ATOM 9490  H HA   . GLN A 1 37 ? -5.694  -0.053  4.929   1.00 0.00 ? 37 GLN A HA   9  
ATOM 9491  H HB2  . GLN A 1 37 ? -4.685  0.681   6.829   1.00 0.00 ? 37 GLN A HB2  9  
ATOM 9492  H HB3  . GLN A 1 37 ? -6.192  1.270   7.569   1.00 0.00 ? 37 GLN A HB3  9  
ATOM 9493  H HG2  . GLN A 1 37 ? -6.458  -1.565  7.440   1.00 0.00 ? 37 GLN A HG2  9  
ATOM 9494  H HG3  . GLN A 1 37 ? -4.898  -1.255  8.054   1.00 0.00 ? 37 GLN A HG3  9  
ATOM 9495  H HE21 . GLN A 1 37 ? -7.675  -2.177  9.132   1.00 0.00 ? 37 GLN A HE21 9  
ATOM 9496  H HE22 . GLN A 1 37 ? -7.859  -1.270  10.628  1.00 0.00 ? 37 GLN A HE22 9  
ATOM 9497  N N    . SER A 1 38 ? -8.649  -0.183  6.425   1.00 0.00 ? 38 SER A N    9  
ATOM 9498  C CA   . SER A 1 38 ? -9.843  -0.973  6.597   1.00 0.00 ? 38 SER A CA   9  
ATOM 9499  C C    . SER A 1 38 ? -10.610 -1.021  5.267   1.00 0.00 ? 38 SER A C    9  
ATOM 9500  O O    . SER A 1 38 ? -11.006 -2.100  4.822   1.00 0.00 ? 38 SER A O    9  
ATOM 9501  C CB   . SER A 1 38 ? -10.650 -0.334  7.732   1.00 0.00 ? 38 SER A CB   9  
ATOM 9502  O OG   . SER A 1 38 ? -11.658 -1.197  8.213   1.00 0.00 ? 38 SER A OG   9  
ATOM 9503  H H    . SER A 1 38 ? -8.614  0.716   6.893   1.00 0.00 ? 38 SER A H    9  
ATOM 9504  H HA   . SER A 1 38 ? -9.518  -1.975  6.888   1.00 0.00 ? 38 SER A HA   9  
ATOM 9505  H HB2  . SER A 1 38 ? -9.976  -0.098  8.558   1.00 0.00 ? 38 SER A HB2  9  
ATOM 9506  H HB3  . SER A 1 38 ? -11.102 0.592   7.378   1.00 0.00 ? 38 SER A HB3  9  
ATOM 9507  H HG   . SER A 1 38 ? -11.206 -1.849  8.787   1.00 0.00 ? 38 SER A HG   9  
ATOM 9508  N N    . ILE A 1 39 ? -10.782 0.139   4.611   1.00 0.00 ? 39 ILE A N    9  
ATOM 9509  C CA   . ILE A 1 39 ? -11.591 0.267   3.397   1.00 0.00 ? 39 ILE A CA   9  
ATOM 9510  C C    . ILE A 1 39 ? -11.039 -0.634  2.283   1.00 0.00 ? 39 ILE A C    9  
ATOM 9511  O O    . ILE A 1 39 ? -11.785 -1.430  1.711   1.00 0.00 ? 39 ILE A O    9  
ATOM 9512  C CB   . ILE A 1 39 ? -11.778 1.742   2.963   1.00 0.00 ? 39 ILE A CB   9  
ATOM 9513  C CG1  . ILE A 1 39 ? -12.361 2.551   4.143   1.00 0.00 ? 39 ILE A CG1  9  
ATOM 9514  C CG2  . ILE A 1 39 ? -12.691 1.827   1.724   1.00 0.00 ? 39 ILE A CG2  9  
ATOM 9515  C CD1  . ILE A 1 39 ? -12.922 3.928   3.795   1.00 0.00 ? 39 ILE A CD1  9  
ATOM 9516  H H    . ILE A 1 39 ? -10.397 0.980   5.028   1.00 0.00 ? 39 ILE A H    9  
ATOM 9517  H HA   . ILE A 1 39 ? -12.585 -0.079  3.647   1.00 0.00 ? 39 ILE A HA   9  
ATOM 9518  H HB   . ILE A 1 39 ? -10.816 2.169   2.698   1.00 0.00 ? 39 ILE A HB   9  
ATOM 9519  H HG12 . ILE A 1 39 ? -13.149 1.975   4.616   1.00 0.00 ? 39 ILE A HG12 9  
ATOM 9520  H HG13 . ILE A 1 39 ? -11.582 2.705   4.879   1.00 0.00 ? 39 ILE A HG13 9  
ATOM 9521  H HG21 . ILE A 1 39 ? -12.286 1.234   0.905   1.00 0.00 ? 39 ILE A HG21 9  
ATOM 9522  H HG22 . ILE A 1 39 ? -13.689 1.463   1.962   1.00 0.00 ? 39 ILE A HG22 9  
ATOM 9523  H HG23 . ILE A 1 39 ? -12.757 2.852   1.359   1.00 0.00 ? 39 ILE A HG23 9  
ATOM 9524  H HD11 . ILE A 1 39 ? -13.028 4.518   4.706   1.00 0.00 ? 39 ILE A HD11 9  
ATOM 9525  H HD12 . ILE A 1 39 ? -12.247 4.431   3.109   1.00 0.00 ? 39 ILE A HD12 9  
ATOM 9526  H HD13 . ILE A 1 39 ? -13.898 3.812   3.325   1.00 0.00 ? 39 ILE A HD13 9  
ATOM 9527  N N    . TYR A 1 40 ? -9.749  -0.506  1.976   1.00 0.00 ? 40 TYR A N    9  
ATOM 9528  C CA   . TYR A 1 40 ? -9.095  -1.183  0.865   1.00 0.00 ? 40 TYR A CA   9  
ATOM 9529  C C    . TYR A 1 40 ? -8.676  -2.611  1.262   1.00 0.00 ? 40 TYR A C    9  
ATOM 9530  O O    . TYR A 1 40 ? -8.479  -3.457  0.382   1.00 0.00 ? 40 TYR A O    9  
ATOM 9531  C CB   . TYR A 1 40 ? -7.903  -0.324  0.391   1.00 0.00 ? 40 TYR A CB   9  
ATOM 9532  C CG   . TYR A 1 40 ? -8.274  0.980   -0.324  1.00 0.00 ? 40 TYR A CG   9  
ATOM 9533  C CD1  . TYR A 1 40 ? -8.877  2.057   0.362   1.00 0.00 ? 40 TYR A CD1  9  
ATOM 9534  C CD2  . TYR A 1 40 ? -7.952  1.156   -1.682  1.00 0.00 ? 40 TYR A CD2  9  
ATOM 9535  C CE1  . TYR A 1 40 ? -9.262  3.231   -0.316  1.00 0.00 ? 40 TYR A CE1  9  
ATOM 9536  C CE2  . TYR A 1 40 ? -8.284  2.340   -2.356  1.00 0.00 ? 40 TYR A CE2  9  
ATOM 9537  C CZ   . TYR A 1 40 ? -9.022  3.345   -1.704  1.00 0.00 ? 40 TYR A CZ   9  
ATOM 9538  O OH   . TYR A 1 40 ? -9.491  4.414   -2.403  1.00 0.00 ? 40 TYR A OH   9  
ATOM 9539  H H    . TYR A 1 40 ? -9.169  0.110   2.533   1.00 0.00 ? 40 TYR A H    9  
ATOM 9540  H HA   . TYR A 1 40 ? -9.804  -1.264  0.039   1.00 0.00 ? 40 TYR A HA   9  
ATOM 9541  H HB2  . TYR A 1 40 ? -7.275  -0.083  1.247   1.00 0.00 ? 40 TYR A HB2  9  
ATOM 9542  H HB3  . TYR A 1 40 ? -7.289  -0.932  -0.275  1.00 0.00 ? 40 TYR A HB3  9  
ATOM 9543  H HD1  . TYR A 1 40 ? -9.046  1.986   1.418   1.00 0.00 ? 40 TYR A HD1  9  
ATOM 9544  H HD2  . TYR A 1 40 ? -7.375  0.418   -2.209  1.00 0.00 ? 40 TYR A HD2  9  
ATOM 9545  H HE1  . TYR A 1 40 ? -9.692  4.069   0.229   1.00 0.00 ? 40 TYR A HE1  9  
ATOM 9546  H HE2  . TYR A 1 40 ? -7.926  2.492   -3.362  1.00 0.00 ? 40 TYR A HE2  9  
ATOM 9547  H HH   . TYR A 1 40 ? -9.299  4.380   -3.362  1.00 0.00 ? 40 TYR A HH   9  
ATOM 9548  N N    . GLY A 1 41 ? -8.595  -2.910  2.563   1.00 0.00 ? 41 GLY A N    9  
ATOM 9549  C CA   . GLY A 1 41 ? -8.262  -4.214  3.132   1.00 0.00 ? 41 GLY A CA   9  
ATOM 9550  C C    . GLY A 1 41 ? -6.759  -4.416  3.328   1.00 0.00 ? 41 GLY A C    9  
ATOM 9551  O O    . GLY A 1 41 ? -6.270  -5.550  3.360   1.00 0.00 ? 41 GLY A O    9  
ATOM 9552  H H    . GLY A 1 41 ? -8.739  -2.168  3.239   1.00 0.00 ? 41 GLY A H    9  
ATOM 9553  H HA2  . GLY A 1 41 ? -8.731  -4.278  4.112   1.00 0.00 ? 41 GLY A HA2  9  
ATOM 9554  H HA3  . GLY A 1 41 ? -8.666  -5.008  2.509   1.00 0.00 ? 41 GLY A HA3  9  
ATOM 9555  N N    . ILE A 1 42 ? -6.008  -3.323  3.442   1.00 0.00 ? 42 ILE A N    9  
ATOM 9556  C CA   . ILE A 1 42 ? -4.556  -3.334  3.580   1.00 0.00 ? 42 ILE A CA   9  
ATOM 9557  C C    . ILE A 1 42 ? -4.244  -3.368  5.087   1.00 0.00 ? 42 ILE A C    9  
ATOM 9558  O O    . ILE A 1 42 ? -5.017  -2.815  5.869   1.00 0.00 ? 42 ILE A O    9  
ATOM 9559  C CB   . ILE A 1 42 ? -3.957  -2.110  2.841   1.00 0.00 ? 42 ILE A CB   9  
ATOM 9560  C CG1  . ILE A 1 42 ? -4.574  -1.999  1.421   1.00 0.00 ? 42 ILE A CG1  9  
ATOM 9561  C CG2  . ILE A 1 42 ? -2.415  -2.151  2.829   1.00 0.00 ? 42 ILE A CG2  9  
ATOM 9562  C CD1  . ILE A 1 42 ? -3.623  -1.694  0.274   1.00 0.00 ? 42 ILE A CD1  9  
ATOM 9563  H H    . ILE A 1 42 ? -6.493  -2.441  3.569   1.00 0.00 ? 42 ILE A H    9  
ATOM 9564  H HA   . ILE A 1 42 ? -4.183  -4.233  3.098   1.00 0.00 ? 42 ILE A HA   9  
ATOM 9565  H HB   . ILE A 1 42 ? -4.255  -1.208  3.378   1.00 0.00 ? 42 ILE A HB   9  
ATOM 9566  H HG12 . ILE A 1 42 ? -5.074  -2.927  1.144   1.00 0.00 ? 42 ILE A HG12 9  
ATOM 9567  H HG13 . ILE A 1 42 ? -5.317  -1.207  1.455   1.00 0.00 ? 42 ILE A HG13 9  
ATOM 9568  H HG21 . ILE A 1 42 ? -2.066  -3.051  2.318   1.00 0.00 ? 42 ILE A HG21 9  
ATOM 9569  H HG22 . ILE A 1 42 ? -2.008  -1.272  2.329   1.00 0.00 ? 42 ILE A HG22 9  
ATOM 9570  H HG23 . ILE A 1 42 ? -2.031  -2.127  3.846   1.00 0.00 ? 42 ILE A HG23 9  
ATOM 9571  H HD11 . ILE A 1 42 ? -4.186  -1.662  -0.656  1.00 0.00 ? 42 ILE A HD11 9  
ATOM 9572  H HD12 . ILE A 1 42 ? -3.143  -0.733  0.439   1.00 0.00 ? 42 ILE A HD12 9  
ATOM 9573  H HD13 . ILE A 1 42 ? -2.877  -2.485  0.213   1.00 0.00 ? 42 ILE A HD13 9  
ATOM 9574  N N    . PRO A 1 43 ? -3.153  -4.010  5.538   1.00 0.00 ? 43 PRO A N    9  
ATOM 9575  C CA   . PRO A 1 43 ? -2.708  -3.916  6.927   1.00 0.00 ? 43 PRO A CA   9  
ATOM 9576  C C    . PRO A 1 43 ? -2.352  -2.470  7.261   1.00 0.00 ? 43 PRO A C    9  
ATOM 9577  O O    . PRO A 1 43 ? -1.849  -1.764  6.386   1.00 0.00 ? 43 PRO A O    9  
ATOM 9578  C CB   . PRO A 1 43 ? -1.458  -4.795  7.034   1.00 0.00 ? 43 PRO A CB   9  
ATOM 9579  C CG   . PRO A 1 43 ? -1.503  -5.663  5.778   1.00 0.00 ? 43 PRO A CG   9  
ATOM 9580  C CD   . PRO A 1 43 ? -2.229  -4.804  4.758   1.00 0.00 ? 43 PRO A CD   9  
ATOM 9581  H HA   . PRO A 1 43 ? -3.494  -4.278  7.590   1.00 0.00 ? 43 PRO A HA   9  
ATOM 9582  H HB2  . PRO A 1 43 ? -0.560  -4.180  7.023   1.00 0.00 ? 43 PRO A HB2  9  
ATOM 9583  H HB3  . PRO A 1 43 ? -1.479  -5.399  7.938   1.00 0.00 ? 43 PRO A HB3  9  
ATOM 9584  H HG2  . PRO A 1 43 ? -0.516  -5.923  5.411   1.00 0.00 ? 43 PRO A HG2  9  
ATOM 9585  H HG3  . PRO A 1 43 ? -2.084  -6.549  5.999   1.00 0.00 ? 43 PRO A HG3  9  
ATOM 9586  H HD2  . PRO A 1 43 ? -1.502  -4.161  4.271   1.00 0.00 ? 43 PRO A HD2  9  
ATOM 9587  H HD3  . PRO A 1 43 ? -2.741  -5.404  4.009   1.00 0.00 ? 43 PRO A HD3  9  
ATOM 9588  N N    . HIS A 1 44 ? -2.521  -2.054  8.518   1.00 0.00 ? 44 HIS A N    9  
ATOM 9589  C CA   . HIS A 1 44 ? -2.206  -0.693  8.927   1.00 0.00 ? 44 HIS A CA   9  
ATOM 9590  C C    . HIS A 1 44 ? -0.723  -0.451  8.723   1.00 0.00 ? 44 HIS A C    9  
ATOM 9591  O O    . HIS A 1 44 ? -0.374  0.435   7.956   1.00 0.00 ? 44 HIS A O    9  
ATOM 9592  C CB   . HIS A 1 44 ? -2.626  -0.401  10.370  1.00 0.00 ? 44 HIS A CB   9  
ATOM 9593  C CG   . HIS A 1 44 ? -2.503  1.060   10.736  1.00 0.00 ? 44 HIS A CG   9  
ATOM 9594  N ND1  . HIS A 1 44 ? -3.563  1.904   10.969  1.00 0.00 ? 44 HIS A ND1  9  
ATOM 9595  C CD2  . HIS A 1 44 ? -1.351  1.791   10.877  1.00 0.00 ? 44 HIS A CD2  9  
ATOM 9596  C CE1  . HIS A 1 44 ? -3.066  3.123   11.238  1.00 0.00 ? 44 HIS A CE1  9  
ATOM 9597  N NE2  . HIS A 1 44 ? -1.724  3.100   11.205  1.00 0.00 ? 44 HIS A NE2  9  
ATOM 9598  H H    . HIS A 1 44 ? -2.878  -2.708  9.206   1.00 0.00 ? 44 HIS A H    9  
ATOM 9599  H HA   . HIS A 1 44 ? -2.751  -0.012  8.272   1.00 0.00 ? 44 HIS A HA   9  
ATOM 9600  H HB2  . HIS A 1 44 ? -3.668  -0.689  10.481  1.00 0.00 ? 44 HIS A HB2  9  
ATOM 9601  H HB3  . HIS A 1 44 ? -2.029  -0.992  11.062  1.00 0.00 ? 44 HIS A HB3  9  
ATOM 9602  H HD1  . HIS A 1 44 ? -4.542  1.621   10.967  1.00 0.00 ? 44 HIS A HD1  9  
ATOM 9603  H HD2  . HIS A 1 44 ? -0.335  1.436   10.753  1.00 0.00 ? 44 HIS A HD2  9  
ATOM 9604  H HE1  . HIS A 1 44 ? -3.650  4.006   11.459  1.00 0.00 ? 44 HIS A HE1  9  
ATOM 9605  N N    . SER A 1 45 ? 0.148   -1.222  9.382   1.00 0.00 ? 45 SER A N    9  
ATOM 9606  C CA   . SER A 1 45 ? 1.584   -0.993  9.287   1.00 0.00 ? 45 SER A CA   9  
ATOM 9607  C C    . SER A 1 45 ? 2.061   -1.122  7.839   1.00 0.00 ? 45 SER A C    9  
ATOM 9608  O O    . SER A 1 45 ? 2.908   -0.336  7.427   1.00 0.00 ? 45 SER A O    9  
ATOM 9609  C CB   . SER A 1 45 ? 2.346   -1.935  10.225  1.00 0.00 ? 45 SER A CB   9  
ATOM 9610  O OG   . SER A 1 45 ? 1.853   -1.814  11.550  1.00 0.00 ? 45 SER A OG   9  
ATOM 9611  H H    . SER A 1 45 ? -0.181  -1.927  10.032  1.00 0.00 ? 45 SER A H    9  
ATOM 9612  H HA   . SER A 1 45 ? 1.784   0.031   9.608   1.00 0.00 ? 45 SER A HA   9  
ATOM 9613  H HB2  . SER A 1 45 ? 2.220   -2.965  9.886   1.00 0.00 ? 45 SER A HB2  9  
ATOM 9614  H HB3  . SER A 1 45 ? 3.409   -1.685  10.208  1.00 0.00 ? 45 SER A HB3  9  
ATOM 9615  H HG   . SER A 1 45 ? 2.424   -1.170  12.016  1.00 0.00 ? 45 SER A HG   9  
ATOM 9616  N N    . THR A 1 46 ? 1.512   -2.045  7.034   1.00 0.00 ? 46 THR A N    9  
ATOM 9617  C CA   . THR A 1 46 ? 1.937   -2.158  5.644   1.00 0.00 ? 46 THR A CA   9  
ATOM 9618  C C    . THR A 1 46 ? 1.502   -0.930  4.840   1.00 0.00 ? 46 THR A C    9  
ATOM 9619  O O    . THR A 1 46 ? 2.336   -0.373  4.140   1.00 0.00 ? 46 THR A O    9  
ATOM 9620  C CB   . THR A 1 46 ? 1.462   -3.489  5.048   1.00 0.00 ? 46 THR A CB   9  
ATOM 9621  O OG1  . THR A 1 46 ? 1.846   -4.519  5.947   1.00 0.00 ? 46 THR A OG1  9  
ATOM 9622  C CG2  . THR A 1 46 ? 2.070   -3.761  3.669   1.00 0.00 ? 46 THR A CG2  9  
ATOM 9623  H H    . THR A 1 46 ? 0.801   -2.693  7.350   1.00 0.00 ? 46 THR A H    9  
ATOM 9624  H HA   . THR A 1 46 ? 3.028   -2.160  5.641   1.00 0.00 ? 46 THR A HA   9  
ATOM 9625  H HB   . THR A 1 46 ? 0.378   -3.472  4.965   1.00 0.00 ? 46 THR A HB   9  
ATOM 9626  H HG1  . THR A 1 46 ? 1.529   -5.381  5.632   1.00 0.00 ? 46 THR A HG1  9  
ATOM 9627  H HG21 . THR A 1 46 ? 3.160   -3.713  3.719   1.00 0.00 ? 46 THR A HG21 9  
ATOM 9628  H HG22 . THR A 1 46 ? 1.765   -4.746  3.313   1.00 0.00 ? 46 THR A HG22 9  
ATOM 9629  H HG23 . THR A 1 46 ? 1.719   -3.013  2.955   1.00 0.00 ? 46 THR A HG23 9  
ATOM 9630  N N    . LEU A 1 47 ? 0.251   -0.472  4.941   1.00 0.00 ? 47 LEU A N    9  
ATOM 9631  C CA   . LEU A 1 47 ? -0.211  0.760   4.321   1.00 0.00 ? 47 LEU A CA   9  
ATOM 9632  C C    . LEU A 1 47 ? 0.683   1.907   4.764   1.00 0.00 ? 47 LEU A C    9  
ATOM 9633  O O    . LEU A 1 47 ? 1.215   2.606   3.918   1.00 0.00 ? 47 LEU A O    9  
ATOM 9634  C CB   . LEU A 1 47 ? -1.682  1.056   4.673   1.00 0.00 ? 47 LEU A CB   9  
ATOM 9635  C CG   . LEU A 1 47 ? -2.184  2.342   3.985   1.00 0.00 ? 47 LEU A CG   9  
ATOM 9636  C CD1  . LEU A 1 47 ? -2.403  2.108   2.498   1.00 0.00 ? 47 LEU A CD1  9  
ATOM 9637  C CD2  . LEU A 1 47 ? -3.557  2.744   4.505   1.00 0.00 ? 47 LEU A CD2  9  
ATOM 9638  H H    . LEU A 1 47 ? -0.417  -0.955  5.514   1.00 0.00 ? 47 LEU A H    9  
ATOM 9639  H HA   . LEU A 1 47 ? -0.115  0.645   3.242   1.00 0.00 ? 47 LEU A HA   9  
ATOM 9640  H HB2  . LEU A 1 47 ? -2.316  0.221   4.369   1.00 0.00 ? 47 LEU A HB2  9  
ATOM 9641  H HB3  . LEU A 1 47 ? -1.770  1.171   5.754   1.00 0.00 ? 47 LEU A HB3  9  
ATOM 9642  H HG   . LEU A 1 47 ? -1.498  3.183   4.137   1.00 0.00 ? 47 LEU A HG   9  
ATOM 9643  H HD11 . LEU A 1 47 ? -1.474  1.834   2.005   1.00 0.00 ? 47 LEU A HD11 9  
ATOM 9644  H HD12 . LEU A 1 47 ? -3.149  1.319   2.373   1.00 0.00 ? 47 LEU A HD12 9  
ATOM 9645  H HD13 . LEU A 1 47 ? -2.773  3.037   2.067   1.00 0.00 ? 47 LEU A HD13 9  
ATOM 9646  H HD21 . LEU A 1 47 ? -3.529  2.875   5.581   1.00 0.00 ? 47 LEU A HD21 9  
ATOM 9647  H HD22 . LEU A 1 47 ? -3.849  3.674   4.018   1.00 0.00 ? 47 LEU A HD22 9  
ATOM 9648  H HD23 . LEU A 1 47 ? -4.282  1.973   4.254   1.00 0.00 ? 47 LEU A HD23 9  
ATOM 9649  N N    . GLU A 1 48 ? 0.860   2.096   6.070   1.00 0.00 ? 48 GLU A N    9  
ATOM 9650  C CA   . GLU A 1 48 ? 1.617   3.175   6.668   1.00 0.00 ? 48 GLU A CA   9  
ATOM 9651  C C    . GLU A 1 48 ? 3.032   3.201   6.076   1.00 0.00 ? 48 GLU A C    9  
ATOM 9652  O O    . GLU A 1 48 ? 3.439   4.192   5.474   1.00 0.00 ? 48 GLU A O    9  
ATOM 9653  C CB   . GLU A 1 48 ? 1.628   2.978   8.192   1.00 0.00 ? 48 GLU A CB   9  
ATOM 9654  C CG   . GLU A 1 48 ? 1.827   4.319   8.883   1.00 0.00 ? 48 GLU A CG   9  
ATOM 9655  C CD   . GLU A 1 48 ? 2.362   4.161   10.297  1.00 0.00 ? 48 GLU A CD   9  
ATOM 9656  O OE1  . GLU A 1 48 ? 3.592   3.995   10.458  1.00 0.00 ? 48 GLU A OE1  9  
ATOM 9657  O OE2  . GLU A 1 48 ? 1.568   4.245   11.258  1.00 0.00 ? 48 GLU A OE2  9  
ATOM 9658  H H    . GLU A 1 48 ? 0.411   1.476   6.733   1.00 0.00 ? 48 GLU A H    9  
ATOM 9659  H HA   . GLU A 1 48 ? 1.103   4.112   6.441   1.00 0.00 ? 48 GLU A HA   9  
ATOM 9660  H HB2  . GLU A 1 48 ? 0.684   2.572   8.541   1.00 0.00 ? 48 GLU A HB2  9  
ATOM 9661  H HB3  . GLU A 1 48 ? 2.416   2.277   8.467   1.00 0.00 ? 48 GLU A HB3  9  
ATOM 9662  H HG2  . GLU A 1 48 ? 2.534   4.890   8.306   1.00 0.00 ? 48 GLU A HG2  9  
ATOM 9663  H HG3  . GLU A 1 48 ? 0.887   4.869   8.896   1.00 0.00 ? 48 GLU A HG3  9  
ATOM 9664  N N    . TYR A 1 49 ? 3.753   2.080   6.172   1.00 0.00 ? 49 TYR A N    9  
ATOM 9665  C CA   . TYR A 1 49 ? 5.048   1.854   5.547   1.00 0.00 ? 49 TYR A CA   9  
ATOM 9666  C C    . TYR A 1 49 ? 4.996   2.279   4.089   1.00 0.00 ? 49 TYR A C    9  
ATOM 9667  O O    . TYR A 1 49 ? 5.825   3.063   3.645   1.00 0.00 ? 49 TYR A O    9  
ATOM 9668  C CB   . TYR A 1 49 ? 5.384   0.355   5.655   1.00 0.00 ? 49 TYR A CB   9  
ATOM 9669  C CG   . TYR A 1 49 ? 6.568   -0.132  4.847   1.00 0.00 ? 49 TYR A CG   9  
ATOM 9670  C CD1  . TYR A 1 49 ? 6.366   -0.558  3.530   1.00 0.00 ? 49 TYR A CD1  9  
ATOM 9671  C CD2  . TYR A 1 49 ? 7.852   -0.201  5.402   1.00 0.00 ? 49 TYR A CD2  9  
ATOM 9672  C CE1  . TYR A 1 49 ? 7.434   -0.994  2.734   1.00 0.00 ? 49 TYR A CE1  9  
ATOM 9673  C CE2  . TYR A 1 49 ? 8.945   -0.596  4.607   1.00 0.00 ? 49 TYR A CE2  9  
ATOM 9674  C CZ   . TYR A 1 49 ? 8.740   -1.001  3.270   1.00 0.00 ? 49 TYR A CZ   9  
ATOM 9675  O OH   . TYR A 1 49 ? 9.803   -1.318  2.482   1.00 0.00 ? 49 TYR A OH   9  
ATOM 9676  H H    . TYR A 1 49 ? 3.320   1.280   6.625   1.00 0.00 ? 49 TYR A H    9  
ATOM 9677  H HA   . TYR A 1 49 ? 5.811   2.458   6.049   1.00 0.00 ? 49 TYR A HA   9  
ATOM 9678  H HB2  . TYR A 1 49 ? 5.535   0.103   6.691   1.00 0.00 ? 49 TYR A HB2  9  
ATOM 9679  H HB3  . TYR A 1 49 ? 4.523   -0.224  5.333   1.00 0.00 ? 49 TYR A HB3  9  
ATOM 9680  H HD1  . TYR A 1 49 ? 5.373   -0.517  3.132   1.00 0.00 ? 49 TYR A HD1  9  
ATOM 9681  H HD2  . TYR A 1 49 ? 7.981   0.059   6.439   1.00 0.00 ? 49 TYR A HD2  9  
ATOM 9682  H HE1  . TYR A 1 49 ? 7.239   -1.231  1.696   1.00 0.00 ? 49 TYR A HE1  9  
ATOM 9683  H HE2  . TYR A 1 49 ? 9.945   -0.587  5.007   1.00 0.00 ? 49 TYR A HE2  9  
ATOM 9684  H HH   . TYR A 1 49 ? 10.026  -0.494  1.987   1.00 0.00 ? 49 TYR A HH   9  
ATOM 9685  N N    . LYS A 1 50 ? 4.043   1.753   3.330   1.00 0.00 ? 50 LYS A N    9  
ATOM 9686  C CA   . LYS A 1 50 ? 3.983   1.931   1.896   1.00 0.00 ? 50 LYS A CA   9  
ATOM 9687  C C    . LYS A 1 50 ? 3.720   3.390   1.522   1.00 0.00 ? 50 LYS A C    9  
ATOM 9688  O O    . LYS A 1 50 ? 4.334   3.878   0.581   1.00 0.00 ? 50 LYS A O    9  
ATOM 9689  C CB   . LYS A 1 50 ? 2.931   0.967   1.348   1.00 0.00 ? 50 LYS A CB   9  
ATOM 9690  C CG   . LYS A 1 50 ? 3.413   -0.480  1.219   1.00 0.00 ? 50 LYS A CG   9  
ATOM 9691  C CD   . LYS A 1 50 ? 4.629   -0.639  0.289   1.00 0.00 ? 50 LYS A CD   9  
ATOM 9692  C CE   . LYS A 1 50 ? 4.706   -1.979  -0.451  1.00 0.00 ? 50 LYS A CE   9  
ATOM 9693  N NZ   . LYS A 1 50 ? 5.002   -1.811  -1.892  1.00 0.00 ? 50 LYS A NZ   9  
ATOM 9694  H H    . LYS A 1 50 ? 3.332   1.171   3.764   1.00 0.00 ? 50 LYS A H    9  
ATOM 9695  H HA   . LYS A 1 50 ? 4.956   1.681   1.480   1.00 0.00 ? 50 LYS A HA   9  
ATOM 9696  H HB2  . LYS A 1 50 ? 2.043   0.962   1.997   1.00 0.00 ? 50 LYS A HB2  9  
ATOM 9697  H HB3  . LYS A 1 50 ? 2.670   1.300   0.353   1.00 0.00 ? 50 LYS A HB3  9  
ATOM 9698  H HG2  . LYS A 1 50 ? 3.641   -0.895  2.201   1.00 0.00 ? 50 LYS A HG2  9  
ATOM 9699  H HG3  . LYS A 1 50 ? 2.568   -1.028  0.834   1.00 0.00 ? 50 LYS A HG3  9  
ATOM 9700  H HD2  . LYS A 1 50 ? 4.697   0.179   -0.414  1.00 0.00 ? 50 LYS A HD2  9  
ATOM 9701  H HD3  . LYS A 1 50 ? 5.513   -0.531  0.892   1.00 0.00 ? 50 LYS A HD3  9  
ATOM 9702  H HE2  . LYS A 1 50 ? 5.495   -2.582  0.002   1.00 0.00 ? 50 LYS A HE2  9  
ATOM 9703  H HE3  . LYS A 1 50 ? 3.770   -2.524  -0.336  1.00 0.00 ? 50 LYS A HE3  9  
ATOM 9704  H HZ1  . LYS A 1 50 ? 4.228   -1.399  -2.410  1.00 0.00 ? 50 LYS A HZ1  9  
ATOM 9705  H HZ2  . LYS A 1 50 ? 5.793   -1.188  -2.027  1.00 0.00 ? 50 LYS A HZ2  9  
ATOM 9706  H HZ3  . LYS A 1 50 ? 5.238   -2.699  -2.328  1.00 0.00 ? 50 LYS A HZ3  9  
ATOM 9707  N N    . VAL A 1 51 ? 2.893   4.109   2.273   1.00 0.00 ? 51 VAL A N    9  
ATOM 9708  C CA   . VAL A 1 51 ? 2.763   5.560   2.202   1.00 0.00 ? 51 VAL A CA   9  
ATOM 9709  C C    . VAL A 1 51 ? 4.149   6.205   2.398   1.00 0.00 ? 51 VAL A C    9  
ATOM 9710  O O    . VAL A 1 51 ? 4.623   6.915   1.516   1.00 0.00 ? 51 VAL A O    9  
ATOM 9711  C CB   . VAL A 1 51 ? 1.708   6.030   3.231   1.00 0.00 ? 51 VAL A CB   9  
ATOM 9712  C CG1  . VAL A 1 51 ? 1.593   7.547   3.328   1.00 0.00 ? 51 VAL A CG1  9  
ATOM 9713  C CG2  . VAL A 1 51 ? 0.289   5.524   2.944   1.00 0.00 ? 51 VAL A CG2  9  
ATOM 9714  H H    . VAL A 1 51 ? 2.379   3.609   2.990   1.00 0.00 ? 51 VAL A H    9  
ATOM 9715  H HA   . VAL A 1 51 ? 2.415   5.822   1.203   1.00 0.00 ? 51 VAL A HA   9  
ATOM 9716  H HB   . VAL A 1 51 ? 1.986   5.668   4.215   1.00 0.00 ? 51 VAL A HB   9  
ATOM 9717  H HG11 . VAL A 1 51 ? 2.519   7.958   3.722   1.00 0.00 ? 51 VAL A HG11 9  
ATOM 9718  H HG12 . VAL A 1 51 ? 1.386   7.967   2.344   1.00 0.00 ? 51 VAL A HG12 9  
ATOM 9719  H HG13 . VAL A 1 51 ? 0.779   7.794   4.010   1.00 0.00 ? 51 VAL A HG13 9  
ATOM 9720  H HG21 . VAL A 1 51 ? -0.323  5.701   3.829   1.00 0.00 ? 51 VAL A HG21 9  
ATOM 9721  H HG22 . VAL A 1 51 ? -0.136  6.046   2.088   1.00 0.00 ? 51 VAL A HG22 9  
ATOM 9722  H HG23 . VAL A 1 51 ? 0.287   4.461   2.743   1.00 0.00 ? 51 VAL A HG23 9  
ATOM 9723  N N    . LYS A 1 52 ? 4.822   5.945   3.524   1.00 0.00 ? 52 LYS A N    9  
ATOM 9724  C CA   . LYS A 1 52 ? 6.119   6.533   3.916   1.00 0.00 ? 52 LYS A CA   9  
ATOM 9725  C C    . LYS A 1 52 ? 7.221   6.299   2.905   1.00 0.00 ? 52 LYS A C    9  
ATOM 9726  O O    . LYS A 1 52 ? 8.084   7.151   2.696   1.00 0.00 ? 52 LYS A O    9  
ATOM 9727  C CB   . LYS A 1 52 ? 6.487   5.948   5.290   1.00 0.00 ? 52 LYS A CB   9  
ATOM 9728  C CG   . LYS A 1 52 ? 5.675   6.710   6.338   1.00 0.00 ? 52 LYS A CG   9  
ATOM 9729  C CD   . LYS A 1 52 ? 5.029   5.815   7.393   1.00 0.00 ? 52 LYS A CD   9  
ATOM 9730  C CE   . LYS A 1 52 ? 5.310   6.238   8.837   1.00 0.00 ? 52 LYS A CE   9  
ATOM 9731  N NZ   . LYS A 1 52 ? 6.652   5.822   9.288   1.00 0.00 ? 52 LYS A NZ   9  
ATOM 9732  H H    . LYS A 1 52 ? 4.376   5.312   4.184   1.00 0.00 ? 52 LYS A H    9  
ATOM 9733  H HA   . LYS A 1 52 ? 6.022   7.613   3.998   1.00 0.00 ? 52 LYS A HA   9  
ATOM 9734  H HB2  . LYS A 1 52 ? 6.252   4.886   5.304   1.00 0.00 ? 52 LYS A HB2  9  
ATOM 9735  H HB3  . LYS A 1 52 ? 7.543   6.042   5.514   1.00 0.00 ? 52 LYS A HB3  9  
ATOM 9736  H HG2  . LYS A 1 52 ? 6.286   7.489   6.793   1.00 0.00 ? 52 LYS A HG2  9  
ATOM 9737  H HG3  . LYS A 1 52 ? 4.860   7.187   5.799   1.00 0.00 ? 52 LYS A HG3  9  
ATOM 9738  H HD2  . LYS A 1 52 ? 3.958   5.897   7.208   1.00 0.00 ? 52 LYS A HD2  9  
ATOM 9739  H HD3  . LYS A 1 52 ? 5.318   4.775   7.251   1.00 0.00 ? 52 LYS A HD3  9  
ATOM 9740  H HE2  . LYS A 1 52 ? 5.204   7.321   8.918   1.00 0.00 ? 52 LYS A HE2  9  
ATOM 9741  H HE3  . LYS A 1 52 ? 4.566   5.770   9.482   1.00 0.00 ? 52 LYS A HE3  9  
ATOM 9742  H HZ1  . LYS A 1 52 ? 6.740   4.809   9.255   1.00 0.00 ? 52 LYS A HZ1  9  
ATOM 9743  H HZ2  . LYS A 1 52 ? 7.373   6.237   8.707   1.00 0.00 ? 52 LYS A HZ2  9  
ATOM 9744  H HZ3  . LYS A 1 52 ? 6.830   6.131   10.240  1.00 0.00 ? 52 LYS A HZ3  9  
ATOM 9745  N N    . GLU A 1 53 ? 7.179   5.132   2.299   1.00 0.00 ? 53 GLU A N    9  
ATOM 9746  C CA   . GLU A 1 53 ? 7.995   4.679   1.208   1.00 0.00 ? 53 GLU A CA   9  
ATOM 9747  C C    . GLU A 1 53 ? 7.703   5.546   -0.016  1.00 0.00 ? 53 GLU A C    9  
ATOM 9748  O O    . GLU A 1 53 ? 8.592   6.252   -0.502  1.00 0.00 ? 53 GLU A O    9  
ATOM 9749  C CB   . GLU A 1 53 ? 7.687   3.201   1.027   1.00 0.00 ? 53 GLU A CB   9  
ATOM 9750  C CG   . GLU A 1 53 ? 8.307   2.327   2.118   1.00 0.00 ? 53 GLU A CG   9  
ATOM 9751  C CD   . GLU A 1 53 ? 9.755   1.885   1.906   1.00 0.00 ? 53 GLU A CD   9  
ATOM 9752  O OE1  . GLU A 1 53 ? 9.964   0.905   1.152   1.00 0.00 ? 53 GLU A OE1  9  
ATOM 9753  O OE2  . GLU A 1 53 ? 10.648  2.398   2.622   1.00 0.00 ? 53 GLU A OE2  9  
ATOM 9754  H H    . GLU A 1 53 ? 6.454   4.500   2.610   1.00 0.00 ? 53 GLU A H    9  
ATOM 9755  H HA   . GLU A 1 53 ? 9.044   4.747   1.450   1.00 0.00 ? 53 GLU A HA   9  
ATOM 9756  H HB2  . GLU A 1 53 ? 6.615   3.056   1.040   1.00 0.00 ? 53 GLU A HB2  9  
ATOM 9757  H HB3  . GLU A 1 53 ? 8.016   2.883   0.074   1.00 0.00 ? 53 GLU A HB3  9  
ATOM 9758  H HG2  . GLU A 1 53 ? 8.264   2.872   3.052   1.00 0.00 ? 53 GLU A HG2  9  
ATOM 9759  H HG3  . GLU A 1 53 ? 7.680   1.445   2.205   1.00 0.00 ? 53 GLU A HG3  9  
ATOM 9760  N N    . ARG A 1 54 ? 6.459   5.510   -0.507  1.00 0.00 ? 54 ARG A N    9  
ATOM 9761  C CA   . ARG A 1 54 ? 6.032   6.187   -1.731  1.00 0.00 ? 54 ARG A CA   9  
ATOM 9762  C C    . ARG A 1 54 ? 6.182   7.704   -1.641  1.00 0.00 ? 54 ARG A C    9  
ATOM 9763  O O    . ARG A 1 54 ? 6.326   8.355   -2.676  1.00 0.00 ? 54 ARG A O    9  
ATOM 9764  C CB   . ARG A 1 54 ? 4.570   5.818   -2.043  1.00 0.00 ? 54 ARG A CB   9  
ATOM 9765  C CG   . ARG A 1 54 ? 4.374   4.371   -2.521  1.00 0.00 ? 54 ARG A CG   9  
ATOM 9766  C CD   . ARG A 1 54 ? 4.916   4.190   -3.934  1.00 0.00 ? 54 ARG A CD   9  
ATOM 9767  N NE   . ARG A 1 54 ? 4.799   2.795   -4.376  1.00 0.00 ? 54 ARG A NE   9  
ATOM 9768  C CZ   . ARG A 1 54 ? 5.694   2.115   -5.091  1.00 0.00 ? 54 ARG A CZ   9  
ATOM 9769  N NH1  . ARG A 1 54 ? 6.739   2.753   -5.606  1.00 0.00 ? 54 ARG A NH1  9  
ATOM 9770  N NH2  . ARG A 1 54 ? 5.543   0.813   -5.299  1.00 0.00 ? 54 ARG A NH2  9  
ATOM 9771  H H    . ARG A 1 54 ? 5.755   4.971   -0.007  1.00 0.00 ? 54 ARG A H    9  
ATOM 9772  H HA   . ARG A 1 54 ? 6.682   5.846   -2.534  1.00 0.00 ? 54 ARG A HA   9  
ATOM 9773  H HB2  . ARG A 1 54 ? 3.969   5.972   -1.148  1.00 0.00 ? 54 ARG A HB2  9  
ATOM 9774  H HB3  . ARG A 1 54 ? 4.185   6.489   -2.812  1.00 0.00 ? 54 ARG A HB3  9  
ATOM 9775  H HG2  . ARG A 1 54 ? 4.885   3.678   -1.855  1.00 0.00 ? 54 ARG A HG2  9  
ATOM 9776  H HG3  . ARG A 1 54 ? 3.310   4.141   -2.525  1.00 0.00 ? 54 ARG A HG3  9  
ATOM 9777  H HD2  . ARG A 1 54 ? 4.356   4.831   -4.613  1.00 0.00 ? 54 ARG A HD2  9  
ATOM 9778  H HD3  . ARG A 1 54 ? 5.961   4.487   -3.939  1.00 0.00 ? 54 ARG A HD3  9  
ATOM 9779  H HE   . ARG A 1 54 ? 3.867   2.383   -4.244  1.00 0.00 ? 54 ARG A HE   9  
ATOM 9780  H HH11 . ARG A 1 54 ? 6.751   3.773   -5.559  1.00 0.00 ? 54 ARG A HH11 9  
ATOM 9781  H HH12 . ARG A 1 54 ? 7.520   2.315   -6.101  1.00 0.00 ? 54 ARG A HH12 9  
ATOM 9782  H HH21 . ARG A 1 54 ? 4.748   0.334   -4.872  1.00 0.00 ? 54 ARG A HH21 9  
ATOM 9783  H HH22 . ARG A 1 54 ? 6.171   0.278   -5.880  1.00 0.00 ? 54 ARG A HH22 9  
ATOM 9784  N N    . LEU A 1 55 ? 6.203   8.263   -0.429  1.00 0.00 ? 55 LEU A N    9  
ATOM 9785  C CA   . LEU A 1 55 ? 6.494   9.666   -0.156  1.00 0.00 ? 55 LEU A CA   9  
ATOM 9786  C C    . LEU A 1 55 ? 7.917   10.066  -0.574  1.00 0.00 ? 55 LEU A C    9  
ATOM 9787  O O    . LEU A 1 55 ? 8.192   11.266  -0.655  1.00 0.00 ? 55 LEU A O    9  
ATOM 9788  C CB   . LEU A 1 55 ? 6.252   9.967   1.333   1.00 0.00 ? 55 LEU A CB   9  
ATOM 9789  C CG   . LEU A 1 55 ? 4.771   10.249  1.674   1.00 0.00 ? 55 LEU A CG   9  
ATOM 9790  C CD1  . LEU A 1 55 ? 4.532   10.128  3.182   1.00 0.00 ? 55 LEU A CD1  9  
ATOM 9791  C CD2  . LEU A 1 55 ? 4.340   11.649  1.223   1.00 0.00 ? 55 LEU A CD2  9  
ATOM 9792  H H    . LEU A 1 55 ? 5.967   7.674   0.363   1.00 0.00 ? 55 LEU A H    9  
ATOM 9793  H HA   . LEU A 1 55 ? 5.811   10.275  -0.749  1.00 0.00 ? 55 LEU A HA   9  
ATOM 9794  H HB2  . LEU A 1 55 ? 6.625   9.135   1.930   1.00 0.00 ? 55 LEU A HB2  9  
ATOM 9795  H HB3  . LEU A 1 55 ? 6.844   10.835  1.612   1.00 0.00 ? 55 LEU A HB3  9  
ATOM 9796  H HG   . LEU A 1 55 ? 4.134   9.515   1.178   1.00 0.00 ? 55 LEU A HG   9  
ATOM 9797  H HD11 . LEU A 1 55 ? 3.507   10.414  3.419   1.00 0.00 ? 55 LEU A HD11 9  
ATOM 9798  H HD12 . LEU A 1 55 ? 4.673   9.096   3.486   1.00 0.00 ? 55 LEU A HD12 9  
ATOM 9799  H HD13 . LEU A 1 55 ? 5.220   10.773  3.730   1.00 0.00 ? 55 LEU A HD13 9  
ATOM 9800  H HD21 . LEU A 1 55 ? 4.948   12.413  1.710   1.00 0.00 ? 55 LEU A HD21 9  
ATOM 9801  H HD22 . LEU A 1 55 ? 4.437   11.747  0.144   1.00 0.00 ? 55 LEU A HD22 9  
ATOM 9802  H HD23 . LEU A 1 55 ? 3.292   11.812  1.479   1.00 0.00 ? 55 LEU A HD23 9  
ATOM 9803  N N    . GLY A 1 56 ? 8.779   9.112   -0.951  1.00 0.00 ? 56 GLY A N    9  
ATOM 9804  C CA   . GLY A 1 56 ? 10.058  9.380   -1.599  1.00 0.00 ? 56 GLY A CA   9  
ATOM 9805  C C    . GLY A 1 56 ? 11.282  8.856   -0.850  1.00 0.00 ? 56 GLY A C    9  
ATOM 9806  O O    . GLY A 1 56 ? 12.375  9.386   -1.054  1.00 0.00 ? 56 GLY A O    9  
ATOM 9807  H H    . GLY A 1 56 ? 8.497   8.144   -0.849  1.00 0.00 ? 56 GLY A H    9  
ATOM 9808  H HA2  . GLY A 1 56 ? 10.040  8.921   -2.587  1.00 0.00 ? 56 GLY A HA2  9  
ATOM 9809  H HA3  . GLY A 1 56 ? 10.178  10.453  -1.742  1.00 0.00 ? 56 GLY A HA3  9  
ATOM 9810  N N    . THR A 1 57 ? 11.136  7.833   -0.006  1.00 0.00 ? 57 THR A N    9  
ATOM 9811  C CA   . THR A 1 57 ? 12.261  7.186   0.681   1.00 0.00 ? 57 THR A CA   9  
ATOM 9812  C C    . THR A 1 57 ? 12.790  5.949   -0.076  1.00 0.00 ? 57 THR A C    9  
ATOM 9813  O O    . THR A 1 57 ? 13.732  5.277   0.360   1.00 0.00 ? 57 THR A O    9  
ATOM 9814  C CB   . THR A 1 57 ? 11.839  6.849   2.116   1.00 0.00 ? 57 THR A CB   9  
ATOM 9815  O OG1  . THR A 1 57 ? 10.579  6.233   2.184   1.00 0.00 ? 57 THR A OG1  9  
ATOM 9816  C CG2  . THR A 1 57 ? 11.745  8.098   2.994   1.00 0.00 ? 57 THR A CG2  9  
ATOM 9817  H H    . THR A 1 57 ? 10.220  7.427   0.143   1.00 0.00 ? 57 THR A H    9  
ATOM 9818  H HA   . THR A 1 57 ? 13.094  7.886   0.745   1.00 0.00 ? 57 THR A HA   9  
ATOM 9819  H HB   . THR A 1 57 ? 12.556  6.136   2.513   1.00 0.00 ? 57 THR A HB   9  
ATOM 9820  H HG1  . THR A 1 57 ? 9.880   6.908   2.272   1.00 0.00 ? 57 THR A HG1  9  
ATOM 9821  H HG21 . THR A 1 57 ? 10.994  8.787   2.597   1.00 0.00 ? 57 THR A HG21 9  
ATOM 9822  H HG22 . THR A 1 57 ? 11.459  7.825   4.010   1.00 0.00 ? 57 THR A HG22 9  
ATOM 9823  H HG23 . THR A 1 57 ? 12.716  8.589   3.023   1.00 0.00 ? 57 THR A HG23 9  
ATOM 9824  N N    . LEU A 1 58 ? 12.171  5.621   -1.214  1.00 0.00 ? 58 LEU A N    9  
ATOM 9825  C CA   . LEU A 1 58 ? 12.423  4.420   -2.005  1.00 0.00 ? 58 LEU A CA   9  
ATOM 9826  C C    . LEU A 1 58 ? 13.669  4.598   -2.875  1.00 0.00 ? 58 LEU A C    9  
ATOM 9827  O O    . LEU A 1 58 ? 13.586  4.609   -4.108  1.00 0.00 ? 58 LEU A O    9  
ATOM 9828  C CB   . LEU A 1 58 ? 11.172  4.119   -2.846  1.00 0.00 ? 58 LEU A CB   9  
ATOM 9829  C CG   . LEU A 1 58 ? 10.032  3.577   -1.971  1.00 0.00 ? 58 LEU A CG   9  
ATOM 9830  C CD1  . LEU A 1 58 ? 8.685   3.861   -2.636  1.00 0.00 ? 58 LEU A CD1  9  
ATOM 9831  C CD2  . LEU A 1 58 ? 10.133  2.061   -1.824  1.00 0.00 ? 58 LEU A CD2  9  
ATOM 9832  H H    . LEU A 1 58 ? 11.402  6.214   -1.487  1.00 0.00 ? 58 LEU A H    9  
ATOM 9833  H HA   . LEU A 1 58 ? 12.602  3.581   -1.328  1.00 0.00 ? 58 LEU A HA   9  
ATOM 9834  H HB2  . LEU A 1 58 ? 10.863  5.039   -3.344  1.00 0.00 ? 58 LEU A HB2  9  
ATOM 9835  H HB3  . LEU A 1 58 ? 11.409  3.386   -3.618  1.00 0.00 ? 58 LEU A HB3  9  
ATOM 9836  H HG   . LEU A 1 58 ? 10.072  4.047   -0.978  1.00 0.00 ? 58 LEU A HG   9  
ATOM 9837  H HD11 . LEU A 1 58 ? 8.595   4.932   -2.800  1.00 0.00 ? 58 LEU A HD11 9  
ATOM 9838  H HD12 . LEU A 1 58 ? 8.614   3.347   -3.592  1.00 0.00 ? 58 LEU A HD12 9  
ATOM 9839  H HD13 . LEU A 1 58 ? 7.878   3.535   -1.979  1.00 0.00 ? 58 LEU A HD13 9  
ATOM 9840  H HD21 . LEU A 1 58 ? 11.034  1.803   -1.268  1.00 0.00 ? 58 LEU A HD21 9  
ATOM 9841  H HD22 . LEU A 1 58 ? 9.270   1.707   -1.269  1.00 0.00 ? 58 LEU A HD22 9  
ATOM 9842  H HD23 . LEU A 1 58 ? 10.148  1.581   -2.802  1.00 0.00 ? 58 LEU A HD23 9  
ATOM 9843  N N    . LYS A 1 59 ? 14.835  4.758   -2.248  1.00 0.00 ? 59 LYS A N    9  
ATOM 9844  C CA   . LYS A 1 59 ? 16.110  4.809   -2.958  1.00 0.00 ? 59 LYS A CA   9  
ATOM 9845  C C    . LYS A 1 59 ? 16.336  3.479   -3.680  1.00 0.00 ? 59 LYS A C    9  
ATOM 9846  O O    . LYS A 1 59 ? 15.796  2.449   -3.267  1.00 0.00 ? 59 LYS A O    9  
ATOM 9847  C CB   . LYS A 1 59 ? 17.234  5.149   -1.961  1.00 0.00 ? 59 LYS A CB   9  
ATOM 9848  C CG   . LYS A 1 59 ? 18.417  5.876   -2.622  1.00 0.00 ? 59 LYS A CG   9  
ATOM 9849  C CD   . LYS A 1 59 ? 19.216  6.686   -1.590  1.00 0.00 ? 59 LYS A CD   9  
ATOM 9850  C CE   . LYS A 1 59 ? 20.376  7.468   -2.224  1.00 0.00 ? 59 LYS A CE   9  
ATOM 9851  N NZ   . LYS A 1 59 ? 21.487  6.590   -2.640  1.00 0.00 ? 59 LYS A NZ   9  
ATOM 9852  H H    . LYS A 1 59 ? 14.825  4.796   -1.233  1.00 0.00 ? 59 LYS A H    9  
ATOM 9853  H HA   . LYS A 1 59 ? 16.031  5.607   -3.697  1.00 0.00 ? 59 LYS A HA   9  
ATOM 9854  H HB2  . LYS A 1 59 ? 16.823  5.806   -1.196  1.00 0.00 ? 59 LYS A HB2  9  
ATOM 9855  H HB3  . LYS A 1 59 ? 17.586  4.242   -1.465  1.00 0.00 ? 59 LYS A HB3  9  
ATOM 9856  H HG2  . LYS A 1 59 ? 19.060  5.147   -3.116  1.00 0.00 ? 59 LYS A HG2  9  
ATOM 9857  H HG3  . LYS A 1 59 ? 18.039  6.576   -3.364  1.00 0.00 ? 59 LYS A HG3  9  
ATOM 9858  H HD2  . LYS A 1 59 ? 18.543  7.402   -1.117  1.00 0.00 ? 59 LYS A HD2  9  
ATOM 9859  H HD3  . LYS A 1 59 ? 19.591  6.033   -0.804  1.00 0.00 ? 59 LYS A HD3  9  
ATOM 9860  H HE2  . LYS A 1 59 ? 20.010  8.040   -3.078  1.00 0.00 ? 59 LYS A HE2  9  
ATOM 9861  H HE3  . LYS A 1 59 ? 20.749  8.179   -1.487  1.00 0.00 ? 59 LYS A HE3  9  
ATOM 9862  H HZ1  . LYS A 1 59 ? 21.711  5.929   -1.903  1.00 0.00 ? 59 LYS A HZ1  9  
ATOM 9863  H HZ2  . LYS A 1 59 ? 21.241  6.023   -3.446  1.00 0.00 ? 59 LYS A HZ2  9  
ATOM 9864  H HZ3  . LYS A 1 59 ? 22.326  7.111   -2.886  1.00 0.00 ? 59 LYS A HZ3  9  
ATOM 9865  N N    . ASN A 1 60 ? 17.150  3.487   -4.740  1.00 0.00 ? 60 ASN A N    9  
ATOM 9866  C CA   . ASN A 1 60 ? 17.308  2.364   -5.675  1.00 0.00 ? 60 ASN A CA   9  
ATOM 9867  C C    . ASN A 1 60 ? 15.951  1.765   -6.106  1.00 0.00 ? 60 ASN A C    9  
ATOM 9868  O O    . ASN A 1 60 ? 15.673  0.589   -5.850  1.00 0.00 ? 60 ASN A O    9  
ATOM 9869  C CB   . ASN A 1 60 ? 18.290  1.316   -5.102  1.00 0.00 ? 60 ASN A CB   9  
ATOM 9870  C CG   . ASN A 1 60 ? 19.713  1.512   -5.591  1.00 0.00 ? 60 ASN A CG   9  
ATOM 9871  O OD1  . ASN A 1 60 ? 20.156  2.619   -5.893  1.00 0.00 ? 60 ASN A OD1  9  
ATOM 9872  N ND2  . ASN A 1 60 ? 20.432  0.427   -5.799  1.00 0.00 ? 60 ASN A ND2  9  
ATOM 9873  H H    . ASN A 1 60 ? 17.572  4.371   -4.987  1.00 0.00 ? 60 ASN A H    9  
ATOM 9874  H HA   . ASN A 1 60 ? 17.754  2.754   -6.588  1.00 0.00 ? 60 ASN A HA   9  
ATOM 9875  H HB2  . ASN A 1 60 ? 18.271  1.339   -4.013  1.00 0.00 ? 60 ASN A HB2  9  
ATOM 9876  H HB3  . ASN A 1 60 ? 17.982  0.317   -5.410  1.00 0.00 ? 60 ASN A HB3  9  
ATOM 9877  H HD21 . ASN A 1 60 ? 20.055  -0.464  -5.487  1.00 0.00 ? 60 ASN A HD21 9  
ATOM 9878  H HD22 . ASN A 1 60 ? 21.445  0.495   -5.910  1.00 0.00 ? 60 ASN A HD22 9  
ATOM 9879  N N    . PRO A 1 61 ? 15.080  2.543   -6.772  1.00 0.00 ? 61 PRO A N    9  
ATOM 9880  C CA   . PRO A 1 61 ? 13.791  2.042   -7.231  1.00 0.00 ? 61 PRO A CA   9  
ATOM 9881  C C    . PRO A 1 61 ? 13.945  1.148   -8.483  1.00 0.00 ? 61 PRO A C    9  
ATOM 9882  O O    . PRO A 1 61 ? 14.914  1.287   -9.242  1.00 0.00 ? 61 PRO A O    9  
ATOM 9883  C CB   . PRO A 1 61 ? 12.967  3.297   -7.510  1.00 0.00 ? 61 PRO A CB   9  
ATOM 9884  C CG   . PRO A 1 61 ? 14.023  4.292   -7.990  1.00 0.00 ? 61 PRO A CG   9  
ATOM 9885  C CD   . PRO A 1 61 ? 15.236  3.946   -7.131  1.00 0.00 ? 61 PRO A CD   9  
ATOM 9886  H HA   . PRO A 1 61 ? 13.320  1.477   -6.426  1.00 0.00 ? 61 PRO A HA   9  
ATOM 9887  H HB2  . PRO A 1 61 ? 12.195  3.117   -8.257  1.00 0.00 ? 61 PRO A HB2  9  
ATOM 9888  H HB3  . PRO A 1 61 ? 12.522  3.655   -6.580  1.00 0.00 ? 61 PRO A HB3  9  
ATOM 9889  H HG2  . PRO A 1 61 ? 14.252  4.104   -9.038  1.00 0.00 ? 61 PRO A HG2  9  
ATOM 9890  H HG3  . PRO A 1 61 ? 13.709  5.325   -7.843  1.00 0.00 ? 61 PRO A HG3  9  
ATOM 9891  H HD2  . PRO A 1 61 ? 16.157  4.117   -7.690  1.00 0.00 ? 61 PRO A HD2  9  
ATOM 9892  H HD3  . PRO A 1 61 ? 15.217  4.553   -6.226  1.00 0.00 ? 61 PRO A HD3  9  
ATOM 9893  N N    . PRO A 1 62 ? 12.983  0.244   -8.745  1.00 0.00 ? 62 PRO A N    9  
ATOM 9894  C CA   . PRO A 1 62 ? 13.065  -0.758  -9.802  1.00 0.00 ? 62 PRO A CA   9  
ATOM 9895  C C    . PRO A 1 62 ? 12.708  -0.171  -11.180 1.00 0.00 ? 62 PRO A C    9  
ATOM 9896  O O    . PRO A 1 62 ? 11.693  -0.537  -11.780 1.00 0.00 ? 62 PRO A O    9  
ATOM 9897  C CB   . PRO A 1 62 ? 12.122  -1.875  -9.338  1.00 0.00 ? 62 PRO A CB   9  
ATOM 9898  C CG   . PRO A 1 62 ? 11.005  -1.093  -8.654  1.00 0.00 ? 62 PRO A CG   9  
ATOM 9899  C CD   . PRO A 1 62 ? 11.786  0.013   -7.947  1.00 0.00 ? 62 PRO A CD   9  
ATOM 9900  H HA   . PRO A 1 62 ? 14.072  -1.164  -9.846  1.00 0.00 ? 62 PRO A HA   9  
ATOM 9901  H HB2  . PRO A 1 62 ? 11.759  -2.498  -10.152 1.00 0.00 ? 62 PRO A HB2  9  
ATOM 9902  H HB3  . PRO A 1 62 ? 12.632  -2.498  -8.600  1.00 0.00 ? 62 PRO A HB3  9  
ATOM 9903  H HG2  . PRO A 1 62 ? 10.336  -0.658  -9.395  1.00 0.00 ? 62 PRO A HG2  9  
ATOM 9904  H HG3  . PRO A 1 62 ? 10.441  -1.710  -7.957  1.00 0.00 ? 62 PRO A HG3  9  
ATOM 9905  H HD2  . PRO A 1 62 ? 11.178  0.913   -7.874  1.00 0.00 ? 62 PRO A HD2  9  
ATOM 9906  H HD3  . PRO A 1 62 ? 12.073  -0.329  -6.954  1.00 0.00 ? 62 PRO A HD3  9  
ATOM 9907  N N    . LYS A 1 63 ? 13.527  0.756   -11.684 1.00 0.00 ? 63 LYS A N    9  
ATOM 9908  C CA   . LYS A 1 63 ? 13.586  1.143   -13.101 1.00 0.00 ? 63 LYS A CA   9  
ATOM 9909  C C    . LYS A 1 63 ? 14.976  1.644   -13.492 1.00 0.00 ? 63 LYS A C    9  
ATOM 9910  O O    . LYS A 1 63 ? 15.346  1.547   -14.659 1.00 0.00 ? 63 LYS A O    9  
ATOM 9911  C CB   . LYS A 1 63 ? 12.500  2.180   -13.431 1.00 0.00 ? 63 LYS A CB   9  
ATOM 9912  C CG   . LYS A 1 63 ? 12.416  2.546   -14.925 1.00 0.00 ? 63 LYS A CG   9  
ATOM 9913  C CD   . LYS A 1 63 ? 10.986  2.869   -15.387 1.00 0.00 ? 63 LYS A CD   9  
ATOM 9914  C CE   . LYS A 1 63 ? 10.138  1.588   -15.413 1.00 0.00 ? 63 LYS A CE   9  
ATOM 9915  N NZ   . LYS A 1 63 ? 8.781   1.798   -15.954 1.00 0.00 ? 63 LYS A NZ   9  
ATOM 9916  H H    . LYS A 1 63 ? 14.276  1.044   -11.067 1.00 0.00 ? 63 LYS A H    9  
ATOM 9917  H HA   . LYS A 1 63 ? 13.382  0.250   -13.697 1.00 0.00 ? 63 LYS A HA   9  
ATOM 9918  H HB2  . LYS A 1 63 ? 11.547  1.768   -13.118 1.00 0.00 ? 63 LYS A HB2  9  
ATOM 9919  H HB3  . LYS A 1 63 ? 12.676  3.086   -12.858 1.00 0.00 ? 63 LYS A HB3  9  
ATOM 9920  H HG2  . LYS A 1 63 ? 13.054  3.413   -15.103 1.00 0.00 ? 63 LYS A HG2  9  
ATOM 9921  H HG3  . LYS A 1 63 ? 12.793  1.724   -15.534 1.00 0.00 ? 63 LYS A HG3  9  
ATOM 9922  H HD2  . LYS A 1 63 ? 10.539  3.603   -14.715 1.00 0.00 ? 63 LYS A HD2  9  
ATOM 9923  H HD3  . LYS A 1 63 ? 11.037  3.288   -16.395 1.00 0.00 ? 63 LYS A HD3  9  
ATOM 9924  H HE2  . LYS A 1 63 ? 10.643  0.849   -16.038 1.00 0.00 ? 63 LYS A HE2  9  
ATOM 9925  H HE3  . LYS A 1 63 ? 10.059  1.174   -14.406 1.00 0.00 ? 63 LYS A HE3  9  
ATOM 9926  H HZ1  . LYS A 1 63 ? 8.813   2.090   -16.927 1.00 0.00 ? 63 LYS A HZ1  9  
ATOM 9927  H HZ2  . LYS A 1 63 ? 8.283   0.912   -15.924 1.00 0.00 ? 63 LYS A HZ2  9  
ATOM 9928  H HZ3  . LYS A 1 63 ? 8.253   2.498   -15.446 1.00 0.00 ? 63 LYS A HZ3  9  
ATOM 9929  N N    . LYS A 1 64 ? 15.790  2.124   -12.540 1.00 0.00 ? 64 LYS A N    9  
ATOM 9930  C CA   . LYS A 1 64 ? 17.143  2.634   -12.799 1.00 0.00 ? 64 LYS A CA   9  
ATOM 9931  C C    . LYS A 1 64 ? 17.161  3.688   -13.921 1.00 0.00 ? 64 LYS A C    9  
ATOM 9932  O O    . LYS A 1 64 ? 18.073  3.691   -14.744 1.00 0.00 ? 64 LYS A O    9  
ATOM 9933  C CB   . LYS A 1 64 ? 18.102  1.463   -13.088 1.00 0.00 ? 64 LYS A CB   9  
ATOM 9934  C CG   . LYS A 1 64 ? 18.605  0.712   -11.855 1.00 0.00 ? 64 LYS A CG   9  
ATOM 9935  C CD   . LYS A 1 64 ? 19.297  -0.606  -12.246 1.00 0.00 ? 64 LYS A CD   9  
ATOM 9936  C CE   . LYS A 1 64 ? 20.537  -0.427  -13.138 1.00 0.00 ? 64 LYS A CE   9  
ATOM 9937  N NZ   . LYS A 1 64 ? 20.232  -0.213  -14.569 1.00 0.00 ? 64 LYS A NZ   9  
ATOM 9938  H H    . LYS A 1 64 ? 15.372  2.348   -11.645 1.00 0.00 ? 64 LYS A H    9  
ATOM 9939  H HA   . LYS A 1 64 ? 17.486  3.139   -11.898 1.00 0.00 ? 64 LYS A HA   9  
ATOM 9940  H HB2  . LYS A 1 64 ? 17.630  0.764   -13.780 1.00 0.00 ? 64 LYS A HB2  9  
ATOM 9941  H HB3  . LYS A 1 64 ? 18.986  1.862   -13.569 1.00 0.00 ? 64 LYS A HB3  9  
ATOM 9942  H HG2  . LYS A 1 64 ? 19.314  1.345   -11.321 1.00 0.00 ? 64 LYS A HG2  9  
ATOM 9943  H HG3  . LYS A 1 64 ? 17.774  0.499   -11.186 1.00 0.00 ? 64 LYS A HG3  9  
ATOM 9944  H HD2  . LYS A 1 64 ? 19.623  -1.087  -11.325 1.00 0.00 ? 64 LYS A HD2  9  
ATOM 9945  H HD3  . LYS A 1 64 ? 18.585  -1.277  -12.730 1.00 0.00 ? 64 LYS A HD3  9  
ATOM 9946  H HE2  . LYS A 1 64 ? 21.132  0.409   -12.768 1.00 0.00 ? 64 LYS A HE2  9  
ATOM 9947  H HE3  . LYS A 1 64 ? 21.150  -1.325  -13.061 1.00 0.00 ? 64 LYS A HE3  9  
ATOM 9948  H HZ1  . LYS A 1 64 ? 19.683  -0.975  -14.958 1.00 0.00 ? 64 LYS A HZ1  9  
ATOM 9949  H HZ2  . LYS A 1 64 ? 19.780  0.676   -14.725 1.00 0.00 ? 64 LYS A HZ2  9  
ATOM 9950  H HZ3  . LYS A 1 64 ? 21.090  -0.188  -15.116 1.00 0.00 ? 64 LYS A HZ3  9  
ATOM 9951  N N    . LYS A 1 65 ? 16.198  4.618   -13.900 1.00 0.00 ? 65 LYS A N    9  
ATOM 9952  C CA   . LYS A 1 65 ? 15.923  5.661   -14.897 1.00 0.00 ? 65 LYS A CA   9  
ATOM 9953  C C    . LYS A 1 65 ? 17.157  6.124   -15.668 1.00 0.00 ? 65 LYS A C    9  
ATOM 9954  O O    . LYS A 1 65 ? 17.147  6.128   -16.899 1.00 0.00 ? 65 LYS A O    9  
ATOM 9955  C CB   . LYS A 1 65 ? 15.205  6.833   -14.205 1.00 0.00 ? 65 LYS A CB   9  
ATOM 9956  C CG   . LYS A 1 65 ? 14.802  7.961   -15.168 1.00 0.00 ? 65 LYS A CG   9  
ATOM 9957  C CD   . LYS A 1 65 ? 14.042  9.049   -14.402 1.00 0.00 ? 65 LYS A CD   9  
ATOM 9958  C CE   . LYS A 1 65 ? 13.616  10.173  -15.345 1.00 0.00 ? 65 LYS A CE   9  
ATOM 9959  N NZ   . LYS A 1 65 ? 12.799  11.198  -14.664 1.00 0.00 ? 65 LYS A NZ   9  
ATOM 9960  H H    . LYS A 1 65 ? 15.509  4.522   -13.162 1.00 0.00 ? 65 LYS A H    9  
ATOM 9961  H HA   . LYS A 1 65 ? 15.236  5.234   -15.625 1.00 0.00 ? 65 LYS A HA   9  
ATOM 9962  H HB2  . LYS A 1 65 ? 14.302  6.450   -13.728 1.00 0.00 ? 65 LYS A HB2  9  
ATOM 9963  H HB3  . LYS A 1 65 ? 15.852  7.247   -13.430 1.00 0.00 ? 65 LYS A HB3  9  
ATOM 9964  H HG2  . LYS A 1 65 ? 15.691  8.403   -15.620 1.00 0.00 ? 65 LYS A HG2  9  
ATOM 9965  H HG3  . LYS A 1 65 ? 14.164  7.556   -15.955 1.00 0.00 ? 65 LYS A HG3  9  
ATOM 9966  H HD2  . LYS A 1 65 ? 13.153  8.607   -13.952 1.00 0.00 ? 65 LYS A HD2  9  
ATOM 9967  H HD3  . LYS A 1 65 ? 14.683  9.458   -13.621 1.00 0.00 ? 65 LYS A HD3  9  
ATOM 9968  H HE2  . LYS A 1 65 ? 14.499  10.642  -15.778 1.00 0.00 ? 65 LYS A HE2  9  
ATOM 9969  H HE3  . LYS A 1 65 ? 13.029  9.737   -16.155 1.00 0.00 ? 65 LYS A HE3  9  
ATOM 9970  H HZ1  . LYS A 1 65 ? 13.358  11.899  -14.189 1.00 0.00 ? 65 LYS A HZ1  9  
ATOM 9971  H HZ2  . LYS A 1 65 ? 12.193  11.659  -15.343 1.00 0.00 ? 65 LYS A HZ2  9  
ATOM 9972  H HZ3  . LYS A 1 65 ? 12.178  10.784  -13.978 1.00 0.00 ? 65 LYS A HZ3  9  
ATOM 9973  N N    . MET A 1 66 ? 18.207  6.540   -14.955 1.00 0.00 ? 66 MET A N    9  
ATOM 9974  C CA   . MET A 1 66 ? 19.475  6.918   -15.557 1.00 0.00 ? 66 MET A CA   9  
ATOM 9975  C C    . MET A 1 66 ? 20.619  6.534   -14.613 1.00 0.00 ? 66 MET A C    9  
ATOM 9976  O O    . MET A 1 66 ? 21.315  7.408   -14.093 1.00 0.00 ? 66 MET A O    9  
ATOM 9977  C CB   . MET A 1 66 ? 19.407  8.418   -15.900 1.00 0.00 ? 66 MET A CB   9  
ATOM 9978  C CG   . MET A 1 66 ? 20.625  8.896   -16.693 1.00 0.00 ? 66 MET A CG   9  
ATOM 9979  S SD   . MET A 1 66 ? 20.380  10.466  -17.544 1.00 0.00 ? 66 MET A SD   9  
ATOM 9980  C CE   . MET A 1 66 ? 19.428  9.868   -18.960 1.00 0.00 ? 66 MET A CE   9  
ATOM 9981  H H    . MET A 1 66 ? 18.149  6.520   -13.949 1.00 0.00 ? 66 MET A H    9  
ATOM 9982  H HA   . MET A 1 66 ? 19.609  6.360   -16.486 1.00 0.00 ? 66 MET A HA   9  
ATOM 9983  H HB2  . MET A 1 66 ? 18.518  8.590   -16.507 1.00 0.00 ? 66 MET A HB2  9  
ATOM 9984  H HB3  . MET A 1 66 ? 19.312  9.012   -14.990 1.00 0.00 ? 66 MET A HB3  9  
ATOM 9985  H HG2  . MET A 1 66 ? 21.478  8.996   -16.021 1.00 0.00 ? 66 MET A HG2  9  
ATOM 9986  H HG3  . MET A 1 66 ? 20.868  8.153   -17.448 1.00 0.00 ? 66 MET A HG3  9  
ATOM 9987  H HE1  . MET A 1 66 ? 19.290  10.674  -19.678 1.00 0.00 ? 66 MET A HE1  9  
ATOM 9988  H HE2  . MET A 1 66 ? 19.969  9.053   -19.443 1.00 0.00 ? 66 MET A HE2  9  
ATOM 9989  H HE3  . MET A 1 66 ? 18.455  9.505   -18.631 1.00 0.00 ? 66 MET A HE3  9  
ATOM 9990  N N    . LYS A 1 67 ? 20.784  5.241   -14.306 1.00 0.00 ? 67 LYS A N    9  
ATOM 9991  C CA   . LYS A 1 67 ? 21.904  4.755   -13.489 1.00 0.00 ? 67 LYS A CA   9  
ATOM 9992  C C    . LYS A 1 67 ? 22.199  3.288   -13.797 1.00 0.00 ? 67 LYS A C    9  
ATOM 9993  O O    . LYS A 1 67 ? 21.280  2.535   -14.124 1.00 0.00 ? 67 LYS A O    9  
ATOM 9994  C CB   . LYS A 1 67 ? 21.619  5.003   -11.997 1.00 0.00 ? 67 LYS A CB   9  
ATOM 9995  C CG   . LYS A 1 67 ? 20.439  4.198   -11.417 1.00 0.00 ? 67 LYS A CG   9  
ATOM 9996  C CD   . LYS A 1 67 ? 19.592  5.020   -10.426 1.00 0.00 ? 67 LYS A CD   9  
ATOM 9997  C CE   . LYS A 1 67 ? 19.262  4.273   -9.129  1.00 0.00 ? 67 LYS A CE   9  
ATOM 9998  N NZ   . LYS A 1 67 ? 20.452  4.147   -8.263  1.00 0.00 ? 67 LYS A NZ   9  
ATOM 9999  H H    . LYS A 1 67 ? 20.184  4.536   -14.729 1.00 0.00 ? 67 LYS A H    9  
ATOM 10000 H HA   . LYS A 1 67 ? 22.788  5.336   -13.751 1.00 0.00 ? 67 LYS A HA   9  
ATOM 10001 H HB2  . LYS A 1 67 ? 22.517  4.770   -11.428 1.00 0.00 ? 67 LYS A HB2  9  
ATOM 10002 H HB3  . LYS A 1 67 ? 21.442  6.071   -11.868 1.00 0.00 ? 67 LYS A HB3  9  
ATOM 10003 H HG2  . LYS A 1 67 ? 19.779  3.872   -12.219 1.00 0.00 ? 67 LYS A HG2  9  
ATOM 10004 H HG3  . LYS A 1 67 ? 20.834  3.303   -10.935 1.00 0.00 ? 67 LYS A HG3  9  
ATOM 10005 H HD2  . LYS A 1 67 ? 20.098  5.950   -10.164 1.00 0.00 ? 67 LYS A HD2  9  
ATOM 10006 H HD3  . LYS A 1 67 ? 18.656  5.292   -10.917 1.00 0.00 ? 67 LYS A HD3  9  
ATOM 10007 H HE2  . LYS A 1 67 ? 18.497  4.842   -8.596  1.00 0.00 ? 67 LYS A HE2  9  
ATOM 10008 H HE3  . LYS A 1 67 ? 18.868  3.283   -9.365  1.00 0.00 ? 67 LYS A HE3  9  
ATOM 10009 H HZ1  . LYS A 1 67 ? 21.179  3.625   -8.729  1.00 0.00 ? 67 LYS A HZ1  9  
ATOM 10010 H HZ2  . LYS A 1 67 ? 20.842  5.067   -8.056  1.00 0.00 ? 67 LYS A HZ2  9  
ATOM 10011 H HZ3  . LYS A 1 67 ? 20.234  3.679   -7.390  1.00 0.00 ? 67 LYS A HZ3  9  
ATOM 10012 N N    . LEU A 1 68 ? 23.458  2.861   -13.663 1.00 0.00 ? 68 LEU A N    9  
ATOM 10013 C CA   . LEU A 1 68 ? 23.874  1.503   -14.034 1.00 0.00 ? 68 LEU A CA   9  
ATOM 10014 C C    . LEU A 1 68 ? 23.811  0.537   -12.849 1.00 0.00 ? 68 LEU A C    9  
ATOM 10015 O O    . LEU A 1 68 ? 23.464  -0.620  -13.055 1.00 0.00 ? 68 LEU A O    9  
ATOM 10016 C CB   . LEU A 1 68 ? 25.252  1.503   -14.722 1.00 0.00 ? 68 LEU A CB   9  
ATOM 10017 C CG   . LEU A 1 68 ? 26.448  1.801   -13.794 1.00 0.00 ? 68 LEU A CG   9  
ATOM 10018 C CD1  . LEU A 1 68 ? 27.197  0.524   -13.401 1.00 0.00 ? 68 LEU A CD1  9  
ATOM 10019 C CD2  . LEU A 1 68 ? 27.411  2.791   -14.458 1.00 0.00 ? 68 LEU A CD2  9  
ATOM 10020 H H    . LEU A 1 68 ? 24.157  3.517   -13.326 1.00 0.00 ? 68 LEU A H    9  
ATOM 10021 H HA   . LEU A 1 68 ? 23.171  1.135   -14.782 1.00 0.00 ? 68 LEU A HA   9  
ATOM 10022 H HB2  . LEU A 1 68 ? 25.402  0.530   -15.192 1.00 0.00 ? 68 LEU A HB2  9  
ATOM 10023 H HB3  . LEU A 1 68 ? 25.218  2.231   -15.532 1.00 0.00 ? 68 LEU A HB3  9  
ATOM 10024 H HG   . LEU A 1 68 ? 26.081  2.265   -12.885 1.00 0.00 ? 68 LEU A HG   9  
ATOM 10025 H HD11 . LEU A 1 68 ? 27.988  0.762   -12.689 1.00 0.00 ? 68 LEU A HD11 9  
ATOM 10026 H HD12 . LEU A 1 68 ? 26.517  -0.190  -12.939 1.00 0.00 ? 68 LEU A HD12 9  
ATOM 10027 H HD13 . LEU A 1 68 ? 27.643  0.062   -14.282 1.00 0.00 ? 68 LEU A HD13 9  
ATOM 10028 H HD21 . LEU A 1 68 ? 26.882  3.708   -14.722 1.00 0.00 ? 68 LEU A HD21 9  
ATOM 10029 H HD22 . LEU A 1 68 ? 28.208  3.048   -13.763 1.00 0.00 ? 68 LEU A HD22 9  
ATOM 10030 H HD23 . LEU A 1 68 ? 27.849  2.354   -15.351 1.00 0.00 ? 68 LEU A HD23 9  
ATOM 10031 N N    . MET A 1 69 ? 24.070  1.023   -11.629 1.00 0.00 ? 69 MET A N    9  
ATOM 10032 C CA   . MET A 1 69 ? 24.054  0.317   -10.345 1.00 0.00 ? 69 MET A CA   9  
ATOM 10033 C C    . MET A 1 69 ? 24.323  -1.193  -10.422 1.00 0.00 ? 69 MET A C    9  
ATOM 10034 O O    . MET A 1 69 ? 23.393  -2.011  -10.375 1.00 0.00 ? 69 MET A O    9  
ATOM 10035 C CB   . MET A 1 69 ? 22.775  0.657   -9.554  1.00 0.00 ? 69 MET A CB   9  
ATOM 10036 C CG   . MET A 1 69 ? 23.034  1.746   -8.512  1.00 0.00 ? 69 MET A CG   9  
ATOM 10037 S SD   . MET A 1 69 ? 23.470  3.391   -9.125  1.00 0.00 ? 69 MET A SD   9  
ATOM 10038 C CE   . MET A 1 69 ? 25.260  3.373   -8.809  1.00 0.00 ? 69 MET A CE   9  
ATOM 10039 H H    . MET A 1 69 ? 24.348  1.993   -11.588 1.00 0.00 ? 69 MET A H    9  
ATOM 10040 H HA   . MET A 1 69 ? 24.890  0.717   -9.777  1.00 0.00 ? 69 MET A HA   9  
ATOM 10041 H HB2  . MET A 1 69 ? 21.974  0.960   -10.229 1.00 0.00 ? 69 MET A HB2  9  
ATOM 10042 H HB3  . MET A 1 69 ? 22.435  -0.216  -8.999  1.00 0.00 ? 69 MET A HB3  9  
ATOM 10043 H HG2  . MET A 1 69 ? 22.142  1.841   -7.895  1.00 0.00 ? 69 MET A HG2  9  
ATOM 10044 H HG3  . MET A 1 69 ? 23.839  1.403   -7.865  1.00 0.00 ? 69 MET A HG3  9  
ATOM 10045 H HE1  . MET A 1 69 ? 25.462  3.157   -7.763  1.00 0.00 ? 69 MET A HE1  9  
ATOM 10046 H HE2  . MET A 1 69 ? 25.740  2.614   -9.422  1.00 0.00 ? 69 MET A HE2  9  
ATOM 10047 H HE3  . MET A 1 69 ? 25.693  4.340   -9.050  1.00 0.00 ? 69 MET A HE3  9  
ATOM 10048 N N    . ARG A 1 70 ? 25.612  -1.550  -10.459 1.00 0.00 ? 70 ARG A N    9  
ATOM 10049 C CA   . ARG A 1 70 ? 26.074  -2.877  -10.061 1.00 0.00 ? 70 ARG A CA   9  
ATOM 10050 C C    . ARG A 1 70 ? 25.655  -3.162  -8.630  1.00 0.00 ? 70 ARG A C    9  
ATOM 10051 O O    . ARG A 1 70 ? 25.575  -4.347  -8.259  1.00 0.00 ? 70 ARG A O    9  
ATOM 10052 C CB   . ARG A 1 70 ? 27.595  -3.039  -10.292 1.00 0.00 ? 70 ARG A CB   9  
ATOM 10053 C CG   . ARG A 1 70 ? 28.575  -2.065  -9.599  1.00 0.00 ? 70 ARG A CG   9  
ATOM 10054 C CD   . ARG A 1 70 ? 29.146  -2.477  -8.228  1.00 0.00 ? 70 ARG A CD   9  
ATOM 10055 N NE   . ARG A 1 70 ? 28.140  -2.464  -7.160  1.00 0.00 ? 70 ARG A NE   9  
ATOM 10056 C CZ   . ARG A 1 70 ? 28.078  -3.254  -6.086  1.00 0.00 ? 70 ARG A CZ   9  
ATOM 10057 N NH1  . ARG A 1 70 ? 29.067  -4.071  -5.761  1.00 0.00 ? 70 ARG A NH1  9  
ATOM 10058 N NH2  . ARG A 1 70 ? 27.001  -3.232  -5.316  1.00 0.00 ? 70 ARG A NH2  9  
ATOM 10059 H H    . ARG A 1 70 ? 26.304  -0.817  -10.474 1.00 0.00 ? 70 ARG A H    9  
ATOM 10060 H HA   . ARG A 1 70 ? 25.565  -3.610  -10.690 1.00 0.00 ? 70 ARG A HA   9  
ATOM 10061 H HB2  . ARG A 1 70 ? 27.882  -4.059  -10.051 1.00 0.00 ? 70 ARG A HB2  9  
ATOM 10062 H HB3  . ARG A 1 70 ? 27.757  -2.931  -11.364 1.00 0.00 ? 70 ARG A HB3  9  
ATOM 10063 H HG2  . ARG A 1 70 ? 29.435  -1.982  -10.263 1.00 0.00 ? 70 ARG A HG2  9  
ATOM 10064 H HG3  . ARG A 1 70 ? 28.132  -1.074  -9.531  1.00 0.00 ? 70 ARG A HG3  9  
ATOM 10065 H HD2  . ARG A 1 70 ? 29.582  -3.470  -8.308  1.00 0.00 ? 70 ARG A HD2  9  
ATOM 10066 H HD3  . ARG A 1 70 ? 29.940  -1.779  -7.963  1.00 0.00 ? 70 ARG A HD3  9  
ATOM 10067 H HE   . ARG A 1 70 ? 27.302  -1.932  -7.375  1.00 0.00 ? 70 ARG A HE   9  
ATOM 10068 H HH11 . ARG A 1 70 ? 29.991  -3.949  -6.169  1.00 0.00 ? 70 ARG A HH11 9  
ATOM 10069 H HH12 . ARG A 1 70 ? 28.954  -4.764  -5.024  1.00 0.00 ? 70 ARG A HH12 9  
ATOM 10070 H HH21 . ARG A 1 70 ? 26.244  -2.579  -5.510  1.00 0.00 ? 70 ARG A HH21 9  
ATOM 10071 H HH22 . ARG A 1 70 ? 26.968  -3.803  -4.480  1.00 0.00 ? 70 ARG A HH22 9  
ATOM 10072 N N    . GLY A 1 1  ? 4.981   -8.442  25.459  1.00 0.00 ? 1  GLY A N    10 
ATOM 10073 C CA   . GLY A 1 1  ? 5.043   -8.611  24.005  1.00 0.00 ? 1  GLY A CA   10 
ATOM 10074 C C    . GLY A 1 1  ? 4.516   -7.375  23.306  1.00 0.00 ? 1  GLY A C    10 
ATOM 10075 O O    . GLY A 1 1  ? 3.383   -6.973  23.571  1.00 0.00 ? 1  GLY A O    10 
ATOM 10076 H H1   . GLY A 1 1  ? 5.285   -9.233  25.989  1.00 0.00 ? 1  GLY A H1   10 
ATOM 10077 H HA2  . GLY A 1 1  ? 6.068   -8.800  23.702  1.00 0.00 ? 1  GLY A HA2  10 
ATOM 10078 H HA3  . GLY A 1 1  ? 4.431   -9.463  23.715  1.00 0.00 ? 1  GLY A HA3  10 
ATOM 10079 N N    . SER A 1 2  ? 5.311   -6.769  22.424  1.00 0.00 ? 2  SER A N    10 
ATOM 10080 C CA   . SER A 1 2  ? 4.921   -5.651  21.578  1.00 0.00 ? 2  SER A CA   10 
ATOM 10081 C C    . SER A 1 2  ? 5.670   -5.782  20.251  1.00 0.00 ? 2  SER A C    10 
ATOM 10082 O O    . SER A 1 2  ? 6.705   -6.451  20.191  1.00 0.00 ? 2  SER A O    10 
ATOM 10083 C CB   . SER A 1 2  ? 5.269   -4.346  22.306  1.00 0.00 ? 2  SER A CB   10 
ATOM 10084 O OG   . SER A 1 2  ? 4.956   -3.198  21.541  1.00 0.00 ? 2  SER A OG   10 
ATOM 10085 H H    . SER A 1 2  ? 6.211   -7.167  22.180  1.00 0.00 ? 2  SER A H    10 
ATOM 10086 H HA   . SER A 1 2  ? 3.847   -5.691  21.390  1.00 0.00 ? 2  SER A HA   10 
ATOM 10087 H HB2  . SER A 1 2  ? 4.708   -4.304  23.241  1.00 0.00 ? 2  SER A HB2  10 
ATOM 10088 H HB3  . SER A 1 2  ? 6.335   -4.334  22.540  1.00 0.00 ? 2  SER A HB3  10 
ATOM 10089 H HG   . SER A 1 2  ? 4.949   -2.454  22.186  1.00 0.00 ? 2  SER A HG   10 
ATOM 10090 N N    . SER A 1 3  ? 5.186   -5.087  19.216  1.00 0.00 ? 3  SER A N    10 
ATOM 10091 C CA   . SER A 1 3  ? 5.609   -5.202  17.819  1.00 0.00 ? 3  SER A CA   10 
ATOM 10092 C C    . SER A 1 3  ? 5.298   -6.597  17.253  1.00 0.00 ? 3  SER A C    10 
ATOM 10093 O O    . SER A 1 3  ? 4.832   -7.479  17.977  1.00 0.00 ? 3  SER A O    10 
ATOM 10094 C CB   . SER A 1 3  ? 7.086   -4.795  17.659  1.00 0.00 ? 3  SER A CB   10 
ATOM 10095 O OG   . SER A 1 3  ? 7.334   -3.551  18.299  1.00 0.00 ? 3  SER A OG   10 
ATOM 10096 H H    . SER A 1 3  ? 4.326   -4.582  19.371  1.00 0.00 ? 3  SER A H    10 
ATOM 10097 H HA   . SER A 1 3  ? 5.014   -4.491  17.248  1.00 0.00 ? 3  SER A HA   10 
ATOM 10098 H HB2  . SER A 1 3  ? 7.732   -5.552  18.098  1.00 0.00 ? 3  SER A HB2  10 
ATOM 10099 H HB3  . SER A 1 3  ? 7.332   -4.715  16.602  1.00 0.00 ? 3  SER A HB3  10 
ATOM 10100 H HG   . SER A 1 3  ? 7.102   -3.662  19.230  1.00 0.00 ? 3  SER A HG   10 
ATOM 10101 N N    . GLY A 1 4  ? 5.512   -6.791  15.953  1.00 0.00 ? 4  GLY A N    10 
ATOM 10102 C CA   . GLY A 1 4  ? 5.227   -8.054  15.285  1.00 0.00 ? 4  GLY A CA   10 
ATOM 10103 C C    . GLY A 1 4  ? 4.772   -7.882  13.842  1.00 0.00 ? 4  GLY A C    10 
ATOM 10104 O O    . GLY A 1 4  ? 4.010   -8.722  13.359  1.00 0.00 ? 4  GLY A O    10 
ATOM 10105 H H    . GLY A 1 4  ? 5.818   -6.000  15.396  1.00 0.00 ? 4  GLY A H    10 
ATOM 10106 H HA2  . GLY A 1 4  ? 6.128   -8.667  15.292  1.00 0.00 ? 4  GLY A HA2  10 
ATOM 10107 H HA3  . GLY A 1 4  ? 4.447   -8.594  15.824  1.00 0.00 ? 4  GLY A HA3  10 
ATOM 10108 N N    . SER A 1 5  ? 5.183   -6.818  13.144  1.00 0.00 ? 5  SER A N    10 
ATOM 10109 C CA   . SER A 1 5  ? 4.973   -6.656  11.707  1.00 0.00 ? 5  SER A CA   10 
ATOM 10110 C C    . SER A 1 5  ? 5.712   -7.797  10.994  1.00 0.00 ? 5  SER A C    10 
ATOM 10111 O O    . SER A 1 5  ? 6.929   -7.756  10.795  1.00 0.00 ? 5  SER A O    10 
ATOM 10112 C CB   . SER A 1 5  ? 5.415   -5.258  11.249  1.00 0.00 ? 5  SER A CB   10 
ATOM 10113 O OG   . SER A 1 5  ? 4.778   -4.266  12.044  1.00 0.00 ? 5  SER A OG   10 
ATOM 10114 H H    . SER A 1 5  ? 5.800   -6.146  13.578  1.00 0.00 ? 5  SER A H    10 
ATOM 10115 H HA   . SER A 1 5  ? 3.906   -6.743  11.498  1.00 0.00 ? 5  SER A HA   10 
ATOM 10116 H HB2  . SER A 1 5  ? 6.497   -5.160  11.348  1.00 0.00 ? 5  SER A HB2  10 
ATOM 10117 H HB3  . SER A 1 5  ? 5.137   -5.120  10.203  1.00 0.00 ? 5  SER A HB3  10 
ATOM 10118 H HG   . SER A 1 5  ? 4.730   -3.442  11.536  1.00 0.00 ? 5  SER A HG   10 
ATOM 10119 N N    . SER A 1 6  ? 4.996   -8.878  10.707  1.00 0.00 ? 6  SER A N    10 
ATOM 10120 C CA   . SER A 1 6  ? 5.484   -10.143 10.197  1.00 0.00 ? 6  SER A CA   10 
ATOM 10121 C C    . SER A 1 6  ? 4.259   -10.815 9.577   1.00 0.00 ? 6  SER A C    10 
ATOM 10122 O O    . SER A 1 6  ? 3.473   -11.472 10.267  1.00 0.00 ? 6  SER A O    10 
ATOM 10123 C CB   . SER A 1 6  ? 6.158   -10.956 11.319  1.00 0.00 ? 6  SER A CB   10 
ATOM 10124 O OG   . SER A 1 6  ? 5.407   -11.021 12.524  1.00 0.00 ? 6  SER A OG   10 
ATOM 10125 H H    . SER A 1 6  ? 3.986   -8.828  10.828  1.00 0.00 ? 6  SER A H    10 
ATOM 10126 H HA   . SER A 1 6  ? 6.224   -9.960  9.417   1.00 0.00 ? 6  SER A HA   10 
ATOM 10127 H HB2  . SER A 1 6  ? 6.355   -11.967 10.958  1.00 0.00 ? 6  SER A HB2  10 
ATOM 10128 H HB3  . SER A 1 6  ? 7.120   -10.493 11.544  1.00 0.00 ? 6  SER A HB3  10 
ATOM 10129 H HG   . SER A 1 6  ? 4.913   -10.191 12.648  1.00 0.00 ? 6  SER A HG   10 
ATOM 10130 N N    . GLY A 1 7  ? 4.038   -10.564 8.287   1.00 0.00 ? 7  GLY A N    10 
ATOM 10131 C CA   . GLY A 1 7  ? 2.802   -10.901 7.601   1.00 0.00 ? 7  GLY A CA   10 
ATOM 10132 C C    . GLY A 1 7  ? 2.747   -10.137 6.290   1.00 0.00 ? 7  GLY A C    10 
ATOM 10133 O O    . GLY A 1 7  ? 2.021   -9.147  6.165   1.00 0.00 ? 7  GLY A O    10 
ATOM 10134 H H    . GLY A 1 7  ? 4.684   -9.967  7.795   1.00 0.00 ? 7  GLY A H    10 
ATOM 10135 H HA2  . GLY A 1 7  ? 2.757   -11.972 7.403   1.00 0.00 ? 7  GLY A HA2  10 
ATOM 10136 H HA3  . GLY A 1 7  ? 1.956   -10.616 8.226   1.00 0.00 ? 7  GLY A HA3  10 
ATOM 10137 N N    . ARG A 1 8  ? 3.578   -10.550 5.335   1.00 0.00 ? 8  ARG A N    10 
ATOM 10138 C CA   . ARG A 1 8  ? 3.708   -9.955  4.012   1.00 0.00 ? 8  ARG A CA   10 
ATOM 10139 C C    . ARG A 1 8  ? 3.213   -11.021 3.037   1.00 0.00 ? 8  ARG A C    10 
ATOM 10140 O O    . ARG A 1 8  ? 3.902   -12.016 2.795   1.00 0.00 ? 8  ARG A O    10 
ATOM 10141 C CB   . ARG A 1 8  ? 5.158   -9.463  3.775   1.00 0.00 ? 8  ARG A CB   10 
ATOM 10142 C CG   . ARG A 1 8  ? 5.494   -8.205  4.612   1.00 0.00 ? 8  ARG A CG   10 
ATOM 10143 C CD   . ARG A 1 8  ? 6.987   -8.028  4.946   1.00 0.00 ? 8  ARG A CD   10 
ATOM 10144 N NE   . ARG A 1 8  ? 7.816   -7.547  3.830   1.00 0.00 ? 8  ARG A NE   10 
ATOM 10145 C CZ   . ARG A 1 8  ? 9.156   -7.607  3.759   1.00 0.00 ? 8  ARG A CZ   10 
ATOM 10146 N NH1  . ARG A 1 8  ? 9.890   -8.142  4.736   1.00 0.00 ? 8  ARG A NH1  10 
ATOM 10147 N NH2  . ARG A 1 8  ? 9.766   -7.128  2.684   1.00 0.00 ? 8  ARG A NH2  10 
ATOM 10148 H H    . ARG A 1 8  ? 4.095   -11.411 5.500   1.00 0.00 ? 8  ARG A H    10 
ATOM 10149 H HA   . ARG A 1 8  ? 3.055   -9.088  3.928   1.00 0.00 ? 8  ARG A HA   10 
ATOM 10150 H HB2  . ARG A 1 8  ? 5.847   -10.267 4.025   1.00 0.00 ? 8  ARG A HB2  10 
ATOM 10151 H HB3  . ARG A 1 8  ? 5.293   -9.221  2.720   1.00 0.00 ? 8  ARG A HB3  10 
ATOM 10152 H HG2  . ARG A 1 8  ? 5.120   -7.315  4.104   1.00 0.00 ? 8  ARG A HG2  10 
ATOM 10153 H HG3  . ARG A 1 8  ? 4.976   -8.272  5.569   1.00 0.00 ? 8  ARG A HG3  10 
ATOM 10154 H HD2  . ARG A 1 8  ? 7.072   -7.303  5.758   1.00 0.00 ? 8  ARG A HD2  10 
ATOM 10155 H HD3  . ARG A 1 8  ? 7.377   -8.979  5.293   1.00 0.00 ? 8  ARG A HD3  10 
ATOM 10156 H HE   . ARG A 1 8  ? 7.355   -6.924  3.168   1.00 0.00 ? 8  ARG A HE   10 
ATOM 10157 H HH11 . ARG A 1 8  ? 9.472   -8.538  5.576   1.00 0.00 ? 8  ARG A HH11 10 
ATOM 10158 H HH12 . ARG A 1 8  ? 10.907  -8.138  4.722   1.00 0.00 ? 8  ARG A HH12 10 
ATOM 10159 H HH21 . ARG A 1 8  ? 9.236   -6.768  1.889   1.00 0.00 ? 8  ARG A HH21 10 
ATOM 10160 H HH22 . ARG A 1 8  ? 10.774  -7.182  2.544   1.00 0.00 ? 8  ARG A HH22 10 
ATOM 10161 N N    . GLY A 1 9  ? 1.985   -10.847 2.549   1.00 0.00 ? 9  GLY A N    10 
ATOM 10162 C CA   . GLY A 1 9  ? 1.374   -11.640 1.495   1.00 0.00 ? 9  GLY A CA   10 
ATOM 10163 C C    . GLY A 1 9  ? 1.178   -13.106 1.868   1.00 0.00 ? 9  GLY A C    10 
ATOM 10164 O O    . GLY A 1 9  ? 1.614   -13.983 1.122   1.00 0.00 ? 9  GLY A O    10 
ATOM 10165 H H    . GLY A 1 9  ? 1.470   -10.032 2.851   1.00 0.00 ? 9  GLY A H    10 
ATOM 10166 H HA2  . GLY A 1 9  ? 0.402   -11.212 1.257   1.00 0.00 ? 9  GLY A HA2  10 
ATOM 10167 H HA3  . GLY A 1 9  ? 1.994   -11.573 0.602   1.00 0.00 ? 9  GLY A HA3  10 
ATOM 10168 N N    . ARG A 1 10 ? 0.537   -13.393 3.005   1.00 0.00 ? 10 ARG A N    10 
ATOM 10169 C CA   . ARG A 1 10 ? 0.084   -14.739 3.378   1.00 0.00 ? 10 ARG A CA   10 
ATOM 10170 C C    . ARG A 1 10 ? -1.224  -15.104 2.658   1.00 0.00 ? 10 ARG A C    10 
ATOM 10171 O O    . ARG A 1 10 ? -1.444  -16.285 2.381   1.00 0.00 ? 10 ARG A O    10 
ATOM 10172 C CB   . ARG A 1 10 ? -0.098  -14.798 4.912   1.00 0.00 ? 10 ARG A CB   10 
ATOM 10173 C CG   . ARG A 1 10 ? -0.429  -16.189 5.491   1.00 0.00 ? 10 ARG A CG   10 
ATOM 10174 C CD   . ARG A 1 10 ? 0.781   -17.122 5.637   1.00 0.00 ? 10 ARG A CD   10 
ATOM 10175 N NE   . ARG A 1 10 ? 0.349   -18.450 6.107   1.00 0.00 ? 10 ARG A NE   10 
ATOM 10176 C CZ   . ARG A 1 10 ? 1.087   -19.414 6.671   1.00 0.00 ? 10 ARG A CZ   10 
ATOM 10177 N NH1  . ARG A 1 10 ? 2.408   -19.311 6.775   1.00 0.00 ? 10 ARG A NH1  10 
ATOM 10178 N NH2  . ARG A 1 10 ? 0.475   -20.504 7.111   1.00 0.00 ? 10 ARG A NH2  10 
ATOM 10179 H H    . ARG A 1 10 ? 0.281   -12.621 3.617   1.00 0.00 ? 10 ARG A H    10 
ATOM 10180 H HA   . ARG A 1 10 ? 0.850   -15.461 3.087   1.00 0.00 ? 10 ARG A HA   10 
ATOM 10181 H HB2  . ARG A 1 10 ? 0.806   -14.429 5.400   1.00 0.00 ? 10 ARG A HB2  10 
ATOM 10182 H HB3  . ARG A 1 10 ? -0.914  -14.125 5.183   1.00 0.00 ? 10 ARG A HB3  10 
ATOM 10183 H HG2  . ARG A 1 10 ? -0.869  -16.049 6.478   1.00 0.00 ? 10 ARG A HG2  10 
ATOM 10184 H HG3  . ARG A 1 10 ? -1.185  -16.675 4.880   1.00 0.00 ? 10 ARG A HG3  10 
ATOM 10185 H HD2  . ARG A 1 10 ? 1.284   -17.224 4.677   1.00 0.00 ? 10 ARG A HD2  10 
ATOM 10186 H HD3  . ARG A 1 10 ? 1.478   -16.691 6.358   1.00 0.00 ? 10 ARG A HD3  10 
ATOM 10187 H HE   . ARG A 1 10 ? -0.640  -18.658 6.001   1.00 0.00 ? 10 ARG A HE   10 
ATOM 10188 H HH11 . ARG A 1 10 ? 2.903   -18.663 6.172   1.00 0.00 ? 10 ARG A HH11 10 
ATOM 10189 H HH12 . ARG A 1 10 ? 2.961   -19.996 7.285   1.00 0.00 ? 10 ARG A HH12 10 
ATOM 10190 H HH21 . ARG A 1 10 ? -0.523  -20.616 6.934   1.00 0.00 ? 10 ARG A HH21 10 
ATOM 10191 H HH22 . ARG A 1 10 ? 1.002   -21.330 7.396   1.00 0.00 ? 10 ARG A HH22 10 
ATOM 10192 N N    . TYR A 1 11 ? -2.109  -14.139 2.382   1.00 0.00 ? 11 TYR A N    10 
ATOM 10193 C CA   . TYR A 1 11 ? -3.450  -14.407 1.858   1.00 0.00 ? 11 TYR A CA   10 
ATOM 10194 C C    . TYR A 1 11 ? -3.928  -13.320 0.897   1.00 0.00 ? 11 TYR A C    10 
ATOM 10195 O O    . TYR A 1 11 ? -3.371  -12.217 0.828   1.00 0.00 ? 11 TYR A O    10 
ATOM 10196 C CB   . TYR A 1 11 ? -4.447  -14.552 3.024   1.00 0.00 ? 11 TYR A CB   10 
ATOM 10197 C CG   . TYR A 1 11 ? -4.468  -15.927 3.660   1.00 0.00 ? 11 TYR A CG   10 
ATOM 10198 C CD1  . TYR A 1 11 ? -5.055  -17.007 2.972   1.00 0.00 ? 11 TYR A CD1  10 
ATOM 10199 C CD2  . TYR A 1 11 ? -3.938  -16.127 4.947   1.00 0.00 ? 11 TYR A CD2  10 
ATOM 10200 C CE1  . TYR A 1 11 ? -5.126  -18.279 3.567   1.00 0.00 ? 11 TYR A CE1  10 
ATOM 10201 C CE2  . TYR A 1 11 ? -4.009  -17.395 5.547   1.00 0.00 ? 11 TYR A CE2  10 
ATOM 10202 C CZ   . TYR A 1 11 ? -4.611  -18.477 4.867   1.00 0.00 ? 11 TYR A CZ   10 
ATOM 10203 O OH   . TYR A 1 11 ? -4.647  -19.700 5.468   1.00 0.00 ? 11 TYR A OH   10 
ATOM 10204 H H    . TYR A 1 11 ? -1.883  -13.170 2.549   1.00 0.00 ? 11 TYR A H    10 
ATOM 10205 H HA   . TYR A 1 11 ? -3.434  -15.340 1.294   1.00 0.00 ? 11 TYR A HA   10 
ATOM 10206 H HB2  . TYR A 1 11 ? -4.236  -13.792 3.779   1.00 0.00 ? 11 TYR A HB2  10 
ATOM 10207 H HB3  . TYR A 1 11 ? -5.460  -14.358 2.668   1.00 0.00 ? 11 TYR A HB3  10 
ATOM 10208 H HD1  . TYR A 1 11 ? -5.458  -16.875 1.979   1.00 0.00 ? 11 TYR A HD1  10 
ATOM 10209 H HD2  . TYR A 1 11 ? -3.477  -15.311 5.487   1.00 0.00 ? 11 TYR A HD2  10 
ATOM 10210 H HE1  . TYR A 1 11 ? -5.574  -19.100 3.023   1.00 0.00 ? 11 TYR A HE1  10 
ATOM 10211 H HE2  . TYR A 1 11 ? -3.608  -17.545 6.537   1.00 0.00 ? 11 TYR A HE2  10 
ATOM 10212 H HH   . TYR A 1 11 ? -5.091  -20.399 4.958   1.00 0.00 ? 11 TYR A HH   10 
ATOM 10213 N N    . ARG A 1 12 ? -5.019  -13.637 0.191   1.00 0.00 ? 12 ARG A N    10 
ATOM 10214 C CA   . ARG A 1 12 ? -5.768  -12.738 -0.670  1.00 0.00 ? 12 ARG A CA   10 
ATOM 10215 C C    . ARG A 1 12 ? -6.324  -11.601 0.172   1.00 0.00 ? 12 ARG A C    10 
ATOM 10216 O O    . ARG A 1 12 ? -7.104  -11.836 1.094   1.00 0.00 ? 12 ARG A O    10 
ATOM 10217 C CB   . ARG A 1 12 ? -6.909  -13.531 -1.327  1.00 0.00 ? 12 ARG A CB   10 
ATOM 10218 C CG   . ARG A 1 12 ? -7.597  -12.832 -2.500  1.00 0.00 ? 12 ARG A CG   10 
ATOM 10219 C CD   . ARG A 1 12 ? -6.642  -12.694 -3.692  1.00 0.00 ? 12 ARG A CD   10 
ATOM 10220 N NE   . ARG A 1 12 ? -7.341  -12.928 -4.959  1.00 0.00 ? 12 ARG A NE   10 
ATOM 10221 C CZ   . ARG A 1 12 ? -7.403  -14.076 -5.642  1.00 0.00 ? 12 ARG A CZ   10 
ATOM 10222 N NH1  . ARG A 1 12 ? -6.862  -15.193 -5.161  1.00 0.00 ? 12 ARG A NH1  10 
ATOM 10223 N NH2  . ARG A 1 12 ? -8.016  -14.090 -6.817  1.00 0.00 ? 12 ARG A NH2  10 
ATOM 10224 H H    . ARG A 1 12 ? -5.417  -14.556 0.328   1.00 0.00 ? 12 ARG A H    10 
ATOM 10225 H HA   . ARG A 1 12 ? -5.087  -12.356 -1.430  1.00 0.00 ? 12 ARG A HA   10 
ATOM 10226 H HB2  . ARG A 1 12 ? -6.510  -14.471 -1.698  1.00 0.00 ? 12 ARG A HB2  10 
ATOM 10227 H HB3  . ARG A 1 12 ? -7.666  -13.764 -0.576  1.00 0.00 ? 12 ARG A HB3  10 
ATOM 10228 H HG2  . ARG A 1 12 ? -8.453  -13.446 -2.785  1.00 0.00 ? 12 ARG A HG2  10 
ATOM 10229 H HG3  . ARG A 1 12 ? -7.969  -11.851 -2.201  1.00 0.00 ? 12 ARG A HG3  10 
ATOM 10230 H HD2  . ARG A 1 12 ? -6.222  -11.688 -3.701  1.00 0.00 ? 12 ARG A HD2  10 
ATOM 10231 H HD3  . ARG A 1 12 ? -5.816  -13.401 -3.606  1.00 0.00 ? 12 ARG A HD3  10 
ATOM 10232 H HE   . ARG A 1 12 ? -7.777  -12.105 -5.363  1.00 0.00 ? 12 ARG A HE   10 
ATOM 10233 H HH11 . ARG A 1 12 ? -6.379  -15.225 -4.272  1.00 0.00 ? 12 ARG A HH11 10 
ATOM 10234 H HH12 . ARG A 1 12 ? -6.817  -16.049 -5.713  1.00 0.00 ? 12 ARG A HH12 10 
ATOM 10235 H HH21 . ARG A 1 12 ? -8.455  -13.238 -7.173  1.00 0.00 ? 12 ARG A HH21 10 
ATOM 10236 H HH22 . ARG A 1 12 ? -7.938  -14.872 -7.462  1.00 0.00 ? 12 ARG A HH22 10 
ATOM 10237 N N    . GLN A 1 13 ? -5.931  -10.374 -0.143  1.00 0.00 ? 13 GLN A N    10 
ATOM 10238 C CA   . GLN A 1 13 ? -6.517  -9.170  0.422   1.00 0.00 ? 13 GLN A CA   10 
ATOM 10239 C C    . GLN A 1 13 ? -6.625  -8.163  -0.703  1.00 0.00 ? 13 GLN A C    10 
ATOM 10240 O O    . GLN A 1 13 ? -7.715  -7.921  -1.218  1.00 0.00 ? 13 GLN A O    10 
ATOM 10241 C CB   . GLN A 1 13 ? -5.682  -8.651  1.609   1.00 0.00 ? 13 GLN A CB   10 
ATOM 10242 C CG   . GLN A 1 13 ? -5.870  -9.445  2.910   1.00 0.00 ? 13 GLN A CG   10 
ATOM 10243 C CD   . GLN A 1 13 ? -7.279  -9.278  3.481   1.00 0.00 ? 13 GLN A CD   10 
ATOM 10244 O OE1  . GLN A 1 13 ? -7.509  -8.433  4.343   1.00 0.00 ? 13 GLN A OE1  10 
ATOM 10245 N NE2  . GLN A 1 13 ? -8.248  -10.070 3.051   1.00 0.00 ? 13 GLN A NE2  10 
ATOM 10246 H H    . GLN A 1 13 ? -5.281  -10.251 -0.904  1.00 0.00 ? 13 GLN A H    10 
ATOM 10247 H HA   . GLN A 1 13 ? -7.533  -9.365  0.743   1.00 0.00 ? 13 GLN A HA   10 
ATOM 10248 H HB2  . GLN A 1 13 ? -4.624  -8.660  1.343   1.00 0.00 ? 13 GLN A HB2  10 
ATOM 10249 H HB3  . GLN A 1 13 ? -5.967  -7.619  1.803   1.00 0.00 ? 13 GLN A HB3  10 
ATOM 10250 H HG2  . GLN A 1 13 ? -5.644  -10.500 2.752   1.00 0.00 ? 13 GLN A HG2  10 
ATOM 10251 H HG3  . GLN A 1 13 ? -5.155  -9.066  3.640   1.00 0.00 ? 13 GLN A HG3  10 
ATOM 10252 H HE21 . GLN A 1 13 ? -8.029  -10.820 2.393   1.00 0.00 ? 13 GLN A HE21 10 
ATOM 10253 H HE22 . GLN A 1 13 ? -9.208  -9.911  3.345   1.00 0.00 ? 13 GLN A HE22 10 
ATOM 10254 N N    . TYR A 1 14 ? -5.478  -7.645  -1.122  1.00 0.00 ? 14 TYR A N    10 
ATOM 10255 C CA   . TYR A 1 14 ? -5.360  -6.616  -2.132  1.00 0.00 ? 14 TYR A CA   10 
ATOM 10256 C C    . TYR A 1 14 ? -4.399  -7.073  -3.223  1.00 0.00 ? 14 TYR A C    10 
ATOM 10257 O O    . TYR A 1 14 ? -3.623  -8.020  -3.041  1.00 0.00 ? 14 TYR A O    10 
ATOM 10258 C CB   . TYR A 1 14 ? -4.895  -5.322  -1.457  1.00 0.00 ? 14 TYR A CB   10 
ATOM 10259 C CG   . TYR A 1 14 ? -3.505  -5.391  -0.833  1.00 0.00 ? 14 TYR A CG   10 
ATOM 10260 C CD1  . TYR A 1 14 ? -3.331  -5.815  0.499   1.00 0.00 ? 14 TYR A CD1  10 
ATOM 10261 C CD2  . TYR A 1 14 ? -2.378  -5.023  -1.589  1.00 0.00 ? 14 TYR A CD2  10 
ATOM 10262 C CE1  . TYR A 1 14 ? -2.039  -5.964  1.032   1.00 0.00 ? 14 TYR A CE1  10 
ATOM 10263 C CE2  . TYR A 1 14 ? -1.084  -5.127  -1.054  1.00 0.00 ? 14 TYR A CE2  10 
ATOM 10264 C CZ   . TYR A 1 14 ? -0.907  -5.634  0.256   1.00 0.00 ? 14 TYR A CZ   10 
ATOM 10265 O OH   . TYR A 1 14 ? 0.334   -5.814  0.789   1.00 0.00 ? 14 TYR A OH   10 
ATOM 10266 H H    . TYR A 1 14 ? -4.623  -7.929  -0.672  1.00 0.00 ? 14 TYR A H    10 
ATOM 10267 H HA   . TYR A 1 14 ? -6.336  -6.432  -2.585  1.00 0.00 ? 14 TYR A HA   10 
ATOM 10268 H HB2  . TYR A 1 14 ? -4.914  -4.530  -2.204  1.00 0.00 ? 14 TYR A HB2  10 
ATOM 10269 H HB3  . TYR A 1 14 ? -5.629  -5.060  -0.695  1.00 0.00 ? 14 TYR A HB3  10 
ATOM 10270 H HD1  . TYR A 1 14 ? -4.186  -6.008  1.131   1.00 0.00 ? 14 TYR A HD1  10 
ATOM 10271 H HD2  . TYR A 1 14 ? -2.504  -4.625  -2.584  1.00 0.00 ? 14 TYR A HD2  10 
ATOM 10272 H HE1  . TYR A 1 14 ? -1.918  -6.319  2.045   1.00 0.00 ? 14 TYR A HE1  10 
ATOM 10273 H HE2  . TYR A 1 14 ? -0.252  -4.814  -1.673  1.00 0.00 ? 14 TYR A HE2  10 
ATOM 10274 H HH   . TYR A 1 14 ? 0.990   -5.159  0.493   1.00 0.00 ? 14 TYR A HH   10 
ATOM 10275 N N    . ASN A 1 15 ? -4.444  -6.357  -4.341  1.00 0.00 ? 15 ASN A N    10 
ATOM 10276 C CA   . ASN A 1 15 ? -3.559  -6.494  -5.488  1.00 0.00 ? 15 ASN A CA   10 
ATOM 10277 C C    . ASN A 1 15 ? -2.644  -5.283  -5.523  1.00 0.00 ? 15 ASN A C    10 
ATOM 10278 O O    . ASN A 1 15 ? -2.975  -4.260  -4.924  1.00 0.00 ? 15 ASN A O    10 
ATOM 10279 C CB   . ASN A 1 15 ? -4.357  -6.606  -6.792  1.00 0.00 ? 15 ASN A CB   10 
ATOM 10280 C CG   . ASN A 1 15 ? -5.197  -7.873  -6.837  1.00 0.00 ? 15 ASN A CG   10 
ATOM 10281 O OD1  . ASN A 1 15 ? -4.777  -8.929  -6.367  1.00 0.00 ? 15 ASN A OD1  10 
ATOM 10282 N ND2  . ASN A 1 15 ? -6.403  -7.796  -7.367  1.00 0.00 ? 15 ASN A ND2  10 
ATOM 10283 H H    . ASN A 1 15 ? -5.032  -5.539  -4.340  1.00 0.00 ? 15 ASN A H    10 
ATOM 10284 H HA   . ASN A 1 15 ? -2.953  -7.390  -5.366  1.00 0.00 ? 15 ASN A HA   10 
ATOM 10285 H HB2  . ASN A 1 15 ? -4.988  -5.724  -6.912  1.00 0.00 ? 15 ASN A HB2  10 
ATOM 10286 H HB3  . ASN A 1 15 ? -3.658  -6.643  -7.626  1.00 0.00 ? 15 ASN A HB3  10 
ATOM 10287 H HD21 . ASN A 1 15 ? -6.705  -6.953  -7.837  1.00 0.00 ? 15 ASN A HD21 10 
ATOM 10288 H HD22 . ASN A 1 15 ? -6.987  -8.620  -7.463  1.00 0.00 ? 15 ASN A HD22 10 
ATOM 10289 N N    . SER A 1 16 ? -1.505  -5.381  -6.208  1.00 0.00 ? 16 SER A N    10 
ATOM 10290 C CA   . SER A 1 16 ? -0.534  -4.296  -6.320  1.00 0.00 ? 16 SER A CA   10 
ATOM 10291 C C    . SER A 1 16 ? -1.208  -2.957  -6.625  1.00 0.00 ? 16 SER A C    10 
ATOM 10292 O O    . SER A 1 16 ? -0.942  -1.955  -5.969  1.00 0.00 ? 16 SER A O    10 
ATOM 10293 C CB   . SER A 1 16 ? 0.509   -4.665  -7.380  1.00 0.00 ? 16 SER A CB   10 
ATOM 10294 O OG   . SER A 1 16 ? -0.087  -5.009  -8.620  1.00 0.00 ? 16 SER A OG   10 
ATOM 10295 H H    . SER A 1 16 ? -1.277  -6.257  -6.661  1.00 0.00 ? 16 SER A H    10 
ATOM 10296 H HA   . SER A 1 16 ? -0.034  -4.192  -5.362  1.00 0.00 ? 16 SER A HA   10 
ATOM 10297 H HB2  . SER A 1 16 ? 1.194   -3.824  -7.510  1.00 0.00 ? 16 SER A HB2  10 
ATOM 10298 H HB3  . SER A 1 16 ? 1.070   -5.526  -7.037  1.00 0.00 ? 16 SER A HB3  10 
ATOM 10299 H HG   . SER A 1 16 ? -0.482  -5.897  -8.564  1.00 0.00 ? 16 SER A HG   10 
ATOM 10300 N N    . GLU A 1 17 ? -2.131  -2.990  -7.575  1.00 0.00 ? 17 GLU A N    10 
ATOM 10301 C CA   . GLU A 1 17 ? -2.957  -1.900  -8.054  1.00 0.00 ? 17 GLU A CA   10 
ATOM 10302 C C    . GLU A 1 17 ? -3.739  -1.249  -6.910  1.00 0.00 ? 17 GLU A C    10 
ATOM 10303 O O    . GLU A 1 17 ? -3.614  -0.045  -6.701  1.00 0.00 ? 17 GLU A O    10 
ATOM 10304 C CB   . GLU A 1 17 ? -3.886  -2.499  -9.110  1.00 0.00 ? 17 GLU A CB   10 
ATOM 10305 C CG   . GLU A 1 17 ? -3.114  -3.048  -10.324 1.00 0.00 ? 17 GLU A CG   10 
ATOM 10306 C CD   . GLU A 1 17 ? -3.904  -4.140  -11.042 1.00 0.00 ? 17 GLU A CD   10 
ATOM 10307 O OE1  . GLU A 1 17 ? -5.156  -4.142  -11.001 1.00 0.00 ? 17 GLU A OE1  10 
ATOM 10308 O OE2  . GLU A 1 17 ? -3.250  -5.101  -11.509 1.00 0.00 ? 17 GLU A OE2  10 
ATOM 10309 H H    . GLU A 1 17 ? -2.185  -3.857  -8.089  1.00 0.00 ? 17 GLU A H    10 
ATOM 10310 H HA   . GLU A 1 17 ? -2.328  -1.146  -8.521  1.00 0.00 ? 17 GLU A HA   10 
ATOM 10311 H HB2  . GLU A 1 17 ? -4.448  -3.311  -8.643  1.00 0.00 ? 17 GLU A HB2  10 
ATOM 10312 H HB3  . GLU A 1 17 ? -4.592  -1.746  -9.444  1.00 0.00 ? 17 GLU A HB3  10 
ATOM 10313 H HG2  . GLU A 1 17 ? -2.882  -2.232  -11.008 1.00 0.00 ? 17 GLU A HG2  10 
ATOM 10314 H HG3  . GLU A 1 17 ? -2.168  -3.496  -9.998  1.00 0.00 ? 17 GLU A HG3  10 
ATOM 10315 N N    . ILE A 1 18 ? -4.507  -2.049  -6.160  1.00 0.00 ? 18 ILE A N    10 
ATOM 10316 C CA   . ILE A 1 18 ? -5.332  -1.642  -5.019  1.00 0.00 ? 18 ILE A CA   10 
ATOM 10317 C C    . ILE A 1 18 ? -4.480  -0.937  -3.970  1.00 0.00 ? 18 ILE A C    10 
ATOM 10318 O O    . ILE A 1 18 ? -4.932  0.007   -3.328  1.00 0.00 ? 18 ILE A O    10 
ATOM 10319 C CB   . ILE A 1 18 ? -6.007  -2.891  -4.401  1.00 0.00 ? 18 ILE A CB   10 
ATOM 10320 C CG1  . ILE A 1 18 ? -7.103  -3.465  -5.316  1.00 0.00 ? 18 ILE A CG1  10 
ATOM 10321 C CG2  . ILE A 1 18 ? -6.559  -2.667  -2.981  1.00 0.00 ? 18 ILE A CG2  10 
ATOM 10322 C CD1  . ILE A 1 18 ? -8.411  -2.678  -5.208  1.00 0.00 ? 18 ILE A CD1  10 
ATOM 10323 H H    . ILE A 1 18 ? -4.449  -3.036  -6.353  1.00 0.00 ? 18 ILE A H    10 
ATOM 10324 H HA   . ILE A 1 18 ? -6.095  -0.944  -5.360  1.00 0.00 ? 18 ILE A HA   10 
ATOM 10325 H HB   . ILE A 1 18 ? -5.245  -3.658  -4.299  1.00 0.00 ? 18 ILE A HB   10 
ATOM 10326 H HG12 . ILE A 1 18 ? -6.769  -3.473  -6.355  1.00 0.00 ? 18 ILE A HG12 10 
ATOM 10327 H HG13 . ILE A 1 18 ? -7.287  -4.494  -5.016  1.00 0.00 ? 18 ILE A HG13 10 
ATOM 10328 H HG21 . ILE A 1 18 ? -7.103  -3.548  -2.637  1.00 0.00 ? 18 ILE A HG21 10 
ATOM 10329 H HG22 . ILE A 1 18 ? -5.750  -2.471  -2.291  1.00 0.00 ? 18 ILE A HG22 10 
ATOM 10330 H HG23 . ILE A 1 18 ? -7.223  -1.807  -2.960  1.00 0.00 ? 18 ILE A HG23 10 
ATOM 10331 H HD11 . ILE A 1 18 ? -8.788  -2.756  -4.187  1.00 0.00 ? 18 ILE A HD11 10 
ATOM 10332 H HD12 . ILE A 1 18 ? -8.237  -1.626  -5.427  1.00 0.00 ? 18 ILE A HD12 10 
ATOM 10333 H HD13 . ILE A 1 18 ? -9.148  -3.088  -5.895  1.00 0.00 ? 18 ILE A HD13 10 
ATOM 10334 N N    . LEU A 1 19 ? -3.263  -1.419  -3.746  1.00 0.00 ? 19 LEU A N    10 
ATOM 10335 C CA   . LEU A 1 19 ? -2.408  -0.781  -2.768  1.00 0.00 ? 19 LEU A CA   10 
ATOM 10336 C C    . LEU A 1 19 ? -2.082  0.656   -3.194  1.00 0.00 ? 19 LEU A C    10 
ATOM 10337 O O    . LEU A 1 19 ? -2.117  1.548   -2.352  1.00 0.00 ? 19 LEU A O    10 
ATOM 10338 C CB   . LEU A 1 19 ? -1.178  -1.652  -2.520  1.00 0.00 ? 19 LEU A CB   10 
ATOM 10339 C CG   . LEU A 1 19 ? -0.142  -0.957  -1.637  1.00 0.00 ? 19 LEU A CG   10 
ATOM 10340 C CD1  . LEU A 1 19 ? -0.724  -0.653  -0.246  1.00 0.00 ? 19 LEU A CD1  10 
ATOM 10341 C CD2  . LEU A 1 19 ? 1.060   -1.886  -1.522  1.00 0.00 ? 19 LEU A CD2  10 
ATOM 10342 H H    . LEU A 1 19 ? -2.954  -2.213  -4.295  1.00 0.00 ? 19 LEU A H    10 
ATOM 10343 H HA   . LEU A 1 19 ? -2.971  -0.718  -1.833  1.00 0.00 ? 19 LEU A HA   10 
ATOM 10344 H HB2  . LEU A 1 19 ? -1.511  -2.560  -2.026  1.00 0.00 ? 19 LEU A HB2  10 
ATOM 10345 H HB3  . LEU A 1 19 ? -0.715  -1.951  -3.458  1.00 0.00 ? 19 LEU A HB3  10 
ATOM 10346 H HG   . LEU A 1 19 ? 0.203   -0.039  -2.108  1.00 0.00 ? 19 LEU A HG   10 
ATOM 10347 H HD11 . LEU A 1 19 ? -1.403  0.199   -0.316  1.00 0.00 ? 19 LEU A HD11 10 
ATOM 10348 H HD12 . LEU A 1 19 ? -1.305  -1.500  0.107   1.00 0.00 ? 19 LEU A HD12 10 
ATOM 10349 H HD13 . LEU A 1 19 ? 0.067   -0.372  0.451   1.00 0.00 ? 19 LEU A HD13 10 
ATOM 10350 H HD21 . LEU A 1 19 ? 0.772   -2.826  -1.059  1.00 0.00 ? 19 LEU A HD21 10 
ATOM 10351 H HD22 . LEU A 1 19 ? 1.459   -2.085  -2.516  1.00 0.00 ? 19 LEU A HD22 10 
ATOM 10352 H HD23 . LEU A 1 19 ? 1.821   -1.374  -0.944  1.00 0.00 ? 19 LEU A HD23 10 
ATOM 10353 N N    . GLU A 1 20 ? -1.796  0.897   -4.475  1.00 0.00 ? 20 GLU A N    10 
ATOM 10354 C CA   . GLU A 1 20 ? -1.501  2.245   -4.955  1.00 0.00 ? 20 GLU A CA   10 
ATOM 10355 C C    . GLU A 1 20 ? -2.737  3.150   -4.844  1.00 0.00 ? 20 GLU A C    10 
ATOM 10356 O O    . GLU A 1 20 ? -2.593  4.350   -4.606  1.00 0.00 ? 20 GLU A O    10 
ATOM 10357 C CB   . GLU A 1 20 ? -0.997  2.228   -6.408  1.00 0.00 ? 20 GLU A CB   10 
ATOM 10358 C CG   . GLU A 1 20 ? 0.209   1.318   -6.677  1.00 0.00 ? 20 GLU A CG   10 
ATOM 10359 C CD   . GLU A 1 20 ? 1.446   1.665   -5.853  1.00 0.00 ? 20 GLU A CD   10 
ATOM 10360 O OE1  . GLU A 1 20 ? 1.939   2.814   -5.940  1.00 0.00 ? 20 GLU A OE1  10 
ATOM 10361 O OE2  . GLU A 1 20 ? 1.975   0.773   -5.145  1.00 0.00 ? 20 GLU A OE2  10 
ATOM 10362 H H    . GLU A 1 20 ? -1.865  0.142   -5.148  1.00 0.00 ? 20 GLU A H    10 
ATOM 10363 H HA   . GLU A 1 20 ? -0.720  2.671   -4.322  1.00 0.00 ? 20 GLU A HA   10 
ATOM 10364 H HB2  . GLU A 1 20 ? -1.811  1.918   -7.063  1.00 0.00 ? 20 GLU A HB2  10 
ATOM 10365 H HB3  . GLU A 1 20 ? -0.720  3.245   -6.681  1.00 0.00 ? 20 GLU A HB3  10 
ATOM 10366 H HG2  . GLU A 1 20 ? -0.069  0.284   -6.499  1.00 0.00 ? 20 GLU A HG2  10 
ATOM 10367 H HG3  . GLU A 1 20 ? 0.471   1.400   -7.729  1.00 0.00 ? 20 GLU A HG3  10 
ATOM 10368 N N    . GLU A 1 21 ? -3.950  2.605   -4.986  1.00 0.00 ? 21 GLU A N    10 
ATOM 10369 C CA   . GLU A 1 21 ? -5.199  3.288   -4.695  1.00 0.00 ? 21 GLU A CA   10 
ATOM 10370 C C    . GLU A 1 21 ? -5.193  3.818   -3.270  1.00 0.00 ? 21 GLU A C    10 
ATOM 10371 O O    . GLU A 1 21 ? -5.249  5.027   -3.056  1.00 0.00 ? 21 GLU A O    10 
ATOM 10372 C CB   . GLU A 1 21 ? -6.380  2.367   -4.894  1.00 0.00 ? 21 GLU A CB   10 
ATOM 10373 C CG   . GLU A 1 21 ? -6.576  1.677   -6.231  1.00 0.00 ? 21 GLU A CG   10 
ATOM 10374 C CD   . GLU A 1 21 ? -6.979  2.657   -7.321  1.00 0.00 ? 21 GLU A CD   10 
ATOM 10375 O OE1  . GLU A 1 21 ? -6.109  3.430   -7.786  1.00 0.00 ? 21 GLU A OE1  10 
ATOM 10376 O OE2  . GLU A 1 21 ? -8.156  2.649   -7.732  1.00 0.00 ? 21 GLU A OE2  10 
ATOM 10377 H H    . GLU A 1 21 ? -4.047  1.621   -5.197  1.00 0.00 ? 21 GLU A H    10 
ATOM 10378 H HA   . GLU A 1 21 ? -5.407  4.117   -5.350  1.00 0.00 ? 21 GLU A HA   10 
ATOM 10379 H HB2  . GLU A 1 21 ? -6.415  1.612   -4.123  1.00 0.00 ? 21 GLU A HB2  10 
ATOM 10380 H HB3  . GLU A 1 21 ? -7.202  3.034   -4.745  1.00 0.00 ? 21 GLU A HB3  10 
ATOM 10381 H HG2  . GLU A 1 21 ? -5.674  1.158   -6.520  1.00 0.00 ? 21 GLU A HG2  10 
ATOM 10382 H HG3  . GLU A 1 21 ? -7.354  0.931   -6.085  1.00 0.00 ? 21 GLU A HG3  10 
ATOM 10383 N N    . ALA A 1 22 ? -5.095  2.894   -2.314  1.00 0.00 ? 22 ALA A N    10 
ATOM 10384 C CA   . ALA A 1 22 ? -5.240  3.115   -0.881  1.00 0.00 ? 22 ALA A CA   10 
ATOM 10385 C C    . ALA A 1 22 ? -4.150  4.014   -0.315  1.00 0.00 ? 22 ALA A C    10 
ATOM 10386 O O    . ALA A 1 22 ? -4.271  4.490   0.813   1.00 0.00 ? 22 ALA A O    10 
ATOM 10387 C CB   . ALA A 1 22 ? -5.191  1.757   -0.190  1.00 0.00 ? 22 ALA A CB   10 
ATOM 10388 H H    . ALA A 1 22 ? -4.951  1.940   -2.639  1.00 0.00 ? 22 ALA A H    10 
ATOM 10389 H HA   . ALA A 1 22 ? -6.204  3.603   -0.681  1.00 0.00 ? 22 ALA A HA   10 
ATOM 10390 H HB1  . ALA A 1 22 ? -5.626  1.848   0.805   1.00 0.00 ? 22 ALA A HB1  10 
ATOM 10391 H HB2  . ALA A 1 22 ? -5.758  1.042   -0.783  1.00 0.00 ? 22 ALA A HB2  10 
ATOM 10392 H HB3  . ALA A 1 22 ? -4.160  1.410   -0.123  1.00 0.00 ? 22 ALA A HB3  10 
ATOM 10393 N N    . ILE A 1 23 ? -3.097  4.245   -1.085  1.00 0.00 ? 23 ILE A N    10 
ATOM 10394 C CA   . ILE A 1 23 ? -2.054  5.193   -0.754  1.00 0.00 ? 23 ILE A CA   10 
ATOM 10395 C C    . ILE A 1 23 ? -2.423  6.540   -1.359  1.00 0.00 ? 23 ILE A C    10 
ATOM 10396 O O    . ILE A 1 23 ? -2.435  7.527   -0.629  1.00 0.00 ? 23 ILE A O    10 
ATOM 10397 C CB   . ILE A 1 23 ? -0.718  4.621   -1.234  1.00 0.00 ? 23 ILE A CB   10 
ATOM 10398 C CG1  . ILE A 1 23 ? -0.345  3.457   -0.295  1.00 0.00 ? 23 ILE A CG1  10 
ATOM 10399 C CG2  . ILE A 1 23 ? 0.391   5.685   -1.226  1.00 0.00 ? 23 ILE A CG2  10 
ATOM 10400 C CD1  . ILE A 1 23 ? 0.681   2.551   -0.949  1.00 0.00 ? 23 ILE A CD1  10 
ATOM 10401 H H    . ILE A 1 23 ? -3.072  3.761   -1.980  1.00 0.00 ? 23 ILE A H    10 
ATOM 10402 H HA   . ILE A 1 23 ? -2.003  5.316   0.328   1.00 0.00 ? 23 ILE A HA   10 
ATOM 10403 H HB   . ILE A 1 23 ? -0.864  4.242   -2.251  1.00 0.00 ? 23 ILE A HB   10 
ATOM 10404 H HG12 . ILE A 1 23 ? 0.053   3.839   0.642   1.00 0.00 ? 23 ILE A HG12 10 
ATOM 10405 H HG13 . ILE A 1 23 ? -1.221  2.850   -0.064  1.00 0.00 ? 23 ILE A HG13 10 
ATOM 10406 H HG21 . ILE A 1 23 ? 0.404   6.198   -0.267  1.00 0.00 ? 23 ILE A HG21 10 
ATOM 10407 H HG22 . ILE A 1 23 ? 1.368   5.231   -1.399  1.00 0.00 ? 23 ILE A HG22 10 
ATOM 10408 H HG23 . ILE A 1 23 ? 0.220   6.407   -2.024  1.00 0.00 ? 23 ILE A HG23 10 
ATOM 10409 H HD11 . ILE A 1 23 ? 0.370   2.335   -1.971  1.00 0.00 ? 23 ILE A HD11 10 
ATOM 10410 H HD12 . ILE A 1 23 ? 1.661   3.025   -0.942  1.00 0.00 ? 23 ILE A HD12 10 
ATOM 10411 H HD13 . ILE A 1 23 ? 0.728   1.626   -0.391  1.00 0.00 ? 23 ILE A HD13 10 
ATOM 10412 N N    . SER A 1 24 ? -2.772  6.595   -2.647  1.00 0.00 ? 24 SER A N    10 
ATOM 10413 C CA   . SER A 1 24 ? -3.171  7.823   -3.326  1.00 0.00 ? 24 SER A CA   10 
ATOM 10414 C C    . SER A 1 24 ? -4.265  8.559   -2.545  1.00 0.00 ? 24 SER A C    10 
ATOM 10415 O O    . SER A 1 24 ? -4.136  9.772   -2.343  1.00 0.00 ? 24 SER A O    10 
ATOM 10416 C CB   . SER A 1 24 ? -3.580  7.483   -4.766  1.00 0.00 ? 24 SER A CB   10 
ATOM 10417 O OG   . SER A 1 24 ? -3.842  8.628   -5.562  1.00 0.00 ? 24 SER A OG   10 
ATOM 10418 H H    . SER A 1 24 ? -2.791  5.731   -3.184  1.00 0.00 ? 24 SER A H    10 
ATOM 10419 H HA   . SER A 1 24 ? -2.293  8.471   -3.363  1.00 0.00 ? 24 SER A HA   10 
ATOM 10420 H HB2  . SER A 1 24 ? -2.744  6.955   -5.214  1.00 0.00 ? 24 SER A HB2  10 
ATOM 10421 H HB3  . SER A 1 24 ? -4.452  6.829   -4.766  1.00 0.00 ? 24 SER A HB3  10 
ATOM 10422 H HG   . SER A 1 24 ? -3.576  8.415   -6.481  1.00 0.00 ? 24 SER A HG   10 
ATOM 10423 N N    . VAL A 1 25 ? -5.299  7.858   -2.063  1.00 0.00 ? 25 VAL A N    10 
ATOM 10424 C CA   . VAL A 1 25 ? -6.312  8.442   -1.190  1.00 0.00 ? 25 VAL A CA   10 
ATOM 10425 C C    . VAL A 1 25 ? -5.645  9.135   0.011   1.00 0.00 ? 25 VAL A C    10 
ATOM 10426 O O    . VAL A 1 25 ? -5.768  10.345  0.187   1.00 0.00 ? 25 VAL A O    10 
ATOM 10427 C CB   . VAL A 1 25 ? -7.396  7.395   -0.805  1.00 0.00 ? 25 VAL A CB   10 
ATOM 10428 C CG1  . VAL A 1 25 ? -8.540  7.396   -1.822  1.00 0.00 ? 25 VAL A CG1  10 
ATOM 10429 C CG2  . VAL A 1 25 ? -6.909  5.982   -0.596  1.00 0.00 ? 25 VAL A CG2  10 
ATOM 10430 H H    . VAL A 1 25 ? -5.364  6.864   -2.274  1.00 0.00 ? 25 VAL A H    10 
ATOM 10431 H HA   . VAL A 1 25 ? -6.796  9.229   -1.766  1.00 0.00 ? 25 VAL A HA   10 
ATOM 10432 H HB   . VAL A 1 25 ? -7.809  7.593   0.170   1.00 0.00 ? 25 VAL A HB   10 
ATOM 10433 H HG11 . VAL A 1 25 ? -9.357  6.770   -1.470  1.00 0.00 ? 25 VAL A HG11 10 
ATOM 10434 H HG12 . VAL A 1 25 ? -8.935  8.399   -1.961  1.00 0.00 ? 25 VAL A HG12 10 
ATOM 10435 H HG13 . VAL A 1 25 ? -8.185  7.030   -2.787  1.00 0.00 ? 25 VAL A HG13 10 
ATOM 10436 H HG21 . VAL A 1 25 ? -5.881  6.001   -0.261  1.00 0.00 ? 25 VAL A HG21 10 
ATOM 10437 H HG22 . VAL A 1 25 ? -7.511  5.509   0.177   1.00 0.00 ? 25 VAL A HG22 10 
ATOM 10438 H HG23 . VAL A 1 25 ? -7.013  5.418   -1.517  1.00 0.00 ? 25 VAL A HG23 10 
ATOM 10439 N N    . VAL A 1 26 ? -4.917  8.387   0.828   1.00 0.00 ? 26 VAL A N    10 
ATOM 10440 C CA   . VAL A 1 26 ? -4.265  8.824   2.058   1.00 0.00 ? 26 VAL A CA   10 
ATOM 10441 C C    . VAL A 1 26 ? -3.299  9.992   1.828   1.00 0.00 ? 26 VAL A C    10 
ATOM 10442 O O    . VAL A 1 26 ? -3.331  10.950  2.604   1.00 0.00 ? 26 VAL A O    10 
ATOM 10443 C CB   . VAL A 1 26 ? -3.591  7.605   2.722   1.00 0.00 ? 26 VAL A CB   10 
ATOM 10444 C CG1  . VAL A 1 26 ? -2.782  7.971   3.972   1.00 0.00 ? 26 VAL A CG1  10 
ATOM 10445 C CG2  . VAL A 1 26 ? -4.649  6.573   3.141   1.00 0.00 ? 26 VAL A CG2  10 
ATOM 10446 H H    . VAL A 1 26 ? -4.818  7.422   0.580   1.00 0.00 ? 26 VAL A H    10 
ATOM 10447 H HA   . VAL A 1 26 ? -5.039  9.187   2.726   1.00 0.00 ? 26 VAL A HA   10 
ATOM 10448 H HB   . VAL A 1 26 ? -2.915  7.136   2.007   1.00 0.00 ? 26 VAL A HB   10 
ATOM 10449 H HG11 . VAL A 1 26 ? -1.948  8.620   3.707   1.00 0.00 ? 26 VAL A HG11 10 
ATOM 10450 H HG12 . VAL A 1 26 ? -3.417  8.469   4.706   1.00 0.00 ? 26 VAL A HG12 10 
ATOM 10451 H HG13 . VAL A 1 26 ? -2.367  7.065   4.403   1.00 0.00 ? 26 VAL A HG13 10 
ATOM 10452 H HG21 . VAL A 1 26 ? -4.154  5.674   3.514   1.00 0.00 ? 26 VAL A HG21 10 
ATOM 10453 H HG22 . VAL A 1 26 ? -5.300  6.988   3.909   1.00 0.00 ? 26 VAL A HG22 10 
ATOM 10454 H HG23 . VAL A 1 26 ? -5.263  6.281   2.292   1.00 0.00 ? 26 VAL A HG23 10 
ATOM 10455 N N    . MET A 1 27 ? -2.467  9.954   0.782   1.00 0.00 ? 27 MET A N    10 
ATOM 10456 C CA   . MET A 1 27 ? -1.492  11.003  0.490   1.00 0.00 ? 27 MET A CA   10 
ATOM 10457 C C    . MET A 1 27 ? -2.186  12.351  0.303   1.00 0.00 ? 27 MET A C    10 
ATOM 10458 O O    . MET A 1 27 ? -1.707  13.370  0.807   1.00 0.00 ? 27 MET A O    10 
ATOM 10459 C CB   . MET A 1 27 ? -0.695  10.676  -0.780  1.00 0.00 ? 27 MET A CB   10 
ATOM 10460 C CG   . MET A 1 27 ? 0.299   9.526   -0.622  1.00 0.00 ? 27 MET A CG   10 
ATOM 10461 S SD   . MET A 1 27 ? 1.370   9.387   -2.078  1.00 0.00 ? 27 MET A SD   10 
ATOM 10462 C CE   . MET A 1 27 ? 2.639   8.274   -1.430  1.00 0.00 ? 27 MET A CE   10 
ATOM 10463 H H    . MET A 1 27 ? -2.491  9.130   0.187   1.00 0.00 ? 27 MET A H    10 
ATOM 10464 H HA   . MET A 1 27 ? -0.802  11.085  1.331   1.00 0.00 ? 27 MET A HA   10 
ATOM 10465 H HB2  . MET A 1 27 ? -1.380  10.449  -1.599  1.00 0.00 ? 27 MET A HB2  10 
ATOM 10466 H HB3  . MET A 1 27 ? -0.126  11.564  -1.058  1.00 0.00 ? 27 MET A HB3  10 
ATOM 10467 H HG2  . MET A 1 27 ? 0.907   9.680   0.268   1.00 0.00 ? 27 MET A HG2  10 
ATOM 10468 H HG3  . MET A 1 27 ? -0.240  8.590   -0.491  1.00 0.00 ? 27 MET A HG3  10 
ATOM 10469 H HE1  . MET A 1 27 ? 3.098   7.731   -2.255  1.00 0.00 ? 27 MET A HE1  10 
ATOM 10470 H HE2  . MET A 1 27 ? 3.399   8.860   -0.925  1.00 0.00 ? 27 MET A HE2  10 
ATOM 10471 H HE3  . MET A 1 27 ? 2.209   7.569   -0.719  1.00 0.00 ? 27 MET A HE3  10 
ATOM 10472 N N    . SER A 1 28 ? -3.306  12.360  -0.421  1.00 0.00 ? 28 SER A N    10 
ATOM 10473 C CA   . SER A 1 28 ? -4.128  13.526  -0.679  1.00 0.00 ? 28 SER A CA   10 
ATOM 10474 C C    . SER A 1 28 ? -5.128  13.812  0.449   1.00 0.00 ? 28 SER A C    10 
ATOM 10475 O O    . SER A 1 28 ? -5.941  14.727  0.317   1.00 0.00 ? 28 SER A O    10 
ATOM 10476 C CB   . SER A 1 28 ? -4.846  13.261  -1.999  1.00 0.00 ? 28 SER A CB   10 
ATOM 10477 O OG   . SER A 1 28 ? -3.915  13.350  -3.071  1.00 0.00 ? 28 SER A OG   10 
ATOM 10478 H H    . SER A 1 28 ? -3.669  11.499  -0.811  1.00 0.00 ? 28 SER A H    10 
ATOM 10479 H HA   . SER A 1 28 ? -3.495  14.408  -0.787  1.00 0.00 ? 28 SER A HA   10 
ATOM 10480 H HB2  . SER A 1 28 ? -5.302  12.270  -1.982  1.00 0.00 ? 28 SER A HB2  10 
ATOM 10481 H HB3  . SER A 1 28 ? -5.633  13.992  -2.130  1.00 0.00 ? 28 SER A HB3  10 
ATOM 10482 H HG   . SER A 1 28 ? -4.073  12.583  -3.667  1.00 0.00 ? 28 SER A HG   10 
ATOM 10483 N N    . GLY A 1 29 ? -5.097  13.061  1.553   1.00 0.00 ? 29 GLY A N    10 
ATOM 10484 C CA   . GLY A 1 29 ? -6.003  13.280  2.666   1.00 0.00 ? 29 GLY A CA   10 
ATOM 10485 C C    . GLY A 1 29 ? -7.434  12.864  2.361   1.00 0.00 ? 29 GLY A C    10 
ATOM 10486 O O    . GLY A 1 29 ? -8.354  13.308  3.050   1.00 0.00 ? 29 GLY A O    10 
ATOM 10487 H H    . GLY A 1 29 ? -4.397  12.335  1.653   1.00 0.00 ? 29 GLY A H    10 
ATOM 10488 H HA2  . GLY A 1 29 ? -5.648  12.720  3.531   1.00 0.00 ? 29 GLY A HA2  10 
ATOM 10489 H HA3  . GLY A 1 29 ? -6.016  14.341  2.899   1.00 0.00 ? 29 GLY A HA3  10 
ATOM 10490 N N    . LYS A 1 30 ? -7.662  12.003  1.359   1.00 0.00 ? 30 LYS A N    10 
ATOM 10491 C CA   . LYS A 1 30 ? -9.012  11.506  1.092   1.00 0.00 ? 30 LYS A CA   10 
ATOM 10492 C C    . LYS A 1 30 ? -9.500  10.694  2.285   1.00 0.00 ? 30 LYS A C    10 
ATOM 10493 O O    . LYS A 1 30 ? -10.702 10.604  2.518   1.00 0.00 ? 30 LYS A O    10 
ATOM 10494 C CB   . LYS A 1 30 ? -9.042  10.643  -0.176  1.00 0.00 ? 30 LYS A CB   10 
ATOM 10495 C CG   . LYS A 1 30 ? -8.584  11.328  -1.476  1.00 0.00 ? 30 LYS A CG   10 
ATOM 10496 C CD   . LYS A 1 30 ? -9.168  12.728  -1.702  1.00 0.00 ? 30 LYS A CD   10 
ATOM 10497 C CE   . LYS A 1 30 ? -9.276  13.054  -3.199  1.00 0.00 ? 30 LYS A CE   10 
ATOM 10498 N NZ   . LYS A 1 30 ? -10.418 12.361  -3.840  1.00 0.00 ? 30 LYS A NZ   10 
ATOM 10499 H H    . LYS A 1 30 ? -6.872  11.534  0.909   1.00 0.00 ? 30 LYS A H    10 
ATOM 10500 H HA   . LYS A 1 30 ? -9.691  12.355  0.976   1.00 0.00 ? 30 LYS A HA   10 
ATOM 10501 H HB2  . LYS A 1 30 ? -8.411  9.781   0.000   1.00 0.00 ? 30 LYS A HB2  10 
ATOM 10502 H HB3  . LYS A 1 30 ? -10.047 10.249  -0.319  1.00 0.00 ? 30 LYS A HB3  10 
ATOM 10503 H HG2  . LYS A 1 30 ? -7.498  11.417  -1.480  1.00 0.00 ? 30 LYS A HG2  10 
ATOM 10504 H HG3  . LYS A 1 30 ? -8.861  10.679  -2.307  1.00 0.00 ? 30 LYS A HG3  10 
ATOM 10505 H HD2  . LYS A 1 30 ? -10.152 12.803  -1.245  1.00 0.00 ? 30 LYS A HD2  10 
ATOM 10506 H HD3  . LYS A 1 30 ? -8.514  13.456  -1.213  1.00 0.00 ? 30 LYS A HD3  10 
ATOM 10507 H HE2  . LYS A 1 30 ? -9.411  14.131  -3.317  1.00 0.00 ? 30 LYS A HE2  10 
ATOM 10508 H HE3  . LYS A 1 30 ? -8.348  12.768  -3.698  1.00 0.00 ? 30 LYS A HE3  10 
ATOM 10509 H HZ1  . LYS A 1 30 ? -10.376 12.469  -4.853  1.00 0.00 ? 30 LYS A HZ1  10 
ATOM 10510 H HZ2  . LYS A 1 30 ? -10.415 11.370  -3.646  1.00 0.00 ? 30 LYS A HZ2  10 
ATOM 10511 H HZ3  . LYS A 1 30 ? -11.299 12.748  -3.520  1.00 0.00 ? 30 LYS A HZ3  10 
ATOM 10512 N N    . MET A 1 31 ? -8.580  10.104  3.049   1.00 0.00 ? 31 MET A N    10 
ATOM 10513 C CA   . MET A 1 31 ? -8.829  9.521   4.351   1.00 0.00 ? 31 MET A CA   10 
ATOM 10514 C C    . MET A 1 31 ? -7.501  9.344   5.090   1.00 0.00 ? 31 MET A C    10 
ATOM 10515 O O    . MET A 1 31 ? -6.440  9.646   4.547   1.00 0.00 ? 31 MET A O    10 
ATOM 10516 C CB   . MET A 1 31 ? -9.538  8.176   4.201   1.00 0.00 ? 31 MET A CB   10 
ATOM 10517 C CG   . MET A 1 31 ? -8.773  7.138   3.403   1.00 0.00 ? 31 MET A CG   10 
ATOM 10518 S SD   . MET A 1 31 ? -9.839  5.812   2.799   1.00 0.00 ? 31 MET A SD   10 
ATOM 10519 C CE   . MET A 1 31 ? -10.641 6.666   1.452   1.00 0.00 ? 31 MET A CE   10 
ATOM 10520 H H    . MET A 1 31 ? -7.598  10.215  2.834   1.00 0.00 ? 31 MET A H    10 
ATOM 10521 H HA   . MET A 1 31 ? -9.464  10.201  4.920   1.00 0.00 ? 31 MET A HA   10 
ATOM 10522 H HB2  . MET A 1 31 ? -9.670  7.782   5.188   1.00 0.00 ? 31 MET A HB2  10 
ATOM 10523 H HB3  . MET A 1 31 ? -10.528 8.273   3.782   1.00 0.00 ? 31 MET A HB3  10 
ATOM 10524 H HG2  . MET A 1 31 ? -8.270  7.596   2.552   1.00 0.00 ? 31 MET A HG2  10 
ATOM 10525 H HG3  . MET A 1 31 ? -8.025  6.716   4.069   1.00 0.00 ? 31 MET A HG3  10 
ATOM 10526 H HE1  . MET A 1 31 ? -11.299 7.427   1.863   1.00 0.00 ? 31 MET A HE1  10 
ATOM 10527 H HE2  . MET A 1 31 ? -9.876  7.127   0.839   1.00 0.00 ? 31 MET A HE2  10 
ATOM 10528 H HE3  . MET A 1 31 ? -11.207 5.941   0.873   1.00 0.00 ? 31 MET A HE3  10 
ATOM 10529 N N    . SER A 1 32 ? -7.570  8.839   6.318   1.00 0.00 ? 32 SER A N    10 
ATOM 10530 C CA   . SER A 1 32 ? -6.438  8.458   7.147   1.00 0.00 ? 32 SER A CA   10 
ATOM 10531 C C    . SER A 1 32 ? -5.898  7.082   6.740   1.00 0.00 ? 32 SER A C    10 
ATOM 10532 O O    . SER A 1 32 ? -6.626  6.321   6.093   1.00 0.00 ? 32 SER A O    10 
ATOM 10533 C CB   . SER A 1 32 ? -6.945  8.435   8.597   1.00 0.00 ? 32 SER A CB   10 
ATOM 10534 O OG   . SER A 1 32 ? -7.444  9.709   8.963   1.00 0.00 ? 32 SER A OG   10 
ATOM 10535 H H    . SER A 1 32 ? -8.484  8.673   6.714   1.00 0.00 ? 32 SER A H    10 
ATOM 10536 H HA   . SER A 1 32 ? -5.644  9.193   7.027   1.00 0.00 ? 32 SER A HA   10 
ATOM 10537 H HB2  . SER A 1 32 ? -7.744  7.699   8.690   1.00 0.00 ? 32 SER A HB2  10 
ATOM 10538 H HB3  . SER A 1 32 ? -6.142  8.159   9.272   1.00 0.00 ? 32 SER A HB3  10 
ATOM 10539 H HG   . SER A 1 32 ? -6.709  10.339  8.849   1.00 0.00 ? 32 SER A HG   10 
ATOM 10540 N N    . VAL A 1 33 ? -4.680  6.732   7.182   1.00 0.00 ? 33 VAL A N    10 
ATOM 10541 C CA   . VAL A 1 33 ? -4.138  5.376   7.056   1.00 0.00 ? 33 VAL A CA   10 
ATOM 10542 C C    . VAL A 1 33 ? -5.151  4.413   7.666   1.00 0.00 ? 33 VAL A C    10 
ATOM 10543 O O    . VAL A 1 33 ? -5.589  3.509   6.973   1.00 0.00 ? 33 VAL A O    10 
ATOM 10544 C CB   . VAL A 1 33 ? -2.737  5.221   7.707   1.00 0.00 ? 33 VAL A CB   10 
ATOM 10545 C CG1  . VAL A 1 33 ? -2.212  3.774   7.652   1.00 0.00 ? 33 VAL A CG1  10 
ATOM 10546 C CG2  . VAL A 1 33 ? -1.697  6.124   7.036   1.00 0.00 ? 33 VAL A CG2  10 
ATOM 10547 H H    . VAL A 1 33 ? -4.141  7.406   7.715   1.00 0.00 ? 33 VAL A H    10 
ATOM 10548 H HA   . VAL A 1 33 ? -4.051  5.143   5.993   1.00 0.00 ? 33 VAL A HA   10 
ATOM 10549 H HB   . VAL A 1 33 ? -2.787  5.504   8.754   1.00 0.00 ? 33 VAL A HB   10 
ATOM 10550 H HG11 . VAL A 1 33 ? -1.824  3.543   6.662   1.00 0.00 ? 33 VAL A HG11 10 
ATOM 10551 H HG12 . VAL A 1 33 ? -1.416  3.642   8.376   1.00 0.00 ? 33 VAL A HG12 10 
ATOM 10552 H HG13 . VAL A 1 33 ? -2.980  3.053   7.928   1.00 0.00 ? 33 VAL A HG13 10 
ATOM 10553 H HG21 . VAL A 1 33 ? -1.543  5.812   6.005   1.00 0.00 ? 33 VAL A HG21 10 
ATOM 10554 H HG22 . VAL A 1 33 ? -2.014  7.165   7.060   1.00 0.00 ? 33 VAL A HG22 10 
ATOM 10555 H HG23 . VAL A 1 33 ? -0.748  6.044   7.563   1.00 0.00 ? 33 VAL A HG23 10 
ATOM 10556 N N    . SER A 1 34 ? -5.556  4.620   8.921   1.00 0.00 ? 34 SER A N    10 
ATOM 10557 C CA   . SER A 1 34 ? -6.523  3.802   9.652   1.00 0.00 ? 34 SER A CA   10 
ATOM 10558 C C    . SER A 1 34 ? -7.766  3.483   8.818   1.00 0.00 ? 34 SER A C    10 
ATOM 10559 O O    . SER A 1 34 ? -8.157  2.329   8.644   1.00 0.00 ? 34 SER A O    10 
ATOM 10560 C CB   . SER A 1 34 ? -6.884  4.565   10.940  1.00 0.00 ? 34 SER A CB   10 
ATOM 10561 O OG   . SER A 1 34 ? -7.188  5.924   10.645  1.00 0.00 ? 34 SER A OG   10 
ATOM 10562 H H    . SER A 1 34 ? -5.190  5.423   9.424   1.00 0.00 ? 34 SER A H    10 
ATOM 10563 H HA   . SER A 1 34 ? -6.060  2.849   9.900   1.00 0.00 ? 34 SER A HA   10 
ATOM 10564 H HB2  . SER A 1 34 ? -7.733  4.087   11.427  1.00 0.00 ? 34 SER A HB2  10 
ATOM 10565 H HB3  . SER A 1 34 ? -6.031  4.540   11.617  1.00 0.00 ? 34 SER A HB3  10 
ATOM 10566 H HG   . SER A 1 34 ? -7.082  6.451   11.459  1.00 0.00 ? 34 SER A HG   10 
ATOM 10567 N N    . LYS A 1 35 ? -8.366  4.539   8.279   1.00 0.00 ? 35 LYS A N    10 
ATOM 10568 C CA   . LYS A 1 35 ? -9.525  4.492   7.416   1.00 0.00 ? 35 LYS A CA   10 
ATOM 10569 C C    . LYS A 1 35 ? -9.228  3.636   6.182   1.00 0.00 ? 35 LYS A C    10 
ATOM 10570 O O    . LYS A 1 35 ? -9.757  2.530   6.100   1.00 0.00 ? 35 LYS A O    10 
ATOM 10571 C CB   . LYS A 1 35 ? -9.954  5.923   7.162   1.00 0.00 ? 35 LYS A CB   10 
ATOM 10572 C CG   . LYS A 1 35 ? -11.233 6.009   6.324   1.00 0.00 ? 35 LYS A CG   10 
ATOM 10573 C CD   . LYS A 1 35 ? -12.017 7.239   6.747   1.00 0.00 ? 35 LYS A CD   10 
ATOM 10574 C CE   . LYS A 1 35 ? -13.155 7.524   5.766   1.00 0.00 ? 35 LYS A CE   10 
ATOM 10575 N NZ   . LYS A 1 35 ? -14.010 8.637   6.220   1.00 0.00 ? 35 LYS A NZ   10 
ATOM 10576 H H    . LYS A 1 35 ? -7.963  5.428   8.538   1.00 0.00 ? 35 LYS A H    10 
ATOM 10577 H HA   . LYS A 1 35 ? -10.344 4.033   7.964   1.00 0.00 ? 35 LYS A HA   10 
ATOM 10578 H HB2  . LYS A 1 35 ? -10.132 6.382   8.138   1.00 0.00 ? 35 LYS A HB2  10 
ATOM 10579 H HB3  . LYS A 1 35 ? -9.139  6.461   6.691   1.00 0.00 ? 35 LYS A HB3  10 
ATOM 10580 H HG2  . LYS A 1 35 ? -10.997 6.063   5.273   1.00 0.00 ? 35 LYS A HG2  10 
ATOM 10581 H HG3  . LYS A 1 35 ? -11.846 5.135   6.460   1.00 0.00 ? 35 LYS A HG3  10 
ATOM 10582 H HD2  . LYS A 1 35 ? -12.422 7.041   7.731   1.00 0.00 ? 35 LYS A HD2  10 
ATOM 10583 H HD3  . LYS A 1 35 ? -11.332 8.077   6.822   1.00 0.00 ? 35 LYS A HD3  10 
ATOM 10584 H HE2  . LYS A 1 35 ? -12.747 7.755   4.779   1.00 0.00 ? 35 LYS A HE2  10 
ATOM 10585 H HE3  . LYS A 1 35 ? -13.774 6.629   5.691   1.00 0.00 ? 35 LYS A HE3  10 
ATOM 10586 H HZ1  . LYS A 1 35 ? -13.558 9.537   6.094   1.00 0.00 ? 35 LYS A HZ1  10 
ATOM 10587 H HZ2  . LYS A 1 35 ? -14.874 8.614   5.688   1.00 0.00 ? 35 LYS A HZ2  10 
ATOM 10588 H HZ3  . LYS A 1 35 ? -14.266 8.524   7.195   1.00 0.00 ? 35 LYS A HZ3  10 
ATOM 10589 N N    . ALA A 1 36 ? -8.412  4.097   5.227   1.00 0.00 ? 36 ALA A N    10 
ATOM 10590 C CA   . ALA A 1 36 ? -8.087  3.345   4.018   1.00 0.00 ? 36 ALA A CA   10 
ATOM 10591 C C    . ALA A 1 36 ? -7.586  1.927   4.262   1.00 0.00 ? 36 ALA A C    10 
ATOM 10592 O O    . ALA A 1 36 ? -7.962  1.052   3.495   1.00 0.00 ? 36 ALA A O    10 
ATOM 10593 C CB   . ALA A 1 36 ? -7.010  4.085   3.214   1.00 0.00 ? 36 ALA A CB   10 
ATOM 10594 H H    . ALA A 1 36 ? -8.110  5.066   5.227   1.00 0.00 ? 36 ALA A H    10 
ATOM 10595 H HA   . ALA A 1 36 ? -9.022  3.246   3.450   1.00 0.00 ? 36 ALA A HA   10 
ATOM 10596 H HB1  . ALA A 1 36 ? -6.785  3.541   2.297   1.00 0.00 ? 36 ALA A HB1  10 
ATOM 10597 H HB2  . ALA A 1 36 ? -7.325  5.087   2.952   1.00 0.00 ? 36 ALA A HB2  10 
ATOM 10598 H HB3  . ALA A 1 36 ? -6.106  4.165   3.815   1.00 0.00 ? 36 ALA A HB3  10 
ATOM 10599 N N    . GLN A 1 37 ? -6.794  1.659   5.297   1.00 0.00 ? 37 GLN A N    10 
ATOM 10600 C CA   . GLN A 1 37 ? -6.436  0.319   5.725   1.00 0.00 ? 37 GLN A CA   10 
ATOM 10601 C C    . GLN A 1 37 ? -7.690  -0.541  5.747   1.00 0.00 ? 37 GLN A C    10 
ATOM 10602 O O    . GLN A 1 37 ? -7.723  -1.620  5.152   1.00 0.00 ? 37 GLN A O    10 
ATOM 10603 C CB   . GLN A 1 37 ? -5.742  0.411   7.100   1.00 0.00 ? 37 GLN A CB   10 
ATOM 10604 C CG   . GLN A 1 37 ? -5.919  -0.825  7.997   1.00 0.00 ? 37 GLN A CG   10 
ATOM 10605 C CD   . GLN A 1 37 ? -6.760  -0.618  9.247   1.00 0.00 ? 37 GLN A CD   10 
ATOM 10606 O OE1  . GLN A 1 37 ? -6.410  0.156   10.135  1.00 0.00 ? 37 GLN A OE1  10 
ATOM 10607 N NE2  . GLN A 1 37 ? -7.808  -1.406  9.406   1.00 0.00 ? 37 GLN A NE2  10 
ATOM 10608 H H    . GLN A 1 37 ? -6.446  2.405   5.885   1.00 0.00 ? 37 GLN A H    10 
ATOM 10609 H HA   . GLN A 1 37 ? -5.741  -0.116  5.008   1.00 0.00 ? 37 GLN A HA   10 
ATOM 10610 H HB2  . GLN A 1 37 ? -4.682  0.603   6.911   1.00 0.00 ? 37 GLN A HB2  10 
ATOM 10611 H HB3  . GLN A 1 37 ? -6.141  1.254   7.654   1.00 0.00 ? 37 GLN A HB3  10 
ATOM 10612 H HG2  . GLN A 1 37 ? -6.333  -1.637  7.430   1.00 0.00 ? 37 GLN A HG2  10 
ATOM 10613 H HG3  . GLN A 1 37 ? -4.969  -1.180  8.317   1.00 0.00 ? 37 GLN A HG3  10 
ATOM 10614 H HE21 . GLN A 1 37 ? -7.971  -2.142  8.720   1.00 0.00 ? 37 GLN A HE21 10 
ATOM 10615 H HE22 . GLN A 1 37 ? -8.413  -1.286  10.203  1.00 0.00 ? 37 GLN A HE22 10 
ATOM 10616 N N    . SER A 1 38 ? -8.708  -0.075  6.461   1.00 0.00 ? 38 SER A N    10 
ATOM 10617 C CA   . SER A 1 38 ? -9.901  -0.848  6.655   1.00 0.00 ? 38 SER A CA   10 
ATOM 10618 C C    . SER A 1 38 ? -10.658 -0.930  5.319   1.00 0.00 ? 38 SER A C    10 
ATOM 10619 O O    . SER A 1 38 ? -11.046 -2.024  4.913   1.00 0.00 ? 38 SER A O    10 
ATOM 10620 C CB   . SER A 1 38 ? -10.694 -0.226  7.808   1.00 0.00 ? 38 SER A CB   10 
ATOM 10621 O OG   . SER A 1 38 ? -11.382 -1.213  8.557   1.00 0.00 ? 38 SER A OG   10 
ATOM 10622 H H    . SER A 1 38 ? -8.678  0.868   6.844   1.00 0.00 ? 38 SER A H    10 
ATOM 10623 H HA   . SER A 1 38 ? -9.555  -1.834  6.961   1.00 0.00 ? 38 SER A HA   10 
ATOM 10624 H HB2  . SER A 1 38 ? -9.985  0.264   8.484   1.00 0.00 ? 38 SER A HB2  10 
ATOM 10625 H HB3  . SER A 1 38 ? -11.391 0.519   7.425   1.00 0.00 ? 38 SER A HB3  10 
ATOM 10626 H HG   . SER A 1 38 ? -11.764 -1.882  7.950   1.00 0.00 ? 38 SER A HG   10 
ATOM 10627 N N    . ILE A 1 39 ? -10.833 0.202   4.622   1.00 0.00 ? 39 ILE A N    10 
ATOM 10628 C CA   . ILE A 1 39 ? -11.580 0.281   3.363   1.00 0.00 ? 39 ILE A CA   10 
ATOM 10629 C C    . ILE A 1 39 ? -10.978 -0.673  2.327   1.00 0.00 ? 39 ILE A C    10 
ATOM 10630 O O    . ILE A 1 39 ? -11.664 -1.549  1.811   1.00 0.00 ? 39 ILE A O    10 
ATOM 10631 C CB   . ILE A 1 39 ? -11.687 1.738   2.848   1.00 0.00 ? 39 ILE A CB   10 
ATOM 10632 C CG1  . ILE A 1 39 ? -12.375 2.596   3.934   1.00 0.00 ? 39 ILE A CG1  10 
ATOM 10633 C CG2  . ILE A 1 39 ? -12.434 1.812   1.500   1.00 0.00 ? 39 ILE A CG2  10 
ATOM 10634 C CD1  . ILE A 1 39 ? -12.901 3.954   3.487   1.00 0.00 ? 39 ILE A CD1  10 
ATOM 10635 H H    . ILE A 1 39 ? -10.447 1.054   5.013   1.00 0.00 ? 39 ILE A H    10 
ATOM 10636 H HA   . ILE A 1 39 ? -12.592 -0.049  3.566   1.00 0.00 ? 39 ILE A HA   10 
ATOM 10637 H HB   . ILE A 1 39 ? -10.688 2.132   2.682   1.00 0.00 ? 39 ILE A HB   10 
ATOM 10638 H HG12 . ILE A 1 39 ? -13.198 2.038   4.361   1.00 0.00 ? 39 ILE A HG12 10 
ATOM 10639 H HG13 . ILE A 1 39 ? -11.671 2.780   4.732   1.00 0.00 ? 39 ILE A HG13 10 
ATOM 10640 H HG21 . ILE A 1 39 ? -12.423 2.829   1.111   1.00 0.00 ? 39 ILE A HG21 10 
ATOM 10641 H HG22 . ILE A 1 39 ? -11.945 1.184   0.753   1.00 0.00 ? 39 ILE A HG22 10 
ATOM 10642 H HG23 . ILE A 1 39 ? -13.465 1.477   1.621   1.00 0.00 ? 39 ILE A HG23 10 
ATOM 10643 H HD11 . ILE A 1 39 ? -13.105 4.567   4.366   1.00 0.00 ? 39 ILE A HD11 10 
ATOM 10644 H HD12 . ILE A 1 39 ? -12.154 4.438   2.865   1.00 0.00 ? 39 ILE A HD12 10 
ATOM 10645 H HD13 . ILE A 1 39 ? -13.819 3.813   2.920   1.00 0.00 ? 39 ILE A HD13 10 
ATOM 10646 N N    . TYR A 1 40 ? -9.704  -0.487  2.005   1.00 0.00 ? 40 TYR A N    10 
ATOM 10647 C CA   . TYR A 1 40 ? -9.019  -1.177  0.928   1.00 0.00 ? 40 TYR A CA   10 
ATOM 10648 C C    . TYR A 1 40 ? -8.555  -2.575  1.352   1.00 0.00 ? 40 TYR A C    10 
ATOM 10649 O O    . TYR A 1 40 ? -8.185  -3.384  0.501   1.00 0.00 ? 40 TYR A O    10 
ATOM 10650 C CB   . TYR A 1 40 ? -7.855  -0.304  0.452   1.00 0.00 ? 40 TYR A CB   10 
ATOM 10651 C CG   . TYR A 1 40 ? -8.295  0.946   -0.302  1.00 0.00 ? 40 TYR A CG   10 
ATOM 10652 C CD1  . TYR A 1 40 ? -8.698  2.117   0.380   1.00 0.00 ? 40 TYR A CD1  10 
ATOM 10653 C CD2  . TYR A 1 40 ? -8.211  0.972   -1.702  1.00 0.00 ? 40 TYR A CD2  10 
ATOM 10654 C CE1  . TYR A 1 40 ? -9.058  3.287   -0.320  1.00 0.00 ? 40 TYR A CE1  10 
ATOM 10655 C CE2  . TYR A 1 40 ? -8.548  2.132   -2.401  1.00 0.00 ? 40 TYR A CE2  10 
ATOM 10656 C CZ   . TYR A 1 40 ? -9.012  3.274   -1.733  1.00 0.00 ? 40 TYR A CZ   10 
ATOM 10657 O OH   . TYR A 1 40 ? -9.409  4.325   -2.498  1.00 0.00 ? 40 TYR A OH   10 
ATOM 10658 H H    . TYR A 1 40 ? -9.158  0.178   2.534   1.00 0.00 ? 40 TYR A H    10 
ATOM 10659 H HA   . TYR A 1 40 ? -9.722  -1.284  0.103   1.00 0.00 ? 40 TYR A HA   10 
ATOM 10660 H HB2  . TYR A 1 40 ? -7.265  0.005   1.312   1.00 0.00 ? 40 TYR A HB2  10 
ATOM 10661 H HB3  . TYR A 1 40 ? -7.188  -0.911  -0.173  1.00 0.00 ? 40 TYR A HB3  10 
ATOM 10662 H HD1  . TYR A 1 40 ? -8.713  2.123   1.453   1.00 0.00 ? 40 TYR A HD1  10 
ATOM 10663 H HD2  . TYR A 1 40 ? -7.842  0.131   -2.265  1.00 0.00 ? 40 TYR A HD2  10 
ATOM 10664 H HE1  . TYR A 1 40 ? -9.329  4.186   0.221   1.00 0.00 ? 40 TYR A HE1  10 
ATOM 10665 H HE2  . TYR A 1 40 ? -8.402  2.157   -3.463  1.00 0.00 ? 40 TYR A HE2  10 
ATOM 10666 H HH   . TYR A 1 40 ? -9.465  5.189   -2.078  1.00 0.00 ? 40 TYR A HH   10 
ATOM 10667 N N    . GLY A 1 41 ? -8.596  -2.882  2.650   1.00 0.00 ? 41 GLY A N    10 
ATOM 10668 C CA   . GLY A 1 41 ? -8.304  -4.205  3.180   1.00 0.00 ? 41 GLY A CA   10 
ATOM 10669 C C    . GLY A 1 41 ? -6.803  -4.431  3.323   1.00 0.00 ? 41 GLY A C    10 
ATOM 10670 O O    . GLY A 1 41 ? -6.338  -5.568  3.295   1.00 0.00 ? 41 GLY A O    10 
ATOM 10671 H H    . GLY A 1 41 ? -8.758  -2.130  3.305   1.00 0.00 ? 41 GLY A H    10 
ATOM 10672 H HA2  . GLY A 1 41 ? -8.770  -4.296  4.160   1.00 0.00 ? 41 GLY A HA2  10 
ATOM 10673 H HA3  . GLY A 1 41 ? -8.722  -4.956  2.510   1.00 0.00 ? 41 GLY A HA3  10 
ATOM 10674 N N    . ILE A 1 42 ? -6.042  -3.347  3.443   1.00 0.00 ? 42 ILE A N    10 
ATOM 10675 C CA   . ILE A 1 42 ? -4.598  -3.359  3.563   1.00 0.00 ? 42 ILE A CA   10 
ATOM 10676 C C    . ILE A 1 42 ? -4.275  -3.410  5.065   1.00 0.00 ? 42 ILE A C    10 
ATOM 10677 O O    . ILE A 1 42 ? -4.928  -2.702  5.827   1.00 0.00 ? 42 ILE A O    10 
ATOM 10678 C CB   . ILE A 1 42 ? -4.015  -2.072  2.933   1.00 0.00 ? 42 ILE A CB   10 
ATOM 10679 C CG1  . ILE A 1 42 ? -4.650  -1.613  1.610   1.00 0.00 ? 42 ILE A CG1  10 
ATOM 10680 C CG2  . ILE A 1 42 ? -2.487  -2.240  2.806   1.00 0.00 ? 42 ILE A CG2  10 
ATOM 10681 C CD1  . ILE A 1 42 ? -4.407  -2.520  0.419   1.00 0.00 ? 42 ILE A CD1  10 
ATOM 10682 H H    . ILE A 1 42 ? -6.518  -2.466  3.590   1.00 0.00 ? 42 ILE A H    10 
ATOM 10683 H HA   . ILE A 1 42 ? -4.213  -4.235  3.042   1.00 0.00 ? 42 ILE A HA   10 
ATOM 10684 H HB   . ILE A 1 42 ? -4.252  -1.241  3.589   1.00 0.00 ? 42 ILE A HB   10 
ATOM 10685 H HG12 . ILE A 1 42 ? -5.722  -1.515  1.739   1.00 0.00 ? 42 ILE A HG12 10 
ATOM 10686 H HG13 . ILE A 1 42 ? -4.300  -0.616  1.372   1.00 0.00 ? 42 ILE A HG13 10 
ATOM 10687 H HG21 . ILE A 1 42 ? -2.030  -2.375  3.789   1.00 0.00 ? 42 ILE A HG21 10 
ATOM 10688 H HG22 . ILE A 1 42 ? -2.276  -3.128  2.201   1.00 0.00 ? 42 ILE A HG22 10 
ATOM 10689 H HG23 . ILE A 1 42 ? -2.056  -1.350  2.348   1.00 0.00 ? 42 ILE A HG23 10 
ATOM 10690 H HD11 . ILE A 1 42 ? -4.889  -3.472  0.618   1.00 0.00 ? 42 ILE A HD11 10 
ATOM 10691 H HD12 . ILE A 1 42 ? -4.852  -2.054  -0.452  1.00 0.00 ? 42 ILE A HD12 10 
ATOM 10692 H HD13 . ILE A 1 42 ? -3.345  -2.659  0.232   1.00 0.00 ? 42 ILE A HD13 10 
ATOM 10693 N N    . PRO A 1 43 ? -3.266  -4.168  5.525   1.00 0.00 ? 43 PRO A N    10 
ATOM 10694 C CA   . PRO A 1 43 ? -2.818  -4.071  6.911   1.00 0.00 ? 43 PRO A CA   10 
ATOM 10695 C C    . PRO A 1 43 ? -2.298  -2.665  7.220   1.00 0.00 ? 43 PRO A C    10 
ATOM 10696 O O    . PRO A 1 43 ? -1.608  -2.075  6.386   1.00 0.00 ? 43 PRO A O    10 
ATOM 10697 C CB   . PRO A 1 43 ? -1.714  -5.115  7.077   1.00 0.00 ? 43 PRO A CB   10 
ATOM 10698 C CG   . PRO A 1 43 ? -1.431  -5.687  5.688   1.00 0.00 ? 43 PRO A CG   10 
ATOM 10699 C CD   . PRO A 1 43 ? -2.507  -5.141  4.760   1.00 0.00 ? 43 PRO A CD   10 
ATOM 10700 H HA   . PRO A 1 43 ? -3.657  -4.299  7.574   1.00 0.00 ? 43 PRO A HA   10 
ATOM 10701 H HB2  . PRO A 1 43 ? -0.811  -4.686  7.513   1.00 0.00 ? 43 PRO A HB2  10 
ATOM 10702 H HB3  . PRO A 1 43 ? -2.083  -5.904  7.715   1.00 0.00 ? 43 PRO A HB3  10 
ATOM 10703 H HG2  . PRO A 1 43 ? -0.465  -5.360  5.328   1.00 0.00 ? 43 PRO A HG2  10 
ATOM 10704 H HG3  . PRO A 1 43 ? -1.441  -6.772  5.713   1.00 0.00 ? 43 PRO A HG3  10 
ATOM 10705 H HD2  . PRO A 1 43 ? -2.033  -4.676  3.899   1.00 0.00 ? 43 PRO A HD2  10 
ATOM 10706 H HD3  . PRO A 1 43 ? -3.158  -5.944  4.423   1.00 0.00 ? 43 PRO A HD3  10 
ATOM 10707 N N    . HIS A 1 44 ? -2.574  -2.146  8.421   1.00 0.00 ? 44 HIS A N    10 
ATOM 10708 C CA   . HIS A 1 44 ? -2.219  -0.784  8.815   1.00 0.00 ? 44 HIS A CA   10 
ATOM 10709 C C    . HIS A 1 44 ? -0.711  -0.595  8.773   1.00 0.00 ? 44 HIS A C    10 
ATOM 10710 O O    . HIS A 1 44 ? -0.244  0.351   8.149   1.00 0.00 ? 44 HIS A O    10 
ATOM 10711 C CB   . HIS A 1 44 ? -2.751  -0.441  10.217  1.00 0.00 ? 44 HIS A CB   10 
ATOM 10712 C CG   . HIS A 1 44 ? -2.637  1.026   10.570  1.00 0.00 ? 44 HIS A CG   10 
ATOM 10713 N ND1  . HIS A 1 44 ? -3.693  1.900   10.682  1.00 0.00 ? 44 HIS A ND1  10 
ATOM 10714 C CD2  . HIS A 1 44 ? -1.491  1.726   10.857  1.00 0.00 ? 44 HIS A CD2  10 
ATOM 10715 C CE1  . HIS A 1 44 ? -3.195  3.107   10.999  1.00 0.00 ? 44 HIS A CE1  10 
ATOM 10716 N NE2  . HIS A 1 44 ? -1.856  3.051   11.132  1.00 0.00 ? 44 HIS A NE2  10 
ATOM 10717 H H    . HIS A 1 44 ? -3.038  -2.736  9.098   1.00 0.00 ? 44 HIS A H    10 
ATOM 10718 H HA   . HIS A 1 44 ? -2.670  -0.095  8.098   1.00 0.00 ? 44 HIS A HA   10 
ATOM 10719 H HB2  . HIS A 1 44 ? -3.800  -0.720  10.277  1.00 0.00 ? 44 HIS A HB2  10 
ATOM 10720 H HB3  . HIS A 1 44 ? -2.207  -1.017  10.964  1.00 0.00 ? 44 HIS A HB3  10 
ATOM 10721 H HD1  . HIS A 1 44 ? -4.679  1.659   10.625  1.00 0.00 ? 44 HIS A HD1  10 
ATOM 10722 H HD2  . HIS A 1 44 ? -0.484  1.331   10.870  1.00 0.00 ? 44 HIS A HD2  10 
ATOM 10723 H HE1  . HIS A 1 44 ? -3.792  3.994   11.168  1.00 0.00 ? 44 HIS A HE1  10 
ATOM 10724 N N    . SER A 1 45 ? 0.046   -1.466  9.448   1.00 0.00 ? 45 SER A N    10 
ATOM 10725 C CA   . SER A 1 45 ? 1.488   -1.292  9.588   1.00 0.00 ? 45 SER A CA   10 
ATOM 10726 C C    . SER A 1 45 ? 2.169   -1.321  8.211   1.00 0.00 ? 45 SER A C    10 
ATOM 10727 O O    . SER A 1 45 ? 3.146   -0.605  7.974   1.00 0.00 ? 45 SER A O    10 
ATOM 10728 C CB   . SER A 1 45 ? 2.043   -2.366  10.541  1.00 0.00 ? 45 SER A CB   10 
ATOM 10729 O OG   . SER A 1 45 ? 2.890   -1.783  11.511  1.00 0.00 ? 45 SER A OG   10 
ATOM 10730 H H    . SER A 1 45 ? -0.407  -2.253  9.901   1.00 0.00 ? 45 SER A H    10 
ATOM 10731 H HA   . SER A 1 45 ? 1.657   -0.306  10.025  1.00 0.00 ? 45 SER A HA   10 
ATOM 10732 H HB2  . SER A 1 45 ? 1.227   -2.866  11.063  1.00 0.00 ? 45 SER A HB2  10 
ATOM 10733 H HB3  . SER A 1 45 ? 2.601   -3.112  9.974   1.00 0.00 ? 45 SER A HB3  10 
ATOM 10734 H HG   . SER A 1 45 ? 2.469   -1.892  12.394  1.00 0.00 ? 45 SER A HG   10 
ATOM 10735 N N    . THR A 1 46 ? 1.633   -2.123  7.291   1.00 0.00 ? 46 THR A N    10 
ATOM 10736 C CA   . THR A 1 46 ? 2.085   -2.203  5.917   1.00 0.00 ? 46 THR A CA   10 
ATOM 10737 C C    . THR A 1 46 ? 1.682   -0.941  5.143   1.00 0.00 ? 46 THR A C    10 
ATOM 10738 O O    . THR A 1 46 ? 2.532   -0.367  4.472   1.00 0.00 ? 46 THR A O    10 
ATOM 10739 C CB   . THR A 1 46 ? 1.492   -3.483  5.324   1.00 0.00 ? 46 THR A CB   10 
ATOM 10740 O OG1  . THR A 1 46 ? 1.800   -4.581  6.172   1.00 0.00 ? 46 THR A OG1  10 
ATOM 10741 C CG2  . THR A 1 46 ? 2.011   -3.803  3.928   1.00 0.00 ? 46 THR A CG2  10 
ATOM 10742 H H    . THR A 1 46 ? 0.853   -2.724  7.524   1.00 0.00 ? 46 THR A H    10 
ATOM 10743 H HA   . THR A 1 46 ? 3.174   -2.274  5.900   1.00 0.00 ? 46 THR A HA   10 
ATOM 10744 H HB   . THR A 1 46 ? 0.409   -3.370  5.275   1.00 0.00 ? 46 THR A HB   10 
ATOM 10745 H HG1  . THR A 1 46 ? 1.738   -5.400  5.631   1.00 0.00 ? 46 THR A HG1  10 
ATOM 10746 H HG21 . THR A 1 46 ? 1.273   -4.438  3.428   1.00 0.00 ? 46 THR A HG21 10 
ATOM 10747 H HG22 . THR A 1 46 ? 2.148   -2.887  3.353   1.00 0.00 ? 46 THR A HG22 10 
ATOM 10748 H HG23 . THR A 1 46 ? 2.969   -4.316  3.990   1.00 0.00 ? 46 THR A HG23 10 
ATOM 10749 N N    . LEU A 1 47 ? 0.419   -0.502  5.212   1.00 0.00 ? 47 LEU A N    10 
ATOM 10750 C CA   . LEU A 1 47 ? -0.076  0.700   4.551   1.00 0.00 ? 47 LEU A CA   10 
ATOM 10751 C C    . LEU A 1 47 ? 0.776   1.889   4.962   1.00 0.00 ? 47 LEU A C    10 
ATOM 10752 O O    . LEU A 1 47 ? 1.290   2.554   4.079   1.00 0.00 ? 47 LEU A O    10 
ATOM 10753 C CB   . LEU A 1 47 ? -1.562  0.954   4.866   1.00 0.00 ? 47 LEU A CB   10 
ATOM 10754 C CG   . LEU A 1 47 ? -2.153  2.163   4.099   1.00 0.00 ? 47 LEU A CG   10 
ATOM 10755 C CD1  . LEU A 1 47 ? -2.322  1.876   2.608   1.00 0.00 ? 47 LEU A CD1  10 
ATOM 10756 C CD2  . LEU A 1 47 ? -3.573  2.442   4.593   1.00 0.00 ? 47 LEU A CD2  10 
ATOM 10757 H H    . LEU A 1 47 ? -0.249  -1.018  5.764   1.00 0.00 ? 47 LEU A H    10 
ATOM 10758 H HA   . LEU A 1 47 ? 0.034   0.556   3.477   1.00 0.00 ? 47 LEU A HA   10 
ATOM 10759 H HB2  . LEU A 1 47 ? -2.139  0.062   4.626   1.00 0.00 ? 47 LEU A HB2  10 
ATOM 10760 H HB3  . LEU A 1 47 ? -1.665  1.132   5.937   1.00 0.00 ? 47 LEU A HB3  10 
ATOM 10761 H HG   . LEU A 1 47 ? -1.540  3.064   4.234   1.00 0.00 ? 47 LEU A HG   10 
ATOM 10762 H HD11 . LEU A 1 47 ? -1.358  1.698   2.138   1.00 0.00 ? 47 LEU A HD11 10 
ATOM 10763 H HD12 . LEU A 1 47 ? -2.969  1.007   2.484   1.00 0.00 ? 47 LEU A HD12 10 
ATOM 10764 H HD13 . LEU A 1 47 ? -2.796  2.737   2.131   1.00 0.00 ? 47 LEU A HD13 10 
ATOM 10765 H HD21 . LEU A 1 47 ? -3.590  2.537   5.673   1.00 0.00 ? 47 LEU A HD21 10 
ATOM 10766 H HD22 . LEU A 1 47 ? -3.934  3.366   4.143   1.00 0.00 ? 47 LEU A HD22 10 
ATOM 10767 H HD23 . LEU A 1 47 ? -4.236  1.627   4.307   1.00 0.00 ? 47 LEU A HD23 10 
ATOM 10768 N N    . GLU A 1 48 ? 0.967   2.116   6.266   1.00 0.00 ? 48 GLU A N    10 
ATOM 10769 C CA   . GLU A 1 48 ? 1.792   3.186   6.824   1.00 0.00 ? 48 GLU A CA   10 
ATOM 10770 C C    . GLU A 1 48 ? 3.135   3.220   6.088   1.00 0.00 ? 48 GLU A C    10 
ATOM 10771 O O    . GLU A 1 48 ? 3.427   4.183   5.382   1.00 0.00 ? 48 GLU A O    10 
ATOM 10772 C CB   . GLU A 1 48 ? 1.982   2.974   8.342   1.00 0.00 ? 48 GLU A CB   10 
ATOM 10773 C CG   . GLU A 1 48 ? 1.380   4.095   9.196   1.00 0.00 ? 48 GLU A CG   10 
ATOM 10774 C CD   . GLU A 1 48 ? 2.330   5.257   9.417   1.00 0.00 ? 48 GLU A CD   10 
ATOM 10775 O OE1  . GLU A 1 48 ? 3.244   5.080   10.257  1.00 0.00 ? 48 GLU A OE1  10 
ATOM 10776 O OE2  . GLU A 1 48 ? 2.166   6.324   8.777   1.00 0.00 ? 48 GLU A OE2  10 
ATOM 10777 H H    . GLU A 1 48 ? 0.526   1.484   6.928   1.00 0.00 ? 48 GLU A H    10 
ATOM 10778 H HA   . GLU A 1 48 ? 1.269   4.134   6.661   1.00 0.00 ? 48 GLU A HA   10 
ATOM 10779 H HB2  . GLU A 1 48 ? 1.514   2.038   8.643   1.00 0.00 ? 48 GLU A HB2  10 
ATOM 10780 H HB3  . GLU A 1 48 ? 3.039   2.873   8.590   1.00 0.00 ? 48 GLU A HB3  10 
ATOM 10781 H HG2  . GLU A 1 48 ? 0.460   4.464   8.758   1.00 0.00 ? 48 GLU A HG2  10 
ATOM 10782 H HG3  . GLU A 1 48 ? 1.167   3.684   10.174  1.00 0.00 ? 48 GLU A HG3  10 
ATOM 10783 N N    . TYR A 1 49 ? 3.915   2.138   6.189   1.00 0.00 ? 49 TYR A N    10 
ATOM 10784 C CA   . TYR A 1 49 ? 5.194   1.989   5.505   1.00 0.00 ? 49 TYR A CA   10 
ATOM 10785 C C    . TYR A 1 49 ? 5.063   2.350   4.029   1.00 0.00 ? 49 TYR A C    10 
ATOM 10786 O O    . TYR A 1 49 ? 5.852   3.118   3.497   1.00 0.00 ? 49 TYR A O    10 
ATOM 10787 C CB   . TYR A 1 49 ? 5.660   0.530   5.636   1.00 0.00 ? 49 TYR A CB   10 
ATOM 10788 C CG   . TYR A 1 49 ? 6.824   0.151   4.743   1.00 0.00 ? 49 TYR A CG   10 
ATOM 10789 C CD1  . TYR A 1 49 ? 8.151   0.364   5.149   1.00 0.00 ? 49 TYR A CD1  10 
ATOM 10790 C CD2  . TYR A 1 49 ? 6.561   -0.402  3.479   1.00 0.00 ? 49 TYR A CD2  10 
ATOM 10791 C CE1  . TYR A 1 49 ? 9.210   0.012   4.294   1.00 0.00 ? 49 TYR A CE1  10 
ATOM 10792 C CE2  . TYR A 1 49 ? 7.613   -0.771  2.621   1.00 0.00 ? 49 TYR A CE2  10 
ATOM 10793 C CZ   . TYR A 1 49 ? 8.949   -0.556  3.028   1.00 0.00 ? 49 TYR A CZ   10 
ATOM 10794 O OH   . TYR A 1 49 ? 9.972   -0.847  2.178   1.00 0.00 ? 49 TYR A OH   10 
ATOM 10795 H H    . TYR A 1 49 ? 3.571   1.354   6.728   1.00 0.00 ? 49 TYR A H    10 
ATOM 10796 H HA   . TYR A 1 49 ? 5.930   2.667   5.953   1.00 0.00 ? 49 TYR A HA   10 
ATOM 10797 H HB2  . TYR A 1 49 ? 5.908   0.306   6.663   1.00 0.00 ? 49 TYR A HB2  10 
ATOM 10798 H HB3  . TYR A 1 49 ? 4.832   -0.133  5.393   1.00 0.00 ? 49 TYR A HB3  10 
ATOM 10799 H HD1  . TYR A 1 49 ? 8.363   0.827   6.103   1.00 0.00 ? 49 TYR A HD1  10 
ATOM 10800 H HD2  . TYR A 1 49 ? 5.532   -0.499  3.171   1.00 0.00 ? 49 TYR A HD2  10 
ATOM 10801 H HE1  . TYR A 1 49 ? 10.222  0.213   4.600   1.00 0.00 ? 49 TYR A HE1  10 
ATOM 10802 H HE2  . TYR A 1 49 ? 7.404   -1.143  1.625   1.00 0.00 ? 49 TYR A HE2  10 
ATOM 10803 H HH   . TYR A 1 49 ? 10.331  -0.010  1.806   1.00 0.00 ? 49 TYR A HH   10 
ATOM 10804 N N    . LYS A 1 50 ? 4.087   1.774   3.338   1.00 0.00 ? 50 LYS A N    10 
ATOM 10805 C CA   . LYS A 1 50 ? 3.971   1.881   1.895   1.00 0.00 ? 50 LYS A CA   10 
ATOM 10806 C C    . LYS A 1 50 ? 3.651   3.309   1.446   1.00 0.00 ? 50 LYS A C    10 
ATOM 10807 O O    . LYS A 1 50 ? 4.219   3.760   0.451   1.00 0.00 ? 50 LYS A O    10 
ATOM 10808 C CB   . LYS A 1 50 ? 2.921   0.866   1.445   1.00 0.00 ? 50 LYS A CB   10 
ATOM 10809 C CG   . LYS A 1 50 ? 3.433   -0.570  1.362   1.00 0.00 ? 50 LYS A CG   10 
ATOM 10810 C CD   . LYS A 1 50 ? 4.594   -0.706  0.360   1.00 0.00 ? 50 LYS A CD   10 
ATOM 10811 C CE   . LYS A 1 50 ? 4.584   -1.966  -0.508  1.00 0.00 ? 50 LYS A CE   10 
ATOM 10812 N NZ   . LYS A 1 50 ? 5.479   -1.829  -1.675  1.00 0.00 ? 50 LYS A NZ   10 
ATOM 10813 H H    . LYS A 1 50 ? 3.406   1.215   3.842   1.00 0.00 ? 50 LYS A H    10 
ATOM 10814 H HA   . LYS A 1 50 ? 4.941   1.647   1.461   1.00 0.00 ? 50 LYS A HA   10 
ATOM 10815 H HB2  . LYS A 1 50 ? 2.096   0.861   2.161   1.00 0.00 ? 50 LYS A HB2  10 
ATOM 10816 H HB3  . LYS A 1 50 ? 2.576   1.147   0.456   1.00 0.00 ? 50 LYS A HB3  10 
ATOM 10817 H HG2  . LYS A 1 50 ? 3.741   -0.909  2.352   1.00 0.00 ? 50 LYS A HG2  10 
ATOM 10818 H HG3  . LYS A 1 50 ? 2.586   -1.178  1.077   1.00 0.00 ? 50 LYS A HG3  10 
ATOM 10819 H HD2  . LYS A 1 50 ? 4.662   0.169   -0.279  1.00 0.00 ? 50 LYS A HD2  10 
ATOM 10820 H HD3  . LYS A 1 50 ? 5.498   -0.706  0.940   1.00 0.00 ? 50 LYS A HD3  10 
ATOM 10821 H HE2  . LYS A 1 50 ? 4.908   -2.812  0.099   1.00 0.00 ? 50 LYS A HE2  10 
ATOM 10822 H HE3  . LYS A 1 50 ? 3.575   -2.166  -0.862  1.00 0.00 ? 50 LYS A HE3  10 
ATOM 10823 H HZ1  . LYS A 1 50 ? 6.427   -1.591  -1.381  1.00 0.00 ? 50 LYS A HZ1  10 
ATOM 10824 H HZ2  . LYS A 1 50 ? 5.552   -2.705  -2.177  1.00 0.00 ? 50 LYS A HZ2  10 
ATOM 10825 H HZ3  . LYS A 1 50 ? 5.162   -1.106  -2.310  1.00 0.00 ? 50 LYS A HZ3  10 
ATOM 10826 N N    . VAL A 1 51 ? 2.813   4.029   2.190   1.00 0.00 ? 51 VAL A N    10 
ATOM 10827 C CA   . VAL A 1 51 ? 2.622   5.466   2.046   1.00 0.00 ? 51 VAL A CA   10 
ATOM 10828 C C    . VAL A 1 51 ? 3.985   6.158   2.174   1.00 0.00 ? 51 VAL A C    10 
ATOM 10829 O O    . VAL A 1 51 ? 4.394   6.892   1.278   1.00 0.00 ? 51 VAL A O    10 
ATOM 10830 C CB   . VAL A 1 51 ? 1.632   5.977   3.118   1.00 0.00 ? 51 VAL A CB   10 
ATOM 10831 C CG1  . VAL A 1 51 ? 1.361   7.470   2.982   1.00 0.00 ? 51 VAL A CG1  10 
ATOM 10832 C CG2  . VAL A 1 51 ? 0.246   5.328   3.117   1.00 0.00 ? 51 VAL A CG2  10 
ATOM 10833 H H    . VAL A 1 51 ? 2.370   3.564   2.976   1.00 0.00 ? 51 VAL A H    10 
ATOM 10834 H HA   . VAL A 1 51 ? 2.222   5.666   1.053   1.00 0.00 ? 51 VAL A HA   10 
ATOM 10835 H HB   . VAL A 1 51 ? 2.064   5.810   4.102   1.00 0.00 ? 51 VAL A HB   10 
ATOM 10836 H HG11 . VAL A 1 51 ? 1.014   7.686   1.972   1.00 0.00 ? 51 VAL A HG11 10 
ATOM 10837 H HG12 . VAL A 1 51 ? 0.606   7.758   3.714   1.00 0.00 ? 51 VAL A HG12 10 
ATOM 10838 H HG13 . VAL A 1 51 ? 2.276   8.016   3.186   1.00 0.00 ? 51 VAL A HG13 10 
ATOM 10839 H HG21 . VAL A 1 51 ? -0.130  5.388   4.140   1.00 0.00 ? 51 VAL A HG21 10 
ATOM 10840 H HG22 . VAL A 1 51 ? -0.423  5.840   2.425   1.00 0.00 ? 51 VAL A HG22 10 
ATOM 10841 H HG23 . VAL A 1 51 ? 0.302   4.286   2.838   1.00 0.00 ? 51 VAL A HG23 10 
ATOM 10842 N N    . LYS A 1 52 ? 4.675   5.933   3.293   1.00 0.00 ? 52 LYS A N    10 
ATOM 10843 C CA   . LYS A 1 52 ? 5.917   6.598   3.697   1.00 0.00 ? 52 LYS A CA   10 
ATOM 10844 C C    . LYS A 1 52 ? 7.041   6.355   2.709   1.00 0.00 ? 52 LYS A C    10 
ATOM 10845 O O    . LYS A 1 52 ? 7.862   7.236   2.474   1.00 0.00 ? 52 LYS A O    10 
ATOM 10846 C CB   . LYS A 1 52 ? 6.273   6.099   5.102   1.00 0.00 ? 52 LYS A CB   10 
ATOM 10847 C CG   . LYS A 1 52 ? 5.263   6.679   6.103   1.00 0.00 ? 52 LYS A CG   10 
ATOM 10848 C CD   . LYS A 1 52 ? 5.121   5.816   7.361   1.00 0.00 ? 52 LYS A CD   10 
ATOM 10849 C CE   . LYS A 1 52 ? 5.341   6.655   8.620   1.00 0.00 ? 52 LYS A CE   10 
ATOM 10850 N NZ   . LYS A 1 52 ? 5.807   5.876   9.772   1.00 0.00 ? 52 LYS A NZ   10 
ATOM 10851 H H    . LYS A 1 52 ? 4.271   5.282   3.963   1.00 0.00 ? 52 LYS A H    10 
ATOM 10852 H HA   . LYS A 1 52 ? 5.772   7.672   3.745   1.00 0.00 ? 52 LYS A HA   10 
ATOM 10853 H HB2  . LYS A 1 52 ? 6.238   5.012   5.114   1.00 0.00 ? 52 LYS A HB2  10 
ATOM 10854 H HB3  . LYS A 1 52 ? 7.279   6.402   5.383   1.00 0.00 ? 52 LYS A HB3  10 
ATOM 10855 H HG2  . LYS A 1 52 ? 5.556   7.698   6.350   1.00 0.00 ? 52 LYS A HG2  10 
ATOM 10856 H HG3  . LYS A 1 52 ? 4.283   6.728   5.631   1.00 0.00 ? 52 LYS A HG3  10 
ATOM 10857 H HD2  . LYS A 1 52 ? 4.101   5.423   7.361   1.00 0.00 ? 52 LYS A HD2  10 
ATOM 10858 H HD3  . LYS A 1 52 ? 5.822   4.984   7.328   1.00 0.00 ? 52 LYS A HD3  10 
ATOM 10859 H HE2  . LYS A 1 52 ? 6.058   7.444   8.410   1.00 0.00 ? 52 LYS A HE2  10 
ATOM 10860 H HE3  . LYS A 1 52 ? 4.383   7.084   8.906   1.00 0.00 ? 52 LYS A HE3  10 
ATOM 10861 H HZ1  . LYS A 1 52 ? 6.067   6.518   10.516  1.00 0.00 ? 52 LYS A HZ1  10 
ATOM 10862 H HZ2  . LYS A 1 52 ? 5.029   5.311   10.099  1.00 0.00 ? 52 LYS A HZ2  10 
ATOM 10863 H HZ3  . LYS A 1 52 ? 6.589   5.279   9.524   1.00 0.00 ? 52 LYS A HZ3  10 
ATOM 10864 N N    . GLU A 1 53 ? 7.048   5.180   2.100   1.00 0.00 ? 53 GLU A N    10 
ATOM 10865 C CA   . GLU A 1 53 ? 7.925   4.789   1.037   1.00 0.00 ? 53 GLU A CA   10 
ATOM 10866 C C    . GLU A 1 53 ? 7.678   5.715   -0.139  1.00 0.00 ? 53 GLU A C    10 
ATOM 10867 O O    . GLU A 1 53 ? 8.548   6.500   -0.526  1.00 0.00 ? 53 GLU A O    10 
ATOM 10868 C CB   . GLU A 1 53 ? 7.677   3.322   0.706   1.00 0.00 ? 53 GLU A CB   10 
ATOM 10869 C CG   . GLU A 1 53 ? 8.418   2.290   1.559   1.00 0.00 ? 53 GLU A CG   10 
ATOM 10870 C CD   . GLU A 1 53 ? 9.935   2.430   1.729   1.00 0.00 ? 53 GLU A CD   10 
ATOM 10871 O OE1  . GLU A 1 53 ? 10.417  3.313   2.478   1.00 0.00 ? 53 GLU A OE1  10 
ATOM 10872 O OE2  . GLU A 1 53 ? 10.677  1.548   1.226   1.00 0.00 ? 53 GLU A OE2  10 
ATOM 10873 H H    . GLU A 1 53 ? 6.328   4.519   2.349   1.00 0.00 ? 53 GLU A H    10 
ATOM 10874 H HA   . GLU A 1 53 ? 8.947   4.894   1.330   1.00 0.00 ? 53 GLU A HA   10 
ATOM 10875 H HB2  . GLU A 1 53 ? 6.614   3.107   0.770   1.00 0.00 ? 53 GLU A HB2  10 
ATOM 10876 H HB3  . GLU A 1 53 ? 7.932   3.171   -0.315  1.00 0.00 ? 53 GLU A HB3  10 
ATOM 10877 H HG2  . GLU A 1 53 ? 7.986   2.313   2.545   1.00 0.00 ? 53 GLU A HG2  10 
ATOM 10878 H HG3  . GLU A 1 53 ? 8.206   1.319   1.114   1.00 0.00 ? 53 GLU A HG3  10 
ATOM 10879 N N    . ARG A 1 54 ? 6.486   5.616   -0.725  1.00 0.00 ? 54 ARG A N    10 
ATOM 10880 C CA   . ARG A 1 54 ? 6.201   6.287   -1.982  1.00 0.00 ? 54 ARG A CA   10 
ATOM 10881 C C    . ARG A 1 54 ? 6.066   7.802   -1.819  1.00 0.00 ? 54 ARG A C    10 
ATOM 10882 O O    . ARG A 1 54 ? 6.072   8.517   -2.821  1.00 0.00 ? 54 ARG A O    10 
ATOM 10883 C CB   . ARG A 1 54 ? 5.003   5.620   -2.666  1.00 0.00 ? 54 ARG A CB   10 
ATOM 10884 C CG   . ARG A 1 54 ? 5.354   4.168   -3.048  1.00 0.00 ? 54 ARG A CG   10 
ATOM 10885 C CD   . ARG A 1 54 ? 5.001   3.834   -4.500  1.00 0.00 ? 54 ARG A CD   10 
ATOM 10886 N NE   . ARG A 1 54 ? 5.888   2.792   -5.036  1.00 0.00 ? 54 ARG A NE   10 
ATOM 10887 C CZ   . ARG A 1 54 ? 5.674   2.068   -6.137  1.00 0.00 ? 54 ARG A CZ   10 
ATOM 10888 N NH1  . ARG A 1 54 ? 4.507   2.081   -6.773  1.00 0.00 ? 54 ARG A NH1  10 
ATOM 10889 N NH2  . ARG A 1 54 ? 6.657   1.314   -6.609  1.00 0.00 ? 54 ARG A NH2  10 
ATOM 10890 H H    . ARG A 1 54 ? 5.771   5.027   -0.303  1.00 0.00 ? 54 ARG A H    10 
ATOM 10891 H HA   . ARG A 1 54 ? 7.078   6.126   -2.614  1.00 0.00 ? 54 ARG A HA   10 
ATOM 10892 H HB2  . ARG A 1 54 ? 4.131   5.630   -2.010  1.00 0.00 ? 54 ARG A HB2  10 
ATOM 10893 H HB3  . ARG A 1 54 ? 4.773   6.192   -3.562  1.00 0.00 ? 54 ARG A HB3  10 
ATOM 10894 H HG2  . ARG A 1 54 ? 6.423   4.007   -2.925  1.00 0.00 ? 54 ARG A HG2  10 
ATOM 10895 H HG3  . ARG A 1 54 ? 4.843   3.478   -2.376  1.00 0.00 ? 54 ARG A HG3  10 
ATOM 10896 H HD2  . ARG A 1 54 ? 3.966   3.509   -4.547  1.00 0.00 ? 54 ARG A HD2  10 
ATOM 10897 H HD3  . ARG A 1 54 ? 5.116   4.724   -5.117  1.00 0.00 ? 54 ARG A HD3  10 
ATOM 10898 H HE   . ARG A 1 54 ? 6.794   2.720   -4.592  1.00 0.00 ? 54 ARG A HE   10 
ATOM 10899 H HH11 . ARG A 1 54 ? 3.674   2.543   -6.387  1.00 0.00 ? 54 ARG A HH11 10 
ATOM 10900 H HH12 . ARG A 1 54 ? 4.381   1.555   -7.628  1.00 0.00 ? 54 ARG A HH12 10 
ATOM 10901 H HH21 . ARG A 1 54 ? 7.579   1.317   -6.180  1.00 0.00 ? 54 ARG A HH21 10 
ATOM 10902 H HH22 . ARG A 1 54 ? 6.507   0.789   -7.471  1.00 0.00 ? 54 ARG A HH22 10 
ATOM 10903 N N    . LEU A 1 55 ? 5.970   8.308   -0.589  1.00 0.00 ? 55 LEU A N    10 
ATOM 10904 C CA   . LEU A 1 55 ? 6.140   9.720   -0.262  1.00 0.00 ? 55 LEU A CA   10 
ATOM 10905 C C    . LEU A 1 55 ? 7.530   10.222  -0.649  1.00 0.00 ? 55 LEU A C    10 
ATOM 10906 O O    . LEU A 1 55 ? 7.658   11.411  -0.946  1.00 0.00 ? 55 LEU A O    10 
ATOM 10907 C CB   . LEU A 1 55 ? 5.903   9.950   1.241   1.00 0.00 ? 55 LEU A CB   10 
ATOM 10908 C CG   . LEU A 1 55 ? 4.437   10.276  1.569   1.00 0.00 ? 55 LEU A CG   10 
ATOM 10909 C CD1  . LEU A 1 55 ? 4.198   10.081  3.062   1.00 0.00 ? 55 LEU A CD1  10 
ATOM 10910 C CD2  . LEU A 1 55 ? 4.056   11.709  1.173   1.00 0.00 ? 55 LEU A CD2  10 
ATOM 10911 H H    . LEU A 1 55 ? 5.859   7.657   0.181   1.00 0.00 ? 55 LEU A H    10 
ATOM 10912 H HA   . LEU A 1 55 ? 5.418   10.295  -0.839  1.00 0.00 ? 55 LEU A HA   10 
ATOM 10913 H HB2  . LEU A 1 55 ? 6.208   9.059   1.785   1.00 0.00 ? 55 LEU A HB2  10 
ATOM 10914 H HB3  . LEU A 1 55 ? 6.540   10.761  1.600   1.00 0.00 ? 55 LEU A HB3  10 
ATOM 10915 H HG   . LEU A 1 55 ? 3.781   9.586   1.043   1.00 0.00 ? 55 LEU A HG   10 
ATOM 10916 H HD11 . LEU A 1 55 ? 4.910   10.672  3.637   1.00 0.00 ? 55 LEU A HD11 10 
ATOM 10917 H HD12 . LEU A 1 55 ? 3.182   10.379  3.309   1.00 0.00 ? 55 LEU A HD12 10 
ATOM 10918 H HD13 . LEU A 1 55 ? 4.321   9.027   3.305   1.00 0.00 ? 55 LEU A HD13 10 
ATOM 10919 H HD21 . LEU A 1 55 ? 4.186   11.857  0.102   1.00 0.00 ? 55 LEU A HD21 10 
ATOM 10920 H HD22 . LEU A 1 55 ? 3.012   11.893  1.424   1.00 0.00 ? 55 LEU A HD22 10 
ATOM 10921 H HD23 . LEU A 1 55 ? 4.681   12.425  1.708   1.00 0.00 ? 55 LEU A HD23 10 
ATOM 10922 N N    . GLY A 1 56 ? 8.541   9.349   -0.726  1.00 0.00 ? 56 GLY A N    10 
ATOM 10923 C CA   . GLY A 1 56 ? 9.891   9.729   -1.103  1.00 0.00 ? 56 GLY A CA   10 
ATOM 10924 C C    . GLY A 1 56 ? 10.995  9.426   -0.095  1.00 0.00 ? 56 GLY A C    10 
ATOM 10925 O O    . GLY A 1 56 ? 12.047  10.063  -0.180  1.00 0.00 ? 56 GLY A O    10 
ATOM 10926 H H    . GLY A 1 56 ? 8.379   8.381   -0.466  1.00 0.00 ? 56 GLY A H    10 
ATOM 10927 H HA2  . GLY A 1 56 ? 10.127  9.173   -2.006  1.00 0.00 ? 56 GLY A HA2  10 
ATOM 10928 H HA3  . GLY A 1 56 ? 9.936   10.790  -1.348  1.00 0.00 ? 56 GLY A HA3  10 
ATOM 10929 N N    . THR A 1 57 ? 10.854  8.451   0.803   1.00 0.00 ? 57 THR A N    10 
ATOM 10930 C CA   . THR A 1 57 ? 12.042  7.790   1.369   1.00 0.00 ? 57 THR A CA   10 
ATOM 10931 C C    . THR A 1 57 ? 12.766  6.924   0.317   1.00 0.00 ? 57 THR A C    10 
ATOM 10932 O O    . THR A 1 57 ? 13.842  6.388   0.581   1.00 0.00 ? 57 THR A O    10 
ATOM 10933 C CB   . THR A 1 57 ? 11.632  6.938   2.573   1.00 0.00 ? 57 THR A CB   10 
ATOM 10934 O OG1  . THR A 1 57 ? 10.641  6.047   2.161   1.00 0.00 ? 57 THR A OG1  10 
ATOM 10935 C CG2  . THR A 1 57 ? 11.062  7.789   3.715   1.00 0.00 ? 57 THR A CG2  10 
ATOM 10936 H H    . THR A 1 57 ? 9.981   7.946   0.929   1.00 0.00 ? 57 THR A H    10 
ATOM 10937 H HA   . THR A 1 57 ? 12.753  8.541   1.715   1.00 0.00 ? 57 THR A HA   10 
ATOM 10938 H HB   . THR A 1 57 ? 12.480  6.355   2.918   1.00 0.00 ? 57 THR A HB   10 
ATOM 10939 H HG1  . THR A 1 57 ? 10.920  5.129   2.345   1.00 0.00 ? 57 THR A HG1  10 
ATOM 10940 H HG21 . THR A 1 57 ? 10.839  7.160   4.574   1.00 0.00 ? 57 THR A HG21 10 
ATOM 10941 H HG22 . THR A 1 57 ? 11.799  8.524   4.021   1.00 0.00 ? 57 THR A HG22 10 
ATOM 10942 H HG23 . THR A 1 57 ? 10.150  8.306   3.403   1.00 0.00 ? 57 THR A HG23 10 
ATOM 10943 N N    . LEU A 1 58 ? 12.180  6.753   -0.875  1.00 0.00 ? 58 LEU A N    10 
ATOM 10944 C CA   . LEU A 1 58 ? 12.717  5.977   -1.990  1.00 0.00 ? 58 LEU A CA   10 
ATOM 10945 C C    . LEU A 1 58 ? 13.723  6.842   -2.770  1.00 0.00 ? 58 LEU A C    10 
ATOM 10946 O O    . LEU A 1 58 ? 14.691  7.320   -2.175  1.00 0.00 ? 58 LEU A O    10 
ATOM 10947 C CB   . LEU A 1 58 ? 11.546  5.448   -2.840  1.00 0.00 ? 58 LEU A CB   10 
ATOM 10948 C CG   . LEU A 1 58 ? 10.598  4.512   -2.065  1.00 0.00 ? 58 LEU A CG   10 
ATOM 10949 C CD1  . LEU A 1 58 ? 9.306   4.322   -2.855  1.00 0.00 ? 58 LEU A CD1  10 
ATOM 10950 C CD2  . LEU A 1 58 ? 11.166  3.122   -1.820  1.00 0.00 ? 58 LEU A CD2  10 
ATOM 10951 H H    . LEU A 1 58 ? 11.262  7.154   -0.988  1.00 0.00 ? 58 LEU A H    10 
ATOM 10952 H HA   . LEU A 1 58 ? 13.263  5.120   -1.595  1.00 0.00 ? 58 LEU A HA   10 
ATOM 10953 H HB2  . LEU A 1 58 ? 10.975  6.308   -3.197  1.00 0.00 ? 58 LEU A HB2  10 
ATOM 10954 H HB3  . LEU A 1 58 ? 11.936  4.909   -3.705  1.00 0.00 ? 58 LEU A HB3  10 
ATOM 10955 H HG   . LEU A 1 58 ? 10.366  4.940   -1.092  1.00 0.00 ? 58 LEU A HG   10 
ATOM 10956 H HD11 . LEU A 1 58 ? 9.508   3.831   -3.804  1.00 0.00 ? 58 LEU A HD11 10 
ATOM 10957 H HD12 . LEU A 1 58 ? 8.606   3.734   -2.258  1.00 0.00 ? 58 LEU A HD12 10 
ATOM 10958 H HD13 . LEU A 1 58 ? 8.880   5.299   -3.060  1.00 0.00 ? 58 LEU A HD13 10 
ATOM 10959 H HD21 . LEU A 1 58 ? 11.437  2.660   -2.767  1.00 0.00 ? 58 LEU A HD21 10 
ATOM 10960 H HD22 . LEU A 1 58 ? 12.036  3.188   -1.169  1.00 0.00 ? 58 LEU A HD22 10 
ATOM 10961 H HD23 . LEU A 1 58 ? 10.401  2.525   -1.324  1.00 0.00 ? 58 LEU A HD23 10 
ATOM 10962 N N    . LYS A 1 59 ? 13.529  7.045   -4.083  1.00 0.00 ? 59 LYS A N    10 
ATOM 10963 C CA   . LYS A 1 59 ? 14.479  7.720   -4.979  1.00 0.00 ? 59 LYS A CA   10 
ATOM 10964 C C    . LYS A 1 59 ? 13.779  8.794   -5.805  1.00 0.00 ? 59 LYS A C    10 
ATOM 10965 O O    . LYS A 1 59 ? 12.569  8.703   -6.029  1.00 0.00 ? 59 LYS A O    10 
ATOM 10966 C CB   . LYS A 1 59 ? 15.133  6.694   -5.909  1.00 0.00 ? 59 LYS A CB   10 
ATOM 10967 C CG   . LYS A 1 59 ? 16.109  5.811   -5.127  1.00 0.00 ? 59 LYS A CG   10 
ATOM 10968 C CD   . LYS A 1 59 ? 16.546  4.597   -5.934  1.00 0.00 ? 59 LYS A CD   10 
ATOM 10969 C CE   . LYS A 1 59 ? 17.388  4.892   -7.182  1.00 0.00 ? 59 LYS A CE   10 
ATOM 10970 N NZ   . LYS A 1 59 ? 18.761  5.333   -6.866  1.00 0.00 ? 59 LYS A NZ   10 
ATOM 10971 H H    . LYS A 1 59 ? 12.679  6.690   -4.504  1.00 0.00 ? 59 LYS A H    10 
ATOM 10972 H HA   . LYS A 1 59 ? 15.278  8.164   -4.389  1.00 0.00 ? 59 LYS A HA   10 
ATOM 10973 H HB2  . LYS A 1 59 ? 14.358  6.084   -6.375  1.00 0.00 ? 59 LYS A HB2  10 
ATOM 10974 H HB3  . LYS A 1 59 ? 15.688  7.213   -6.690  1.00 0.00 ? 59 LYS A HB3  10 
ATOM 10975 H HG2  . LYS A 1 59 ? 16.975  6.393   -4.819  1.00 0.00 ? 59 LYS A HG2  10 
ATOM 10976 H HG3  . LYS A 1 59 ? 15.610  5.431   -4.237  1.00 0.00 ? 59 LYS A HG3  10 
ATOM 10977 H HD2  . LYS A 1 59 ? 17.094  3.932   -5.270  1.00 0.00 ? 59 LYS A HD2  10 
ATOM 10978 H HD3  . LYS A 1 59 ? 15.636  4.089   -6.246  1.00 0.00 ? 59 LYS A HD3  10 
ATOM 10979 H HE2  . LYS A 1 59 ? 17.452  3.973   -7.768  1.00 0.00 ? 59 LYS A HE2  10 
ATOM 10980 H HE3  . LYS A 1 59 ? 16.892  5.643   -7.799  1.00 0.00 ? 59 LYS A HE3  10 
ATOM 10981 H HZ1  . LYS A 1 59 ? 18.780  6.275   -6.487  1.00 0.00 ? 59 LYS A HZ1  10 
ATOM 10982 H HZ2  . LYS A 1 59 ? 19.193  4.718   -6.181  1.00 0.00 ? 59 LYS A HZ2  10 
ATOM 10983 H HZ3  . LYS A 1 59 ? 19.316  5.319   -7.719  1.00 0.00 ? 59 LYS A HZ3  10 
ATOM 10984 N N    . ASN A 1 60 ? 14.543  9.751   -6.337  1.00 0.00 ? 60 ASN A N    10 
ATOM 10985 C CA   . ASN A 1 60 ? 14.072  10.877  -7.152  1.00 0.00 ? 60 ASN A CA   10 
ATOM 10986 C C    . ASN A 1 60 ? 12.811  11.554  -6.579  1.00 0.00 ? 60 ASN A C    10 
ATOM 10987 O O    . ASN A 1 60 ? 11.747  11.452  -7.191  1.00 0.00 ? 60 ASN A O    10 
ATOM 10988 C CB   . ASN A 1 60 ? 13.889  10.416  -8.610  1.00 0.00 ? 60 ASN A CB   10 
ATOM 10989 C CG   . ASN A 1 60 ? 13.639  11.584  -9.562  1.00 0.00 ? 60 ASN A CG   10 
ATOM 10990 O OD1  . ASN A 1 60 ? 14.325  12.605  -9.489  1.00 0.00 ? 60 ASN A OD1  10 
ATOM 10991 N ND2  . ASN A 1 60 ? 12.721  11.468  -10.506 1.00 0.00 ? 60 ASN A ND2  10 
ATOM 10992 H H    . ASN A 1 60 ? 15.530  9.733   -6.126  1.00 0.00 ? 60 ASN A H    10 
ATOM 10993 H HA   . ASN A 1 60 ? 14.863  11.623  -7.158  1.00 0.00 ? 60 ASN A HA   10 
ATOM 10994 H HB2  . ASN A 1 60 ? 14.799  9.911   -8.922  1.00 0.00 ? 60 ASN A HB2  10 
ATOM 10995 H HB3  . ASN A 1 60 ? 13.064  9.704   -8.669  1.00 0.00 ? 60 ASN A HB3  10 
ATOM 10996 H HD21 . ASN A 1 60 ? 12.167  10.614  -10.584 1.00 0.00 ? 60 ASN A HD21 10 
ATOM 10997 H HD22 . ASN A 1 60 ? 12.587  12.195  -11.192 1.00 0.00 ? 60 ASN A HD22 10 
ATOM 10998 N N    . PRO A 1 61 ? 12.882  12.203  -5.403  1.00 0.00 ? 61 PRO A N    10 
ATOM 10999 C CA   . PRO A 1 61 ? 11.723  12.788  -4.738  1.00 0.00 ? 61 PRO A CA   10 
ATOM 11000 C C    . PRO A 1 61 ? 11.278  14.084  -5.430  1.00 0.00 ? 61 PRO A C    10 
ATOM 11001 O O    . PRO A 1 61 ? 12.019  15.071  -5.380  1.00 0.00 ? 61 PRO A O    10 
ATOM 11002 C CB   . PRO A 1 61 ? 12.156  13.057  -3.290  1.00 0.00 ? 61 PRO A CB   10 
ATOM 11003 C CG   . PRO A 1 61 ? 13.678  13.183  -3.365  1.00 0.00 ? 61 PRO A CG   10 
ATOM 11004 C CD   . PRO A 1 61 ? 14.071  12.341  -4.577  1.00 0.00 ? 61 PRO A CD   10 
ATOM 11005 H HA   . PRO A 1 61 ? 10.910  12.066  -4.724  1.00 0.00 ? 61 PRO A HA   10 
ATOM 11006 H HB2  . PRO A 1 61 ? 11.701  13.962  -2.884  1.00 0.00 ? 61 PRO A HB2  10 
ATOM 11007 H HB3  . PRO A 1 61 ? 11.885  12.209  -2.664  1.00 0.00 ? 61 PRO A HB3  10 
ATOM 11008 H HG2  . PRO A 1 61 ? 13.955  14.223  -3.536  1.00 0.00 ? 61 PRO A HG2  10 
ATOM 11009 H HG3  . PRO A 1 61 ? 14.153  12.807  -2.459  1.00 0.00 ? 61 PRO A HG3  10 
ATOM 11010 H HD2  . PRO A 1 61 ? 14.882  12.824  -5.119  1.00 0.00 ? 61 PRO A HD2  10 
ATOM 11011 H HD3  . PRO A 1 61 ? 14.387  11.356  -4.249  1.00 0.00 ? 61 PRO A HD3  10 
ATOM 11012 N N    . PRO A 1 62 ? 10.068  14.151  -6.018  1.00 0.00 ? 62 PRO A N    10 
ATOM 11013 C CA   . PRO A 1 62 ? 9.499   15.422  -6.445  1.00 0.00 ? 62 PRO A CA   10 
ATOM 11014 C C    . PRO A 1 62 ? 8.923   16.208  -5.262  1.00 0.00 ? 62 PRO A C    10 
ATOM 11015 O O    . PRO A 1 62 ? 8.771   17.423  -5.358  1.00 0.00 ? 62 PRO A O    10 
ATOM 11016 C CB   . PRO A 1 62 ? 8.395   15.041  -7.429  1.00 0.00 ? 62 PRO A CB   10 
ATOM 11017 C CG   . PRO A 1 62 ? 7.879   13.712  -6.883  1.00 0.00 ? 62 PRO A CG   10 
ATOM 11018 C CD   . PRO A 1 62 ? 9.137   13.063  -6.304  1.00 0.00 ? 62 PRO A CD   10 
ATOM 11019 H HA   . PRO A 1 62 ? 10.248  16.034  -6.949  1.00 0.00 ? 62 PRO A HA   10 
ATOM 11020 H HB2  . PRO A 1 62 ? 7.613   15.796  -7.491  1.00 0.00 ? 62 PRO A HB2  10 
ATOM 11021 H HB3  . PRO A 1 62 ? 8.833   14.879  -8.410  1.00 0.00 ? 62 PRO A HB3  10 
ATOM 11022 H HG2  . PRO A 1 62 ? 7.149   13.888  -6.091  1.00 0.00 ? 62 PRO A HG2  10 
ATOM 11023 H HG3  . PRO A 1 62 ? 7.447   13.102  -7.675  1.00 0.00 ? 62 PRO A HG3  10 
ATOM 11024 H HD2  . PRO A 1 62 ? 8.889   12.495  -5.406  1.00 0.00 ? 62 PRO A HD2  10 
ATOM 11025 H HD3  . PRO A 1 62 ? 9.563   12.407  -7.059  1.00 0.00 ? 62 PRO A HD3  10 
ATOM 11026 N N    . LYS A 1 63 ? 8.558   15.536  -4.157  1.00 0.00 ? 63 LYS A N    10 
ATOM 11027 C CA   . LYS A 1 63 ? 7.876   16.103  -2.983  1.00 0.00 ? 63 LYS A CA   10 
ATOM 11028 C C    . LYS A 1 63 ? 6.543   16.799  -3.320  1.00 0.00 ? 63 LYS A C    10 
ATOM 11029 O O    . LYS A 1 63 ? 5.965   17.516  -2.501  1.00 0.00 ? 63 LYS A O    10 
ATOM 11030 C CB   . LYS A 1 63 ? 8.874   17.004  -2.231  1.00 0.00 ? 63 LYS A CB   10 
ATOM 11031 C CG   . LYS A 1 63 ? 8.626   17.025  -0.717  1.00 0.00 ? 63 LYS A CG   10 
ATOM 11032 C CD   . LYS A 1 63 ? 9.816   17.643  0.022   1.00 0.00 ? 63 LYS A CD   10 
ATOM 11033 C CE   . LYS A 1 63 ? 10.025  19.137  -0.266  1.00 0.00 ? 63 LYS A CE   10 
ATOM 11034 N NZ   . LYS A 1 63 ? 9.112   20.007  0.495   1.00 0.00 ? 63 LYS A NZ   10 
ATOM 11035 H H    . LYS A 1 63 ? 8.741   14.544  -4.151  1.00 0.00 ? 63 LYS A H    10 
ATOM 11036 H HA   . LYS A 1 63 ? 7.634   15.263  -2.328  1.00 0.00 ? 63 LYS A HA   10 
ATOM 11037 H HB2  . LYS A 1 63 ? 9.883   16.619  -2.394  1.00 0.00 ? 63 LYS A HB2  10 
ATOM 11038 H HB3  . LYS A 1 63 ? 8.831   18.017  -2.634  1.00 0.00 ? 63 LYS A HB3  10 
ATOM 11039 H HG2  . LYS A 1 63 ? 7.713   17.568  -0.479  1.00 0.00 ? 63 LYS A HG2  10 
ATOM 11040 H HG3  . LYS A 1 63 ? 8.513   16.002  -0.368  1.00 0.00 ? 63 LYS A HG3  10 
ATOM 11041 H HD2  . LYS A 1 63 ? 9.685   17.483  1.091   1.00 0.00 ? 63 LYS A HD2  10 
ATOM 11042 H HD3  . LYS A 1 63 ? 10.722  17.110  -0.273  1.00 0.00 ? 63 LYS A HD3  10 
ATOM 11043 H HE2  . LYS A 1 63 ? 11.037  19.397  0.042   1.00 0.00 ? 63 LYS A HE2  10 
ATOM 11044 H HE3  . LYS A 1 63 ? 9.941   19.338  -1.335  1.00 0.00 ? 63 LYS A HE3  10 
ATOM 11045 H HZ1  . LYS A 1 63 ? 9.472   20.959  0.463   1.00 0.00 ? 63 LYS A HZ1  10 
ATOM 11046 H HZ2  . LYS A 1 63 ? 8.163   20.015  0.137   1.00 0.00 ? 63 LYS A HZ2  10 
ATOM 11047 H HZ3  . LYS A 1 63 ? 9.148   19.756  1.481   1.00 0.00 ? 63 LYS A HZ3  10 
ATOM 11048 N N    . LYS A 1 64 ? 6.042   16.607  -4.539  1.00 0.00 ? 64 LYS A N    10 
ATOM 11049 C CA   . LYS A 1 64 ? 4.872   17.262  -5.100  1.00 0.00 ? 64 LYS A CA   10 
ATOM 11050 C C    . LYS A 1 64 ? 3.603   16.591  -4.599  1.00 0.00 ? 64 LYS A C    10 
ATOM 11051 O O    . LYS A 1 64 ? 3.152   15.609  -5.199  1.00 0.00 ? 64 LYS A O    10 
ATOM 11052 C CB   . LYS A 1 64 ? 4.986   17.203  -6.630  1.00 0.00 ? 64 LYS A CB   10 
ATOM 11053 C CG   . LYS A 1 64 ? 5.915   18.307  -7.156  1.00 0.00 ? 64 LYS A CG   10 
ATOM 11054 C CD   . LYS A 1 64 ? 5.150   19.588  -7.507  1.00 0.00 ? 64 LYS A CD   10 
ATOM 11055 C CE   . LYS A 1 64 ? 4.749   19.685  -8.988  1.00 0.00 ? 64 LYS A CE   10 
ATOM 11056 N NZ   . LYS A 1 64 ? 3.779   18.654  -9.406  1.00 0.00 ? 64 LYS A NZ   10 
ATOM 11057 H H    . LYS A 1 64 ? 6.583   16.037  -5.165  1.00 0.00 ? 64 LYS A H    10 
ATOM 11058 H HA   . LYS A 1 64 ? 4.860   18.307  -4.787  1.00 0.00 ? 64 LYS A HA   10 
ATOM 11059 H HB2  . LYS A 1 64 ? 5.384   16.231  -6.921  1.00 0.00 ? 64 LYS A HB2  10 
ATOM 11060 H HB3  . LYS A 1 64 ? 3.999   17.305  -7.078  1.00 0.00 ? 64 LYS A HB3  10 
ATOM 11061 H HG2  . LYS A 1 64 ? 6.660   18.548  -6.398  1.00 0.00 ? 64 LYS A HG2  10 
ATOM 11062 H HG3  . LYS A 1 64 ? 6.455   17.951  -8.028  1.00 0.00 ? 64 LYS A HG3  10 
ATOM 11063 H HD2  . LYS A 1 64 ? 4.269   19.693  -6.874  1.00 0.00 ? 64 LYS A HD2  10 
ATOM 11064 H HD3  . LYS A 1 64 ? 5.810   20.427  -7.286  1.00 0.00 ? 64 LYS A HD3  10 
ATOM 11065 H HE2  . LYS A 1 64 ? 4.308   20.668  -9.160  1.00 0.00 ? 64 LYS A HE2  10 
ATOM 11066 H HE3  . LYS A 1 64 ? 5.649   19.608  -9.603  1.00 0.00 ? 64 LYS A HE3  10 
ATOM 11067 H HZ1  . LYS A 1 64 ? 3.435   18.845  -10.340 1.00 0.00 ? 64 LYS A HZ1  10 
ATOM 11068 H HZ2  . LYS A 1 64 ? 4.197   17.729  -9.404  1.00 0.00 ? 64 LYS A HZ2  10 
ATOM 11069 H HZ3  . LYS A 1 64 ? 2.972   18.639  -8.787  1.00 0.00 ? 64 LYS A HZ3  10 
ATOM 11070 N N    . LYS A 1 65 ? 3.016   17.136  -3.533  1.00 0.00 ? 65 LYS A N    10 
ATOM 11071 C CA   . LYS A 1 65 ? 1.651   16.810  -3.127  1.00 0.00 ? 65 LYS A CA   10 
ATOM 11072 C C    . LYS A 1 65 ? 0.656   17.127  -4.246  1.00 0.00 ? 65 LYS A C    10 
ATOM 11073 O O    . LYS A 1 65 ? 0.975   17.869  -5.182  1.00 0.00 ? 65 LYS A O    10 
ATOM 11074 C CB   . LYS A 1 65 ? 1.282   17.505  -1.801  1.00 0.00 ? 65 LYS A CB   10 
ATOM 11075 C CG   . LYS A 1 65 ? 1.091   19.036  -1.804  1.00 0.00 ? 65 LYS A CG   10 
ATOM 11076 C CD   . LYS A 1 65 ? 2.367   19.857  -2.061  1.00 0.00 ? 65 LYS A CD   10 
ATOM 11077 C CE   . LYS A 1 65 ? 2.311   21.259  -1.428  1.00 0.00 ? 65 LYS A CE   10 
ATOM 11078 N NZ   . LYS A 1 65 ? 2.401   21.235  0.051   1.00 0.00 ? 65 LYS A NZ   10 
ATOM 11079 H H    . LYS A 1 65 ? 3.504   17.876  -3.050  1.00 0.00 ? 65 LYS A H    10 
ATOM 11080 H HA   . LYS A 1 65 ? 1.617   15.733  -2.953  1.00 0.00 ? 65 LYS A HA   10 
ATOM 11081 H HB2  . LYS A 1 65 ? 0.341   17.068  -1.467  1.00 0.00 ? 65 LYS A HB2  10 
ATOM 11082 H HB3  . LYS A 1 65 ? 2.027   17.248  -1.047  1.00 0.00 ? 65 LYS A HB3  10 
ATOM 11083 H HG2  . LYS A 1 65 ? 0.328   19.314  -2.530  1.00 0.00 ? 65 LYS A HG2  10 
ATOM 11084 H HG3  . LYS A 1 65 ? 0.705   19.304  -0.823  1.00 0.00 ? 65 LYS A HG3  10 
ATOM 11085 H HD2  . LYS A 1 65 ? 3.235   19.329  -1.669  1.00 0.00 ? 65 LYS A HD2  10 
ATOM 11086 H HD3  . LYS A 1 65 ? 2.495   19.968  -3.139  1.00 0.00 ? 65 LYS A HD3  10 
ATOM 11087 H HE2  . LYS A 1 65 ? 3.151   21.846  -1.807  1.00 0.00 ? 65 LYS A HE2  10 
ATOM 11088 H HE3  . LYS A 1 65 ? 1.389   21.760  -1.731  1.00 0.00 ? 65 LYS A HE3  10 
ATOM 11089 H HZ1  . LYS A 1 65 ? 1.587   20.805  0.484   1.00 0.00 ? 65 LYS A HZ1  10 
ATOM 11090 H HZ2  . LYS A 1 65 ? 3.235   20.737  0.357   1.00 0.00 ? 65 LYS A HZ2  10 
ATOM 11091 H HZ3  . LYS A 1 65 ? 2.466   22.179  0.416   1.00 0.00 ? 65 LYS A HZ3  10 
ATOM 11092 N N    . MET A 1 66 ? -0.553  16.586  -4.150  1.00 0.00 ? 66 MET A N    10 
ATOM 11093 C CA   . MET A 1 66 ? -1.648  16.788  -5.093  1.00 0.00 ? 66 MET A CA   10 
ATOM 11094 C C    . MET A 1 66 ? -2.778  17.503  -4.357  1.00 0.00 ? 66 MET A C    10 
ATOM 11095 O O    . MET A 1 66 ? -2.895  17.380  -3.135  1.00 0.00 ? 66 MET A O    10 
ATOM 11096 C CB   . MET A 1 66 ? -2.102  15.405  -5.588  1.00 0.00 ? 66 MET A CB   10 
ATOM 11097 C CG   . MET A 1 66 ? -3.112  15.409  -6.734  1.00 0.00 ? 66 MET A CG   10 
ATOM 11098 S SD   . MET A 1 66 ? -3.543  13.729  -7.249  1.00 0.00 ? 66 MET A SD   10 
ATOM 11099 C CE   . MET A 1 66 ? -4.731  14.104  -8.558  1.00 0.00 ? 66 MET A CE   10 
ATOM 11100 H H    . MET A 1 66 ? -0.785  16.012  -3.344  1.00 0.00 ? 66 MET A H    10 
ATOM 11101 H HA   . MET A 1 66 ? -1.319  17.387  -5.943  1.00 0.00 ? 66 MET A HA   10 
ATOM 11102 H HB2  . MET A 1 66 ? -1.232  14.844  -5.920  1.00 0.00 ? 66 MET A HB2  10 
ATOM 11103 H HB3  . MET A 1 66 ? -2.548  14.865  -4.756  1.00 0.00 ? 66 MET A HB3  10 
ATOM 11104 H HG2  . MET A 1 66 ? -4.024  15.914  -6.420  1.00 0.00 ? 66 MET A HG2  10 
ATOM 11105 H HG3  . MET A 1 66 ? -2.690  15.938  -7.585  1.00 0.00 ? 66 MET A HG3  10 
ATOM 11106 H HE1  . MET A 1 66 ? -4.224  14.582  -9.397  1.00 0.00 ? 66 MET A HE1  10 
ATOM 11107 H HE2  . MET A 1 66 ? -5.198  13.181  -8.898  1.00 0.00 ? 66 MET A HE2  10 
ATOM 11108 H HE3  . MET A 1 66 ? -5.499  14.764  -8.165  1.00 0.00 ? 66 MET A HE3  10 
ATOM 11109 N N    . LYS A 1 67 ? -3.658  18.189  -5.089  1.00 0.00 ? 67 LYS A N    10 
ATOM 11110 C CA   . LYS A 1 67 ? -5.012  18.481  -4.637  1.00 0.00 ? 67 LYS A CA   10 
ATOM 11111 C C    . LYS A 1 67 ? -5.950  18.366  -5.843  1.00 0.00 ? 67 LYS A C    10 
ATOM 11112 O O    . LYS A 1 67 ? -5.473  18.236  -6.979  1.00 0.00 ? 67 LYS A O    10 
ATOM 11113 C CB   . LYS A 1 67 ? -5.052  19.834  -3.894  1.00 0.00 ? 67 LYS A CB   10 
ATOM 11114 C CG   . LYS A 1 67 ? -6.362  20.003  -3.107  1.00 0.00 ? 67 LYS A CG   10 
ATOM 11115 C CD   . LYS A 1 67 ? -6.263  20.988  -1.936  1.00 0.00 ? 67 LYS A CD   10 
ATOM 11116 C CE   . LYS A 1 67 ? -7.401  20.723  -0.943  1.00 0.00 ? 67 LYS A CE   10 
ATOM 11117 N NZ   . LYS A 1 67 ? -7.138  19.558  -0.068  1.00 0.00 ? 67 LYS A NZ   10 
ATOM 11118 H H    . LYS A 1 67 ? -3.543  18.273  -6.092  1.00 0.00 ? 67 LYS A H    10 
ATOM 11119 H HA   . LYS A 1 67 ? -5.292  17.700  -3.934  1.00 0.00 ? 67 LYS A HA   10 
ATOM 11120 H HB2  . LYS A 1 67 ? -4.223  19.852  -3.184  1.00 0.00 ? 67 LYS A HB2  10 
ATOM 11121 H HB3  . LYS A 1 67 ? -4.916  20.661  -4.589  1.00 0.00 ? 67 LYS A HB3  10 
ATOM 11122 H HG2  . LYS A 1 67 ? -7.149  20.341  -3.780  1.00 0.00 ? 67 LYS A HG2  10 
ATOM 11123 H HG3  . LYS A 1 67 ? -6.653  19.033  -2.709  1.00 0.00 ? 67 LYS A HG3  10 
ATOM 11124 H HD2  . LYS A 1 67 ? -5.304  20.891  -1.424  1.00 0.00 ? 67 LYS A HD2  10 
ATOM 11125 H HD3  . LYS A 1 67 ? -6.356  22.004  -2.320  1.00 0.00 ? 67 LYS A HD3  10 
ATOM 11126 H HE2  . LYS A 1 67 ? -7.539  21.602  -0.314  1.00 0.00 ? 67 LYS A HE2  10 
ATOM 11127 H HE3  . LYS A 1 67 ? -8.334  20.570  -1.494  1.00 0.00 ? 67 LYS A HE3  10 
ATOM 11128 H HZ1  . LYS A 1 67 ? -6.909  18.728  -0.597  1.00 0.00 ? 67 LYS A HZ1  10 
ATOM 11129 H HZ2  . LYS A 1 67 ? -6.360  19.749  0.558   1.00 0.00 ? 67 LYS A HZ2  10 
ATOM 11130 H HZ3  . LYS A 1 67 ? -7.968  19.367  0.488   1.00 0.00 ? 67 LYS A HZ3  10 
ATOM 11131 N N    . LEU A 1 68 ? -7.262  18.376  -5.606  1.00 0.00 ? 68 LEU A N    10 
ATOM 11132 C CA   . LEU A 1 68 ? -8.307  18.349  -6.625  1.00 0.00 ? 68 LEU A CA   10 
ATOM 11133 C C    . LEU A 1 68 ? -9.330  19.435  -6.290  1.00 0.00 ? 68 LEU A C    10 
ATOM 11134 O O    . LEU A 1 68 ? -10.527 19.169  -6.185  1.00 0.00 ? 68 LEU A O    10 
ATOM 11135 C CB   . LEU A 1 68 ? -8.936  16.942  -6.737  1.00 0.00 ? 68 LEU A CB   10 
ATOM 11136 C CG   . LEU A 1 68 ? -8.046  15.906  -7.447  1.00 0.00 ? 68 LEU A CG   10 
ATOM 11137 C CD1  . LEU A 1 68 ? -8.631  14.502  -7.273  1.00 0.00 ? 68 LEU A CD1  10 
ATOM 11138 C CD2  . LEU A 1 68 ? -7.912  16.204  -8.949  1.00 0.00 ? 68 LEU A CD2  10 
ATOM 11139 H H    . LEU A 1 68 ? -7.582  18.467  -4.652  1.00 0.00 ? 68 LEU A H    10 
ATOM 11140 H HA   . LEU A 1 68 ? -7.869  18.618  -7.582  1.00 0.00 ? 68 LEU A HA   10 
ATOM 11141 H HB2  . LEU A 1 68 ? -9.186  16.590  -5.735  1.00 0.00 ? 68 LEU A HB2  10 
ATOM 11142 H HB3  . LEU A 1 68 ? -9.868  17.011  -7.301  1.00 0.00 ? 68 LEU A HB3  10 
ATOM 11143 H HG   . LEU A 1 68 ? -7.056  15.916  -6.994  1.00 0.00 ? 68 LEU A HG   10 
ATOM 11144 H HD11 . LEU A 1 68 ? -7.991  13.768  -7.762  1.00 0.00 ? 68 LEU A HD11 10 
ATOM 11145 H HD12 . LEU A 1 68 ? -8.700  14.260  -6.214  1.00 0.00 ? 68 LEU A HD12 10 
ATOM 11146 H HD13 . LEU A 1 68 ? -9.627  14.451  -7.716  1.00 0.00 ? 68 LEU A HD13 10 
ATOM 11147 H HD21 . LEU A 1 68 ? -8.899  16.219  -9.409  1.00 0.00 ? 68 LEU A HD21 10 
ATOM 11148 H HD22 . LEU A 1 68 ? -7.462  17.178  -9.109  1.00 0.00 ? 68 LEU A HD22 10 
ATOM 11149 H HD23 . LEU A 1 68 ? -7.321  15.432  -9.441  1.00 0.00 ? 68 LEU A HD23 10 
ATOM 11150 N N    . MET A 1 69 ? -8.859  20.672  -6.117  1.00 0.00 ? 69 MET A N    10 
ATOM 11151 C CA   . MET A 1 69 ? -9.636  21.815  -5.631  1.00 0.00 ? 69 MET A CA   10 
ATOM 11152 C C    . MET A 1 69 ? -10.165 21.591  -4.204  1.00 0.00 ? 69 MET A C    10 
ATOM 11153 O O    . MET A 1 69 ? -9.865  20.580  -3.561  1.00 0.00 ? 69 MET A O    10 
ATOM 11154 C CB   . MET A 1 69 ? -10.766 22.210  -6.605  1.00 0.00 ? 69 MET A CB   10 
ATOM 11155 C CG   . MET A 1 69 ? -10.357 22.243  -8.079  1.00 0.00 ? 69 MET A CG   10 
ATOM 11156 S SD   . MET A 1 69 ? -11.643 22.869  -9.191  1.00 0.00 ? 69 MET A SD   10 
ATOM 11157 C CE   . MET A 1 69 ? -11.553 24.638  -8.812  1.00 0.00 ? 69 MET A CE   10 
ATOM 11158 H H    . MET A 1 69 ? -7.867  20.820  -6.273  1.00 0.00 ? 69 MET A H    10 
ATOM 11159 H HA   . MET A 1 69 ? -8.951  22.660  -5.589  1.00 0.00 ? 69 MET A HA   10 
ATOM 11160 H HB2  . MET A 1 69 ? -11.602 21.518  -6.497  1.00 0.00 ? 69 MET A HB2  10 
ATOM 11161 H HB3  . MET A 1 69 ? -11.119 23.202  -6.329  1.00 0.00 ? 69 MET A HB3  10 
ATOM 11162 H HG2  . MET A 1 69 ? -9.464  22.856  -8.194  1.00 0.00 ? 69 MET A HG2  10 
ATOM 11163 H HG3  . MET A 1 69 ? -10.114 21.229  -8.388  1.00 0.00 ? 69 MET A HG3  10 
ATOM 11164 H HE1  . MET A 1 69 ? -10.525 24.982  -8.915  1.00 0.00 ? 69 MET A HE1  10 
ATOM 11165 H HE2  . MET A 1 69 ? -12.185 25.188  -9.506  1.00 0.00 ? 69 MET A HE2  10 
ATOM 11166 H HE3  . MET A 1 69 ? -11.895 24.822  -7.797  1.00 0.00 ? 69 MET A HE3  10 
ATOM 11167 N N    . ARG A 1 70 ? -10.947 22.565  -3.718  1.00 0.00 ? 70 ARG A N    10 
ATOM 11168 C CA   . ARG A 1 70 ? -11.452 22.701  -2.353  1.00 0.00 ? 70 ARG A CA   10 
ATOM 11169 C C    . ARG A 1 70 ? -10.348 22.401  -1.353  1.00 0.00 ? 70 ARG A C    10 
ATOM 11170 O O    . ARG A 1 70 ? -9.403  23.220  -1.327  1.00 0.00 ? 70 ARG A O    10 
ATOM 11171 C CB   . ARG A 1 70 ? -12.742 21.888  -2.139  1.00 0.00 ? 70 ARG A CB   10 
ATOM 11172 C CG   . ARG A 1 70 ? -13.885 22.339  -3.067  1.00 0.00 ? 70 ARG A CG   10 
ATOM 11173 C CD   . ARG A 1 70 ? -15.178 21.539  -2.869  1.00 0.00 ? 70 ARG A CD   10 
ATOM 11174 N NE   . ARG A 1 70 ? -15.682 21.661  -1.491  1.00 0.00 ? 70 ARG A NE   10 
ATOM 11175 C CZ   . ARG A 1 70 ? -16.901 22.036  -1.095  1.00 0.00 ? 70 ARG A CZ   10 
ATOM 11176 N NH1  . ARG A 1 70 ? -17.919 22.147  -1.946  1.00 0.00 ? 70 ARG A NH1  10 
ATOM 11177 N NH2  . ARG A 1 70 ? -17.087 22.312  0.189   1.00 0.00 ? 70 ARG A NH2  10 
ATOM 11178 H H    . ARG A 1 70 ? -11.104 23.361  -4.318  1.00 0.00 ? 70 ARG A H    10 
ATOM 11179 H HA   . ARG A 1 70 ? -11.714 23.746  -2.204  1.00 0.00 ? 70 ARG A HA   10 
ATOM 11180 H HB2  . ARG A 1 70 ? -12.535 20.833  -2.300  1.00 0.00 ? 70 ARG A HB2  10 
ATOM 11181 H HB3  . ARG A 1 70 ? -13.051 22.017  -1.101  1.00 0.00 ? 70 ARG A HB3  10 
ATOM 11182 H HG2  . ARG A 1 70 ? -14.095 23.395  -2.891  1.00 0.00 ? 70 ARG A HG2  10 
ATOM 11183 H HG3  . ARG A 1 70 ? -13.577 22.219  -4.106  1.00 0.00 ? 70 ARG A HG3  10 
ATOM 11184 H HD2  . ARG A 1 70 ? -15.918 21.918  -3.575  1.00 0.00 ? 70 ARG A HD2  10 
ATOM 11185 H HD3  . ARG A 1 70 ? -14.994 20.490  -3.096  1.00 0.00 ? 70 ARG A HD3  10 
ATOM 11186 H HE   . ARG A 1 70 ? -15.001 21.436  -0.766  1.00 0.00 ? 70 ARG A HE   10 
ATOM 11187 H HH11 . ARG A 1 70 ? -17.847 21.839  -2.918  1.00 0.00 ? 70 ARG A HH11 10 
ATOM 11188 H HH12 . ARG A 1 70 ? -18.824 22.497  -1.641  1.00 0.00 ? 70 ARG A HH12 10 
ATOM 11189 H HH21 . ARG A 1 70 ? -16.308 22.257  0.838   1.00 0.00 ? 70 ARG A HH21 10 
ATOM 11190 H HH22 . ARG A 1 70 ? -17.993 22.561  0.570   1.00 0.00 ? 70 ARG A HH22 10 
ATOM 11191 N N    . GLY A 1 1  ? -11.144 -7.079  10.069  1.00 0.00 ? 1  GLY A N    11 
ATOM 11192 C CA   . GLY A 1 1  ? -9.969  -6.883  9.203   1.00 0.00 ? 1  GLY A CA   11 
ATOM 11193 C C    . GLY A 1 1  ? -8.743  -7.564  9.792   1.00 0.00 ? 1  GLY A C    11 
ATOM 11194 O O    . GLY A 1 1  ? -8.882  -8.609  10.421  1.00 0.00 ? 1  GLY A O    11 
ATOM 11195 H H1   . GLY A 1 1  ? -11.381 -8.033  10.251  1.00 0.00 ? 1  GLY A H1   11 
ATOM 11196 H HA2  . GLY A 1 1  ? -10.168 -7.315  8.223   1.00 0.00 ? 1  GLY A HA2  11 
ATOM 11197 H HA3  . GLY A 1 1  ? -9.780  -5.816  9.092   1.00 0.00 ? 1  GLY A HA3  11 
ATOM 11198 N N    . SER A 1 2  ? -7.551  -6.991  9.596   1.00 0.00 ? 2  SER A N    11 
ATOM 11199 C CA   . SER A 1 2  ? -6.239  -7.582  9.847   1.00 0.00 ? 2  SER A CA   11 
ATOM 11200 C C    . SER A 1 2  ? -6.164  -8.357  11.164  1.00 0.00 ? 2  SER A C    11 
ATOM 11201 O O    . SER A 1 2  ? -6.011  -7.746  12.222  1.00 0.00 ? 2  SER A O    11 
ATOM 11202 C CB   . SER A 1 2  ? -5.188  -6.468  9.765   1.00 0.00 ? 2  SER A CB   11 
ATOM 11203 O OG   . SER A 1 2  ? -3.864  -6.965  9.790   1.00 0.00 ? 2  SER A OG   11 
ATOM 11204 H H    . SER A 1 2  ? -7.531  -6.121  9.080   1.00 0.00 ? 2  SER A H    11 
ATOM 11205 H HA   . SER A 1 2  ? -6.033  -8.275  9.040   1.00 0.00 ? 2  SER A HA   11 
ATOM 11206 H HB2  . SER A 1 2  ? -5.325  -5.920  8.833   1.00 0.00 ? 2  SER A HB2  11 
ATOM 11207 H HB3  . SER A 1 2  ? -5.328  -5.778  10.597  1.00 0.00 ? 2  SER A HB3  11 
ATOM 11208 H HG   . SER A 1 2  ? -3.734  -7.451  10.615  1.00 0.00 ? 2  SER A HG   11 
ATOM 11209 N N    . SER A 1 3  ? -6.214  -9.687  11.092  1.00 0.00 ? 3  SER A N    11 
ATOM 11210 C CA   . SER A 1 3  ? -5.879  -10.578 12.196  1.00 0.00 ? 3  SER A CA   11 
ATOM 11211 C C    . SER A 1 3  ? -4.548  -11.270 11.886  1.00 0.00 ? 3  SER A C    11 
ATOM 11212 O O    . SER A 1 3  ? -3.944  -11.003 10.844  1.00 0.00 ? 3  SER A O    11 
ATOM 11213 C CB   . SER A 1 3  ? -7.038  -11.551 12.458  1.00 0.00 ? 3  SER A CB   11 
ATOM 11214 O OG   . SER A 1 3  ? -7.305  -12.389 11.350  1.00 0.00 ? 3  SER A OG   11 
ATOM 11215 H H    . SER A 1 3  ? -6.252  -10.118 10.179  1.00 0.00 ? 3  SER A H    11 
ATOM 11216 H HA   . SER A 1 3  ? -5.738  -9.996  13.106  1.00 0.00 ? 3  SER A HA   11 
ATOM 11217 H HB2  . SER A 1 3  ? -6.788  -12.178 13.313  1.00 0.00 ? 3  SER A HB2  11 
ATOM 11218 H HB3  . SER A 1 3  ? -7.938  -10.986 12.701  1.00 0.00 ? 3  SER A HB3  11 
ATOM 11219 H HG   . SER A 1 3  ? -7.792  -11.879 10.686  1.00 0.00 ? 3  SER A HG   11 
ATOM 11220 N N    . GLY A 1 4  ? -4.094  -12.144 12.786  1.00 0.00 ? 4  GLY A N    11 
ATOM 11221 C CA   . GLY A 1 4  ? -2.932  -12.997 12.612  1.00 0.00 ? 4  GLY A CA   11 
ATOM 11222 C C    . GLY A 1 4  ? -1.669  -12.177 12.391  1.00 0.00 ? 4  GLY A C    11 
ATOM 11223 O O    . GLY A 1 4  ? -1.293  -11.948 11.241  1.00 0.00 ? 4  GLY A O    11 
ATOM 11224 H H    . GLY A 1 4  ? -4.620  -12.255 13.645  1.00 0.00 ? 4  GLY A H    11 
ATOM 11225 H HA2  . GLY A 1 4  ? -2.816  -13.621 13.496  1.00 0.00 ? 4  GLY A HA2  11 
ATOM 11226 H HA3  . GLY A 1 4  ? -3.093  -13.645 11.751  1.00 0.00 ? 4  GLY A HA3  11 
ATOM 11227 N N    . SER A 1 5  ? -1.027  -11.727 13.476  1.00 0.00 ? 5  SER A N    11 
ATOM 11228 C CA   . SER A 1 5  ? 0.190   -10.922 13.453  1.00 0.00 ? 5  SER A CA   11 
ATOM 11229 C C    . SER A 1 5  ? 1.167   -11.426 12.390  1.00 0.00 ? 5  SER A C    11 
ATOM 11230 O O    . SER A 1 5  ? 1.432   -10.706 11.425  1.00 0.00 ? 5  SER A O    11 
ATOM 11231 C CB   . SER A 1 5  ? 0.809   -10.825 14.850  1.00 0.00 ? 5  SER A CB   11 
ATOM 11232 O OG   . SER A 1 5  ? 1.933   -9.965  14.845  1.00 0.00 ? 5  SER A OG   11 
ATOM 11233 H H    . SER A 1 5  ? -1.458  -11.879 14.381  1.00 0.00 ? 5  SER A H    11 
ATOM 11234 H HA   . SER A 1 5  ? -0.116  -9.922  13.179  1.00 0.00 ? 5  SER A HA   11 
ATOM 11235 H HB2  . SER A 1 5  ? 0.066   -10.423 15.537  1.00 0.00 ? 5  SER A HB2  11 
ATOM 11236 H HB3  . SER A 1 5  ? 1.110   -11.815 15.194  1.00 0.00 ? 5  SER A HB3  11 
ATOM 11237 H HG   . SER A 1 5  ? 2.665   -10.450 15.277  1.00 0.00 ? 5  SER A HG   11 
ATOM 11238 N N    . SER A 1 6  ? 1.652   -12.661 12.528  1.00 0.00 ? 6  SER A N    11 
ATOM 11239 C CA   . SER A 1 6  ? 2.242   -13.419 11.439  1.00 0.00 ? 6  SER A CA   11 
ATOM 11240 C C    . SER A 1 6  ? 1.179   -14.396 10.940  1.00 0.00 ? 6  SER A C    11 
ATOM 11241 O O    . SER A 1 6  ? 0.789   -15.317 11.668  1.00 0.00 ? 6  SER A O    11 
ATOM 11242 C CB   . SER A 1 6  ? 3.496   -14.141 11.928  1.00 0.00 ? 6  SER A CB   11 
ATOM 11243 O OG   . SER A 1 6  ? 4.550   -13.229 12.179  1.00 0.00 ? 6  SER A OG   11 
ATOM 11244 H H    . SER A 1 6  ? 1.416   -13.189 13.358  1.00 0.00 ? 6  SER A H    11 
ATOM 11245 H HA   . SER A 1 6  ? 2.526   -12.756 10.625  1.00 0.00 ? 6  SER A HA   11 
ATOM 11246 H HB2  . SER A 1 6  ? 3.265   -14.679 12.844  1.00 0.00 ? 6  SER A HB2  11 
ATOM 11247 H HB3  . SER A 1 6  ? 3.818   -14.858 11.173  1.00 0.00 ? 6  SER A HB3  11 
ATOM 11248 H HG   . SER A 1 6  ? 4.195   -12.315 12.167  1.00 0.00 ? 6  SER A HG   11 
ATOM 11249 N N    . GLY A 1 7  ? 0.689   -14.194 9.720   1.00 0.00 ? 7  GLY A N    11 
ATOM 11250 C CA   . GLY A 1 7  ? -0.263  -15.061 9.041   1.00 0.00 ? 7  GLY A CA   11 
ATOM 11251 C C    . GLY A 1 7  ? 0.325   -15.581 7.735   1.00 0.00 ? 7  GLY A C    11 
ATOM 11252 O O    . GLY A 1 7  ? 1.430   -15.207 7.326   1.00 0.00 ? 7  GLY A O    11 
ATOM 11253 H H    . GLY A 1 7  ? 1.060   -13.417 9.182   1.00 0.00 ? 7  GLY A H    11 
ATOM 11254 H HA2  . GLY A 1 7  ? -0.533  -15.906 9.671   1.00 0.00 ? 7  GLY A HA2  11 
ATOM 11255 H HA3  . GLY A 1 7  ? -1.164  -14.491 8.819   1.00 0.00 ? 7  GLY A HA3  11 
ATOM 11256 N N    . ARG A 1 8  ? -0.402  -16.473 7.066   1.00 0.00 ? 8  ARG A N    11 
ATOM 11257 C CA   . ARG A 1 8  ? -0.201  -16.767 5.651   1.00 0.00 ? 8  ARG A CA   11 
ATOM 11258 C C    . ARG A 1 8  ? -1.094  -15.803 4.870   1.00 0.00 ? 8  ARG A C    11 
ATOM 11259 O O    . ARG A 1 8  ? -2.034  -15.234 5.431   1.00 0.00 ? 8  ARG A O    11 
ATOM 11260 C CB   . ARG A 1 8  ? -0.566  -18.231 5.337   1.00 0.00 ? 8  ARG A CB   11 
ATOM 11261 C CG   . ARG A 1 8  ? 0.414   -19.277 5.895   1.00 0.00 ? 8  ARG A CG   11 
ATOM 11262 C CD   . ARG A 1 8  ? 0.293   -19.523 7.407   1.00 0.00 ? 8  ARG A CD   11 
ATOM 11263 N NE   . ARG A 1 8  ? 1.268   -20.530 7.843   1.00 0.00 ? 8  ARG A NE   11 
ATOM 11264 C CZ   . ARG A 1 8  ? 1.983   -20.524 8.972   1.00 0.00 ? 8  ARG A CZ   11 
ATOM 11265 N NH1  . ARG A 1 8  ? 1.757   -19.648 9.944   1.00 0.00 ? 8  ARG A NH1  11 
ATOM 11266 N NH2  . ARG A 1 8  ? 2.953   -21.412 9.147   1.00 0.00 ? 8  ARG A NH2  11 
ATOM 11267 H H    . ARG A 1 8  ? -1.312  -16.721 7.443   1.00 0.00 ? 8  ARG A H    11 
ATOM 11268 H HA   . ARG A 1 8  ? 0.836   -16.586 5.367   1.00 0.00 ? 8  ARG A HA   11 
ATOM 11269 H HB2  . ARG A 1 8  ? -1.574  -18.446 5.694   1.00 0.00 ? 8  ARG A HB2  11 
ATOM 11270 H HB3  . ARG A 1 8  ? -0.568  -18.348 4.253   1.00 0.00 ? 8  ARG A HB3  11 
ATOM 11271 H HG2  . ARG A 1 8  ? 0.219   -20.221 5.384   1.00 0.00 ? 8  ARG A HG2  11 
ATOM 11272 H HG3  . ARG A 1 8  ? 1.434   -18.972 5.655   1.00 0.00 ? 8  ARG A HG3  11 
ATOM 11273 H HD2  . ARG A 1 8  ? 0.493   -18.599 7.943   1.00 0.00 ? 8  ARG A HD2  11 
ATOM 11274 H HD3  . ARG A 1 8  ? -0.715  -19.867 7.643   1.00 0.00 ? 8  ARG A HD3  11 
ATOM 11275 H HE   . ARG A 1 8  ? 1.461   -21.260 7.161   1.00 0.00 ? 8  ARG A HE   11 
ATOM 11276 H HH11 . ARG A 1 8  ? 0.975   -19.001 9.977   1.00 0.00 ? 8  ARG A HH11 11 
ATOM 11277 H HH12 . ARG A 1 8  ? 2.335   -19.706 10.784  1.00 0.00 ? 8  ARG A HH12 11 
ATOM 11278 H HH21 . ARG A 1 8  ? 3.193   -22.127 8.461   1.00 0.00 ? 8  ARG A HH21 11 
ATOM 11279 H HH22 . ARG A 1 8  ? 3.501   -21.386 10.007  1.00 0.00 ? 8  ARG A HH22 11 
ATOM 11280 N N    . GLY A 1 9  ? -0.857  -15.646 3.576   1.00 0.00 ? 9  GLY A N    11 
ATOM 11281 C CA   . GLY A 1 9  ? -1.730  -14.859 2.731   1.00 0.00 ? 9  GLY A CA   11 
ATOM 11282 C C    . GLY A 1 9  ? -1.394  -15.125 1.279   1.00 0.00 ? 9  GLY A C    11 
ATOM 11283 O O    . GLY A 1 9  ? -1.516  -16.256 0.819   1.00 0.00 ? 9  GLY A O    11 
ATOM 11284 H H    . GLY A 1 9  ? -0.100  -16.143 3.118   1.00 0.00 ? 9  GLY A H    11 
ATOM 11285 H HA2  . GLY A 1 9  ? -2.761  -15.159 2.915   1.00 0.00 ? 9  GLY A HA2  11 
ATOM 11286 H HA3  . GLY A 1 9  ? -1.615  -13.803 2.973   1.00 0.00 ? 9  GLY A HA3  11 
ATOM 11287 N N    . ARG A 1 10 ? -0.962  -14.095 0.549   1.00 0.00 ? 10 ARG A N    11 
ATOM 11288 C CA   . ARG A 1 10 ? -0.577  -14.079 -0.866  1.00 0.00 ? 10 ARG A CA   11 
ATOM 11289 C C    . ARG A 1 10 ? -1.695  -14.426 -1.857  1.00 0.00 ? 10 ARG A C    11 
ATOM 11290 O O    . ARG A 1 10 ? -1.599  -14.030 -3.018  1.00 0.00 ? 10 ARG A O    11 
ATOM 11291 C CB   . ARG A 1 10 ? 0.706   -14.911 -1.063  1.00 0.00 ? 10 ARG A CB   11 
ATOM 11292 C CG   . ARG A 1 10 ? 1.347   -14.692 -2.440  1.00 0.00 ? 10 ARG A CG   11 
ATOM 11293 C CD   . ARG A 1 10 ? 2.856   -14.946 -2.399  1.00 0.00 ? 10 ARG A CD   11 
ATOM 11294 N NE   . ARG A 1 10 ? 3.530   -14.301 -3.534  1.00 0.00 ? 10 ARG A NE   11 
ATOM 11295 C CZ   . ARG A 1 10 ? 4.843   -14.077 -3.627  1.00 0.00 ? 10 ARG A CZ   11 
ATOM 11296 N NH1  . ARG A 1 10 ? 5.690   -14.611 -2.754  1.00 0.00 ? 10 ARG A NH1  11 
ATOM 11297 N NH2  . ARG A 1 10 ? 5.310   -13.303 -4.599  1.00 0.00 ? 10 ARG A NH2  11 
ATOM 11298 H H    . ARG A 1 10 ? -0.837  -13.210 1.035   1.00 0.00 ? 10 ARG A H    11 
ATOM 11299 H HA   . ARG A 1 10 ? -0.302  -13.044 -1.070  1.00 0.00 ? 10 ARG A HA   11 
ATOM 11300 H HB2  . ARG A 1 10 ? 1.414   -14.597 -0.295  1.00 0.00 ? 10 ARG A HB2  11 
ATOM 11301 H HB3  . ARG A 1 10 ? 0.506   -15.976 -0.931  1.00 0.00 ? 10 ARG A HB3  11 
ATOM 11302 H HG2  . ARG A 1 10 ? 0.881   -15.367 -3.163  1.00 0.00 ? 10 ARG A HG2  11 
ATOM 11303 H HG3  . ARG A 1 10 ? 1.183   -13.658 -2.746  1.00 0.00 ? 10 ARG A HG3  11 
ATOM 11304 H HD2  . ARG A 1 10 ? 3.265   -14.524 -1.478  1.00 0.00 ? 10 ARG A HD2  11 
ATOM 11305 H HD3  . ARG A 1 10 ? 3.044   -16.019 -2.415  1.00 0.00 ? 10 ARG A HD3  11 
ATOM 11306 H HE   . ARG A 1 10 ? 2.910   -13.902 -4.235  1.00 0.00 ? 10 ARG A HE   11 
ATOM 11307 H HH11 . ARG A 1 10 ? 5.383   -15.262 -2.042  1.00 0.00 ? 10 ARG A HH11 11 
ATOM 11308 H HH12 . ARG A 1 10 ? 6.684   -14.404 -2.823  1.00 0.00 ? 10 ARG A HH12 11 
ATOM 11309 H HH21 . ARG A 1 10 ? 4.699   -12.866 -5.273  1.00 0.00 ? 10 ARG A HH21 11 
ATOM 11310 H HH22 . ARG A 1 10 ? 6.307   -13.111 -4.682  1.00 0.00 ? 10 ARG A HH22 11 
ATOM 11311 N N    . TYR A 1 11 ? -2.761  -15.090 -1.417  1.00 0.00 ? 11 TYR A N    11 
ATOM 11312 C CA   . TYR A 1 11 ? -3.819  -15.652 -2.251  1.00 0.00 ? 11 TYR A CA   11 
ATOM 11313 C C    . TYR A 1 11 ? -5.174  -14.967 -2.039  1.00 0.00 ? 11 TYR A C    11 
ATOM 11314 O O    . TYR A 1 11 ? -6.094  -15.194 -2.830  1.00 0.00 ? 11 TYR A O    11 
ATOM 11315 C CB   . TYR A 1 11 ? -3.893  -17.150 -1.943  1.00 0.00 ? 11 TYR A CB   11 
ATOM 11316 C CG   . TYR A 1 11 ? -2.843  -17.964 -2.666  1.00 0.00 ? 11 TYR A CG   11 
ATOM 11317 C CD1  . TYR A 1 11 ? -3.127  -18.458 -3.950  1.00 0.00 ? 11 TYR A CD1  11 
ATOM 11318 C CD2  . TYR A 1 11 ? -1.600  -18.245 -2.070  1.00 0.00 ? 11 TYR A CD2  11 
ATOM 11319 C CE1  . TYR A 1 11 ? -2.179  -19.231 -4.642  1.00 0.00 ? 11 TYR A CE1  11 
ATOM 11320 C CE2  . TYR A 1 11 ? -0.639  -19.002 -2.763  1.00 0.00 ? 11 TYR A CE2  11 
ATOM 11321 C CZ   . TYR A 1 11 ? -0.925  -19.505 -4.055  1.00 0.00 ? 11 TYR A CZ   11 
ATOM 11322 O OH   . TYR A 1 11 ? -0.027  -20.273 -4.735  1.00 0.00 ? 11 TYR A OH   11 
ATOM 11323 H H    . TYR A 1 11 ? -2.690  -15.473 -0.484  1.00 0.00 ? 11 TYR A H    11 
ATOM 11324 H HA   . TYR A 1 11 ? -3.570  -15.553 -3.309  1.00 0.00 ? 11 TYR A HA   11 
ATOM 11325 H HB2  . TYR A 1 11 ? -3.799  -17.302 -0.869  1.00 0.00 ? 11 TYR A HB2  11 
ATOM 11326 H HB3  . TYR A 1 11 ? -4.868  -17.532 -2.236  1.00 0.00 ? 11 TYR A HB3  11 
ATOM 11327 H HD1  . TYR A 1 11 ? -4.076  -18.223 -4.414  1.00 0.00 ? 11 TYR A HD1  11 
ATOM 11328 H HD2  . TYR A 1 11 ? -1.368  -17.879 -1.079  1.00 0.00 ? 11 TYR A HD2  11 
ATOM 11329 H HE1  . TYR A 1 11 ? -2.403  -19.597 -5.635  1.00 0.00 ? 11 TYR A HE1  11 
ATOM 11330 H HE2  . TYR A 1 11 ? 0.317   -19.176 -2.293  1.00 0.00 ? 11 TYR A HE2  11 
ATOM 11331 H HH   . TYR A 1 11 ? 0.820   -20.389 -4.276  1.00 0.00 ? 11 TYR A HH   11 
ATOM 11332 N N    . ARG A 1 12 ? -5.339  -14.141 -0.999  1.00 0.00 ? 12 ARG A N    11 
ATOM 11333 C CA   . ARG A 1 12 ? -6.545  -13.335 -0.800  1.00 0.00 ? 12 ARG A CA   11 
ATOM 11334 C C    . ARG A 1 12 ? -6.157  -11.992 -0.187  1.00 0.00 ? 12 ARG A C    11 
ATOM 11335 O O    . ARG A 1 12 ? -6.649  -11.614 0.878   1.00 0.00 ? 12 ARG A O    11 
ATOM 11336 C CB   . ARG A 1 12 ? -7.590  -14.122 0.026   1.00 0.00 ? 12 ARG A CB   11 
ATOM 11337 C CG   . ARG A 1 12 ? -9.012  -13.524 0.029   1.00 0.00 ? 12 ARG A CG   11 
ATOM 11338 C CD   . ARG A 1 12 ? -9.840  -13.885 -1.211  1.00 0.00 ? 12 ARG A CD   11 
ATOM 11339 N NE   . ARG A 1 12 ? -9.341  -13.250 -2.439  1.00 0.00 ? 12 ARG A NE   11 
ATOM 11340 C CZ   . ARG A 1 12 ? -9.504  -13.693 -3.688  1.00 0.00 ? 12 ARG A CZ   11 
ATOM 11341 N NH1  . ARG A 1 12 ? -10.328 -14.706 -3.941  1.00 0.00 ? 12 ARG A NH1  11 
ATOM 11342 N NH2  . ARG A 1 12 ? -8.826  -13.101 -4.664  1.00 0.00 ? 12 ARG A NH2  11 
ATOM 11343 H H    . ARG A 1 12 ? -4.573  -14.006 -0.356  1.00 0.00 ? 12 ARG A H    11 
ATOM 11344 H HA   . ARG A 1 12 ? -6.954  -13.132 -1.787  1.00 0.00 ? 12 ARG A HA   11 
ATOM 11345 H HB2  . ARG A 1 12 ? -7.651  -15.146 -0.343  1.00 0.00 ? 12 ARG A HB2  11 
ATOM 11346 H HB3  . ARG A 1 12 ? -7.246  -14.172 1.058   1.00 0.00 ? 12 ARG A HB3  11 
ATOM 11347 H HG2  . ARG A 1 12 ? -9.536  -13.932 0.896   1.00 0.00 ? 12 ARG A HG2  11 
ATOM 11348 H HG3  . ARG A 1 12 ? -8.981  -12.441 0.146   1.00 0.00 ? 12 ARG A HG3  11 
ATOM 11349 H HD2  . ARG A 1 12 ? -9.818  -14.968 -1.332  1.00 0.00 ? 12 ARG A HD2  11 
ATOM 11350 H HD3  . ARG A 1 12 ? -10.871 -13.566 -1.049  1.00 0.00 ? 12 ARG A HD3  11 
ATOM 11351 H HE   . ARG A 1 12 ? -8.814  -12.390 -2.313  1.00 0.00 ? 12 ARG A HE   11 
ATOM 11352 H HH11 . ARG A 1 12 ? -10.873 -15.118 -3.185  1.00 0.00 ? 12 ARG A HH11 11 
ATOM 11353 H HH12 . ARG A 1 12 ? -10.535 -15.060 -4.875  1.00 0.00 ? 12 ARG A HH12 11 
ATOM 11354 H HH21 . ARG A 1 12 ? -8.188  -12.341 -4.472  1.00 0.00 ? 12 ARG A HH21 11 
ATOM 11355 H HH22 . ARG A 1 12 ? -8.756  -13.525 -5.591  1.00 0.00 ? 12 ARG A HH22 11 
ATOM 11356 N N    . GLN A 1 13 ? -5.259  -11.267 -0.851  1.00 0.00 ? 13 GLN A N    11 
ATOM 11357 C CA   . GLN A 1 13 ? -4.832  -9.935  -0.449  1.00 0.00 ? 13 GLN A CA   11 
ATOM 11358 C C    . GLN A 1 13 ? -5.134  -8.923  -1.549  1.00 0.00 ? 13 GLN A C    11 
ATOM 11359 O O    . GLN A 1 13 ? -5.428  -9.290  -2.689  1.00 0.00 ? 13 GLN A O    11 
ATOM 11360 C CB   . GLN A 1 13 ? -3.334  -9.938  -0.071  1.00 0.00 ? 13 GLN A CB   11 
ATOM 11361 C CG   . GLN A 1 13 ? -3.114  -9.343  1.329   1.00 0.00 ? 13 GLN A CG   11 
ATOM 11362 C CD   . GLN A 1 13 ? -3.798  -10.168 2.415   1.00 0.00 ? 13 GLN A CD   11 
ATOM 11363 O OE1  . GLN A 1 13 ? -4.629  -9.667  3.173   1.00 0.00 ? 13 GLN A OE1  11 
ATOM 11364 N NE2  . GLN A 1 13 ? -3.454  -11.435 2.536   1.00 0.00 ? 13 GLN A NE2  11 
ATOM 11365 H H    . GLN A 1 13 ? -4.933  -11.586 -1.761  1.00 0.00 ? 13 GLN A H    11 
ATOM 11366 H HA   . GLN A 1 13 ? -5.417  -9.638  0.419   1.00 0.00 ? 13 GLN A HA   11 
ATOM 11367 H HB2  . GLN A 1 13 ? -2.933  -10.953 -0.097  1.00 0.00 ? 13 GLN A HB2  11 
ATOM 11368 H HB3  . GLN A 1 13 ? -2.768  -9.348  -0.794  1.00 0.00 ? 13 GLN A HB3  11 
ATOM 11369 H HG2  . GLN A 1 13 ? -2.045  -9.290  1.535   1.00 0.00 ? 13 GLN A HG2  11 
ATOM 11370 H HG3  . GLN A 1 13 ? -3.511  -8.331  1.351   1.00 0.00 ? 13 GLN A HG3  11 
ATOM 11371 H HE21 . GLN A 1 13 ? -2.647  -11.750 2.009   1.00 0.00 ? 13 GLN A HE21 11 
ATOM 11372 H HE22 . GLN A 1 13 ? -3.888  -12.037 3.233   1.00 0.00 ? 13 GLN A HE22 11 
ATOM 11373 N N    . TYR A 1 14 ? -5.008  -7.646  -1.194  1.00 0.00 ? 14 TYR A N    11 
ATOM 11374 C CA   . TYR A 1 14 ? -5.064  -6.513  -2.100  1.00 0.00 ? 14 TYR A CA   11 
ATOM 11375 C C    . TYR A 1 14 ? -4.129  -6.766  -3.290  1.00 0.00 ? 14 TYR A C    11 
ATOM 11376 O O    . TYR A 1 14 ? -3.004  -7.261  -3.124  1.00 0.00 ? 14 TYR A O    11 
ATOM 11377 C CB   . TYR A 1 14 ? -4.707  -5.223  -1.336  1.00 0.00 ? 14 TYR A CB   11 
ATOM 11378 C CG   . TYR A 1 14 ? -3.313  -5.223  -0.721  1.00 0.00 ? 14 TYR A CG   11 
ATOM 11379 C CD1  . TYR A 1 14 ? -2.216  -4.794  -1.488  1.00 0.00 ? 14 TYR A CD1  11 
ATOM 11380 C CD2  . TYR A 1 14 ? -3.098  -5.701  0.586   1.00 0.00 ? 14 TYR A CD2  11 
ATOM 11381 C CE1  . TYR A 1 14 ? -0.905  -4.903  -0.998  1.00 0.00 ? 14 TYR A CE1  11 
ATOM 11382 C CE2  . TYR A 1 14 ? -1.787  -5.823  1.087   1.00 0.00 ? 14 TYR A CE2  11 
ATOM 11383 C CZ   . TYR A 1 14 ? -0.682  -5.438  0.291   1.00 0.00 ? 14 TYR A CZ   11 
ATOM 11384 O OH   . TYR A 1 14 ? 0.585   -5.645  0.750   1.00 0.00 ? 14 TYR A OH   11 
ATOM 11385 H H    . TYR A 1 14 ? -4.852  -7.434  -0.219  1.00 0.00 ? 14 TYR A H    11 
ATOM 11386 H HA   . TYR A 1 14 ? -6.088  -6.417  -2.458  1.00 0.00 ? 14 TYR A HA   11 
ATOM 11387 H HB2  . TYR A 1 14 ? -4.793  -4.387  -2.031  1.00 0.00 ? 14 TYR A HB2  11 
ATOM 11388 H HB3  . TYR A 1 14 ? -5.444  -5.061  -0.547  1.00 0.00 ? 14 TYR A HB3  11 
ATOM 11389 H HD1  . TYR A 1 14 ? -2.372  -4.382  -2.474  1.00 0.00 ? 14 TYR A HD1  11 
ATOM 11390 H HD2  . TYR A 1 14 ? -3.941  -5.992  1.197   1.00 0.00 ? 14 TYR A HD2  11 
ATOM 11391 H HE1  . TYR A 1 14 ? -0.099  -4.570  -1.641  1.00 0.00 ? 14 TYR A HE1  11 
ATOM 11392 H HE2  . TYR A 1 14 ? -1.628  -6.218  2.077   1.00 0.00 ? 14 TYR A HE2  11 
ATOM 11393 H HH   . TYR A 1 14 ? 1.261   -5.216  0.194   1.00 0.00 ? 14 TYR A HH   11 
ATOM 11394 N N    . ASN A 1 15 ? -4.598  -6.472  -4.500  1.00 0.00 ? 15 ASN A N    11 
ATOM 11395 C CA   . ASN A 1 15 ? -3.772  -6.491  -5.706  1.00 0.00 ? 15 ASN A CA   11 
ATOM 11396 C C    . ASN A 1 15 ? -2.666  -5.447  -5.568  1.00 0.00 ? 15 ASN A C    11 
ATOM 11397 O O    . ASN A 1 15 ? -2.827  -4.476  -4.829  1.00 0.00 ? 15 ASN A O    11 
ATOM 11398 C CB   . ASN A 1 15 ? -4.617  -6.195  -6.955  1.00 0.00 ? 15 ASN A CB   11 
ATOM 11399 C CG   . ASN A 1 15 ? -5.674  -7.258  -7.226  1.00 0.00 ? 15 ASN A CG   11 
ATOM 11400 O OD1  . ASN A 1 15 ? -5.531  -8.412  -6.828  1.00 0.00 ? 15 ASN A OD1  11 
ATOM 11401 N ND2  . ASN A 1 15 ? -6.737  -6.909  -7.929  1.00 0.00 ? 15 ASN A ND2  11 
ATOM 11402 H H    . ASN A 1 15 ? -5.582  -6.224  -4.571  1.00 0.00 ? 15 ASN A H    11 
ATOM 11403 H HA   . ASN A 1 15 ? -3.322  -7.481  -5.812  1.00 0.00 ? 15 ASN A HA   11 
ATOM 11404 H HB2  . ASN A 1 15 ? -5.095  -5.222  -6.846  1.00 0.00 ? 15 ASN A HB2  11 
ATOM 11405 H HB3  . ASN A 1 15 ? -3.954  -6.151  -7.818  1.00 0.00 ? 15 ASN A HB3  11 
ATOM 11406 H HD21 . ASN A 1 15 ? -6.834  -5.973  -8.323  1.00 0.00 ? 15 ASN A HD21 11 
ATOM 11407 H HD22 . ASN A 1 15 ? -7.479  -7.593  -8.068  1.00 0.00 ? 15 ASN A HD22 11 
ATOM 11408 N N    . SER A 1 16 ? -1.571  -5.589  -6.316  1.00 0.00 ? 16 SER A N    11 
ATOM 11409 C CA   . SER A 1 16 ? -0.491  -4.604  -6.311  1.00 0.00 ? 16 SER A CA   11 
ATOM 11410 C C    . SER A 1 16 ? -0.992  -3.193  -6.609  1.00 0.00 ? 16 SER A C    11 
ATOM 11411 O O    . SER A 1 16 ? -0.497  -2.217  -6.055  1.00 0.00 ? 16 SER A O    11 
ATOM 11412 C CB   . SER A 1 16 ? 0.548   -5.001  -7.356  1.00 0.00 ? 16 SER A CB   11 
ATOM 11413 O OG   . SER A 1 16 ? -0.038  -5.390  -8.586  1.00 0.00 ? 16 SER A OG   11 
ATOM 11414 H H    . SER A 1 16 ? -1.478  -6.339  -6.987  1.00 0.00 ? 16 SER A H    11 
ATOM 11415 H HA   . SER A 1 16 ? -0.028  -4.596  -5.325  1.00 0.00 ? 16 SER A HA   11 
ATOM 11416 H HB2  . SER A 1 16 ? 1.220   -4.157  -7.515  1.00 0.00 ? 16 SER A HB2  11 
ATOM 11417 H HB3  . SER A 1 16 ? 1.113   -5.847  -6.975  1.00 0.00 ? 16 SER A HB3  11 
ATOM 11418 H HG   . SER A 1 16 ? -0.030  -4.605  -9.189  1.00 0.00 ? 16 SER A HG   11 
ATOM 11419 N N    . GLU A 1 17 ? -1.977  -3.116  -7.495  1.00 0.00 ? 17 GLU A N    11 
ATOM 11420 C CA   . GLU A 1 17 ? -2.512  -1.882  -8.021  1.00 0.00 ? 17 GLU A CA   11 
ATOM 11421 C C    . GLU A 1 17 ? -3.469  -1.253  -7.002  1.00 0.00 ? 17 GLU A C    11 
ATOM 11422 O O    . GLU A 1 17 ? -3.490  -0.034  -6.886  1.00 0.00 ? 17 GLU A O    11 
ATOM 11423 C CB   . GLU A 1 17 ? -3.189  -2.190  -9.365  1.00 0.00 ? 17 GLU A CB   11 
ATOM 11424 C CG   . GLU A 1 17 ? -2.364  -3.090  -10.306 1.00 0.00 ? 17 GLU A CG   11 
ATOM 11425 C CD   . GLU A 1 17 ? -0.938  -2.584  -10.510 1.00 0.00 ? 17 GLU A CD   11 
ATOM 11426 O OE1  . GLU A 1 17 ? -0.757  -1.452  -10.985 1.00 0.00 ? 17 GLU A OE1  11 
ATOM 11427 O OE2  . GLU A 1 17 ? 0.019   -3.340  -10.172 1.00 0.00 ? 17 GLU A OE2  11 
ATOM 11428 H H    . GLU A 1 17 ? -2.273  -3.978  -7.927  1.00 0.00 ? 17 GLU A H    11 
ATOM 11429 H HA   . GLU A 1 17 ? -1.692  -1.181  -8.195  1.00 0.00 ? 17 GLU A HA   11 
ATOM 11430 H HB2  . GLU A 1 17 ? -4.118  -2.713  -9.159  1.00 0.00 ? 17 GLU A HB2  11 
ATOM 11431 H HB3  . GLU A 1 17 ? -3.420  -1.254  -9.871  1.00 0.00 ? 17 GLU A HB3  11 
ATOM 11432 H HG2  . GLU A 1 17 ? -2.321  -4.096  -9.884  1.00 0.00 ? 17 GLU A HG2  11 
ATOM 11433 H HG3  . GLU A 1 17 ? -2.867  -3.146  -11.273 1.00 0.00 ? 17 GLU A HG3  11 
ATOM 11434 N N    . ILE A 1 18 ? -4.192  -2.062  -6.212  1.00 0.00 ? 18 ILE A N    11 
ATOM 11435 C CA   . ILE A 1 18 ? -5.052  -1.605  -5.112  1.00 0.00 ? 18 ILE A CA   11 
ATOM 11436 C C    . ILE A 1 18 ? -4.206  -0.910  -4.048  1.00 0.00 ? 18 ILE A C    11 
ATOM 11437 O O    . ILE A 1 18 ? -4.673  0.000   -3.366  1.00 0.00 ? 18 ILE A O    11 
ATOM 11438 C CB   . ILE A 1 18 ? -5.804  -2.811  -4.497  1.00 0.00 ? 18 ILE A CB   11 
ATOM 11439 C CG1  . ILE A 1 18 ? -6.874  -3.353  -5.470  1.00 0.00 ? 18 ILE A CG1  11 
ATOM 11440 C CG2  . ILE A 1 18 ? -6.413  -2.525  -3.110  1.00 0.00 ? 18 ILE A CG2  11 
ATOM 11441 C CD1  . ILE A 1 18 ? -8.282  -2.781  -5.263  1.00 0.00 ? 18 ILE A CD1  11 
ATOM 11442 H H    . ILE A 1 18 ? -4.041  -3.055  -6.294  1.00 0.00 ? 18 ILE A H    11 
ATOM 11443 H HA   . ILE A 1 18 ? -5.776  -0.886  -5.495  1.00 0.00 ? 18 ILE A HA   11 
ATOM 11444 H HB   . ILE A 1 18 ? -5.074  -3.604  -4.339  1.00 0.00 ? 18 ILE A HB   11 
ATOM 11445 H HG12 . ILE A 1 18 ? -6.575  -3.173  -6.502  1.00 0.00 ? 18 ILE A HG12 11 
ATOM 11446 H HG13 . ILE A 1 18 ? -6.926  -4.428  -5.342  1.00 0.00 ? 18 ILE A HG13 11 
ATOM 11447 H HG21 . ILE A 1 18 ? -7.068  -1.659  -3.171  1.00 0.00 ? 18 ILE A HG21 11 
ATOM 11448 H HG22 . ILE A 1 18 ? -6.972  -3.390  -2.753  1.00 0.00 ? 18 ILE A HG22 11 
ATOM 11449 H HG23 . ILE A 1 18 ? -5.635  -2.303  -2.385  1.00 0.00 ? 18 ILE A HG23 11 
ATOM 11450 H HD11 . ILE A 1 18 ? -8.665  -3.090  -4.290  1.00 0.00 ? 18 ILE A HD11 11 
ATOM 11451 H HD12 . ILE A 1 18 ? -8.247  -1.693  -5.306  1.00 0.00 ? 18 ILE A HD12 11 
ATOM 11452 H HD13 . ILE A 1 18 ? -8.949  -3.159  -6.034  1.00 0.00 ? 18 ILE A HD13 11 
ATOM 11453 N N    . LEU A 1 19 ? -2.969  -1.361  -3.857  1.00 0.00 ? 19 LEU A N    11 
ATOM 11454 C CA   . LEU A 1 19 ? -2.106  -0.744  -2.872  1.00 0.00 ? 19 LEU A CA   11 
ATOM 11455 C C    . LEU A 1 19 ? -1.824  0.711   -3.247  1.00 0.00 ? 19 LEU A C    11 
ATOM 11456 O O    . LEU A 1 19 ? -1.884  1.580   -2.382  1.00 0.00 ? 19 LEU A O    11 
ATOM 11457 C CB   . LEU A 1 19 ? -0.852  -1.600  -2.686  1.00 0.00 ? 19 LEU A CB   11 
ATOM 11458 C CG   . LEU A 1 19 ? 0.210   -0.952  -1.800  1.00 0.00 ? 19 LEU A CG   11 
ATOM 11459 C CD1  . LEU A 1 19 ? -0.344  -0.649  -0.406  1.00 0.00 ? 19 LEU A CD1  11 
ATOM 11460 C CD2  . LEU A 1 19 ? 1.381   -1.924  -1.656  1.00 0.00 ? 19 LEU A CD2  11 
ATOM 11461 H H    . LEU A 1 19 ? -2.647  -2.135  -4.424  1.00 0.00 ? 19 LEU A H    11 
ATOM 11462 H HA   . LEU A 1 19 ? -2.645  -0.728  -1.926  1.00 0.00 ? 19 LEU A HA   11 
ATOM 11463 H HB2  . LEU A 1 19 ? -1.158  -2.533  -2.232  1.00 0.00 ? 19 LEU A HB2  11 
ATOM 11464 H HB3  . LEU A 1 19 ? -0.404  -1.837  -3.644  1.00 0.00 ? 19 LEU A HB3  11 
ATOM 11465 H HG   . LEU A 1 19 ? 0.575   -0.042  -2.270  1.00 0.00 ? 19 LEU A HG   11 
ATOM 11466 H HD11 . LEU A 1 19 ? -0.799  -1.553  0.000   1.00 0.00 ? 19 LEU A HD11 11 
ATOM 11467 H HD12 . LEU A 1 19 ? 0.463   -0.287  0.222   1.00 0.00 ? 19 LEU A HD12 11 
ATOM 11468 H HD13 . LEU A 1 19 ? -1.098  0.137   -0.457  1.00 0.00 ? 19 LEU A HD13 11 
ATOM 11469 H HD21 . LEU A 1 19 ? 2.242   -1.380  -1.280  1.00 0.00 ? 19 LEU A HD21 11 
ATOM 11470 H HD22 . LEU A 1 19 ? 1.112   -2.739  -0.982  1.00 0.00 ? 19 LEU A HD22 11 
ATOM 11471 H HD23 . LEU A 1 19 ? 1.633   -2.339  -2.632  1.00 0.00 ? 19 LEU A HD23 11 
ATOM 11472 N N    . GLU A 1 20 ? -1.555  0.993   -4.521  1.00 0.00 ? 20 GLU A N    11 
ATOM 11473 C CA   . GLU A 1 20 ? -1.301  2.352   -4.984  1.00 0.00 ? 20 GLU A CA   11 
ATOM 11474 C C    . GLU A 1 20 ? -2.520  3.255   -4.778  1.00 0.00 ? 20 GLU A C    11 
ATOM 11475 O O    . GLU A 1 20 ? -2.347  4.444   -4.502  1.00 0.00 ? 20 GLU A O    11 
ATOM 11476 C CB   . GLU A 1 20 ? -0.901  2.336   -6.463  1.00 0.00 ? 20 GLU A CB   11 
ATOM 11477 C CG   . GLU A 1 20 ? 0.502   1.756   -6.689  1.00 0.00 ? 20 GLU A CG   11 
ATOM 11478 C CD   . GLU A 1 20 ? 1.594   2.641   -6.081  1.00 0.00 ? 20 GLU A CD   11 
ATOM 11479 O OE1  . GLU A 1 20 ? 1.641   3.846   -6.435  1.00 0.00 ? 20 GLU A OE1  11 
ATOM 11480 O OE2  . GLU A 1 20 ? 2.410   2.145   -5.274  1.00 0.00 ? 20 GLU A OE2  11 
ATOM 11481 H H    . GLU A 1 20 ? -1.585  0.251   -5.208  1.00 0.00 ? 20 GLU A H    11 
ATOM 11482 H HA   . GLU A 1 20 ? -0.481  2.768   -4.398  1.00 0.00 ? 20 GLU A HA   11 
ATOM 11483 H HB2  . GLU A 1 20 ? -1.628  1.755   -7.027  1.00 0.00 ? 20 GLU A HB2  11 
ATOM 11484 H HB3  . GLU A 1 20 ? -0.927  3.357   -6.842  1.00 0.00 ? 20 GLU A HB3  11 
ATOM 11485 H HG2  . GLU A 1 20 ? 0.556   0.751   -6.268  1.00 0.00 ? 20 GLU A HG2  11 
ATOM 11486 H HG3  . GLU A 1 20 ? 0.672   1.680   -7.764  1.00 0.00 ? 20 GLU A HG3  11 
ATOM 11487 N N    . GLU A 1 21 ? -3.725  2.694   -4.881  1.00 0.00 ? 21 GLU A N    11 
ATOM 11488 C CA   . GLU A 1 21 ? -5.002  3.333   -4.625  1.00 0.00 ? 21 GLU A CA   11 
ATOM 11489 C C    . GLU A 1 21 ? -5.106  3.771   -3.178  1.00 0.00 ? 21 GLU A C    11 
ATOM 11490 O O    . GLU A 1 21 ? -5.199  4.965   -2.906  1.00 0.00 ? 21 GLU A O    11 
ATOM 11491 C CB   . GLU A 1 21 ? -6.133  2.387   -4.978  1.00 0.00 ? 21 GLU A CB   11 
ATOM 11492 C CG   . GLU A 1 21 ? -6.156  1.876   -6.408  1.00 0.00 ? 21 GLU A CG   11 
ATOM 11493 C CD   . GLU A 1 21 ? -6.736  2.903   -7.366  1.00 0.00 ? 21 GLU A CD   11 
ATOM 11494 O OE1  . GLU A 1 21 ? -6.212  4.032   -7.474  1.00 0.00 ? 21 GLU A OE1  11 
ATOM 11495 O OE2  . GLU A 1 21 ? -7.778  2.603   -8.001  1.00 0.00 ? 21 GLU A OE2  11 
ATOM 11496 H H    . GLU A 1 21 ? -3.784  1.718   -5.134  1.00 0.00 ? 21 GLU A H    11 
ATOM 11497 H HA   . GLU A 1 21 ? -5.153  4.210   -5.234  1.00 0.00 ? 21 GLU A HA   11 
ATOM 11498 H HB2  . GLU A 1 21 ? -6.167  1.540   -4.307  1.00 0.00 ? 21 GLU A HB2  11 
ATOM 11499 H HB3  . GLU A 1 21 ? -7.018  2.963   -4.820  1.00 0.00 ? 21 GLU A HB3  11 
ATOM 11500 H HG2  . GLU A 1 21 ? -5.160  1.613   -6.723  1.00 0.00 ? 21 GLU A HG2  11 
ATOM 11501 H HG3  . GLU A 1 21 ? -6.763  0.974   -6.415  1.00 0.00 ? 21 GLU A HG3  11 
ATOM 11502 N N    . ALA A 1 22 ? -5.054  2.806   -2.259  1.00 0.00 ? 22 ALA A N    11 
ATOM 11503 C CA   . ALA A 1 22 ? -5.172  3.034   -0.821  1.00 0.00 ? 22 ALA A CA   11 
ATOM 11504 C C    . ALA A 1 22 ? -4.048  3.917   -0.281  1.00 0.00 ? 22 ALA A C    11 
ATOM 11505 O O    . ALA A 1 22 ? -4.158  4.433   0.831   1.00 0.00 ? 22 ALA A O    11 
ATOM 11506 C CB   . ALA A 1 22 ? -5.146  1.680   -0.117  1.00 0.00 ? 22 ALA A CB   11 
ATOM 11507 H H    . ALA A 1 22 ? -4.931  1.859   -2.611  1.00 0.00 ? 22 ALA A H    11 
ATOM 11508 H HA   . ALA A 1 22 ? -6.121  3.541   -0.606  1.00 0.00 ? 22 ALA A HA   11 
ATOM 11509 H HB1  . ALA A 1 22 ? -5.773  0.982   -0.665  1.00 0.00 ? 22 ALA A HB1  11 
ATOM 11510 H HB2  . ALA A 1 22 ? -4.127  1.295   -0.101  1.00 0.00 ? 22 ALA A HB2  11 
ATOM 11511 H HB3  . ALA A 1 22 ? -5.520  1.794   0.901   1.00 0.00 ? 22 ALA A HB3  11 
ATOM 11512 N N    . ILE A 1 23 ? -2.980  4.101   -1.053  1.00 0.00 ? 23 ILE A N    11 
ATOM 11513 C CA   . ILE A 1 23 ? -1.948  5.079   -0.763  1.00 0.00 ? 23 ILE A CA   11 
ATOM 11514 C C    . ILE A 1 23 ? -2.416  6.443   -1.272  1.00 0.00 ? 23 ILE A C    11 
ATOM 11515 O O    . ILE A 1 23 ? -2.449  7.395   -0.494  1.00 0.00 ? 23 ILE A O    11 
ATOM 11516 C CB   . ILE A 1 23 ? -0.628  4.572   -1.366  1.00 0.00 ? 23 ILE A CB   11 
ATOM 11517 C CG1  . ILE A 1 23 ? -0.088  3.452   -0.452  1.00 0.00 ? 23 ILE A CG1  11 
ATOM 11518 C CG2  . ILE A 1 23 ? 0.432   5.669   -1.534  1.00 0.00 ? 23 ILE A CG2  11 
ATOM 11519 C CD1  . ILE A 1 23 ? 0.917   2.586   -1.210  1.00 0.00 ? 23 ILE A CD1  11 
ATOM 11520 H H    . ILE A 1 23 ? -2.953  3.598   -1.940  1.00 0.00 ? 23 ILE A H    11 
ATOM 11521 H HA   . ILE A 1 23 ? -1.829  5.159   0.317   1.00 0.00 ? 23 ILE A HA   11 
ATOM 11522 H HB   . ILE A 1 23 ? -0.848  4.160   -2.352  1.00 0.00 ? 23 ILE A HB   11 
ATOM 11523 H HG12 . ILE A 1 23 ? 0.407   3.886   0.411   1.00 0.00 ? 23 ILE A HG12 11 
ATOM 11524 H HG13 . ILE A 1 23 ? -0.909  2.827   -0.073  1.00 0.00 ? 23 ILE A HG13 11 
ATOM 11525 H HG21 . ILE A 1 23 ? 0.569   6.200   -0.593  1.00 0.00 ? 23 ILE A HG21 11 
ATOM 11526 H HG22 . ILE A 1 23 ? 1.383   5.241   -1.854  1.00 0.00 ? 23 ILE A HG22 11 
ATOM 11527 H HG23 . ILE A 1 23 ? 0.110   6.366   -2.307  1.00 0.00 ? 23 ILE A HG23 11 
ATOM 11528 H HD11 . ILE A 1 23 ? 0.559   2.389   -2.221  1.00 0.00 ? 23 ILE A HD11 11 
ATOM 11529 H HD12 . ILE A 1 23 ? 1.892   3.071   -1.250  1.00 0.00 ? 23 ILE A HD12 11 
ATOM 11530 H HD13 . ILE A 1 23 ? 1.017   1.644   -0.689  1.00 0.00 ? 23 ILE A HD13 11 
ATOM 11531 N N    . SER A 1 24 ? -2.803  6.543   -2.546  1.00 0.00 ? 24 SER A N    11 
ATOM 11532 C CA   . SER A 1 24 ? -3.283  7.766   -3.184  1.00 0.00 ? 24 SER A CA   11 
ATOM 11533 C C    . SER A 1 24 ? -4.349  8.469   -2.342  1.00 0.00 ? 24 SER A C    11 
ATOM 11534 O O    . SER A 1 24 ? -4.207  9.666   -2.096  1.00 0.00 ? 24 SER A O    11 
ATOM 11535 C CB   . SER A 1 24 ? -3.780  7.439   -4.601  1.00 0.00 ? 24 SER A CB   11 
ATOM 11536 O OG   . SER A 1 24 ? -4.188  8.595   -5.310  1.00 0.00 ? 24 SER A OG   11 
ATOM 11537 H H    . SER A 1 24 ? -2.800  5.699   -3.114  1.00 0.00 ? 24 SER A H    11 
ATOM 11538 H HA   . SER A 1 24 ? -2.434  8.446   -3.261  1.00 0.00 ? 24 SER A HA   11 
ATOM 11539 H HB2  . SER A 1 24 ? -2.973  6.961   -5.157  1.00 0.00 ? 24 SER A HB2  11 
ATOM 11540 H HB3  . SER A 1 24 ? -4.621  6.749   -4.549  1.00 0.00 ? 24 SER A HB3  11 
ATOM 11541 H HG   . SER A 1 24 ? -4.009  8.415   -6.248  1.00 0.00 ? 24 SER A HG   11 
ATOM 11542 N N    . VAL A 1 25 ? -5.370  7.754   -1.851  1.00 0.00 ? 25 VAL A N    11 
ATOM 11543 C CA   . VAL A 1 25 ? -6.398  8.332   -0.989  1.00 0.00 ? 25 VAL A CA   11 
ATOM 11544 C C    . VAL A 1 25 ? -5.755  9.076   0.192   1.00 0.00 ? 25 VAL A C    11 
ATOM 11545 O O    . VAL A 1 25 ? -5.929  10.277  0.353   1.00 0.00 ? 25 VAL A O    11 
ATOM 11546 C CB   . VAL A 1 25 ? -7.449  7.273   -0.553  1.00 0.00 ? 25 VAL A CB   11 
ATOM 11547 C CG1  . VAL A 1 25 ? -8.672  7.269   -1.476  1.00 0.00 ? 25 VAL A CG1  11 
ATOM 11548 C CG2  . VAL A 1 25 ? -6.917  5.870   -0.403  1.00 0.00 ? 25 VAL A CG2  11 
ATOM 11549 H H    . VAL A 1 25 ? -5.429  6.766   -2.085  1.00 0.00 ? 25 VAL A H    11 
ATOM 11550 H HA   . VAL A 1 25 ? -6.901  9.086   -1.588  1.00 0.00 ? 25 VAL A HA   11 
ATOM 11551 H HB   . VAL A 1 25 ? -7.795  7.453   0.450   1.00 0.00 ? 25 VAL A HB   11 
ATOM 11552 H HG11 . VAL A 1 25 ? -9.145  8.242   -1.506  1.00 0.00 ? 25 VAL A HG11 11 
ATOM 11553 H HG12 . VAL A 1 25 ? -8.376  6.986   -2.487  1.00 0.00 ? 25 VAL A HG12 11 
ATOM 11554 H HG13 . VAL A 1 25 ? -9.412  6.564   -1.096  1.00 0.00 ? 25 VAL A HG13 11 
ATOM 11555 H HG21 . VAL A 1 25 ? -6.952  5.373   -1.365  1.00 0.00 ? 25 VAL A HG21 11 
ATOM 11556 H HG22 . VAL A 1 25 ? -5.911  5.902   -0.005  1.00 0.00 ? 25 VAL A HG22 11 
ATOM 11557 H HG23 . VAL A 1 25 ? -7.551  5.331   0.296   1.00 0.00 ? 25 VAL A HG23 11 
ATOM 11558 N N    . VAL A 1 26 ? -5.000  8.377   1.023   1.00 0.00 ? 26 VAL A N    11 
ATOM 11559 C CA   . VAL A 1 26 ? -4.307  8.873   2.206   1.00 0.00 ? 26 VAL A CA   11 
ATOM 11560 C C    . VAL A 1 26 ? -3.426  10.072  1.855   1.00 0.00 ? 26 VAL A C    11 
ATOM 11561 O O    . VAL A 1 26 ? -3.534  11.117  2.504   1.00 0.00 ? 26 VAL A O    11 
ATOM 11562 C CB   . VAL A 1 26 ? -3.516  7.713   2.848   1.00 0.00 ? 26 VAL A CB   11 
ATOM 11563 C CG1  . VAL A 1 26 ? -2.737  8.142   4.095   1.00 0.00 ? 26 VAL A CG1  11 
ATOM 11564 C CG2  . VAL A 1 26 ? -4.485  6.603   3.267   1.00 0.00 ? 26 VAL A CG2  11 
ATOM 11565 H H    . VAL A 1 26 ? -4.874  7.423   0.770   1.00 0.00 ? 26 VAL A H    11 
ATOM 11566 H HA   . VAL A 1 26 ? -5.055  9.214   2.915   1.00 0.00 ? 26 VAL A HA   11 
ATOM 11567 H HB   . VAL A 1 26 ? -2.811  7.306   2.125   1.00 0.00 ? 26 VAL A HB   11 
ATOM 11568 H HG11 . VAL A 1 26 ? -1.977  8.875   3.821   1.00 0.00 ? 26 VAL A HG11 11 
ATOM 11569 H HG12 . VAL A 1 26 ? -3.413  8.577   4.829   1.00 0.00 ? 26 VAL A HG12 11 
ATOM 11570 H HG13 . VAL A 1 26 ? -2.231  7.281   4.530   1.00 0.00 ? 26 VAL A HG13 11 
ATOM 11571 H HG21 . VAL A 1 26 ? -5.029  6.234   2.402   1.00 0.00 ? 26 VAL A HG21 11 
ATOM 11572 H HG22 . VAL A 1 26 ? -3.925  5.765   3.682   1.00 0.00 ? 26 VAL A HG22 11 
ATOM 11573 H HG23 . VAL A 1 26 ? -5.194  6.993   3.995   1.00 0.00 ? 26 VAL A HG23 11 
ATOM 11574 N N    . MET A 1 27 ? -2.596  9.945   0.820   1.00 0.00 ? 27 MET A N    11 
ATOM 11575 C CA   . MET A 1 27 ? -1.681  10.989  0.391   1.00 0.00 ? 27 MET A CA   11 
ATOM 11576 C C    . MET A 1 27 ? -2.437  12.267  0.048   1.00 0.00 ? 27 MET A C    11 
ATOM 11577 O O    . MET A 1 27 ? -2.168  13.338  0.597   1.00 0.00 ? 27 MET A O    11 
ATOM 11578 C CB   . MET A 1 27 ? -0.886  10.529  -0.829  1.00 0.00 ? 27 MET A CB   11 
ATOM 11579 C CG   . MET A 1 27 ? 0.145   9.462   -0.496  1.00 0.00 ? 27 MET A CG   11 
ATOM 11580 S SD   . MET A 1 27 ? 1.078   9.011   -1.969  1.00 0.00 ? 27 MET A SD   11 
ATOM 11581 C CE   . MET A 1 27 ? 2.596   8.473   -1.172  1.00 0.00 ? 27 MET A CE   11 
ATOM 11582 H H    . MET A 1 27 ? -2.586  9.068   0.307   1.00 0.00 ? 27 MET A H    11 
ATOM 11583 H HA   . MET A 1 27 ? -0.993  11.193  1.206   1.00 0.00 ? 27 MET A HA   11 
ATOM 11584 H HB2  . MET A 1 27 ? -1.561  10.151  -1.599  1.00 0.00 ? 27 MET A HB2  11 
ATOM 11585 H HB3  . MET A 1 27 ? -0.348  11.389  -1.227  1.00 0.00 ? 27 MET A HB3  11 
ATOM 11586 H HG2  . MET A 1 27 ? 0.823   9.852   0.258   1.00 0.00 ? 27 MET A HG2  11 
ATOM 11587 H HG3  . MET A 1 27 ? -0.336  8.576   -0.087  1.00 0.00 ? 27 MET A HG3  11 
ATOM 11588 H HE1  . MET A 1 27 ? 2.397   7.648   -0.488  1.00 0.00 ? 27 MET A HE1  11 
ATOM 11589 H HE2  . MET A 1 27 ? 3.282   8.155   -1.950  1.00 0.00 ? 27 MET A HE2  11 
ATOM 11590 H HE3  . MET A 1 27 ? 3.033   9.306   -0.625  1.00 0.00 ? 27 MET A HE3  11 
ATOM 11591 N N    . SER A 1 28 ? -3.404  12.151  -0.855  1.00 0.00 ? 28 SER A N    11 
ATOM 11592 C CA   . SER A 1 28 ? -4.214  13.251  -1.336  1.00 0.00 ? 28 SER A CA   11 
ATOM 11593 C C    . SER A 1 28 ? -5.208  13.758  -0.282  1.00 0.00 ? 28 SER A C    11 
ATOM 11594 O O    . SER A 1 28 ? -5.886  14.755  -0.540  1.00 0.00 ? 28 SER A O    11 
ATOM 11595 C CB   . SER A 1 28 ? -4.872  12.806  -2.645  1.00 0.00 ? 28 SER A CB   11 
ATOM 11596 O OG   . SER A 1 28 ? -3.832  12.529  -3.577  1.00 0.00 ? 28 SER A OG   11 
ATOM 11597 H H    . SER A 1 28 ? -3.599  11.242  -1.268  1.00 0.00 ? 28 SER A H    11 
ATOM 11598 H HA   . SER A 1 28 ? -3.554  14.085  -1.575  1.00 0.00 ? 28 SER A HA   11 
ATOM 11599 H HB2  . SER A 1 28 ? -5.476  11.914  -2.477  1.00 0.00 ? 28 SER A HB2  11 
ATOM 11600 H HB3  . SER A 1 28 ? -5.514  13.600  -3.024  1.00 0.00 ? 28 SER A HB3  11 
ATOM 11601 H HG   . SER A 1 28 ? -4.229  12.226  -4.415  1.00 0.00 ? 28 SER A HG   11 
ATOM 11602 N N    . GLY A 1 29 ? -5.280  13.148  0.911   1.00 0.00 ? 29 GLY A N    11 
ATOM 11603 C CA   . GLY A 1 29 ? -6.088  13.675  2.003   1.00 0.00 ? 29 GLY A CA   11 
ATOM 11604 C C    . GLY A 1 29 ? -7.520  13.170  1.956   1.00 0.00 ? 29 GLY A C    11 
ATOM 11605 O O    . GLY A 1 29 ? -8.403  13.777  2.561   1.00 0.00 ? 29 GLY A O    11 
ATOM 11606 H H    . GLY A 1 29 ? -4.770  12.280  1.073   1.00 0.00 ? 29 GLY A H    11 
ATOM 11607 H HA2  . GLY A 1 29 ? -5.639  13.393  2.955   1.00 0.00 ? 29 GLY A HA2  11 
ATOM 11608 H HA3  . GLY A 1 29 ? -6.130  14.762  1.930   1.00 0.00 ? 29 GLY A HA3  11 
ATOM 11609 N N    . LYS A 1 30 ? -7.780  12.083  1.224   1.00 0.00 ? 30 LYS A N    11 
ATOM 11610 C CA   . LYS A 1 30 ? -9.115  11.509  1.117   1.00 0.00 ? 30 LYS A CA   11 
ATOM 11611 C C    . LYS A 1 30 ? -9.486  10.843  2.434   1.00 0.00 ? 30 LYS A C    11 
ATOM 11612 O O    . LYS A 1 30 ? -10.668 10.704  2.743   1.00 0.00 ? 30 LYS A O    11 
ATOM 11613 C CB   . LYS A 1 30 ? -9.140  10.494  -0.033  1.00 0.00 ? 30 LYS A CB   11 
ATOM 11614 C CG   . LYS A 1 30 ? -8.670  11.062  -1.388  1.00 0.00 ? 30 LYS A CG   11 
ATOM 11615 C CD   . LYS A 1 30 ? -9.518  12.226  -1.885  1.00 0.00 ? 30 LYS A CD   11 
ATOM 11616 C CE   . LYS A 1 30 ? -9.040  12.589  -3.295  1.00 0.00 ? 30 LYS A CE   11 
ATOM 11617 N NZ   . LYS A 1 30 ? -9.976  13.491  -3.985  1.00 0.00 ? 30 LYS A NZ   11 
ATOM 11618 H H    . LYS A 1 30 ? -7.003  11.518  0.861   1.00 0.00 ? 30 LYS A H    11 
ATOM 11619 H HA   . LYS A 1 30 ? -9.837  12.299  0.918   1.00 0.00 ? 30 LYS A HA   11 
ATOM 11620 H HB2  . LYS A 1 30 ? -8.489  9.674   0.248   1.00 0.00 ? 30 LYS A HB2  11 
ATOM 11621 H HB3  . LYS A 1 30 ? -10.138 10.072  -0.141  1.00 0.00 ? 30 LYS A HB3  11 
ATOM 11622 H HG2  . LYS A 1 30 ? -7.634  11.391  -1.317  1.00 0.00 ? 30 LYS A HG2  11 
ATOM 11623 H HG3  . LYS A 1 30 ? -8.710  10.279  -2.141  1.00 0.00 ? 30 LYS A HG3  11 
ATOM 11624 H HD2  . LYS A 1 30 ? -10.567 11.927  -1.907  1.00 0.00 ? 30 LYS A HD2  11 
ATOM 11625 H HD3  . LYS A 1 30 ? -9.380  13.077  -1.214  1.00 0.00 ? 30 LYS A HD3  11 
ATOM 11626 H HE2  . LYS A 1 30 ? -8.064  13.072  -3.222  1.00 0.00 ? 30 LYS A HE2  11 
ATOM 11627 H HE3  . LYS A 1 30 ? -8.925  11.682  -3.890  1.00 0.00 ? 30 LYS A HE3  11 
ATOM 11628 H HZ1  . LYS A 1 30 ? -10.230 14.276  -3.396  1.00 0.00 ? 30 LYS A HZ1  11 
ATOM 11629 H HZ2  . LYS A 1 30 ? -9.548  13.891  -4.810  1.00 0.00 ? 30 LYS A HZ2  11 
ATOM 11630 H HZ3  . LYS A 1 30 ? -10.816 12.987  -4.250  1.00 0.00 ? 30 LYS A HZ3  11 
ATOM 11631 N N    . MET A 1 31 ? -8.485  10.400  3.196   1.00 0.00 ? 31 MET A N    11 
ATOM 11632 C CA   . MET A 1 31 ? -8.612  9.796   4.509   1.00 0.00 ? 31 MET A CA   11 
ATOM 11633 C C    . MET A 1 31 ? -7.232  9.738   5.173   1.00 0.00 ? 31 MET A C    11 
ATOM 11634 O O    . MET A 1 31 ? -6.273  10.321  4.663   1.00 0.00 ? 31 MET A O    11 
ATOM 11635 C CB   . MET A 1 31 ? -9.260  8.415   4.385   1.00 0.00 ? 31 MET A CB   11 
ATOM 11636 C CG   . MET A 1 31 ? -8.503  7.409   3.537   1.00 0.00 ? 31 MET A CG   11 
ATOM 11637 S SD   . MET A 1 31 ? -9.554  6.091   2.878   1.00 0.00 ? 31 MET A SD   11 
ATOM 11638 C CE   . MET A 1 31 ? -10.643 6.967   1.765   1.00 0.00 ? 31 MET A CE   11 
ATOM 11639 H H    . MET A 1 31 ? -7.531  10.570  2.906   1.00 0.00 ? 31 MET A H    11 
ATOM 11640 H HA   . MET A 1 31 ? -9.262  10.422  5.117   1.00 0.00 ? 31 MET A HA   11 
ATOM 11641 H HB2  . MET A 1 31 ? -9.361  8.004   5.376   1.00 0.00 ? 31 MET A HB2  11 
ATOM 11642 H HB3  . MET A 1 31 ? -10.254 8.506   3.977   1.00 0.00 ? 31 MET A HB3  11 
ATOM 11643 H HG2  . MET A 1 31 ? -7.998  7.904   2.708   1.00 0.00 ? 31 MET A HG2  11 
ATOM 11644 H HG3  . MET A 1 31 ? -7.760  6.956   4.189   1.00 0.00 ? 31 MET A HG3  11 
ATOM 11645 H HE1  . MET A 1 31 ? -10.058 7.636   1.141   1.00 0.00 ? 31 MET A HE1  11 
ATOM 11646 H HE2  . MET A 1 31 ? -11.149 6.218   1.161   1.00 0.00 ? 31 MET A HE2  11 
ATOM 11647 H HE3  . MET A 1 31 ? -11.367 7.525   2.353   1.00 0.00 ? 31 MET A HE3  11 
ATOM 11648 N N    . SER A 1 32 ? -7.131  9.013   6.285   1.00 0.00 ? 32 SER A N    11 
ATOM 11649 C CA   . SER A 1 32 ? -5.892  8.706   7.000   1.00 0.00 ? 32 SER A CA   11 
ATOM 11650 C C    . SER A 1 32 ? -5.622  7.204   6.876   1.00 0.00 ? 32 SER A C    11 
ATOM 11651 O O    . SER A 1 32 ? -6.502  6.482   6.394   1.00 0.00 ? 32 SER A O    11 
ATOM 11652 C CB   . SER A 1 32 ? -6.048  9.170   8.450   1.00 0.00 ? 32 SER A CB   11 
ATOM 11653 O OG   . SER A 1 32 ? -6.629  10.464  8.516   1.00 0.00 ? 32 SER A OG   11 
ATOM 11654 H H    . SER A 1 32 ? -7.948  8.510   6.612   1.00 0.00 ? 32 SER A H    11 
ATOM 11655 H HA   . SER A 1 32 ? -5.042  9.220   6.567   1.00 0.00 ? 32 SER A HA   11 
ATOM 11656 H HB2  . SER A 1 32 ? -6.711  8.480   8.960   1.00 0.00 ? 32 SER A HB2  11 
ATOM 11657 H HB3  . SER A 1 32 ? -5.082  9.168   8.953   1.00 0.00 ? 32 SER A HB3  11 
ATOM 11658 H HG   . SER A 1 32 ? -5.957  11.128  8.280   1.00 0.00 ? 32 SER A HG   11 
ATOM 11659 N N    . VAL A 1 33 ? -4.439  6.727   7.291   1.00 0.00 ? 33 VAL A N    11 
ATOM 11660 C CA   . VAL A 1 33 ? -4.058  5.320   7.142   1.00 0.00 ? 33 VAL A CA   11 
ATOM 11661 C C    . VAL A 1 33 ? -5.154  4.428   7.709   1.00 0.00 ? 33 VAL A C    11 
ATOM 11662 O O    . VAL A 1 33 ? -5.645  3.588   6.964   1.00 0.00 ? 33 VAL A O    11 
ATOM 11663 C CB   . VAL A 1 33 ? -2.680  5.004   7.770   1.00 0.00 ? 33 VAL A CB   11 
ATOM 11664 C CG1  . VAL A 1 33 ? -2.374  3.493   7.877   1.00 0.00 ? 33 VAL A CG1  11 
ATOM 11665 C CG2  . VAL A 1 33 ? -1.555  5.633   6.938   1.00 0.00 ? 33 VAL A CG2  11 
ATOM 11666 H H    . VAL A 1 33 ? -3.744  7.370   7.664   1.00 0.00 ? 33 VAL A H    11 
ATOM 11667 H HA   . VAL A 1 33 ? -3.994  5.108   6.075   1.00 0.00 ? 33 VAL A HA   11 
ATOM 11668 H HB   . VAL A 1 33 ? -2.650  5.421   8.776   1.00 0.00 ? 33 VAL A HB   11 
ATOM 11669 H HG11 . VAL A 1 33 ? -1.932  3.116   6.959   1.00 0.00 ? 33 VAL A HG11 11 
ATOM 11670 H HG12 . VAL A 1 33 ? -1.672  3.337   8.685   1.00 0.00 ? 33 VAL A HG12 11 
ATOM 11671 H HG13 . VAL A 1 33 ? -3.244  2.892   8.129   1.00 0.00 ? 33 VAL A HG13 11 
ATOM 11672 H HG21 . VAL A 1 33 ? -0.591  5.370   7.376   1.00 0.00 ? 33 VAL A HG21 11 
ATOM 11673 H HG22 . VAL A 1 33 ? -1.583  5.260   5.916   1.00 0.00 ? 33 VAL A HG22 11 
ATOM 11674 H HG23 . VAL A 1 33 ? -1.643  6.717   6.927   1.00 0.00 ? 33 VAL A HG23 11 
ATOM 11675 N N    . SER A 1 34 ? -5.534  4.573   8.984   1.00 0.00 ? 34 SER A N    11 
ATOM 11676 C CA   . SER A 1 34 ? -6.383  3.554   9.611   1.00 0.00 ? 34 SER A CA   11 
ATOM 11677 C C    . SER A 1 34 ? -7.730  3.413   8.906   1.00 0.00 ? 34 SER A C    11 
ATOM 11678 O O    . SER A 1 34 ? -8.267  2.307   8.803   1.00 0.00 ? 34 SER A O    11 
ATOM 11679 C CB   . SER A 1 34 ? -6.598  3.813   11.100  1.00 0.00 ? 34 SER A CB   11 
ATOM 11680 O OG   . SER A 1 34 ? -5.414  3.575   11.832  1.00 0.00 ? 34 SER A OG   11 
ATOM 11681 H H    . SER A 1 34 ? -5.171  5.354   9.516   1.00 0.00 ? 34 SER A H    11 
ATOM 11682 H HA   . SER A 1 34 ? -5.870  2.609   9.499   1.00 0.00 ? 34 SER A HA   11 
ATOM 11683 H HB2  . SER A 1 34 ? -6.930  4.831   11.256  1.00 0.00 ? 34 SER A HB2  11 
ATOM 11684 H HB3  . SER A 1 34 ? -7.381  3.153   11.469  1.00 0.00 ? 34 SER A HB3  11 
ATOM 11685 H HG   . SER A 1 34 ? -5.611  3.749   12.770  1.00 0.00 ? 34 SER A HG   11 
ATOM 11686 N N    . LYS A 1 35 ? -8.237  4.526   8.378   1.00 0.00 ? 35 LYS A N    11 
ATOM 11687 C CA   . LYS A 1 35 ? -9.406  4.554   7.530   1.00 0.00 ? 35 LYS A CA   11 
ATOM 11688 C C    . LYS A 1 35 ? -9.141  3.730   6.269   1.00 0.00 ? 35 LYS A C    11 
ATOM 11689 O O    . LYS A 1 35 ? -9.669  2.626   6.179   1.00 0.00 ? 35 LYS A O    11 
ATOM 11690 C CB   . LYS A 1 35 ? -9.801  6.012   7.330   1.00 0.00 ? 35 LYS A CB   11 
ATOM 11691 C CG   . LYS A 1 35 ? -11.006 6.146   6.402   1.00 0.00 ? 35 LYS A CG   11 
ATOM 11692 C CD   . LYS A 1 35 ? -11.844 7.361   6.779   1.00 0.00 ? 35 LYS A CD   11 
ATOM 11693 C CE   . LYS A 1 35 ? -12.700 7.815   5.600   1.00 0.00 ? 35 LYS A CE   11 
ATOM 11694 N NZ   . LYS A 1 35 ? -13.548 8.962   5.951   1.00 0.00 ? 35 LYS A NZ   11 
ATOM 11695 H H    . LYS A 1 35 ? -7.692  5.370   8.483   1.00 0.00 ? 35 LYS A H    11 
ATOM 11696 H HA   . LYS A 1 35 ? -10.226 4.080   8.064   1.00 0.00 ? 35 LYS A HA   11 
ATOM 11697 H HB2  . LYS A 1 35 ? -10.052 6.421   8.312   1.00 0.00 ? 35 LYS A HB2  11 
ATOM 11698 H HB3  . LYS A 1 35 ? -8.961  6.576   6.937   1.00 0.00 ? 35 LYS A HB3  11 
ATOM 11699 H HG2  . LYS A 1 35 ? -10.674 6.224   5.378   1.00 0.00 ? 35 LYS A HG2  11 
ATOM 11700 H HG3  . LYS A 1 35 ? -11.615 5.262   6.465   1.00 0.00 ? 35 LYS A HG3  11 
ATOM 11701 H HD2  . LYS A 1 35 ? -12.478 7.097   7.618   1.00 0.00 ? 35 LYS A HD2  11 
ATOM 11702 H HD3  . LYS A 1 35 ? -11.182 8.165   7.084   1.00 0.00 ? 35 LYS A HD3  11 
ATOM 11703 H HE2  . LYS A 1 35 ? -12.059 8.093   4.769   1.00 0.00 ? 35 LYS A HE2  11 
ATOM 11704 H HE3  . LYS A 1 35 ? -13.329 6.991   5.274   1.00 0.00 ? 35 LYS A HE3  11 
ATOM 11705 H HZ1  . LYS A 1 35 ? -14.277 8.686   6.597   1.00 0.00 ? 35 LYS A HZ1  11 
ATOM 11706 H HZ2  . LYS A 1 35 ? -12.991 9.707   6.354   1.00 0.00 ? 35 LYS A HZ2  11 
ATOM 11707 H HZ3  . LYS A 1 35 ? -14.003 9.346   5.126   1.00 0.00 ? 35 LYS A HZ3  11 
ATOM 11708 N N    . ALA A 1 36 ? -8.320  4.195   5.319   1.00 0.00 ? 36 ALA A N    11 
ATOM 11709 C CA   . ALA A 1 36 ? -8.051  3.471   4.076   1.00 0.00 ? 36 ALA A CA   11 
ATOM 11710 C C    . ALA A 1 36 ? -7.633  2.016   4.267   1.00 0.00 ? 36 ALA A C    11 
ATOM 11711 O O    . ALA A 1 36 ? -8.114  1.168   3.527   1.00 0.00 ? 36 ALA A O    11 
ATOM 11712 C CB   . ALA A 1 36 ? -6.935  4.174   3.291   1.00 0.00 ? 36 ALA A CB   11 
ATOM 11713 H H    . ALA A 1 36 ? -7.997  5.154   5.354   1.00 0.00 ? 36 ALA A H    11 
ATOM 11714 H HA   . ALA A 1 36 ? -8.999  3.450   3.517   1.00 0.00 ? 36 ALA A HA   11 
ATOM 11715 H HB1  . ALA A 1 36 ? -6.818  3.708   2.312   1.00 0.00 ? 36 ALA A HB1  11 
ATOM 11716 H HB2  . ALA A 1 36 ? -7.142  5.229   3.155   1.00 0.00 ? 36 ALA A HB2  11 
ATOM 11717 H HB3  . ALA A 1 36 ? -6.001  4.101   3.845   1.00 0.00 ? 36 ALA A HB3  11 
ATOM 11718 N N    . GLN A 1 37 ? -6.788  1.706   5.250   1.00 0.00 ? 37 GLN A N    11 
ATOM 11719 C CA   . GLN A 1 37 ? -6.468  0.356   5.681   1.00 0.00 ? 37 GLN A CA   11 
ATOM 11720 C C    . GLN A 1 37 ? -7.751  -0.457  5.748   1.00 0.00 ? 37 GLN A C    11 
ATOM 11721 O O    . GLN A 1 37 ? -7.835  -1.498  5.106   1.00 0.00 ? 37 GLN A O    11 
ATOM 11722 C CB   . GLN A 1 37 ? -5.727  0.439   7.029   1.00 0.00 ? 37 GLN A CB   11 
ATOM 11723 C CG   . GLN A 1 37 ? -5.810  -0.804  7.939   1.00 0.00 ? 37 GLN A CG   11 
ATOM 11724 C CD   . GLN A 1 37 ? -6.060  -0.462  9.407   1.00 0.00 ? 37 GLN A CD   11 
ATOM 11725 O OE1  . GLN A 1 37 ? -5.438  0.417   9.995   1.00 0.00 ? 37 GLN A OE1  11 
ATOM 11726 N NE2  . GLN A 1 37 ? -6.971  -1.165  10.049  1.00 0.00 ? 37 GLN A NE2  11 
ATOM 11727 H H    . GLN A 1 37 ? -6.390  2.449   5.810   1.00 0.00 ? 37 GLN A H    11 
ATOM 11728 H HA   . GLN A 1 37 ? -5.810  -0.110  4.948   1.00 0.00 ? 37 GLN A HA   11 
ATOM 11729 H HB2  . GLN A 1 37 ? -4.681  0.686   6.810   1.00 0.00 ? 37 GLN A HB2  11 
ATOM 11730 H HB3  . GLN A 1 37 ? -6.162  1.259   7.593   1.00 0.00 ? 37 GLN A HB3  11 
ATOM 11731 H HG2  . GLN A 1 37 ? -6.600  -1.472  7.615   1.00 0.00 ? 37 GLN A HG2  11 
ATOM 11732 H HG3  . GLN A 1 37 ? -4.900  -1.373  7.861   1.00 0.00 ? 37 GLN A HG3  11 
ATOM 11733 H HE21 . GLN A 1 37 ? -7.398  -1.968  9.599   1.00 0.00 ? 37 GLN A HE21 11 
ATOM 11734 H HE22 . GLN A 1 37 ? -7.240  -0.878  10.984  1.00 0.00 ? 37 GLN A HE22 11 
ATOM 11735 N N    . SER A 1 38 ? -8.735  -0.010  6.523   1.00 0.00 ? 38 SER A N    11 
ATOM 11736 C CA   . SER A 1 38 ? -9.935  -0.786  6.721   1.00 0.00 ? 38 SER A CA   11 
ATOM 11737 C C    . SER A 1 38 ? -10.870 -0.716  5.504   1.00 0.00 ? 38 SER A C    11 
ATOM 11738 O O    . SER A 1 38 ? -11.666 -1.636  5.307   1.00 0.00 ? 38 SER A O    11 
ATOM 11739 C CB   . SER A 1 38 ? -10.633 -0.282  7.981   1.00 0.00 ? 38 SER A CB   11 
ATOM 11740 O OG   . SER A 1 38 ? -11.473 -1.302  8.495   1.00 0.00 ? 38 SER A OG   11 
ATOM 11741 H H    . SER A 1 38 ? -8.678  0.912   6.950   1.00 0.00 ? 38 SER A H    11 
ATOM 11742 H HA   . SER A 1 38 ? -9.601  -1.814  6.884   1.00 0.00 ? 38 SER A HA   11 
ATOM 11743 H HB2  . SER A 1 38 ? -9.875  -0.044  8.731   1.00 0.00 ? 38 SER A HB2  11 
ATOM 11744 H HB3  . SER A 1 38 ? -11.205 0.623   7.753   1.00 0.00 ? 38 SER A HB3  11 
ATOM 11745 H HG   . SER A 1 38 ? -11.364 -1.267  9.471   1.00 0.00 ? 38 SER A HG   11 
ATOM 11746 N N    . ILE A 1 39 ? -10.812 0.357   4.705   1.00 0.00 ? 39 ILE A N    11 
ATOM 11747 C CA   . ILE A 1 39 ? -11.626 0.500   3.501   1.00 0.00 ? 39 ILE A CA   11 
ATOM 11748 C C    . ILE A 1 39 ? -11.154 -0.522  2.465   1.00 0.00 ? 39 ILE A C    11 
ATOM 11749 O O    . ILE A 1 39 ? -11.921 -1.401  2.080   1.00 0.00 ? 39 ILE A O    11 
ATOM 11750 C CB   . ILE A 1 39 ? -11.670 1.961   2.986   1.00 0.00 ? 39 ILE A CB   11 
ATOM 11751 C CG1  . ILE A 1 39 ? -12.327 2.838   4.074   1.00 0.00 ? 39 ILE A CG1  11 
ATOM 11752 C CG2  . ILE A 1 39 ? -12.439 2.046   1.655   1.00 0.00 ? 39 ILE A CG2  11 
ATOM 11753 C CD1  . ILE A 1 39 ? -12.761 4.241   3.659   1.00 0.00 ? 39 ILE A CD1  11 
ATOM 11754 H H    . ILE A 1 39 ? -10.173 1.102   4.952   1.00 0.00 ? 39 ILE A H    11 
ATOM 11755 H HA   . ILE A 1 39 ? -12.643 0.251   3.775   1.00 0.00 ? 39 ILE A HA   11 
ATOM 11756 H HB   . ILE A 1 39 ? -10.663 2.327   2.809   1.00 0.00 ? 39 ILE A HB   11 
ATOM 11757 H HG12 . ILE A 1 39 ? -13.195 2.327   4.462   1.00 0.00 ? 39 ILE A HG12 11 
ATOM 11758 H HG13 . ILE A 1 39 ? -11.641 2.951   4.902   1.00 0.00 ? 39 ILE A HG13 11 
ATOM 11759 H HG21 . ILE A 1 39 ? -11.954 1.443   0.888   1.00 0.00 ? 39 ILE A HG21 11 
ATOM 11760 H HG22 . ILE A 1 39 ? -13.464 1.702   1.781   1.00 0.00 ? 39 ILE A HG22 11 
ATOM 11761 H HG23 . ILE A 1 39 ? -12.445 3.071   1.289   1.00 0.00 ? 39 ILE A HG23 11 
ATOM 11762 H HD11 . ILE A 1 39 ? -13.623 4.185   2.995   1.00 0.00 ? 39 ILE A HD11 11 
ATOM 11763 H HD12 . ILE A 1 39 ? -13.039 4.797   4.552   1.00 0.00 ? 39 ILE A HD12 11 
ATOM 11764 H HD13 . ILE A 1 39 ? -11.937 4.737   3.157   1.00 0.00 ? 39 ILE A HD13 11 
ATOM 11765 N N    . TYR A 1 40 ? -9.897  -0.407  2.040   1.00 0.00 ? 40 TYR A N    11 
ATOM 11766 C CA   . TYR A 1 40 ? -9.263  -1.185  0.985   1.00 0.00 ? 40 TYR A CA   11 
ATOM 11767 C C    . TYR A 1 40 ? -8.827  -2.564  1.497   1.00 0.00 ? 40 TYR A C    11 
ATOM 11768 O O    . TYR A 1 40 ? -8.487  -3.443  0.703   1.00 0.00 ? 40 TYR A O    11 
ATOM 11769 C CB   . TYR A 1 40 ? -8.051  -0.393  0.462   1.00 0.00 ? 40 TYR A CB   11 
ATOM 11770 C CG   . TYR A 1 40 ? -8.390  0.892   -0.291  1.00 0.00 ? 40 TYR A CG   11 
ATOM 11771 C CD1  . TYR A 1 40 ? -8.837  2.044   0.392   1.00 0.00 ? 40 TYR A CD1  11 
ATOM 11772 C CD2  . TYR A 1 40 ? -8.159  0.978   -1.677  1.00 0.00 ? 40 TYR A CD2  11 
ATOM 11773 C CE1  . TYR A 1 40 ? -9.130  3.233   -0.297  1.00 0.00 ? 40 TYR A CE1  11 
ATOM 11774 C CE2  . TYR A 1 40 ? -8.411  2.171   -2.363  1.00 0.00 ? 40 TYR A CE2  11 
ATOM 11775 C CZ   . TYR A 1 40 ? -8.949  3.284   -1.694  1.00 0.00 ? 40 TYR A CZ   11 
ATOM 11776 O OH   . TYR A 1 40 ? -9.265  4.406   -2.387  1.00 0.00 ? 40 TYR A OH   11 
ATOM 11777 H H    . TYR A 1 40 ? -9.307  0.282   2.490   1.00 0.00 ? 40 TYR A H    11 
ATOM 11778 H HA   . TYR A 1 40 ? -9.974  -1.327  0.168   1.00 0.00 ? 40 TYR A HA   11 
ATOM 11779 H HB2  . TYR A 1 40 ? -7.413  -0.133  1.307   1.00 0.00 ? 40 TYR A HB2  11 
ATOM 11780 H HB3  . TYR A 1 40 ? -7.457  -1.043  -0.187  1.00 0.00 ? 40 TYR A HB3  11 
ATOM 11781 H HD1  . TYR A 1 40 ? -8.949  2.039   1.456   1.00 0.00 ? 40 TYR A HD1  11 
ATOM 11782 H HD2  . TYR A 1 40 ? -7.731  0.167   -2.239  1.00 0.00 ? 40 TYR A HD2  11 
ATOM 11783 H HE1  . TYR A 1 40 ? -9.456  4.122   0.233   1.00 0.00 ? 40 TYR A HE1  11 
ATOM 11784 H HE2  . TYR A 1 40 ? -8.158  2.239   -3.400  1.00 0.00 ? 40 TYR A HE2  11 
ATOM 11785 H HH   . TYR A 1 40 ? -8.908  4.450   -3.290  1.00 0.00 ? 40 TYR A HH   11 
ATOM 11786 N N    . GLY A 1 41 ? -8.833  -2.781  2.814   1.00 0.00 ? 41 GLY A N    11 
ATOM 11787 C CA   . GLY A 1 41 ? -8.489  -4.041  3.451   1.00 0.00 ? 41 GLY A CA   11 
ATOM 11788 C C    . GLY A 1 41 ? -6.985  -4.303  3.471   1.00 0.00 ? 41 GLY A C    11 
ATOM 11789 O O    . GLY A 1 41 ? -6.562  -5.460  3.434   1.00 0.00 ? 41 GLY A O    11 
ATOM 11790 H H    . GLY A 1 41 ? -9.065  -2.016  3.434   1.00 0.00 ? 41 GLY A H    11 
ATOM 11791 H HA2  . GLY A 1 41 ? -8.847  -4.020  4.479   1.00 0.00 ? 41 GLY A HA2  11 
ATOM 11792 H HA3  . GLY A 1 41 ? -8.992  -4.841  2.921   1.00 0.00 ? 41 GLY A HA3  11 
ATOM 11793 N N    . ILE A 1 42 ? -6.163  -3.260  3.537   1.00 0.00 ? 42 ILE A N    11 
ATOM 11794 C CA   . ILE A 1 42 ? -4.707  -3.377  3.597   1.00 0.00 ? 42 ILE A CA   11 
ATOM 11795 C C    . ILE A 1 42 ? -4.347  -3.447  5.094   1.00 0.00 ? 42 ILE A C    11 
ATOM 11796 O O    . ILE A 1 42 ? -5.109  -2.940  5.923   1.00 0.00 ? 42 ILE A O    11 
ATOM 11797 C CB   . ILE A 1 42 ? -4.071  -2.168  2.865   1.00 0.00 ? 42 ILE A CB   11 
ATOM 11798 C CG1  . ILE A 1 42 ? -4.679  -1.979  1.451   1.00 0.00 ? 42 ILE A CG1  11 
ATOM 11799 C CG2  . ILE A 1 42 ? -2.533  -2.226  2.848   1.00 0.00 ? 42 ILE A CG2  11 
ATOM 11800 C CD1  . ILE A 1 42 ? -3.725  -1.727  0.286   1.00 0.00 ? 42 ILE A CD1  11 
ATOM 11801 H H    . ILE A 1 42 ? -6.587  -2.360  3.732   1.00 0.00 ? 42 ILE A H    11 
ATOM 11802 H HA   . ILE A 1 42 ? -4.393  -4.293  3.099   1.00 0.00 ? 42 ILE A HA   11 
ATOM 11803 H HB   . ILE A 1 42 ? -4.351  -1.272  3.421   1.00 0.00 ? 42 ILE A HB   11 
ATOM 11804 H HG12 . ILE A 1 42 ? -5.278  -2.845  1.167   1.00 0.00 ? 42 ILE A HG12 11 
ATOM 11805 H HG13 . ILE A 1 42 ? -5.334  -1.113  1.520   1.00 0.00 ? 42 ILE A HG13 11 
ATOM 11806 H HG21 . ILE A 1 42 ? -2.141  -1.323  2.387   1.00 0.00 ? 42 ILE A HG21 11 
ATOM 11807 H HG22 . ILE A 1 42 ? -2.129  -2.244  3.856   1.00 0.00 ? 42 ILE A HG22 11 
ATOM 11808 H HG23 . ILE A 1 42 ? -2.164  -3.099  2.305   1.00 0.00 ? 42 ILE A HG23 11 
ATOM 11809 H HD11 . ILE A 1 42 ? -4.304  -1.626  -0.630  1.00 0.00 ? 42 ILE A HD11 11 
ATOM 11810 H HD12 . ILE A 1 42 ? -3.170  -0.806  0.449   1.00 0.00 ? 42 ILE A HD12 11 
ATOM 11811 H HD13 . ILE A 1 42 ? -3.040  -2.567  0.182   1.00 0.00 ? 42 ILE A HD13 11 
ATOM 11812 N N    . PRO A 1 43 ? -3.251  -4.107  5.502   1.00 0.00 ? 43 PRO A N    11 
ATOM 11813 C CA   . PRO A 1 43 ? -2.784  -4.053  6.887   1.00 0.00 ? 43 PRO A CA   11 
ATOM 11814 C C    . PRO A 1 43 ? -2.356  -2.633  7.260   1.00 0.00 ? 43 PRO A C    11 
ATOM 11815 O O    . PRO A 1 43 ? -1.869  -1.905  6.395   1.00 0.00 ? 43 PRO A O    11 
ATOM 11816 C CB   . PRO A 1 43 ? -1.575  -4.992  6.944   1.00 0.00 ? 43 PRO A CB   11 
ATOM 11817 C CG   . PRO A 1 43 ? -1.721  -5.877  5.709   1.00 0.00 ? 43 PRO A CG   11 
ATOM 11818 C CD   . PRO A 1 43 ? -2.380  -4.949  4.703   1.00 0.00 ? 43 PRO A CD   11 
ATOM 11819 H HA   . PRO A 1 43 ? -3.583  -4.392  7.552   1.00 0.00 ? 43 PRO A HA   11 
ATOM 11820 H HB2  . PRO A 1 43 ? -0.648  -4.421  6.877   1.00 0.00 ? 43 PRO A HB2  11 
ATOM 11821 H HB3  . PRO A 1 43 ? -1.582  -5.585  7.849   1.00 0.00 ? 43 PRO A HB3  11 
ATOM 11822 H HG2  . PRO A 1 43 ? -0.766  -6.243  5.340   1.00 0.00 ? 43 PRO A HG2  11 
ATOM 11823 H HG3  . PRO A 1 43 ? -2.382  -6.704  5.946   1.00 0.00 ? 43 PRO A HG3  11 
ATOM 11824 H HD2  . PRO A 1 43 ? -1.609  -4.347  4.228   1.00 0.00 ? 43 PRO A HD2  11 
ATOM 11825 H HD3  . PRO A 1 43 ? -2.925  -5.510  3.946   1.00 0.00 ? 43 PRO A HD3  11 
ATOM 11826 N N    . HIS A 1 44 ? -2.443  -2.263  8.541   1.00 0.00 ? 44 HIS A N    11 
ATOM 11827 C CA   . HIS A 1 44 ? -1.994  -0.950  8.992   1.00 0.00 ? 44 HIS A CA   11 
ATOM 11828 C C    . HIS A 1 44 ? -0.485  -0.840  8.821   1.00 0.00 ? 44 HIS A C    11 
ATOM 11829 O O    . HIS A 1 44 ? -0.007  0.121   8.229   1.00 0.00 ? 44 HIS A O    11 
ATOM 11830 C CB   . HIS A 1 44 ? -2.358  -0.708  10.459  1.00 0.00 ? 44 HIS A CB   11 
ATOM 11831 C CG   . HIS A 1 44 ? -2.145  0.727   10.876  1.00 0.00 ? 44 HIS A CG   11 
ATOM 11832 N ND1  . HIS A 1 44 ? -3.074  1.731   10.763  1.00 0.00 ? 44 HIS A ND1  11 
ATOM 11833 C CD2  . HIS A 1 44 ? -1.023  1.267   11.449  1.00 0.00 ? 44 HIS A CD2  11 
ATOM 11834 C CE1  . HIS A 1 44 ? -2.521  2.861   11.231  1.00 0.00 ? 44 HIS A CE1  11 
ATOM 11835 N NE2  . HIS A 1 44 ? -1.285  2.620   11.704  1.00 0.00 ? 44 HIS A NE2  11 
ATOM 11836 H H    . HIS A 1 44 ? -2.731  -2.950  9.230   1.00 0.00 ? 44 HIS A H    11 
ATOM 11837 H HA   . HIS A 1 44 ? -2.473  -0.187  8.374   1.00 0.00 ? 44 HIS A HA   11 
ATOM 11838 H HB2  . HIS A 1 44 ? -3.400  -0.977  10.622  1.00 0.00 ? 44 HIS A HB2  11 
ATOM 11839 H HB3  . HIS A 1 44 ? -1.747  -1.340  11.095  1.00 0.00 ? 44 HIS A HB3  11 
ATOM 11840 H HD1  . HIS A 1 44 ? -4.020  1.633   10.393  1.00 0.00 ? 44 HIS A HD1  11 
ATOM 11841 H HD2  . HIS A 1 44 ? -0.103  0.742   11.664  1.00 0.00 ? 44 HIS A HD2  11 
ATOM 11842 H HE1  . HIS A 1 44 ? -3.018  3.826   11.241  1.00 0.00 ? 44 HIS A HE1  11 
ATOM 11843 N N    . SER A 1 45 ? 0.254   -1.831  9.325   1.00 0.00 ? 45 SER A N    11 
ATOM 11844 C CA   . SER A 1 45 ? 1.706   -1.860  9.301   1.00 0.00 ? 45 SER A CA   11 
ATOM 11845 C C    . SER A 1 45 ? 2.234   -1.765  7.872   1.00 0.00 ? 45 SER A C    11 
ATOM 11846 O O    . SER A 1 45 ? 3.208   -1.051  7.622   1.00 0.00 ? 45 SER A O    11 
ATOM 11847 C CB   . SER A 1 45 ? 2.185   -3.131  10.018  1.00 0.00 ? 45 SER A CB   11 
ATOM 11848 O OG   . SER A 1 45 ? 1.383   -4.261  9.696   1.00 0.00 ? 45 SER A OG   11 
ATOM 11849 H H    . SER A 1 45 ? -0.187  -2.624  9.766   1.00 0.00 ? 45 SER A H    11 
ATOM 1